data_2HTY
# 
_entry.id   2HTY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2HTY         pdb_00002hty 10.2210/pdb2hty/pdb 
RCSB  RCSB038757   ?            ?                   
WWPDB D_1000038757 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HT5 . unspecified 
PDB 2HT7 . unspecified 
PDB 2HT8 . unspecified 
PDB 2HTU . unspecified 
PDB 2HTQ . unspecified 
PDB 2HTV . unspecified 
PDB 2HTR . unspecified 
PDB 2HTW . unspecified 
PDB 2HU0 . unspecified 
PDB 2HU4 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HTY 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Russell, R.J.'   1 
'Haire, L.F.'     2 
'Stevens, D.J.'   3 
'Collins, P.J.'   4 
'Lin, Y.P.'       5 
'Blackburn, G.M.' 6 
'Hay, A.J.'       7 
'Gamblin, S.J.'   8 
'Skehel, J.J.'    9 
# 
_citation.id                        primary 
_citation.title                     
'The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            443 
_citation.page_first                45 
_citation.page_last                 49 
_citation.year                      2006 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16915235 
_citation.pdbx_database_id_DOI      10.1038/nature05114 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Russell, R.J.'   1 ? 
primary 'Haire, L.F.'     2 ? 
primary 'Stevens, D.J.'   3 ? 
primary 'Collins, P.J.'   4 ? 
primary 'Lin, Y.P.'       5 ? 
primary 'Blackburn, G.M.' 6 ? 
primary 'Hay, A.J.'       7 ? 
primary 'Gamblin, S.J.'   8 ? 
primary 'Skehel, J.J.'    9 ? 
# 
_cell.entry_id           2HTY 
_cell.length_a           200.210 
_cell.length_b           200.770 
_cell.length_c           211.680 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              64 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HTY 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Neuraminidase                             42429.180 8   ? H253Y ? ? 
2 non-polymer man 2-acetamido-2-deoxy-alpha-D-glucopyranose 221.208   7   ? ?     ? ? 
3 non-polymer syn 'CALCIUM ION'                             40.078    8   ? ?     ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose  221.208   1   ? ?     ? ? 
5 water       nat water                                     18.015    634 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Neuraminidase NA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCP
VGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVM
TDGPSNGQASYKIFKMEKGKVVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVF
GDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGY
SGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCP
VGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVM
TDGPSNGQASYKIFKMEKGKVVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVF
GDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGY
SGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   LYS n 
1 3   LEU n 
1 4   ALA n 
1 5   GLY n 
1 6   ASN n 
1 7   SER n 
1 8   SER n 
1 9   LEU n 
1 10  CYS n 
1 11  PRO n 
1 12  ILE n 
1 13  ASN n 
1 14  GLY n 
1 15  TRP n 
1 16  ALA n 
1 17  VAL n 
1 18  TYR n 
1 19  SER n 
1 20  LYS n 
1 21  ASP n 
1 22  ASN n 
1 23  SER n 
1 24  ILE n 
1 25  ARG n 
1 26  ILE n 
1 27  GLY n 
1 28  SER n 
1 29  LYS n 
1 30  GLY n 
1 31  ASP n 
1 32  VAL n 
1 33  PHE n 
1 34  VAL n 
1 35  ILE n 
1 36  ARG n 
1 37  GLU n 
1 38  PRO n 
1 39  PHE n 
1 40  ILE n 
1 41  SER n 
1 42  CYS n 
1 43  SER n 
1 44  HIS n 
1 45  LEU n 
1 46  GLU n 
1 47  CYS n 
1 48  ARG n 
1 49  THR n 
1 50  PHE n 
1 51  PHE n 
1 52  LEU n 
1 53  THR n 
1 54  GLN n 
1 55  GLY n 
1 56  ALA n 
1 57  LEU n 
1 58  LEU n 
1 59  ASN n 
1 60  ASP n 
1 61  LYS n 
1 62  HIS n 
1 63  SER n 
1 64  ASN n 
1 65  GLY n 
1 66  THR n 
1 67  VAL n 
1 68  LYS n 
1 69  ASP n 
1 70  ARG n 
1 71  SER n 
1 72  PRO n 
1 73  HIS n 
1 74  ARG n 
1 75  THR n 
1 76  LEU n 
1 77  MET n 
1 78  SER n 
1 79  CYS n 
1 80  PRO n 
1 81  VAL n 
1 82  GLY n 
1 83  GLU n 
1 84  ALA n 
1 85  PRO n 
1 86  SER n 
1 87  PRO n 
1 88  TYR n 
1 89  ASN n 
1 90  SER n 
1 91  ARG n 
1 92  PHE n 
1 93  GLU n 
1 94  SER n 
1 95  VAL n 
1 96  ALA n 
1 97  TRP n 
1 98  SER n 
1 99  ALA n 
1 100 SER n 
1 101 ALA n 
1 102 CYS n 
1 103 HIS n 
1 104 ASP n 
1 105 GLY n 
1 106 THR n 
1 107 SER n 
1 108 TRP n 
1 109 LEU n 
1 110 THR n 
1 111 ILE n 
1 112 GLY n 
1 113 ILE n 
1 114 SER n 
1 115 GLY n 
1 116 PRO n 
1 117 ASP n 
1 118 ASN n 
1 119 GLY n 
1 120 ALA n 
1 121 VAL n 
1 122 ALA n 
1 123 VAL n 
1 124 LEU n 
1 125 LYS n 
1 126 TYR n 
1 127 ASN n 
1 128 GLY n 
1 129 ILE n 
1 130 ILE n 
1 131 THR n 
1 132 ASP n 
1 133 THR n 
1 134 ILE n 
1 135 LYS n 
1 136 SER n 
1 137 TRP n 
1 138 ARG n 
1 139 ASN n 
1 140 ASN n 
1 141 ILE n 
1 142 LEU n 
1 143 ARG n 
1 144 THR n 
1 145 GLN n 
1 146 GLU n 
1 147 SER n 
1 148 GLU n 
1 149 CYS n 
1 150 ALA n 
1 151 CYS n 
1 152 VAL n 
1 153 ASN n 
1 154 GLY n 
1 155 SER n 
1 156 CYS n 
1 157 PHE n 
1 158 THR n 
1 159 VAL n 
1 160 MET n 
1 161 THR n 
1 162 ASP n 
1 163 GLY n 
1 164 PRO n 
1 165 SER n 
1 166 ASN n 
1 167 GLY n 
1 168 GLN n 
1 169 ALA n 
1 170 SER n 
1 171 TYR n 
1 172 LYS n 
1 173 ILE n 
1 174 PHE n 
1 175 LYS n 
1 176 MET n 
1 177 GLU n 
1 178 LYS n 
1 179 GLY n 
1 180 LYS n 
1 181 VAL n 
1 182 VAL n 
1 183 LYS n 
1 184 SER n 
1 185 VAL n 
1 186 GLU n 
1 187 LEU n 
1 188 ASP n 
1 189 ALA n 
1 190 PRO n 
1 191 ASN n 
1 192 TYR n 
1 193 HIS n 
1 194 TYR n 
1 195 GLU n 
1 196 GLU n 
1 197 CYS n 
1 198 SER n 
1 199 CYS n 
1 200 TYR n 
1 201 PRO n 
1 202 ASN n 
1 203 ALA n 
1 204 GLY n 
1 205 GLU n 
1 206 ILE n 
1 207 THR n 
1 208 CYS n 
1 209 VAL n 
1 210 CYS n 
1 211 ARG n 
1 212 ASP n 
1 213 ASN n 
1 214 TRP n 
1 215 HIS n 
1 216 GLY n 
1 217 SER n 
1 218 ASN n 
1 219 ARG n 
1 220 PRO n 
1 221 TRP n 
1 222 VAL n 
1 223 SER n 
1 224 PHE n 
1 225 ASN n 
1 226 GLN n 
1 227 ASN n 
1 228 LEU n 
1 229 GLU n 
1 230 TYR n 
1 231 GLN n 
1 232 ILE n 
1 233 GLY n 
1 234 TYR n 
1 235 ILE n 
1 236 CYS n 
1 237 SER n 
1 238 GLY n 
1 239 VAL n 
1 240 PHE n 
1 241 GLY n 
1 242 ASP n 
1 243 ASN n 
1 244 PRO n 
1 245 ARG n 
1 246 PRO n 
1 247 ASN n 
1 248 ASP n 
1 249 GLY n 
1 250 THR n 
1 251 GLY n 
1 252 SER n 
1 253 CYS n 
1 254 GLY n 
1 255 PRO n 
1 256 VAL n 
1 257 SER n 
1 258 SER n 
1 259 ASN n 
1 260 GLY n 
1 261 ALA n 
1 262 TYR n 
1 263 GLY n 
1 264 VAL n 
1 265 LYS n 
1 266 GLY n 
1 267 PHE n 
1 268 SER n 
1 269 PHE n 
1 270 LYS n 
1 271 TYR n 
1 272 GLY n 
1 273 ASN n 
1 274 GLY n 
1 275 VAL n 
1 276 TRP n 
1 277 ILE n 
1 278 GLY n 
1 279 ARG n 
1 280 THR n 
1 281 LYS n 
1 282 SER n 
1 283 THR n 
1 284 ASN n 
1 285 SER n 
1 286 ARG n 
1 287 SER n 
1 288 GLY n 
1 289 PHE n 
1 290 GLU n 
1 291 MET n 
1 292 ILE n 
1 293 TRP n 
1 294 ASP n 
1 295 PRO n 
1 296 ASN n 
1 297 GLY n 
1 298 TRP n 
1 299 THR n 
1 300 GLU n 
1 301 THR n 
1 302 ASP n 
1 303 SER n 
1 304 SER n 
1 305 PHE n 
1 306 SER n 
1 307 VAL n 
1 308 LYS n 
1 309 GLN n 
1 310 ASP n 
1 311 ILE n 
1 312 VAL n 
1 313 ALA n 
1 314 ILE n 
1 315 THR n 
1 316 ASP n 
1 317 TRP n 
1 318 SER n 
1 319 GLY n 
1 320 TYR n 
1 321 SER n 
1 322 GLY n 
1 323 SER n 
1 324 PHE n 
1 325 VAL n 
1 326 GLN n 
1 327 HIS n 
1 328 PRO n 
1 329 GLU n 
1 330 LEU n 
1 331 THR n 
1 332 GLY n 
1 333 LEU n 
1 334 ASP n 
1 335 CYS n 
1 336 ILE n 
1 337 ARG n 
1 338 PRO n 
1 339 CYS n 
1 340 PHE n 
1 341 TRP n 
1 342 VAL n 
1 343 GLU n 
1 344 LEU n 
1 345 ILE n 
1 346 ARG n 
1 347 GLY n 
1 348 ARG n 
1 349 PRO n 
1 350 LYS n 
1 351 GLU n 
1 352 SER n 
1 353 THR n 
1 354 ILE n 
1 355 TRP n 
1 356 THR n 
1 357 SER n 
1 358 GLY n 
1 359 SER n 
1 360 SER n 
1 361 ILE n 
1 362 SER n 
1 363 PHE n 
1 364 CYS n 
1 365 GLY n 
1 366 VAL n 
1 367 ASN n 
1 368 SER n 
1 369 ASP n 
1 370 THR n 
1 371 VAL n 
1 372 GLY n 
1 373 TRP n 
1 374 SER n 
1 375 TRP n 
1 376 PRO n 
1 377 ASP n 
1 378 GLY n 
1 379 ALA n 
1 380 GLU n 
1 381 LEU n 
1 382 PRO n 
1 383 PHE n 
1 384 THR n 
1 385 ILE n 
1 386 ASP n 
1 387 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Influenza A virus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      11320 
_entity_src_nat.genus                      'Influenzavirus A' 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q6DPL2_9INFA 
_struct_ref.pdbx_db_accession          Q6DPL2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCP
VGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVM
TDGPSNGQASHKIFKMEKGKVVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVF
GDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGY
SGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
;
_struct_ref.pdbx_align_begin           63 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HTY A 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
2 1 2HTY B 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
3 1 2HTY C 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
4 1 2HTY D 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
5 1 2HTY E 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
6 1 2HTY F 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
7 1 2HTY G 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
8 1 2HTY H 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HTY TYR A 88 A UNP Q6DPL2 HIS 233 'engineered mutation' 169 1 
2 2HTY TYR B 88 A UNP Q6DPL2 HIS 233 'engineered mutation' 169 2 
3 2HTY TYR C 88 A UNP Q6DPL2 HIS 233 'engineered mutation' 169 3 
4 2HTY TYR D 88 A UNP Q6DPL2 HIS 233 'engineered mutation' 169 4 
5 2HTY TYR E 88 A UNP Q6DPL2 HIS 233 'engineered mutation' 169 5 
6 2HTY TYR F 88 A UNP Q6DPL2 HIS 233 'engineered mutation' 169 6 
7 2HTY TYR G 88 A UNP Q6DPL2 HIS 233 'engineered mutation' 169 7 
8 2HTY TYR H 88 A UNP Q6DPL2 HIS 233 'engineered mutation' 169 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                   ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                  ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'     133.103 
CA  non-polymer                   . 'CALCIUM ION'                             ? 'Ca 2'           40.078  
CYS 'L-peptide linking'           y CYSTEINE                                  ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                 ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                   ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                 ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                     ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                   ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                    ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose  
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose 
;N-acetyl-alpha-D-glucosamine; 2-acetamido-2-deoxy-alpha-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; 2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                             ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                   ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                    ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                 ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                  ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                    ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2HTY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.13 
_exptl_crystal.density_percent_sol   60.73 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2006-03-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     2HTY 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             30 
_reflns.number_all                   146515 
_reflns.number_obs                   143352 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.119 
_reflns.pdbx_netI_over_sigmaI        7.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2HTY 
_refine.ls_d_res_high                            2.5 
_refine.ls_d_res_low                             30 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     146515 
_refine.ls_number_reflns_obs                     143352 
_refine.ls_number_reflns_R_free                  7155 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.232 
_refine.ls_R_factor_R_work                       0.232 
_refine.ls_R_factor_R_free                       0.262 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        23696 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         128 
_refine_hist.number_atoms_solvent             634 
_refine_hist.number_atoms_total               24458 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        30 
# 
_struct.entry_id                  2HTY 
_struct.title                     'N1 neuraminidase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HTY 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'N1, neuraminidase, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 2 ? 
N  N N 3 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 3 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 5 ? 
EA N N 5 ? 
FA N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 22  ? SER A 28  ? ASN A 104 SER A 110 1 ? 7 
HELX_P HELX_P2  2  ASP A 60  ? ASN A 64  ? ASP A 142 ASN A 146 5 ? 5 
HELX_P HELX_P3  3  HIS A 327 A GLY A 332 ? HIS A 412 GLY A 414 1 ? 6 
HELX_P HELX_P4  4  ASN B 22  ? SER B 28  ? ASN B 104 SER B 110 1 ? 7 
HELX_P HELX_P5  5  ASP B 60  ? ASN B 64  ? ASP B 142 ASN B 146 5 ? 5 
HELX_P HELX_P6  6  HIS B 327 A GLY B 332 ? HIS B 412 GLY B 414 1 ? 6 
HELX_P HELX_P7  7  ASN C 22  ? GLY C 27  ? ASN C 104 GLY C 109 1 ? 6 
HELX_P HELX_P8  8  ASP C 60  ? ASN C 64  ? ASP C 142 ASN C 146 5 ? 5 
HELX_P HELX_P9  9  PRO C 116 ? GLY C 119 ? PRO C 197 GLY C 200 5 ? 4 
HELX_P HELX_P10 10 GLN C 326 ? GLY C 332 ? GLN C 412 GLY C 414 1 ? 7 
HELX_P HELX_P11 11 ASN D 22  ? SER D 28  ? ASN D 104 SER D 110 1 ? 7 
HELX_P HELX_P12 12 ASP D 60  ? ASN D 64  ? ASP D 142 ASN D 146 5 ? 5 
HELX_P HELX_P13 13 HIS D 327 A GLY D 332 ? HIS D 412 GLY D 414 1 ? 6 
HELX_P HELX_P14 14 ASN E 22  ? SER E 28  ? ASN E 104 SER E 110 1 ? 7 
HELX_P HELX_P15 15 ASP E 60  ? ASN E 64  ? ASP E 142 ASN E 146 5 ? 5 
HELX_P HELX_P16 16 HIS E 327 A GLY E 332 ? HIS E 412 GLY E 414 1 ? 6 
HELX_P HELX_P17 17 ASN F 22  ? GLY F 27  ? ASN F 104 GLY F 109 1 ? 6 
HELX_P HELX_P18 18 ASP F 60  ? ASN F 64  ? ASP F 142 ASN F 146 5 ? 5 
HELX_P HELX_P19 19 HIS F 327 A GLY F 332 ? HIS F 412 GLY F 414 1 ? 6 
HELX_P HELX_P20 20 ASN G 22  ? GLY G 27  ? ASN G 104 GLY G 109 1 ? 6 
HELX_P HELX_P21 21 ASP G 60  ? GLY G 65  ? ASP G 142 GLY G 147 5 ? 6 
HELX_P HELX_P22 22 HIS G 327 A GLY G 332 ? HIS G 412 GLY G 414 1 ? 6 
HELX_P HELX_P23 23 ASN H 22  ? GLY H 27  ? ASN H 104 GLY H 109 1 ? 6 
HELX_P HELX_P24 24 ASP H 60  ? ASN H 64  ? ASP H 142 ASN H 146 5 ? 5 
HELX_P HELX_P25 25 HIS H 327 A GLY H 332 ? HIS H 412 GLY H 414 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 10  SG  ? ? ? 1_555 A  CYS 335 SG ? ? A CYS 92  A CYS 417  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf2  disulf ? ? A CYS 42  SG  ? ? ? 1_555 A  CYS 47  SG ? ? A CYS 124 A CYS 129  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf3  disulf ? ? A CYS 102 SG  ? ? ? 1_555 A  CYS 149 SG ? ? A CYS 183 A CYS 230  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf4  disulf ? ? A CYS 151 SG  ? ? ? 1_555 A  CYS 156 SG ? ? A CYS 232 A CYS 237  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf5  disulf ? ? A CYS 197 SG  ? ? ? 1_555 A  CYS 210 SG ? ? A CYS 278 A CYS 291  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf6  disulf ? ? A CYS 199 SG  ? ? ? 1_555 A  CYS 208 SG ? ? A CYS 280 A CYS 289  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf7  disulf ? ? A CYS 236 SG  ? ? ? 1_555 A  CYS 253 SG ? ? A CYS 318 A CYS 336  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf8  disulf ? ? A CYS 339 SG  ? ? ? 1_555 A  CYS 364 SG ? ? A CYS 421 A CYS 447  1_555 ? ? ? ? ? ? ? 2.055 ? ? 
disulf9  disulf ? ? B CYS 10  SG  ? ? ? 1_555 B  CYS 335 SG ? ? B CYS 92  B CYS 417  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf10 disulf ? ? B CYS 42  SG  ? ? ? 1_555 B  CYS 47  SG ? ? B CYS 124 B CYS 129  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf11 disulf ? ? B CYS 102 SG  ? ? ? 1_555 B  CYS 149 SG ? ? B CYS 183 B CYS 230  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf12 disulf ? ? B CYS 151 SG  ? ? ? 1_555 B  CYS 156 SG ? ? B CYS 232 B CYS 237  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf13 disulf ? ? B CYS 197 SG  ? ? ? 1_555 B  CYS 210 SG ? ? B CYS 278 B CYS 291  1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf14 disulf ? ? B CYS 199 SG  ? ? ? 1_555 B  CYS 208 SG ? ? B CYS 280 B CYS 289  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf15 disulf ? ? B CYS 236 SG  ? ? ? 1_555 B  CYS 253 SG ? ? B CYS 318 B CYS 336  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf16 disulf ? ? B CYS 339 SG  ? ? ? 1_555 B  CYS 364 SG ? ? B CYS 421 B CYS 447  1_555 ? ? ? ? ? ? ? 2.059 ? ? 
disulf17 disulf ? ? C CYS 10  SG  ? ? ? 1_555 C  CYS 335 SG ? ? C CYS 92  C CYS 417  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf18 disulf ? ? C CYS 42  SG  ? ? ? 1_555 C  CYS 47  SG ? ? C CYS 124 C CYS 129  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf19 disulf ? ? C CYS 102 SG  ? ? ? 1_555 C  CYS 149 SG ? ? C CYS 183 C CYS 230  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf20 disulf ? ? C CYS 151 SG  ? ? ? 1_555 C  CYS 156 SG ? ? C CYS 232 C CYS 237  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf21 disulf ? ? C CYS 197 SG  ? ? ? 1_555 C  CYS 210 SG ? ? C CYS 278 C CYS 291  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf22 disulf ? ? C CYS 199 SG  ? ? ? 1_555 C  CYS 208 SG ? ? C CYS 280 C CYS 289  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf23 disulf ? ? C CYS 236 SG  ? ? ? 1_555 C  CYS 253 SG ? ? C CYS 318 C CYS 336  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf24 disulf ? ? C CYS 339 SG  ? ? ? 1_555 C  CYS 364 SG ? ? C CYS 421 C CYS 447  1_555 ? ? ? ? ? ? ? 2.056 ? ? 
disulf25 disulf ? ? D CYS 10  SG  ? ? ? 1_555 D  CYS 335 SG ? ? D CYS 92  D CYS 417  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf26 disulf ? ? D CYS 42  SG  ? ? ? 1_555 D  CYS 47  SG ? ? D CYS 124 D CYS 129  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf27 disulf ? ? D CYS 102 SG  ? ? ? 1_555 D  CYS 149 SG ? ? D CYS 183 D CYS 230  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf28 disulf ? ? D CYS 151 SG  ? ? ? 1_555 D  CYS 156 SG ? ? D CYS 232 D CYS 237  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf29 disulf ? ? D CYS 197 SG  ? ? ? 1_555 D  CYS 210 SG ? ? D CYS 278 D CYS 291  1_555 ? ? ? ? ? ? ? 2.059 ? ? 
disulf30 disulf ? ? D CYS 199 SG  ? ? ? 1_555 D  CYS 208 SG ? ? D CYS 280 D CYS 289  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf31 disulf ? ? D CYS 236 SG  ? ? ? 1_555 D  CYS 253 SG ? ? D CYS 318 D CYS 336  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf32 disulf ? ? D CYS 339 SG  ? ? ? 1_555 D  CYS 364 SG ? ? D CYS 421 D CYS 447  1_555 ? ? ? ? ? ? ? 2.067 ? ? 
disulf33 disulf ? ? E CYS 10  SG  ? ? ? 1_555 E  CYS 335 SG ? ? E CYS 92  E CYS 417  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf34 disulf ? ? E CYS 42  SG  ? ? ? 1_555 E  CYS 47  SG ? ? E CYS 124 E CYS 129  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf35 disulf ? ? E CYS 102 SG  ? ? ? 1_555 E  CYS 149 SG ? ? E CYS 183 E CYS 230  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf36 disulf ? ? E CYS 151 SG  ? ? ? 1_555 E  CYS 156 SG ? ? E CYS 232 E CYS 237  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf37 disulf ? ? E CYS 197 SG  ? ? ? 1_555 E  CYS 210 SG ? ? E CYS 278 E CYS 291  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf38 disulf ? ? E CYS 199 SG  ? ? ? 1_555 E  CYS 208 SG ? ? E CYS 280 E CYS 289  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf39 disulf ? ? E CYS 236 SG  ? ? ? 1_555 E  CYS 253 SG ? ? E CYS 318 E CYS 336  1_555 ? ? ? ? ? ? ? 2.052 ? ? 
disulf40 disulf ? ? E CYS 339 SG  ? ? ? 1_555 E  CYS 364 SG ? ? E CYS 421 E CYS 447  1_555 ? ? ? ? ? ? ? 2.060 ? ? 
disulf41 disulf ? ? F CYS 10  SG  ? ? ? 1_555 F  CYS 335 SG ? ? F CYS 92  F CYS 417  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf42 disulf ? ? F CYS 42  SG  ? ? ? 1_555 F  CYS 47  SG ? ? F CYS 124 F CYS 129  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf43 disulf ? ? F CYS 102 SG  ? ? ? 1_555 F  CYS 149 SG ? ? F CYS 183 F CYS 230  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf44 disulf ? ? F CYS 151 SG  ? ? ? 1_555 F  CYS 156 SG ? ? F CYS 232 F CYS 237  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf45 disulf ? ? F CYS 197 SG  ? ? ? 1_555 F  CYS 210 SG ? ? F CYS 278 F CYS 291  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf46 disulf ? ? F CYS 199 SG  ? ? ? 1_555 F  CYS 208 SG ? ? F CYS 280 F CYS 289  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf47 disulf ? ? F CYS 236 SG  ? ? ? 1_555 F  CYS 253 SG ? ? F CYS 318 F CYS 336  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf48 disulf ? ? F CYS 339 SG  ? ? ? 1_555 F  CYS 364 SG ? ? F CYS 421 F CYS 447  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf49 disulf ? ? G CYS 10  SG  ? ? ? 1_555 G  CYS 335 SG ? ? G CYS 92  G CYS 417  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf50 disulf ? ? G CYS 42  SG  ? ? ? 1_555 G  CYS 47  SG ? ? G CYS 124 G CYS 129  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf51 disulf ? ? G CYS 102 SG  ? ? ? 1_555 G  CYS 149 SG ? ? G CYS 183 G CYS 230  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf52 disulf ? ? G CYS 151 SG  ? ? ? 1_555 G  CYS 156 SG ? ? G CYS 232 G CYS 237  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf53 disulf ? ? G CYS 197 SG  ? ? ? 1_555 G  CYS 210 SG ? ? G CYS 278 G CYS 291  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf54 disulf ? ? G CYS 199 SG  ? ? ? 1_555 G  CYS 208 SG ? ? G CYS 280 G CYS 289  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf55 disulf ? ? G CYS 236 SG  ? ? ? 1_555 G  CYS 253 SG ? ? G CYS 318 G CYS 336  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf56 disulf ? ? G CYS 339 SG  ? ? ? 1_555 G  CYS 364 SG ? ? G CYS 421 G CYS 447  1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf57 disulf ? ? H CYS 10  SG  ? ? ? 1_555 H  CYS 335 SG ? ? H CYS 92  H CYS 417  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf58 disulf ? ? H CYS 42  SG  ? ? ? 1_555 H  CYS 47  SG ? ? H CYS 124 H CYS 129  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf59 disulf ? ? H CYS 102 SG  ? ? ? 1_555 H  CYS 149 SG ? ? H CYS 183 H CYS 230  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf60 disulf ? ? H CYS 151 SG  ? ? ? 1_555 H  CYS 156 SG ? ? H CYS 232 H CYS 237  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf61 disulf ? ? H CYS 197 SG  ? ? ? 1_555 H  CYS 210 SG ? ? H CYS 278 H CYS 291  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf62 disulf ? ? H CYS 199 SG  ? ? ? 1_555 H  CYS 208 SG ? ? H CYS 280 H CYS 289  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf63 disulf ? ? H CYS 236 SG  ? ? ? 1_555 H  CYS 253 SG ? ? H CYS 318 H CYS 336  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf64 disulf ? ? H CYS 339 SG  ? ? ? 1_555 H  CYS 364 SG ? ? H CYS 421 H CYS 447  1_555 ? ? ? ? ? ? ? 2.055 ? ? 
metalc1  metalc ? ? A ASP 212 O   ? ? ? 1_555 J  CA  .   CA ? ? A ASP 293 A CA  991  1_555 ? ? ? ? ? ? ? 2.534 ? ? 
metalc2  metalc ? ? A GLY 216 O   ? ? ? 1_555 J  CA  .   CA ? ? A GLY 297 A CA  991  1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc3  metalc ? ? A ASP 242 OD1 ? ? ? 1_555 J  CA  .   CA ? ? A ASP 324 A CA  991  1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc4  metalc ? ? A GLY 260 O   ? ? ? 1_555 J  CA  .   CA ? ? A GLY 345 A CA  991  1_555 ? ? ? ? ? ? ? 3.215 ? ? 
metalc5  metalc ? ? A TYR 262 N   ? ? ? 1_555 J  CA  .   CA ? ? A TYR 347 A CA  991  1_555 ? ? ? ? ? ? ? 3.303 ? ? 
metalc6  metalc ? ? A TYR 262 O   ? ? ? 1_555 J  CA  .   CA ? ? A TYR 347 A CA  991  1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc7  metalc ? ? B ASP 212 O   ? ? ? 1_555 L  CA  .   CA ? ? B ASP 293 B CA  992  1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc8  metalc ? ? B GLY 216 O   ? ? ? 1_555 L  CA  .   CA ? ? B GLY 297 B CA  992  1_555 ? ? ? ? ? ? ? 2.401 ? ? 
metalc9  metalc ? ? B ASP 242 OD1 ? ? ? 1_555 L  CA  .   CA ? ? B ASP 324 B CA  992  1_555 ? ? ? ? ? ? ? 2.399 ? ? 
metalc10 metalc ? ? B GLY 260 O   ? ? ? 1_555 L  CA  .   CA ? ? B GLY 345 B CA  992  1_555 ? ? ? ? ? ? ? 3.193 ? ? 
metalc11 metalc ? ? B TYR 262 O   ? ? ? 1_555 L  CA  .   CA ? ? B TYR 347 B CA  992  1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc12 metalc ? ? C ASP 212 O   ? ? ? 1_555 N  CA  .   CA ? ? C ASP 293 C CA  993  1_555 ? ? ? ? ? ? ? 2.441 ? ? 
metalc13 metalc ? ? C GLY 216 O   ? ? ? 1_555 N  CA  .   CA ? ? C GLY 297 C CA  993  1_555 ? ? ? ? ? ? ? 2.424 ? ? 
metalc14 metalc ? ? C ASP 242 OD1 ? ? ? 1_555 N  CA  .   CA ? ? C ASP 324 C CA  993  1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc15 metalc ? ? C GLY 260 O   ? ? ? 1_555 N  CA  .   CA ? ? C GLY 345 C CA  993  1_555 ? ? ? ? ? ? ? 2.808 ? ? 
metalc16 metalc ? ? C TYR 262 O   ? ? ? 1_555 N  CA  .   CA ? ? C TYR 347 C CA  993  1_555 ? ? ? ? ? ? ? 2.102 ? ? 
metalc17 metalc ? ? D ASP 212 O   ? ? ? 1_555 P  CA  .   CA ? ? D ASP 293 D CA  994  1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc18 metalc ? ? D GLY 216 O   ? ? ? 1_555 P  CA  .   CA ? ? D GLY 297 D CA  994  1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc19 metalc ? ? D ASP 242 OD1 ? ? ? 1_555 P  CA  .   CA ? ? D ASP 324 D CA  994  1_555 ? ? ? ? ? ? ? 2.277 ? ? 
metalc20 metalc ? ? D GLY 260 O   ? ? ? 1_555 P  CA  .   CA ? ? D GLY 345 D CA  994  1_555 ? ? ? ? ? ? ? 2.663 ? ? 
metalc21 metalc ? ? D TYR 262 O   ? ? ? 1_555 P  CA  .   CA ? ? D TYR 347 D CA  994  1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc22 metalc ? ? E ASP 212 O   ? ? ? 1_555 R  CA  .   CA ? ? E ASP 293 E CA  995  1_555 ? ? ? ? ? ? ? 2.460 ? ? 
metalc23 metalc ? ? E GLY 216 O   ? ? ? 1_555 R  CA  .   CA ? ? E GLY 297 E CA  995  1_555 ? ? ? ? ? ? ? 2.371 ? ? 
metalc24 metalc ? ? E ASP 242 OD1 ? ? ? 1_555 R  CA  .   CA ? ? E ASP 324 E CA  995  1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc25 metalc ? ? E GLY 260 O   ? ? ? 1_555 R  CA  .   CA ? ? E GLY 345 E CA  995  1_555 ? ? ? ? ? ? ? 2.778 ? ? 
metalc26 metalc ? ? E TYR 262 O   ? ? ? 1_555 R  CA  .   CA ? ? E TYR 347 E CA  995  1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc27 metalc ? ? F ASP 212 O   ? ? ? 1_555 T  CA  .   CA ? ? F ASP 293 F CA  996  1_555 ? ? ? ? ? ? ? 2.532 ? ? 
metalc28 metalc ? ? F GLY 216 O   ? ? ? 1_555 T  CA  .   CA ? ? F GLY 297 F CA  996  1_555 ? ? ? ? ? ? ? 2.497 ? ? 
metalc29 metalc ? ? F ASP 242 OD1 ? ? ? 1_555 T  CA  .   CA ? ? F ASP 324 F CA  996  1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc30 metalc ? ? F GLY 260 O   ? ? ? 1_555 T  CA  .   CA ? ? F GLY 345 F CA  996  1_555 ? ? ? ? ? ? ? 2.946 ? ? 
metalc31 metalc ? ? F TYR 262 O   ? ? ? 1_555 T  CA  .   CA ? ? F TYR 347 F CA  996  1_555 ? ? ? ? ? ? ? 2.153 ? ? 
metalc32 metalc ? ? G ASP 212 O   ? ? ? 1_555 V  CA  .   CA ? ? G ASP 293 G CA  997  1_555 ? ? ? ? ? ? ? 2.591 ? ? 
metalc33 metalc ? ? G GLY 216 O   ? ? ? 1_555 V  CA  .   CA ? ? G GLY 297 G CA  997  1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc34 metalc ? ? G ASP 242 OD1 ? ? ? 1_555 V  CA  .   CA ? ? G ASP 324 G CA  997  1_555 ? ? ? ? ? ? ? 2.190 ? ? 
metalc35 metalc ? ? G TYR 262 O   ? ? ? 1_555 V  CA  .   CA ? ? G TYR 347 G CA  997  1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc36 metalc ? ? V CA  .   CA  ? ? ? 1_555 EA HOH .   O  ? ? G CA  997 G HOH 1147 1_555 ? ? ? ? ? ? ? 2.238 ? ? 
metalc37 metalc ? ? H ASP 212 O   ? ? ? 1_555 X  CA  .   CA ? ? H ASP 293 H CA  998  1_555 ? ? ? ? ? ? ? 2.636 ? ? 
metalc38 metalc ? ? H GLY 216 O   ? ? ? 1_555 X  CA  .   CA ? ? H GLY 297 H CA  998  1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc39 metalc ? ? H ASP 242 OD1 ? ? ? 1_555 X  CA  .   CA ? ? H ASP 324 H CA  998  1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc40 metalc ? ? H GLY 260 O   ? ? ? 1_555 X  CA  .   CA ? ? H GLY 345 H CA  998  1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc41 metalc ? ? H TYR 262 O   ? ? ? 1_555 X  CA  .   CA ? ? H TYR 347 H CA  998  1_555 ? ? ? ? ? ? ? 2.156 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASN 243 A . ? ASN 325 A PRO 244 A ? PRO 326 A 1 5.86  
2  ARG 348 A . ? ARG 430 A PRO 349 A ? PRO 431 A 1 1.54  
3  LEU 381 A . ? LEU 464 A PRO 382 A ? PRO 465 A 1 -2.86 
4  ASN 243 B . ? ASN 325 B PRO 244 B ? PRO 326 B 1 3.90  
5  ARG 348 B . ? ARG 430 B PRO 349 B ? PRO 431 B 1 -0.11 
6  LEU 381 B . ? LEU 464 B PRO 382 B ? PRO 465 B 1 -2.82 
7  ASN 243 C . ? ASN 325 C PRO 244 C ? PRO 326 C 1 -0.62 
8  ARG 348 C . ? ARG 430 C PRO 349 C ? PRO 431 C 1 0.61  
9  LEU 381 C . ? LEU 464 C PRO 382 C ? PRO 465 C 1 -0.18 
10 ASN 243 D . ? ASN 325 D PRO 244 D ? PRO 326 D 1 1.54  
11 ARG 348 D . ? ARG 430 D PRO 349 D ? PRO 431 D 1 -1.02 
12 LEU 381 D . ? LEU 464 D PRO 382 D ? PRO 465 D 1 1.58  
13 ASN 243 E . ? ASN 325 E PRO 244 E ? PRO 326 E 1 -3.17 
14 ARG 348 E . ? ARG 430 E PRO 349 E ? PRO 431 E 1 0.46  
15 LEU 381 E . ? LEU 464 E PRO 382 E ? PRO 465 E 1 -0.37 
16 ASN 243 F . ? ASN 325 F PRO 244 F ? PRO 326 F 1 3.60  
17 ARG 348 F . ? ARG 430 F PRO 349 F ? PRO 431 F 1 -0.20 
18 LEU 381 F . ? LEU 464 F PRO 382 F ? PRO 465 F 1 2.11  
19 ASN 243 G . ? ASN 325 G PRO 244 G ? PRO 326 G 1 -0.63 
20 ARG 348 G . ? ARG 430 G PRO 349 G ? PRO 431 G 1 0.85  
21 LEU 381 G . ? LEU 464 G PRO 382 G ? PRO 465 G 1 0.96  
22 ASN 243 H . ? ASN 325 H PRO 244 H ? PRO 326 H 1 2.06  
23 ARG 348 H . ? ARG 430 H PRO 349 H ? PRO 431 H 1 -1.09 
24 LEU 381 H . ? LEU 464 H PRO 382 H ? PRO 465 H 1 -2.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 4 ? 
D  ? 3 ? 
E  ? 4 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 4 ? 
I  ? 3 ? 
J  ? 4 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 4 ? 
N  ? 4 ? 
O  ? 4 ? 
P  ? 3 ? 
Q  ? 4 ? 
R  ? 4 ? 
S  ? 4 ? 
T  ? 4 ? 
U  ? 4 ? 
V  ? 4 ? 
W  ? 3 ? 
X  ? 4 ? 
Y  ? 4 ? 
Z  ? 4 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 4 ? 
AF ? 5 ? 
AG ? 3 ? 
AH ? 4 ? 
AI ? 4 ? 
AJ ? 4 ? 
AK ? 4 ? 
AL ? 3 ? 
AM ? 4 ? 
AN ? 4 ? 
AO ? 3 ? 
AP ? 4 ? 
AQ ? 4 ? 
AR ? 4 ? 
AS ? 4 ? 
AT ? 3 ? 
AU ? 4 ? 
AV ? 4 ? 
AW ? 4 ? 
AX ? 4 ? 
AY ? 4 ? 
AZ ? 4 ? 
BA ? 3 ? 
BB ? 4 ? 
BC ? 4 ? 
BD ? 3 ? 
BE ? 4 ? 
BF ? 4 ? 
BG ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? parallel      
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AY 3 4 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BF 3 4 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ALA A 16  ? LYS A 20  ? ALA A 98  LYS A 102 
A  2 THR A 356 ? CYS A 364 ? THR A 439 CYS A 447 
A  3 ARG A 337 ? GLY A 347 ? ARG A 419 GLY A 429 
A  4 SER A 321 ? GLN A 326 ? SER A 407 GLN A 412 
B  1 PHE A 33  ? CYS A 42  ? PHE A 115 CYS A 124 
B  2 CYS A 47  ? LEU A 57  ? CYS A 129 LEU A 139 
B  3 THR A 75  ? PRO A 80  ? THR A 157 PRO A 162 
B  4 ARG A 91  ? VAL A 95  ? ARG A 172 VAL A 176 
C  1 SER A 98  ? HIS A 103 ? SER A 179 HIS A 184 
C  2 TRP A 108 ? SER A 114 ? TRP A 189 SER A 195 
C  3 VAL A 121 ? TYR A 126 ? VAL A 202 TYR A 207 
C  4 ILE A 129 ? LYS A 135 ? ILE A 210 LYS A 216 
D  1 ARG A 143 ? THR A 144 ? ARG A 224 THR A 225 
D  2 SER A 155 ? ASP A 162 ? SER A 236 ASP A 243 
D  3 ALA A 150 ? VAL A 152 ? ALA A 231 VAL A 233 
E  1 ARG A 143 ? THR A 144 ? ARG A 224 THR A 225 
E  2 SER A 155 ? ASP A 162 ? SER A 236 ASP A 243 
E  3 SER A 170 ? GLU A 177 ? SER A 251 GLU A 258 
E  4 LYS A 180 ? GLU A 186 ? LYS A 261 GLU A 267 
F  1 SER A 198 ? ASN A 202 ? SER A 279 ASN A 283 
F  2 GLU A 205 ? VAL A 209 ? GLU A 286 VAL A 290 
F  3 PRO A 220 ? PHE A 224 ? PRO A 301 PHE A 305 
F  4 TYR A 230 ? TYR A 234 ? TYR A 312 TYR A 316 
G  1 SER A 268 ? TYR A 271 ? SER A 353 TYR A 356 
G  2 GLY A 274 ? ARG A 279 ? GLY A 359 ARG A 364 
G  3 SER A 287 ? ASP A 294 ? SER A 372 ASP A 379 
G  4 VAL A 307 ? TRP A 317 ? VAL A 392 TRP A 403 
H  1 ALA B 16  ? LYS B 20  ? ALA B 98  LYS B 102 
H  2 THR B 356 ? CYS B 364 ? THR B 439 CYS B 447 
H  3 ARG B 337 ? GLY B 347 ? ARG B 419 GLY B 429 
H  4 SER B 321 ? GLN B 326 ? SER B 407 GLN B 412 
I  1 PHE B 33  ? ARG B 36  ? PHE B 115 ARG B 118 
I  2 CYS B 47  ? LEU B 57  ? CYS B 129 LEU B 139 
I  3 ILE B 40  ? CYS B 42  ? ILE B 122 CYS B 124 
J  1 PHE B 33  ? ARG B 36  ? PHE B 115 ARG B 118 
J  2 CYS B 47  ? LEU B 57  ? CYS B 129 LEU B 139 
J  3 THR B 75  ? PRO B 80  ? THR B 157 PRO B 162 
J  4 ARG B 91  ? VAL B 95  ? ARG B 172 VAL B 176 
K  1 SER B 98  ? HIS B 103 ? SER B 179 HIS B 184 
K  2 TRP B 108 ? SER B 114 ? TRP B 189 SER B 195 
K  3 VAL B 121 ? TYR B 126 ? VAL B 202 TYR B 207 
K  4 ILE B 129 ? LYS B 135 ? ILE B 210 LYS B 216 
L  1 ALA B 150 ? VAL B 152 ? ALA B 231 VAL B 233 
L  2 SER B 155 ? ASP B 162 ? SER B 236 ASP B 243 
L  3 SER B 170 ? GLU B 177 ? SER B 251 GLU B 258 
L  4 LYS B 180 ? GLU B 186 ? LYS B 261 GLU B 267 
M  1 SER B 198 ? ASN B 202 ? SER B 279 ASN B 283 
M  2 GLU B 205 ? VAL B 209 ? GLU B 286 VAL B 290 
M  3 PRO B 220 ? PHE B 224 ? PRO B 301 PHE B 305 
M  4 TYR B 230 ? TYR B 234 ? TYR B 312 TYR B 316 
N  1 SER B 268 ? TYR B 271 ? SER B 353 TYR B 356 
N  2 GLY B 274 ? ARG B 279 ? GLY B 359 ARG B 364 
N  3 SER B 287 ? ASP B 294 ? SER B 372 ASP B 379 
N  4 VAL B 307 ? TRP B 317 ? VAL B 392 TRP B 403 
O  1 ALA C 16  ? LYS C 20  ? ALA C 98  LYS C 102 
O  2 THR C 356 ? CYS C 364 ? THR C 439 CYS C 447 
O  3 PRO C 338 ? GLY C 347 ? PRO C 420 GLY C 429 
O  4 SER C 321 ? VAL C 325 ? SER C 407 VAL C 411 
P  1 PHE C 33  ? ARG C 36  ? PHE C 115 ARG C 118 
P  2 CYS C 47  ? LEU C 57  ? CYS C 129 LEU C 139 
P  3 ILE C 40  ? CYS C 42  ? ILE C 122 CYS C 124 
Q  1 PHE C 33  ? ARG C 36  ? PHE C 115 ARG C 118 
Q  2 CYS C 47  ? LEU C 57  ? CYS C 129 LEU C 139 
Q  3 THR C 75  ? PRO C 80  ? THR C 157 PRO C 162 
Q  4 ARG C 91  ? VAL C 95  ? ARG C 172 VAL C 176 
R  1 SER C 98  ? HIS C 103 ? SER C 179 HIS C 184 
R  2 TRP C 108 ? SER C 114 ? TRP C 189 SER C 195 
R  3 VAL C 121 ? TYR C 126 ? VAL C 202 TYR C 207 
R  4 ILE C 129 ? LYS C 135 ? ILE C 210 LYS C 216 
S  1 ALA C 150 ? VAL C 152 ? ALA C 231 VAL C 233 
S  2 SER C 155 ? ASP C 162 ? SER C 236 ASP C 243 
S  3 SER C 170 ? GLU C 177 ? SER C 251 GLU C 258 
S  4 LYS C 180 ? GLU C 186 ? LYS C 261 GLU C 267 
T  1 GLU C 195 ? ASN C 202 ? GLU C 276 ASN C 283 
T  2 GLU C 205 ? ARG C 211 ? GLU C 286 ARG C 292 
T  3 PRO C 220 ? PHE C 224 ? PRO C 301 PHE C 305 
T  4 TYR C 230 ? TYR C 234 ? TYR C 312 TYR C 316 
U  1 SER C 268 ? TYR C 271 ? SER C 353 TYR C 356 
U  2 GLY C 274 ? ARG C 279 ? GLY C 359 ARG C 364 
U  3 SER C 287 ? ASP C 294 ? SER C 372 ASP C 379 
U  4 VAL C 307 ? TRP C 317 ? VAL C 392 TRP C 403 
V  1 ALA D 16  ? LYS D 20  ? ALA D 98  LYS D 102 
V  2 THR D 356 ? CYS D 364 ? THR D 439 CYS D 447 
V  3 ARG D 337 ? GLY D 347 ? ARG D 419 GLY D 429 
V  4 SER D 321 ? GLN D 326 ? SER D 407 GLN D 412 
W  1 PHE D 33  ? ARG D 36  ? PHE D 115 ARG D 118 
W  2 CYS D 47  ? LEU D 57  ? CYS D 129 LEU D 139 
W  3 ILE D 40  ? CYS D 42  ? ILE D 122 CYS D 124 
X  1 PHE D 33  ? ARG D 36  ? PHE D 115 ARG D 118 
X  2 CYS D 47  ? LEU D 57  ? CYS D 129 LEU D 139 
X  3 THR D 75  ? PRO D 80  ? THR D 157 PRO D 162 
X  4 ARG D 91  ? VAL D 95  ? ARG D 172 VAL D 176 
Y  1 SER D 98  ? HIS D 103 ? SER D 179 HIS D 184 
Y  2 TRP D 108 ? SER D 114 ? TRP D 189 SER D 195 
Y  3 VAL D 121 ? TYR D 126 ? VAL D 202 TYR D 207 
Y  4 ILE D 129 ? LYS D 135 ? ILE D 210 LYS D 216 
Z  1 ALA D 150 ? VAL D 152 ? ALA D 231 VAL D 233 
Z  2 SER D 155 ? ASP D 162 ? SER D 236 ASP D 243 
Z  3 SER D 170 ? GLU D 177 ? SER D 251 GLU D 258 
Z  4 LYS D 180 ? GLU D 186 ? LYS D 261 GLU D 267 
AA 1 SER D 198 ? ASN D 202 ? SER D 279 ASN D 283 
AA 2 GLU D 205 ? VAL D 209 ? GLU D 286 VAL D 290 
AA 3 PRO D 220 ? PHE D 224 ? PRO D 301 PHE D 305 
AA 4 TYR D 230 ? TYR D 234 ? TYR D 312 TYR D 316 
AB 1 SER D 268 ? TYR D 271 ? SER D 353 TYR D 356 
AB 2 GLY D 274 ? ARG D 279 ? GLY D 359 ARG D 364 
AB 3 SER D 287 ? ASP D 294 ? SER D 372 ASP D 379 
AB 4 VAL D 307 ? TRP D 317 ? VAL D 392 TRP D 403 
AC 1 ALA E 16  ? LYS E 20  ? ALA E 98  LYS E 102 
AC 2 THR E 356 ? CYS E 364 ? THR E 439 CYS E 447 
AC 3 PRO E 338 ? GLY E 347 ? PRO E 420 GLY E 429 
AC 4 SER E 321 ? VAL E 325 ? SER E 407 VAL E 411 
AD 1 PHE E 33  ? ARG E 36  ? PHE E 115 ARG E 118 
AD 2 CYS E 47  ? LEU E 57  ? CYS E 129 LEU E 139 
AD 3 ILE E 40  ? CYS E 42  ? ILE E 122 CYS E 124 
AE 1 PHE E 33  ? ARG E 36  ? PHE E 115 ARG E 118 
AE 2 CYS E 47  ? LEU E 57  ? CYS E 129 LEU E 139 
AE 3 THR E 75  ? PRO E 80  ? THR E 157 PRO E 162 
AE 4 ARG E 91  ? VAL E 95  ? ARG E 172 VAL E 176 
AF 1 ILE E 129 ? LYS E 135 ? ILE E 210 LYS E 216 
AF 2 VAL E 121 ? TYR E 126 ? VAL E 202 TYR E 207 
AF 3 TRP E 108 ? SER E 114 ? TRP E 189 SER E 195 
AF 4 SER E 98  ? HIS E 103 ? SER E 179 HIS E 184 
AF 5 SER E 147 ? GLU E 148 ? SER E 228 GLU E 229 
AG 1 ARG E 143 ? THR E 144 ? ARG E 224 THR E 225 
AG 2 SER E 155 ? ASP E 162 ? SER E 236 ASP E 243 
AG 3 ALA E 150 ? VAL E 152 ? ALA E 231 VAL E 233 
AH 1 ARG E 143 ? THR E 144 ? ARG E 224 THR E 225 
AH 2 SER E 155 ? ASP E 162 ? SER E 236 ASP E 243 
AH 3 SER E 170 ? GLU E 177 ? SER E 251 GLU E 258 
AH 4 LYS E 180 ? GLU E 186 ? LYS E 261 GLU E 267 
AI 1 GLU E 195 ? ASN E 202 ? GLU E 276 ASN E 283 
AI 2 GLU E 205 ? ARG E 211 ? GLU E 286 ARG E 292 
AI 3 PRO E 220 ? PHE E 224 ? PRO E 301 PHE E 305 
AI 4 TYR E 230 ? TYR E 234 ? TYR E 312 TYR E 316 
AJ 1 PHE E 267 ? TYR E 271 ? PHE E 352 TYR E 356 
AJ 2 GLY E 274 ? ARG E 279 ? GLY E 359 ARG E 364 
AJ 3 SER E 287 ? ASP E 294 ? SER E 372 ASP E 379 
AJ 4 VAL E 307 ? TRP E 317 ? VAL E 392 TRP E 403 
AK 1 ALA F 16  ? LYS F 20  ? ALA F 98  LYS F 102 
AK 2 THR F 356 ? CYS F 364 ? THR F 439 CYS F 447 
AK 3 ARG F 337 ? GLY F 347 ? ARG F 419 GLY F 429 
AK 4 SER F 321 ? GLN F 326 ? SER F 407 GLN F 412 
AL 1 PHE F 33  ? ARG F 36  ? PHE F 115 ARG F 118 
AL 2 CYS F 47  ? LEU F 57  ? CYS F 129 LEU F 139 
AL 3 ILE F 40  ? CYS F 42  ? ILE F 122 CYS F 124 
AM 1 PHE F 33  ? ARG F 36  ? PHE F 115 ARG F 118 
AM 2 CYS F 47  ? LEU F 57  ? CYS F 129 LEU F 139 
AM 3 THR F 75  ? PRO F 80  ? THR F 157 PRO F 162 
AM 4 ARG F 91  ? VAL F 95  ? ARG F 172 VAL F 176 
AN 1 ALA F 99  ? HIS F 103 ? ALA F 180 HIS F 184 
AN 2 TRP F 108 ? SER F 114 ? TRP F 189 SER F 195 
AN 3 VAL F 121 ? TYR F 126 ? VAL F 202 TYR F 207 
AN 4 ILE F 129 ? LYS F 135 ? ILE F 210 LYS F 216 
AO 1 ARG F 143 ? THR F 144 ? ARG F 224 THR F 225 
AO 2 SER F 155 ? ASP F 162 ? SER F 236 ASP F 243 
AO 3 ALA F 150 ? VAL F 152 ? ALA F 231 VAL F 233 
AP 1 ARG F 143 ? THR F 144 ? ARG F 224 THR F 225 
AP 2 SER F 155 ? ASP F 162 ? SER F 236 ASP F 243 
AP 3 SER F 170 ? GLU F 177 ? SER F 251 GLU F 258 
AP 4 LYS F 180 ? GLU F 186 ? LYS F 261 GLU F 267 
AQ 1 SER F 198 ? ASN F 202 ? SER F 279 ASN F 283 
AQ 2 GLU F 205 ? VAL F 209 ? GLU F 286 VAL F 290 
AQ 3 PRO F 220 ? PHE F 224 ? PRO F 301 PHE F 305 
AQ 4 TYR F 230 ? TYR F 234 ? TYR F 312 TYR F 316 
AR 1 PHE F 267 ? TYR F 271 ? PHE F 352 TYR F 356 
AR 2 GLY F 274 ? ARG F 279 ? GLY F 359 ARG F 364 
AR 3 SER F 287 ? ASP F 294 ? SER F 372 ASP F 379 
AR 4 VAL F 307 ? TRP F 317 ? VAL F 392 TRP F 403 
AS 1 ALA G 16  ? LYS G 20  ? ALA G 98  LYS G 102 
AS 2 THR G 356 ? CYS G 364 ? THR G 439 CYS G 447 
AS 3 ARG G 337 ? GLY G 347 ? ARG G 419 GLY G 429 
AS 4 SER G 321 ? GLN G 326 ? SER G 407 GLN G 412 
AT 1 PHE G 33  ? ARG G 36  ? PHE G 115 ARG G 118 
AT 2 CYS G 47  ? LEU G 57  ? CYS G 129 LEU G 139 
AT 3 ILE G 40  ? CYS G 42  ? ILE G 122 CYS G 124 
AU 1 PHE G 33  ? ARG G 36  ? PHE G 115 ARG G 118 
AU 2 CYS G 47  ? LEU G 57  ? CYS G 129 LEU G 139 
AU 3 THR G 75  ? PRO G 80  ? THR G 157 PRO G 162 
AU 4 ARG G 91  ? VAL G 95  ? ARG G 172 VAL G 176 
AV 1 SER G 98  ? HIS G 103 ? SER G 179 HIS G 184 
AV 2 TRP G 108 ? SER G 114 ? TRP G 189 SER G 195 
AV 3 VAL G 121 ? TYR G 126 ? VAL G 202 TYR G 207 
AV 4 ILE G 129 ? LYS G 135 ? ILE G 210 LYS G 216 
AW 1 ALA G 150 ? VAL G 152 ? ALA G 231 VAL G 233 
AW 2 SER G 155 ? ASP G 162 ? SER G 236 ASP G 243 
AW 3 SER G 170 ? GLU G 177 ? SER G 251 GLU G 258 
AW 4 LYS G 180 ? GLU G 186 ? LYS G 261 GLU G 267 
AX 1 SER G 198 ? ASN G 202 ? SER G 279 ASN G 283 
AX 2 GLU G 205 ? VAL G 209 ? GLU G 286 VAL G 290 
AX 3 PRO G 220 ? PHE G 224 ? PRO G 301 PHE G 305 
AX 4 TYR G 230 ? TYR G 234 ? TYR G 312 TYR G 316 
AY 1 SER G 268 ? TYR G 271 ? SER G 353 TYR G 356 
AY 2 GLY G 274 ? ARG G 279 ? GLY G 359 ARG G 364 
AY 3 SER G 287 ? ASP G 294 ? SER G 372 ASP G 379 
AY 4 VAL G 307 ? TRP G 317 ? VAL G 392 TRP G 403 
AZ 1 ALA H 16  ? LYS H 20  ? ALA H 98  LYS H 102 
AZ 2 THR H 356 ? CYS H 364 ? THR H 439 CYS H 447 
AZ 3 ARG H 337 ? GLY H 347 ? ARG H 419 GLY H 429 
AZ 4 SER H 321 ? GLN H 326 ? SER H 407 GLN H 412 
BA 1 PHE H 33  ? ARG H 36  ? PHE H 115 ARG H 118 
BA 2 CYS H 47  ? LEU H 57  ? CYS H 129 LEU H 139 
BA 3 ILE H 40  ? CYS H 42  ? ILE H 122 CYS H 124 
BB 1 PHE H 33  ? ARG H 36  ? PHE H 115 ARG H 118 
BB 2 CYS H 47  ? LEU H 57  ? CYS H 129 LEU H 139 
BB 3 THR H 75  ? PRO H 80  ? THR H 157 PRO H 162 
BB 4 ARG H 91  ? VAL H 95  ? ARG H 172 VAL H 176 
BC 1 SER H 98  ? HIS H 103 ? SER H 179 HIS H 184 
BC 2 TRP H 108 ? SER H 114 ? TRP H 189 SER H 195 
BC 3 VAL H 121 ? TYR H 126 ? VAL H 202 TYR H 207 
BC 4 ILE H 129 ? LYS H 135 ? ILE H 210 LYS H 216 
BD 1 ARG H 143 ? THR H 144 ? ARG H 224 THR H 225 
BD 2 SER H 155 ? ASP H 162 ? SER H 236 ASP H 243 
BD 3 ALA H 150 ? VAL H 152 ? ALA H 231 VAL H 233 
BE 1 ARG H 143 ? THR H 144 ? ARG H 224 THR H 225 
BE 2 SER H 155 ? ASP H 162 ? SER H 236 ASP H 243 
BE 3 SER H 170 ? GLU H 177 ? SER H 251 GLU H 258 
BE 4 LYS H 180 ? GLU H 186 ? LYS H 261 GLU H 267 
BF 1 SER H 198 ? ASN H 202 ? SER H 279 ASN H 283 
BF 2 GLU H 205 ? VAL H 209 ? GLU H 286 VAL H 290 
BF 3 PRO H 220 ? PHE H 224 ? PRO H 301 PHE H 305 
BF 4 TYR H 230 ? TYR H 234 ? TYR H 312 TYR H 316 
BG 1 SER H 268 ? TYR H 271 ? SER H 353 TYR H 356 
BG 2 GLY H 274 ? ARG H 279 ? GLY H 359 ARG H 364 
BG 3 SER H 287 ? ASP H 294 ? SER H 372 ASP H 379 
BG 4 VAL H 307 ? TRP H 317 ? VAL H 392 TRP H 403 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N TYR A 18  ? N TYR A 100 O SER A 362 ? O SER A 445 
A  2 3 O SER A 359 ? O SER A 442 N LEU A 344 ? N LEU A 426 
A  3 4 O ARG A 337 ? O ARG A 419 N GLN A 326 ? N GLN A 412 
B  1 2 N PHE A 39  ? N PHE A 121 O PHE A 50  ? O PHE A 132 
B  2 3 N THR A 49  ? N THR A 131 O CYS A 79  ? O CYS A 161 
B  3 4 N LEU A 76  ? N LEU A 158 O SER A 94  ? O SER A 175 
C  1 2 N SER A 98  ? N SER A 179 O ILE A 113 ? O ILE A 194 
C  2 3 N GLY A 112 ? N GLY A 193 O VAL A 123 ? O VAL A 204 
C  3 4 N ALA A 122 ? N ALA A 203 O ILE A 134 ? O ILE A 215 
D  1 2 N ARG A 143 ? N ARG A 224 O THR A 161 ? O THR A 242 
D  2 3 O SER A 155 ? O SER A 236 N VAL A 152 ? N VAL A 233 
E  1 2 N ARG A 143 ? N ARG A 224 O THR A 161 ? O THR A 242 
E  2 3 N THR A 158 ? N THR A 239 O PHE A 174 ? O PHE A 255 
E  3 4 N LYS A 175 ? N LYS A 256 O LYS A 183 ? O LYS A 264 
F  1 2 N ASN A 202 ? N ASN A 283 O GLU A 205 ? O GLU A 286 
F  2 3 N CYS A 208 ? N CYS A 289 O VAL A 222 ? O VAL A 303 
F  3 4 N TRP A 221 ? N TRP A 302 O GLY A 233 ? O GLY A 315 
G  1 2 N TYR A 271 ? N TYR A 356 O GLY A 274 ? O GLY A 359 
G  2 3 N ILE A 277 ? N ILE A 362 O ILE A 292 ? O ILE A 377 
G  3 4 N MET A 291 ? N MET A 376 O GLN A 309 ? O GLN A 395 
H  1 2 N TYR B 18  ? N TYR B 100 O SER B 362 ? O SER B 445 
H  2 3 O SER B 357 ? O SER B 440 N ARG B 346 ? N ARG B 428 
H  3 4 O TRP B 341 ? O TRP B 423 N GLY B 322 ? N GLY B 408 
I  1 2 N VAL B 34  ? N VAL B 116 O ALA B 56  ? O ALA B 138 
I  2 3 O ARG B 48  ? O ARG B 130 N SER B 41  ? N SER B 123 
J  1 2 N VAL B 34  ? N VAL B 116 O ALA B 56  ? O ALA B 138 
J  2 3 N THR B 49  ? N THR B 131 O CYS B 79  ? O CYS B 161 
J  3 4 N LEU B 76  ? N LEU B 158 O SER B 94  ? O SER B 175 
K  1 2 N CYS B 102 ? N CYS B 183 O LEU B 109 ? O LEU B 190 
K  2 3 N GLY B 112 ? N GLY B 193 O VAL B 123 ? O VAL B 204 
K  3 4 N ALA B 122 ? N ALA B 203 O ILE B 134 ? O ILE B 215 
L  1 2 N ALA B 150 ? N ALA B 231 O PHE B 157 ? O PHE B 238 
L  2 3 N ASP B 162 ? N ASP B 243 O SER B 170 ? O SER B 251 
L  3 4 N LYS B 175 ? N LYS B 256 O VAL B 182 ? O VAL B 263 
M  1 2 N ASN B 202 ? N ASN B 283 O GLU B 205 ? O GLU B 286 
M  2 3 N CYS B 208 ? N CYS B 289 O VAL B 222 ? O VAL B 303 
M  3 4 N TRP B 221 ? N TRP B 302 O GLY B 233 ? O GLY B 315 
N  1 2 N TYR B 271 ? N TYR B 356 O GLY B 274 ? O GLY B 359 
N  2 3 N ILE B 277 ? N ILE B 362 O ILE B 292 ? O ILE B 377 
N  3 4 N MET B 291 ? N MET B 376 O GLN B 309 ? O GLN B 395 
O  1 2 N TYR C 18  ? N TYR C 100 O SER C 362 ? O SER C 445 
O  2 3 O SER C 357 ? O SER C 440 N ARG C 346 ? N ARG C 428 
O  3 4 O TRP C 341 ? O TRP C 423 N GLY C 322 ? N GLY C 408 
P  1 2 N ARG C 36  ? N ARG C 118 O LEU C 52  ? O LEU C 134 
P  2 3 O ARG C 48  ? O ARG C 130 N SER C 41  ? N SER C 123 
Q  1 2 N ARG C 36  ? N ARG C 118 O LEU C 52  ? O LEU C 134 
Q  2 3 N THR C 49  ? N THR C 131 O CYS C 79  ? O CYS C 161 
Q  3 4 N LEU C 76  ? N LEU C 158 O SER C 94  ? O SER C 175 
R  1 2 N SER C 98  ? N SER C 179 O ILE C 113 ? O ILE C 194 
R  2 3 N GLY C 112 ? N GLY C 193 O VAL C 123 ? O VAL C 204 
R  3 4 N ALA C 122 ? N ALA C 203 O ILE C 134 ? O ILE C 215 
S  1 2 N VAL C 152 ? N VAL C 233 O SER C 155 ? O SER C 236 
S  2 3 N CYS C 156 ? N CYS C 237 O MET C 176 ? O MET C 257 
S  3 4 N LYS C 175 ? N LYS C 256 O LYS C 183 ? O LYS C 264 
T  1 2 N ASN C 202 ? N ASN C 283 O GLU C 205 ? O GLU C 286 
T  2 3 N CYS C 210 ? N CYS C 291 O PRO C 220 ? O PRO C 301 
T  3 4 N TRP C 221 ? N TRP C 302 O GLY C 233 ? O GLY C 315 
U  1 2 N TYR C 271 ? N TYR C 356 O GLY C 274 ? O GLY C 359 
U  2 3 N ILE C 277 ? N ILE C 362 O ILE C 292 ? O ILE C 377 
U  3 4 N MET C 291 ? N MET C 376 O GLN C 309 ? O GLN C 395 
V  1 2 N TYR D 18  ? N TYR D 100 O SER D 362 ? O SER D 445 
V  2 3 O ILE D 361 ? O ILE D 444 N VAL D 342 ? N VAL D 424 
V  3 4 O ARG D 337 ? O ARG D 419 N GLN D 326 ? N GLN D 412 
W  1 2 N VAL D 34  ? N VAL D 116 O ALA D 56  ? O ALA D 138 
W  2 3 O ARG D 48  ? O ARG D 130 N SER D 41  ? N SER D 123 
X  1 2 N VAL D 34  ? N VAL D 116 O ALA D 56  ? O ALA D 138 
X  2 3 N THR D 49  ? N THR D 131 O CYS D 79  ? O CYS D 161 
X  3 4 N LEU D 76  ? N LEU D 158 O SER D 94  ? O SER D 175 
Y  1 2 N CYS D 102 ? N CYS D 183 O LEU D 109 ? O LEU D 190 
Y  2 3 N GLY D 112 ? N GLY D 193 O VAL D 123 ? O VAL D 204 
Y  3 4 N ALA D 122 ? N ALA D 203 O ILE D 134 ? O ILE D 215 
Z  1 2 N VAL D 152 ? N VAL D 233 O SER D 155 ? O SER D 236 
Z  2 3 N ASP D 162 ? N ASP D 243 O SER D 170 ? O SER D 251 
Z  3 4 N LYS D 175 ? N LYS D 256 O LYS D 183 ? O LYS D 264 
AA 1 2 N TYR D 200 ? N TYR D 281 O THR D 207 ? O THR D 288 
AA 2 3 N ILE D 206 ? N ILE D 287 O PHE D 224 ? O PHE D 305 
AA 3 4 N TRP D 221 ? N TRP D 302 O GLY D 233 ? O GLY D 315 
AB 1 2 N TYR D 271 ? N TYR D 356 O GLY D 274 ? O GLY D 359 
AB 2 3 N ILE D 277 ? N ILE D 362 O ILE D 292 ? O ILE D 377 
AB 3 4 N MET D 291 ? N MET D 376 O GLN D 309 ? O GLN D 395 
AC 1 2 N TYR E 18  ? N TYR E 100 O SER E 362 ? O SER E 445 
AC 2 3 O SER E 359 ? O SER E 442 N LEU E 344 ? N LEU E 426 
AC 3 4 O TRP E 341 ? O TRP E 423 N GLY E 322 ? N GLY E 408 
AD 1 2 N VAL E 34  ? N VAL E 116 O ALA E 56  ? O ALA E 138 
AD 2 3 O ARG E 48  ? O ARG E 130 N SER E 41  ? N SER E 123 
AE 1 2 N VAL E 34  ? N VAL E 116 O ALA E 56  ? O ALA E 138 
AE 2 3 N THR E 49  ? N THR E 131 O CYS E 79  ? O CYS E 161 
AE 3 4 N LEU E 76  ? N LEU E 158 O SER E 94  ? O SER E 175 
AF 1 2 O THR E 131 ? O THR E 212 N LEU E 124 ? N LEU E 205 
AF 2 3 O VAL E 123 ? O VAL E 204 N GLY E 112 ? N GLY E 193 
AF 3 4 O ILE E 111 ? O ILE E 192 N SER E 100 ? N SER E 181 
AF 4 5 O ALA E 99  ? O ALA E 180 N SER E 147 ? N SER E 228 
AG 1 2 N ARG E 143 ? N ARG E 224 O THR E 161 ? O THR E 242 
AG 2 3 O PHE E 157 ? O PHE E 238 N ALA E 150 ? N ALA E 231 
AH 1 2 N ARG E 143 ? N ARG E 224 O THR E 161 ? O THR E 242 
AH 2 3 N THR E 158 ? N THR E 239 O PHE E 174 ? O PHE E 255 
AH 3 4 N LYS E 175 ? N LYS E 256 O VAL E 182 ? O VAL E 263 
AI 1 2 N ASN E 202 ? N ASN E 283 O GLU E 205 ? O GLU E 286 
AI 2 3 N CYS E 208 ? N CYS E 289 O VAL E 222 ? O VAL E 303 
AI 3 4 N TRP E 221 ? N TRP E 302 O GLY E 233 ? O GLY E 315 
AJ 1 2 N TYR E 271 ? N TYR E 356 O GLY E 274 ? O GLY E 359 
AJ 2 3 N ILE E 277 ? N ILE E 362 O ILE E 292 ? O ILE E 377 
AJ 3 4 N MET E 291 ? N MET E 376 O GLN E 309 ? O GLN E 395 
AK 1 2 N TYR F 18  ? N TYR F 100 O SER F 362 ? O SER F 445 
AK 2 3 O SER F 357 ? O SER F 440 N ARG F 346 ? N ARG F 428 
AK 3 4 O ARG F 337 ? O ARG F 419 N GLN F 326 ? N GLN F 412 
AL 1 2 N VAL F 34  ? N VAL F 116 O ALA F 56  ? O ALA F 138 
AL 2 3 O ARG F 48  ? O ARG F 130 N SER F 41  ? N SER F 123 
AM 1 2 N VAL F 34  ? N VAL F 116 O ALA F 56  ? O ALA F 138 
AM 2 3 N THR F 49  ? N THR F 131 O CYS F 79  ? O CYS F 161 
AM 3 4 N LEU F 76  ? N LEU F 158 O SER F 94  ? O SER F 175 
AN 1 2 N SER F 100 ? N SER F 181 O ILE F 111 ? O ILE F 192 
AN 2 3 N GLY F 112 ? N GLY F 193 O VAL F 123 ? O VAL F 204 
AN 3 4 N LEU F 124 ? N LEU F 205 O THR F 131 ? O THR F 212 
AO 1 2 N ARG F 143 ? N ARG F 224 O THR F 161 ? O THR F 242 
AO 2 3 O PHE F 157 ? O PHE F 238 N ALA F 150 ? N ALA F 231 
AP 1 2 N ARG F 143 ? N ARG F 224 O THR F 161 ? O THR F 242 
AP 2 3 N THR F 158 ? N THR F 239 O PHE F 174 ? O PHE F 255 
AP 3 4 N LYS F 175 ? N LYS F 256 O VAL F 182 ? O VAL F 263 
AQ 1 2 N SER F 198 ? N SER F 279 O VAL F 209 ? O VAL F 290 
AQ 2 3 N CYS F 208 ? N CYS F 289 O VAL F 222 ? O VAL F 303 
AQ 3 4 N TRP F 221 ? N TRP F 302 O GLY F 233 ? O GLY F 315 
AR 1 2 N TYR F 271 ? N TYR F 356 O GLY F 274 ? O GLY F 359 
AR 2 3 N ILE F 277 ? N ILE F 362 O ILE F 292 ? O ILE F 377 
AR 3 4 N MET F 291 ? N MET F 376 O GLN F 309 ? O GLN F 395 
AS 1 2 N TYR G 18  ? N TYR G 100 O SER G 362 ? O SER G 445 
AS 2 3 O SER G 357 ? O SER G 440 N ARG G 346 ? N ARG G 428 
AS 3 4 O TRP G 341 ? O TRP G 423 N GLY G 322 ? N GLY G 408 
AT 1 2 N ARG G 36  ? N ARG G 118 O LEU G 52  ? O LEU G 134 
AT 2 3 O ARG G 48  ? O ARG G 130 N SER G 41  ? N SER G 123 
AU 1 2 N ARG G 36  ? N ARG G 118 O LEU G 52  ? O LEU G 134 
AU 2 3 N THR G 49  ? N THR G 131 O CYS G 79  ? O CYS G 161 
AU 3 4 N SER G 78  ? N SER G 160 O ARG G 91  ? O ARG G 172 
AV 1 2 N SER G 98  ? N SER G 179 O ILE G 113 ? O ILE G 194 
AV 2 3 N GLY G 112 ? N GLY G 193 O VAL G 123 ? O VAL G 204 
AV 3 4 N ALA G 122 ? N ALA G 203 O ILE G 134 ? O ILE G 215 
AW 1 2 N ALA G 150 ? N ALA G 231 O PHE G 157 ? O PHE G 238 
AW 2 3 N CYS G 156 ? N CYS G 237 O MET G 176 ? O MET G 257 
AW 3 4 N LYS G 175 ? N LYS G 256 O LYS G 183 ? O LYS G 264 
AX 1 2 N SER G 198 ? N SER G 279 O VAL G 209 ? O VAL G 290 
AX 2 3 N CYS G 208 ? N CYS G 289 O VAL G 222 ? O VAL G 303 
AX 3 4 N TRP G 221 ? N TRP G 302 O GLY G 233 ? O GLY G 315 
AY 1 2 N TYR G 271 ? N TYR G 356 O GLY G 274 ? O GLY G 359 
AY 2 3 N ILE G 277 ? N ILE G 362 O ILE G 292 ? O ILE G 377 
AY 3 4 N MET G 291 ? N MET G 376 O GLN G 309 ? O GLN G 395 
AZ 1 2 N TYR H 18  ? N TYR H 100 O SER H 362 ? O SER H 445 
AZ 2 3 O SER H 357 ? O SER H 440 N ARG H 346 ? N ARG H 428 
AZ 3 4 O ARG H 337 ? O ARG H 419 N GLN H 326 ? N GLN H 412 
BA 1 2 N VAL H 34  ? N VAL H 116 O ALA H 56  ? O ALA H 138 
BA 2 3 O ARG H 48  ? O ARG H 130 N SER H 41  ? N SER H 123 
BB 1 2 N VAL H 34  ? N VAL H 116 O ALA H 56  ? O ALA H 138 
BB 2 3 N THR H 49  ? N THR H 131 O CYS H 79  ? O CYS H 161 
BB 3 4 N SER H 78  ? N SER H 160 O ARG H 91  ? O ARG H 172 
BC 1 2 N SER H 100 ? N SER H 181 O ILE H 111 ? O ILE H 192 
BC 2 3 N GLY H 112 ? N GLY H 193 O VAL H 123 ? O VAL H 204 
BC 3 4 N ALA H 122 ? N ALA H 203 O ILE H 134 ? O ILE H 215 
BD 1 2 N ARG H 143 ? N ARG H 224 O THR H 161 ? O THR H 242 
BD 2 3 O PHE H 157 ? O PHE H 238 N ALA H 150 ? N ALA H 231 
BE 1 2 N ARG H 143 ? N ARG H 224 O THR H 161 ? O THR H 242 
BE 2 3 N CYS H 156 ? N CYS H 237 O MET H 176 ? O MET H 257 
BE 3 4 N LYS H 175 ? N LYS H 256 O VAL H 182 ? O VAL H 263 
BF 1 2 N SER H 198 ? N SER H 279 O VAL H 209 ? O VAL H 290 
BF 2 3 N CYS H 208 ? N CYS H 289 O VAL H 222 ? O VAL H 303 
BF 3 4 N TRP H 221 ? N TRP H 302 O GLY H 233 ? O GLY H 315 
BG 1 2 N TYR H 271 ? N TYR H 356 O GLY H 274 ? O GLY H 359 
BG 2 3 N ILE H 277 ? N ILE H 362 O ILE H 292 ? O ILE H 377 
BG 3 4 N TRP H 293 ? N TRP H 378 O VAL H 307 ? O VAL H 392 
# 
_database_PDB_matrix.entry_id          2HTY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HTY 
_atom_sites.fract_transf_matrix[1][1]   0.004995 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004981 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004724 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . VAL A  1 1   ? 0.306   65.459   77.627  1.00 37.87 ? 83   VAL A N   1 
ATOM   2     C  CA  . VAL A  1 1   ? -0.303  66.656   76.965  1.00 39.64 ? 83   VAL A CA  1 
ATOM   3     C  C   . VAL A  1 1   ? -0.691  67.764   77.954  1.00 38.32 ? 83   VAL A C   1 
ATOM   4     O  O   . VAL A  1 1   ? -1.548  67.574   78.817  1.00 38.71 ? 83   VAL A O   1 
ATOM   5     C  CB  . VAL A  1 1   ? -1.567  66.271   76.158  1.00 40.69 ? 83   VAL A CB  1 
ATOM   6     C  CG1 . VAL A  1 1   ? -2.104  67.491   75.418  1.00 37.87 ? 83   VAL A CG1 1 
ATOM   7     C  CG2 . VAL A  1 1   ? -1.238  65.149   75.184  1.00 41.90 ? 83   VAL A CG2 1 
ATOM   8     N  N   . LYS A  1 2   ? -0.062  68.922   77.796  1.00 36.22 ? 84   LYS A N   1 
ATOM   9     C  CA  . LYS A  1 2   ? -0.295  70.074   78.654  1.00 34.86 ? 84   LYS A CA  1 
ATOM   10    C  C   . LYS A  1 2   ? -1.766  70.368   78.897  1.00 32.23 ? 84   LYS A C   1 
ATOM   11    O  O   . LYS A  1 2   ? -2.610  70.209   78.020  1.00 31.06 ? 84   LYS A O   1 
ATOM   12    C  CB  . LYS A  1 2   ? 0.397   71.305   78.059  1.00 37.91 ? 84   LYS A CB  1 
ATOM   13    C  CG  . LYS A  1 2   ? 1.892   71.099   77.863  1.00 43.02 ? 84   LYS A CG  1 
ATOM   14    C  CD  . LYS A  1 2   ? 2.491   72.075   76.854  1.00 46.91 ? 84   LYS A CD  1 
ATOM   15    C  CE  . LYS A  1 2   ? 3.923   71.669   76.496  1.00 48.65 ? 84   LYS A CE  1 
ATOM   16    N  NZ  . LYS A  1 2   ? 4.585   72.630   75.569  1.00 51.31 ? 84   LYS A NZ  1 
ATOM   17    N  N   . LEU A  1 3   ? -2.047  70.812   80.113  1.00 29.80 ? 85   LEU A N   1 
ATOM   18    C  CA  . LEU A  1 3   ? -3.389  71.147   80.562  1.00 27.81 ? 85   LEU A CA  1 
ATOM   19    C  C   . LEU A  1 3   ? -3.812  72.498   79.995  1.00 27.58 ? 85   LEU A C   1 
ATOM   20    O  O   . LEU A  1 3   ? -3.183  73.523   80.263  1.00 28.15 ? 85   LEU A O   1 
ATOM   21    C  CB  . LEU A  1 3   ? -3.387  71.205   82.089  1.00 25.62 ? 85   LEU A CB  1 
ATOM   22    C  CG  . LEU A  1 3   ? -4.535  70.649   82.916  1.00 25.26 ? 85   LEU A CG  1 
ATOM   23    C  CD1 . LEU A  1 3   ? -4.800  69.203   82.551  1.00 22.72 ? 85   LEU A CD1 1 
ATOM   24    C  CD2 . LEU A  1 3   ? -4.164  70.766   84.377  1.00 22.95 ? 85   LEU A CD2 1 
ATOM   25    N  N   . ALA A  1 4   ? -4.867  72.505   79.193  1.00 27.20 ? 86   ALA A N   1 
ATOM   26    C  CA  . ALA A  1 4   ? -5.348  73.757   78.630  1.00 26.03 ? 86   ALA A CA  1 
ATOM   27    C  C   . ALA A  1 4   ? -6.308  74.326   79.657  1.00 27.65 ? 86   ALA A C   1 
ATOM   28    O  O   . ALA A  1 4   ? -7.179  73.608   80.173  1.00 30.40 ? 86   ALA A O   1 
ATOM   29    C  CB  . ALA A  1 4   ? -6.069  73.505   77.331  1.00 24.07 ? 86   ALA A CB  1 
ATOM   30    N  N   . GLY A  1 5   ? -6.151  75.601   79.981  1.00 25.46 ? 87   GLY A N   1 
ATOM   31    C  CA  . GLY A  1 5   ? -7.046  76.187   80.957  1.00 24.22 ? 87   GLY A CA  1 
ATOM   32    C  C   . GLY A  1 5   ? -7.858  77.265   80.289  1.00 24.27 ? 87   GLY A C   1 
ATOM   33    O  O   . GLY A  1 5   ? -8.078  78.326   80.865  1.00 24.46 ? 87   GLY A O   1 
ATOM   34    N  N   . ASN A  1 6   ? -8.298  76.998   79.066  1.00 23.79 ? 88   ASN A N   1 
ATOM   35    C  CA  . ASN A  1 6   ? -9.065  77.977   78.310  1.00 25.00 ? 88   ASN A CA  1 
ATOM   36    C  C   . ASN A  1 6   ? -10.558 78.021   78.626  1.00 24.92 ? 88   ASN A C   1 
ATOM   37    O  O   . ASN A  1 6   ? -11.220 79.008   78.317  1.00 27.01 ? 88   ASN A O   1 
ATOM   38    C  CB  . ASN A  1 6   ? -8.877  77.755   76.807  1.00 26.76 ? 88   ASN A CB  1 
ATOM   39    C  CG  . ASN A  1 6   ? -9.248  76.350   76.369  1.00 29.84 ? 88   ASN A CG  1 
ATOM   40    O  OD1 . ASN A  1 6   ? -9.546  76.112   75.192  1.00 34.04 ? 88   ASN A OD1 1 
ATOM   41    N  ND2 . ASN A  1 6   ? -9.216  75.406   77.307  1.00 29.37 ? 88   ASN A ND2 1 
ATOM   42    N  N   . SER A  1 7   ? -11.096 76.965   79.229  1.00 21.88 ? 89   SER A N   1 
ATOM   43    C  CA  . SER A  1 7   ? -12.512 76.954   79.555  1.00 19.59 ? 89   SER A CA  1 
ATOM   44    C  C   . SER A  1 7   ? -12.757 77.769   80.815  1.00 18.57 ? 89   SER A C   1 
ATOM   45    O  O   . SER A  1 7   ? -11.812 78.195   81.467  1.00 16.96 ? 89   SER A O   1 
ATOM   46    C  CB  . SER A  1 7   ? -12.992 75.524   79.744  1.00 18.44 ? 89   SER A CB  1 
ATOM   47    O  OG  . SER A  1 7   ? -12.109 74.833   80.596  1.00 22.71 ? 89   SER A OG  1 
ATOM   48    N  N   . SER A  1 8   ? -14.027 77.999   81.142  1.00 18.98 ? 90   SER A N   1 
ATOM   49    C  CA  . SER A  1 8   ? -14.406 78.774   82.326  1.00 20.54 ? 90   SER A CA  1 
ATOM   50    C  C   . SER A  1 8   ? -14.957 77.883   83.435  1.00 20.60 ? 90   SER A C   1 
ATOM   51    O  O   . SER A  1 8   ? -15.243 76.705   83.222  1.00 18.90 ? 90   SER A O   1 
ATOM   52    C  CB  . SER A  1 8   ? -15.475 79.817   81.976  1.00 20.61 ? 90   SER A CB  1 
ATOM   53    O  OG  . SER A  1 8   ? -15.011 80.729   81.001  1.00 23.65 ? 90   SER A OG  1 
ATOM   54    N  N   . LEU A  1 9   ? -15.109 78.459   84.621  1.00 20.62 ? 91   LEU A N   1 
ATOM   55    C  CA  . LEU A  1 9   ? -15.646 77.714   85.739  1.00 21.57 ? 91   LEU A CA  1 
ATOM   56    C  C   . LEU A  1 9   ? -17.043 77.218   85.399  1.00 22.86 ? 91   LEU A C   1 
ATOM   57    O  O   . LEU A  1 9   ? -17.858 77.956   84.842  1.00 23.35 ? 91   LEU A O   1 
ATOM   58    C  CB  . LEU A  1 9   ? -15.705 78.588   86.991  1.00 22.40 ? 91   LEU A CB  1 
ATOM   59    C  CG  . LEU A  1 9   ? -14.373 78.945   87.660  1.00 22.70 ? 91   LEU A CG  1 
ATOM   60    C  CD1 . LEU A  1 9   ? -14.652 79.809   88.877  1.00 22.10 ? 91   LEU A CD1 1 
ATOM   61    C  CD2 . LEU A  1 9   ? -13.625 77.678   88.061  1.00 20.77 ? 91   LEU A CD2 1 
ATOM   62    N  N   . CYS A  1 10  ? -17.302 75.958   85.726  1.00 24.35 ? 92   CYS A N   1 
ATOM   63    C  CA  . CYS A  1 10  ? -18.599 75.342   85.482  1.00 25.73 ? 92   CYS A CA  1 
ATOM   64    C  C   . CYS A  1 10  ? -19.652 76.000   86.349  1.00 24.33 ? 92   CYS A C   1 
ATOM   65    O  O   . CYS A  1 10  ? -19.396 76.319   87.514  1.00 24.44 ? 92   CYS A O   1 
ATOM   66    C  CB  . CYS A  1 10  ? -18.587 73.861   85.861  1.00 28.92 ? 92   CYS A CB  1 
ATOM   67    S  SG  . CYS A  1 10  ? -17.334 72.809   85.065  1.00 39.59 ? 92   CYS A SG  1 
ATOM   68    N  N   . PRO A  1 11  ? -20.851 76.218   85.797  1.00 23.37 ? 93   PRO A N   1 
ATOM   69    C  CA  . PRO A  1 11  ? -21.909 76.836   86.605  1.00 22.56 ? 93   PRO A CA  1 
ATOM   70    C  C   . PRO A  1 11  ? -22.289 75.854   87.721  1.00 20.29 ? 93   PRO A C   1 
ATOM   71    O  O   . PRO A  1 11  ? -22.303 74.641   87.501  1.00 18.83 ? 93   PRO A O   1 
ATOM   72    C  CB  . PRO A  1 11  ? -23.034 77.054   85.590  1.00 21.86 ? 93   PRO A CB  1 
ATOM   73    C  CG  . PRO A  1 11  ? -22.786 75.990   84.573  1.00 23.27 ? 93   PRO A CG  1 
ATOM   74    C  CD  . PRO A  1 11  ? -21.290 76.043   84.406  1.00 22.79 ? 93   PRO A CD  1 
ATOM   75    N  N   . ILE A  1 12  ? -22.580 76.369   88.913  1.00 19.13 ? 94   ILE A N   1 
ATOM   76    C  CA  . ILE A  1 12  ? -22.920 75.500   90.031  1.00 19.26 ? 94   ILE A CA  1 
ATOM   77    C  C   . ILE A  1 12  ? -24.029 76.044   90.920  1.00 20.36 ? 94   ILE A C   1 
ATOM   78    O  O   . ILE A  1 12  ? -24.205 77.258   91.043  1.00 21.46 ? 94   ILE A O   1 
ATOM   79    C  CB  . ILE A  1 12  ? -21.691 75.250   90.938  1.00 19.15 ? 94   ILE A CB  1 
ATOM   80    C  CG1 . ILE A  1 12  ? -21.243 76.576   91.558  1.00 20.01 ? 94   ILE A CG1 1 
ATOM   81    C  CG2 . ILE A  1 12  ? -20.555 74.624   90.131  1.00 17.74 ? 94   ILE A CG2 1 
ATOM   82    C  CD1 . ILE A  1 12  ? -20.323 76.445   92.743  1.00 19.81 ? 94   ILE A CD1 1 
ATOM   83    N  N   . ASN A  1 13  ? -24.753 75.133   91.564  1.00 20.37 ? 95   ASN A N   1 
ATOM   84    C  CA  . ASN A  1 13  ? -25.838 75.496   92.467  1.00 20.15 ? 95   ASN A CA  1 
ATOM   85    C  C   . ASN A  1 13  ? -25.450 75.213   93.918  1.00 19.05 ? 95   ASN A C   1 
ATOM   86    O  O   . ASN A  1 13  ? -25.954 75.853   94.843  1.00 19.50 ? 95   ASN A O   1 
ATOM   87    C  CB  . ASN A  1 13  ? -27.106 74.694   92.140  1.00 21.85 ? 95   ASN A CB  1 
ATOM   88    C  CG  . ASN A  1 13  ? -27.625 74.949   90.732  1.00 24.48 ? 95   ASN A CG  1 
ATOM   89    O  OD1 . ASN A  1 13  ? -27.805 76.096   90.303  1.00 24.29 ? 95   ASN A OD1 1 
ATOM   90    N  ND2 . ASN A  1 13  ? -27.885 73.873   90.010  1.00 24.10 ? 95   ASN A ND2 1 
ATOM   91    N  N   . GLY A  1 14  ? -24.561 74.245   94.125  1.00 17.66 ? 96   GLY A N   1 
ATOM   92    C  CA  . GLY A  1 14  ? -24.173 73.911   95.486  1.00 15.50 ? 96   GLY A CA  1 
ATOM   93    C  C   . GLY A  1 14  ? -22.925 73.063   95.557  1.00 13.41 ? 96   GLY A C   1 
ATOM   94    O  O   . GLY A  1 14  ? -22.271 72.853   94.553  1.00 12.91 ? 96   GLY A O   1 
ATOM   95    N  N   . TRP A  1 15  ? -22.600 72.549   96.734  1.00 12.60 ? 97   TRP A N   1 
ATOM   96    C  CA  . TRP A  1 15  ? -21.384 71.765   96.861  1.00 13.32 ? 97   TRP A CA  1 
ATOM   97    C  C   . TRP A  1 15  ? -21.604 70.376   97.433  1.00 13.46 ? 97   TRP A C   1 
ATOM   98    O  O   . TRP A  1 15  ? -22.184 70.227   98.491  1.00 15.05 ? 97   TRP A O   1 
ATOM   99    C  CB  . TRP A  1 15  ? -20.387 72.542   97.725  1.00 11.85 ? 97   TRP A CB  1 
ATOM   100   C  CG  . TRP A  1 15  ? -20.256 73.969   97.299  1.00 11.15 ? 97   TRP A CG  1 
ATOM   101   C  CD1 . TRP A  1 15  ? -21.133 74.984   97.554  1.00 12.88 ? 97   TRP A CD1 1 
ATOM   102   C  CD2 . TRP A  1 15  ? -19.219 74.529   96.489  1.00 12.23 ? 97   TRP A CD2 1 
ATOM   103   N  NE1 . TRP A  1 15  ? -20.710 76.147   96.945  1.00 13.14 ? 97   TRP A NE1 1 
ATOM   104   C  CE2 . TRP A  1 15  ? -19.537 75.894   96.284  1.00 12.97 ? 97   TRP A CE2 1 
ATOM   105   C  CE3 . TRP A  1 15  ? -18.051 74.012   95.912  1.00 12.33 ? 97   TRP A CE3 1 
ATOM   106   C  CZ2 . TRP A  1 15  ? -18.727 76.746   95.530  1.00 11.65 ? 97   TRP A CZ2 1 
ATOM   107   C  CZ3 . TRP A  1 15  ? -17.244 74.865   95.157  1.00 11.94 ? 97   TRP A CZ3 1 
ATOM   108   C  CH2 . TRP A  1 15  ? -17.590 76.215   94.974  1.00 11.74 ? 97   TRP A CH2 1 
ATOM   109   N  N   . ALA A  1 16  ? -21.112 69.360   96.739  1.00 12.98 ? 98   ALA A N   1 
ATOM   110   C  CA  . ALA A  1 16  ? -21.272 67.987   97.193  1.00 13.79 ? 98   ALA A CA  1 
ATOM   111   C  C   . ALA A  1 16  ? -20.004 67.505   97.892  1.00 13.78 ? 98   ALA A C   1 
ATOM   112   O  O   . ALA A  1 16  ? -18.913 67.800   97.429  1.00 14.40 ? 98   ALA A O   1 
ATOM   113   C  CB  . ALA A  1 16  ? -21.587 67.101   95.994  1.00 13.01 ? 98   ALA A CB  1 
ATOM   114   N  N   . VAL A  1 17  ? -20.127 66.773   99.002  1.00 16.12 ? 99   VAL A N   1 
ATOM   115   C  CA  . VAL A  1 17  ? -18.922 66.290   99.689  1.00 16.95 ? 99   VAL A CA  1 
ATOM   116   C  C   . VAL A  1 17  ? -18.116 65.453   98.732  1.00 17.26 ? 99   VAL A C   1 
ATOM   117   O  O   . VAL A  1 17  ? -18.668 64.691   97.938  1.00 17.07 ? 99   VAL A O   1 
ATOM   118   C  CB  . VAL A  1 17  ? -19.197 65.384   100.919 1.00 17.61 ? 99   VAL A CB  1 
ATOM   119   C  CG1 . VAL A  1 17  ? -19.492 66.218   102.123 1.00 19.86 ? 99   VAL A CG1 1 
ATOM   120   C  CG2 . VAL A  1 17  ? -20.339 64.422   100.628 1.00 17.99 ? 99   VAL A CG2 1 
ATOM   121   N  N   . TYR A  1 18  ? -16.804 65.591   98.826  1.00 17.14 ? 100  TYR A N   1 
ATOM   122   C  CA  . TYR A  1 18  ? -15.910 64.849   97.968  1.00 16.93 ? 100  TYR A CA  1 
ATOM   123   C  C   . TYR A  1 18  ? -15.050 63.891   98.793  1.00 16.86 ? 100  TYR A C   1 
ATOM   124   O  O   . TYR A  1 18  ? -14.829 62.748   98.390  1.00 17.37 ? 100  TYR A O   1 
ATOM   125   C  CB  . TYR A  1 18  ? -15.032 65.815   97.185  1.00 15.07 ? 100  TYR A CB  1 
ATOM   126   C  CG  . TYR A  1 18  ? -14.222 65.159   96.105  1.00 16.61 ? 100  TYR A CG  1 
ATOM   127   C  CD1 . TYR A  1 18  ? -14.829 64.342   95.154  1.00 17.83 ? 100  TYR A CD1 1 
ATOM   128   C  CD2 . TYR A  1 18  ? -12.855 65.393   95.996  1.00 16.73 ? 100  TYR A CD2 1 
ATOM   129   C  CE1 . TYR A  1 18  ? -14.086 63.779   94.115  1.00 19.67 ? 100  TYR A CE1 1 
ATOM   130   C  CE2 . TYR A  1 18  ? -12.109 64.838   94.968  1.00 18.01 ? 100  TYR A CE2 1 
ATOM   131   C  CZ  . TYR A  1 18  ? -12.724 64.037   94.034  1.00 19.45 ? 100  TYR A CZ  1 
ATOM   132   O  OH  . TYR A  1 18  ? -11.971 63.486   93.024  1.00 22.99 ? 100  TYR A OH  1 
ATOM   133   N  N   . SER A  1 19  ? -14.583 64.339   99.953  1.00 14.45 ? 101  SER A N   1 
ATOM   134   C  CA  . SER A  1 19  ? -13.758 63.473   100.775 1.00 14.02 ? 101  SER A CA  1 
ATOM   135   C  C   . SER A  1 19  ? -13.688 63.898   102.234 1.00 13.25 ? 101  SER A C   1 
ATOM   136   O  O   . SER A  1 19  ? -14.028 65.020   102.583 1.00 11.43 ? 101  SER A O   1 
ATOM   137   C  CB  . SER A  1 19  ? -12.337 63.428   100.212 1.00 14.47 ? 101  SER A CB  1 
ATOM   138   O  OG  . SER A  1 19  ? -11.585 64.537   100.679 1.00 16.47 ? 101  SER A OG  1 
ATOM   139   N  N   . LYS A  1 20  ? -13.233 62.973   103.071 1.00 13.28 ? 102  LYS A N   1 
ATOM   140   C  CA  . LYS A  1 20  ? -13.045 63.192   104.499 1.00 14.54 ? 102  LYS A CA  1 
ATOM   141   C  C   . LYS A  1 20  ? -12.038 62.114   104.905 1.00 15.58 ? 102  LYS A C   1 
ATOM   142   O  O   . LYS A  1 20  ? -12.297 60.914   104.763 1.00 15.91 ? 102  LYS A O   1 
ATOM   143   C  CB  . LYS A  1 20  ? -14.362 63.027   105.262 1.00 14.09 ? 102  LYS A CB  1 
ATOM   144   C  CG  . LYS A  1 20  ? -14.292 63.520   106.701 1.00 13.23 ? 102  LYS A CG  1 
ATOM   145   C  CD  . LYS A  1 20  ? -15.609 63.335   107.421 1.00 14.05 ? 102  LYS A CD  1 
ATOM   146   C  CE  . LYS A  1 20  ? -15.619 64.047   108.767 1.00 15.19 ? 102  LYS A CE  1 
ATOM   147   N  NZ  . LYS A  1 20  ? -14.572 63.557   109.707 1.00 17.57 ? 102  LYS A NZ  1 
ATOM   148   N  N   . ASP A  1 21  ? -10.882 62.542   105.393 1.00 17.00 ? 103  ASP A N   1 
ATOM   149   C  CA  . ASP A  1 21  ? -9.836  61.606   105.757 1.00 17.11 ? 103  ASP A CA  1 
ATOM   150   C  C   . ASP A  1 21  ? -9.921  61.064   107.172 1.00 15.48 ? 103  ASP A C   1 
ATOM   151   O  O   . ASP A  1 21  ? -9.311  60.038   107.466 1.00 15.61 ? 103  ASP A O   1 
ATOM   152   C  CB  . ASP A  1 21  ? -8.467  62.241   105.525 1.00 21.78 ? 103  ASP A CB  1 
ATOM   153   C  CG  . ASP A  1 21  ? -8.239  63.469   106.388 1.00 26.92 ? 103  ASP A CG  1 
ATOM   154   O  OD1 . ASP A  1 21  ? -7.114  64.035   106.351 1.00 30.15 ? 103  ASP A OD1 1 
ATOM   155   O  OD2 . ASP A  1 21  ? -9.187  63.865   107.105 1.00 27.22 ? 103  ASP A OD2 1 
ATOM   156   N  N   . ASN A  1 22  ? -10.680 61.727   108.040 1.00 13.94 ? 104  ASN A N   1 
ATOM   157   C  CA  . ASN A  1 22  ? -10.825 61.277   109.430 1.00 15.50 ? 104  ASN A CA  1 
ATOM   158   C  C   . ASN A  1 22  ? -9.466  61.051   110.080 1.00 16.18 ? 104  ASN A C   1 
ATOM   159   O  O   . ASN A  1 22  ? -9.370  60.340   111.078 1.00 17.61 ? 104  ASN A O   1 
ATOM   160   C  CB  . ASN A  1 22  ? -11.595 59.947   109.496 1.00 14.39 ? 104  ASN A CB  1 
ATOM   161   C  CG  . ASN A  1 22  ? -13.085 60.121   109.359 1.00 14.15 ? 104  ASN A CG  1 
ATOM   162   O  OD1 . ASN A  1 22  ? -13.730 59.450   108.555 1.00 14.79 ? 104  ASN A OD1 1 
ATOM   163   N  ND2 . ASN A  1 22  ? -13.647 61.013   110.158 1.00 14.36 ? 104  ASN A ND2 1 
ATOM   164   N  N   . SER A  1 23  ? -8.424  61.657   109.526 1.00 16.55 ? 105  SER A N   1 
ATOM   165   C  CA  . SER A  1 23  ? -7.077  61.440   110.030 1.00 16.51 ? 105  SER A CA  1 
ATOM   166   C  C   . SER A  1 23  ? -6.890  61.509   111.543 1.00 17.35 ? 105  SER A C   1 
ATOM   167   O  O   . SER A  1 23  ? -6.210  60.659   112.117 1.00 18.26 ? 105  SER A O   1 
ATOM   168   C  CB  . SER A  1 23  ? -6.092  62.383   109.323 1.00 16.02 ? 105  SER A CB  1 
ATOM   169   O  OG  . SER A  1 23  ? -6.401  63.739   109.561 1.00 18.71 ? 105  SER A OG  1 
ATOM   170   N  N   . ILE A  1 24  ? -7.498  62.488   112.205 1.00 17.04 ? 106  ILE A N   1 
ATOM   171   C  CA  . ILE A  1 24  ? -7.321  62.597   113.644 1.00 16.85 ? 106  ILE A CA  1 
ATOM   172   C  C   . ILE A  1 24  ? -7.998  61.481   114.441 1.00 17.35 ? 106  ILE A C   1 
ATOM   173   O  O   . ILE A  1 24  ? -7.424  60.974   115.410 1.00 18.80 ? 106  ILE A O   1 
ATOM   174   C  CB  . ILE A  1 24  ? -7.760  63.985   114.141 1.00 16.81 ? 106  ILE A CB  1 
ATOM   175   C  CG1 . ILE A  1 24  ? -6.923  65.053   113.422 1.00 17.61 ? 106  ILE A CG1 1 
ATOM   176   C  CG2 . ILE A  1 24  ? -7.533  64.099   115.647 1.00 14.55 ? 106  ILE A CG2 1 
ATOM   177   C  CD1 . ILE A  1 24  ? -7.301  66.482   113.743 1.00 18.85 ? 106  ILE A CD1 1 
ATOM   178   N  N   . ARG A  1 25  ? -9.209  61.094   114.055 1.00 16.59 ? 107  ARG A N   1 
ATOM   179   C  CA  . ARG A  1 25  ? -9.886  59.993   114.744 1.00 16.28 ? 107  ARG A CA  1 
ATOM   180   C  C   . ARG A  1 25  ? -9.005  58.739   114.621 1.00 14.77 ? 107  ARG A C   1 
ATOM   181   O  O   . ARG A  1 25  ? -8.765  58.038   115.597 1.00 13.20 ? 107  ARG A O   1 
ATOM   182   C  CB  . ARG A  1 25  ? -11.260 59.716   114.104 1.00 17.22 ? 107  ARG A CB  1 
ATOM   183   C  CG  . ARG A  1 25  ? -12.341 60.713   114.488 1.00 16.29 ? 107  ARG A CG  1 
ATOM   184   C  CD  . ARG A  1 25  ? -13.506 60.630   113.542 1.00 18.06 ? 107  ARG A CD  1 
ATOM   185   N  NE  . ARG A  1 25  ? -14.174 59.333   113.562 1.00 22.34 ? 107  ARG A NE  1 
ATOM   186   C  CZ  . ARG A  1 25  ? -14.918 58.889   114.572 1.00 22.68 ? 107  ARG A CZ  1 
ATOM   187   N  NH1 . ARG A  1 25  ? -15.494 57.696   114.503 1.00 21.87 ? 107  ARG A NH1 1 
ATOM   188   N  NH2 . ARG A  1 25  ? -15.080 59.638   115.653 1.00 22.67 ? 107  ARG A NH2 1 
ATOM   189   N  N   . ILE A  1 26  ? -8.516  58.493   113.407 1.00 13.49 ? 108  ILE A N   1 
ATOM   190   C  CA  . ILE A  1 26  ? -7.676  57.347   113.088 1.00 12.96 ? 108  ILE A CA  1 
ATOM   191   C  C   . ILE A  1 26  ? -6.312  57.456   113.741 1.00 14.26 ? 108  ILE A C   1 
ATOM   192   O  O   . ILE A  1 26  ? -5.694  56.450   114.112 1.00 11.58 ? 108  ILE A O   1 
ATOM   193   C  CB  . ILE A  1 26  ? -7.480  57.241   111.560 1.00 12.27 ? 108  ILE A CB  1 
ATOM   194   C  CG1 . ILE A  1 26  ? -8.838  57.054   110.869 1.00 11.30 ? 108  ILE A CG1 1 
ATOM   195   C  CG2 . ILE A  1 26  ? -6.546  56.095   111.223 1.00 10.58 ? 108  ILE A CG2 1 
ATOM   196   C  CD1 . ILE A  1 26  ? -8.756  57.104   109.368 1.00 8.55  ? 108  ILE A CD1 1 
ATOM   197   N  N   . GLY A  1 27  ? -5.840  58.689   113.869 1.00 15.95 ? 109  GLY A N   1 
ATOM   198   C  CA  . GLY A  1 27  ? -4.537  58.920   114.462 1.00 17.69 ? 109  GLY A CA  1 
ATOM   199   C  C   . GLY A  1 27  ? -4.490  58.529   115.921 1.00 18.52 ? 109  GLY A C   1 
ATOM   200   O  O   . GLY A  1 27  ? -3.416  58.401   116.509 1.00 18.99 ? 109  GLY A O   1 
ATOM   201   N  N   . SER A  1 28  ? -5.661  58.345   116.515 1.00 20.00 ? 110  SER A N   1 
ATOM   202   C  CA  . SER A  1 28  ? -5.725  57.963   117.913 1.00 21.42 ? 110  SER A CA  1 
ATOM   203   C  C   . SER A  1 28  ? -4.942  56.670   118.131 1.00 21.48 ? 110  SER A C   1 
ATOM   204   O  O   . SER A  1 28  ? -4.299  56.497   119.161 1.00 22.37 ? 110  SER A O   1 
ATOM   205   C  CB  . SER A  1 28  ? -7.175  57.781   118.345 1.00 20.79 ? 110  SER A CB  1 
ATOM   206   O  OG  . SER A  1 28  ? -7.235  57.508   119.730 1.00 23.01 ? 110  SER A OG  1 
ATOM   207   N  N   . LYS A  1 29  ? -4.992  55.767   117.154 1.00 21.64 ? 111  LYS A N   1 
ATOM   208   C  CA  . LYS A  1 29  ? -4.266  54.505   117.250 1.00 21.80 ? 111  LYS A CA  1 
ATOM   209   C  C   . LYS A  1 29  ? -3.343  54.316   116.053 1.00 22.17 ? 111  LYS A C   1 
ATOM   210   O  O   . LYS A  1 29  ? -2.216  53.847   116.193 1.00 22.40 ? 111  LYS A O   1 
ATOM   211   C  CB  . LYS A  1 29  ? -5.241  53.328   117.320 1.00 21.76 ? 111  LYS A CB  1 
ATOM   212   C  CG  . LYS A  1 29  ? -4.563  51.957   117.344 1.00 21.15 ? 111  LYS A CG  1 
ATOM   213   C  CD  . LYS A  1 29  ? -5.600  50.846   117.409 1.00 23.75 ? 111  LYS A CD  1 
ATOM   214   C  CE  . LYS A  1 29  ? -4.984  49.455   117.530 1.00 23.29 ? 111  LYS A CE  1 
ATOM   215   N  NZ  . LYS A  1 29  ? -4.369  48.995   116.263 1.00 24.78 ? 111  LYS A NZ  1 
ATOM   216   N  N   . GLY A  1 30  ? -3.832  54.673   114.871 1.00 22.69 ? 112  GLY A N   1 
ATOM   217   C  CA  . GLY A  1 30  ? -3.033  54.523   113.671 1.00 22.27 ? 112  GLY A CA  1 
ATOM   218   C  C   . GLY A  1 30  ? -1.786  55.389   113.673 1.00 22.29 ? 112  GLY A C   1 
ATOM   219   O  O   . GLY A  1 30  ? -1.576  56.202   114.576 1.00 24.18 ? 112  GLY A O   1 
ATOM   220   N  N   . ASP A  1 31  ? -0.948  55.206   112.660 1.00 20.87 ? 113  ASP A N   1 
ATOM   221   C  CA  . ASP A  1 31  ? 0.270   55.982   112.533 1.00 20.16 ? 113  ASP A CA  1 
ATOM   222   C  C   . ASP A  1 31  ? 0.010   57.112   111.550 1.00 19.44 ? 113  ASP A C   1 
ATOM   223   O  O   . ASP A  1 31  ? 0.416   57.078   110.404 1.00 20.44 ? 113  ASP A O   1 
ATOM   224   C  CB  . ASP A  1 31  ? 1.423   55.093   112.057 1.00 21.06 ? 113  ASP A CB  1 
ATOM   225   C  CG  . ASP A  1 31  ? 1.804   54.046   113.088 1.00 22.90 ? 113  ASP A CG  1 
ATOM   226   O  OD1 . ASP A  1 31  ? 1.378   54.200   114.258 1.00 22.85 ? 113  ASP A OD1 1 
ATOM   227   O  OD2 . ASP A  1 31  ? 2.530   53.086   112.740 1.00 22.23 ? 113  ASP A OD2 1 
ATOM   228   N  N   . VAL A  1 32  ? -0.691  58.126   112.023 1.00 18.54 ? 114  VAL A N   1 
ATOM   229   C  CA  . VAL A  1 32  ? -1.022  59.271   111.200 1.00 19.13 ? 114  VAL A CA  1 
ATOM   230   C  C   . VAL A  1 32  ? -0.136  60.477   111.508 1.00 19.54 ? 114  VAL A C   1 
ATOM   231   O  O   . VAL A  1 32  ? 0.148   60.769   112.671 1.00 20.44 ? 114  VAL A O   1 
ATOM   232   C  CB  . VAL A  1 32  ? -2.479  59.665   111.432 1.00 18.20 ? 114  VAL A CB  1 
ATOM   233   C  CG1 . VAL A  1 32  ? -2.806  60.932   110.671 1.00 17.01 ? 114  VAL A CG1 1 
ATOM   234   C  CG2 . VAL A  1 32  ? -3.384  58.513   111.015 1.00 18.24 ? 114  VAL A CG2 1 
ATOM   235   N  N   . PHE A  1 33  ? 0.301   61.177   110.465 1.00 18.19 ? 115  PHE A N   1 
ATOM   236   C  CA  . PHE A  1 33  ? 1.130   62.361   110.658 1.00 16.92 ? 115  PHE A CA  1 
ATOM   237   C  C   . PHE A  1 33  ? 0.295   63.452   111.309 1.00 17.58 ? 115  PHE A C   1 
ATOM   238   O  O   . PHE A  1 33  ? -0.909  63.534   111.081 1.00 16.61 ? 115  PHE A O   1 
ATOM   239   C  CB  . PHE A  1 33  ? 1.630   62.905   109.315 1.00 13.90 ? 115  PHE A CB  1 
ATOM   240   C  CG  . PHE A  1 33  ? 2.826   62.199   108.776 1.00 13.78 ? 115  PHE A CG  1 
ATOM   241   C  CD1 . PHE A  1 33  ? 2.814   61.674   107.492 1.00 13.85 ? 115  PHE A CD1 1 
ATOM   242   C  CD2 . PHE A  1 33  ? 3.976   62.071   109.543 1.00 14.53 ? 115  PHE A CD2 1 
ATOM   243   C  CE1 . PHE A  1 33  ? 3.936   61.025   106.978 1.00 14.66 ? 115  PHE A CE1 1 
ATOM   244   C  CE2 . PHE A  1 33  ? 5.102   61.425   109.040 1.00 14.18 ? 115  PHE A CE2 1 
ATOM   245   C  CZ  . PHE A  1 33  ? 5.082   60.902   107.754 1.00 14.36 ? 115  PHE A CZ  1 
ATOM   246   N  N   . VAL A  1 34  ? 0.930   64.270   112.142 1.00 18.18 ? 116  VAL A N   1 
ATOM   247   C  CA  . VAL A  1 34  ? 0.244   65.405   112.730 1.00 19.63 ? 116  VAL A CA  1 
ATOM   248   C  C   . VAL A  1 34  ? 0.486   66.422   111.609 1.00 19.51 ? 116  VAL A C   1 
ATOM   249   O  O   . VAL A  1 34  ? 1.630   66.649   111.223 1.00 18.76 ? 116  VAL A O   1 
ATOM   250   C  CB  . VAL A  1 34  ? 0.909   65.845   114.037 1.00 20.33 ? 116  VAL A CB  1 
ATOM   251   C  CG1 . VAL A  1 34  ? 2.395   65.693   113.929 1.00 24.22 ? 116  VAL A CG1 1 
ATOM   252   C  CG2 . VAL A  1 34  ? 0.556   67.291   114.335 1.00 22.03 ? 116  VAL A CG2 1 
ATOM   253   N  N   . ILE A  1 35  ? -0.573  67.018   111.068 1.00 19.14 ? 117  ILE A N   1 
ATOM   254   C  CA  . ILE A  1 35  ? -0.390  67.920   109.938 1.00 18.39 ? 117  ILE A CA  1 
ATOM   255   C  C   . ILE A  1 35  ? -1.112  69.251   109.956 1.00 18.79 ? 117  ILE A C   1 
ATOM   256   O  O   . ILE A  1 35  ? -1.914  69.530   110.834 1.00 20.58 ? 117  ILE A O   1 
ATOM   257   C  CB  . ILE A  1 35  ? -0.808  67.229   108.638 1.00 18.50 ? 117  ILE A CB  1 
ATOM   258   C  CG1 . ILE A  1 35  ? -2.333  67.235   108.526 1.00 18.46 ? 117  ILE A CG1 1 
ATOM   259   C  CG2 . ILE A  1 35  ? -0.290  65.797   108.618 1.00 16.78 ? 117  ILE A CG2 1 
ATOM   260   C  CD1 . ILE A  1 35  ? -2.854  66.608   107.253 1.00 21.64 ? 117  ILE A CD1 1 
ATOM   261   N  N   . ARG A  1 36  ? -0.811  70.060   108.947 1.00 18.32 ? 118  ARG A N   1 
ATOM   262   C  CA  . ARG A  1 36  ? -1.415  71.370   108.762 1.00 19.59 ? 118  ARG A CA  1 
ATOM   263   C  C   . ARG A  1 36  ? -1.626  71.609   107.267 1.00 19.77 ? 118  ARG A C   1 
ATOM   264   O  O   . ARG A  1 36  ? -0.923  71.045   106.432 1.00 19.82 ? 118  ARG A O   1 
ATOM   265   C  CB  . ARG A  1 36  ? -0.518  72.481   109.326 1.00 21.32 ? 118  ARG A CB  1 
ATOM   266   C  CG  . ARG A  1 36  ? -0.539  72.643   110.853 1.00 21.97 ? 118  ARG A CG  1 
ATOM   267   C  CD  . ARG A  1 36  ? -1.965  72.660   111.424 1.00 23.46 ? 118  ARG A CD  1 
ATOM   268   N  NE  . ARG A  1 36  ? -2.848  73.616   110.752 1.00 23.73 ? 118  ARG A NE  1 
ATOM   269   C  CZ  . ARG A  1 36  ? -2.817  74.937   110.927 1.00 24.31 ? 118  ARG A CZ  1 
ATOM   270   N  NH1 . ARG A  1 36  ? -3.667  75.719   110.261 1.00 23.62 ? 118  ARG A NH1 1 
ATOM   271   N  NH2 . ARG A  1 36  ? -1.950  75.478   111.777 1.00 23.03 ? 118  ARG A NH2 1 
ATOM   272   N  N   . GLU A  1 37  ? -2.600  72.447   106.939 1.00 20.91 ? 119  GLU A N   1 
ATOM   273   C  CA  . GLU A  1 37  ? -2.922  72.788   105.556 1.00 22.36 ? 119  GLU A CA  1 
ATOM   274   C  C   . GLU A  1 37  ? -2.870  71.638   104.557 1.00 21.01 ? 119  GLU A C   1 
ATOM   275   O  O   . GLU A  1 37  ? -1.955  71.551   103.733 1.00 20.60 ? 119  GLU A O   1 
ATOM   276   C  CB  . GLU A  1 37  ? -2.013  73.919   105.060 1.00 24.69 ? 119  GLU A CB  1 
ATOM   277   C  CG  . GLU A  1 37  ? -0.541  73.674   105.302 1.00 29.68 ? 119  GLU A CG  1 
ATOM   278   C  CD  . GLU A  1 37  ? 0.335   74.724   104.665 1.00 34.06 ? 119  GLU A CD  1 
ATOM   279   O  OE1 . GLU A  1 37  ? 0.821   74.491   103.527 1.00 35.25 ? 119  GLU A OE1 1 
ATOM   280   O  OE2 . GLU A  1 37  ? 0.522   75.787   105.303 1.00 35.26 ? 119  GLU A OE2 1 
ATOM   281   N  N   . PRO A  1 38  ? -3.853  70.733   104.621 1.00 20.23 ? 120  PRO A N   1 
ATOM   282   C  CA  . PRO A  1 38  ? -3.939  69.584   103.716 1.00 19.14 ? 120  PRO A CA  1 
ATOM   283   C  C   . PRO A  1 38  ? -4.707  70.033   102.477 1.00 19.70 ? 120  PRO A C   1 
ATOM   284   O  O   . PRO A  1 38  ? -5.886  69.709   102.314 1.00 21.75 ? 120  PRO A O   1 
ATOM   285   C  CB  . PRO A  1 38  ? -4.725  68.579   104.530 1.00 18.67 ? 120  PRO A CB  1 
ATOM   286   C  CG  . PRO A  1 38  ? -5.711  69.460   105.233 1.00 19.47 ? 120  PRO A CG  1 
ATOM   287   C  CD  . PRO A  1 38  ? -4.846  70.619   105.705 1.00 20.93 ? 120  PRO A CD  1 
ATOM   288   N  N   . PHE A  1 39  ? -4.055  70.809   101.621 1.00 18.51 ? 121  PHE A N   1 
ATOM   289   C  CA  . PHE A  1 39  ? -4.714  71.293   100.421 1.00 18.11 ? 121  PHE A CA  1 
ATOM   290   C  C   . PHE A  1 39  ? -4.711  70.225   99.345  1.00 18.28 ? 121  PHE A C   1 
ATOM   291   O  O   . PHE A  1 39  ? -3.790  69.413   99.264  1.00 19.49 ? 121  PHE A O   1 
ATOM   292   C  CB  . PHE A  1 39  ? -4.033  72.565   99.909  1.00 15.61 ? 121  PHE A CB  1 
ATOM   293   C  CG  . PHE A  1 39  ? -2.618  72.363   99.429  1.00 16.24 ? 121  PHE A CG  1 
ATOM   294   C  CD1 . PHE A  1 39  ? -2.356  72.029   98.101  1.00 15.53 ? 121  PHE A CD1 1 
ATOM   295   C  CD2 . PHE A  1 39  ? -1.543  72.565   100.293 1.00 14.83 ? 121  PHE A CD2 1 
ATOM   296   C  CE1 . PHE A  1 39  ? -1.044  71.911   97.637  1.00 15.00 ? 121  PHE A CE1 1 
ATOM   297   C  CE2 . PHE A  1 39  ? -0.233  72.447   99.845  1.00 14.73 ? 121  PHE A CE2 1 
ATOM   298   C  CZ  . PHE A  1 39  ? 0.020   72.121   98.515  1.00 15.59 ? 121  PHE A CZ  1 
ATOM   299   N  N   . ILE A  1 40  ? -5.747  70.233   98.517  1.00 17.26 ? 122  ILE A N   1 
ATOM   300   C  CA  . ILE A  1 40  ? -5.867  69.260   97.446  1.00 15.67 ? 122  ILE A CA  1 
ATOM   301   C  C   . ILE A  1 40  ? -5.452  69.856   96.109  1.00 15.65 ? 122  ILE A C   1 
ATOM   302   O  O   . ILE A  1 40  ? -5.507  71.065   95.919  1.00 16.70 ? 122  ILE A O   1 
ATOM   303   C  CB  . ILE A  1 40  ? -7.325  68.733   97.362  1.00 14.18 ? 122  ILE A CB  1 
ATOM   304   C  CG1 . ILE A  1 40  ? -7.647  67.958   98.644  1.00 11.58 ? 122  ILE A CG1 1 
ATOM   305   C  CG2 . ILE A  1 40  ? -7.511  67.871   96.117  1.00 11.08 ? 122  ILE A CG2 1 
ATOM   306   C  CD1 . ILE A  1 40  ? -9.061  67.458   98.754  1.00 12.43 ? 122  ILE A CD1 1 
ATOM   307   N  N   . SER A  1 41  ? -5.001  69.002   95.198  1.00 16.18 ? 123  SER A N   1 
ATOM   308   C  CA  . SER A  1 41  ? -4.599  69.427   93.862  1.00 16.59 ? 123  SER A CA  1 
ATOM   309   C  C   . SER A  1 41  ? -4.738  68.200   92.990  1.00 16.50 ? 123  SER A C   1 
ATOM   310   O  O   . SER A  1 41  ? -4.505  67.093   93.456  1.00 18.37 ? 123  SER A O   1 
ATOM   311   C  CB  . SER A  1 41  ? -3.152  69.923   93.851  1.00 16.79 ? 123  SER A CB  1 
ATOM   312   O  OG  . SER A  1 41  ? -2.786  70.356   92.554  1.00 17.05 ? 123  SER A OG  1 
ATOM   313   N  N   . CYS A  1 42  ? -5.117  68.384   91.733  1.00 17.36 ? 124  CYS A N   1 
ATOM   314   C  CA  . CYS A  1 42  ? -5.307  67.250   90.842  1.00 19.22 ? 124  CYS A CA  1 
ATOM   315   C  C   . CYS A  1 42  ? -4.470  67.345   89.589  1.00 19.06 ? 124  CYS A C   1 
ATOM   316   O  O   . CYS A  1 42  ? -4.022  68.414   89.209  1.00 18.84 ? 124  CYS A O   1 
ATOM   317   C  CB  . CYS A  1 42  ? -6.769  67.147   90.420  1.00 21.24 ? 124  CYS A CB  1 
ATOM   318   S  SG  . CYS A  1 42  ? -7.986  67.265   91.766  1.00 29.72 ? 124  CYS A SG  1 
ATOM   319   N  N   . SER A  1 43  ? -4.270  66.202   88.952  1.00 20.23 ? 125  SER A N   1 
ATOM   320   C  CA  . SER A  1 43  ? -3.522  66.117   87.713  1.00 21.54 ? 125  SER A CA  1 
ATOM   321   C  C   . SER A  1 43  ? -4.569  65.752   86.679  1.00 22.69 ? 125  SER A C   1 
ATOM   322   O  O   . SER A  1 43  ? -5.757  65.973   86.899  1.00 23.56 ? 125  SER A O   1 
ATOM   323   C  CB  . SER A  1 43  ? -2.495  65.005   87.801  1.00 21.10 ? 125  SER A CB  1 
ATOM   324   O  OG  . SER A  1 43  ? -3.152  63.774   88.003  1.00 23.32 ? 125  SER A OG  1 
ATOM   325   N  N   . HIS A  1 44  ? -4.150  65.180   85.560  1.00 23.29 ? 126  HIS A N   1 
ATOM   326   C  CA  . HIS A  1 44  ? -5.117  64.802   84.538  1.00 24.34 ? 126  HIS A CA  1 
ATOM   327   C  C   . HIS A  1 44  ? -5.671  63.413   84.841  1.00 24.66 ? 126  HIS A C   1 
ATOM   328   O  O   . HIS A  1 44  ? -6.585  62.946   84.162  1.00 26.08 ? 126  HIS A O   1 
ATOM   329   C  CB  . HIS A  1 44  ? -4.461  64.815   83.152  1.00 23.91 ? 126  HIS A CB  1 
ATOM   330   C  CG  . HIS A  1 44  ? -3.285  63.895   83.029  1.00 26.61 ? 126  HIS A CG  1 
ATOM   331   N  ND1 . HIS A  1 44  ? -2.172  63.990   83.838  1.00 26.17 ? 126  HIS A ND1 1 
ATOM   332   C  CD2 . HIS A  1 44  ? -3.046  62.859   82.186  1.00 25.89 ? 126  HIS A CD2 1 
ATOM   333   C  CE1 . HIS A  1 44  ? -1.300  63.056   83.502  1.00 26.42 ? 126  HIS A CE1 1 
ATOM   334   N  NE2 . HIS A  1 44  ? -1.809  62.355   82.501  1.00 27.00 ? 126  HIS A NE2 1 
ATOM   335   N  N   . LEU A  1 45  ? -5.128  62.770   85.873  1.00 23.63 ? 127  LEU A N   1 
ATOM   336   C  CA  . LEU A  1 45  ? -5.545  61.422   86.236  1.00 24.08 ? 127  LEU A CA  1 
ATOM   337   C  C   . LEU A  1 45  ? -6.050  61.189   87.658  1.00 25.60 ? 127  LEU A C   1 
ATOM   338   O  O   . LEU A  1 45  ? -6.874  60.301   87.880  1.00 25.77 ? 127  LEU A O   1 
ATOM   339   C  CB  . LEU A  1 45  ? -4.398  60.457   85.983  1.00 21.33 ? 127  LEU A CB  1 
ATOM   340   C  CG  . LEU A  1 45  ? -3.955  60.364   84.530  1.00 22.30 ? 127  LEU A CG  1 
ATOM   341   C  CD1 . LEU A  1 45  ? -2.664  59.559   84.429  1.00 21.21 ? 127  LEU A CD1 1 
ATOM   342   C  CD2 . LEU A  1 45  ? -5.065  59.730   83.714  1.00 18.88 ? 127  LEU A CD2 1 
ATOM   343   N  N   . GLU A  1 46  ? -5.559  61.963   88.619  1.00 25.46 ? 128  GLU A N   1 
ATOM   344   C  CA  . GLU A  1 46  ? -5.978  61.771   90.004  1.00 27.09 ? 128  GLU A CA  1 
ATOM   345   C  C   . GLU A  1 46  ? -5.864  63.054   90.823  1.00 26.02 ? 128  GLU A C   1 
ATOM   346   O  O   . GLU A  1 46  ? -5.357  64.065   90.346  1.00 27.09 ? 128  GLU A O   1 
ATOM   347   C  CB  . GLU A  1 46  ? -5.098  60.701   90.668  1.00 28.86 ? 128  GLU A CB  1 
ATOM   348   C  CG  . GLU A  1 46  ? -3.676  61.197   90.976  1.00 32.14 ? 128  GLU A CG  1 
ATOM   349   C  CD  . GLU A  1 46  ? -2.895  60.284   91.925  1.00 35.79 ? 128  GLU A CD  1 
ATOM   350   O  OE1 . GLU A  1 46  ? -3.505  59.685   92.847  1.00 36.08 ? 128  GLU A OE1 1 
ATOM   351   O  OE2 . GLU A  1 46  ? -1.656  60.187   91.765  1.00 37.45 ? 128  GLU A OE2 1 
ATOM   352   N  N   . CYS A  1 47  ? -6.347  62.999   92.058  1.00 23.31 ? 129  CYS A N   1 
ATOM   353   C  CA  . CYS A  1 47  ? -6.252  64.129   92.962  1.00 24.60 ? 129  CYS A CA  1 
ATOM   354   C  C   . CYS A  1 47  ? -5.495  63.651   94.191  1.00 22.95 ? 129  CYS A C   1 
ATOM   355   O  O   . CYS A  1 47  ? -5.693  62.539   94.681  1.00 22.96 ? 129  CYS A O   1 
ATOM   356   C  CB  . CYS A  1 47  ? -7.626  64.647   93.379  1.00 26.60 ? 129  CYS A CB  1 
ATOM   357   S  SG  . CYS A  1 47  ? -8.654  65.352   92.042  1.00 33.44 ? 129  CYS A SG  1 
ATOM   358   N  N   . ARG A  1 48  ? -4.610  64.496   94.683  1.00 20.68 ? 130  ARG A N   1 
ATOM   359   C  CA  . ARG A  1 48  ? -3.831  64.138   95.840  1.00 19.40 ? 130  ARG A CA  1 
ATOM   360   C  C   . ARG A  1 48  ? -3.971  65.221   96.884  1.00 19.32 ? 130  ARG A C   1 
ATOM   361   O  O   . ARG A  1 48  ? -4.262  66.379   96.564  1.00 19.28 ? 130  ARG A O   1 
ATOM   362   C  CB  . ARG A  1 48  ? -2.361  63.985   95.454  1.00 17.21 ? 130  ARG A CB  1 
ATOM   363   C  CG  . ARG A  1 48  ? -2.095  62.917   94.417  1.00 16.98 ? 130  ARG A CG  1 
ATOM   364   C  CD  . ARG A  1 48  ? -0.598  62.779   94.151  1.00 19.33 ? 130  ARG A CD  1 
ATOM   365   N  NE  . ARG A  1 48  ? 0.129   62.362   95.343  1.00 15.38 ? 130  ARG A NE  1 
ATOM   366   C  CZ  . ARG A  1 48  ? 0.131   61.123   95.814  1.00 15.94 ? 130  ARG A CZ  1 
ATOM   367   N  NH1 . ARG A  1 48  ? 0.816   60.828   96.915  1.00 16.64 ? 130  ARG A NH1 1 
ATOM   368   N  NH2 . ARG A  1 48  ? -0.533  60.174   95.173  1.00 14.18 ? 130  ARG A NH2 1 
ATOM   369   N  N   . THR A  1 49  ? -3.785  64.826   98.136  1.00 18.07 ? 131  THR A N   1 
ATOM   370   C  CA  . THR A  1 49  ? -3.832  65.758   99.240  1.00 17.55 ? 131  THR A CA  1 
ATOM   371   C  C   . THR A  1 49  ? -2.383  66.034   99.608  1.00 16.15 ? 131  THR A C   1 
ATOM   372   O  O   . THR A  1 49  ? -1.609  65.102   99.831  1.00 15.92 ? 131  THR A O   1 
ATOM   373   C  CB  . THR A  1 49  ? -4.537  65.152   100.476 1.00 18.25 ? 131  THR A CB  1 
ATOM   374   O  OG1 . THR A  1 49  ? -5.950  65.111   100.255 1.00 21.85 ? 131  THR A OG1 1 
ATOM   375   C  CG2 . THR A  1 49  ? -4.257  65.977   101.711 1.00 16.87 ? 131  THR A CG2 1 
ATOM   376   N  N   . PHE A  1 50  ? -2.005  67.306   99.627  1.00 16.20 ? 132  PHE A N   1 
ATOM   377   C  CA  . PHE A  1 50  ? -0.658  67.687   100.037 1.00 15.34 ? 132  PHE A CA  1 
ATOM   378   C  C   . PHE A  1 50  ? -0.817  68.267   101.423 1.00 16.72 ? 132  PHE A C   1 
ATOM   379   O  O   . PHE A  1 50  ? -1.872  68.813   101.757 1.00 18.55 ? 132  PHE A O   1 
ATOM   380   C  CB  . PHE A  1 50  ? -0.055  68.735   99.104  1.00 12.71 ? 132  PHE A CB  1 
ATOM   381   C  CG  . PHE A  1 50  ? 0.188   68.230   97.720  1.00 11.20 ? 132  PHE A CG  1 
ATOM   382   C  CD1 . PHE A  1 50  ? -0.878  68.013   96.855  1.00 11.46 ? 132  PHE A CD1 1 
ATOM   383   C  CD2 . PHE A  1 50  ? 1.469   67.919   97.294  1.00 9.50  ? 132  PHE A CD2 1 
ATOM   384   C  CE1 . PHE A  1 50  ? -0.670  67.484   95.575  1.00 11.12 ? 132  PHE A CE1 1 
ATOM   385   C  CE2 . PHE A  1 50  ? 1.689   67.389   96.020  1.00 11.27 ? 132  PHE A CE2 1 
ATOM   386   C  CZ  . PHE A  1 50  ? 0.613   67.173   95.158  1.00 10.22 ? 132  PHE A CZ  1 
ATOM   387   N  N   . PHE A  1 51  ? 0.224   68.154   102.231 1.00 17.44 ? 133  PHE A N   1 
ATOM   388   C  CA  . PHE A  1 51  ? 0.165   68.662   103.587 1.00 18.52 ? 133  PHE A CA  1 
ATOM   389   C  C   . PHE A  1 51  ? 1.574   68.860   104.109 1.00 18.27 ? 133  PHE A C   1 
ATOM   390   O  O   . PHE A  1 51  ? 2.525   68.366   103.519 1.00 18.61 ? 133  PHE A O   1 
ATOM   391   C  CB  . PHE A  1 51  ? -0.587  67.650   104.452 1.00 19.82 ? 133  PHE A CB  1 
ATOM   392   C  CG  . PHE A  1 51  ? -0.002  66.272   104.406 1.00 18.50 ? 133  PHE A CG  1 
ATOM   393   C  CD1 . PHE A  1 51  ? 1.018   65.907   105.278 1.00 18.66 ? 133  PHE A CD1 1 
ATOM   394   C  CD2 . PHE A  1 51  ? -0.438  65.351   103.461 1.00 19.13 ? 133  PHE A CD2 1 
ATOM   395   C  CE1 . PHE A  1 51  ? 1.603   64.639   105.212 1.00 17.49 ? 133  PHE A CE1 1 
ATOM   396   C  CE2 . PHE A  1 51  ? 0.136   64.079   103.382 1.00 19.46 ? 133  PHE A CE2 1 
ATOM   397   C  CZ  . PHE A  1 51  ? 1.162   63.725   104.263 1.00 19.00 ? 133  PHE A CZ  1 
ATOM   398   N  N   . LEU A  1 52  ? 1.704   69.578   105.217 1.00 19.00 ? 134  LEU A N   1 
ATOM   399   C  CA  . LEU A  1 52  ? 3.011   69.827   105.815 1.00 19.75 ? 134  LEU A CA  1 
ATOM   400   C  C   . LEU A  1 52  ? 3.065   69.114   107.146 1.00 21.63 ? 134  LEU A C   1 
ATOM   401   O  O   . LEU A  1 52  ? 2.107   69.165   107.908 1.00 23.08 ? 134  LEU A O   1 
ATOM   402   C  CB  . LEU A  1 52  ? 3.232   71.328   106.042 1.00 17.73 ? 134  LEU A CB  1 
ATOM   403   C  CG  . LEU A  1 52  ? 3.260   72.249   104.817 1.00 15.72 ? 134  LEU A CG  1 
ATOM   404   C  CD1 . LEU A  1 52  ? 3.475   73.685   105.272 1.00 16.72 ? 134  LEU A CD1 1 
ATOM   405   C  CD2 . LEU A  1 52  ? 4.365   71.840   103.879 1.00 13.42 ? 134  LEU A CD2 1 
ATOM   406   N  N   . THR A  1 53  ? 4.179   68.455   107.437 1.00 23.71 ? 135  THR A N   1 
ATOM   407   C  CA  . THR A  1 53  ? 4.307   67.751   108.707 1.00 26.27 ? 135  THR A CA  1 
ATOM   408   C  C   . THR A  1 53  ? 5.573   68.147   109.434 1.00 27.04 ? 135  THR A C   1 
ATOM   409   O  O   . THR A  1 53  ? 6.585   68.453   108.808 1.00 27.86 ? 135  THR A O   1 
ATOM   410   C  CB  . THR A  1 53  ? 4.383   66.240   108.511 1.00 27.64 ? 135  THR A CB  1 
ATOM   411   O  OG1 . THR A  1 53  ? 5.571   65.925   107.773 1.00 29.83 ? 135  THR A OG1 1 
ATOM   412   C  CG2 . THR A  1 53  ? 3.186   65.743   107.761 1.00 29.98 ? 135  THR A CG2 1 
ATOM   413   N  N   . GLN A  1 54  ? 5.511   68.125   110.759 1.00 28.60 ? 136  GLN A N   1 
ATOM   414   C  CA  . GLN A  1 54  ? 6.669   68.443   111.580 1.00 30.68 ? 136  GLN A CA  1 
ATOM   415   C  C   . GLN A  1 54  ? 7.485   67.162   111.682 1.00 28.47 ? 136  GLN A C   1 
ATOM   416   O  O   . GLN A  1 54  ? 8.564   67.132   112.272 1.00 30.48 ? 136  GLN A O   1 
ATOM   417   C  CB  . GLN A  1 54  ? 6.226   68.895   112.974 1.00 34.89 ? 136  GLN A CB  1 
ATOM   418   C  CG  . GLN A  1 54  ? 5.865   70.387   113.095 1.00 41.96 ? 136  GLN A CG  1 
ATOM   419   C  CD  . GLN A  1 54  ? 7.096   71.306   113.154 1.00 45.51 ? 136  GLN A CD  1 
ATOM   420   O  OE1 . GLN A  1 54  ? 8.030   71.075   113.936 1.00 45.71 ? 136  GLN A OE1 1 
ATOM   421   N  NE2 . GLN A  1 54  ? 7.089   72.359   112.337 1.00 46.69 ? 136  GLN A NE2 1 
ATOM   422   N  N   . GLY A  1 55  ? 6.957   66.101   111.091 1.00 25.57 ? 137  GLY A N   1 
ATOM   423   C  CA  . GLY A  1 55  ? 7.637   64.826   111.133 1.00 22.97 ? 137  GLY A CA  1 
ATOM   424   C  C   . GLY A  1 55  ? 7.383   64.113   112.444 1.00 22.04 ? 137  GLY A C   1 
ATOM   425   O  O   . GLY A  1 55  ? 8.302   63.583   113.065 1.00 23.38 ? 137  GLY A O   1 
ATOM   426   N  N   . ALA A  1 56  ? 6.128   64.107   112.872 1.00 19.96 ? 138  ALA A N   1 
ATOM   427   C  CA  . ALA A  1 56  ? 5.743   63.455   114.110 1.00 18.27 ? 138  ALA A CA  1 
ATOM   428   C  C   . ALA A  1 56  ? 4.398   62.776   113.914 1.00 17.45 ? 138  ALA A C   1 
ATOM   429   O  O   . ALA A  1 56  ? 3.612   63.173   113.063 1.00 18.40 ? 138  ALA A O   1 
ATOM   430   C  CB  . ALA A  1 56  ? 5.651   64.477   115.224 1.00 17.95 ? 138  ALA A CB  1 
ATOM   431   N  N   . LEU A  1 57  ? 4.129   61.743   114.693 1.00 17.84 ? 139  LEU A N   1 
ATOM   432   C  CA  . LEU A  1 57  ? 2.859   61.055   114.574 1.00 16.78 ? 139  LEU A CA  1 
ATOM   433   C  C   . LEU A  1 57  ? 1.941   61.453   115.715 1.00 17.19 ? 139  LEU A C   1 
ATOM   434   O  O   . LEU A  1 57  ? 2.408   61.859   116.788 1.00 16.57 ? 139  LEU A O   1 
ATOM   435   C  CB  . LEU A  1 57  ? 3.072   59.550   114.585 1.00 16.61 ? 139  LEU A CB  1 
ATOM   436   C  CG  . LEU A  1 57  ? 3.905   58.981   113.435 1.00 18.59 ? 139  LEU A CG  1 
ATOM   437   C  CD1 . LEU A  1 57  ? 3.950   57.468   113.557 1.00 16.74 ? 139  LEU A CD1 1 
ATOM   438   C  CD2 . LEU A  1 57  ? 3.301   59.387   112.096 1.00 18.98 ? 139  LEU A CD2 1 
ATOM   439   N  N   . LEU A  1 58  ? 0.636   61.354   115.478 1.00 15.98 ? 140  LEU A N   1 
ATOM   440   C  CA  . LEU A  1 58  ? -0.329  61.691   116.507 1.00 16.65 ? 140  LEU A CA  1 
ATOM   441   C  C   . LEU A  1 58  ? -0.149  60.747   117.693 1.00 17.82 ? 140  LEU A C   1 
ATOM   442   O  O   . LEU A  1 58  ? 0.253   59.599   117.535 1.00 15.12 ? 140  LEU A O   1 
ATOM   443   C  CB  . LEU A  1 58  ? -1.755  61.605   115.953 1.00 16.16 ? 140  LEU A CB  1 
ATOM   444   C  CG  . LEU A  1 58  ? -2.219  62.834   115.161 1.00 15.25 ? 140  LEU A CG  1 
ATOM   445   C  CD1 . LEU A  1 58  ? -3.498  62.516   114.421 1.00 17.52 ? 140  LEU A CD1 1 
ATOM   446   C  CD2 . LEU A  1 58  ? -2.429  63.997   116.110 1.00 12.32 ? 140  LEU A CD2 1 
ATOM   447   N  N   . ASN A  1 59  ? -0.449  61.255   118.883 1.00 20.29 ? 141  ASN A N   1 
ATOM   448   C  CA  . ASN A  1 59  ? -0.303  60.503   120.123 1.00 20.40 ? 141  ASN A CA  1 
ATOM   449   C  C   . ASN A  1 59  ? 1.153   60.120   120.408 1.00 19.48 ? 141  ASN A C   1 
ATOM   450   O  O   . ASN A  1 59  ? 1.426   59.100   121.024 1.00 18.86 ? 141  ASN A O   1 
ATOM   451   C  CB  . ASN A  1 59  ? -1.179  59.250   120.117 1.00 20.53 ? 141  ASN A CB  1 
ATOM   452   C  CG  . ASN A  1 59  ? -2.146  59.227   121.281 1.00 23.08 ? 141  ASN A CG  1 
ATOM   453   O  OD1 . ASN A  1 59  ? -1.877  59.813   122.330 1.00 24.88 ? 141  ASN A OD1 1 
ATOM   454   N  ND2 . ASN A  1 59  ? -3.275  58.545   121.110 1.00 23.97 ? 141  ASN A ND2 1 
ATOM   455   N  N   . ASP A  1 60  ? 2.091   60.929   119.939 1.00 18.84 ? 142  ASP A N   1 
ATOM   456   C  CA  . ASP A  1 60  ? 3.492   60.662   120.213 1.00 20.11 ? 142  ASP A CA  1 
ATOM   457   C  C   . ASP A  1 60  ? 4.087   61.917   120.831 1.00 19.31 ? 142  ASP A C   1 
ATOM   458   O  O   . ASP A  1 60  ? 3.674   63.024   120.502 1.00 18.23 ? 142  ASP A O   1 
ATOM   459   C  CB  . ASP A  1 60  ? 4.262   60.310   118.948 1.00 22.22 ? 142  ASP A CB  1 
ATOM   460   C  CG  . ASP A  1 60  ? 5.720   59.989   119.238 1.00 26.20 ? 142  ASP A CG  1 
ATOM   461   O  OD1 . ASP A  1 60  ? 5.981   58.951   119.886 1.00 25.45 ? 142  ASP A OD1 1 
ATOM   462   O  OD2 . ASP A  1 60  ? 6.604   60.782   118.833 1.00 29.32 ? 142  ASP A OD2 1 
ATOM   463   N  N   . LYS A  1 61  ? 5.054   61.745   121.723 1.00 18.51 ? 143  LYS A N   1 
ATOM   464   C  CA  . LYS A  1 61  ? 5.667   62.887   122.385 1.00 18.32 ? 143  LYS A CA  1 
ATOM   465   C  C   . LYS A  1 61  ? 6.211   63.937   121.417 1.00 19.38 ? 143  LYS A C   1 
ATOM   466   O  O   . LYS A  1 61  ? 6.280   65.112   121.758 1.00 20.70 ? 143  LYS A O   1 
ATOM   467   C  CB  . LYS A  1 61  ? 6.783   62.416   123.324 1.00 14.76 ? 143  LYS A CB  1 
ATOM   468   C  CG  . LYS A  1 61  ? 8.003   61.855   122.627 1.00 12.76 ? 143  LYS A CG  1 
ATOM   469   C  CD  . LYS A  1 61  ? 9.026   61.393   123.641 1.00 10.29 ? 143  LYS A CD  1 
ATOM   470   C  CE  . LYS A  1 61  ? 10.339  61.067   122.981 1.00 11.35 ? 143  LYS A CE  1 
ATOM   471   N  NZ  . LYS A  1 61  ? 11.421  60.863   123.981 1.00 14.36 ? 143  LYS A NZ  1 
ATOM   472   N  N   . HIS A  1 62  ? 6.582   63.525   120.209 1.00 21.98 ? 144  HIS A N   1 
ATOM   473   C  CA  . HIS A  1 62  ? 7.139   64.462   119.233 1.00 22.44 ? 144  HIS A CA  1 
ATOM   474   C  C   . HIS A  1 62  ? 6.121   65.404   118.598 1.00 23.05 ? 144  HIS A C   1 
ATOM   475   O  O   . HIS A  1 62  ? 6.482   66.319   117.859 1.00 23.22 ? 144  HIS A O   1 
ATOM   476   C  CB  . HIS A  1 62  ? 7.879   63.692   118.144 1.00 24.46 ? 144  HIS A CB  1 
ATOM   477   C  CG  . HIS A  1 62  ? 9.113   63.006   118.630 1.00 26.14 ? 144  HIS A CG  1 
ATOM   478   N  ND1 . HIS A  1 62  ? 10.269  63.685   118.943 1.00 27.47 ? 144  HIS A ND1 1 
ATOM   479   C  CD2 . HIS A  1 62  ? 9.364   61.700   118.892 1.00 26.93 ? 144  HIS A CD2 1 
ATOM   480   C  CE1 . HIS A  1 62  ? 11.179  62.831   119.378 1.00 26.77 ? 144  HIS A CE1 1 
ATOM   481   N  NE2 . HIS A  1 62  ? 10.652  61.619   119.355 1.00 26.41 ? 144  HIS A NE2 1 
ATOM   482   N  N   . SER A  1 63  ? 4.846   65.178   118.870 1.00 23.80 ? 145  SER A N   1 
ATOM   483   C  CA  . SER A  1 63  ? 3.821   66.049   118.332 1.00 25.19 ? 145  SER A CA  1 
ATOM   484   C  C   . SER A  1 63  ? 3.679   67.201   119.320 1.00 28.11 ? 145  SER A C   1 
ATOM   485   O  O   . SER A  1 63  ? 2.680   67.907   119.310 1.00 29.66 ? 145  SER A O   1 
ATOM   486   C  CB  . SER A  1 63  ? 2.492   65.309   118.219 1.00 23.65 ? 145  SER A CB  1 
ATOM   487   O  OG  . SER A  1 63  ? 1.903   65.127   119.496 1.00 19.93 ? 145  SER A OG  1 
ATOM   488   N  N   . ASN A  1 64  ? 4.696   67.379   120.162 1.00 32.07 ? 146  ASN A N   1 
ATOM   489   C  CA  . ASN A  1 64  ? 4.726   68.416   121.198 1.00 36.57 ? 146  ASN A CA  1 
ATOM   490   C  C   . ASN A  1 64  ? 4.274   69.817   120.751 1.00 39.26 ? 146  ASN A C   1 
ATOM   491   O  O   . ASN A  1 64  ? 3.884   70.639   121.572 1.00 41.23 ? 146  ASN A O   1 
ATOM   492   C  CB  . ASN A  1 64  ? 6.130   68.487   121.807 1.00 39.28 ? 146  ASN A CB  1 
ATOM   493   C  CG  . ASN A  1 64  ? 6.127   69.049   123.217 1.00 40.91 ? 146  ASN A CG  1 
ATOM   494   O  OD1 . ASN A  1 64  ? 5.732   70.189   123.443 1.00 41.73 ? 146  ASN A OD1 1 
ATOM   495   N  ND2 . ASN A  1 64  ? 6.574   68.244   124.174 1.00 43.51 ? 146  ASN A ND2 1 
ATOM   496   N  N   . GLY A  1 65  ? 4.347   70.108   119.462 1.00 40.68 ? 147  GLY A N   1 
ATOM   497   C  CA  . GLY A  1 65  ? 3.874   71.393   118.977 1.00 43.54 ? 147  GLY A CA  1 
ATOM   498   C  C   . GLY A  1 65  ? 4.326   72.720   119.578 1.00 46.28 ? 147  GLY A C   1 
ATOM   499   O  O   . GLY A  1 65  ? 3.846   73.771   119.144 1.00 47.67 ? 147  GLY A O   1 
ATOM   500   N  N   . THR A  1 66  ? 5.207   72.729   120.569 1.00 47.35 ? 148  THR A N   1 
ATOM   501   C  CA  . THR A  1 66  ? 5.649   74.025   121.078 1.00 49.32 ? 148  THR A CA  1 
ATOM   502   C  C   . THR A  1 66  ? 6.723   74.553   120.126 1.00 49.12 ? 148  THR A C   1 
ATOM   503   O  O   . THR A  1 66  ? 7.188   75.681   120.256 1.00 50.40 ? 148  THR A O   1 
ATOM   504   C  CB  . THR A  1 66  ? 6.241   73.941   122.501 1.00 50.26 ? 148  THR A CB  1 
ATOM   505   O  OG1 . THR A  1 66  ? 7.289   72.962   122.528 1.00 53.44 ? 148  THR A OG1 1 
ATOM   506   C  CG2 . THR A  1 66  ? 5.157   73.591   123.510 1.00 49.13 ? 148  THR A CG2 1 
ATOM   507   N  N   . VAL A  1 67  ? 7.097   73.724   119.159 1.00 49.12 ? 149  VAL A N   1 
ATOM   508   C  CA  . VAL A  1 67  ? 8.104   74.076   118.163 1.00 48.81 ? 149  VAL A CA  1 
ATOM   509   C  C   . VAL A  1 67  ? 7.667   75.264   117.306 1.00 47.64 ? 149  VAL A C   1 
ATOM   510   O  O   . VAL A  1 67  ? 6.482   75.483   117.081 1.00 47.87 ? 149  VAL A O   1 
ATOM   511   C  CB  . VAL A  1 67  ? 8.382   72.881   117.205 1.00 49.23 ? 149  VAL A CB  1 
ATOM   512   C  CG1 . VAL A  1 67  ? 9.556   73.202   116.286 1.00 50.09 ? 149  VAL A CG1 1 
ATOM   513   C  CG2 . VAL A  1 67  ? 8.667   71.619   118.006 1.00 49.64 ? 149  VAL A CG2 1 
ATOM   514   N  N   . LYS A  1 68  ? 8.642   76.032   116.836 1.00 47.18 ? 150  LYS A N   1 
ATOM   515   C  CA  . LYS A  1 68  ? 8.388   77.173   115.966 1.00 45.61 ? 150  LYS A CA  1 
ATOM   516   C  C   . LYS A  1 68  ? 7.636   76.642   114.744 1.00 43.71 ? 150  LYS A C   1 
ATOM   517   O  O   . LYS A  1 68  ? 7.891   75.520   114.302 1.00 43.58 ? 150  LYS A O   1 
ATOM   518   C  CB  . LYS A  1 68  ? 9.725   77.783   115.525 1.00 47.44 ? 150  LYS A CB  1 
ATOM   519   C  CG  . LYS A  1 68  ? 10.822  76.722   115.331 1.00 50.48 ? 150  LYS A CG  1 
ATOM   520   C  CD  . LYS A  1 68  ? 11.862  77.087   114.274 1.00 52.90 ? 150  LYS A CD  1 
ATOM   521   C  CE  . LYS A  1 68  ? 12.716  78.280   114.674 1.00 54.73 ? 150  LYS A CE  1 
ATOM   522   N  NZ  . LYS A  1 68  ? 13.728  78.581   113.611 1.00 55.28 ? 150  LYS A NZ  1 
ATOM   523   N  N   . ASP A  1 69  ? 6.710   77.432   114.204 1.00 41.54 ? 151  ASP A N   1 
ATOM   524   C  CA  . ASP A  1 69  ? 5.945   77.020   113.025 1.00 38.70 ? 151  ASP A CA  1 
ATOM   525   C  C   . ASP A  1 69  ? 6.888   76.589   111.910 1.00 35.39 ? 151  ASP A C   1 
ATOM   526   O  O   . ASP A  1 69  ? 6.728   75.527   111.310 1.00 33.81 ? 151  ASP A O   1 
ATOM   527   C  CB  . ASP A  1 69  ? 5.079   78.175   112.519 1.00 42.33 ? 151  ASP A CB  1 
ATOM   528   C  CG  . ASP A  1 69  ? 3.831   78.383   113.355 1.00 46.10 ? 151  ASP A CG  1 
ATOM   529   O  OD1 . ASP A  1 69  ? 2.905   77.544   113.244 1.00 49.41 ? 151  ASP A OD1 1 
ATOM   530   O  OD2 . ASP A  1 69  ? 3.776   79.375   114.122 1.00 45.31 ? 151  ASP A OD2 1 
ATOM   531   N  N   . ARG A  1 70  ? 7.876   77.434   111.651 1.00 31.99 ? 152  ARG A N   1 
ATOM   532   C  CA  . ARG A  1 70  ? 8.862   77.197   110.611 1.00 29.32 ? 152  ARG A CA  1 
ATOM   533   C  C   . ARG A  1 70  ? 10.089  76.490   111.172 1.00 28.17 ? 152  ARG A C   1 
ATOM   534   O  O   . ARG A  1 70  ? 11.108  77.129   111.446 1.00 28.70 ? 152  ARG A O   1 
ATOM   535   C  CB  . ARG A  1 70  ? 9.287   78.533   109.981 1.00 27.89 ? 152  ARG A CB  1 
ATOM   536   C  CG  . ARG A  1 70  ? 8.159   79.333   109.336 1.00 23.85 ? 152  ARG A CG  1 
ATOM   537   C  CD  . ARG A  1 70  ? 8.661   80.674   108.816 1.00 22.20 ? 152  ARG A CD  1 
ATOM   538   N  NE  . ARG A  1 70  ? 9.001   81.616   109.884 1.00 21.66 ? 152  ARG A NE  1 
ATOM   539   C  CZ  . ARG A  1 70  ? 8.113   82.191   110.696 1.00 21.33 ? 152  ARG A CZ  1 
ATOM   540   N  NH1 . ARG A  1 70  ? 8.522   83.031   111.631 1.00 20.05 ? 152  ARG A NH1 1 
ATOM   541   N  NH2 . ARG A  1 70  ? 6.815   81.935   110.578 1.00 21.51 ? 152  ARG A NH2 1 
ATOM   542   N  N   . SER A  1 71  ? 9.996   75.176   111.349 1.00 26.33 ? 153  SER A N   1 
ATOM   543   C  CA  . SER A  1 71  ? 11.129  74.422   111.865 1.00 25.80 ? 153  SER A CA  1 
ATOM   544   C  C   . SER A  1 71  ? 11.781  73.687   110.703 1.00 24.58 ? 153  SER A C   1 
ATOM   545   O  O   . SER A  1 71  ? 11.175  73.530   109.650 1.00 24.39 ? 153  SER A O   1 
ATOM   546   C  CB  . SER A  1 71  ? 10.677  73.419   112.921 1.00 25.78 ? 153  SER A CB  1 
ATOM   547   O  OG  . SER A  1 71  ? 10.480  72.143   112.345 1.00 30.59 ? 153  SER A OG  1 
ATOM   548   N  N   . PRO A  1 72  ? 13.033  73.232   110.873 1.00 24.65 ? 154  PRO A N   1 
ATOM   549   C  CA  . PRO A  1 72  ? 13.700  72.518   109.781 1.00 23.51 ? 154  PRO A CA  1 
ATOM   550   C  C   . PRO A  1 72  ? 13.185  71.094   109.594 1.00 23.28 ? 154  PRO A C   1 
ATOM   551   O  O   . PRO A  1 72  ? 13.748  70.332   108.812 1.00 23.88 ? 154  PRO A O   1 
ATOM   552   C  CB  . PRO A  1 72  ? 15.160  72.553   110.202 1.00 23.47 ? 154  PRO A CB  1 
ATOM   553   C  CG  . PRO A  1 72  ? 15.060  72.431   111.698 1.00 22.92 ? 154  PRO A CG  1 
ATOM   554   C  CD  . PRO A  1 72  ? 13.941  73.398   112.024 1.00 23.96 ? 154  PRO A CD  1 
ATOM   555   N  N   . HIS A  1 73  ? 12.120  70.733   110.308 1.00 22.16 ? 155  HIS A N   1 
ATOM   556   C  CA  . HIS A  1 73  ? 11.551  69.387   110.198 1.00 22.69 ? 155  HIS A CA  1 
ATOM   557   C  C   . HIS A  1 73  ? 10.264  69.373   109.393 1.00 23.38 ? 155  HIS A C   1 
ATOM   558   O  O   . HIS A  1 73  ? 9.743   68.308   109.056 1.00 23.88 ? 155  HIS A O   1 
ATOM   559   C  CB  . HIS A  1 73  ? 11.252  68.811   111.577 1.00 22.51 ? 155  HIS A CB  1 
ATOM   560   C  CG  . HIS A  1 73  ? 12.425  68.835   112.492 1.00 22.86 ? 155  HIS A CG  1 
ATOM   561   N  ND1 . HIS A  1 73  ? 12.379  69.420   113.737 1.00 22.84 ? 155  HIS A ND1 1 
ATOM   562   C  CD2 . HIS A  1 73  ? 13.692  68.400   112.320 1.00 22.34 ? 155  HIS A CD2 1 
ATOM   563   C  CE1 . HIS A  1 73  ? 13.574  69.349   114.293 1.00 24.49 ? 155  HIS A CE1 1 
ATOM   564   N  NE2 . HIS A  1 73  ? 14.389  68.735   113.455 1.00 25.52 ? 155  HIS A NE2 1 
ATOM   565   N  N   . ARG A  1 74  ? 9.738   70.555   109.108 1.00 22.11 ? 156  ARG A N   1 
ATOM   566   C  CA  . ARG A  1 74  ? 8.512   70.648   108.343 1.00 21.42 ? 156  ARG A CA  1 
ATOM   567   C  C   . ARG A  1 74  ? 8.826   70.131   106.938 1.00 19.44 ? 156  ARG A C   1 
ATOM   568   O  O   . ARG A  1 74  ? 9.802   70.547   106.322 1.00 18.54 ? 156  ARG A O   1 
ATOM   569   C  CB  . ARG A  1 74  ? 8.051   72.105   108.284 1.00 22.99 ? 156  ARG A CB  1 
ATOM   570   C  CG  . ARG A  1 74  ? 6.554   72.321   108.287 1.00 26.52 ? 156  ARG A CG  1 
ATOM   571   C  CD  . ARG A  1 74  ? 6.025   72.498   109.700 1.00 29.95 ? 156  ARG A CD  1 
ATOM   572   N  NE  . ARG A  1 74  ? 4.587   72.791   109.749 1.00 32.90 ? 156  ARG A NE  1 
ATOM   573   C  CZ  . ARG A  1 74  ? 4.029   73.924   109.328 1.00 33.67 ? 156  ARG A CZ  1 
ATOM   574   N  NH1 . ARG A  1 74  ? 2.715   74.099   109.418 1.00 35.19 ? 156  ARG A NH1 1 
ATOM   575   N  NH2 . ARG A  1 74  ? 4.781   74.886   108.815 1.00 34.07 ? 156  ARG A NH2 1 
ATOM   576   N  N   . THR A  1 75  ? 8.011   69.203   106.449 1.00 17.22 ? 157  THR A N   1 
ATOM   577   C  CA  . THR A  1 75  ? 8.192   68.657   105.115 1.00 16.57 ? 157  THR A CA  1 
ATOM   578   C  C   . THR A  1 75  ? 6.860   68.635   104.382 1.00 16.97 ? 157  THR A C   1 
ATOM   579   O  O   . THR A  1 75  ? 5.806   68.463   104.997 1.00 17.95 ? 157  THR A O   1 
ATOM   580   C  CB  . THR A  1 75  ? 8.709   67.215   105.145 1.00 17.25 ? 157  THR A CB  1 
ATOM   581   O  OG1 . THR A  1 75  ? 7.816   66.409   105.925 1.00 18.32 ? 157  THR A OG1 1 
ATOM   582   C  CG2 . THR A  1 75  ? 10.108  67.155   105.722 1.00 16.03 ? 157  THR A CG2 1 
ATOM   583   N  N   . LEU A  1 76  ? 6.912   68.817   103.066 1.00 15.46 ? 158  LEU A N   1 
ATOM   584   C  CA  . LEU A  1 76  ? 5.717   68.785   102.244 1.00 13.06 ? 158  LEU A CA  1 
ATOM   585   C  C   . LEU A  1 76  ? 5.568   67.360   101.740 1.00 15.13 ? 158  LEU A C   1 
ATOM   586   O  O   . LEU A  1 76  ? 6.525   66.777   101.214 1.00 13.87 ? 158  LEU A O   1 
ATOM   587   C  CB  . LEU A  1 76  ? 5.851   69.726   101.041 1.00 11.64 ? 158  LEU A CB  1 
ATOM   588   C  CG  . LEU A  1 76  ? 4.744   69.527   99.998  1.00 10.41 ? 158  LEU A CG  1 
ATOM   589   C  CD1 . LEU A  1 76  ? 3.444   70.072   100.545 1.00 9.37  ? 158  LEU A CD1 1 
ATOM   590   C  CD2 . LEU A  1 76  ? 5.092   70.190   98.694  1.00 7.42  ? 158  LEU A CD2 1 
ATOM   591   N  N   . MET A  1 77  ? 4.372   66.798   101.906 1.00 15.84 ? 159  MET A N   1 
ATOM   592   C  CA  . MET A  1 77  ? 4.096   65.441   101.448 1.00 17.72 ? 159  MET A CA  1 
ATOM   593   C  C   . MET A  1 77  ? 2.678   65.314   100.895 1.00 18.05 ? 159  MET A C   1 
ATOM   594   O  O   . MET A  1 77  ? 1.835   66.177   101.117 1.00 18.58 ? 159  MET A O   1 
ATOM   595   C  CB  . MET A  1 77  ? 4.310   64.441   102.589 1.00 18.28 ? 159  MET A CB  1 
ATOM   596   C  CG  . MET A  1 77  ? 5.742   64.405   103.095 1.00 22.17 ? 159  MET A CG  1 
ATOM   597   S  SD  . MET A  1 77  ? 6.101   62.971   104.128 1.00 28.61 ? 159  MET A SD  1 
ATOM   598   C  CE  . MET A  1 77  ? 5.482   63.549   105.664 1.00 28.06 ? 159  MET A CE  1 
ATOM   599   N  N   . SER A  1 78  ? 2.418   64.242   100.154 1.00 18.16 ? 160  SER A N   1 
ATOM   600   C  CA  . SER A  1 78  ? 1.091   64.035   99.605  1.00 17.81 ? 160  SER A CA  1 
ATOM   601   C  C   . SER A  1 78  ? 0.694   62.574   99.692  1.00 18.52 ? 160  SER A C   1 
ATOM   602   O  O   . SER A  1 78  ? 1.540   61.685   99.786  1.00 17.39 ? 160  SER A O   1 
ATOM   603   C  CB  . SER A  1 78  ? 1.021   64.486   98.149  1.00 16.34 ? 160  SER A CB  1 
ATOM   604   O  OG  . SER A  1 78  ? 1.729   63.594   97.311  1.00 17.12 ? 160  SER A OG  1 
ATOM   605   N  N   . CYS A  1 79  ? -0.611  62.344   99.670  1.00 18.26 ? 161  CYS A N   1 
ATOM   606   C  CA  . CYS A  1 79  ? -1.159  61.006   99.732  1.00 20.15 ? 161  CYS A CA  1 
ATOM   607   C  C   . CYS A  1 79  ? -2.464  61.098   98.968  1.00 19.60 ? 161  CYS A C   1 
ATOM   608   O  O   . CYS A  1 79  ? -2.969  62.197   98.734  1.00 20.18 ? 161  CYS A O   1 
ATOM   609   C  CB  . CYS A  1 79  ? -1.410  60.596   101.189 1.00 20.90 ? 161  CYS A CB  1 
ATOM   610   S  SG  . CYS A  1 79  ? -2.755  61.486   102.035 1.00 26.06 ? 161  CYS A SG  1 
ATOM   611   N  N   . PRO A  1 80  ? -3.014  59.962   98.534  1.00 20.04 ? 162  PRO A N   1 
ATOM   612   C  CA  . PRO A  1 80  ? -4.276  60.066   97.799  1.00 20.30 ? 162  PRO A CA  1 
ATOM   613   C  C   . PRO A  1 80  ? -5.387  60.706   98.632  1.00 19.58 ? 162  PRO A C   1 
ATOM   614   O  O   . PRO A  1 80  ? -5.428  60.559   99.853  1.00 20.74 ? 162  PRO A O   1 
ATOM   615   C  CB  . PRO A  1 80  ? -4.570  58.620   97.382  1.00 20.41 ? 162  PRO A CB  1 
ATOM   616   C  CG  . PRO A  1 80  ? -3.662  57.783   98.252  1.00 22.54 ? 162  PRO A CG  1 
ATOM   617   C  CD  . PRO A  1 80  ? -2.439  58.616   98.423  1.00 21.23 ? 162  PRO A CD  1 
ATOM   618   N  N   . VAL A  1 81  ? -6.269  61.437   97.959  1.00 18.01 ? 163  VAL A N   1 
ATOM   619   C  CA  . VAL A  1 81  ? -7.363  62.128   98.622  1.00 18.59 ? 163  VAL A CA  1 
ATOM   620   C  C   . VAL A  1 81  ? -8.276  61.207   99.424  1.00 17.13 ? 163  VAL A C   1 
ATOM   621   O  O   . VAL A  1 81  ? -8.686  60.144   98.945  1.00 15.94 ? 163  VAL A O   1 
ATOM   622   C  CB  . VAL A  1 81  ? -8.216  62.911   97.594  1.00 19.64 ? 163  VAL A CB  1 
ATOM   623   C  CG1 . VAL A  1 81  ? -9.286  63.734   98.299  1.00 19.92 ? 163  VAL A CG1 1 
ATOM   624   C  CG2 . VAL A  1 81  ? -7.321  63.824   96.783  1.00 22.00 ? 163  VAL A CG2 1 
ATOM   625   N  N   . GLY A  1 82  ? -8.584  61.636   100.646 1.00 16.19 ? 164  GLY A N   1 
ATOM   626   C  CA  . GLY A  1 82  ? -9.462  60.883   101.523 1.00 16.71 ? 164  GLY A CA  1 
ATOM   627   C  C   . GLY A  1 82  ? -8.762  59.929   102.472 1.00 18.08 ? 164  GLY A C   1 
ATOM   628   O  O   . GLY A  1 82  ? -9.360  59.460   103.437 1.00 17.46 ? 164  GLY A O   1 
ATOM   629   N  N   . GLU A  1 83  ? -7.491  59.642   102.204 1.00 19.43 ? 165  GLU A N   1 
ATOM   630   C  CA  . GLU A  1 83  ? -6.725  58.728   103.039 1.00 19.80 ? 165  GLU A CA  1 
ATOM   631   C  C   . GLU A  1 83  ? -6.027  59.459   104.172 1.00 19.31 ? 165  GLU A C   1 
ATOM   632   O  O   . GLU A  1 83  ? -5.688  60.630   104.047 1.00 20.28 ? 165  GLU A O   1 
ATOM   633   C  CB  . GLU A  1 83  ? -5.707  57.977   102.178 1.00 20.38 ? 165  GLU A CB  1 
ATOM   634   C  CG  . GLU A  1 83  ? -6.331  56.843   101.371 1.00 25.08 ? 165  GLU A CG  1 
ATOM   635   C  CD  . GLU A  1 83  ? -5.405  56.292   100.301 1.00 27.85 ? 165  GLU A CD  1 
ATOM   636   O  OE1 . GLU A  1 83  ? -4.179  56.205   100.555 1.00 29.38 ? 165  GLU A OE1 1 
ATOM   637   O  OE2 . GLU A  1 83  ? -5.905  55.935   99.210  1.00 27.56 ? 165  GLU A OE2 1 
ATOM   638   N  N   . ALA A  1 84  ? -5.829  58.778   105.293 1.00 18.42 ? 166  ALA A N   1 
ATOM   639   C  CA  . ALA A  1 84  ? -5.156  59.413   106.417 1.00 18.49 ? 166  ALA A CA  1 
ATOM   640   C  C   . ALA A  1 84  ? -3.693  59.527   106.028 1.00 17.92 ? 166  ALA A C   1 
ATOM   641   O  O   . ALA A  1 84  ? -3.112  58.562   105.541 1.00 19.60 ? 166  ALA A O   1 
ATOM   642   C  CB  . ALA A  1 84  ? -5.312  58.567   107.683 1.00 16.35 ? 166  ALA A CB  1 
ATOM   643   N  N   . PRO A  1 85  ? -3.078  60.705   106.230 1.00 17.17 ? 167  PRO A N   1 
ATOM   644   C  CA  . PRO A  1 85  ? -1.666  60.897   105.879 1.00 16.89 ? 167  PRO A CA  1 
ATOM   645   C  C   . PRO A  1 85  ? -0.750  60.169   106.860 1.00 17.00 ? 167  PRO A C   1 
ATOM   646   O  O   . PRO A  1 85  ? -0.571  60.609   107.995 1.00 19.21 ? 167  PRO A O   1 
ATOM   647   C  CB  . PRO A  1 85  ? -1.504  62.412   105.948 1.00 17.12 ? 167  PRO A CB  1 
ATOM   648   C  CG  . PRO A  1 85  ? -2.350  62.757   107.141 1.00 18.53 ? 167  PRO A CG  1 
ATOM   649   C  CD  . PRO A  1 85  ? -3.616  61.898   106.911 1.00 17.44 ? 167  PRO A CD  1 
ATOM   650   N  N   . SER A  1 86  ? -0.169  59.058   106.425 1.00 16.96 ? 168  SER A N   1 
ATOM   651   C  CA  . SER A  1 86  ? 0.711   58.274   107.281 1.00 18.00 ? 168  SER A CA  1 
ATOM   652   C  C   . SER A  1 86  ? 2.050   58.040   106.589 1.00 18.58 ? 168  SER A C   1 
ATOM   653   O  O   . SER A  1 86  ? 2.168   58.172   105.388 1.00 19.21 ? 168  SER A O   1 
ATOM   654   C  CB  . SER A  1 86  ? 0.048   56.933   107.564 1.00 18.52 ? 168  SER A CB  1 
ATOM   655   O  OG  . SER A  1 86  ? 0.745   55.895   106.893 1.00 22.79 ? 168  SER A OG  1 
ATOM   656   N  N   . PRO A  1 87  ? 3.092   57.718   107.338 1.00 20.21 ? 169  PRO A N   1 
ATOM   657   C  CA  . PRO A  1 87  ? 4.315   57.507   106.551 1.00 21.03 ? 169  PRO A CA  1 
ATOM   658   C  C   . PRO A  1 87  ? 4.250   56.245   105.684 1.00 21.12 ? 169  PRO A C   1 
ATOM   659   O  O   . PRO A  1 87  ? 5.146   55.970   104.860 1.00 21.17 ? 169  PRO A O   1 
ATOM   660   C  CB  . PRO A  1 87  ? 5.404   57.408   107.623 1.00 21.39 ? 169  PRO A CB  1 
ATOM   661   C  CG  . PRO A  1 87  ? 4.596   57.182   108.971 1.00 21.85 ? 169  PRO A CG  1 
ATOM   662   C  CD  . PRO A  1 87  ? 3.402   58.041   108.735 1.00 22.31 ? 169  PRO A CD  1 
ATOM   663   N  N   . TYR A  1 88  A 3.181   55.481   105.855 1.00 21.05 ? 169  TYR A N   1 
ATOM   664   C  CA  . TYR A  1 88  A 3.067   54.226   105.118 1.00 21.97 ? 169  TYR A CA  1 
ATOM   665   C  C   . TYR A  1 88  A 2.345   54.422   103.837 1.00 22.13 ? 169  TYR A C   1 
ATOM   666   O  O   . TYR A  1 88  A 2.304   53.549   102.970 1.00 22.44 ? 169  TYR A O   1 
ATOM   667   C  CB  . TYR A  1 88  A 2.301   53.210   105.944 1.00 19.14 ? 169  TYR A CB  1 
ATOM   668   C  CG  . TYR A  1 88  A 2.830   53.102   107.373 1.00 18.33 ? 169  TYR A CG  1 
ATOM   669   C  CD1 . TYR A  1 88  A 1.995   52.763   108.405 1.00 18.79 ? 169  TYR A CD1 1 
ATOM   670   C  CD2 . TYR A  1 88  A 4.168   53.364   107.657 1.00 17.46 ? 169  TYR A CD2 1 
ATOM   671   C  CE1 . TYR A  1 88  A 2.440   52.672   109.666 1.00 17.45 ? 169  TYR A CE1 1 
ATOM   672   C  CE2 . TYR A  1 88  A 4.661   53.276   108.887 1.00 14.24 ? 169  TYR A CE2 1 
ATOM   673   C  CZ  . TYR A  1 88  A 3.764   52.920   109.893 1.00 14.52 ? 169  TYR A CZ  1 
ATOM   674   O  OH  . TYR A  1 88  A 4.224   52.686   111.104 1.00 14.19 ? 169  TYR A OH  1 
ATOM   675   N  N   . ASN A  1 89  ? 1.787   55.603   103.704 1.00 22.32 ? 170  ASN A N   1 
ATOM   676   C  CA  . ASN A  1 89  ? 1.034   55.858   102.515 1.00 24.07 ? 170  ASN A CA  1 
ATOM   677   C  C   . ASN A  1 89  ? 1.318   57.200   101.873 1.00 23.66 ? 170  ASN A C   1 
ATOM   678   O  O   . ASN A  1 89  ? 0.816   57.457   100.788 1.00 24.58 ? 170  ASN A O   1 
ATOM   679   C  CB  . ASN A  1 89  ? -0.460  55.718   102.820 1.00 23.42 ? 170  ASN A CB  1 
ATOM   680   C  CG  . ASN A  1 89  ? -1.075  57.002   103.337 1.00 25.58 ? 170  ASN A CG  1 
ATOM   681   O  OD1 . ASN A  1 89  ? -0.508  57.685   104.192 1.00 26.20 ? 170  ASN A OD1 1 
ATOM   682   N  ND2 . ASN A  1 89  ? -2.250  57.340   102.815 1.00 27.94 ? 170  ASN A ND2 1 
ATOM   683   N  N   . SER A  1 90  ? 2.115   58.048   102.521 1.00 22.32 ? 171  SER A N   1 
ATOM   684   C  CA  . SER A  1 90  ? 2.440   59.369   101.966 1.00 21.90 ? 171  SER A CA  1 
ATOM   685   C  C   . SER A  1 90  ? 3.721   59.393   101.139 1.00 21.05 ? 171  SER A C   1 
ATOM   686   O  O   . SER A  1 90  ? 4.678   58.686   101.435 1.00 22.06 ? 171  SER A O   1 
ATOM   687   C  CB  . SER A  1 90  ? 2.599   60.405   103.084 1.00 22.57 ? 171  SER A CB  1 
ATOM   688   O  OG  . SER A  1 90  ? 1.432   60.504   103.874 1.00 23.20 ? 171  SER A OG  1 
ATOM   689   N  N   . ARG A  1 91  ? 3.745   60.226   100.111 1.00 20.05 ? 172  ARG A N   1 
ATOM   690   C  CA  . ARG A  1 91  ? 4.927   60.357   99.271  1.00 21.11 ? 172  ARG A CA  1 
ATOM   691   C  C   . ARG A  1 91  ? 5.688   61.593   99.736  1.00 19.14 ? 172  ARG A C   1 
ATOM   692   O  O   . ARG A  1 91  ? 5.074   62.607   100.066 1.00 20.66 ? 172  ARG A O   1 
ATOM   693   C  CB  . ARG A  1 91  ? 4.520   60.545   97.811  1.00 23.77 ? 172  ARG A CB  1 
ATOM   694   C  CG  . ARG A  1 91  ? 5.678   60.892   96.891  1.00 28.16 ? 172  ARG A CG  1 
ATOM   695   C  CD  . ARG A  1 91  ? 5.190   61.672   95.671  1.00 32.95 ? 172  ARG A CD  1 
ATOM   696   N  NE  . ARG A  1 91  ? 4.208   60.933   94.880  1.00 34.13 ? 172  ARG A NE  1 
ATOM   697   C  CZ  . ARG A  1 91  ? 3.349   61.508   94.043  1.00 34.33 ? 172  ARG A CZ  1 
ATOM   698   N  NH1 . ARG A  1 91  ? 2.497   60.761   93.359  1.00 33.29 ? 172  ARG A NH1 1 
ATOM   699   N  NH2 . ARG A  1 91  ? 3.329   62.831   93.904  1.00 33.71 ? 172  ARG A NH2 1 
ATOM   700   N  N   . PHE A  1 92  ? 7.010   61.528   99.789  1.00 15.88 ? 173  PHE A N   1 
ATOM   701   C  CA  . PHE A  1 92  ? 7.741   62.715   100.196 1.00 14.82 ? 173  PHE A CA  1 
ATOM   702   C  C   . PHE A  1 92  ? 7.716   63.690   99.018  1.00 16.95 ? 173  PHE A C   1 
ATOM   703   O  O   . PHE A  1 92  ? 7.784   63.273   97.854  1.00 17.47 ? 173  PHE A O   1 
ATOM   704   C  CB  . PHE A  1 92  ? 9.186   62.390   100.524 1.00 13.50 ? 173  PHE A CB  1 
ATOM   705   C  CG  . PHE A  1 92  ? 10.005  63.603   100.834 1.00 11.38 ? 173  PHE A CG  1 
ATOM   706   C  CD1 . PHE A  1 92  ? 9.893   64.230   102.068 1.00 10.72 ? 173  PHE A CD1 1 
ATOM   707   C  CD2 . PHE A  1 92  ? 10.841  64.154   99.873  1.00 6.67  ? 173  PHE A CD2 1 
ATOM   708   C  CE1 . PHE A  1 92  ? 10.603  65.398   102.336 1.00 10.28 ? 173  PHE A CE1 1 
ATOM   709   C  CE2 . PHE A  1 92  ? 11.548  65.307   100.129 1.00 5.50  ? 173  PHE A CE2 1 
ATOM   710   C  CZ  . PHE A  1 92  ? 11.432  65.935   101.360 1.00 9.11  ? 173  PHE A CZ  1 
ATOM   711   N  N   . GLU A  1 93  ? 7.616   64.984   99.304  1.00 16.69 ? 174  GLU A N   1 
ATOM   712   C  CA  . GLU A  1 93  ? 7.584   65.967   98.236  1.00 16.44 ? 174  GLU A CA  1 
ATOM   713   C  C   . GLU A  1 93  ? 8.713   66.971   98.319  1.00 16.75 ? 174  GLU A C   1 
ATOM   714   O  O   . GLU A  1 93  ? 9.392   67.213   97.326  1.00 20.82 ? 174  GLU A O   1 
ATOM   715   C  CB  . GLU A  1 93  ? 6.259   66.726   98.244  1.00 16.87 ? 174  GLU A CB  1 
ATOM   716   C  CG  . GLU A  1 93  ? 5.032   65.849   98.059  1.00 18.27 ? 174  GLU A CG  1 
ATOM   717   C  CD  . GLU A  1 93  ? 4.960   65.230   96.685  1.00 16.08 ? 174  GLU A CD  1 
ATOM   718   O  OE1 . GLU A  1 93  ? 4.023   64.435   96.429  1.00 14.88 ? 174  GLU A OE1 1 
ATOM   719   O  OE2 . GLU A  1 93  ? 5.843   65.546   95.863  1.00 16.43 ? 174  GLU A OE2 1 
ATOM   720   N  N   . SER A  1 94  ? 8.926   67.550   99.496  1.00 15.81 ? 175  SER A N   1 
ATOM   721   C  CA  . SER A  1 94  ? 9.952   68.571   99.640  1.00 16.49 ? 175  SER A CA  1 
ATOM   722   C  C   . SER A  1 94  ? 10.112  68.974   101.100 1.00 15.47 ? 175  SER A C   1 
ATOM   723   O  O   . SER A  1 94  ? 9.228   68.719   101.912 1.00 16.02 ? 175  SER A O   1 
ATOM   724   C  CB  . SER A  1 94  ? 9.534   69.790   98.809  1.00 17.90 ? 175  SER A CB  1 
ATOM   725   O  OG  . SER A  1 94  ? 10.535  70.785   98.739  1.00 19.61 ? 175  SER A OG  1 
ATOM   726   N  N   . VAL A  1 95  ? 11.247  69.582   101.437 1.00 13.58 ? 176  VAL A N   1 
ATOM   727   C  CA  . VAL A  1 95  ? 11.475  70.048   102.802 1.00 13.62 ? 176  VAL A CA  1 
ATOM   728   C  C   . VAL A  1 95  ? 10.914  71.458   102.819 1.00 13.46 ? 176  VAL A C   1 
ATOM   729   O  O   . VAL A  1 95  ? 11.373  72.308   102.064 1.00 13.41 ? 176  VAL A O   1 
ATOM   730   C  CB  . VAL A  1 95  ? 12.975  70.073   103.143 1.00 13.34 ? 176  VAL A CB  1 
ATOM   731   C  CG1 . VAL A  1 95  ? 13.191  70.652   104.536 1.00 11.10 ? 176  VAL A CG1 1 
ATOM   732   C  CG2 . VAL A  1 95  ? 13.540  68.652   103.066 1.00 14.16 ? 176  VAL A CG2 1 
ATOM   733   N  N   . ALA A  1 96  ? 9.912   71.714   103.660 1.00 13.81 ? 177  ALA A N   1 
ATOM   734   C  CA  . ALA A  1 96  ? 9.309   73.039   103.668 1.00 13.76 ? 177  ALA A CA  1 
ATOM   735   C  C   . ALA A  1 96  ? 8.362   73.359   104.809 1.00 14.27 ? 177  ALA A C   1 
ATOM   736   O  O   . ALA A  1 96  ? 7.658   72.482   105.305 1.00 15.04 ? 177  ALA A O   1 
ATOM   737   C  CB  . ALA A  1 96  ? 8.575   73.244   102.371 1.00 13.26 ? 177  ALA A CB  1 
ATOM   738   N  N   . TRP A  1 97  ? 8.353   74.629   105.220 1.00 14.21 ? 178  TRP A N   1 
ATOM   739   C  CA  . TRP A  1 97  ? 7.430   75.089   106.253 1.00 14.31 ? 178  TRP A CA  1 
ATOM   740   C  C   . TRP A  1 97  ? 6.362   75.974   105.601 1.00 14.15 ? 178  TRP A C   1 
ATOM   741   O  O   . TRP A  1 97  ? 5.515   76.559   106.273 1.00 14.42 ? 178  TRP A O   1 
ATOM   742   C  CB  . TRP A  1 97  ? 8.139   75.845   107.390 1.00 13.69 ? 178  TRP A CB  1 
ATOM   743   C  CG  . TRP A  1 97  ? 9.315   76.721   107.036 1.00 13.81 ? 178  TRP A CG  1 
ATOM   744   C  CD1 . TRP A  1 97  ? 10.630  76.468   107.315 1.00 12.15 ? 178  TRP A CD1 1 
ATOM   745   C  CD2 . TRP A  1 97  ? 9.281   78.012   106.411 1.00 11.23 ? 178  TRP A CD2 1 
ATOM   746   N  NE1 . TRP A  1 97  ? 11.412  77.516   106.907 1.00 12.16 ? 178  TRP A NE1 1 
ATOM   747   C  CE2 . TRP A  1 97  ? 10.611  78.479   106.349 1.00 12.41 ? 178  TRP A CE2 1 
ATOM   748   C  CE3 . TRP A  1 97  ? 8.258   78.818   105.899 1.00 12.61 ? 178  TRP A CE3 1 
ATOM   749   C  CZ2 . TRP A  1 97  ? 10.947  79.721   105.795 1.00 12.30 ? 178  TRP A CZ2 1 
ATOM   750   C  CZ3 . TRP A  1 97  ? 8.592   80.057   105.343 1.00 11.74 ? 178  TRP A CZ3 1 
ATOM   751   C  CH2 . TRP A  1 97  ? 9.927   80.493   105.298 1.00 12.74 ? 178  TRP A CH2 1 
ATOM   752   N  N   . SER A  1 98  ? 6.424   76.056   104.274 1.00 13.81 ? 179  SER A N   1 
ATOM   753   C  CA  . SER A  1 98  ? 5.468   76.805   103.465 1.00 13.21 ? 179  SER A CA  1 
ATOM   754   C  C   . SER A  1 98  ? 5.543   76.232   102.060 1.00 13.62 ? 179  SER A C   1 
ATOM   755   O  O   . SER A  1 98  ? 6.635   75.919   101.587 1.00 14.44 ? 179  SER A O   1 
ATOM   756   C  CB  . SER A  1 98  ? 5.823   78.280   103.419 1.00 12.85 ? 179  SER A CB  1 
ATOM   757   O  OG  . SER A  1 98  ? 4.972   78.945   102.504 1.00 12.28 ? 179  SER A OG  1 
ATOM   758   N  N   . ALA A  1 99  ? 4.413   76.103   101.371 1.00 13.37 ? 180  ALA A N   1 
ATOM   759   C  CA  . ALA A  1 99  ? 4.486   75.528   100.035 1.00 14.53 ? 180  ALA A CA  1 
ATOM   760   C  C   . ALA A  1 99  ? 3.226   75.553   99.208  1.00 15.03 ? 180  ALA A C   1 
ATOM   761   O  O   . ALA A  1 99  ? 2.170   75.976   99.661  1.00 15.12 ? 180  ALA A O   1 
ATOM   762   C  CB  . ALA A  1 99  ? 4.947   74.093   100.145 1.00 16.85 ? 180  ALA A CB  1 
ATOM   763   N  N   . SER A  1 100 ? 3.368   75.075   97.977  1.00 15.56 ? 181  SER A N   1 
ATOM   764   C  CA  . SER A  1 100 ? 2.256   74.943   97.051  1.00 19.27 ? 181  SER A CA  1 
ATOM   765   C  C   . SER A  1 100 ? 2.628   73.827   96.084  1.00 18.42 ? 181  SER A C   1 
ATOM   766   O  O   . SER A  1 100 ? 3.748   73.326   96.112  1.00 19.09 ? 181  SER A O   1 
ATOM   767   C  CB  . SER A  1 100 ? 1.976   76.251   96.296  1.00 21.93 ? 181  SER A CB  1 
ATOM   768   O  OG  . SER A  1 100 ? 3.051   76.610   95.450  1.00 28.97 ? 181  SER A OG  1 
ATOM   769   N  N   . ALA A  1 101 ? 1.683   73.424   95.246  1.00 18.82 ? 182  ALA A N   1 
ATOM   770   C  CA  . ALA A  1 101 ? 1.929   72.364   94.282  1.00 19.28 ? 182  ALA A CA  1 
ATOM   771   C  C   . ALA A  1 101 ? 0.819   72.357   93.243  1.00 19.31 ? 182  ALA A C   1 
ATOM   772   O  O   . ALA A  1 101 ? -0.310  72.756   93.523  1.00 19.57 ? 182  ALA A O   1 
ATOM   773   C  CB  . ALA A  1 101 ? 1.994   71.009   94.992  1.00 19.42 ? 182  ALA A CB  1 
ATOM   774   N  N   . CYS A  1 102 ? 1.154   71.923   92.037  1.00 19.20 ? 183  CYS A N   1 
ATOM   775   C  CA  . CYS A  1 102 ? 0.182   71.836   90.962  1.00 19.72 ? 183  CYS A CA  1 
ATOM   776   C  C   . CYS A  1 102 ? 0.746   71.022   89.804  1.00 18.92 ? 183  CYS A C   1 
ATOM   777   O  O   . CYS A  1 102 ? 1.952   70.943   89.609  1.00 19.92 ? 183  CYS A O   1 
ATOM   778   C  CB  . CYS A  1 102 ? -0.237  73.229   90.492  1.00 20.73 ? 183  CYS A CB  1 
ATOM   779   S  SG  . CYS A  1 102 ? 1.132   74.351   90.097  1.00 26.43 ? 183  CYS A SG  1 
ATOM   780   N  N   . HIS A  1 103 ? -0.147  70.399   89.052  1.00 18.37 ? 184  HIS A N   1 
ATOM   781   C  CA  . HIS A  1 103 ? 0.226   69.570   87.924  1.00 17.48 ? 184  HIS A CA  1 
ATOM   782   C  C   . HIS A  1 103 ? -0.143  70.339   86.660  1.00 18.13 ? 184  HIS A C   1 
ATOM   783   O  O   . HIS A  1 103 ? -1.204  70.953   86.592  1.00 19.22 ? 184  HIS A O   1 
ATOM   784   C  CB  . HIS A  1 103 ? -0.550  68.256   88.015  1.00 16.47 ? 184  HIS A CB  1 
ATOM   785   C  CG  . HIS A  1 103 ? -0.051  67.181   87.101  1.00 16.17 ? 184  HIS A CG  1 
ATOM   786   N  ND1 . HIS A  1 103 ? 0.662   66.093   87.555  1.00 16.20 ? 184  HIS A ND1 1 
ATOM   787   C  CD2 . HIS A  1 103 ? -0.208  67.002   85.769  1.00 14.61 ? 184  HIS A CD2 1 
ATOM   788   C  CE1 . HIS A  1 103 ? 0.919   65.285   86.540  1.00 15.62 ? 184  HIS A CE1 1 
ATOM   789   N  NE2 . HIS A  1 103 ? 0.403   65.813   85.447  1.00 15.61 ? 184  HIS A NE2 1 
ATOM   790   N  N   . ASP A  1 104 ? 0.731   70.308   85.662  1.00 19.03 ? 185  ASP A N   1 
ATOM   791   C  CA  . ASP A  1 104 ? 0.482   71.034   84.418  1.00 19.11 ? 185  ASP A CA  1 
ATOM   792   C  C   . ASP A  1 104 ? -0.072  70.153   83.313  1.00 18.96 ? 185  ASP A C   1 
ATOM   793   O  O   . ASP A  1 104 ? -0.319  70.631   82.214  1.00 19.87 ? 185  ASP A O   1 
ATOM   794   C  CB  . ASP A  1 104 ? 1.774   71.692   83.919  1.00 19.25 ? 185  ASP A CB  1 
ATOM   795   C  CG  . ASP A  1 104 ? 2.817   70.675   83.470  1.00 20.96 ? 185  ASP A CG  1 
ATOM   796   O  OD1 . ASP A  1 104 ? 2.574   69.455   83.591  1.00 22.69 ? 185  ASP A OD1 1 
ATOM   797   O  OD2 . ASP A  1 104 ? 3.889   71.091   82.993  1.00 21.81 ? 185  ASP A OD2 1 
ATOM   798   N  N   . GLY A  1 105 ? -0.261  68.870   83.595  1.00 19.72 ? 186  GLY A N   1 
ATOM   799   C  CA  . GLY A  1 105 ? -0.773  67.964   82.577  1.00 19.66 ? 186  GLY A CA  1 
ATOM   800   C  C   . GLY A  1 105 ? 0.256   66.892   82.269  1.00 20.20 ? 186  GLY A C   1 
ATOM   801   O  O   . GLY A  1 105 ? -0.073  65.801   81.792  1.00 20.69 ? 186  GLY A O   1 
ATOM   802   N  N   . THR A  1 106 ? 1.516   67.214   82.547  1.00 19.74 ? 187  THR A N   1 
ATOM   803   C  CA  . THR A  1 106 ? 2.615   66.289   82.323  1.00 19.16 ? 187  THR A CA  1 
ATOM   804   C  C   . THR A  1 106 ? 3.164   65.808   83.665  1.00 18.47 ? 187  THR A C   1 
ATOM   805   O  O   . THR A  1 106 ? 3.144   64.614   83.961  1.00 18.26 ? 187  THR A O   1 
ATOM   806   C  CB  . THR A  1 106 ? 3.742   66.962   81.514  1.00 19.36 ? 187  THR A CB  1 
ATOM   807   O  OG1 . THR A  1 106 ? 3.228   67.372   80.242  1.00 21.22 ? 187  THR A OG1 1 
ATOM   808   C  CG2 . THR A  1 106 ? 4.906   65.999   81.299  1.00 17.99 ? 187  THR A CG2 1 
ATOM   809   N  N   . SER A  1 107 ? 3.637   66.742   84.483  1.00 17.50 ? 188  SER A N   1 
ATOM   810   C  CA  . SER A  1 107 ? 4.196   66.386   85.779  1.00 16.27 ? 188  SER A CA  1 
ATOM   811   C  C   . SER A  1 107 ? 3.749   67.312   86.898  1.00 14.14 ? 188  SER A C   1 
ATOM   812   O  O   . SER A  1 107 ? 3.103   68.324   86.654  1.00 12.86 ? 188  SER A O   1 
ATOM   813   C  CB  . SER A  1 107 ? 5.718   66.399   85.697  1.00 17.21 ? 188  SER A CB  1 
ATOM   814   O  OG  . SER A  1 107 ? 6.169   65.478   84.718  1.00 23.53 ? 188  SER A OG  1 
ATOM   815   N  N   . TRP A  1 108 ? 4.090   66.945   88.129  1.00 13.41 ? 189  TRP A N   1 
ATOM   816   C  CA  . TRP A  1 108 ? 3.760   67.763   89.286  1.00 11.96 ? 189  TRP A CA  1 
ATOM   817   C  C   . TRP A  1 108 ? 4.855   68.790   89.487  1.00 11.39 ? 189  TRP A C   1 
ATOM   818   O  O   . TRP A  1 108 ? 6.028   68.536   89.202  1.00 10.56 ? 189  TRP A O   1 
ATOM   819   C  CB  . TRP A  1 108 ? 3.669   66.934   90.577  1.00 12.23 ? 189  TRP A CB  1 
ATOM   820   C  CG  . TRP A  1 108 ? 2.419   66.145   90.726  1.00 13.67 ? 189  TRP A CG  1 
ATOM   821   C  CD1 . TRP A  1 108 ? 2.259   64.827   90.470  1.00 11.88 ? 189  TRP A CD1 1 
ATOM   822   C  CD2 . TRP A  1 108 ? 1.131   66.641   91.125  1.00 14.80 ? 189  TRP A CD2 1 
ATOM   823   N  NE1 . TRP A  1 108 ? 0.949   64.460   90.676  1.00 15.42 ? 189  TRP A NE1 1 
ATOM   824   C  CE2 . TRP A  1 108 ? 0.234   65.558   91.081  1.00 14.20 ? 189  TRP A CE2 1 
ATOM   825   C  CE3 . TRP A  1 108 ? 0.648   67.902   91.511  1.00 15.60 ? 189  TRP A CE3 1 
ATOM   826   C  CZ2 . TRP A  1 108 ? -1.122  65.685   91.408  1.00 15.13 ? 189  TRP A CZ2 1 
ATOM   827   C  CZ3 . TRP A  1 108 ? -0.709  68.035   91.835  1.00 15.40 ? 189  TRP A CZ3 1 
ATOM   828   C  CH2 . TRP A  1 108 ? -1.575  66.929   91.781  1.00 14.63 ? 189  TRP A CH2 1 
ATOM   829   N  N   . LEU A  1 109 ? 4.447   69.949   89.979  1.00 10.21 ? 190  LEU A N   1 
ATOM   830   C  CA  . LEU A  1 109 ? 5.340   71.037   90.298  1.00 8.72  ? 190  LEU A CA  1 
ATOM   831   C  C   . LEU A  1 109 ? 5.123   71.220   91.780  1.00 9.94  ? 190  LEU A C   1 
ATOM   832   O  O   . LEU A  1 109 ? 3.992   71.330   92.247  1.00 11.00 ? 190  LEU A O   1 
ATOM   833   C  CB  . LEU A  1 109 ? 4.927   72.319   89.567  1.00 10.12 ? 190  LEU A CB  1 
ATOM   834   C  CG  . LEU A  1 109 ? 5.449   73.642   90.150  1.00 10.31 ? 190  LEU A CG  1 
ATOM   835   C  CD1 . LEU A  1 109 ? 6.962   73.627   90.250  1.00 10.96 ? 190  LEU A CD1 1 
ATOM   836   C  CD2 . LEU A  1 109 ? 4.997   74.786   89.274  1.00 10.58 ? 190  LEU A CD2 1 
ATOM   837   N  N   . THR A  1 110 ? 6.195   71.220   92.540  1.00 10.87 ? 191  THR A N   1 
ATOM   838   C  CA  . THR A  1 110 ? 6.043   71.419   93.958  1.00 12.34 ? 191  THR A CA  1 
ATOM   839   C  C   . THR A  1 110 ? 6.962   72.549   94.350  1.00 12.66 ? 191  THR A C   1 
ATOM   840   O  O   . THR A  1 110 ? 8.024   72.752   93.752  1.00 12.63 ? 191  THR A O   1 
ATOM   841   C  CB  . THR A  1 110 ? 6.358   70.149   94.747  1.00 12.16 ? 191  THR A CB  1 
ATOM   842   O  OG1 . THR A  1 110 ? 7.694   69.720   94.461  1.00 16.15 ? 191  THR A OG1 1 
ATOM   843   C  CG2 . THR A  1 110 ? 5.376   69.054   94.359  1.00 12.97 ? 191  THR A CG2 1 
ATOM   844   N  N   . ILE A  1 111 ? 6.521   73.312   95.337  1.00 12.55 ? 192  ILE A N   1 
ATOM   845   C  CA  . ILE A  1 111 ? 7.283   74.445   95.791  1.00 13.55 ? 192  ILE A CA  1 
ATOM   846   C  C   . ILE A  1 111 ? 7.347   74.387   97.293  1.00 14.56 ? 192  ILE A C   1 
ATOM   847   O  O   . ILE A  1 111 ? 6.332   74.518   97.964  1.00 17.71 ? 192  ILE A O   1 
ATOM   848   C  CB  . ILE A  1 111 ? 6.612   75.741   95.340  1.00 12.61 ? 192  ILE A CB  1 
ATOM   849   C  CG1 . ILE A  1 111 ? 6.487   75.738   93.816  1.00 9.91  ? 192  ILE A CG1 1 
ATOM   850   C  CG2 . ILE A  1 111 ? 7.429   76.933   95.794  1.00 12.13 ? 192  ILE A CG2 1 
ATOM   851   C  CD1 . ILE A  1 111 ? 5.476   76.725   93.288  1.00 11.82 ? 192  ILE A CD1 1 
ATOM   852   N  N   . GLY A  1 112 ? 8.543   74.161   97.817  1.00 14.32 ? 193  GLY A N   1 
ATOM   853   C  CA  . GLY A  1 112 ? 8.704   74.091   99.249  1.00 13.68 ? 193  GLY A CA  1 
ATOM   854   C  C   . GLY A  1 112 ? 9.712   75.121   99.706  1.00 14.85 ? 193  GLY A C   1 
ATOM   855   O  O   . GLY A  1 112 ? 10.808  75.223   99.152  1.00 15.16 ? 193  GLY A O   1 
ATOM   856   N  N   . ILE A  1 113 ? 9.334   75.898   100.713 1.00 15.23 ? 194  ILE A N   1 
ATOM   857   C  CA  . ILE A  1 113 ? 10.215  76.912   101.258 1.00 15.19 ? 194  ILE A CA  1 
ATOM   858   C  C   . ILE A  1 113 ? 10.768  76.420   102.589 1.00 15.68 ? 194  ILE A C   1 
ATOM   859   O  O   . ILE A  1 113 ? 10.029  75.896   103.422 1.00 17.88 ? 194  ILE A O   1 
ATOM   860   C  CB  . ILE A  1 113 ? 9.463   78.247   101.497 1.00 15.84 ? 194  ILE A CB  1 
ATOM   861   C  CG1 . ILE A  1 113 ? 8.869   78.764   100.180 1.00 15.38 ? 194  ILE A CG1 1 
ATOM   862   C  CG2 . ILE A  1 113 ? 10.420  79.276   102.101 1.00 15.00 ? 194  ILE A CG2 1 
ATOM   863   C  CD1 . ILE A  1 113 ? 7.958   79.961   100.334 1.00 14.75 ? 194  ILE A CD1 1 
ATOM   864   N  N   . SER A  1 114 ? 12.072  76.570   102.775 1.00 14.21 ? 195  SER A N   1 
ATOM   865   C  CA  . SER A  1 114 ? 12.714  76.178   104.016 1.00 13.68 ? 195  SER A CA  1 
ATOM   866   C  C   . SER A  1 114 ? 13.821  77.197   104.244 1.00 14.54 ? 195  SER A C   1 
ATOM   867   O  O   . SER A  1 114 ? 13.952  78.143   103.467 1.00 14.34 ? 195  SER A O   1 
ATOM   868   C  CB  . SER A  1 114 ? 13.294  74.769   103.914 1.00 13.35 ? 195  SER A CB  1 
ATOM   869   O  OG  . SER A  1 114 ? 13.556  74.245   105.209 1.00 13.72 ? 195  SER A OG  1 
ATOM   870   N  N   . GLY A  1 115 ? 14.619  77.020   105.290 1.00 14.02 ? 196  GLY A N   1 
ATOM   871   C  CA  . GLY A  1 115 ? 15.672  77.987   105.551 1.00 14.60 ? 196  GLY A CA  1 
ATOM   872   C  C   . GLY A  1 115 ? 15.264  78.973   106.642 1.00 14.73 ? 196  GLY A C   1 
ATOM   873   O  O   . GLY A  1 115 ? 14.113  78.962   107.092 1.00 14.27 ? 196  GLY A O   1 
ATOM   874   N  N   . PRO A  1 116 ? 16.182  79.846   107.083 1.00 13.82 ? 197  PRO A N   1 
ATOM   875   C  CA  . PRO A  1 116 ? 15.931  80.844   108.127 1.00 13.32 ? 197  PRO A CA  1 
ATOM   876   C  C   . PRO A  1 116 ? 14.975  81.932   107.660 1.00 15.28 ? 197  PRO A C   1 
ATOM   877   O  O   . PRO A  1 116 ? 14.797  82.138   106.459 1.00 16.27 ? 197  PRO A O   1 
ATOM   878   C  CB  . PRO A  1 116 ? 17.322  81.385   108.411 1.00 11.55 ? 197  PRO A CB  1 
ATOM   879   C  CG  . PRO A  1 116 ? 17.936  81.362   107.063 1.00 11.13 ? 197  PRO A CG  1 
ATOM   880   C  CD  . PRO A  1 116 ? 17.537  80.004   106.533 1.00 13.10 ? 197  PRO A CD  1 
ATOM   881   N  N   . ASP A  1 117 ? 14.370  82.641   108.604 1.00 15.86 ? 198  ASP A N   1 
ATOM   882   C  CA  . ASP A  1 117 ? 13.432  83.687   108.250 1.00 15.64 ? 198  ASP A CA  1 
ATOM   883   C  C   . ASP A  1 117 ? 14.078  84.829   107.491 1.00 15.73 ? 198  ASP A C   1 
ATOM   884   O  O   . ASP A  1 117 ? 13.436  85.460   106.653 1.00 16.89 ? 198  ASP A O   1 
ATOM   885   C  CB  . ASP A  1 117 ? 12.743  84.215   109.499 1.00 17.03 ? 198  ASP A CB  1 
ATOM   886   C  CG  . ASP A  1 117 ? 11.955  83.142   110.212 1.00 20.96 ? 198  ASP A CG  1 
ATOM   887   O  OD1 . ASP A  1 117 ? 11.651  82.108   109.571 1.00 21.33 ? 198  ASP A OD1 1 
ATOM   888   O  OD2 . ASP A  1 117 ? 11.627  83.332   111.406 1.00 22.40 ? 198  ASP A OD2 1 
ATOM   889   N  N   . ASN A  1 118 ? 15.347  85.097   107.761 1.00 14.65 ? 199  ASN A N   1 
ATOM   890   C  CA  . ASN A  1 118 ? 16.007  86.190   107.065 1.00 15.74 ? 199  ASN A CA  1 
ATOM   891   C  C   . ASN A  1 118 ? 16.612  85.814   105.700 1.00 16.31 ? 199  ASN A C   1 
ATOM   892   O  O   . ASN A  1 118 ? 17.439  86.549   105.157 1.00 17.01 ? 199  ASN A O   1 
ATOM   893   C  CB  . ASN A  1 118 ? 17.087  86.809   107.955 1.00 15.16 ? 199  ASN A CB  1 
ATOM   894   C  CG  . ASN A  1 118 ? 18.287  85.894   108.155 1.00 16.89 ? 199  ASN A CG  1 
ATOM   895   O  OD1 . ASN A  1 118 ? 18.444  84.879   107.471 1.00 16.55 ? 199  ASN A OD1 1 
ATOM   896   N  ND2 . ASN A  1 118 ? 19.150  86.265   109.089 1.00 17.14 ? 199  ASN A ND2 1 
ATOM   897   N  N   . GLY A  1 119 ? 16.195  84.687   105.134 1.00 15.78 ? 200  GLY A N   1 
ATOM   898   C  CA  . GLY A  1 119 ? 16.734  84.293   103.845 1.00 15.53 ? 200  GLY A CA  1 
ATOM   899   C  C   . GLY A  1 119 ? 16.210  82.962   103.342 1.00 16.53 ? 200  GLY A C   1 
ATOM   900   O  O   . GLY A  1 119 ? 16.950  82.181   102.735 1.00 16.45 ? 200  GLY A O   1 
ATOM   901   N  N   . ALA A  1 120 ? 14.928  82.706   103.577 1.00 15.80 ? 201  ALA A N   1 
ATOM   902   C  CA  . ALA A  1 120 ? 14.321  81.458   103.138 1.00 16.89 ? 201  ALA A CA  1 
ATOM   903   C  C   . ALA A  1 120 ? 14.457  81.302   101.632 1.00 17.50 ? 201  ALA A C   1 
ATOM   904   O  O   . ALA A  1 120 ? 14.439  82.286   100.894 1.00 16.19 ? 201  ALA A O   1 
ATOM   905   C  CB  . ALA A  1 120 ? 12.847  81.417   103.536 1.00 16.84 ? 201  ALA A CB  1 
ATOM   906   N  N   . VAL A  1 121 ? 14.582  80.057   101.185 1.00 17.48 ? 202  VAL A N   1 
ATOM   907   C  CA  . VAL A  1 121 ? 14.724  79.778   99.773  1.00 19.00 ? 202  VAL A CA  1 
ATOM   908   C  C   . VAL A  1 121 ? 13.677  78.763   99.296  1.00 17.84 ? 202  VAL A C   1 
ATOM   909   O  O   . VAL A  1 121 ? 13.502  77.705   99.890  1.00 17.44 ? 202  VAL A O   1 
ATOM   910   C  CB  . VAL A  1 121 ? 16.151  79.265   99.480  1.00 20.26 ? 202  VAL A CB  1 
ATOM   911   C  CG1 . VAL A  1 121 ? 16.334  77.874   100.043 1.00 24.44 ? 202  VAL A CG1 1 
ATOM   912   C  CG2 . VAL A  1 121 ? 16.413  79.285   97.997  1.00 22.15 ? 202  VAL A CG2 1 
ATOM   913   N  N   . ALA A  1 122 ? 12.959  79.104   98.234  1.00 16.91 ? 203  ALA A N   1 
ATOM   914   C  CA  . ALA A  1 122 ? 11.946  78.202   97.705  1.00 17.21 ? 203  ALA A CA  1 
ATOM   915   C  C   . ALA A  1 122 ? 12.584  77.293   96.663  1.00 17.67 ? 203  ALA A C   1 
ATOM   916   O  O   . ALA A  1 122 ? 13.187  77.766   95.697  1.00 17.04 ? 203  ALA A O   1 
ATOM   917   C  CB  . ALA A  1 122 ? 10.800  78.991   97.078  1.00 16.10 ? 203  ALA A CB  1 
ATOM   918   N  N   . VAL A  1 123 ? 12.464  75.988   96.875  1.00 17.43 ? 204  VAL A N   1 
ATOM   919   C  CA  . VAL A  1 123 ? 13.021  75.025   95.947  1.00 17.69 ? 204  VAL A CA  1 
ATOM   920   C  C   . VAL A  1 123 ? 11.890  74.516   95.084  1.00 18.60 ? 204  VAL A C   1 
ATOM   921   O  O   . VAL A  1 123 ? 10.924  73.942   95.596  1.00 18.84 ? 204  VAL A O   1 
ATOM   922   C  CB  . VAL A  1 123 ? 13.650  73.818   96.684  1.00 18.02 ? 204  VAL A CB  1 
ATOM   923   C  CG1 . VAL A  1 123 ? 14.042  72.724   95.674  1.00 15.46 ? 204  VAL A CG1 1 
ATOM   924   C  CG2 . VAL A  1 123 ? 14.866  74.268   97.459  1.00 15.08 ? 204  VAL A CG2 1 
ATOM   925   N  N   . LEU A  1 124 ? 11.993  74.737   93.780  1.00 18.11 ? 205  LEU A N   1 
ATOM   926   C  CA  . LEU A  1 124 ? 10.967  74.261   92.871  1.00 17.88 ? 205  LEU A CA  1 
ATOM   927   C  C   . LEU A  1 124 ? 11.382  72.906   92.330  1.00 17.55 ? 205  LEU A C   1 
ATOM   928   O  O   . LEU A  1 124 ? 12.516  72.728   91.876  1.00 17.89 ? 205  LEU A O   1 
ATOM   929   C  CB  . LEU A  1 124 ? 10.776  75.217   91.694  1.00 19.18 ? 205  LEU A CB  1 
ATOM   930   C  CG  . LEU A  1 124 ? 10.551  76.711   91.936  1.00 21.86 ? 205  LEU A CG  1 
ATOM   931   C  CD1 . LEU A  1 124 ? 9.782   77.279   90.746  1.00 21.24 ? 205  LEU A CD1 1 
ATOM   932   C  CD2 . LEU A  1 124 ? 9.781   76.943   93.215  1.00 21.92 ? 205  LEU A CD2 1 
ATOM   933   N  N   . LYS A  1 125 ? 10.464  71.950   92.376  1.00 17.46 ? 206  LYS A N   1 
ATOM   934   C  CA  . LYS A  1 125 ? 10.738  70.614   91.864  1.00 16.68 ? 206  LYS A CA  1 
ATOM   935   C  C   . LYS A  1 125 ? 9.727   70.251   90.788  1.00 16.74 ? 206  LYS A C   1 
ATOM   936   O  O   . LYS A  1 125 ? 8.538   70.562   90.902  1.00 14.41 ? 206  LYS A O   1 
ATOM   937   C  CB  . LYS A  1 125 ? 10.664  69.577   92.978  1.00 16.03 ? 206  LYS A CB  1 
ATOM   938   C  CG  . LYS A  1 125 ? 11.784  69.629   93.979  1.00 16.83 ? 206  LYS A CG  1 
ATOM   939   C  CD  . LYS A  1 125 ? 11.618  68.486   94.949  1.00 18.77 ? 206  LYS A CD  1 
ATOM   940   C  CE  . LYS A  1 125 ? 12.643  68.501   96.045  1.00 19.73 ? 206  LYS A CE  1 
ATOM   941   N  NZ  . LYS A  1 125 ? 12.459  67.286   96.872  1.00 21.74 ? 206  LYS A NZ  1 
ATOM   942   N  N   . TYR A  1 126 ? 10.213  69.598   89.740  1.00 17.08 ? 207  TYR A N   1 
ATOM   943   C  CA  . TYR A  1 126 ? 9.362   69.170   88.642  1.00 18.26 ? 207  TYR A CA  1 
ATOM   944   C  C   . TYR A  1 126 ? 9.594   67.674   88.522  1.00 19.35 ? 207  TYR A C   1 
ATOM   945   O  O   . TYR A  1 126 ? 10.701  67.226   88.220  1.00 20.17 ? 207  TYR A O   1 
ATOM   946   C  CB  . TYR A  1 126 ? 9.751   69.892   87.353  1.00 17.23 ? 207  TYR A CB  1 
ATOM   947   C  CG  . TYR A  1 126 ? 8.712   69.801   86.259  1.00 17.89 ? 207  TYR A CG  1 
ATOM   948   C  CD1 . TYR A  1 126 ? 8.973   69.093   85.086  1.00 17.83 ? 207  TYR A CD1 1 
ATOM   949   C  CD2 . TYR A  1 126 ? 7.470   70.430   86.389  1.00 16.91 ? 207  TYR A CD2 1 
ATOM   950   C  CE1 . TYR A  1 126 ? 8.028   69.007   84.057  1.00 18.69 ? 207  TYR A CE1 1 
ATOM   951   C  CE2 . TYR A  1 126 ? 6.510   70.353   85.362  1.00 19.03 ? 207  TYR A CE2 1 
ATOM   952   C  CZ  . TYR A  1 126 ? 6.801   69.637   84.198  1.00 19.81 ? 207  TYR A CZ  1 
ATOM   953   O  OH  . TYR A  1 126 ? 5.874   69.537   83.179  1.00 19.46 ? 207  TYR A OH  1 
ATOM   954   N  N   . ASN A  1 127 ? 8.539   66.909   88.781  1.00 21.00 ? 208  ASN A N   1 
ATOM   955   C  CA  . ASN A  1 127 ? 8.590   65.454   88.758  1.00 22.53 ? 208  ASN A CA  1 
ATOM   956   C  C   . ASN A  1 127 ? 9.638   64.957   89.744  1.00 22.65 ? 208  ASN A C   1 
ATOM   957   O  O   . ASN A  1 127 ? 10.401  64.039   89.442  1.00 24.18 ? 208  ASN A O   1 
ATOM   958   C  CB  . ASN A  1 127 ? 8.920   64.916   87.366  1.00 23.51 ? 208  ASN A CB  1 
ATOM   959   C  CG  . ASN A  1 127 ? 8.311   63.534   87.125  1.00 27.35 ? 208  ASN A CG  1 
ATOM   960   O  OD1 . ASN A  1 127 ? 8.347   62.656   87.995  1.00 24.99 ? 208  ASN A OD1 1 
ATOM   961   N  ND2 . ASN A  1 127 ? 7.744   63.342   85.940  1.00 31.20 ? 208  ASN A ND2 1 
ATOM   962   N  N   . GLY A  1 128 ? 9.683   65.577   90.918  1.00 22.13 ? 209  GLY A N   1 
ATOM   963   C  CA  . GLY A  1 128 ? 10.637  65.162   91.928  1.00 22.36 ? 209  GLY A CA  1 
ATOM   964   C  C   . GLY A  1 128 ? 12.045  65.727   91.815  1.00 23.48 ? 209  GLY A C   1 
ATOM   965   O  O   . GLY A  1 128 ? 12.837  65.588   92.757  1.00 23.90 ? 209  GLY A O   1 
ATOM   966   N  N   . ILE A  1 129 ? 12.387  66.349   90.688  1.00 21.17 ? 210  ILE A N   1 
ATOM   967   C  CA  . ILE A  1 129 ? 13.727  66.903   90.579  1.00 20.76 ? 210  ILE A CA  1 
ATOM   968   C  C   . ILE A  1 129 ? 13.723  68.426   90.582  1.00 19.26 ? 210  ILE A C   1 
ATOM   969   O  O   . ILE A  1 129 ? 12.912  69.068   89.907  1.00 18.97 ? 210  ILE A O   1 
ATOM   970   C  CB  . ILE A  1 129 ? 14.491  66.394   89.316  1.00 21.51 ? 210  ILE A CB  1 
ATOM   971   C  CG1 . ILE A  1 129 ? 14.238  67.313   88.138  1.00 23.68 ? 210  ILE A CG1 1 
ATOM   972   C  CG2 . ILE A  1 129 ? 14.048  64.975   88.959  1.00 19.69 ? 210  ILE A CG2 1 
ATOM   973   C  CD1 . ILE A  1 129 ? 15.096  66.986   86.962  1.00 28.61 ? 210  ILE A CD1 1 
ATOM   974   N  N   . ILE A  1 130 ? 14.631  68.987   91.374  1.00 17.85 ? 211  ILE A N   1 
ATOM   975   C  CA  . ILE A  1 130 ? 14.795  70.424   91.506  1.00 15.67 ? 211  ILE A CA  1 
ATOM   976   C  C   . ILE A  1 130 ? 15.050  71.068   90.146  1.00 15.85 ? 211  ILE A C   1 
ATOM   977   O  O   . ILE A  1 130 ? 15.986  70.699   89.437  1.00 12.93 ? 211  ILE A O   1 
ATOM   978   C  CB  . ILE A  1 130 ? 15.960  70.730   92.443  1.00 15.03 ? 211  ILE A CB  1 
ATOM   979   C  CG1 . ILE A  1 130 ? 15.672  70.105   93.812  1.00 12.52 ? 211  ILE A CG1 1 
ATOM   980   C  CG2 . ILE A  1 130 ? 16.179  72.247   92.534  1.00 13.21 ? 211  ILE A CG2 1 
ATOM   981   C  CD1 . ILE A  1 130 ? 16.807  70.242   94.795  1.00 13.33 ? 211  ILE A CD1 1 
ATOM   982   N  N   . THR A  1 131 ? 14.206  72.035   89.795  1.00 16.30 ? 212  THR A N   1 
ATOM   983   C  CA  . THR A  1 131 ? 14.314  72.719   88.517  1.00 19.22 ? 212  THR A CA  1 
ATOM   984   C  C   . THR A  1 131 ? 14.587  74.215   88.649  1.00 20.55 ? 212  THR A C   1 
ATOM   985   O  O   . THR A  1 131 ? 14.910  74.883   87.664  1.00 21.35 ? 212  THR A O   1 
ATOM   986   C  CB  . THR A  1 131 ? 13.042  72.517   87.681  1.00 18.80 ? 212  THR A CB  1 
ATOM   987   O  OG1 . THR A  1 131 ? 11.891  72.639   88.526  1.00 21.26 ? 212  THR A OG1 1 
ATOM   988   C  CG2 . THR A  1 131 ? 13.052  71.146   87.026  1.00 18.48 ? 212  THR A CG2 1 
ATOM   989   N  N   . ASP A  1 132 ? 14.447  74.741   89.860  1.00 20.54 ? 213  ASP A N   1 
ATOM   990   C  CA  . ASP A  1 132 ? 14.717  76.144   90.091  1.00 21.22 ? 213  ASP A CA  1 
ATOM   991   C  C   . ASP A  1 132 ? 14.691  76.466   91.575  1.00 21.21 ? 213  ASP A C   1 
ATOM   992   O  O   . ASP A  1 132 ? 14.234  75.668   92.389  1.00 19.66 ? 213  ASP A O   1 
ATOM   993   C  CB  . ASP A  1 132 ? 13.713  77.025   89.345  1.00 23.15 ? 213  ASP A CB  1 
ATOM   994   C  CG  . ASP A  1 132 ? 14.290  78.398   88.997  1.00 26.98 ? 213  ASP A CG  1 
ATOM   995   O  OD1 . ASP A  1 132 ? 15.455  78.671   89.371  1.00 28.74 ? 213  ASP A OD1 1 
ATOM   996   O  OD2 . ASP A  1 132 ? 13.586  79.207   88.349  1.00 29.00 ? 213  ASP A OD2 1 
ATOM   997   N  N   . THR A  1 133 ? 15.201  77.647   91.909  1.00 22.05 ? 214  THR A N   1 
ATOM   998   C  CA  . THR A  1 133 ? 15.266  78.133   93.281  1.00 22.43 ? 214  THR A CA  1 
ATOM   999   C  C   . THR A  1 133 ? 14.948  79.630   93.312  1.00 22.22 ? 214  THR A C   1 
ATOM   1000  O  O   . THR A  1 133 ? 15.369  80.373   92.423  1.00 23.75 ? 214  THR A O   1 
ATOM   1001  C  CB  . THR A  1 133 ? 16.672  77.902   93.856  1.00 23.50 ? 214  THR A CB  1 
ATOM   1002  O  OG1 . THR A  1 133 ? 16.665  76.727   94.672  1.00 25.19 ? 214  THR A OG1 1 
ATOM   1003  C  CG2 . THR A  1 133 ? 17.126  79.087   94.663  1.00 25.38 ? 214  THR A CG2 1 
ATOM   1004  N  N   . ILE A  1 134 ? 14.199  80.061   94.327  1.00 21.06 ? 215  ILE A N   1 
ATOM   1005  C  CA  . ILE A  1 134 ? 13.835  81.473   94.491  1.00 19.87 ? 215  ILE A CA  1 
ATOM   1006  C  C   . ILE A  1 134 ? 14.171  81.907   95.913  1.00 19.65 ? 215  ILE A C   1 
ATOM   1007  O  O   . ILE A  1 134 ? 13.656  81.345   96.880  1.00 19.12 ? 215  ILE A O   1 
ATOM   1008  C  CB  . ILE A  1 134 ? 12.315  81.718   94.272  1.00 20.43 ? 215  ILE A CB  1 
ATOM   1009  C  CG1 . ILE A  1 134 ? 11.897  81.266   92.874  1.00 19.77 ? 215  ILE A CG1 1 
ATOM   1010  C  CG2 . ILE A  1 134 ? 12.002  83.196   94.433  1.00 19.72 ? 215  ILE A CG2 1 
ATOM   1011  C  CD1 . ILE A  1 134 ? 10.407  81.375   92.627  1.00 19.13 ? 215  ILE A CD1 1 
ATOM   1012  N  N   . LYS A  1 135 ? 15.041  82.903   96.036  1.00 20.61 ? 216  LYS A N   1 
ATOM   1013  C  CA  . LYS A  1 135 ? 15.443  83.418   97.341  1.00 21.95 ? 216  LYS A CA  1 
ATOM   1014  C  C   . LYS A  1 135 ? 14.556  84.561   97.809  1.00 20.28 ? 216  LYS A C   1 
ATOM   1015  O  O   . LYS A  1 135 ? 13.964  85.272   97.006  1.00 20.74 ? 216  LYS A O   1 
ATOM   1016  C  CB  . LYS A  1 135 ? 16.873  83.951   97.289  1.00 25.59 ? 216  LYS A CB  1 
ATOM   1017  C  CG  . LYS A  1 135 ? 17.965  82.948   97.530  1.00 31.88 ? 216  LYS A CG  1 
ATOM   1018  C  CD  . LYS A  1 135 ? 19.225  83.348   96.739  1.00 35.73 ? 216  LYS A CD  1 
ATOM   1019  C  CE  . LYS A  1 135 ? 19.026  83.176   95.205  1.00 35.67 ? 216  LYS A CE  1 
ATOM   1020  N  NZ  . LYS A  1 135 ? 20.210  83.584   94.369  1.00 32.73 ? 216  LYS A NZ  1 
ATOM   1021  N  N   . SER A  1 136 ? 14.493  84.730   99.124  1.00 20.14 ? 217  SER A N   1 
ATOM   1022  C  CA  . SER A  1 136 ? 13.747  85.808   99.747  1.00 19.10 ? 217  SER A CA  1 
ATOM   1023  C  C   . SER A  1 136 ? 14.343  87.077   99.145  1.00 18.33 ? 217  SER A C   1 
ATOM   1024  O  O   . SER A  1 136 ? 15.542  87.115   98.868  1.00 18.09 ? 217  SER A O   1 
ATOM   1025  C  CB  . SER A  1 136 ? 14.004  85.779   101.256 1.00 19.48 ? 217  SER A CB  1 
ATOM   1026  O  OG  . SER A  1 136 ? 13.403  86.873   101.926 1.00 20.55 ? 217  SER A OG  1 
ATOM   1027  N  N   . TRP A  1 137 ? 13.525  88.098   98.910  1.00 17.63 ? 218  TRP A N   1 
ATOM   1028  C  CA  . TRP A  1 137 ? 14.051  89.346   98.357  1.00 18.14 ? 218  TRP A CA  1 
ATOM   1029  C  C   . TRP A  1 137 ? 13.845  90.480   99.353  1.00 18.41 ? 218  TRP A C   1 
ATOM   1030  O  O   . TRP A  1 137 ? 14.129  91.635   99.050  1.00 18.79 ? 218  TRP A O   1 
ATOM   1031  C  CB  . TRP A  1 137 ? 13.401  89.676   96.999  1.00 17.02 ? 218  TRP A CB  1 
ATOM   1032  C  CG  . TRP A  1 137 ? 11.926  89.892   97.057  1.00 17.88 ? 218  TRP A CG  1 
ATOM   1033  C  CD1 . TRP A  1 137 ? 11.287  91.052   97.338  1.00 17.33 ? 218  TRP A CD1 1 
ATOM   1034  C  CD2 . TRP A  1 137 ? 10.903  88.895   96.894  1.00 18.25 ? 218  TRP A CD2 1 
ATOM   1035  N  NE1 . TRP A  1 137 ? 9.924   90.851   97.371  1.00 19.56 ? 218  TRP A NE1 1 
ATOM   1036  C  CE2 . TRP A  1 137 ? 9.662   89.533   97.104  1.00 18.71 ? 218  TRP A CE2 1 
ATOM   1037  C  CE3 . TRP A  1 137 ? 10.919  87.522   96.599  1.00 18.31 ? 218  TRP A CE3 1 
ATOM   1038  C  CZ2 . TRP A  1 137 ? 8.440   88.851   97.023  1.00 18.18 ? 218  TRP A CZ2 1 
ATOM   1039  C  CZ3 . TRP A  1 137 ? 9.703   86.841   96.517  1.00 17.20 ? 218  TRP A CZ3 1 
ATOM   1040  C  CH2 . TRP A  1 137 ? 8.482   87.508   96.732  1.00 18.01 ? 218  TRP A CH2 1 
ATOM   1041  N  N   . ARG A  1 138 ? 13.354  90.134   100.543 1.00 18.65 ? 219  ARG A N   1 
ATOM   1042  C  CA  . ARG A  1 138 ? 13.136  91.100   101.622 1.00 19.86 ? 219  ARG A CA  1 
ATOM   1043  C  C   . ARG A  1 138 ? 13.763  90.570   102.898 1.00 19.71 ? 219  ARG A C   1 
ATOM   1044  O  O   . ARG A  1 138 ? 13.933  91.310   103.867 1.00 20.54 ? 219  ARG A O   1 
ATOM   1045  C  CB  . ARG A  1 138 ? 11.648  91.325   101.881 1.00 23.14 ? 219  ARG A CB  1 
ATOM   1046  C  CG  . ARG A  1 138 ? 10.941  92.071   100.787 1.00 27.04 ? 219  ARG A CG  1 
ATOM   1047  C  CD  . ARG A  1 138 ? 11.507  93.464   100.620 1.00 31.10 ? 219  ARG A CD  1 
ATOM   1048  N  NE  . ARG A  1 138 ? 10.873  94.127   99.490  1.00 36.52 ? 219  ARG A NE  1 
ATOM   1049  C  CZ  . ARG A  1 138 ? 11.167  95.352   99.080  1.00 39.10 ? 219  ARG A CZ  1 
ATOM   1050  N  NH1 . ARG A  1 138 ? 12.096  96.059   99.716  1.00 40.63 ? 219  ARG A NH1 1 
ATOM   1051  N  NH2 . ARG A  1 138 ? 10.534  95.864   98.028  1.00 41.12 ? 219  ARG A NH2 1 
ATOM   1052  N  N   . ASN A  1 139 ? 14.101  89.283   102.886 1.00 18.21 ? 220  ASN A N   1 
ATOM   1053  C  CA  . ASN A  1 139 ? 14.710  88.619   104.035 1.00 17.80 ? 220  ASN A CA  1 
ATOM   1054  C  C   . ASN A  1 139 ? 13.804  88.714   105.242 1.00 16.24 ? 220  ASN A C   1 
ATOM   1055  O  O   . ASN A  1 139 ? 14.236  89.056   106.344 1.00 15.27 ? 220  ASN A O   1 
ATOM   1056  C  CB  . ASN A  1 139 ? 16.066  89.238   104.380 1.00 18.18 ? 220  ASN A CB  1 
ATOM   1057  C  CG  . ASN A  1 139 ? 16.961  89.374   103.183 1.00 19.49 ? 220  ASN A CG  1 
ATOM   1058  O  OD1 . ASN A  1 139 ? 16.989  88.508   102.304 1.00 20.57 ? 220  ASN A OD1 1 
ATOM   1059  N  ND2 . ASN A  1 139 ? 17.712  90.462   103.140 1.00 22.28 ? 220  ASN A ND2 1 
ATOM   1060  N  N   . ASN A  1 140 ? 12.535  88.423   105.023 1.00 16.62 ? 221  ASN A N   1 
ATOM   1061  C  CA  . ASN A  1 140 ? 11.576  88.462   106.102 1.00 16.51 ? 221  ASN A CA  1 
ATOM   1062  C  C   . ASN A  1 140 ? 10.441  87.483   105.853 1.00 16.95 ? 221  ASN A C   1 
ATOM   1063  O  O   . ASN A  1 140 ? 9.322   87.864   105.490 1.00 14.88 ? 221  ASN A O   1 
ATOM   1064  C  CB  . ASN A  1 140 ? 11.029  89.873   106.284 1.00 16.18 ? 221  ASN A CB  1 
ATOM   1065  C  CG  . ASN A  1 140 ? 10.164  89.994   107.516 1.00 16.15 ? 221  ASN A CG  1 
ATOM   1066  O  OD1 . ASN A  1 140 ? 10.009  89.030   108.277 1.00 13.85 ? 221  ASN A OD1 1 
ATOM   1067  N  ND2 . ASN A  1 140 ? 9.592   91.180   107.726 1.00 14.82 ? 221  ASN A ND2 1 
ATOM   1068  N  N   . ILE A  1 141 ? 10.778  86.209   106.032 1.00 17.00 ? 222  ILE A N   1 
ATOM   1069  C  CA  . ILE A  1 141 ? 9.855   85.088   105.898 1.00 16.96 ? 222  ILE A CA  1 
ATOM   1070  C  C   . ILE A  1 141 ? 9.150   84.947   104.564 1.00 17.43 ? 222  ILE A C   1 
ATOM   1071  O  O   . ILE A  1 141 ? 7.951   85.185   104.455 1.00 17.41 ? 222  ILE A O   1 
ATOM   1072  C  CB  . ILE A  1 141 ? 8.806   85.121   107.023 1.00 15.39 ? 222  ILE A CB  1 
ATOM   1073  C  CG1 . ILE A  1 141 ? 9.511   85.397   108.357 1.00 15.57 ? 222  ILE A CG1 1 
ATOM   1074  C  CG2 . ILE A  1 141 ? 8.083   83.792   107.100 1.00 15.04 ? 222  ILE A CG2 1 
ATOM   1075  C  CD1 . ILE A  1 141 ? 8.591   85.440   109.553 1.00 15.78 ? 222  ILE A CD1 1 
ATOM   1076  N  N   . LEU A  1 142 ? 9.908   84.548   103.548 1.00 18.31 ? 223  LEU A N   1 
ATOM   1077  C  CA  . LEU A  1 142 ? 9.348   84.329   102.223 1.00 17.67 ? 223  LEU A CA  1 
ATOM   1078  C  C   . LEU A  1 142 ? 8.305   83.230   102.420 1.00 17.56 ? 223  LEU A C   1 
ATOM   1079  O  O   . LEU A  1 142 ? 8.591   82.201   103.029 1.00 18.15 ? 223  LEU A O   1 
ATOM   1080  C  CB  . LEU A  1 142 ? 10.442  83.846   101.259 1.00 16.32 ? 223  LEU A CB  1 
ATOM   1081  C  CG  . LEU A  1 142 ? 9.963   83.380   99.874  1.00 18.05 ? 223  LEU A CG  1 
ATOM   1082  C  CD1 . LEU A  1 142 ? 9.396   84.557   99.096  1.00 14.55 ? 223  LEU A CD1 1 
ATOM   1083  C  CD2 . LEU A  1 142 ? 11.117  82.743   99.106  1.00 14.71 ? 223  LEU A CD2 1 
ATOM   1084  N  N   . ARG A  1 143 ? 7.096   83.447   101.922 1.00 17.01 ? 224  ARG A N   1 
ATOM   1085  C  CA  . ARG A  1 143 ? 6.040   82.456   102.075 1.00 15.94 ? 224  ARG A CA  1 
ATOM   1086  C  C   . ARG A  1 143 ? 5.165   82.413   100.826 1.00 16.43 ? 224  ARG A C   1 
ATOM   1087  O  O   . ARG A  1 143 ? 5.180   83.337   100.005 1.00 16.62 ? 224  ARG A O   1 
ATOM   1088  C  CB  . ARG A  1 143 ? 5.213   82.764   103.331 1.00 16.44 ? 224  ARG A CB  1 
ATOM   1089  C  CG  . ARG A  1 143 ? 4.896   84.252   103.548 1.00 16.53 ? 224  ARG A CG  1 
ATOM   1090  C  CD  . ARG A  1 143 ? 4.494   84.547   104.992 1.00 16.38 ? 224  ARG A CD  1 
ATOM   1091  N  NE  . ARG A  1 143 ? 3.965   85.903   105.175 1.00 18.27 ? 224  ARG A NE  1 
ATOM   1092  C  CZ  . ARG A  1 143 ? 4.689   87.017   105.102 1.00 16.44 ? 224  ARG A CZ  1 
ATOM   1093  N  NH1 . ARG A  1 143 ? 4.114   88.197   105.275 1.00 15.23 ? 224  ARG A NH1 1 
ATOM   1094  N  NH2 . ARG A  1 143 ? 5.988   86.953   104.864 1.00 16.75 ? 224  ARG A NH2 1 
ATOM   1095  N  N   . THR A  1 144 ? 4.418   81.326   100.676 1.00 16.01 ? 225  THR A N   1 
ATOM   1096  C  CA  . THR A  1 144 ? 3.574   81.154   99.513  1.00 13.98 ? 225  THR A CA  1 
ATOM   1097  C  C   . THR A  1 144 ? 2.146   80.673   99.857  1.00 13.70 ? 225  THR A C   1 
ATOM   1098  O  O   . THR A  1 144 ? 1.725   80.695   101.014 1.00 12.56 ? 225  THR A O   1 
ATOM   1099  C  CB  . THR A  1 144 ? 4.298   80.225   98.498  1.00 14.32 ? 225  THR A CB  1 
ATOM   1100  O  OG1 . THR A  1 144 ? 3.515   80.086   97.308  1.00 16.38 ? 225  THR A OG1 1 
ATOM   1101  C  CG2 . THR A  1 144 ? 4.574   78.872   99.113  1.00 14.90 ? 225  THR A CG2 1 
ATOM   1102  N  N   . GLN A  1 145 ? 1.413   80.242   98.840  1.00 13.69 ? 226  GLN A N   1 
ATOM   1103  C  CA  . GLN A  1 145 ? 0.015   79.851   98.962  1.00 13.01 ? 226  GLN A CA  1 
ATOM   1104  C  C   . GLN A  1 145 ? -0.493  78.940   100.076 1.00 14.00 ? 226  GLN A C   1 
ATOM   1105  O  O   . GLN A  1 145 ? -1.482  79.259   100.738 1.00 12.95 ? 226  GLN A O   1 
ATOM   1106  C  CB  . GLN A  1 145 ? -0.444  79.280   97.626  1.00 12.43 ? 226  GLN A CB  1 
ATOM   1107  C  CG  . GLN A  1 145 ? -0.093  80.148   96.433  1.00 14.28 ? 226  GLN A CG  1 
ATOM   1108  C  CD  . GLN A  1 145 ? -0.594  79.555   95.131  1.00 16.19 ? 226  GLN A CD  1 
ATOM   1109  O  OE1 . GLN A  1 145 ? -1.805  79.452   94.903  1.00 18.81 ? 226  GLN A OE1 1 
ATOM   1110  N  NE2 . GLN A  1 145 ? 0.332   79.151   94.273  1.00 15.85 ? 226  GLN A NE2 1 
ATOM   1111  N  N   . GLU A  1 146 ? 0.175   77.814   100.278 1.00 15.34 ? 227  GLU A N   1 
ATOM   1112  C  CA  . GLU A  1 146 ? -0.247  76.813   101.253 1.00 17.05 ? 227  GLU A CA  1 
ATOM   1113  C  C   . GLU A  1 146 ? -1.438  76.109   100.611 1.00 17.42 ? 227  GLU A C   1 
ATOM   1114  O  O   . GLU A  1 146 ? -2.333  75.611   101.294 1.00 17.37 ? 227  GLU A O   1 
ATOM   1115  C  CB  . GLU A  1 146 ? -0.686  77.407   102.600 1.00 18.01 ? 227  GLU A CB  1 
ATOM   1116  C  CG  . GLU A  1 146 ? 0.337   78.226   103.359 1.00 21.99 ? 227  GLU A CG  1 
ATOM   1117  C  CD  . GLU A  1 146 ? 1.777   77.805   103.111 1.00 24.56 ? 227  GLU A CD  1 
ATOM   1118  O  OE1 . GLU A  1 146 ? 2.052   76.592   102.955 1.00 24.74 ? 227  GLU A OE1 1 
ATOM   1119  O  OE2 . GLU A  1 146 ? 2.646   78.706   103.089 1.00 26.89 ? 227  GLU A OE2 1 
ATOM   1120  N  N   . SER A  1 147 ? -1.455  76.123   99.284  1.00 17.85 ? 228  SER A N   1 
ATOM   1121  C  CA  . SER A  1 147 ? -2.480  75.448   98.506  1.00 17.88 ? 228  SER A CA  1 
ATOM   1122  C  C   . SER A  1 147 ? -2.054  75.337   97.046  1.00 19.52 ? 228  SER A C   1 
ATOM   1123  O  O   . SER A  1 147 ? -1.008  75.834   96.636  1.00 19.59 ? 228  SER A O   1 
ATOM   1124  C  CB  . SER A  1 147 ? -3.845  76.141   98.633  1.00 17.27 ? 228  SER A CB  1 
ATOM   1125  O  OG  . SER A  1 147 ? -3.979  77.273   97.799  1.00 18.49 ? 228  SER A OG  1 
ATOM   1126  N  N   . GLU A  1 148 ? -2.870  74.642   96.277  1.00 22.14 ? 229  GLU A N   1 
ATOM   1127  C  CA  . GLU A  1 148 ? -2.640  74.393   94.861  1.00 23.90 ? 229  GLU A CA  1 
ATOM   1128  C  C   . GLU A  1 148 ? -2.294  75.634   94.041  1.00 23.85 ? 229  GLU A C   1 
ATOM   1129  O  O   . GLU A  1 148 ? -2.837  76.706   94.295  1.00 23.16 ? 229  GLU A O   1 
ATOM   1130  C  CB  . GLU A  1 148 ? -3.908  73.749   94.309  1.00 26.47 ? 229  GLU A CB  1 
ATOM   1131  C  CG  . GLU A  1 148 ? -3.990  73.633   92.829  1.00 32.07 ? 229  GLU A CG  1 
ATOM   1132  C  CD  . GLU A  1 148 ? -5.398  73.315   92.381  1.00 35.62 ? 229  GLU A CD  1 
ATOM   1133  O  OE1 . GLU A  1 148 ? -6.276  74.195   92.547  1.00 37.28 ? 229  GLU A OE1 1 
ATOM   1134  O  OE2 . GLU A  1 148 ? -5.629  72.190   91.874  1.00 37.08 ? 229  GLU A OE2 1 
ATOM   1135  N  N   . CYS A  1 149 ? -1.379  75.504   93.077  1.00 23.47 ? 230  CYS A N   1 
ATOM   1136  C  CA  . CYS A  1 149 ? -1.079  76.643   92.207  1.00 24.32 ? 230  CYS A CA  1 
ATOM   1137  C  C   . CYS A  1 149 ? -1.912  76.439   90.951  1.00 24.44 ? 230  CYS A C   1 
ATOM   1138  O  O   . CYS A  1 149 ? -2.579  75.417   90.814  1.00 24.43 ? 230  CYS A O   1 
ATOM   1139  C  CB  . CYS A  1 149 ? 0.416   76.778   91.840  1.00 24.17 ? 230  CYS A CB  1 
ATOM   1140  S  SG  . CYS A  1 149 ? 1.495   75.309   91.860  1.00 26.37 ? 230  CYS A SG  1 
ATOM   1141  N  N   . ALA A  1 150 ? -1.883  77.401   90.037  1.00 24.81 ? 231  ALA A N   1 
ATOM   1142  C  CA  . ALA A  1 150 ? -2.684  77.294   88.827  1.00 26.15 ? 231  ALA A CA  1 
ATOM   1143  C  C   . ALA A  1 150 ? -1.862  77.174   87.561  1.00 27.15 ? 231  ALA A C   1 
ATOM   1144  O  O   . ALA A  1 150 ? -0.925  77.941   87.350  1.00 27.11 ? 231  ALA A O   1 
ATOM   1145  C  CB  . ALA A  1 150 ? -3.611  78.492   88.721  1.00 26.27 ? 231  ALA A CB  1 
ATOM   1146  N  N   . CYS A  1 151 ? -2.210  76.202   86.721  1.00 27.77 ? 232  CYS A N   1 
ATOM   1147  C  CA  . CYS A  1 151 ? -1.502  76.023   85.460  1.00 29.22 ? 232  CYS A CA  1 
ATOM   1148  C  C   . CYS A  1 151 ? -2.446  76.273   84.285  1.00 29.04 ? 232  CYS A C   1 
ATOM   1149  O  O   . CYS A  1 151 ? -3.628  75.921   84.325  1.00 28.22 ? 232  CYS A O   1 
ATOM   1150  C  CB  . CYS A  1 151 ? -0.898  74.621   85.353  1.00 28.65 ? 232  CYS A CB  1 
ATOM   1151  S  SG  . CYS A  1 151 ? 0.205   74.130   86.727  1.00 32.32 ? 232  CYS A SG  1 
ATOM   1152  N  N   . VAL A  1 152 ? -1.906  76.897   83.246  1.00 28.95 ? 233  VAL A N   1 
ATOM   1153  C  CA  . VAL A  1 152 ? -2.664  77.217   82.050  1.00 29.12 ? 233  VAL A CA  1 
ATOM   1154  C  C   . VAL A  1 152 ? -1.756  77.167   80.823  1.00 28.51 ? 233  VAL A C   1 
ATOM   1155  O  O   . VAL A  1 152 ? -0.643  77.688   80.847  1.00 29.13 ? 233  VAL A O   1 
ATOM   1156  C  CB  . VAL A  1 152 ? -3.259  78.633   82.159  1.00 30.23 ? 233  VAL A CB  1 
ATOM   1157  C  CG1 . VAL A  1 152 ? -4.027  78.982   80.902  1.00 31.99 ? 233  VAL A CG1 1 
ATOM   1158  C  CG2 . VAL A  1 152 ? -4.168  78.711   83.355  1.00 30.57 ? 233  VAL A CG2 1 
ATOM   1159  N  N   . ASN A  1 153 ? -2.219  76.521   79.759  1.00 26.85 ? 234  ASN A N   1 
ATOM   1160  C  CA  . ASN A  1 153 ? -1.447  76.456   78.520  1.00 25.45 ? 234  ASN A CA  1 
ATOM   1161  C  C   . ASN A  1 153 ? 0.004   76.008   78.731  1.00 24.39 ? 234  ASN A C   1 
ATOM   1162  O  O   . ASN A  1 153 ? 0.914   76.478   78.054  1.00 24.98 ? 234  ASN A O   1 
ATOM   1163  C  CB  . ASN A  1 153 ? -1.493  77.842   77.835  1.00 25.52 ? 234  ASN A CB  1 
ATOM   1164  C  CG  . ASN A  1 153 ? -0.873  77.848   76.437  1.00 25.96 ? 234  ASN A CG  1 
ATOM   1165  O  OD1 . ASN A  1 153 ? -0.860  76.825   75.740  1.00 26.33 ? 234  ASN A OD1 1 
ATOM   1166  N  ND2 . ASN A  1 153 ? -0.374  79.013   76.014  1.00 22.63 ? 234  ASN A ND2 1 
ATOM   1167  N  N   . GLY A  1 154 ? 0.224   75.104   79.675  1.00 23.75 ? 235  GLY A N   1 
ATOM   1168  C  CA  . GLY A  1 154 ? 1.572   74.617   79.912  1.00 23.44 ? 235  GLY A CA  1 
ATOM   1169  C  C   . GLY A  1 154 ? 2.454   75.483   80.794  1.00 23.96 ? 235  GLY A C   1 
ATOM   1170  O  O   . GLY A  1 154 ? 3.666   75.289   80.849  1.00 24.12 ? 235  GLY A O   1 
ATOM   1171  N  N   . SER A  1 155 ? 1.857   76.441   81.489  1.00 23.74 ? 236  SER A N   1 
ATOM   1172  C  CA  . SER A  1 155 ? 2.617   77.315   82.374  1.00 24.49 ? 236  SER A CA  1 
ATOM   1173  C  C   . SER A  1 155 ? 1.906   77.352   83.710  1.00 24.95 ? 236  SER A C   1 
ATOM   1174  O  O   . SER A  1 155 ? 0.677   77.369   83.758  1.00 26.57 ? 236  SER A O   1 
ATOM   1175  C  CB  . SER A  1 155 ? 2.683   78.727   81.801  1.00 23.42 ? 236  SER A CB  1 
ATOM   1176  O  OG  . SER A  1 155 ? 3.282   78.707   80.519  1.00 26.32 ? 236  SER A OG  1 
ATOM   1177  N  N   . CYS A  1 156 ? 2.659   77.353   84.800  1.00 23.51 ? 237  CYS A N   1 
ATOM   1178  C  CA  . CYS A  1 156 ? 2.022   77.406   86.106  1.00 22.81 ? 237  CYS A CA  1 
ATOM   1179  C  C   . CYS A  1 156 ? 2.317   78.729   86.811  1.00 20.05 ? 237  CYS A C   1 
ATOM   1180  O  O   . CYS A  1 156 ? 3.345   79.364   86.564  1.00 19.69 ? 237  CYS A O   1 
ATOM   1181  C  CB  . CYS A  1 156 ? 2.469   76.221   86.952  1.00 25.85 ? 237  CYS A CB  1 
ATOM   1182  S  SG  . CYS A  1 156 ? 2.120   74.601   86.187  1.00 28.65 ? 237  CYS A SG  1 
ATOM   1183  N  N   . PHE A  1 157 ? 1.408   79.147   87.685  1.00 16.64 ? 238  PHE A N   1 
ATOM   1184  C  CA  . PHE A  1 157 ? 1.568   80.411   88.371  1.00 15.65 ? 238  PHE A CA  1 
ATOM   1185  C  C   . PHE A  1 157 ? 1.376   80.260   89.858  1.00 16.14 ? 238  PHE A C   1 
ATOM   1186  O  O   . PHE A  1 157 ? 0.671   79.370   90.315  1.00 16.89 ? 238  PHE A O   1 
ATOM   1187  C  CB  . PHE A  1 157 ? 0.559   81.435   87.837  1.00 15.45 ? 238  PHE A CB  1 
ATOM   1188  C  CG  . PHE A  1 157 ? 0.560   81.563   86.337  1.00 14.49 ? 238  PHE A CG  1 
ATOM   1189  C  CD1 . PHE A  1 157 ? 0.009   80.561   85.537  1.00 11.57 ? 238  PHE A CD1 1 
ATOM   1190  C  CD2 . PHE A  1 157 ? 1.128   82.674   85.724  1.00 13.20 ? 238  PHE A CD2 1 
ATOM   1191  C  CE1 . PHE A  1 157 ? 0.029   80.654   84.165  1.00 9.81  ? 238  PHE A CE1 1 
ATOM   1192  C  CE2 . PHE A  1 157 ? 1.150   82.777   84.341  1.00 13.72 ? 238  PHE A CE2 1 
ATOM   1193  C  CZ  . PHE A  1 157 ? 0.596   81.764   83.560  1.00 11.59 ? 238  PHE A CZ  1 
ATOM   1194  N  N   . THR A  1 158 ? 2.007   81.153   90.606  1.00 15.77 ? 239  THR A N   1 
ATOM   1195  C  CA  . THR A  1 158 ? 1.916   81.144   92.050  1.00 15.45 ? 239  THR A CA  1 
ATOM   1196  C  C   . THR A  1 158 ? 2.196   82.570   92.511  1.00 15.14 ? 239  THR A C   1 
ATOM   1197  O  O   . THR A  1 158 ? 2.690   83.399   91.742  1.00 15.92 ? 239  THR A O   1 
ATOM   1198  C  CB  . THR A  1 158 ? 2.961   80.165   92.670  1.00 16.43 ? 239  THR A CB  1 
ATOM   1199  O  OG1 . THR A  1 158 ? 2.647   79.942   94.045  1.00 18.49 ? 239  THR A OG1 1 
ATOM   1200  C  CG2 . THR A  1 158 ? 4.381   80.740   92.593  1.00 15.14 ? 239  THR A CG2 1 
ATOM   1201  N  N   . VAL A  1 159 ? 1.870   82.849   93.764  1.00 13.39 ? 240  VAL A N   1 
ATOM   1202  C  CA  . VAL A  1 159 ? 2.076   84.156   94.354  1.00 11.72 ? 240  VAL A CA  1 
ATOM   1203  C  C   . VAL A  1 159 ? 2.859   83.954   95.635  1.00 13.43 ? 240  VAL A C   1 
ATOM   1204  O  O   . VAL A  1 159 ? 2.522   83.091   96.438  1.00 14.67 ? 240  VAL A O   1 
ATOM   1205  C  CB  . VAL A  1 159 ? 0.742   84.816   94.720  1.00 11.63 ? 240  VAL A CB  1 
ATOM   1206  C  CG1 . VAL A  1 159 ? 0.989   86.171   95.325  1.00 10.17 ? 240  VAL A CG1 1 
ATOM   1207  C  CG2 . VAL A  1 159 ? -0.146  84.934   93.485  1.00 10.75 ? 240  VAL A CG2 1 
ATOM   1208  N  N   . MET A  1 160 ? 3.918   84.731   95.823  1.00 14.97 ? 241  MET A N   1 
ATOM   1209  C  CA  . MET A  1 160 ? 4.716   84.623   97.035  1.00 15.41 ? 241  MET A CA  1 
ATOM   1210  C  C   . MET A  1 160 ? 4.782   85.987   97.696  1.00 14.97 ? 241  MET A C   1 
ATOM   1211  O  O   . MET A  1 160 ? 4.657   87.021   97.037  1.00 14.02 ? 241  MET A O   1 
ATOM   1212  C  CB  . MET A  1 160 ? 6.137   84.145   96.727  1.00 16.50 ? 241  MET A CB  1 
ATOM   1213  C  CG  . MET A  1 160 ? 6.208   82.944   95.831  1.00 19.16 ? 241  MET A CG  1 
ATOM   1214  S  SD  . MET A  1 160 ? 7.748   82.039   96.077  1.00 23.14 ? 241  MET A SD  1 
ATOM   1215  C  CE  . MET A  1 160 ? 7.107   80.385   95.997  1.00 21.61 ? 241  MET A CE  1 
ATOM   1216  N  N   . THR A  1 161 ? 4.976   85.978   99.005  1.00 14.60 ? 242  THR A N   1 
ATOM   1217  C  CA  . THR A  1 161 ? 5.056   87.202   99.770  1.00 14.85 ? 242  THR A CA  1 
ATOM   1218  C  C   . THR A  1 161 ? 6.358   87.193   100.527 1.00 15.21 ? 242  THR A C   1 
ATOM   1219  O  O   . THR A  1 161 ? 6.866   86.139   100.899 1.00 16.98 ? 242  THR A O   1 
ATOM   1220  C  CB  . THR A  1 161 ? 3.915   87.300   100.799 1.00 14.54 ? 242  THR A CB  1 
ATOM   1221  O  OG1 . THR A  1 161 ? 2.662   87.323   100.112 1.00 16.27 ? 242  THR A OG1 1 
ATOM   1222  C  CG2 . THR A  1 161 ? 4.053   88.563   101.651 1.00 13.94 ? 242  THR A CG2 1 
ATOM   1223  N  N   . ASP A  1 162 ? 6.899   88.379   100.739 1.00 16.19 ? 243  ASP A N   1 
ATOM   1224  C  CA  . ASP A  1 162 ? 8.128   88.541   101.491 1.00 17.90 ? 243  ASP A CA  1 
ATOM   1225  C  C   . ASP A  1 162 ? 7.942   89.892   102.142 1.00 18.10 ? 243  ASP A C   1 
ATOM   1226  O  O   . ASP A  1 162 ? 7.566   90.856   101.481 1.00 20.87 ? 243  ASP A O   1 
ATOM   1227  C  CB  . ASP A  1 162 ? 9.340   88.540   100.562 1.00 17.76 ? 243  ASP A CB  1 
ATOM   1228  C  CG  . ASP A  1 162 ? 10.632  88.234   101.294 1.00 16.99 ? 243  ASP A CG  1 
ATOM   1229  O  OD1 . ASP A  1 162 ? 11.624  87.914   100.611 1.00 17.60 ? 243  ASP A OD1 1 
ATOM   1230  O  OD2 . ASP A  1 162 ? 10.655  88.319   102.541 1.00 15.48 ? 243  ASP A OD2 1 
ATOM   1231  N  N   . GLY A  1 163 ? 8.166   89.952   103.444 1.00 18.25 ? 244  GLY A N   1 
ATOM   1232  C  CA  . GLY A  1 163 ? 7.982   91.193   104.167 1.00 17.34 ? 244  GLY A CA  1 
ATOM   1233  C  C   . GLY A  1 163 ? 7.164   90.916   105.413 1.00 17.98 ? 244  GLY A C   1 
ATOM   1234  O  O   . GLY A  1 163 ? 6.840   89.766   105.697 1.00 16.74 ? 244  GLY A O   1 
ATOM   1235  N  N   . PRO A  1 164 ? 6.800   91.952   106.177 1.00 18.92 ? 245  PRO A N   1 
ATOM   1236  C  CA  . PRO A  1 164 ? 6.011   91.772   107.402 1.00 19.16 ? 245  PRO A CA  1 
ATOM   1237  C  C   . PRO A  1 164 ? 4.581   91.225   107.274 1.00 19.73 ? 245  PRO A C   1 
ATOM   1238  O  O   . PRO A  1 164 ? 3.911   91.402   106.260 1.00 19.41 ? 245  PRO A O   1 
ATOM   1239  C  CB  . PRO A  1 164 ? 6.059   93.164   108.042 1.00 17.05 ? 245  PRO A CB  1 
ATOM   1240  C  CG  . PRO A  1 164 ? 6.227   94.068   106.883 1.00 16.35 ? 245  PRO A CG  1 
ATOM   1241  C  CD  . PRO A  1 164 ? 7.219   93.356   106.022 1.00 16.78 ? 245  PRO A CD  1 
ATOM   1242  N  N   . SER A  1 165 ? 4.129   90.534   108.313 1.00 21.43 ? 246  SER A N   1 
ATOM   1243  C  CA  . SER A  1 165 ? 2.777   90.005   108.323 1.00 23.58 ? 246  SER A CA  1 
ATOM   1244  C  C   . SER A  1 165 ? 1.848   91.076   108.909 1.00 24.06 ? 246  SER A C   1 
ATOM   1245  O  O   . SER A  1 165 ? 0.638   90.879   109.021 1.00 24.91 ? 246  SER A O   1 
ATOM   1246  C  CB  . SER A  1 165 ? 2.713   88.697   109.116 1.00 25.31 ? 246  SER A CB  1 
ATOM   1247  O  OG  . SER A  1 165 ? 3.380   88.813   110.362 1.00 31.17 ? 246  SER A OG  1 
ATOM   1248  N  N   . ASN A  1 166 ? 2.441   92.211   109.277 1.00 25.09 ? 247  ASN A N   1 
ATOM   1249  C  CA  . ASN A  1 166 ? 1.705   93.374   109.765 1.00 25.61 ? 247  ASN A CA  1 
ATOM   1250  C  C   . ASN A  1 166 ? 1.632   94.289   108.558 1.00 26.93 ? 247  ASN A C   1 
ATOM   1251  O  O   . ASN A  1 166 ? 1.144   93.895   107.503 1.00 31.76 ? 247  ASN A O   1 
ATOM   1252  C  CB  . ASN A  1 166 ? 2.467   94.110   110.843 1.00 25.93 ? 247  ASN A CB  1 
ATOM   1253  C  CG  . ASN A  1 166 ? 2.701   93.271   112.028 1.00 24.51 ? 247  ASN A CG  1 
ATOM   1254  O  OD1 . ASN A  1 166 ? 1.822   92.512   112.425 1.00 28.04 ? 247  ASN A OD1 1 
ATOM   1255  N  ND2 . ASN A  1 166 ? 3.872   93.400   112.630 1.00 20.40 ? 247  ASN A ND2 1 
ATOM   1256  N  N   . GLY A  1 167 ? 2.154   95.499   108.698 1.00 24.96 ? 248  GLY A N   1 
ATOM   1257  C  CA  . GLY A  1 167 ? 2.135   96.446   107.593 1.00 23.52 ? 248  GLY A CA  1 
ATOM   1258  C  C   . GLY A  1 167 ? 2.501   95.962   106.195 1.00 22.24 ? 248  GLY A C   1 
ATOM   1259  O  O   . GLY A  1 167 ? 2.632   94.773   105.928 1.00 19.88 ? 248  GLY A O   1 
ATOM   1260  N  N   . GLN A  1 168 ? 2.655   96.926   105.294 1.00 22.89 ? 249  GLN A N   1 
ATOM   1261  C  CA  . GLN A  1 168 ? 3.007   96.677   103.903 1.00 22.44 ? 249  GLN A CA  1 
ATOM   1262  C  C   . GLN A  1 168 ? 4.042   95.592   103.753 1.00 23.37 ? 249  GLN A C   1 
ATOM   1263  O  O   . GLN A  1 168 ? 5.012   95.538   104.513 1.00 25.14 ? 249  GLN A O   1 
ATOM   1264  C  CB  . GLN A  1 168 ? 3.577   97.945   103.273 1.00 22.76 ? 249  GLN A CB  1 
ATOM   1265  C  CG  . GLN A  1 168 ? 2.602   98.731   102.454 1.00 24.27 ? 249  GLN A CG  1 
ATOM   1266  C  CD  . GLN A  1 168 ? 2.113   97.939   101.292 1.00 22.52 ? 249  GLN A CD  1 
ATOM   1267  O  OE1 . GLN A  1 168 ? 2.884   97.263   100.634 1.00 26.67 ? 249  GLN A OE1 1 
ATOM   1268  N  NE2 . GLN A  1 168 ? 0.831   98.015   101.024 1.00 25.82 ? 249  GLN A NE2 1 
ATOM   1269  N  N   . ALA A  1 169 ? 3.840   94.732   102.762 1.00 21.57 ? 250  ALA A N   1 
ATOM   1270  C  CA  . ALA A  1 169 ? 4.790   93.671   102.481 1.00 18.82 ? 250  ALA A CA  1 
ATOM   1271  C  C   . ALA A  1 169 ? 5.006   93.707   100.995 1.00 17.87 ? 250  ALA A C   1 
ATOM   1272  O  O   . ALA A  1 169 ? 4.451   94.557   100.302 1.00 17.64 ? 250  ALA A O   1 
ATOM   1273  C  CB  . ALA A  1 169 ? 4.244   92.339   102.891 1.00 20.32 ? 250  ALA A CB  1 
ATOM   1274  N  N   . SER A  1 170 ? 5.823   92.790   100.502 1.00 17.21 ? 251  SER A N   1 
ATOM   1275  C  CA  . SER A  1 170 ? 6.099   92.731   99.081  1.00 15.22 ? 251  SER A CA  1 
ATOM   1276  C  C   . SER A  1 170 ? 5.465   91.463   98.534  1.00 14.21 ? 251  SER A C   1 
ATOM   1277  O  O   . SER A  1 170 ? 5.565   90.398   99.144  1.00 15.23 ? 251  SER A O   1 
ATOM   1278  C  CB  . SER A  1 170 ? 7.609   92.737   98.848  1.00 14.45 ? 251  SER A CB  1 
ATOM   1279  O  OG  . SER A  1 170 ? 7.909   92.508   97.482  1.00 16.29 ? 251  SER A OG  1 
ATOM   1280  N  N   . TYR A  1 171 ? 4.808   91.586   97.387  1.00 13.55 ? 252  TYR A N   1 
ATOM   1281  C  CA  . TYR A  1 171 ? 4.128   90.463   96.747  1.00 13.69 ? 252  TYR A CA  1 
ATOM   1282  C  C   . TYR A  1 171 ? 4.558   90.306   95.299  1.00 14.36 ? 252  TYR A C   1 
ATOM   1283  O  O   . TYR A  1 171 ? 4.705   91.290   94.570  1.00 15.59 ? 252  TYR A O   1 
ATOM   1284  C  CB  . TYR A  1 171 ? 2.617   90.686   96.799  1.00 11.48 ? 252  TYR A CB  1 
ATOM   1285  C  CG  . TYR A  1 171 ? 2.218   91.462   98.017  1.00 10.66 ? 252  TYR A CG  1 
ATOM   1286  C  CD1 . TYR A  1 171 ? 1.868   92.806   97.923  1.00 10.05 ? 252  TYR A CD1 1 
ATOM   1287  C  CD2 . TYR A  1 171 ? 2.280   90.877   99.280  1.00 10.29 ? 252  TYR A CD2 1 
ATOM   1288  C  CE1 . TYR A  1 171 ? 1.595   93.555   99.061  1.00 12.16 ? 252  TYR A CE1 1 
ATOM   1289  C  CE2 . TYR A  1 171 ? 2.011   91.611   100.427 1.00 11.97 ? 252  TYR A CE2 1 
ATOM   1290  C  CZ  . TYR A  1 171 ? 1.672   92.950   100.311 1.00 13.01 ? 252  TYR A CZ  1 
ATOM   1291  O  OH  . TYR A  1 171 ? 1.428   93.675   101.445 1.00 11.41 ? 252  TYR A OH  1 
ATOM   1292  N  N   . LYS A  1 172 ? 4.751   89.065   94.878  1.00 15.55 ? 253  LYS A N   1 
ATOM   1293  C  CA  . LYS A  1 172 ? 5.149   88.809   93.507  1.00 17.06 ? 253  LYS A CA  1 
ATOM   1294  C  C   . LYS A  1 172 ? 4.383   87.643   92.916  1.00 18.50 ? 253  LYS A C   1 
ATOM   1295  O  O   . LYS A  1 172 ? 3.977   86.720   93.626  1.00 20.96 ? 253  LYS A O   1 
ATOM   1296  C  CB  . LYS A  1 172 ? 6.639   88.508   93.429  1.00 17.69 ? 253  LYS A CB  1 
ATOM   1297  C  CG  . LYS A  1 172 ? 7.551   89.676   93.745  1.00 16.09 ? 253  LYS A CG  1 
ATOM   1298  C  CD  . LYS A  1 172 ? 8.967   89.270   93.435  1.00 16.87 ? 253  LYS A CD  1 
ATOM   1299  C  CE  . LYS A  1 172 ? 9.979   90.338   93.775  1.00 17.56 ? 253  LYS A CE  1 
ATOM   1300  N  NZ  . LYS A  1 172 ? 11.251  90.031   93.048  1.00 19.41 ? 253  LYS A NZ  1 
ATOM   1301  N  N   . ILE A  1 173 ? 4.169   87.700   91.610  1.00 18.56 ? 254  ILE A N   1 
ATOM   1302  C  CA  . ILE A  1 173 ? 3.483   86.634   90.904  1.00 19.47 ? 254  ILE A CA  1 
ATOM   1303  C  C   . ILE A  1 173 ? 4.528   85.928   90.069  1.00 19.49 ? 254  ILE A C   1 
ATOM   1304  O  O   . ILE A  1 173 ? 5.263   86.565   89.309  1.00 20.35 ? 254  ILE A O   1 
ATOM   1305  C  CB  . ILE A  1 173 ? 2.448   87.163   89.942  1.00 20.08 ? 254  ILE A CB  1 
ATOM   1306  C  CG1 . ILE A  1 173 ? 1.376   87.936   90.692  1.00 21.15 ? 254  ILE A CG1 1 
ATOM   1307  C  CG2 . ILE A  1 173 ? 1.844   86.005   89.174  1.00 21.62 ? 254  ILE A CG2 1 
ATOM   1308  C  CD1 . ILE A  1 173 ? 0.465   88.679   89.743  1.00 24.11 ? 254  ILE A CD1 1 
ATOM   1309  N  N   . PHE A  1 174 ? 4.599   84.613   90.196  1.00 19.08 ? 255  PHE A N   1 
ATOM   1310  C  CA  . PHE A  1 174 ? 5.576   83.865   89.430  1.00 17.16 ? 255  PHE A CA  1 
ATOM   1311  C  C   . PHE A  1 174 ? 4.954   83.004   88.341  1.00 16.69 ? 255  PHE A C   1 
ATOM   1312  O  O   . PHE A  1 174 ? 3.892   82.402   88.517  1.00 15.99 ? 255  PHE A O   1 
ATOM   1313  C  CB  . PHE A  1 174 ? 6.417   82.983   90.358  1.00 17.62 ? 255  PHE A CB  1 
ATOM   1314  C  CG  . PHE A  1 174 ? 7.262   83.757   91.328  1.00 17.62 ? 255  PHE A CG  1 
ATOM   1315  C  CD1 . PHE A  1 174 ? 6.693   84.370   92.432  1.00 18.49 ? 255  PHE A CD1 1 
ATOM   1316  C  CD2 . PHE A  1 174 ? 8.628   83.901   91.115  1.00 18.52 ? 255  PHE A CD2 1 
ATOM   1317  C  CE1 . PHE A  1 174 ? 7.476   85.115   93.315  1.00 19.58 ? 255  PHE A CE1 1 
ATOM   1318  C  CE2 . PHE A  1 174 ? 9.415   84.639   91.985  1.00 17.96 ? 255  PHE A CE2 1 
ATOM   1319  C  CZ  . PHE A  1 174 ? 8.840   85.249   93.088  1.00 19.01 ? 255  PHE A CZ  1 
ATOM   1320  N  N   . LYS A  1 175 ? 5.632   82.966   87.204  1.00 16.92 ? 256  LYS A N   1 
ATOM   1321  C  CA  . LYS A  1 175 ? 5.206   82.160   86.079  1.00 17.90 ? 256  LYS A CA  1 
ATOM   1322  C  C   . LYS A  1 175 ? 6.325   81.176   85.800  1.00 19.82 ? 256  LYS A C   1 
ATOM   1323  O  O   . LYS A  1 175 ? 7.466   81.574   85.566  1.00 18.92 ? 256  LYS A O   1 
ATOM   1324  C  CB  . LYS A  1 175 ? 4.983   83.023   84.839  1.00 16.74 ? 256  LYS A CB  1 
ATOM   1325  C  CG  . LYS A  1 175 ? 4.566   82.229   83.609  1.00 16.40 ? 256  LYS A CG  1 
ATOM   1326  C  CD  . LYS A  1 175 ? 4.584   83.094   82.359  1.00 16.59 ? 256  LYS A CD  1 
ATOM   1327  C  CE  . LYS A  1 175 ? 4.042   82.342   81.157  1.00 15.88 ? 256  LYS A CE  1 
ATOM   1328  N  NZ  . LYS A  1 175 ? 4.174   83.169   79.932  1.00 17.59 ? 256  LYS A NZ  1 
ATOM   1329  N  N   . MET A  1 176 ? 6.021   79.887   85.850  1.00 22.19 ? 257  MET A N   1 
ATOM   1330  C  CA  . MET A  1 176 ? 7.054   78.915   85.546  1.00 24.86 ? 257  MET A CA  1 
ATOM   1331  C  C   . MET A  1 176 ? 6.588   77.878   84.557  1.00 25.04 ? 257  MET A C   1 
ATOM   1332  O  O   . MET A  1 176 ? 5.388   77.645   84.388  1.00 24.68 ? 257  MET A O   1 
ATOM   1333  C  CB  . MET A  1 176 ? 7.596   78.240   86.806  1.00 25.52 ? 257  MET A CB  1 
ATOM   1334  C  CG  . MET A  1 176 ? 6.572   77.814   87.807  1.00 26.98 ? 257  MET A CG  1 
ATOM   1335  S  SD  . MET A  1 176 ? 6.785   78.739   89.340  1.00 27.75 ? 257  MET A SD  1 
ATOM   1336  C  CE  . MET A  1 176 ? 5.105   78.602   89.972  1.00 22.88 ? 257  MET A CE  1 
ATOM   1337  N  N   . GLU A  1 177 ? 7.569   77.287   83.884  1.00 25.45 ? 258  GLU A N   1 
ATOM   1338  C  CA  . GLU A  1 177 ? 7.344   76.271   82.875  1.00 25.37 ? 258  GLU A CA  1 
ATOM   1339  C  C   . GLU A  1 177 ? 8.350   75.165   83.133  1.00 24.43 ? 258  GLU A C   1 
ATOM   1340  O  O   . GLU A  1 177 ? 9.551   75.397   83.109  1.00 25.06 ? 258  GLU A O   1 
ATOM   1341  C  CB  . GLU A  1 177 ? 7.519   76.906   81.495  1.00 27.34 ? 258  GLU A CB  1 
ATOM   1342  C  CG  . GLU A  1 177 ? 6.414   77.947   81.208  1.00 32.96 ? 258  GLU A CG  1 
ATOM   1343  C  CD  . GLU A  1 177 ? 6.702   78.867   80.024  1.00 36.64 ? 258  GLU A CD  1 
ATOM   1344  O  OE1 . GLU A  1 177 ? 5.789   79.637   79.638  1.00 37.38 ? 258  GLU A OE1 1 
ATOM   1345  O  OE2 . GLU A  1 177 ? 7.834   78.835   79.487  1.00 39.90 ? 258  GLU A OE2 1 
ATOM   1346  N  N   . LYS A  1 178 ? 7.849   73.964   83.400  1.00 24.76 ? 259  LYS A N   1 
ATOM   1347  C  CA  . LYS A  1 178 ? 8.700   72.816   83.710  1.00 24.20 ? 259  LYS A CA  1 
ATOM   1348  C  C   . LYS A  1 178 ? 9.515   73.135   84.954  1.00 22.31 ? 259  LYS A C   1 
ATOM   1349  O  O   . LYS A  1 178 ? 10.726  72.910   84.989  1.00 21.76 ? 259  LYS A O   1 
ATOM   1350  C  CB  . LYS A  1 178 ? 9.646   72.495   82.554  1.00 28.33 ? 259  LYS A CB  1 
ATOM   1351  C  CG  . LYS A  1 178 ? 8.960   72.016   81.289  1.00 34.21 ? 259  LYS A CG  1 
ATOM   1352  C  CD  . LYS A  1 178 ? 9.982   71.614   80.241  1.00 38.55 ? 259  LYS A CD  1 
ATOM   1353  C  CE  . LYS A  1 178 ? 9.303   71.128   78.966  1.00 42.87 ? 259  LYS A CE  1 
ATOM   1354  N  NZ  . LYS A  1 178 ? 10.293  70.635   77.956  1.00 46.04 ? 259  LYS A NZ  1 
ATOM   1355  N  N   . GLY A  1 179 ? 8.841   73.697   85.952  1.00 19.46 ? 260  GLY A N   1 
ATOM   1356  C  CA  . GLY A  1 179 ? 9.471   74.031   87.213  1.00 18.30 ? 260  GLY A CA  1 
ATOM   1357  C  C   . GLY A  1 179 ? 10.500  75.140   87.217  1.00 19.56 ? 260  GLY A C   1 
ATOM   1358  O  O   . GLY A  1 179 ? 11.235  75.293   88.188  1.00 21.13 ? 260  GLY A O   1 
ATOM   1359  N  N   . LYS A  1 180 ? 10.572  75.926   86.153  1.00 19.93 ? 261  LYS A N   1 
ATOM   1360  C  CA  . LYS A  1 180 ? 11.560  77.000   86.105  1.00 19.64 ? 261  LYS A CA  1 
ATOM   1361  C  C   . LYS A  1 180 ? 10.879  78.353   85.950  1.00 18.10 ? 261  LYS A C   1 
ATOM   1362  O  O   . LYS A  1 180 ? 9.980   78.517   85.121  1.00 17.09 ? 261  LYS A O   1 
ATOM   1363  C  CB  . LYS A  1 180 ? 12.543  76.760   84.946  1.00 21.32 ? 261  LYS A CB  1 
ATOM   1364  C  CG  . LYS A  1 180 ? 13.626  77.830   84.788  1.00 25.05 ? 261  LYS A CG  1 
ATOM   1365  C  CD  . LYS A  1 180 ? 14.624  77.460   83.694  1.00 28.02 ? 261  LYS A CD  1 
ATOM   1366  C  CE  . LYS A  1 180 ? 15.446  76.227   84.092  1.00 33.07 ? 261  LYS A CE  1 
ATOM   1367  N  NZ  . LYS A  1 180 ? 16.349  75.715   82.995  1.00 34.81 ? 261  LYS A NZ  1 
ATOM   1368  N  N   . VAL A  1 181 ? 11.290  79.324   86.754  1.00 15.84 ? 262  VAL A N   1 
ATOM   1369  C  CA  . VAL A  1 181 ? 10.685  80.636   86.642  1.00 16.87 ? 262  VAL A CA  1 
ATOM   1370  C  C   . VAL A  1 181 ? 11.095  81.241   85.314  1.00 18.49 ? 262  VAL A C   1 
ATOM   1371  O  O   . VAL A  1 181 ? 12.285  81.325   85.008  1.00 20.67 ? 262  VAL A O   1 
ATOM   1372  C  CB  . VAL A  1 181 ? 11.130  81.566   87.769  1.00 15.84 ? 262  VAL A CB  1 
ATOM   1373  C  CG1 . VAL A  1 181 ? 10.450  82.922   87.614  1.00 12.47 ? 262  VAL A CG1 1 
ATOM   1374  C  CG2 . VAL A  1 181 ? 10.797  80.933   89.123  1.00 13.15 ? 262  VAL A CG2 1 
ATOM   1375  N  N   . VAL A  1 182 ? 10.106  81.623   84.512  1.00 18.06 ? 263  VAL A N   1 
ATOM   1376  C  CA  . VAL A  1 182 ? 10.367  82.231   83.215  1.00 17.38 ? 263  VAL A CA  1 
ATOM   1377  C  C   . VAL A  1 182 ? 9.985   83.697   83.290  1.00 18.26 ? 263  VAL A C   1 
ATOM   1378  O  O   . VAL A  1 182 ? 10.429  84.500   82.473  1.00 19.51 ? 263  VAL A O   1 
ATOM   1379  C  CB  . VAL A  1 182 ? 9.578   81.547   82.072  1.00 16.64 ? 263  VAL A CB  1 
ATOM   1380  C  CG1 . VAL A  1 182 ? 10.142  80.156   81.813  1.00 14.55 ? 263  VAL A CG1 1 
ATOM   1381  C  CG2 . VAL A  1 182 ? 8.100   81.466   82.426  1.00 15.31 ? 263  VAL A CG2 1 
ATOM   1382  N  N   . LYS A  1 183 ? 9.152   84.048   84.266  1.00 17.36 ? 264  LYS A N   1 
ATOM   1383  C  CA  . LYS A  1 183 ? 8.773   85.438   84.452  1.00 18.36 ? 264  LYS A CA  1 
ATOM   1384  C  C   . LYS A  1 183 ? 8.181   85.694   85.827  1.00 19.34 ? 264  LYS A C   1 
ATOM   1385  O  O   . LYS A  1 183 ? 7.526   84.834   86.407  1.00 20.66 ? 264  LYS A O   1 
ATOM   1386  C  CB  . LYS A  1 183 ? 7.797   85.894   83.370  1.00 18.35 ? 264  LYS A CB  1 
ATOM   1387  C  CG  . LYS A  1 183 ? 7.457   87.375   83.465  1.00 20.09 ? 264  LYS A CG  1 
ATOM   1388  C  CD  . LYS A  1 183 ? 6.641   87.856   82.273  1.00 21.69 ? 264  LYS A CD  1 
ATOM   1389  C  CE  . LYS A  1 183 ? 6.516   89.382   82.276  1.00 23.96 ? 264  LYS A CE  1 
ATOM   1390  N  NZ  . LYS A  1 183 ? 5.856   89.901   81.042  1.00 22.21 ? 264  LYS A NZ  1 
ATOM   1391  N  N   . SER A  1 184 ? 8.441   86.881   86.358  1.00 20.36 ? 265  SER A N   1 
ATOM   1392  C  CA  . SER A  1 184 ? 7.919   87.262   87.659  1.00 21.19 ? 265  SER A CA  1 
ATOM   1393  C  C   . SER A  1 184 ? 7.620   88.752   87.627  1.00 20.21 ? 265  SER A C   1 
ATOM   1394  O  O   . SER A  1 184 ? 8.214   89.504   86.857  1.00 21.00 ? 265  SER A O   1 
ATOM   1395  C  CB  . SER A  1 184 ? 8.935   86.960   88.762  1.00 23.03 ? 265  SER A CB  1 
ATOM   1396  O  OG  . SER A  1 184 ? 9.931   87.967   88.823  1.00 27.27 ? 265  SER A OG  1 
ATOM   1397  N  N   . VAL A  1 185 ? 6.694   89.173   88.469  1.00 19.90 ? 266  VAL A N   1 
ATOM   1398  C  CA  . VAL A  1 185 ? 6.303   90.571   88.540  1.00 20.50 ? 266  VAL A CA  1 
ATOM   1399  C  C   . VAL A  1 185 ? 5.992   90.903   89.982  1.00 21.30 ? 266  VAL A C   1 
ATOM   1400  O  O   . VAL A  1 185 ? 5.371   90.108   90.685  1.00 20.76 ? 266  VAL A O   1 
ATOM   1401  C  CB  . VAL A  1 185 ? 5.012   90.840   87.730  1.00 20.96 ? 266  VAL A CB  1 
ATOM   1402  C  CG1 . VAL A  1 185 ? 4.458   92.211   88.074  1.00 20.30 ? 266  VAL A CG1 1 
ATOM   1403  C  CG2 . VAL A  1 185 ? 5.285   90.727   86.250  1.00 19.84 ? 266  VAL A CG2 1 
ATOM   1404  N  N   . GLU A  1 186 ? 6.425   92.071   90.432  1.00 23.00 ? 267  GLU A N   1 
ATOM   1405  C  CA  . GLU A  1 186 ? 6.115   92.480   91.792  1.00 24.49 ? 267  GLU A CA  1 
ATOM   1406  C  C   . GLU A  1 186 ? 4.847   93.299   91.664  1.00 23.79 ? 267  GLU A C   1 
ATOM   1407  O  O   . GLU A  1 186 ? 4.741   94.139   90.777  1.00 24.47 ? 267  GLU A O   1 
ATOM   1408  C  CB  . GLU A  1 186 ? 7.238   93.331   92.382  1.00 26.03 ? 267  GLU A CB  1 
ATOM   1409  C  CG  . GLU A  1 186 ? 6.919   93.898   93.756  1.00 29.77 ? 267  GLU A CG  1 
ATOM   1410  C  CD  . GLU A  1 186 ? 8.153   94.418   94.461  1.00 32.11 ? 267  GLU A CD  1 
ATOM   1411  O  OE1 . GLU A  1 186 ? 8.928   95.177   93.840  1.00 35.78 ? 267  GLU A OE1 1 
ATOM   1412  O  OE2 . GLU A  1 186 ? 8.352   94.073   95.639  1.00 34.52 ? 267  GLU A OE2 1 
ATOM   1413  N  N   . LEU A  1 187 ? 3.872   93.043   92.522  1.00 23.00 ? 268  LEU A N   1 
ATOM   1414  C  CA  . LEU A  1 187 ? 2.632   93.792   92.442  1.00 22.05 ? 268  LEU A CA  1 
ATOM   1415  C  C   . LEU A  1 187 ? 2.798   95.177   93.048  1.00 22.21 ? 268  LEU A C   1 
ATOM   1416  O  O   . LEU A  1 187 ? 3.412   95.340   94.098  1.00 22.40 ? 268  LEU A O   1 
ATOM   1417  C  CB  . LEU A  1 187 ? 1.509   93.059   93.183  1.00 20.33 ? 268  LEU A CB  1 
ATOM   1418  C  CG  . LEU A  1 187 ? 1.057   91.682   92.695  1.00 20.57 ? 268  LEU A CG  1 
ATOM   1419  C  CD1 . LEU A  1 187 ? -0.011  91.156   93.627  1.00 18.88 ? 268  LEU A CD1 1 
ATOM   1420  C  CD2 . LEU A  1 187 ? 0.527   91.775   91.271  1.00 19.74 ? 268  LEU A CD2 1 
ATOM   1421  N  N   . ASP A  1 188 ? 2.270   96.185   92.374  1.00 23.07 ? 269  ASP A N   1 
ATOM   1422  C  CA  . ASP A  1 188 ? 2.321   97.528   92.927  1.00 23.28 ? 269  ASP A CA  1 
ATOM   1423  C  C   . ASP A  1 188 ? 0.999   97.656   93.679  1.00 22.92 ? 269  ASP A C   1 
ATOM   1424  O  O   . ASP A  1 188 ? 0.015   98.196   93.160  1.00 22.43 ? 269  ASP A O   1 
ATOM   1425  C  CB  . ASP A  1 188 ? 2.413   98.563   91.819  1.00 25.95 ? 269  ASP A CB  1 
ATOM   1426  C  CG  . ASP A  1 188 ? 2.386   99.970   92.353  1.00 28.92 ? 269  ASP A CG  1 
ATOM   1427  O  OD1 . ASP A  1 188 ? 2.692   100.145  93.553  1.00 32.33 ? 269  ASP A OD1 1 
ATOM   1428  O  OD2 . ASP A  1 188 ? 2.071   100.897  91.576  1.00 31.49 ? 269  ASP A OD2 1 
ATOM   1429  N  N   . ALA A  1 189 ? 0.988   97.139   94.905  1.00 21.31 ? 270  ALA A N   1 
ATOM   1430  C  CA  . ALA A  1 189 ? -0.218  97.122   95.720  1.00 19.61 ? 270  ALA A CA  1 
ATOM   1431  C  C   . ALA A  1 189 ? -0.122  97.857   97.047  1.00 19.41 ? 270  ALA A C   1 
ATOM   1432  O  O   . ALA A  1 189 ? -0.380  97.286   98.106  1.00 18.96 ? 270  ALA A O   1 
ATOM   1433  C  CB  . ALA A  1 189 ? -0.623  95.684   95.969  1.00 17.55 ? 270  ALA A CB  1 
ATOM   1434  N  N   . PRO A  1 190 ? 0.242   99.139   97.014  1.00 19.29 ? 271  PRO A N   1 
ATOM   1435  C  CA  . PRO A  1 190 ? 0.327   99.840   98.293  1.00 19.46 ? 271  PRO A CA  1 
ATOM   1436  C  C   . PRO A  1 190 ? -1.020  99.755   99.023  1.00 19.50 ? 271  PRO A C   1 
ATOM   1437  O  O   . PRO A  1 190 ? -2.072  99.905   98.406  1.00 20.67 ? 271  PRO A O   1 
ATOM   1438  C  CB  . PRO A  1 190 ? 0.689   101.263  97.869  1.00 18.68 ? 271  PRO A CB  1 
ATOM   1439  C  CG  . PRO A  1 190 ? -0.009  101.403  96.555  1.00 17.06 ? 271  PRO A CG  1 
ATOM   1440  C  CD  . PRO A  1 190 ? 0.346   100.086  95.891  1.00 19.83 ? 271  PRO A CD  1 
ATOM   1441  N  N   . ASN A  1 191 ? -0.967  99.499   100.327 1.00 19.24 ? 272  ASN A N   1 
ATOM   1442  C  CA  . ASN A  1 191 ? -2.145  99.376   101.193 1.00 19.64 ? 272  ASN A CA  1 
ATOM   1443  C  C   . ASN A  1 191 ? -2.795  97.985   101.164 1.00 19.89 ? 272  ASN A C   1 
ATOM   1444  O  O   . ASN A  1 191 ? -3.734  97.712   101.922 1.00 18.48 ? 272  ASN A O   1 
ATOM   1445  C  CB  . ASN A  1 191 ? -3.197  100.438  100.842 1.00 17.23 ? 272  ASN A CB  1 
ATOM   1446  C  CG  . ASN A  1 191 ? -4.142  100.712  101.996 1.00 16.33 ? 272  ASN A CG  1 
ATOM   1447  O  OD1 . ASN A  1 191 ? -3.708  100.849  103.134 1.00 14.53 ? 272  ASN A OD1 1 
ATOM   1448  N  ND2 . ASN A  1 191 ? -5.434  100.804  101.708 1.00 15.63 ? 272  ASN A ND2 1 
ATOM   1449  N  N   . TYR A  1 192 ? -2.289  97.116   100.291 1.00 19.37 ? 273  TYR A N   1 
ATOM   1450  C  CA  . TYR A  1 192 ? -2.801  95.753   100.158 1.00 19.33 ? 273  TYR A CA  1 
ATOM   1451  C  C   . TYR A  1 192 ? -1.935  94.795   100.962 1.00 19.37 ? 273  TYR A C   1 
ATOM   1452  O  O   . TYR A  1 192 ? -0.808  95.122   101.319 1.00 19.39 ? 273  TYR A O   1 
ATOM   1453  C  CB  . TYR A  1 192 ? -2.779  95.305   98.687  1.00 18.58 ? 273  TYR A CB  1 
ATOM   1454  C  CG  . TYR A  1 192 ? -3.910  95.834   97.833  1.00 19.71 ? 273  TYR A CG  1 
ATOM   1455  C  CD1 . TYR A  1 192 ? -3.964  97.174   97.446  1.00 19.56 ? 273  TYR A CD1 1 
ATOM   1456  C  CD2 . TYR A  1 192 ? -4.945  94.991   97.426  1.00 20.39 ? 273  TYR A CD2 1 
ATOM   1457  C  CE1 . TYR A  1 192 ? -5.023  97.654   96.680  1.00 20.69 ? 273  TYR A CE1 1 
ATOM   1458  C  CE2 . TYR A  1 192 ? -6.004  95.461   96.666  1.00 20.25 ? 273  TYR A CE2 1 
ATOM   1459  C  CZ  . TYR A  1 192 ? -6.041  96.789   96.299  1.00 21.35 ? 273  TYR A CZ  1 
ATOM   1460  O  OH  . TYR A  1 192 ? -7.117  97.255   95.583  1.00 23.62 ? 273  TYR A OH  1 
ATOM   1461  N  N   . HIS A  1 193 ? -2.460  93.608   101.245 1.00 20.48 ? 274  HIS A N   1 
ATOM   1462  C  CA  . HIS A  1 193 ? -1.687  92.600   101.972 1.00 20.59 ? 274  HIS A CA  1 
ATOM   1463  C  C   . HIS A  1 193 ? -2.119  91.233   101.489 1.00 20.09 ? 274  HIS A C   1 
ATOM   1464  O  O   . HIS A  1 193 ? -3.284  90.868   101.631 1.00 22.83 ? 274  HIS A O   1 
ATOM   1465  C  CB  . HIS A  1 193 ? -1.913  92.717   103.476 1.00 20.64 ? 274  HIS A CB  1 
ATOM   1466  C  CG  . HIS A  1 193 ? -0.891  91.993   104.291 1.00 19.66 ? 274  HIS A CG  1 
ATOM   1467  N  ND1 . HIS A  1 193 ? -1.090  90.719   104.778 1.00 20.20 ? 274  HIS A ND1 1 
ATOM   1468  C  CD2 . HIS A  1 193 ? 0.355   92.354   104.677 1.00 18.67 ? 274  HIS A CD2 1 
ATOM   1469  C  CE1 . HIS A  1 193 ? -0.010  90.328   105.431 1.00 19.81 ? 274  HIS A CE1 1 
ATOM   1470  N  NE2 . HIS A  1 193 ? 0.882   91.302   105.384 1.00 20.26 ? 274  HIS A NE2 1 
ATOM   1471  N  N   . TYR A  1 194 ? -1.187  90.484   100.906 1.00 19.04 ? 275  TYR A N   1 
ATOM   1472  C  CA  . TYR A  1 194 ? -1.493  89.159   100.381 1.00 18.35 ? 275  TYR A CA  1 
ATOM   1473  C  C   . TYR A  1 194 ? -0.734  88.047   101.087 1.00 20.59 ? 275  TYR A C   1 
ATOM   1474  O  O   . TYR A  1 194 ? 0.474   88.148   101.306 1.00 20.62 ? 275  TYR A O   1 
ATOM   1475  C  CB  . TYR A  1 194 ? -1.187  89.085   98.888  1.00 16.62 ? 275  TYR A CB  1 
ATOM   1476  C  CG  . TYR A  1 194 ? -2.026  90.003   98.028  1.00 18.91 ? 275  TYR A CG  1 
ATOM   1477  C  CD1 . TYR A  1 194 ? -1.606  91.304   97.735  1.00 18.31 ? 275  TYR A CD1 1 
ATOM   1478  C  CD2 . TYR A  1 194 ? -3.244  89.569   97.497  1.00 18.08 ? 275  TYR A CD2 1 
ATOM   1479  C  CE1 . TYR A  1 194 ? -2.373  92.148   96.925  1.00 17.79 ? 275  TYR A CE1 1 
ATOM   1480  C  CE2 . TYR A  1 194 ? -4.016  90.403   96.696  1.00 18.92 ? 275  TYR A CE2 1 
ATOM   1481  C  CZ  . TYR A  1 194 ? -3.574  91.690   96.409  1.00 19.20 ? 275  TYR A CZ  1 
ATOM   1482  O  OH  . TYR A  1 194 ? -4.331  92.497   95.583  1.00 20.41 ? 275  TYR A OH  1 
ATOM   1483  N  N   . GLU A  1 195 ? -1.461  86.984   101.434 1.00 22.01 ? 276  GLU A N   1 
ATOM   1484  C  CA  . GLU A  1 195 ? -0.902  85.816   102.102 1.00 22.59 ? 276  GLU A CA  1 
ATOM   1485  C  C   . GLU A  1 195 ? -1.764  84.585   101.878 1.00 22.10 ? 276  GLU A C   1 
ATOM   1486  O  O   . GLU A  1 195 ? -2.989  84.673   101.831 1.00 22.26 ? 276  GLU A O   1 
ATOM   1487  C  CB  . GLU A  1 195 ? -0.786  86.048   103.610 1.00 24.62 ? 276  GLU A CB  1 
ATOM   1488  C  CG  . GLU A  1 195 ? 0.514   86.672   104.074 1.00 26.24 ? 276  GLU A CG  1 
ATOM   1489  C  CD  . GLU A  1 195 ? 0.608   86.721   105.587 1.00 28.26 ? 276  GLU A CD  1 
ATOM   1490  O  OE1 . GLU A  1 195 ? 1.664   87.135   106.111 1.00 28.72 ? 276  GLU A OE1 1 
ATOM   1491  O  OE2 . GLU A  1 195 ? -0.383  86.345   106.255 1.00 30.90 ? 276  GLU A OE2 1 
ATOM   1492  N  N   . GLU A  1 196 ? -1.104  83.439   101.744 1.00 21.37 ? 277  GLU A N   1 
ATOM   1493  C  CA  . GLU A  1 196 ? -1.775  82.163   101.566 1.00 21.44 ? 277  GLU A CA  1 
ATOM   1494  C  C   . GLU A  1 196 ? -2.865  82.246   100.512 1.00 22.23 ? 277  GLU A C   1 
ATOM   1495  O  O   . GLU A  1 196 ? -4.011  81.859   100.742 1.00 23.54 ? 277  GLU A O   1 
ATOM   1496  C  CB  . GLU A  1 196 ? -2.348  81.713   102.917 1.00 21.22 ? 277  GLU A CB  1 
ATOM   1497  C  CG  . GLU A  1 196 ? -1.339  81.882   104.053 1.00 20.78 ? 277  GLU A CG  1 
ATOM   1498  C  CD  . GLU A  1 196 ? -1.860  81.461   105.411 1.00 21.92 ? 277  GLU A CD  1 
ATOM   1499  O  OE1 . GLU A  1 196 ? -3.041  81.723   105.721 1.00 22.58 ? 277  GLU A OE1 1 
ATOM   1500  O  OE2 . GLU A  1 196 ? -1.073  80.881   106.185 1.00 23.91 ? 277  GLU A OE2 1 
ATOM   1501  N  N   . CYS A  1 197 ? -2.488  82.746   99.342  1.00 22.86 ? 278  CYS A N   1 
ATOM   1502  C  CA  . CYS A  1 197 ? -3.404  82.912   98.221  1.00 21.77 ? 278  CYS A CA  1 
ATOM   1503  C  C   . CYS A  1 197 ? -4.001  81.628   97.656  1.00 22.36 ? 278  CYS A C   1 
ATOM   1504  O  O   . CYS A  1 197 ? -3.288  80.644   97.430  1.00 22.56 ? 278  CYS A O   1 
ATOM   1505  C  CB  . CYS A  1 197 ? -2.690  83.638   97.090  1.00 23.23 ? 278  CYS A CB  1 
ATOM   1506  S  SG  . CYS A  1 197 ? -2.475  85.434   97.303  1.00 25.19 ? 278  CYS A SG  1 
ATOM   1507  N  N   . SER A  1 198 ? -5.312  81.643   97.423  1.00 21.73 ? 279  SER A N   1 
ATOM   1508  C  CA  . SER A  1 198 ? -5.997  80.494   96.826  1.00 21.28 ? 279  SER A CA  1 
ATOM   1509  C  C   . SER A  1 198 ? -6.267  80.873   95.373  1.00 22.32 ? 279  SER A C   1 
ATOM   1510  O  O   . SER A  1 198 ? -7.172  81.649   95.080  1.00 23.65 ? 279  SER A O   1 
ATOM   1511  C  CB  . SER A  1 198 ? -7.311  80.208   97.544  1.00 19.71 ? 279  SER A CB  1 
ATOM   1512  O  OG  . SER A  1 198 ? -7.070  79.763   98.866  1.00 18.39 ? 279  SER A OG  1 
ATOM   1513  N  N   . CYS A  1 199 ? -5.469  80.332   94.463  1.00 22.61 ? 280  CYS A N   1 
ATOM   1514  C  CA  . CYS A  1 199 ? -5.604  80.663   93.056  1.00 23.62 ? 280  CYS A CA  1 
ATOM   1515  C  C   . CYS A  1 199 ? -6.233  79.558   92.223  1.00 24.22 ? 280  CYS A C   1 
ATOM   1516  O  O   . CYS A  1 199 ? -6.191  78.384   92.593  1.00 26.65 ? 280  CYS A O   1 
ATOM   1517  C  CB  . CYS A  1 199 ? -4.232  80.986   92.486  1.00 24.09 ? 280  CYS A CB  1 
ATOM   1518  S  SG  . CYS A  1 199 ? -3.256  82.236   93.395  1.00 26.77 ? 280  CYS A SG  1 
ATOM   1519  N  N   . TYR A  1 200 ? -6.812  79.942   91.089  1.00 22.41 ? 281  TYR A N   1 
ATOM   1520  C  CA  . TYR A  1 200 ? -7.447  78.989   90.196  1.00 21.86 ? 281  TYR A CA  1 
ATOM   1521  C  C   . TYR A  1 200 ? -7.536  79.557   88.787  1.00 23.12 ? 281  TYR A C   1 
ATOM   1522  O  O   . TYR A  1 200 ? -7.581  80.772   88.603  1.00 24.07 ? 281  TYR A O   1 
ATOM   1523  C  CB  . TYR A  1 200 ? -8.851  78.639   90.691  1.00 20.44 ? 281  TYR A CB  1 
ATOM   1524  C  CG  . TYR A  1 200 ? -9.828  79.793   90.717  1.00 20.90 ? 281  TYR A CG  1 
ATOM   1525  C  CD1 . TYR A  1 200 ? -10.057 80.523   91.887  1.00 20.22 ? 281  TYR A CD1 1 
ATOM   1526  C  CD2 . TYR A  1 200 ? -10.542 80.148   89.572  1.00 21.95 ? 281  TYR A CD2 1 
ATOM   1527  C  CE1 . TYR A  1 200 ? -10.986 81.584   91.911  1.00 21.55 ? 281  TYR A CE1 1 
ATOM   1528  C  CE2 . TYR A  1 200 ? -11.470 81.203   89.583  1.00 21.81 ? 281  TYR A CE2 1 
ATOM   1529  C  CZ  . TYR A  1 200 ? -11.689 81.914   90.749  1.00 21.55 ? 281  TYR A CZ  1 
ATOM   1530  O  OH  . TYR A  1 200 ? -12.611 82.941   90.736  1.00 21.09 ? 281  TYR A OH  1 
ATOM   1531  N  N   . PRO A  1 201 ? -7.539  78.684   87.767  1.00 23.09 ? 282  PRO A N   1 
ATOM   1532  C  CA  . PRO A  1 201 ? -7.628  79.184   86.391  1.00 22.68 ? 282  PRO A CA  1 
ATOM   1533  C  C   . PRO A  1 201 ? -9.069  79.398   85.929  1.00 22.77 ? 282  PRO A C   1 
ATOM   1534  O  O   . PRO A  1 201 ? -9.983  78.686   86.342  1.00 22.00 ? 282  PRO A O   1 
ATOM   1535  C  CB  . PRO A  1 201 ? -6.917  78.100   85.585  1.00 20.98 ? 282  PRO A CB  1 
ATOM   1536  C  CG  . PRO A  1 201 ? -7.282  76.858   86.327  1.00 21.59 ? 282  PRO A CG  1 
ATOM   1537  C  CD  . PRO A  1 201 ? -7.124  77.268   87.786  1.00 22.03 ? 282  PRO A CD  1 
ATOM   1538  N  N   . ASN A  1 202 ? -9.261  80.387   85.066  1.00 23.13 ? 283  ASN A N   1 
ATOM   1539  C  CA  . ASN A  1 202 ? -10.580 80.691   84.530  1.00 24.46 ? 283  ASN A CA  1 
ATOM   1540  C  C   . ASN A  1 202 ? -10.389 81.361   83.179  1.00 24.45 ? 283  ASN A C   1 
ATOM   1541  O  O   . ASN A  1 202 ? -9.865  82.479   83.098  1.00 25.48 ? 283  ASN A O   1 
ATOM   1542  C  CB  . ASN A  1 202 ? -11.339 81.641   85.463  1.00 25.52 ? 283  ASN A CB  1 
ATOM   1543  C  CG  . ASN A  1 202 ? -12.831 81.677   85.172  1.00 27.58 ? 283  ASN A CG  1 
ATOM   1544  O  OD1 . ASN A  1 202 ? -13.269 81.408   84.049  1.00 30.21 ? 283  ASN A OD1 1 
ATOM   1545  N  ND2 . ASN A  1 202 ? -13.620 82.025   86.183  1.00 29.42 ? 283  ASN A ND2 1 
ATOM   1546  N  N   . ALA A  1 203 ? -10.796 80.676   82.117  1.00 23.18 ? 284  ALA A N   1 
ATOM   1547  C  CA  . ALA A  1 203 ? -10.673 81.223   80.773  1.00 23.00 ? 284  ALA A CA  1 
ATOM   1548  C  C   . ALA A  1 203 ? -9.270  81.753   80.462  1.00 22.90 ? 284  ALA A C   1 
ATOM   1549  O  O   . ALA A  1 203 ? -9.112  82.887   80.021  1.00 22.75 ? 284  ALA A O   1 
ATOM   1550  C  CB  . ALA A  1 203 ? -11.697 82.334   80.574  1.00 21.58 ? 284  ALA A CB  1 
ATOM   1551  N  N   . GLY A  1 204 ? -8.251  80.942   80.709  1.00 21.74 ? 285  GLY A N   1 
ATOM   1552  C  CA  . GLY A  1 204 ? -6.897  81.358   80.393  1.00 21.46 ? 285  GLY A CA  1 
ATOM   1553  C  C   . GLY A  1 204 ? -6.214  82.335   81.321  1.00 21.58 ? 285  GLY A C   1 
ATOM   1554  O  O   . GLY A  1 204 ? -5.103  82.774   81.030  1.00 22.08 ? 285  GLY A O   1 
ATOM   1555  N  N   . GLU A  1 205 ? -6.855  82.684   82.431  1.00 22.10 ? 286  GLU A N   1 
ATOM   1556  C  CA  . GLU A  1 205 ? -6.250  83.611   83.384  1.00 22.97 ? 286  GLU A CA  1 
ATOM   1557  C  C   . GLU A  1 205 ? -6.385  83.059   84.795  1.00 21.44 ? 286  GLU A C   1 
ATOM   1558  O  O   . GLU A  1 205 ? -7.173  82.152   85.038  1.00 22.50 ? 286  GLU A O   1 
ATOM   1559  C  CB  . GLU A  1 205 ? -6.927  84.982   83.319  1.00 25.98 ? 286  GLU A CB  1 
ATOM   1560  C  CG  . GLU A  1 205 ? -7.374  85.402   81.933  1.00 30.28 ? 286  GLU A CG  1 
ATOM   1561  C  CD  . GLU A  1 205 ? -7.270  86.898   81.728  1.00 32.97 ? 286  GLU A CD  1 
ATOM   1562  O  OE1 . GLU A  1 205 ? -7.470  87.645   82.716  1.00 33.75 ? 286  GLU A OE1 1 
ATOM   1563  O  OE2 . GLU A  1 205 ? -6.993  87.319   80.579  1.00 35.14 ? 286  GLU A OE2 1 
ATOM   1564  N  N   . ILE A  1 206 ? -5.625  83.615   85.726  1.00 18.80 ? 287  ILE A N   1 
ATOM   1565  C  CA  . ILE A  1 206 ? -5.674  83.154   87.101  1.00 17.49 ? 287  ILE A CA  1 
ATOM   1566  C  C   . ILE A  1 206 ? -6.296  84.214   88.001  1.00 18.63 ? 287  ILE A C   1 
ATOM   1567  O  O   . ILE A  1 206 ? -6.094  85.412   87.797  1.00 18.77 ? 287  ILE A O   1 
ATOM   1568  C  CB  . ILE A  1 206 ? -4.259  82.820   87.634  1.00 15.99 ? 287  ILE A CB  1 
ATOM   1569  C  CG1 . ILE A  1 206 ? -3.653  81.668   86.831  1.00 15.92 ? 287  ILE A CG1 1 
ATOM   1570  C  CG2 . ILE A  1 206 ? -4.330  82.428   89.098  1.00 14.64 ? 287  ILE A CG2 1 
ATOM   1571  C  CD1 . ILE A  1 206 ? -3.273  82.033   85.427  1.00 16.08 ? 287  ILE A CD1 1 
ATOM   1572  N  N   . THR A  1 207 ? -7.058  83.759   88.989  1.00 17.61 ? 288  THR A N   1 
ATOM   1573  C  CA  . THR A  1 207 ? -7.707  84.640   89.943  1.00 18.73 ? 288  THR A CA  1 
ATOM   1574  C  C   . THR A  1 207 ? -7.376  84.089   91.320  1.00 19.52 ? 288  THR A C   1 
ATOM   1575  O  O   . THR A  1 207 ? -7.563  82.907   91.580  1.00 20.50 ? 288  THR A O   1 
ATOM   1576  C  CB  . THR A  1 207 ? -9.228  84.639   89.743  1.00 19.93 ? 288  THR A CB  1 
ATOM   1577  O  OG1 . THR A  1 207 ? -9.530  85.088   88.417  1.00 22.70 ? 288  THR A OG1 1 
ATOM   1578  C  CG2 . THR A  1 207 ? -9.904  85.552   90.748  1.00 19.08 ? 288  THR A CG2 1 
ATOM   1579  N  N   . CYS A  1 208 ? -6.867  84.937   92.201  1.00 19.27 ? 289  CYS A N   1 
ATOM   1580  C  CA  . CYS A  1 208 ? -6.509  84.480   93.532  1.00 19.47 ? 289  CYS A CA  1 
ATOM   1581  C  C   . CYS A  1 208 ? -7.224  85.280   94.597  1.00 19.50 ? 289  CYS A C   1 
ATOM   1582  O  O   . CYS A  1 208 ? -7.296  86.510   94.519  1.00 19.33 ? 289  CYS A O   1 
ATOM   1583  C  CB  . CYS A  1 208 ? -5.023  84.659   93.788  1.00 21.66 ? 289  CYS A CB  1 
ATOM   1584  S  SG  . CYS A  1 208 ? -3.842  84.008   92.576  1.00 22.30 ? 289  CYS A SG  1 
ATOM   1585  N  N   . VAL A  1 209 ? -7.753  84.579   95.591  1.00 17.18 ? 290  VAL A N   1 
ATOM   1586  C  CA  . VAL A  1 209 ? -8.404  85.241   96.698  1.00 16.01 ? 290  VAL A CA  1 
ATOM   1587  C  C   . VAL A  1 209 ? -7.490  84.863   97.842  1.00 16.70 ? 290  VAL A C   1 
ATOM   1588  O  O   . VAL A  1 209 ? -7.231  83.681   98.089  1.00 15.80 ? 290  VAL A O   1 
ATOM   1589  C  CB  . VAL A  1 209 ? -9.819  84.724   96.922  1.00 15.53 ? 290  VAL A CB  1 
ATOM   1590  C  CG1 . VAL A  1 209 ? -10.420 85.384   98.163  1.00 14.17 ? 290  VAL A CG1 1 
ATOM   1591  C  CG2 . VAL A  1 209 ? -10.662 85.045   95.702  1.00 15.16 ? 290  VAL A CG2 1 
ATOM   1592  N  N   . CYS A  1 210 ? -6.980  85.869   98.531  1.00 16.28 ? 291  CYS A N   1 
ATOM   1593  C  CA  . CYS A  1 210 ? -6.035  85.608   99.585  1.00 16.02 ? 291  CYS A CA  1 
ATOM   1594  C  C   . CYS A  1 210 ? -6.416  86.035   100.982 1.00 15.00 ? 291  CYS A C   1 
ATOM   1595  O  O   . CYS A  1 210 ? -7.576  86.298   101.296 1.00 16.01 ? 291  CYS A O   1 
ATOM   1596  C  CB  . CYS A  1 210 ? -4.722  86.251   99.194  1.00 17.81 ? 291  CYS A CB  1 
ATOM   1597  S  SG  . CYS A  1 210 ? -4.408  86.129   97.403  1.00 21.77 ? 291  CYS A SG  1 
ATOM   1598  N  N   . ARG A  1 211 ? -5.399  86.090   101.824 1.00 14.85 ? 292  ARG A N   1 
ATOM   1599  C  CA  . ARG A  1 211 ? -5.561  86.460   103.206 1.00 13.87 ? 292  ARG A CA  1 
ATOM   1600  C  C   . ARG A  1 211 ? -4.804  87.742   103.504 1.00 15.33 ? 292  ARG A C   1 
ATOM   1601  O  O   . ARG A  1 211 ? -3.599  87.821   103.259 1.00 16.66 ? 292  ARG A O   1 
ATOM   1602  C  CB  . ARG A  1 211 ? -5.026  85.334   104.080 1.00 14.05 ? 292  ARG A CB  1 
ATOM   1603  C  CG  . ARG A  1 211 ? -4.890  85.680   105.552 1.00 13.02 ? 292  ARG A CG  1 
ATOM   1604  C  CD  . ARG A  1 211 ? -4.223  84.539   106.280 1.00 13.48 ? 292  ARG A CD  1 
ATOM   1605  N  NE  . ARG A  1 211 ? -3.896  84.901   107.650 1.00 15.01 ? 292  ARG A NE  1 
ATOM   1606  C  CZ  . ARG A  1 211 ? -3.519  84.035   108.582 1.00 15.30 ? 292  ARG A CZ  1 
ATOM   1607  N  NH1 . ARG A  1 211 ? -3.239  84.470   109.802 1.00 15.95 ? 292  ARG A NH1 1 
ATOM   1608  N  NH2 . ARG A  1 211 ? -3.432  82.737   108.297 1.00 15.01 ? 292  ARG A NH2 1 
ATOM   1609  N  N   . ASP A  1 212 ? -5.517  88.747   104.010 1.00 14.94 ? 293  ASP A N   1 
ATOM   1610  C  CA  . ASP A  1 212 ? -4.913  90.019   104.389 1.00 15.00 ? 293  ASP A CA  1 
ATOM   1611  C  C   . ASP A  1 212 ? -4.839  89.908   105.897 1.00 14.37 ? 293  ASP A C   1 
ATOM   1612  O  O   . ASP A  1 212 ? -5.853  90.008   106.596 1.00 12.85 ? 293  ASP A O   1 
ATOM   1613  C  CB  . ASP A  1 212 ? -5.799  91.199   103.964 1.00 16.72 ? 293  ASP A CB  1 
ATOM   1614  C  CG  . ASP A  1 212 ? -5.383  92.527   104.607 1.00 19.59 ? 293  ASP A CG  1 
ATOM   1615  O  OD1 . ASP A  1 212 ? -5.864  93.588   104.132 1.00 19.00 ? 293  ASP A OD1 1 
ATOM   1616  O  OD2 . ASP A  1 212 ? -4.595  92.513   105.588 1.00 19.77 ? 293  ASP A OD2 1 
ATOM   1617  N  N   . ASN A  1 213 ? -3.623  89.681   106.380 1.00 14.57 ? 294  ASN A N   1 
ATOM   1618  C  CA  . ASN A  1 213 ? -3.349  89.491   107.799 1.00 15.03 ? 294  ASN A CA  1 
ATOM   1619  C  C   . ASN A  1 213 ? -2.954  90.796   108.481 1.00 15.73 ? 294  ASN A C   1 
ATOM   1620  O  O   . ASN A  1 213 ? -2.804  90.861   109.706 1.00 15.75 ? 294  ASN A O   1 
ATOM   1621  C  CB  . ASN A  1 213 ? -2.225  88.470   107.945 1.00 14.86 ? 294  ASN A CB  1 
ATOM   1622  C  CG  . ASN A  1 213 ? -2.128  87.906   109.335 1.00 18.64 ? 294  ASN A CG  1 
ATOM   1623  O  OD1 . ASN A  1 213 ? -3.042  87.219   109.800 1.00 20.91 ? 294  ASN A OD1 1 
ATOM   1624  N  ND2 . ASN A  1 213 ? -1.012  88.186   110.017 1.00 20.99 ? 294  ASN A ND2 1 
ATOM   1625  N  N   . TRP A  1 214 ? -2.807  91.839   107.674 1.00 14.65 ? 295  TRP A N   1 
ATOM   1626  C  CA  . TRP A  1 214 ? -2.406  93.145   108.162 1.00 13.32 ? 295  TRP A CA  1 
ATOM   1627  C  C   . TRP A  1 214 ? -3.576  93.968   108.663 1.00 14.51 ? 295  TRP A C   1 
ATOM   1628  O  O   . TRP A  1 214 ? -3.658  94.286   109.850 1.00 14.84 ? 295  TRP A O   1 
ATOM   1629  C  CB  . TRP A  1 214 ? -1.675  93.893   107.043 1.00 11.71 ? 295  TRP A CB  1 
ATOM   1630  C  CG  . TRP A  1 214 ? -1.353  95.346   107.303 1.00 9.60  ? 295  TRP A CG  1 
ATOM   1631  C  CD1 . TRP A  1 214 ? -1.294  95.988   108.515 1.00 8.80  ? 295  TRP A CD1 1 
ATOM   1632  C  CD2 . TRP A  1 214 ? -1.009  96.324   106.318 1.00 7.42  ? 295  TRP A CD2 1 
ATOM   1633  N  NE1 . TRP A  1 214 ? -0.938  97.307   108.339 1.00 7.22  ? 295  TRP A NE1 1 
ATOM   1634  C  CE2 . TRP A  1 214 ? -0.760  97.540   107.001 1.00 8.33  ? 295  TRP A CE2 1 
ATOM   1635  C  CE3 . TRP A  1 214 ? -0.894  96.295   104.924 1.00 6.38  ? 295  TRP A CE3 1 
ATOM   1636  C  CZ2 . TRP A  1 214 ? -0.397  98.716   106.328 1.00 9.02  ? 295  TRP A CZ2 1 
ATOM   1637  C  CZ3 . TRP A  1 214 ? -0.533  97.464   104.254 1.00 8.79  ? 295  TRP A CZ3 1 
ATOM   1638  C  CH2 . TRP A  1 214 ? -0.291  98.660   104.959 1.00 8.12  ? 295  TRP A CH2 1 
ATOM   1639  N  N   . HIS A  1 215 ? -4.502  94.305   107.774 1.00 15.30 ? 296  HIS A N   1 
ATOM   1640  C  CA  . HIS A  1 215 ? -5.606  95.140   108.209 1.00 15.43 ? 296  HIS A CA  1 
ATOM   1641  C  C   . HIS A  1 215 ? -6.918  95.001   107.449 1.00 14.11 ? 296  HIS A C   1 
ATOM   1642  O  O   . HIS A  1 215 ? -7.624  95.990   107.269 1.00 15.79 ? 296  HIS A O   1 
ATOM   1643  C  CB  . HIS A  1 215 ? -5.139  96.604   108.185 1.00 16.43 ? 296  HIS A CB  1 
ATOM   1644  C  CG  . HIS A  1 215 ? -4.607  97.042   106.858 1.00 15.33 ? 296  HIS A CG  1 
ATOM   1645  N  ND1 . HIS A  1 215 ? -4.728  96.270   105.720 1.00 17.00 ? 296  HIS A ND1 1 
ATOM   1646  C  CD2 . HIS A  1 215 ? -3.984  98.179   106.475 1.00 16.68 ? 296  HIS A CD2 1 
ATOM   1647  C  CE1 . HIS A  1 215 ? -4.203  96.916   104.694 1.00 16.40 ? 296  HIS A CE1 1 
ATOM   1648  N  NE2 . HIS A  1 215 ? -3.744  98.078   105.125 1.00 16.95 ? 296  HIS A NE2 1 
ATOM   1649  N  N   . GLY A  1 216 ? -7.257  93.790   107.018 1.00 14.30 ? 297  GLY A N   1 
ATOM   1650  C  CA  . GLY A  1 216 ? -8.504  93.598   106.297 1.00 14.25 ? 297  GLY A CA  1 
ATOM   1651  C  C   . GLY A  1 216 ? -9.350  92.420   106.757 1.00 16.53 ? 297  GLY A C   1 
ATOM   1652  O  O   . GLY A  1 216 ? -8.834  91.328   106.998 1.00 17.45 ? 297  GLY A O   1 
ATOM   1653  N  N   . SER A  1 217 ? -10.656 92.651   106.871 1.00 18.40 ? 298  SER A N   1 
ATOM   1654  C  CA  . SER A  1 217 ? -11.624 91.633   107.273 1.00 19.21 ? 298  SER A CA  1 
ATOM   1655  C  C   . SER A  1 217 ? -12.178 90.940   106.026 1.00 19.20 ? 298  SER A C   1 
ATOM   1656  O  O   . SER A  1 217 ? -12.722 89.832   106.094 1.00 19.70 ? 298  SER A O   1 
ATOM   1657  C  CB  . SER A  1 217 ? -12.774 92.277   108.043 1.00 21.30 ? 298  SER A CB  1 
ATOM   1658  O  OG  . SER A  1 217 ? -12.391 92.540   109.383 1.00 25.78 ? 298  SER A OG  1 
ATOM   1659  N  N   . ASN A  1 218 ? -12.063 91.619   104.891 1.00 17.36 ? 299  ASN A N   1 
ATOM   1660  C  CA  . ASN A  1 218 ? -12.509 91.072   103.615 1.00 16.13 ? 299  ASN A CA  1 
ATOM   1661  C  C   . ASN A  1 218 ? -11.243 90.537   102.969 1.00 14.46 ? 299  ASN A C   1 
ATOM   1662  O  O   . ASN A  1 218 ? -10.144 90.866   103.393 1.00 12.93 ? 299  ASN A O   1 
ATOM   1663  C  CB  . ASN A  1 218 ? -13.151 92.169   102.752 1.00 16.73 ? 299  ASN A CB  1 
ATOM   1664  C  CG  . ASN A  1 218 ? -12.305 93.434   102.678 1.00 19.55 ? 299  ASN A CG  1 
ATOM   1665  O  OD1 . ASN A  1 218 ? -11.701 93.859   103.670 1.00 19.12 ? 299  ASN A OD1 1 
ATOM   1666  N  ND2 . ASN A  1 218 ? -12.278 94.057   101.505 1.00 21.66 ? 299  ASN A ND2 1 
ATOM   1667  N  N   . ARG A  1 219 ? -11.390 89.701   101.959 1.00 15.25 ? 300  ARG A N   1 
ATOM   1668  C  CA  . ARG A  1 219 ? -10.225 89.137   101.313 1.00 15.02 ? 300  ARG A CA  1 
ATOM   1669  C  C   . ARG A  1 219 ? -9.805  89.926   100.088 1.00 15.20 ? 300  ARG A C   1 
ATOM   1670  O  O   . ARG A  1 219 ? -10.635 90.364   99.293  1.00 14.41 ? 300  ARG A O   1 
ATOM   1671  C  CB  . ARG A  1 219 ? -10.488 87.679   100.929 1.00 13.20 ? 300  ARG A CB  1 
ATOM   1672  C  CG  . ARG A  1 219 ? -10.732 86.778   102.124 1.00 13.61 ? 300  ARG A CG  1 
ATOM   1673  C  CD  . ARG A  1 219 ? -10.765 85.309   101.727 1.00 13.01 ? 300  ARG A CD  1 
ATOM   1674  N  NE  . ARG A  1 219 ? -10.898 84.449   102.900 1.00 13.32 ? 300  ARG A NE  1 
ATOM   1675  C  CZ  . ARG A  1 219 ? -9.933  84.245   103.788 1.00 13.18 ? 300  ARG A CZ  1 
ATOM   1676  N  NH1 . ARG A  1 219 ? -10.144 83.450   104.827 1.00 10.09 ? 300  ARG A NH1 1 
ATOM   1677  N  NH2 . ARG A  1 219 ? -8.750  84.828   103.626 1.00 12.71 ? 300  ARG A NH2 1 
ATOM   1678  N  N   . PRO A  1 220 ? -8.496  90.135   99.933  1.00 14.72 ? 301  PRO A N   1 
ATOM   1679  C  CA  . PRO A  1 220 ? -7.969  90.874   98.786  1.00 16.65 ? 301  PRO A CA  1 
ATOM   1680  C  C   . PRO A  1 220 ? -7.817  89.873   97.655  1.00 15.50 ? 301  PRO A C   1 
ATOM   1681  O  O   . PRO A  1 220 ? -7.781  88.677   97.905  1.00 14.44 ? 301  PRO A O   1 
ATOM   1682  C  CB  . PRO A  1 220 ? -6.630  91.373   99.298  1.00 15.04 ? 301  PRO A CB  1 
ATOM   1683  C  CG  . PRO A  1 220 ? -6.178  90.213   100.140 1.00 17.13 ? 301  PRO A CG  1 
ATOM   1684  C  CD  . PRO A  1 220 ? -7.430  89.833   100.903 1.00 14.62 ? 301  PRO A CD  1 
ATOM   1685  N  N   . TRP A  1 221 ? -7.739  90.345   96.418  1.00 15.06 ? 302  TRP A N   1 
ATOM   1686  C  CA  . TRP A  1 221 ? -7.582  89.431   95.301  1.00 15.20 ? 302  TRP A CA  1 
ATOM   1687  C  C   . TRP A  1 221 ? -6.647  89.971   94.241  1.00 16.67 ? 302  TRP A C   1 
ATOM   1688  O  O   . TRP A  1 221 ? -6.340  91.160   94.214  1.00 18.64 ? 302  TRP A O   1 
ATOM   1689  C  CB  . TRP A  1 221 ? -8.930  89.107   94.649  1.00 12.59 ? 302  TRP A CB  1 
ATOM   1690  C  CG  . TRP A  1 221 ? -9.712  90.302   94.177  1.00 13.96 ? 302  TRP A CG  1 
ATOM   1691  C  CD1 . TRP A  1 221 ? -10.704 90.955   94.863  1.00 13.32 ? 302  TRP A CD1 1 
ATOM   1692  C  CD2 . TRP A  1 221 ? -9.580  90.988   92.916  1.00 13.03 ? 302  TRP A CD2 1 
ATOM   1693  N  NE1 . TRP A  1 221 ? -11.195 91.996   94.110  1.00 12.86 ? 302  TRP A NE1 1 
ATOM   1694  C  CE2 . TRP A  1 221 ? -10.529 92.042   92.918  1.00 12.73 ? 302  TRP A CE2 1 
ATOM   1695  C  CE3 . TRP A  1 221 ? -8.760  90.815   91.794  1.00 12.55 ? 302  TRP A CE3 1 
ATOM   1696  C  CZ2 . TRP A  1 221 ? -10.673 92.918   91.834  1.00 11.19 ? 302  TRP A CZ2 1 
ATOM   1697  C  CZ3 . TRP A  1 221 ? -8.906  91.688   90.715  1.00 12.84 ? 302  TRP A CZ3 1 
ATOM   1698  C  CH2 . TRP A  1 221 ? -9.858  92.726   90.746  1.00 12.89 ? 302  TRP A CH2 1 
ATOM   1699  N  N   . VAL A  1 222 ? -6.183  89.071   93.383  1.00 16.70 ? 303  VAL A N   1 
ATOM   1700  C  CA  . VAL A  1 222 ? -5.306  89.417   92.278  1.00 17.61 ? 303  VAL A CA  1 
ATOM   1701  C  C   . VAL A  1 222 ? -5.679  88.512   91.128  1.00 17.51 ? 303  VAL A C   1 
ATOM   1702  O  O   . VAL A  1 222 ? -5.957  87.335   91.317  1.00 18.72 ? 303  VAL A O   1 
ATOM   1703  C  CB  . VAL A  1 222 ? -3.804  89.138   92.568  1.00 18.73 ? 303  VAL A CB  1 
ATOM   1704  C  CG1 . VAL A  1 222 ? -2.953  89.704   91.439  1.00 15.42 ? 303  VAL A CG1 1 
ATOM   1705  C  CG2 . VAL A  1 222 ? -3.395  89.745   93.860  1.00 19.62 ? 303  VAL A CG2 1 
ATOM   1706  N  N   . SER A  1 223 ? -5.705  89.061   89.933  1.00 17.84 ? 304  SER A N   1 
ATOM   1707  C  CA  . SER A  1 223 ? -5.987  88.242   88.776  1.00 19.28 ? 304  SER A CA  1 
ATOM   1708  C  C   . SER A  1 223 ? -4.958  88.704   87.761  1.00 18.61 ? 304  SER A C   1 
ATOM   1709  O  O   . SER A  1 223 ? -4.542  89.865   87.779  1.00 16.48 ? 304  SER A O   1 
ATOM   1710  C  CB  . SER A  1 223 ? -7.417  88.459   88.273  1.00 19.18 ? 304  SER A CB  1 
ATOM   1711  O  OG  . SER A  1 223 ? -7.611  89.797   87.864  1.00 27.63 ? 304  SER A OG  1 
ATOM   1712  N  N   . PHE A  1 224 ? -4.522  87.790   86.904  1.00 20.00 ? 305  PHE A N   1 
ATOM   1713  C  CA  . PHE A  1 224 ? -3.531  88.129   85.904  1.00 22.87 ? 305  PHE A CA  1 
ATOM   1714  C  C   . PHE A  1 224 ? -3.576  87.223   84.677  1.00 25.70 ? 305  PHE A C   1 
ATOM   1715  O  O   . PHE A  1 224 ? -4.059  86.090   84.738  1.00 25.49 ? 305  PHE A O   1 
ATOM   1716  C  CB  . PHE A  1 224 ? -2.139  88.104   86.544  1.00 21.05 ? 305  PHE A CB  1 
ATOM   1717  C  CG  . PHE A  1 224 ? -1.868  86.871   87.355  1.00 19.43 ? 305  PHE A CG  1 
ATOM   1718  C  CD1 . PHE A  1 224 ? -1.347  85.730   86.757  1.00 18.22 ? 305  PHE A CD1 1 
ATOM   1719  C  CD2 . PHE A  1 224 ? -2.119  86.856   88.724  1.00 19.09 ? 305  PHE A CD2 1 
ATOM   1720  C  CE1 . PHE A  1 224 ? -1.069  84.586   87.512  1.00 18.23 ? 305  PHE A CE1 1 
ATOM   1721  C  CE2 . PHE A  1 224 ? -1.848  85.719   89.488  1.00 19.47 ? 305  PHE A CE2 1 
ATOM   1722  C  CZ  . PHE A  1 224 ? -1.318  84.579   88.877  1.00 18.34 ? 305  PHE A CZ  1 
ATOM   1723  N  N   . ASN A  1 225 ? -3.086  87.758   83.562  1.00 28.65 ? 306  ASN A N   1 
ATOM   1724  C  CA  . ASN A  1 225 ? -3.030  87.042   82.300  1.00 31.49 ? 306  ASN A CA  1 
ATOM   1725  C  C   . ASN A  1 225 ? -1.764  86.194   82.311  1.00 29.58 ? 306  ASN A C   1 
ATOM   1726  O  O   . ASN A  1 225 ? -0.960  86.298   83.232  1.00 29.31 ? 306  ASN A O   1 
ATOM   1727  C  CB  . ASN A  1 225 ? -2.990  88.042   81.134  1.00 38.21 ? 306  ASN A CB  1 
ATOM   1728  C  CG  . ASN A  1 225 ? -2.699  87.367   79.790  1.00 46.12 ? 306  ASN A CG  1 
ATOM   1729  O  OD1 . ASN A  1 225 ? -3.242  86.287   79.478  1.00 48.87 ? 306  ASN A OD1 1 
ATOM   1730  N  ND2 . ASN A  1 225 ? -1.846  88.003   78.984  1.00 48.22 ? 306  ASN A ND2 1 
ATOM   1731  N  N   . GLN A  1 226 ? -1.583  85.367   81.287  1.00 28.53 ? 308  GLN A N   1 
ATOM   1732  C  CA  . GLN A  1 226 ? -0.412  84.502   81.196  1.00 28.55 ? 308  GLN A CA  1 
ATOM   1733  C  C   . GLN A  1 226 ? 0.897   85.259   81.059  1.00 28.63 ? 308  GLN A C   1 
ATOM   1734  O  O   . GLN A  1 226 ? 1.964   84.659   81.004  1.00 29.29 ? 308  GLN A O   1 
ATOM   1735  C  CB  . GLN A  1 226 ? -0.580  83.516   80.041  1.00 27.91 ? 308  GLN A CB  1 
ATOM   1736  C  CG  . GLN A  1 226 ? -1.657  82.487   80.327  1.00 28.40 ? 308  GLN A CG  1 
ATOM   1737  C  CD  . GLN A  1 226 ? -2.000  81.617   79.133  1.00 29.65 ? 308  GLN A CD  1 
ATOM   1738  O  OE1 . GLN A  1 226 ? -1.157  80.872   78.618  1.00 30.64 ? 308  GLN A OE1 1 
ATOM   1739  N  NE2 . GLN A  1 226 ? -3.251  81.697   78.691  1.00 28.82 ? 308  GLN A NE2 1 
ATOM   1740  N  N   . ASN A  1 227 ? 0.815   86.580   81.019  1.00 29.13 ? 309  ASN A N   1 
ATOM   1741  C  CA  . ASN A  1 227 ? 2.008   87.403   80.915  1.00 29.41 ? 309  ASN A CA  1 
ATOM   1742  C  C   . ASN A  1 227 ? 2.187   88.279   82.147  1.00 28.39 ? 309  ASN A C   1 
ATOM   1743  O  O   . ASN A  1 227 ? 2.906   89.277   82.123  1.00 29.07 ? 309  ASN A O   1 
ATOM   1744  C  CB  . ASN A  1 227 ? 1.936   88.255   79.663  1.00 31.43 ? 309  ASN A CB  1 
ATOM   1745  C  CG  . ASN A  1 227 ? 2.166   87.447   78.421  1.00 36.97 ? 309  ASN A CG  1 
ATOM   1746  O  OD1 . ASN A  1 227 ? 3.224   86.825   78.257  1.00 38.21 ? 309  ASN A OD1 1 
ATOM   1747  N  ND2 . ASN A  1 227 ? 1.176   87.430   77.533  1.00 40.54 ? 309  ASN A ND2 1 
ATOM   1748  N  N   . LEU A  1 228 ? 1.512   87.896   83.221  1.00 26.29 ? 310  LEU A N   1 
ATOM   1749  C  CA  . LEU A  1 228 ? 1.598   88.606   84.483  1.00 24.60 ? 310  LEU A CA  1 
ATOM   1750  C  C   . LEU A  1 228 ? 1.104   90.048   84.475  1.00 23.39 ? 310  LEU A C   1 
ATOM   1751  O  O   . LEU A  1 228 ? 1.537   90.862   85.278  1.00 23.73 ? 310  LEU A O   1 
ATOM   1752  C  CB  . LEU A  1 228 ? 3.031   88.509   85.015  1.00 22.82 ? 310  LEU A CB  1 
ATOM   1753  C  CG  . LEU A  1 228 ? 3.361   87.165   85.687  1.00 21.09 ? 310  LEU A CG  1 
ATOM   1754  C  CD1 . LEU A  1 228 ? 2.525   86.029   85.112  1.00 18.58 ? 310  LEU A CD1 1 
ATOM   1755  C  CD2 . LEU A  1 228 ? 4.835   86.883   85.526  1.00 20.77 ? 310  LEU A CD2 1 
ATOM   1756  N  N   . GLU A  1 229 ? 0.198   90.359   83.555  1.00 22.97 ? 311  GLU A N   1 
ATOM   1757  C  CA  . GLU A  1 229 ? -0.410  91.681   83.491  1.00 21.03 ? 311  GLU A CA  1 
ATOM   1758  C  C   . GLU A  1 229 ? -1.562  91.466   84.476  1.00 20.85 ? 311  GLU A C   1 
ATOM   1759  O  O   . GLU A  1 229 ? -2.344  90.523   84.324  1.00 21.35 ? 311  GLU A O   1 
ATOM   1760  C  CB  . GLU A  1 229 ? -0.884  91.955   82.064  1.00 20.81 ? 311  GLU A CB  1 
ATOM   1761  C  CG  . GLU A  1 229 ? 0.250   91.744   81.058  1.00 24.98 ? 311  GLU A CG  1 
ATOM   1762  C  CD  . GLU A  1 229 ? -0.131  92.029   79.614  1.00 27.74 ? 311  GLU A CD  1 
ATOM   1763  O  OE1 . GLU A  1 229 ? -1.170  91.515   79.148  1.00 29.52 ? 311  GLU A OE1 1 
ATOM   1764  O  OE2 . GLU A  1 229 ? 0.625   92.757   78.936  1.00 30.40 ? 311  GLU A OE2 1 
ATOM   1765  N  N   . TYR A  1 230 ? -1.682  92.326   85.482  1.00 18.82 ? 312  TYR A N   1 
ATOM   1766  C  CA  . TYR A  1 230 ? -2.680  92.084   86.512  1.00 19.40 ? 312  TYR A CA  1 
ATOM   1767  C  C   . TYR A  1 230 ? -3.632  93.189   86.956  1.00 20.54 ? 312  TYR A C   1 
ATOM   1768  O  O   . TYR A  1 230 ? -3.526  94.354   86.561  1.00 21.18 ? 312  TYR A O   1 
ATOM   1769  C  CB  . TYR A  1 230 ? -1.939  91.589   87.755  1.00 18.68 ? 312  TYR A CB  1 
ATOM   1770  C  CG  . TYR A  1 230 ? -1.070  92.673   88.356  1.00 16.26 ? 312  TYR A CG  1 
ATOM   1771  C  CD1 . TYR A  1 230 ? -1.604  93.610   89.244  1.00 13.07 ? 312  TYR A CD1 1 
ATOM   1772  C  CD2 . TYR A  1 230 ? 0.259   92.828   87.958  1.00 17.10 ? 312  TYR A CD2 1 
ATOM   1773  C  CE1 . TYR A  1 230 ? -0.842  94.681   89.715  1.00 12.52 ? 312  TYR A CE1 1 
ATOM   1774  C  CE2 . TYR A  1 230 ? 1.035   93.904   88.426  1.00 15.54 ? 312  TYR A CE2 1 
ATOM   1775  C  CZ  . TYR A  1 230 ? 0.473   94.825   89.301  1.00 14.06 ? 312  TYR A CZ  1 
ATOM   1776  O  OH  . TYR A  1 230 ? 1.212   95.900   89.743  1.00 14.15 ? 312  TYR A OH  1 
ATOM   1777  N  N   . GLN A  1 231 ? -4.548  92.782   87.830  1.00 19.75 ? 313  GLN A N   1 
ATOM   1778  C  CA  . GLN A  1 231 ? -5.538  93.660   88.444  1.00 20.83 ? 313  GLN A CA  1 
ATOM   1779  C  C   . GLN A  1 231 ? -5.650  93.197   89.889  1.00 19.38 ? 313  GLN A C   1 
ATOM   1780  O  O   . GLN A  1 231 ? -5.468  92.014   90.179  1.00 18.86 ? 313  GLN A O   1 
ATOM   1781  C  CB  . GLN A  1 231 ? -6.911  93.527   87.774  1.00 22.21 ? 313  GLN A CB  1 
ATOM   1782  C  CG  . GLN A  1 231 ? -6.934  93.919   86.321  1.00 27.75 ? 313  GLN A CG  1 
ATOM   1783  C  CD  . GLN A  1 231 ? -8.340  93.947   85.742  1.00 32.18 ? 313  GLN A CD  1 
ATOM   1784  O  OE1 . GLN A  1 231 ? -8.521  94.192   84.543  1.00 35.32 ? 313  GLN A OE1 1 
ATOM   1785  N  NE2 . GLN A  1 231 ? -9.346  93.703   86.586  1.00 32.25 ? 313  GLN A NE2 1 
ATOM   1786  N  N   . ILE A  1 232 ? -5.950  94.123   90.791  1.00 17.81 ? 314  ILE A N   1 
ATOM   1787  C  CA  . ILE A  1 232 ? -6.086  93.784   92.196  1.00 16.17 ? 314  ILE A CA  1 
ATOM   1788  C  C   . ILE A  1 232 ? -7.261  94.515   92.813  1.00 16.68 ? 314  ILE A C   1 
ATOM   1789  O  O   . ILE A  1 232 ? -7.799  95.451   92.231  1.00 16.40 ? 314  ILE A O   1 
ATOM   1790  C  CB  . ILE A  1 232 ? -4.828  94.165   92.987  1.00 15.73 ? 314  ILE A CB  1 
ATOM   1791  C  CG1 . ILE A  1 232 ? -4.515  95.646   92.752  1.00 15.36 ? 314  ILE A CG1 1 
ATOM   1792  C  CG2 . ILE A  1 232 ? -3.659  93.256   92.593  1.00 15.78 ? 314  ILE A CG2 1 
ATOM   1793  C  CD1 . ILE A  1 232 ? -3.301  96.153   93.494  1.00 15.03 ? 314  ILE A CD1 1 
ATOM   1794  N  N   . GLY A  1 233 ? -7.647  94.079   94.004  1.00 17.07 ? 315  GLY A N   1 
ATOM   1795  C  CA  . GLY A  1 233 ? -8.745  94.704   94.709  1.00 16.11 ? 315  GLY A CA  1 
ATOM   1796  C  C   . GLY A  1 233 ? -9.154  93.862   95.896  1.00 17.28 ? 315  GLY A C   1 
ATOM   1797  O  O   . GLY A  1 233 ? -8.438  92.943   96.302  1.00 17.17 ? 315  GLY A O   1 
ATOM   1798  N  N   . TYR A  1 234 ? -10.310 94.185   96.462  1.00 18.15 ? 316  TYR A N   1 
ATOM   1799  C  CA  . TYR A  1 234 ? -10.850 93.451   97.600  1.00 17.76 ? 316  TYR A CA  1 
ATOM   1800  C  C   . TYR A  1 234 ? -12.291 93.068   97.281  1.00 17.64 ? 316  TYR A C   1 
ATOM   1801  O  O   . TYR A  1 234 ? -12.965 93.748   96.500  1.00 18.81 ? 316  TYR A O   1 
ATOM   1802  C  CB  . TYR A  1 234 ? -10.825 94.312   98.879  1.00 16.68 ? 316  TYR A CB  1 
ATOM   1803  C  CG  . TYR A  1 234 ? -9.485  94.377   99.596  1.00 17.19 ? 316  TYR A CG  1 
ATOM   1804  C  CD1 . TYR A  1 234 ? -8.380  95.023   99.027  1.00 18.82 ? 316  TYR A CD1 1 
ATOM   1805  C  CD2 . TYR A  1 234 ? -9.320  93.781   100.843 1.00 17.96 ? 316  TYR A CD2 1 
ATOM   1806  C  CE1 . TYR A  1 234 ? -7.137  95.064   99.694  1.00 19.33 ? 316  TYR A CE1 1 
ATOM   1807  C  CE2 . TYR A  1 234 ? -8.088  93.812   101.514 1.00 19.43 ? 316  TYR A CE2 1 
ATOM   1808  C  CZ  . TYR A  1 234 ? -7.003  94.452   100.937 1.00 20.14 ? 316  TYR A CZ  1 
ATOM   1809  O  OH  . TYR A  1 234 ? -5.795  94.461   101.606 1.00 19.49 ? 316  TYR A OH  1 
ATOM   1810  N  N   . ILE A  1 235 ? -12.748 91.962   97.858  1.00 18.03 ? 317  ILE A N   1 
ATOM   1811  C  CA  . ILE A  1 235 ? -14.118 91.510   97.674  1.00 18.11 ? 317  ILE A CA  1 
ATOM   1812  C  C   . ILE A  1 235 ? -14.954 92.549   98.443  1.00 19.01 ? 317  ILE A C   1 
ATOM   1813  O  O   . ILE A  1 235 ? -14.780 92.721   99.652  1.00 16.94 ? 317  ILE A O   1 
ATOM   1814  C  CB  . ILE A  1 235 ? -14.273 90.089   98.259  1.00 17.78 ? 317  ILE A CB  1 
ATOM   1815  C  CG1 . ILE A  1 235 ? -13.406 89.130   97.450  1.00 17.74 ? 317  ILE A CG1 1 
ATOM   1816  C  CG2 . ILE A  1 235 ? -15.723 89.644   98.246  1.00 16.78 ? 317  ILE A CG2 1 
ATOM   1817  C  CD1 . ILE A  1 235 ? -13.538 87.697   97.874  1.00 18.72 ? 317  ILE A CD1 1 
ATOM   1818  N  N   . CYS A  1 236 ? -15.845 93.254   97.751  1.00 19.76 ? 318  CYS A N   1 
ATOM   1819  C  CA  . CYS A  1 236 ? -16.613 94.298   98.417  1.00 23.45 ? 318  CYS A CA  1 
ATOM   1820  C  C   . CYS A  1 236 ? -17.820 93.837   99.209  1.00 22.91 ? 318  CYS A C   1 
ATOM   1821  O  O   . CYS A  1 236 ? -18.438 94.641   99.900  1.00 24.79 ? 318  CYS A O   1 
ATOM   1822  C  CB  . CYS A  1 236 ? -17.076 95.363   97.418  1.00 27.41 ? 318  CYS A CB  1 
ATOM   1823  S  SG  . CYS A  1 236 ? -16.061 95.616   95.922  1.00 34.40 ? 318  CYS A SG  1 
ATOM   1824  N  N   . SER A  1 237 ? -18.162 92.558   99.122  1.00 21.96 ? 319  SER A N   1 
ATOM   1825  C  CA  . SER A  1 237 ? -19.318 92.056   99.846  1.00 20.53 ? 319  SER A CA  1 
ATOM   1826  C  C   . SER A  1 237 ? -19.274 92.339   101.336 1.00 21.73 ? 319  SER A C   1 
ATOM   1827  O  O   . SER A  1 237 ? -18.240 92.187   101.975 1.00 23.92 ? 319  SER A O   1 
ATOM   1828  C  CB  . SER A  1 237 ? -19.468 90.552   99.644  1.00 20.47 ? 319  SER A CB  1 
ATOM   1829  O  OG  . SER A  1 237 ? -20.494 90.038   100.482 1.00 20.48 ? 319  SER A OG  1 
ATOM   1830  N  N   . GLY A  1 238 ? -20.414 92.739   101.886 1.00 23.00 ? 320  GLY A N   1 
ATOM   1831  C  CA  . GLY A  1 238 ? -20.499 93.009   103.307 1.00 23.22 ? 320  GLY A CA  1 
ATOM   1832  C  C   . GLY A  1 238 ? -20.489 91.704   104.067 1.00 24.89 ? 320  GLY A C   1 
ATOM   1833  O  O   . GLY A  1 238 ? -20.557 91.698   105.296 1.00 27.15 ? 320  GLY A O   1 
ATOM   1834  N  N   . VAL A  1 239 ? -20.441 90.590   103.338 1.00 24.76 ? 321  VAL A N   1 
ATOM   1835  C  CA  . VAL A  1 239 ? -20.363 89.270   103.968 1.00 24.29 ? 321  VAL A CA  1 
ATOM   1836  C  C   . VAL A  1 239 ? -18.868 88.977   104.006 1.00 23.95 ? 321  VAL A C   1 
ATOM   1837  O  O   . VAL A  1 239 ? -18.336 88.286   103.139 1.00 23.75 ? 321  VAL A O   1 
ATOM   1838  C  CB  . VAL A  1 239 ? -21.060 88.180   103.135 1.00 24.05 ? 321  VAL A CB  1 
ATOM   1839  C  CG1 . VAL A  1 239 ? -20.808 86.824   103.752 1.00 23.57 ? 321  VAL A CG1 1 
ATOM   1840  C  CG2 . VAL A  1 239 ? -22.547 88.443   103.076 1.00 25.58 ? 321  VAL A CG2 1 
ATOM   1841  N  N   . PHE A  1 240 ? -18.199 89.546   105.002 1.00 23.01 ? 322  PHE A N   1 
ATOM   1842  C  CA  . PHE A  1 240 ? -16.760 89.407   105.178 1.00 22.66 ? 322  PHE A CA  1 
ATOM   1843  C  C   . PHE A  1 240 ? -16.317 87.963   105.227 1.00 21.81 ? 322  PHE A C   1 
ATOM   1844  O  O   . PHE A  1 240 ? -16.930 87.141   105.909 1.00 22.00 ? 322  PHE A O   1 
ATOM   1845  C  CB  . PHE A  1 240 ? -16.350 90.138   106.447 1.00 23.29 ? 322  PHE A CB  1 
ATOM   1846  C  CG  . PHE A  1 240 ? -16.889 91.528   106.519 1.00 23.61 ? 322  PHE A CG  1 
ATOM   1847  C  CD1 . PHE A  1 240 ? -17.796 91.885   107.505 1.00 24.22 ? 322  PHE A CD1 1 
ATOM   1848  C  CD2 . PHE A  1 240 ? -16.539 92.469   105.553 1.00 24.04 ? 322  PHE A CD2 1 
ATOM   1849  C  CE1 . PHE A  1 240 ? -18.352 93.161   107.525 1.00 24.30 ? 322  PHE A CE1 1 
ATOM   1850  C  CE2 . PHE A  1 240 ? -17.086 93.743   105.563 1.00 22.55 ? 322  PHE A CE2 1 
ATOM   1851  C  CZ  . PHE A  1 240 ? -17.995 94.089   106.548 1.00 24.55 ? 322  PHE A CZ  1 
ATOM   1852  N  N   . GLY A  1 241 ? -15.232 87.673   104.514 1.00 21.22 ? 323  GLY A N   1 
ATOM   1853  C  CA  . GLY A  1 241 ? -14.727 86.316   104.429 1.00 21.01 ? 323  GLY A CA  1 
ATOM   1854  C  C   . GLY A  1 241 ? -13.558 85.915   105.300 1.00 20.60 ? 323  GLY A C   1 
ATOM   1855  O  O   . GLY A  1 241 ? -13.294 84.724   105.462 1.00 22.62 ? 323  GLY A O   1 
ATOM   1856  N  N   . ASP A  1 242 ? -12.851 86.881   105.868 1.00 20.01 ? 324  ASP A N   1 
ATOM   1857  C  CA  . ASP A  1 242 ? -11.706 86.557   106.717 1.00 18.98 ? 324  ASP A CA  1 
ATOM   1858  C  C   . ASP A  1 242 ? -12.171 86.191   108.117 1.00 17.53 ? 324  ASP A C   1 
ATOM   1859  O  O   . ASP A  1 242 ? -13.354 86.290   108.451 1.00 16.96 ? 324  ASP A O   1 
ATOM   1860  C  CB  . ASP A  1 242 ? -10.750 87.764   106.797 1.00 20.12 ? 324  ASP A CB  1 
ATOM   1861  C  CG  . ASP A  1 242 ? -9.300  87.364   107.065 1.00 22.37 ? 324  ASP A CG  1 
ATOM   1862  O  OD1 . ASP A  1 242 ? -8.415  88.257   107.058 1.00 22.57 ? 324  ASP A OD1 1 
ATOM   1863  O  OD2 . ASP A  1 242 ? -9.036  86.163   107.277 1.00 23.39 ? 324  ASP A OD2 1 
ATOM   1864  N  N   . ASN A  1 243 ? -11.219 85.764   108.933 1.00 16.34 ? 325  ASN A N   1 
ATOM   1865  C  CA  . ASN A  1 243 ? -11.467 85.433   110.305 1.00 14.11 ? 325  ASN A CA  1 
ATOM   1866  C  C   . ASN A  1 243 ? -10.175 85.681   111.063 1.00 13.82 ? 325  ASN A C   1 
ATOM   1867  O  O   . ASN A  1 243 ? -9.111  85.206   110.672 1.00 15.59 ? 325  ASN A O   1 
ATOM   1868  C  CB  . ASN A  1 243 ? -11.867 83.959   110.447 1.00 16.64 ? 325  ASN A CB  1 
ATOM   1869  C  CG  . ASN A  1 243 ? -12.163 83.565   111.886 1.00 18.02 ? 325  ASN A CG  1 
ATOM   1870  O  OD1 . ASN A  1 243 ? -11.255 83.451   112.706 1.00 19.71 ? 325  ASN A OD1 1 
ATOM   1871  N  ND2 . ASN A  1 243 ? -13.442 83.368   112.199 1.00 18.26 ? 325  ASN A ND2 1 
ATOM   1872  N  N   . PRO A  1 244 ? -10.220 86.554   112.073 1.00 13.13 ? 326  PRO A N   1 
ATOM   1873  C  CA  . PRO A  1 244 ? -11.424 87.208   112.599 1.00 11.78 ? 326  PRO A CA  1 
ATOM   1874  C  C   . PRO A  1 244 ? -12.078 88.165   111.604 1.00 12.37 ? 326  PRO A C   1 
ATOM   1875  O  O   . PRO A  1 244 ? -11.586 88.366   110.500 1.00 12.07 ? 326  PRO A O   1 
ATOM   1876  C  CB  . PRO A  1 244 ? -10.900 87.966   113.809 1.00 12.00 ? 326  PRO A CB  1 
ATOM   1877  C  CG  . PRO A  1 244 ? -9.501  88.286   113.428 1.00 10.26 ? 326  PRO A CG  1 
ATOM   1878  C  CD  . PRO A  1 244 ? -9.031  86.969   112.835 1.00 10.81 ? 326  PRO A CD  1 
ATOM   1879  N  N   . ARG A  1 245 ? -13.197 88.742   112.028 1.00 14.03 ? 327  ARG A N   1 
ATOM   1880  C  CA  . ARG A  1 245 ? -13.943 89.694   111.217 1.00 15.16 ? 327  ARG A CA  1 
ATOM   1881  C  C   . ARG A  1 245 ? -15.073 90.268   112.057 1.00 16.04 ? 327  ARG A C   1 
ATOM   1882  O  O   . ARG A  1 245 ? -15.341 89.783   113.153 1.00 15.89 ? 327  ARG A O   1 
ATOM   1883  C  CB  . ARG A  1 245 ? -14.541 89.008   109.990 1.00 16.09 ? 327  ARG A CB  1 
ATOM   1884  C  CG  . ARG A  1 245 ? -15.519 87.900   110.335 1.00 17.21 ? 327  ARG A CG  1 
ATOM   1885  C  CD  . ARG A  1 245 ? -16.267 87.445   109.104 1.00 16.85 ? 327  ARG A CD  1 
ATOM   1886  N  NE  . ARG A  1 245 ? -17.298 86.459   109.416 1.00 15.40 ? 327  ARG A NE  1 
ATOM   1887  C  CZ  . ARG A  1 245 ? -17.115 85.144   109.388 1.00 16.31 ? 327  ARG A CZ  1 
ATOM   1888  N  NH1 . ARG A  1 245 ? -18.121 84.329   109.684 1.00 15.46 ? 327  ARG A NH1 1 
ATOM   1889  N  NH2 . ARG A  1 245 ? -15.930 84.641   109.051 1.00 16.01 ? 327  ARG A NH2 1 
ATOM   1890  N  N   . PRO A  1 246 ? -15.729 91.333   111.568 1.00 17.08 ? 328  PRO A N   1 
ATOM   1891  C  CA  . PRO A  1 246 ? -16.837 91.931   112.318 1.00 18.12 ? 328  PRO A CA  1 
ATOM   1892  C  C   . PRO A  1 246 ? -18.117 91.302   111.788 1.00 19.35 ? 328  PRO A C   1 
ATOM   1893  O  O   . PRO A  1 246 ? -18.067 90.564   110.811 1.00 20.45 ? 328  PRO A O   1 
ATOM   1894  C  CB  . PRO A  1 246 ? -16.732 93.402   111.950 1.00 17.45 ? 328  PRO A CB  1 
ATOM   1895  C  CG  . PRO A  1 246 ? -16.329 93.344   110.509 1.00 16.79 ? 328  PRO A CG  1 
ATOM   1896  C  CD  . PRO A  1 246 ? -15.301 92.217   110.464 1.00 15.76 ? 328  PRO A CD  1 
ATOM   1897  N  N   . ASN A  1 247 ? -19.253 91.573   112.420 1.00 20.18 ? 329  ASN A N   1 
ATOM   1898  C  CA  . ASN A  1 247 ? -20.518 91.033   111.927 1.00 21.85 ? 329  ASN A CA  1 
ATOM   1899  C  C   . ASN A  1 247 ? -20.759 91.613   110.533 1.00 22.83 ? 329  ASN A C   1 
ATOM   1900  O  O   . ASN A  1 247 ? -20.318 92.723   110.247 1.00 24.56 ? 329  ASN A O   1 
ATOM   1901  C  CB  . ASN A  1 247 ? -21.658 91.412   112.872 1.00 20.84 ? 329  ASN A CB  1 
ATOM   1902  C  CG  . ASN A  1 247 ? -21.516 90.759   114.233 1.00 22.83 ? 329  ASN A CG  1 
ATOM   1903  O  OD1 . ASN A  1 247 ? -21.304 89.551   114.331 1.00 23.73 ? 329  ASN A OD1 1 
ATOM   1904  N  ND2 . ASN A  1 247 ? -21.640 91.551   115.292 1.00 23.47 ? 329  ASN A ND2 1 
ATOM   1905  N  N   . ASP A  1 248 ? -21.448 90.875   109.667 1.00 23.91 ? 330  ASP A N   1 
ATOM   1906  C  CA  . ASP A  1 248 ? -21.690 91.341   108.298 1.00 27.62 ? 330  ASP A CA  1 
ATOM   1907  C  C   . ASP A  1 248 ? -22.438 92.664   108.169 1.00 29.88 ? 330  ASP A C   1 
ATOM   1908  O  O   . ASP A  1 248 ? -23.664 92.690   108.141 1.00 33.56 ? 330  ASP A O   1 
ATOM   1909  C  CB  . ASP A  1 248 ? -22.457 90.295   107.486 1.00 27.64 ? 330  ASP A CB  1 
ATOM   1910  C  CG  . ASP A  1 248 ? -21.694 89.011   107.313 1.00 26.83 ? 330  ASP A CG  1 
ATOM   1911  O  OD1 . ASP A  1 248 ? -20.445 89.034   107.356 1.00 26.36 ? 330  ASP A OD1 1 
ATOM   1912  O  OD2 . ASP A  1 248 ? -22.363 87.979   107.113 1.00 26.63 ? 330  ASP A OD2 1 
ATOM   1913  N  N   . GLY A  1 249 ? -21.704 93.761   108.062 1.00 31.43 ? 331  GLY A N   1 
ATOM   1914  C  CA  . GLY A  1 249 ? -22.353 95.050   107.930 1.00 31.76 ? 331  GLY A CA  1 
ATOM   1915  C  C   . GLY A  1 249 ? -22.240 95.571   106.511 1.00 31.27 ? 331  GLY A C   1 
ATOM   1916  O  O   . GLY A  1 249 ? -22.877 95.061   105.597 1.00 32.62 ? 331  GLY A O   1 
ATOM   1917  N  N   . THR A  1 250 ? -21.426 96.599   106.324 1.00 29.74 ? 332  THR A N   1 
ATOM   1918  C  CA  . THR A  1 250 ? -21.235 97.172   105.008 1.00 27.24 ? 332  THR A CA  1 
ATOM   1919  C  C   . THR A  1 250 ? -19.769 97.040   104.655 1.00 26.73 ? 332  THR A C   1 
ATOM   1920  O  O   . THR A  1 250 ? -18.903 97.535   105.368 1.00 26.44 ? 332  THR A O   1 
ATOM   1921  C  CB  . THR A  1 250 ? -21.646 98.655   104.989 1.00 27.59 ? 332  THR A CB  1 
ATOM   1922  O  OG1 . THR A  1 250 ? -23.063 98.754   105.169 1.00 27.48 ? 332  THR A OG1 1 
ATOM   1923  C  CG2 . THR A  1 250 ? -21.266 99.303   103.671 1.00 25.57 ? 332  THR A CG2 1 
ATOM   1924  N  N   . GLY A  1 251 ? -19.494 96.357   103.553 1.00 26.28 ? 333  GLY A N   1 
ATOM   1925  C  CA  . GLY A  1 251 ? -18.122 96.169   103.140 1.00 25.79 ? 333  GLY A CA  1 
ATOM   1926  C  C   . GLY A  1 251 ? -17.608 97.301   102.283 1.00 26.36 ? 333  GLY A C   1 
ATOM   1927  O  O   . GLY A  1 251 ? -18.243 98.346   102.161 1.00 25.90 ? 333  GLY A O   1 
ATOM   1928  N  N   . SER A  1 252 ? -16.438 97.087   101.698 1.00 26.86 ? 335  SER A N   1 
ATOM   1929  C  CA  . SER A  1 252 ? -15.816 98.067   100.821 1.00 29.01 ? 335  SER A CA  1 
ATOM   1930  C  C   . SER A  1 252 ? -14.859 97.299   99.939  1.00 29.64 ? 335  SER A C   1 
ATOM   1931  O  O   . SER A  1 252 ? -14.536 96.144   100.229 1.00 29.95 ? 335  SER A O   1 
ATOM   1932  C  CB  . SER A  1 252 ? -15.041 99.105   101.622 1.00 29.74 ? 335  SER A CB  1 
ATOM   1933  O  OG  . SER A  1 252 ? -13.846 98.544   102.101 1.00 30.12 ? 335  SER A OG  1 
ATOM   1934  N  N   . CYS A  1 253 ? -14.398 97.931   98.867  1.00 30.34 ? 336  CYS A N   1 
ATOM   1935  C  CA  . CYS A  1 253 ? -13.483 97.254   97.965  1.00 31.53 ? 336  CYS A CA  1 
ATOM   1936  C  C   . CYS A  1 253 ? -12.041 97.555   98.343  1.00 30.51 ? 336  CYS A C   1 
ATOM   1937  O  O   . CYS A  1 253 ? -11.114 97.346   97.567  1.00 31.42 ? 336  CYS A O   1 
ATOM   1938  C  CB  . CYS A  1 253 ? -13.750 97.670   96.527  1.00 33.25 ? 336  CYS A CB  1 
ATOM   1939  S  SG  . CYS A  1 253 ? -15.489 97.578   95.952  1.00 40.55 ? 336  CYS A SG  1 
ATOM   1940  N  N   . GLY A  1 254 ? -11.875 98.049   99.559  1.00 29.78 ? 339  GLY A N   1 
ATOM   1941  C  CA  . GLY A  1 254 ? -10.569 98.359   100.086 1.00 28.37 ? 339  GLY A CA  1 
ATOM   1942  C  C   . GLY A  1 254 ? -10.639 97.880   101.520 1.00 28.78 ? 339  GLY A C   1 
ATOM   1943  O  O   . GLY A  1 254 ? -11.593 98.188   102.229 1.00 34.17 ? 339  GLY A O   1 
ATOM   1944  N  N   . PRO A  1 255 ? -9.626  97.163   101.989 1.00 26.24 ? 340  PRO A N   1 
ATOM   1945  C  CA  . PRO A  1 255 ? -9.514  96.608   103.335 1.00 24.91 ? 340  PRO A CA  1 
ATOM   1946  C  C   . PRO A  1 255 ? -10.458 97.136   104.409 1.00 24.70 ? 340  PRO A C   1 
ATOM   1947  O  O   . PRO A  1 255 ? -10.449 98.319   104.737 1.00 25.00 ? 340  PRO A O   1 
ATOM   1948  C  CB  . PRO A  1 255 ? -8.054  96.879   103.695 1.00 25.11 ? 340  PRO A CB  1 
ATOM   1949  C  CG  . PRO A  1 255 ? -7.644  97.980   102.754 1.00 22.66 ? 340  PRO A CG  1 
ATOM   1950  C  CD  . PRO A  1 255 ? -8.288  97.506   101.499 1.00 26.71 ? 340  PRO A CD  1 
ATOM   1951  N  N   . VAL A  1 256 ? -11.289 96.251   104.949 1.00 23.03 ? 341  VAL A N   1 
ATOM   1952  C  CA  . VAL A  1 256 ? -12.177 96.630   106.045 1.00 21.35 ? 341  VAL A CA  1 
ATOM   1953  C  C   . VAL A  1 256 ? -11.240 96.450   107.230 1.00 20.76 ? 341  VAL A C   1 
ATOM   1954  O  O   . VAL A  1 256 ? -10.716 95.360   107.429 1.00 22.23 ? 341  VAL A O   1 
ATOM   1955  C  CB  . VAL A  1 256 ? -13.391 95.663   106.209 1.00 20.31 ? 341  VAL A CB  1 
ATOM   1956  C  CG1 . VAL A  1 256 ? -14.247 96.086   107.407 1.00 15.97 ? 341  VAL A CG1 1 
ATOM   1957  C  CG2 . VAL A  1 256 ? -14.222 95.684   104.941 1.00 19.20 ? 341  VAL A CG2 1 
ATOM   1958  N  N   . SER A  1 257 ? -11.008 97.508   107.998 1.00 20.29 ? 342  SER A N   1 
ATOM   1959  C  CA  . SER A  1 257 ? -10.103 97.443   109.148 1.00 22.60 ? 342  SER A CA  1 
ATOM   1960  C  C   . SER A  1 257 ? -10.791 96.969   110.403 1.00 25.34 ? 342  SER A C   1 
ATOM   1961  O  O   . SER A  1 257 ? -10.143 96.546   111.357 1.00 25.93 ? 342  SER A O   1 
ATOM   1962  C  CB  . SER A  1 257 ? -9.505  98.816   109.411 1.00 21.22 ? 342  SER A CB  1 
ATOM   1963  O  OG  . SER A  1 257 ? -10.545 99.690   109.777 1.00 21.06 ? 342  SER A OG  1 
ATOM   1964  N  N   . SER A  1 258 ? -12.116 96.991   110.399 1.00 29.19 ? 343  SER A N   1 
ATOM   1965  C  CA  . SER A  1 258 ? -12.818 96.568   111.601 1.00 33.20 ? 343  SER A CA  1 
ATOM   1966  C  C   . SER A  1 258 ? -12.696 95.090   111.918 1.00 34.56 ? 343  SER A C   1 
ATOM   1967  O  O   . SER A  1 258 ? -13.386 94.238   111.372 1.00 36.38 ? 343  SER A O   1 
ATOM   1968  C  CB  . SER A  1 258 ? -14.314 96.947   111.603 1.00 35.47 ? 343  SER A CB  1 
ATOM   1969  O  OG  . SER A  1 258 ? -15.104 96.267   110.630 1.00 42.29 ? 343  SER A OG  1 
ATOM   1970  N  N   . ASN A  1 259 ? -11.733 94.783   112.763 1.00 35.48 ? 344  ASN A N   1 
ATOM   1971  C  CA  . ASN A  1 259 ? -11.585 93.438   113.271 1.00 37.29 ? 344  ASN A CA  1 
ATOM   1972  C  C   . ASN A  1 259 ? -10.836 92.416   112.431 1.00 39.02 ? 344  ASN A C   1 
ATOM   1973  O  O   . ASN A  1 259 ? -10.659 91.267   112.794 1.00 40.53 ? 344  ASN A O   1 
ATOM   1974  C  CB  . ASN A  1 259 ? -12.984 92.947   113.615 1.00 37.12 ? 344  ASN A CB  1 
ATOM   1975  C  CG  . ASN A  1 259 ? -12.960 91.866   114.616 1.00 38.67 ? 344  ASN A CG  1 
ATOM   1976  O  OD1 . ASN A  1 259 ? -11.918 91.597   115.186 1.00 38.78 ? 344  ASN A OD1 1 
ATOM   1977  N  ND2 . ASN A  1 259 ? -14.103 91.228   114.858 1.00 43.84 ? 344  ASN A ND2 1 
ATOM   1978  N  N   . GLY A  1 260 ? -10.371 92.880   111.296 1.00 39.08 ? 345  GLY A N   1 
ATOM   1979  C  CA  . GLY A  1 260 ? -9.672  92.017   110.392 1.00 38.82 ? 345  GLY A CA  1 
ATOM   1980  C  C   . GLY A  1 260 ? -8.215  92.408   110.360 1.00 38.43 ? 345  GLY A C   1 
ATOM   1981  O  O   . GLY A  1 260 ? -7.751  92.907   109.352 1.00 38.16 ? 345  GLY A O   1 
ATOM   1982  N  N   . ALA A  1 261 ? -7.490  92.276   111.459 1.00 37.26 ? 346  ALA A N   1 
ATOM   1983  C  CA  . ALA A  1 261 ? -6.085  92.592   111.366 1.00 33.96 ? 346  ALA A CA  1 
ATOM   1984  C  C   . ALA A  1 261 ? -5.303  91.371   111.736 1.00 33.10 ? 346  ALA A C   1 
ATOM   1985  O  O   . ALA A  1 261 ? -4.279  91.464   112.398 1.00 35.74 ? 346  ALA A O   1 
ATOM   1986  C  CB  . ALA A  1 261 ? -5.733  93.771   112.240 1.00 33.61 ? 346  ALA A CB  1 
ATOM   1987  N  N   . TYR A  1 262 ? -5.815  90.227   111.296 1.00 29.82 ? 347  TYR A N   1 
ATOM   1988  C  CA  . TYR A  1 262 ? -5.184  88.934   111.515 1.00 26.10 ? 347  TYR A CA  1 
ATOM   1989  C  C   . TYR A  1 262 ? -5.745  88.134   110.347 1.00 23.76 ? 347  TYR A C   1 
ATOM   1990  O  O   . TYR A  1 262 ? -5.746  88.626   109.216 1.00 24.14 ? 347  TYR A O   1 
ATOM   1991  C  CB  . TYR A  1 262 ? -5.610  88.353   112.869 1.00 27.65 ? 347  TYR A CB  1 
ATOM   1992  C  CG  . TYR A  1 262 ? -5.102  86.955   113.166 1.00 28.53 ? 347  TYR A CG  1 
ATOM   1993  C  CD1 . TYR A  1 262 ? -3.773  86.595   112.922 1.00 28.80 ? 347  TYR A CD1 1 
ATOM   1994  C  CD2 . TYR A  1 262 ? -5.965  85.970   113.663 1.00 28.98 ? 347  TYR A CD2 1 
ATOM   1995  C  CE1 . TYR A  1 262 ? -3.318  85.271   113.161 1.00 26.28 ? 347  TYR A CE1 1 
ATOM   1996  C  CE2 . TYR A  1 262 ? -5.519  84.655   113.904 1.00 26.30 ? 347  TYR A CE2 1 
ATOM   1997  C  CZ  . TYR A  1 262 ? -4.201  84.316   113.646 1.00 26.34 ? 347  TYR A CZ  1 
ATOM   1998  O  OH  . TYR A  1 262 ? -3.796  83.014   113.853 1.00 25.32 ? 347  TYR A OH  1 
ATOM   1999  N  N   . GLY A  1 263 ? -6.234  86.925   110.571 1.00 21.61 ? 348  GLY A N   1 
ATOM   2000  C  CA  . GLY A  1 263 ? -6.786  86.217   109.432 1.00 19.74 ? 348  GLY A CA  1 
ATOM   2001  C  C   . GLY A  1 263 ? -6.670  84.718   109.393 1.00 18.03 ? 348  GLY A C   1 
ATOM   2002  O  O   . GLY A  1 263 ? -6.209  84.085   110.334 1.00 17.77 ? 348  GLY A O   1 
ATOM   2003  N  N   . VAL A  1 264 ? -7.123  84.162   108.278 1.00 17.52 ? 349  VAL A N   1 
ATOM   2004  C  CA  . VAL A  1 264 ? -7.104  82.727   108.052 1.00 17.09 ? 349  VAL A CA  1 
ATOM   2005  C  C   . VAL A  1 264 ? -7.138  82.455   106.549 1.00 17.45 ? 349  VAL A C   1 
ATOM   2006  O  O   . VAL A  1 264 ? -7.871  83.114   105.804 1.00 18.16 ? 349  VAL A O   1 
ATOM   2007  C  CB  . VAL A  1 264 ? -8.321  82.036   108.735 1.00 17.09 ? 349  VAL A CB  1 
ATOM   2008  C  CG1 . VAL A  1 264 ? -9.624  82.420   108.027 1.00 14.10 ? 349  VAL A CG1 1 
ATOM   2009  C  CG2 . VAL A  1 264 ? -8.122  80.525   108.742 1.00 15.91 ? 349  VAL A CG2 1 
ATOM   2010  N  N   . LYS A  1 265 ? -6.335  81.500   106.095 1.00 16.47 ? 350  LYS A N   1 
ATOM   2011  C  CA  . LYS A  1 265 ? -6.306  81.189   104.672 1.00 15.99 ? 350  LYS A CA  1 
ATOM   2012  C  C   . LYS A  1 265 ? -7.699  80.804   104.244 1.00 17.41 ? 350  LYS A C   1 
ATOM   2013  O  O   . LYS A  1 265 ? -8.343  79.961   104.874 1.00 18.62 ? 350  LYS A O   1 
ATOM   2014  C  CB  . LYS A  1 265 ? -5.352  80.034   104.366 1.00 14.74 ? 350  LYS A CB  1 
ATOM   2015  C  CG  . LYS A  1 265 ? -5.366  79.633   102.891 1.00 14.27 ? 350  LYS A CG  1 
ATOM   2016  C  CD  . LYS A  1 265 ? -4.493  78.425   102.620 1.00 14.67 ? 350  LYS A CD  1 
ATOM   2017  C  CE  . LYS A  1 265 ? -4.657  77.927   101.187 1.00 14.54 ? 350  LYS A CE  1 
ATOM   2018  N  NZ  . LYS A  1 265 ? -4.173  78.903   100.161 1.00 14.94 ? 350  LYS A NZ  1 
ATOM   2019  N  N   . GLY A  1 266 ? -8.170  81.425   103.173 1.00 18.01 ? 351  GLY A N   1 
ATOM   2020  C  CA  . GLY A  1 266 ? -9.499  81.124   102.677 1.00 16.66 ? 351  GLY A CA  1 
ATOM   2021  C  C   . GLY A  1 266 ? -9.523  81.218   101.170 1.00 16.66 ? 351  GLY A C   1 
ATOM   2022  O  O   . GLY A  1 266 ? -8.483  81.425   100.545 1.00 17.80 ? 351  GLY A O   1 
ATOM   2023  N  N   . PHE A  1 267 ? -10.704 81.070   100.582 1.00 15.06 ? 352  PHE A N   1 
ATOM   2024  C  CA  . PHE A  1 267 ? -10.841 81.144   99.137  1.00 12.71 ? 352  PHE A CA  1 
ATOM   2025  C  C   . PHE A  1 267 ? -12.159 81.807   98.801  1.00 12.91 ? 352  PHE A C   1 
ATOM   2026  O  O   . PHE A  1 267 ? -12.922 82.180   99.689  1.00 11.71 ? 352  PHE A O   1 
ATOM   2027  C  CB  . PHE A  1 267 ? -10.846 79.749   98.523  1.00 11.75 ? 352  PHE A CB  1 
ATOM   2028  C  CG  . PHE A  1 267 ? -12.068 78.958   98.863  1.00 9.85  ? 352  PHE A CG  1 
ATOM   2029  C  CD1 . PHE A  1 267 ? -12.205 78.373   100.119 1.00 9.44  ? 352  PHE A CD1 1 
ATOM   2030  C  CD2 . PHE A  1 267 ? -13.111 78.845   97.951  1.00 9.49  ? 352  PHE A CD2 1 
ATOM   2031  C  CE1 . PHE A  1 267 ? -13.373 77.690   100.467 1.00 8.67  ? 352  PHE A CE1 1 
ATOM   2032  C  CE2 . PHE A  1 267 ? -14.287 78.164   98.284  1.00 9.01  ? 352  PHE A CE2 1 
ATOM   2033  C  CZ  . PHE A  1 267 ? -14.416 77.583   99.548  1.00 9.61  ? 352  PHE A CZ  1 
ATOM   2034  N  N   . SER A  1 268 ? -12.415 81.927   97.503  1.00 12.49 ? 353  SER A N   1 
ATOM   2035  C  CA  . SER A  1 268 ? -13.641 82.508   96.985  1.00 12.89 ? 353  SER A CA  1 
ATOM   2036  C  C   . SER A  1 268 ? -13.644 82.264   95.501  1.00 12.77 ? 353  SER A C   1 
ATOM   2037  O  O   . SER A  1 268 ? -12.590 82.284   94.877  1.00 11.68 ? 353  SER A O   1 
ATOM   2038  C  CB  . SER A  1 268 ? -13.691 84.010   97.240  1.00 13.87 ? 353  SER A CB  1 
ATOM   2039  O  OG  . SER A  1 268 ? -13.889 84.286   98.614  1.00 19.05 ? 353  SER A OG  1 
ATOM   2040  N  N   . PHE A  1 269 ? -14.821 82.017   94.936  1.00 12.33 ? 354  PHE A N   1 
ATOM   2041  C  CA  . PHE A  1 269 ? -14.931 81.801   93.498  1.00 13.79 ? 354  PHE A CA  1 
ATOM   2042  C  C   . PHE A  1 269 ? -15.761 82.892   92.863  1.00 15.25 ? 354  PHE A C   1 
ATOM   2043  O  O   . PHE A  1 269 ? -16.911 83.107   93.235  1.00 16.45 ? 354  PHE A O   1 
ATOM   2044  C  CB  . PHE A  1 269 ? -15.559 80.445   93.187  1.00 14.01 ? 354  PHE A CB  1 
ATOM   2045  C  CG  . PHE A  1 269 ? -14.636 79.294   93.420  1.00 13.20 ? 354  PHE A CG  1 
ATOM   2046  C  CD1 . PHE A  1 269 ? -14.848 78.419   94.472  1.00 10.86 ? 354  PHE A CD1 1 
ATOM   2047  C  CD2 . PHE A  1 269 ? -13.546 79.094   92.586  1.00 12.94 ? 354  PHE A CD2 1 
ATOM   2048  C  CE1 . PHE A  1 269 ? -13.992 77.360   94.691  1.00 13.45 ? 354  PHE A CE1 1 
ATOM   2049  C  CE2 . PHE A  1 269 ? -12.677 78.031   92.795  1.00 15.26 ? 354  PHE A CE2 1 
ATOM   2050  C  CZ  . PHE A  1 269 ? -12.902 77.160   93.853  1.00 14.71 ? 354  PHE A CZ  1 
ATOM   2051  N  N   . LYS A  1 270 ? -15.169 83.590   91.903  1.00 16.80 ? 355  LYS A N   1 
ATOM   2052  C  CA  . LYS A  1 270 ? -15.868 84.668   91.225  1.00 17.23 ? 355  LYS A CA  1 
ATOM   2053  C  C   . LYS A  1 270 ? -16.631 84.186   90.004  1.00 17.24 ? 355  LYS A C   1 
ATOM   2054  O  O   . LYS A  1 270 ? -16.108 83.440   89.185  1.00 17.88 ? 355  LYS A O   1 
ATOM   2055  C  CB  . LYS A  1 270 ? -14.872 85.749   90.813  1.00 17.42 ? 355  LYS A CB  1 
ATOM   2056  C  CG  . LYS A  1 270 ? -15.411 86.811   89.871  1.00 17.15 ? 355  LYS A CG  1 
ATOM   2057  C  CD  . LYS A  1 270 ? -14.317 87.823   89.565  1.00 19.32 ? 355  LYS A CD  1 
ATOM   2058  C  CE  . LYS A  1 270 ? -14.474 88.459   88.185  1.00 19.23 ? 355  LYS A CE  1 
ATOM   2059  N  NZ  . LYS A  1 270 ? -15.679 89.301   88.083  1.00 18.39 ? 355  LYS A NZ  1 
ATOM   2060  N  N   . TYR A  1 271 ? -17.886 84.591   89.913  1.00 16.41 ? 356  TYR A N   1 
ATOM   2061  C  CA  . TYR A  1 271 ? -18.711 84.262   88.765  1.00 18.22 ? 356  TYR A CA  1 
ATOM   2062  C  C   . TYR A  1 271 ? -19.300 85.606   88.383  1.00 19.70 ? 356  TYR A C   1 
ATOM   2063  O  O   . TYR A  1 271 ? -20.139 86.152   89.107  1.00 19.69 ? 356  TYR A O   1 
ATOM   2064  C  CB  . TYR A  1 271 ? -19.835 83.285   89.127  1.00 17.26 ? 356  TYR A CB  1 
ATOM   2065  C  CG  . TYR A  1 271 ? -19.409 81.841   89.225  1.00 14.16 ? 356  TYR A CG  1 
ATOM   2066  C  CD1 . TYR A  1 271 ? -18.903 81.322   90.415  1.00 15.02 ? 356  TYR A CD1 1 
ATOM   2067  C  CD2 . TYR A  1 271 ? -19.517 80.994   88.131  1.00 11.40 ? 356  TYR A CD2 1 
ATOM   2068  C  CE1 . TYR A  1 271 ? -18.520 79.988   90.515  1.00 14.58 ? 356  TYR A CE1 1 
ATOM   2069  C  CE2 . TYR A  1 271 ? -19.131 79.663   88.213  1.00 15.19 ? 356  TYR A CE2 1 
ATOM   2070  C  CZ  . TYR A  1 271 ? -18.638 79.160   89.410  1.00 15.81 ? 356  TYR A CZ  1 
ATOM   2071  O  OH  . TYR A  1 271 ? -18.298 77.827   89.511  1.00 15.76 ? 356  TYR A OH  1 
ATOM   2072  N  N   . GLY A  1 272 ? -18.852 86.152   87.259  1.00 21.12 ? 357  GLY A N   1 
ATOM   2073  C  CA  . GLY A  1 272 ? -19.348 87.453   86.845  1.00 22.03 ? 357  GLY A CA  1 
ATOM   2074  C  C   . GLY A  1 272 ? -19.104 88.402   87.998  1.00 22.96 ? 357  GLY A C   1 
ATOM   2075  O  O   . GLY A  1 272 ? -17.974 88.518   88.476  1.00 23.87 ? 357  GLY A O   1 
ATOM   2076  N  N   . ASN A  1 273 ? -20.163 89.055   88.462  1.00 23.52 ? 358  ASN A N   1 
ATOM   2077  C  CA  . ASN A  1 273 ? -20.067 89.981   89.581  1.00 24.28 ? 358  ASN A CA  1 
ATOM   2078  C  C   . ASN A  1 273 ? -20.396 89.309   90.913  1.00 23.48 ? 358  ASN A C   1 
ATOM   2079  O  O   . ASN A  1 273 ? -20.338 89.948   91.963  1.00 23.26 ? 358  ASN A O   1 
ATOM   2080  C  CB  . ASN A  1 273 ? -21.009 91.164   89.367  1.00 27.10 ? 358  ASN A CB  1 
ATOM   2081  C  CG  . ASN A  1 273 ? -20.571 92.050   88.222  1.00 29.59 ? 358  ASN A CG  1 
ATOM   2082  O  OD1 . ASN A  1 273 ? -19.423 92.501   88.175  1.00 31.19 ? 358  ASN A OD1 1 
ATOM   2083  N  ND2 . ASN A  1 273 ? -21.482 92.307   87.290  1.00 30.99 ? 358  ASN A ND2 1 
ATOM   2084  N  N   . GLY A  1 274 ? -20.722 88.019   90.863  1.00 21.96 ? 359  GLY A N   1 
ATOM   2085  C  CA  . GLY A  1 274 ? -21.065 87.284   92.067  1.00 20.80 ? 359  GLY A CA  1 
ATOM   2086  C  C   . GLY A  1 274 ? -19.897 86.570   92.724  1.00 20.94 ? 359  GLY A C   1 
ATOM   2087  O  O   . GLY A  1 274 ? -18.806 86.488   92.162  1.00 20.96 ? 359  GLY A O   1 
ATOM   2088  N  N   . VAL A  1 275 ? -20.128 86.039   93.919  1.00 20.28 ? 360  VAL A N   1 
ATOM   2089  C  CA  . VAL A  1 275 ? -19.074 85.349   94.645  1.00 19.74 ? 360  VAL A CA  1 
ATOM   2090  C  C   . VAL A  1 275 ? -19.550 84.216   95.521  1.00 19.01 ? 360  VAL A C   1 
ATOM   2091  O  O   . VAL A  1 275 ? -20.557 84.331   96.222  1.00 18.19 ? 360  VAL A O   1 
ATOM   2092  C  CB  . VAL A  1 275 ? -18.307 86.280   95.624  1.00 19.17 ? 360  VAL A CB  1 
ATOM   2093  C  CG1 . VAL A  1 275 ? -16.819 86.163   95.382  1.00 19.49 ? 360  VAL A CG1 1 
ATOM   2094  C  CG2 . VAL A  1 275 ? -18.800 87.700   95.515  1.00 20.68 ? 360  VAL A CG2 1 
ATOM   2095  N  N   . TRP A  1 276 ? -18.803 83.122   95.483  1.00 18.30 ? 361  TRP A N   1 
ATOM   2096  C  CA  . TRP A  1 276 ? -19.085 82.006   96.357  1.00 17.94 ? 361  TRP A CA  1 
ATOM   2097  C  C   . TRP A  1 276 ? -18.025 82.220   97.419  1.00 18.09 ? 361  TRP A C   1 
ATOM   2098  O  O   . TRP A  1 276 ? -16.834 81.996   97.207  1.00 18.59 ? 361  TRP A O   1 
ATOM   2099  C  CB  . TRP A  1 276 ? -18.888 80.656   95.670  1.00 17.03 ? 361  TRP A CB  1 
ATOM   2100  C  CG  . TRP A  1 276 ? -20.130 80.126   95.034  1.00 16.68 ? 361  TRP A CG  1 
ATOM   2101  C  CD1 . TRP A  1 276 ? -20.399 80.047   93.698  1.00 16.70 ? 361  TRP A CD1 1 
ATOM   2102  C  CD2 . TRP A  1 276 ? -21.265 79.572   95.707  1.00 16.90 ? 361  TRP A CD2 1 
ATOM   2103  N  NE1 . TRP A  1 276 ? -21.633 79.470   93.495  1.00 17.51 ? 361  TRP A NE1 1 
ATOM   2104  C  CE2 . TRP A  1 276 ? -22.187 79.168   94.713  1.00 17.00 ? 361  TRP A CE2 1 
ATOM   2105  C  CE3 . TRP A  1 276 ? -21.594 79.368   97.055  1.00 17.79 ? 361  TRP A CE3 1 
ATOM   2106  C  CZ2 . TRP A  1 276 ? -23.415 78.573   95.022  1.00 17.05 ? 361  TRP A CZ2 1 
ATOM   2107  C  CZ3 . TRP A  1 276 ? -22.819 78.771   97.368  1.00 18.12 ? 361  TRP A CZ3 1 
ATOM   2108  C  CH2 . TRP A  1 276 ? -23.713 78.380   96.351  1.00 18.41 ? 361  TRP A CH2 1 
ATOM   2109  N  N   . ILE A  1 277 ? -18.472 82.715   98.556  1.00 18.15 ? 362  ILE A N   1 
ATOM   2110  C  CA  . ILE A  1 277 ? -17.589 82.964   99.661  1.00 17.86 ? 362  ILE A CA  1 
ATOM   2111  C  C   . ILE A  1 277 ? -17.608 81.768   100.595 1.00 17.39 ? 362  ILE A C   1 
ATOM   2112  O  O   . ILE A  1 277 ? -18.678 81.331   101.043 1.00 17.10 ? 362  ILE A O   1 
ATOM   2113  C  CB  . ILE A  1 277 ? -18.051 84.197   100.445 1.00 19.56 ? 362  ILE A CB  1 
ATOM   2114  C  CG1 . ILE A  1 277 ? -18.007 85.424   99.532  1.00 19.41 ? 362  ILE A CG1 1 
ATOM   2115  C  CG2 . ILE A  1 277 ? -17.196 84.369   101.702 1.00 18.92 ? 362  ILE A CG2 1 
ATOM   2116  C  CD1 . ILE A  1 277 ? -18.574 86.685   100.162 1.00 20.95 ? 362  ILE A CD1 1 
ATOM   2117  N  N   . GLY A  1 278 ? -16.425 81.221   100.853 1.00 14.83 ? 363  GLY A N   1 
ATOM   2118  C  CA  . GLY A  1 278 ? -16.305 80.124   101.786 1.00 13.12 ? 363  GLY A CA  1 
ATOM   2119  C  C   . GLY A  1 278 ? -15.795 80.833   103.025 1.00 14.52 ? 363  GLY A C   1 
ATOM   2120  O  O   . GLY A  1 278 ? -14.962 81.732   102.912 1.00 14.98 ? 363  GLY A O   1 
ATOM   2121  N  N   . ARG A  1 279 ? -16.296 80.482   104.203 1.00 13.85 ? 364  ARG A N   1 
ATOM   2122  C  CA  . ARG A  1 279 ? -15.826 81.143   105.408 1.00 12.69 ? 364  ARG A CA  1 
ATOM   2123  C  C   . ARG A  1 279 ? -16.282 80.417   106.656 1.00 13.23 ? 364  ARG A C   1 
ATOM   2124  O  O   . ARG A  1 279 ? -17.156 79.549   106.604 1.00 15.07 ? 364  ARG A O   1 
ATOM   2125  C  CB  . ARG A  1 279 ? -16.329 82.586   105.448 1.00 12.98 ? 364  ARG A CB  1 
ATOM   2126  C  CG  . ARG A  1 279 ? -17.817 82.705   105.766 1.00 14.39 ? 364  ARG A CG  1 
ATOM   2127  C  CD  . ARG A  1 279 ? -18.257 84.147   105.887 1.00 11.96 ? 364  ARG A CD  1 
ATOM   2128  N  NE  . ARG A  1 279 ? -19.609 84.243   106.422 1.00 11.51 ? 364  ARG A NE  1 
ATOM   2129  C  CZ  . ARG A  1 279 ? -20.209 85.386   106.744 1.00 10.87 ? 364  ARG A CZ  1 
ATOM   2130  N  NH1 . ARG A  1 279 ? -21.444 85.363   107.221 1.00 7.49  ? 364  ARG A NH1 1 
ATOM   2131  N  NH2 . ARG A  1 279 ? -19.572 86.546   106.590 1.00 10.75 ? 364  ARG A NH2 1 
ATOM   2132  N  N   . THR A  1 280 ? -15.677 80.778   107.781 1.00 13.18 ? 365  THR A N   1 
ATOM   2133  C  CA  . THR A  1 280 ? -16.013 80.180   109.064 1.00 14.85 ? 365  THR A CA  1 
ATOM   2134  C  C   . THR A  1 280 ? -17.375 80.698   109.476 1.00 15.40 ? 365  THR A C   1 
ATOM   2135  O  O   . THR A  1 280 ? -17.822 81.718   108.968 1.00 15.49 ? 365  THR A O   1 
ATOM   2136  C  CB  . THR A  1 280 ? -15.019 80.606   110.147 1.00 14.41 ? 365  THR A CB  1 
ATOM   2137  O  OG1 . THR A  1 280 ? -15.000 82.036   110.225 1.00 14.89 ? 365  THR A OG1 1 
ATOM   2138  C  CG2 . THR A  1 280 ? -13.638 80.104   109.830 1.00 14.05 ? 365  THR A CG2 1 
ATOM   2139  N  N   . LYS A  1 281 ? -18.031 80.004   110.400 1.00 17.65 ? 366  LYS A N   1 
ATOM   2140  C  CA  . LYS A  1 281 ? -19.330 80.457   110.878 1.00 18.87 ? 366  LYS A CA  1 
ATOM   2141  C  C   . LYS A  1 281 ? -19.127 81.469   112.014 1.00 18.84 ? 366  LYS A C   1 
ATOM   2142  O  O   . LYS A  1 281 ? -19.911 82.397   112.170 1.00 18.60 ? 366  LYS A O   1 
ATOM   2143  C  CB  . LYS A  1 281 ? -20.181 79.268   111.336 1.00 18.54 ? 366  LYS A CB  1 
ATOM   2144  C  CG  . LYS A  1 281 ? -20.458 78.277   110.207 1.00 20.91 ? 366  LYS A CG  1 
ATOM   2145  C  CD  . LYS A  1 281 ? -21.457 77.187   110.594 1.00 21.27 ? 366  LYS A CD  1 
ATOM   2146  C  CE  . LYS A  1 281 ? -22.893 77.659   110.478 1.00 23.52 ? 366  LYS A CE  1 
ATOM   2147  N  NZ  . LYS A  1 281 ? -23.300 77.966   109.080 1.00 23.13 ? 366  LYS A NZ  1 
ATOM   2148  N  N   . SER A  1 282 ? -18.062 81.308   112.788 1.00 19.73 ? 367  SER A N   1 
ATOM   2149  C  CA  . SER A  1 282 ? -17.787 82.246   113.874 1.00 22.19 ? 367  SER A CA  1 
ATOM   2150  C  C   . SER A  1 282 ? -16.997 83.455   113.360 1.00 23.07 ? 367  SER A C   1 
ATOM   2151  O  O   . SER A  1 282 ? -16.266 83.350   112.375 1.00 23.45 ? 367  SER A O   1 
ATOM   2152  C  CB  . SER A  1 282 ? -16.994 81.554   114.984 1.00 21.75 ? 367  SER A CB  1 
ATOM   2153  O  OG  . SER A  1 282 ? -16.664 82.471   116.012 1.00 22.67 ? 367  SER A OG  1 
ATOM   2154  N  N   . THR A  1 283 ? -17.140 84.599   114.021 1.00 24.08 ? 368  THR A N   1 
ATOM   2155  C  CA  . THR A  1 283 ? -16.419 85.799   113.601 1.00 26.44 ? 368  THR A CA  1 
ATOM   2156  C  C   . THR A  1 283 ? -15.154 85.981   114.416 1.00 28.10 ? 368  THR A C   1 
ATOM   2157  O  O   . THR A  1 283 ? -14.352 86.866   114.132 1.00 29.37 ? 368  THR A O   1 
ATOM   2158  C  CB  . THR A  1 283 ? -17.261 87.075   113.771 1.00 25.35 ? 368  THR A CB  1 
ATOM   2159  O  OG1 . THR A  1 283 ? -17.658 87.203   115.140 1.00 26.45 ? 368  THR A OG1 1 
ATOM   2160  C  CG2 . THR A  1 283 ? -18.490 87.031   112.885 1.00 24.86 ? 368  THR A CG2 1 
ATOM   2161  N  N   . ASN A  1 284 ? -14.977 85.141   115.429 1.00 31.05 ? 369  ASN A N   1 
ATOM   2162  C  CA  . ASN A  1 284 ? -13.802 85.229   116.286 1.00 34.02 ? 369  ASN A CA  1 
ATOM   2163  C  C   . ASN A  1 284 ? -12.943 83.984   116.283 1.00 33.91 ? 369  ASN A C   1 
ATOM   2164  O  O   . ASN A  1 284 ? -11.736 84.061   116.495 1.00 36.34 ? 369  ASN A O   1 
ATOM   2165  C  CB  . ASN A  1 284 ? -14.219 85.521   117.720 1.00 38.10 ? 369  ASN A CB  1 
ATOM   2166  C  CG  . ASN A  1 284 ? -14.893 86.856   117.853 1.00 43.74 ? 369  ASN A CG  1 
ATOM   2167  O  OD1 . ASN A  1 284 ? -14.331 87.887   117.468 1.00 47.52 ? 369  ASN A OD1 1 
ATOM   2168  N  ND2 . ASN A  1 284 ? -16.109 86.855   118.395 1.00 46.93 ? 369  ASN A ND2 1 
ATOM   2169  N  N   . SER A  1 285 ? -13.559 82.835   116.044 1.00 32.45 ? 370  SER A N   1 
ATOM   2170  C  CA  . SER A  1 285 ? -12.820 81.590   116.057 1.00 30.17 ? 370  SER A CA  1 
ATOM   2171  C  C   . SER A  1 285 ? -12.864 80.857   114.743 1.00 28.95 ? 370  SER A C   1 
ATOM   2172  O  O   . SER A  1 285 ? -13.738 81.086   113.911 1.00 28.15 ? 370  SER A O   1 
ATOM   2173  C  CB  . SER A  1 285 ? -13.372 80.668   117.139 1.00 31.02 ? 370  SER A CB  1 
ATOM   2174  O  OG  . SER A  1 285 ? -13.498 81.359   118.366 1.00 35.23 ? 370  SER A OG  1 
ATOM   2175  N  N   . ARG A  1 286 ? -11.904 79.961   114.574 1.00 27.07 ? 371  ARG A N   1 
ATOM   2176  C  CA  . ARG A  1 286 ? -11.842 79.144   113.387 1.00 25.61 ? 371  ARG A CA  1 
ATOM   2177  C  C   . ARG A  1 286 ? -12.766 77.955   113.648 1.00 24.74 ? 371  ARG A C   1 
ATOM   2178  O  O   . ARG A  1 286 ? -12.344 76.795   113.687 1.00 23.64 ? 371  ARG A O   1 
ATOM   2179  C  CB  . ARG A  1 286 ? -10.403 78.692   113.140 1.00 25.06 ? 371  ARG A CB  1 
ATOM   2180  C  CG  . ARG A  1 286 ? -9.519  79.815   112.648 1.00 22.45 ? 371  ARG A CG  1 
ATOM   2181  C  CD  . ARG A  1 286 ? -8.060  79.414   112.587 1.00 21.66 ? 371  ARG A CD  1 
ATOM   2182  N  NE  . ARG A  1 286 ? -7.232  80.537   112.153 1.00 20.65 ? 371  ARG A NE  1 
ATOM   2183  C  CZ  . ARG A  1 286 ? -5.942  80.446   111.855 1.00 20.73 ? 371  ARG A CZ  1 
ATOM   2184  N  NH1 . ARG A  1 286 ? -5.279  81.523   111.464 1.00 21.16 ? 371  ARG A NH1 1 
ATOM   2185  N  NH2 . ARG A  1 286 ? -5.312  79.281   111.950 1.00 21.27 ? 371  ARG A NH2 1 
ATOM   2186  N  N   . SER A  1 287 ? -14.040 78.275   113.846 1.00 22.98 ? 372  SER A N   1 
ATOM   2187  C  CA  . SER A  1 287 ? -15.056 77.270   114.096 1.00 22.05 ? 372  SER A CA  1 
ATOM   2188  C  C   . SER A  1 287 ? -16.193 77.355   113.075 1.00 20.72 ? 372  SER A C   1 
ATOM   2189  O  O   . SER A  1 287 ? -16.638 78.447   112.687 1.00 18.20 ? 372  SER A O   1 
ATOM   2190  C  CB  . SER A  1 287 ? -15.597 77.414   115.525 1.00 23.51 ? 372  SER A CB  1 
ATOM   2191  O  OG  . SER A  1 287 ? -15.779 78.772   115.872 1.00 26.03 ? 372  SER A OG  1 
ATOM   2192  N  N   . GLY A  1 288 ? -16.648 76.182   112.642 1.00 19.71 ? 373  GLY A N   1 
ATOM   2193  C  CA  . GLY A  1 288 ? -17.716 76.099   111.666 1.00 17.12 ? 373  GLY A CA  1 
ATOM   2194  C  C   . GLY A  1 288 ? -17.260 76.583   110.305 1.00 16.53 ? 373  GLY A C   1 
ATOM   2195  O  O   . GLY A  1 288 ? -16.266 77.313   110.192 1.00 16.97 ? 373  GLY A O   1 
ATOM   2196  N  N   . PHE A  1 289 ? -17.970 76.165   109.265 1.00 13.65 ? 374  PHE A N   1 
ATOM   2197  C  CA  . PHE A  1 289 ? -17.637 76.598   107.921 1.00 12.74 ? 374  PHE A CA  1 
ATOM   2198  C  C   . PHE A  1 289 ? -18.926 76.650   107.109 1.00 13.28 ? 374  PHE A C   1 
ATOM   2199  O  O   . PHE A  1 289 ? -19.869 75.901   107.376 1.00 13.51 ? 374  PHE A O   1 
ATOM   2200  C  CB  . PHE A  1 289 ? -16.639 75.644   107.260 1.00 9.46  ? 374  PHE A CB  1 
ATOM   2201  C  CG  . PHE A  1 289 ? -15.920 76.255   106.083 1.00 8.83  ? 374  PHE A CG  1 
ATOM   2202  C  CD1 . PHE A  1 289 ? -14.856 77.141   106.282 1.00 5.97  ? 374  PHE A CD1 1 
ATOM   2203  C  CD2 . PHE A  1 289 ? -16.342 76.000   104.778 1.00 6.73  ? 374  PHE A CD2 1 
ATOM   2204  C  CE1 . PHE A  1 289 ? -14.227 77.765   105.201 1.00 3.56  ? 374  PHE A CE1 1 
ATOM   2205  C  CE2 . PHE A  1 289 ? -15.717 76.622   103.686 1.00 5.64  ? 374  PHE A CE2 1 
ATOM   2206  C  CZ  . PHE A  1 289 ? -14.659 77.506   103.900 1.00 4.83  ? 374  PHE A CZ  1 
ATOM   2207  N  N   . GLU A  1 290 ? -18.968 77.535   106.119 1.00 14.21 ? 375  GLU A N   1 
ATOM   2208  C  CA  . GLU A  1 290 ? -20.163 77.681   105.294 1.00 16.57 ? 375  GLU A CA  1 
ATOM   2209  C  C   . GLU A  1 290 ? -19.826 78.280   103.936 1.00 16.31 ? 375  GLU A C   1 
ATOM   2210  O  O   . GLU A  1 290 ? -18.857 79.023   103.799 1.00 18.03 ? 375  GLU A O   1 
ATOM   2211  C  CB  . GLU A  1 290 ? -21.185 78.582   106.008 1.00 17.48 ? 375  GLU A CB  1 
ATOM   2212  C  CG  . GLU A  1 290 ? -20.675 80.014   106.281 1.00 20.53 ? 375  GLU A CG  1 
ATOM   2213  C  CD  . GLU A  1 290 ? -21.677 80.868   107.059 1.00 24.32 ? 375  GLU A CD  1 
ATOM   2214  O  OE1 . GLU A  1 290 ? -22.700 80.309   107.515 1.00 25.70 ? 375  GLU A OE1 1 
ATOM   2215  O  OE2 . GLU A  1 290 ? -21.443 82.093   107.230 1.00 24.77 ? 375  GLU A OE2 1 
ATOM   2216  N  N   . MET A  1 291 ? -20.633 77.940   102.941 1.00 16.19 ? 376  MET A N   1 
ATOM   2217  C  CA  . MET A  1 291 ? -20.470 78.444   101.588 1.00 17.83 ? 376  MET A CA  1 
ATOM   2218  C  C   . MET A  1 291 ? -21.606 79.426   101.353 1.00 18.81 ? 376  MET A C   1 
ATOM   2219  O  O   . MET A  1 291 ? -22.781 79.097   101.554 1.00 18.88 ? 376  MET A O   1 
ATOM   2220  C  CB  . MET A  1 291 ? -20.559 77.303   100.570 1.00 18.40 ? 376  MET A CB  1 
ATOM   2221  C  CG  . MET A  1 291 ? -19.393 76.340   100.626 1.00 18.27 ? 376  MET A CG  1 
ATOM   2222  S  SD  . MET A  1 291 ? -17.832 77.233   100.479 1.00 21.78 ? 376  MET A SD  1 
ATOM   2223  C  CE  . MET A  1 291 ? -17.895 77.739   98.754  1.00 20.96 ? 376  MET A CE  1 
ATOM   2224  N  N   . ILE A  1 292 ? -21.258 80.632   100.924 1.00 19.42 ? 377  ILE A N   1 
ATOM   2225  C  CA  . ILE A  1 292 ? -22.256 81.664   100.693 1.00 18.84 ? 377  ILE A CA  1 
ATOM   2226  C  C   . ILE A  1 292 ? -22.214 82.242   99.292  1.00 19.61 ? 377  ILE A C   1 
ATOM   2227  O  O   . ILE A  1 292 ? -21.162 82.678   98.812  1.00 19.93 ? 377  ILE A O   1 
ATOM   2228  C  CB  . ILE A  1 292 ? -22.069 82.817   101.680 1.00 18.82 ? 377  ILE A CB  1 
ATOM   2229  C  CG1 . ILE A  1 292 ? -22.331 82.323   103.099 1.00 19.19 ? 377  ILE A CG1 1 
ATOM   2230  C  CG2 . ILE A  1 292 ? -22.982 83.968   101.308 1.00 17.34 ? 377  ILE A CG2 1 
ATOM   2231  C  CD1 . ILE A  1 292 ? -22.114 83.378   104.140 1.00 20.86 ? 377  ILE A CD1 1 
ATOM   2232  N  N   . TRP A  1 293 ? -23.364 82.256   98.634  1.00 19.31 ? 378  TRP A N   1 
ATOM   2233  C  CA  . TRP A  1 293 ? -23.426 82.810   97.301  1.00 19.35 ? 378  TRP A CA  1 
ATOM   2234  C  C   . TRP A  1 293 ? -24.095 84.164   97.349  1.00 20.92 ? 378  TRP A C   1 
ATOM   2235  O  O   . TRP A  1 293 ? -25.305 84.263   97.567  1.00 19.96 ? 378  TRP A O   1 
ATOM   2236  C  CB  . TRP A  1 293 ? -24.190 81.886   96.350  1.00 18.19 ? 378  TRP A CB  1 
ATOM   2237  C  CG  . TRP A  1 293 ? -24.590 82.564   95.058  1.00 18.50 ? 378  TRP A CG  1 
ATOM   2238  C  CD1 . TRP A  1 293 ? -25.855 82.909   94.671  1.00 17.47 ? 378  TRP A CD1 1 
ATOM   2239  C  CD2 . TRP A  1 293 ? -23.719 82.984   93.997  1.00 16.90 ? 378  TRP A CD2 1 
ATOM   2240  N  NE1 . TRP A  1 293 ? -25.827 83.516   93.435  1.00 17.96 ? 378  TRP A NE1 1 
ATOM   2241  C  CE2 . TRP A  1 293 ? -24.530 83.576   92.999  1.00 17.22 ? 378  TRP A CE2 1 
ATOM   2242  C  CE3 . TRP A  1 293 ? -22.334 82.917   93.793  1.00 16.06 ? 378  TRP A CE3 1 
ATOM   2243  C  CZ2 . TRP A  1 293 ? -24.000 84.096   91.814  1.00 15.47 ? 378  TRP A CZ2 1 
ATOM   2244  C  CZ3 . TRP A  1 293 ? -21.803 83.439   92.608  1.00 16.20 ? 378  TRP A CZ3 1 
ATOM   2245  C  CH2 . TRP A  1 293 ? -22.635 84.020   91.637  1.00 16.44 ? 378  TRP A CH2 1 
ATOM   2246  N  N   . ASP A  1 294 ? -23.283 85.203   97.171  1.00 22.75 ? 379  ASP A N   1 
ATOM   2247  C  CA  . ASP A  1 294 ? -23.764 86.578   97.143  1.00 26.12 ? 379  ASP A CA  1 
ATOM   2248  C  C   . ASP A  1 294 ? -23.616 87.013   95.690  1.00 27.01 ? 379  ASP A C   1 
ATOM   2249  O  O   . ASP A  1 294 ? -22.542 87.413   95.251  1.00 27.48 ? 379  ASP A O   1 
ATOM   2250  C  CB  . ASP A  1 294 ? -22.923 87.461   98.081  1.00 25.83 ? 379  ASP A CB  1 
ATOM   2251  C  CG  . ASP A  1 294 ? -23.278 88.950   97.998  1.00 27.57 ? 379  ASP A CG  1 
ATOM   2252  O  OD1 . ASP A  1 294 ? -24.342 89.341   97.461  1.00 29.64 ? 379  ASP A OD1 1 
ATOM   2253  O  OD2 . ASP A  1 294 ? -22.470 89.751   98.500  1.00 29.22 ? 379  ASP A OD2 1 
ATOM   2254  N  N   . PRO A  1 295 ? -24.696 86.894   94.910  1.00 28.71 ? 380  PRO A N   1 
ATOM   2255  C  CA  . PRO A  1 295 ? -24.604 87.300   93.509  1.00 30.55 ? 380  PRO A CA  1 
ATOM   2256  C  C   . PRO A  1 295 ? -24.261 88.767   93.567  1.00 32.85 ? 380  PRO A C   1 
ATOM   2257  O  O   . PRO A  1 295 ? -24.357 89.367   94.639  1.00 34.32 ? 380  PRO A O   1 
ATOM   2258  C  CB  . PRO A  1 295 ? -26.015 87.059   92.994  1.00 28.99 ? 380  PRO A CB  1 
ATOM   2259  C  CG  . PRO A  1 295 ? -26.851 87.391   94.191  1.00 28.88 ? 380  PRO A CG  1 
ATOM   2260  C  CD  . PRO A  1 295 ? -26.101 86.712   95.315  1.00 28.91 ? 380  PRO A CD  1 
ATOM   2261  N  N   . ASN A  1 296 ? -23.845 89.348   92.451  1.00 34.38 ? 381  ASN A N   1 
ATOM   2262  C  CA  . ASN A  1 296 ? -23.525 90.775   92.447  1.00 37.39 ? 381  ASN A CA  1 
ATOM   2263  C  C   . ASN A  1 296 ? -23.079 91.208   93.858  1.00 35.96 ? 381  ASN A C   1 
ATOM   2264  O  O   . ASN A  1 296 ? -23.782 91.972   94.545  1.00 35.42 ? 381  ASN A O   1 
ATOM   2265  C  CB  . ASN A  1 296 ? -24.770 91.568   92.001  1.00 41.54 ? 381  ASN A CB  1 
ATOM   2266  C  CG  . ASN A  1 296 ? -25.427 90.980   90.728  1.00 44.45 ? 381  ASN A CG  1 
ATOM   2267  O  OD1 . ASN A  1 296 ? -24.871 91.062   89.624  1.00 43.99 ? 381  ASN A OD1 1 
ATOM   2268  N  ND2 . ASN A  1 296 ? -26.610 90.379   90.893  1.00 44.44 ? 381  ASN A ND2 1 
ATOM   2269  N  N   . GLY A  1 297 ? -21.925 90.674   94.271  1.00 34.09 ? 382  GLY A N   1 
ATOM   2270  C  CA  . GLY A  1 297 ? -21.340 90.943   95.576  1.00 32.25 ? 382  GLY A CA  1 
ATOM   2271  C  C   . GLY A  1 297 ? -19.810 90.921   95.586  1.00 31.79 ? 382  GLY A C   1 
ATOM   2272  O  O   . GLY A  1 297 ? -19.173 90.978   96.637  1.00 30.82 ? 382  GLY A O   1 
ATOM   2273  N  N   . TRP A  1 298 ? -19.208 90.825   94.409  1.00 31.09 ? 383  TRP A N   1 
ATOM   2274  C  CA  . TRP A  1 298 ? -17.758 90.840   94.295  1.00 29.33 ? 383  TRP A CA  1 
ATOM   2275  C  C   . TRP A  1 298 ? -17.373 92.291   94.046  1.00 29.97 ? 383  TRP A C   1 
ATOM   2276  O  O   . TRP A  1 298 ? -16.289 92.736   94.416  1.00 28.62 ? 383  TRP A O   1 
ATOM   2277  C  CB  . TRP A  1 298 ? -17.328 89.962   93.122  1.00 28.82 ? 383  TRP A CB  1 
ATOM   2278  C  CG  . TRP A  1 298 ? -15.905 90.126   92.689  1.00 26.06 ? 383  TRP A CG  1 
ATOM   2279  C  CD1 . TRP A  1 298 ? -15.391 91.129   91.922  1.00 25.90 ? 383  TRP A CD1 1 
ATOM   2280  C  CD2 . TRP A  1 298 ? -14.831 89.231   92.949  1.00 24.67 ? 383  TRP A CD2 1 
ATOM   2281  N  NE1 . TRP A  1 298 ? -14.058 90.913   91.689  1.00 25.51 ? 383  TRP A NE1 1 
ATOM   2282  C  CE2 . TRP A  1 298 ? -13.682 89.750   92.322  1.00 24.84 ? 383  TRP A CE2 1 
ATOM   2283  C  CE3 . TRP A  1 298 ? -14.712 88.038   93.677  1.00 25.42 ? 383  TRP A CE3 1 
ATOM   2284  C  CZ2 . TRP A  1 298 ? -12.442 89.116   92.368  1.00 25.58 ? 383  TRP A CZ2 1 
ATOM   2285  C  CZ3 . TRP A  1 298 ? -13.477 87.401   93.730  1.00 24.41 ? 383  TRP A CZ3 1 
ATOM   2286  C  CH2 . TRP A  1 298 ? -12.356 87.949   93.087  1.00 24.47 ? 383  TRP A CH2 1 
ATOM   2287  N  N   . THR A  1 299 ? -18.291 93.019   93.419  1.00 31.07 ? 384  THR A N   1 
ATOM   2288  C  CA  . THR A  1 299 ? -18.100 94.428   93.102  1.00 32.75 ? 384  THR A CA  1 
ATOM   2289  C  C   . THR A  1 299 ? -18.987 95.309   93.977  1.00 33.72 ? 384  THR A C   1 
ATOM   2290  O  O   . THR A  1 299 ? -18.747 96.507   94.103  1.00 34.24 ? 384  THR A O   1 
ATOM   2291  C  CB  . THR A  1 299 ? -18.454 94.733   91.621  1.00 32.24 ? 384  THR A CB  1 
ATOM   2292  O  OG1 . THR A  1 299 ? -19.845 94.469   91.390  1.00 31.44 ? 384  THR A OG1 1 
ATOM   2293  C  CG2 . THR A  1 299 ? -17.621 93.876   90.682  1.00 31.54 ? 384  THR A CG2 1 
ATOM   2294  N  N   . GLU A  1 300 ? -20.007 94.717   94.587  1.00 34.70 ? 385  GLU A N   1 
ATOM   2295  C  CA  . GLU A  1 300 ? -20.924 95.490   95.410  1.00 35.43 ? 385  GLU A CA  1 
ATOM   2296  C  C   . GLU A  1 300 ? -20.800 95.262   96.897  1.00 34.74 ? 385  GLU A C   1 
ATOM   2297  O  O   . GLU A  1 300 ? -20.282 94.247   97.339  1.00 34.63 ? 385  GLU A O   1 
ATOM   2298  C  CB  . GLU A  1 300 ? -22.366 95.218   94.989  1.00 37.64 ? 385  GLU A CB  1 
ATOM   2299  C  CG  . GLU A  1 300 ? -22.692 95.648   93.574  1.00 40.69 ? 385  GLU A CG  1 
ATOM   2300  C  CD  . GLU A  1 300 ? -22.446 97.124   93.344  1.00 43.18 ? 385  GLU A CD  1 
ATOM   2301  O  OE1 . GLU A  1 300 ? -22.966 97.947   94.135  1.00 43.39 ? 385  GLU A OE1 1 
ATOM   2302  O  OE2 . GLU A  1 300 ? -21.739 97.458   92.367  1.00 45.15 ? 385  GLU A OE2 1 
ATOM   2303  N  N   . THR A  1 301 ? -21.293 96.231   97.659  1.00 35.33 ? 386  THR A N   1 
ATOM   2304  C  CA  . THR A  1 301 ? -21.271 96.179   99.112  1.00 35.74 ? 386  THR A CA  1 
ATOM   2305  C  C   . THR A  1 301 ? -22.694 95.934   99.582  1.00 37.98 ? 386  THR A C   1 
ATOM   2306  O  O   . THR A  1 301 ? -23.599 96.666   99.204  1.00 41.55 ? 386  THR A O   1 
ATOM   2307  C  CB  . THR A  1 301 ? -20.827 97.509   99.715  1.00 35.95 ? 386  THR A CB  1 
ATOM   2308  O  OG1 . THR A  1 301 ? -19.543 97.887   99.205  1.00 31.30 ? 386  THR A OG1 1 
ATOM   2309  C  CG2 . THR A  1 301 ? -20.769 97.385   101.216 1.00 37.71 ? 386  THR A CG2 1 
ATOM   2310  N  N   . ASP A  1 302 ? -22.898 94.908   100.394 1.00 39.01 ? 387  ASP A N   1 
ATOM   2311  C  CA  . ASP A  1 302 ? -24.225 94.580   100.908 1.00 39.49 ? 387  ASP A CA  1 
ATOM   2312  C  C   . ASP A  1 302 ? -23.978 93.691   102.096 1.00 39.42 ? 387  ASP A C   1 
ATOM   2313  O  O   . ASP A  1 302 ? -22.894 93.666   102.645 1.00 42.16 ? 387  ASP A O   1 
ATOM   2314  C  CB  . ASP A  1 302 ? -25.060 93.771   99.902  1.00 41.60 ? 387  ASP A CB  1 
ATOM   2315  C  CG  . ASP A  1 302 ? -25.497 94.577   98.705  1.00 42.65 ? 387  ASP A CG  1 
ATOM   2316  O  OD1 . ASP A  1 302 ? -25.975 95.709   98.901  1.00 46.20 ? 387  ASP A OD1 1 
ATOM   2317  O  OD2 . ASP A  1 302 ? -25.384 94.075   97.565  1.00 46.16 ? 387  ASP A OD2 1 
ATOM   2318  N  N   . SER A  1 303 ? -25.001 92.953   102.481 1.00 38.64 ? 388  SER A N   1 
ATOM   2319  C  CA  . SER A  1 303 ? -24.909 92.016   103.582 1.00 37.13 ? 388  SER A CA  1 
ATOM   2320  C  C   . SER A  1 303 ? -25.785 90.903   103.076 1.00 35.52 ? 388  SER A C   1 
ATOM   2321  O  O   . SER A  1 303 ? -25.781 89.798   103.602 1.00 35.30 ? 388  SER A O   1 
ATOM   2322  C  CB  . SER A  1 303 ? -25.527 92.588   104.858 1.00 38.29 ? 388  SER A CB  1 
ATOM   2323  O  OG  . SER A  1 303 ? -24.879 93.771   105.267 1.00 40.25 ? 388  SER A OG  1 
ATOM   2324  N  N   . SER A  1 304 ? -26.543 91.227   102.035 1.00 33.14 ? 389  SER A N   1 
ATOM   2325  C  CA  . SER A  1 304 ? -27.462 90.281   101.442 1.00 33.03 ? 389  SER A CA  1 
ATOM   2326  C  C   . SER A  1 304 ? -26.821 89.407   100.377 1.00 31.97 ? 389  SER A C   1 
ATOM   2327  O  O   . SER A  1 304 ? -25.969 89.852   99.597  1.00 33.06 ? 389  SER A O   1 
ATOM   2328  C  CB  . SER A  1 304 ? -28.666 91.022   100.863 1.00 31.97 ? 389  SER A CB  1 
ATOM   2329  O  OG  . SER A  1 304 ? -28.244 91.976   99.913  1.00 32.33 ? 389  SER A OG  1 
ATOM   2330  N  N   . PHE A  1 305 ? -27.262 88.154   100.370 1.00 30.89 ? 390  PHE A N   1 
ATOM   2331  C  CA  . PHE A  1 305 ? -26.795 87.122   99.455  1.00 30.32 ? 390  PHE A CA  1 
ATOM   2332  C  C   . PHE A  1 305 ? -27.984 86.192   99.253  1.00 28.76 ? 390  PHE A C   1 
ATOM   2333  O  O   . PHE A  1 305 ? -28.950 86.276   100.001 1.00 29.49 ? 390  PHE A O   1 
ATOM   2334  C  CB  . PHE A  1 305 ? -25.647 86.361   100.107 1.00 30.97 ? 390  PHE A CB  1 
ATOM   2335  C  CG  . PHE A  1 305 ? -26.004 85.772   101.444 1.00 30.12 ? 390  PHE A CG  1 
ATOM   2336  C  CD1 . PHE A  1 305 ? -26.322 84.423   101.564 1.00 30.79 ? 390  PHE A CD1 1 
ATOM   2337  C  CD2 . PHE A  1 305 ? -26.057 86.574   102.578 1.00 29.02 ? 390  PHE A CD2 1 
ATOM   2338  C  CE1 . PHE A  1 305 ? -26.685 83.884   102.795 1.00 29.15 ? 390  PHE A CE1 1 
ATOM   2339  C  CE2 . PHE A  1 305 ? -26.418 86.044   103.810 1.00 28.69 ? 390  PHE A CE2 1 
ATOM   2340  C  CZ  . PHE A  1 305 ? -26.734 84.697   103.919 1.00 28.30 ? 390  PHE A CZ  1 
ATOM   2341  N  N   . SER A  1 306 ? -27.924 85.298   98.275  1.00 26.99 ? 391  SER A N   1 
ATOM   2342  C  CA  . SER A  1 306 ? -29.050 84.410   98.052  1.00 26.96 ? 391  SER A CA  1 
ATOM   2343  C  C   . SER A  1 306 ? -28.955 82.996   98.621  1.00 25.84 ? 391  SER A C   1 
ATOM   2344  O  O   . SER A  1 306 ? -29.982 82.380   98.916  1.00 26.98 ? 391  SER A O   1 
ATOM   2345  C  CB  . SER A  1 306 ? -29.384 84.343   96.558  1.00 26.90 ? 391  SER A CB  1 
ATOM   2346  O  OG  . SER A  1 306 ? -28.266 84.663   95.767  1.00 28.81 ? 391  SER A OG  1 
ATOM   2347  N  N   . VAL A  1 307 ? -27.751 82.470   98.792  1.00 22.70 ? 392  VAL A N   1 
ATOM   2348  C  CA  . VAL A  1 307 ? -27.646 81.117   99.315  1.00 20.19 ? 392  VAL A CA  1 
ATOM   2349  C  C   . VAL A  1 307 ? -26.566 80.913   100.352 1.00 19.36 ? 392  VAL A C   1 
ATOM   2350  O  O   . VAL A  1 307 ? -25.463 81.440   100.246 1.00 18.78 ? 392  VAL A O   1 
ATOM   2351  C  CB  . VAL A  1 307 ? -27.398 80.088   98.190  1.00 19.54 ? 392  VAL A CB  1 
ATOM   2352  C  CG1 . VAL A  1 307 ? -27.429 78.675   98.763  1.00 17.31 ? 392  VAL A CG1 1 
ATOM   2353  C  CG2 . VAL A  1 307 ? -28.433 80.244   97.106  1.00 17.57 ? 392  VAL A CG2 1 
ATOM   2354  N  N   . LYS A  1 308 ? -26.908 80.122   101.357 1.00 19.59 ? 394  LYS A N   1 
ATOM   2355  C  CA  . LYS A  1 308 ? -25.992 79.783   102.429 1.00 19.74 ? 394  LYS A CA  1 
ATOM   2356  C  C   . LYS A  1 308 ? -26.062 78.278   102.563 1.00 18.72 ? 394  LYS A C   1 
ATOM   2357  O  O   . LYS A  1 308 ? -27.138 77.728   102.780 1.00 18.57 ? 394  LYS A O   1 
ATOM   2358  C  CB  . LYS A  1 308 ? -26.449 80.415   103.736 1.00 21.74 ? 394  LYS A CB  1 
ATOM   2359  C  CG  . LYS A  1 308 ? -25.610 80.071   104.961 1.00 25.37 ? 394  LYS A CG  1 
ATOM   2360  C  CD  . LYS A  1 308 ? -26.423 80.318   106.238 1.00 29.38 ? 394  LYS A CD  1 
ATOM   2361  C  CE  . LYS A  1 308 ? -25.552 80.694   107.436 1.00 29.98 ? 394  LYS A CE  1 
ATOM   2362  N  NZ  . LYS A  1 308 ? -24.929 82.048   107.295 1.00 29.88 ? 394  LYS A NZ  1 
ATOM   2363  N  N   . GLN A  1 309 ? -24.929 77.607   102.403 1.00 18.77 ? 395  GLN A N   1 
ATOM   2364  C  CA  . GLN A  1 309 ? -24.892 76.156   102.558 1.00 17.80 ? 395  GLN A CA  1 
ATOM   2365  C  C   . GLN A  1 309 ? -23.942 75.802   103.707 1.00 16.57 ? 395  GLN A C   1 
ATOM   2366  O  O   . GLN A  1 309 ? -22.766 76.151   103.662 1.00 16.31 ? 395  GLN A O   1 
ATOM   2367  C  CB  . GLN A  1 309 ? -24.425 75.479   101.261 1.00 16.79 ? 395  GLN A CB  1 
ATOM   2368  C  CG  . GLN A  1 309 ? -24.356 73.957   101.362 1.00 16.97 ? 395  GLN A CG  1 
ATOM   2369  C  CD  . GLN A  1 309 ? -23.919 73.287   100.069 1.00 19.10 ? 395  GLN A CD  1 
ATOM   2370  O  OE1 . GLN A  1 309 ? -23.627 72.088   100.051 1.00 19.71 ? 395  GLN A OE1 1 
ATOM   2371  N  NE2 . GLN A  1 309 ? -23.877 74.054   98.979  1.00 18.48 ? 395  GLN A NE2 1 
ATOM   2372  N  N   . ASP A  1 310 ? -24.452 75.128   104.737 1.00 15.51 ? 396  ASP A N   1 
ATOM   2373  C  CA  . ASP A  1 310 ? -23.625 74.736   105.880 1.00 16.35 ? 396  ASP A CA  1 
ATOM   2374  C  C   . ASP A  1 310 ? -22.655 73.580   105.574 1.00 15.87 ? 396  ASP A C   1 
ATOM   2375  O  O   . ASP A  1 310 ? -22.984 72.655   104.838 1.00 16.51 ? 396  ASP A O   1 
ATOM   2376  C  CB  . ASP A  1 310 ? -24.506 74.329   107.063 1.00 17.77 ? 396  ASP A CB  1 
ATOM   2377  C  CG  . ASP A  1 310 ? -25.347 75.471   107.586 1.00 21.12 ? 396  ASP A CG  1 
ATOM   2378  O  OD1 . ASP A  1 310 ? -24.894 76.634   107.505 1.00 23.14 ? 396  ASP A OD1 1 
ATOM   2379  O  OD2 . ASP A  1 310 ? -26.457 75.203   108.098 1.00 21.15 ? 396  ASP A OD2 1 
ATOM   2380  N  N   . ILE A  1 311 ? -21.467 73.637   106.160 1.00 15.16 ? 397  ILE A N   1 
ATOM   2381  C  CA  . ILE A  1 311 ? -20.458 72.608   105.959 1.00 17.16 ? 397  ILE A CA  1 
ATOM   2382  C  C   . ILE A  1 311 ? -19.932 72.069   107.293 1.00 18.80 ? 397  ILE A C   1 
ATOM   2383  O  O   . ILE A  1 311 ? -19.743 70.862   107.456 1.00 19.37 ? 397  ILE A O   1 
ATOM   2384  C  CB  . ILE A  1 311 ? -19.330 73.162   105.102 1.00 17.12 ? 397  ILE A CB  1 
ATOM   2385  C  CG1 . ILE A  1 311 ? -19.882 73.401   103.704 1.00 17.97 ? 397  ILE A CG1 1 
ATOM   2386  C  CG2 . ILE A  1 311 ? -18.160 72.210   105.069 1.00 16.48 ? 397  ILE A CG2 1 
ATOM   2387  C  CD1 . ILE A  1 311 ? -18.930 74.072   102.798 1.00 24.17 ? 397  ILE A CD1 1 
ATOM   2388  N  N   . VAL A  1 312 ? -19.692 72.965   108.246 1.00 19.27 ? 398  VAL A N   1 
ATOM   2389  C  CA  . VAL A  1 312 ? -19.256 72.568   109.578 1.00 18.54 ? 398  VAL A CA  1 
ATOM   2390  C  C   . VAL A  1 312 ? -19.989 73.484   110.561 1.00 19.42 ? 398  VAL A C   1 
ATOM   2391  O  O   . VAL A  1 312 ? -19.950 74.707   110.434 1.00 18.80 ? 398  VAL A O   1 
ATOM   2392  C  CB  . VAL A  1 312 ? -17.729 72.704   109.770 1.00 17.68 ? 398  VAL A CB  1 
ATOM   2393  C  CG1 . VAL A  1 312 ? -17.353 72.242   111.157 1.00 16.34 ? 398  VAL A CG1 1 
ATOM   2394  C  CG2 . VAL A  1 312 ? -16.988 71.865   108.735 1.00 18.28 ? 398  VAL A CG2 1 
ATOM   2395  N  N   . ALA A  1 313 ? -20.671 72.870   111.522 1.00 20.56 ? 399  ALA A N   1 
ATOM   2396  C  CA  . ALA A  1 313 ? -21.449 73.574   112.534 1.00 20.60 ? 399  ALA A CA  1 
ATOM   2397  C  C   . ALA A  1 313 ? -20.607 74.489   113.412 1.00 21.28 ? 399  ALA A C   1 
ATOM   2398  O  O   . ALA A  1 313 ? -19.490 74.145   113.796 1.00 20.86 ? 399  ALA A O   1 
ATOM   2399  C  CB  . ALA A  1 313 ? -22.194 72.560   113.403 1.00 18.00 ? 399  ALA A CB  1 
ATOM   2400  N  N   . ILE A  1 314 ? -21.163 75.652   113.737 1.00 22.96 ? 400  ILE A N   1 
ATOM   2401  C  CA  . ILE A  1 314 ? -20.477 76.634   114.572 1.00 24.77 ? 400  ILE A CA  1 
ATOM   2402  C  C   . ILE A  1 314 ? -19.902 75.944   115.791 1.00 24.44 ? 400  ILE A C   1 
ATOM   2403  O  O   . ILE A  1 314 ? -18.915 76.391   116.359 1.00 25.50 ? 400  ILE A O   1 
ATOM   2404  C  CB  . ILE A  1 314 ? -21.447 77.729   115.083 1.00 26.35 ? 400  ILE A CB  1 
ATOM   2405  C  CG1 . ILE A  1 314 ? -22.428 78.110   113.974 1.00 31.20 ? 400  ILE A CG1 1 
ATOM   2406  C  CG2 . ILE A  1 314 ? -20.671 78.981   115.499 1.00 24.56 ? 400  ILE A CG2 1 
ATOM   2407  C  CD1 . ILE A  1 314 ? -23.408 79.206   114.363 1.00 35.21 ? 400  ILE A CD1 1 
ATOM   2408  N  N   . THR A  1 315 ? -20.533 74.848   116.187 1.00 24.46 ? 401  THR A N   1 
ATOM   2409  C  CA  . THR A  1 315 ? -20.120 74.105   117.365 1.00 25.22 ? 401  THR A CA  1 
ATOM   2410  C  C   . THR A  1 315 ? -18.829 73.314   117.216 1.00 25.65 ? 401  THR A C   1 
ATOM   2411  O  O   . THR A  1 315 ? -18.262 72.864   118.213 1.00 25.57 ? 401  THR A O   1 
ATOM   2412  C  CB  . THR A  1 315 ? -21.240 73.153   117.814 1.00 25.91 ? 401  THR A CB  1 
ATOM   2413  O  OG1 . THR A  1 315 ? -21.602 72.286   116.729 1.00 24.97 ? 401  THR A OG1 1 
ATOM   2414  C  CG2 . THR A  1 315 ? -22.465 73.953   118.243 1.00 26.02 ? 401  THR A CG2 1 
ATOM   2415  N  N   . ASP A  1 316 ? -18.356 73.151   115.982 1.00 25.23 ? 402  ASP A N   1 
ATOM   2416  C  CA  . ASP A  1 316 ? -17.126 72.401   115.734 1.00 24.27 ? 402  ASP A CA  1 
ATOM   2417  C  C   . ASP A  1 316 ? -16.021 73.247   115.108 1.00 22.37 ? 402  ASP A C   1 
ATOM   2418  O  O   . ASP A  1 316 ? -16.288 74.268   114.482 1.00 21.55 ? 402  ASP A O   1 
ATOM   2419  C  CB  . ASP A  1 316 ? -17.430 71.185   114.857 1.00 25.54 ? 402  ASP A CB  1 
ATOM   2420  C  CG  . ASP A  1 316 ? -18.300 70.169   115.569 1.00 28.01 ? 402  ASP A CG  1 
ATOM   2421  O  OD1 . ASP A  1 316 ? -17.813 69.559   116.545 1.00 29.21 ? 402  ASP A OD1 1 
ATOM   2422  O  OD2 . ASP A  1 316 ? -19.472 69.987   115.168 1.00 28.98 ? 402  ASP A OD2 1 
ATOM   2423  N  N   . TRP A  1 317 ? -14.781 72.796   115.276 1.00 20.59 ? 403  TRP A N   1 
ATOM   2424  C  CA  . TRP A  1 317 ? -13.608 73.505   114.774 1.00 20.35 ? 403  TRP A CA  1 
ATOM   2425  C  C   . TRP A  1 317 ? -13.310 73.362   113.291 1.00 19.12 ? 403  TRP A C   1 
ATOM   2426  O  O   . TRP A  1 317 ? -13.399 72.272   112.725 1.00 18.84 ? 403  TRP A O   1 
ATOM   2427  C  CB  . TRP A  1 317 ? -12.355 73.066   115.547 1.00 20.78 ? 403  TRP A CB  1 
ATOM   2428  C  CG  . TRP A  1 317 ? -12.462 73.289   117.019 1.00 22.75 ? 403  TRP A CG  1 
ATOM   2429  C  CD1 . TRP A  1 317 ? -12.623 72.338   117.983 1.00 23.01 ? 403  TRP A CD1 1 
ATOM   2430  C  CD2 . TRP A  1 317 ? -12.483 74.551   117.690 1.00 22.86 ? 403  TRP A CD2 1 
ATOM   2431  N  NE1 . TRP A  1 317 ? -12.748 72.930   119.221 1.00 24.13 ? 403  TRP A NE1 1 
ATOM   2432  C  CE2 . TRP A  1 317 ? -12.667 74.289   119.070 1.00 23.80 ? 403  TRP A CE2 1 
ATOM   2433  C  CE3 . TRP A  1 317 ? -12.367 75.877   117.263 1.00 22.11 ? 403  TRP A CE3 1 
ATOM   2434  C  CZ2 . TRP A  1 317 ? -12.741 75.309   120.027 1.00 24.29 ? 403  TRP A CZ2 1 
ATOM   2435  C  CZ3 . TRP A  1 317 ? -12.439 76.896   118.216 1.00 25.00 ? 403  TRP A CZ3 1 
ATOM   2436  C  CH2 . TRP A  1 317 ? -12.625 76.604   119.583 1.00 24.30 ? 403  TRP A CH2 1 
ATOM   2437  N  N   . SER A  1 318 ? -12.940 74.475   112.667 1.00 16.82 ? 404  SER A N   1 
ATOM   2438  C  CA  . SER A  1 318 ? -12.571 74.453   111.267 1.00 14.42 ? 404  SER A CA  1 
ATOM   2439  C  C   . SER A  1 318 ? -11.140 74.975   111.178 1.00 12.77 ? 404  SER A C   1 
ATOM   2440  O  O   . SER A  1 318 ? -10.311 74.687   112.049 1.00 9.99  ? 404  SER A O   1 
ATOM   2441  C  CB  . SER A  1 318 ? -13.535 75.304   110.416 1.00 15.77 ? 404  SER A CB  1 
ATOM   2442  O  OG  . SER A  1 318 ? -13.618 76.647   110.859 1.00 16.05 ? 404  SER A OG  1 
ATOM   2443  N  N   . GLY A  1 319 ? -10.840 75.727   110.127 1.00 11.50 ? 405  GLY A N   1 
ATOM   2444  C  CA  . GLY A  1 319 ? -9.500  76.251   109.987 1.00 10.70 ? 405  GLY A CA  1 
ATOM   2445  C  C   . GLY A  1 319 ? -9.244  76.703   108.578 1.00 10.33 ? 405  GLY A C   1 
ATOM   2446  O  O   . GLY A  1 319 ? -10.128 77.241   107.919 1.00 10.70 ? 405  GLY A O   1 
ATOM   2447  N  N   . TYR A  1 320 ? -8.020  76.495   108.116 1.00 10.59 ? 406  TYR A N   1 
ATOM   2448  C  CA  . TYR A  1 320 ? -7.652  76.884   106.764 1.00 9.59  ? 406  TYR A CA  1 
ATOM   2449  C  C   . TYR A  1 320 ? -8.609  76.255   105.775 1.00 9.15  ? 406  TYR A C   1 
ATOM   2450  O  O   . TYR A  1 320 ? -9.215  75.230   106.048 1.00 8.43  ? 406  TYR A O   1 
ATOM   2451  C  CB  . TYR A  1 320 ? -6.234  76.399   106.443 1.00 9.32  ? 406  TYR A CB  1 
ATOM   2452  C  CG  . TYR A  1 320 ? -5.142  77.328   106.909 1.00 10.12 ? 406  TYR A CG  1 
ATOM   2453  C  CD1 . TYR A  1 320 ? -5.317  78.125   108.036 1.00 11.22 ? 406  TYR A CD1 1 
ATOM   2454  C  CD2 . TYR A  1 320 ? -3.928  77.405   106.228 1.00 11.38 ? 406  TYR A CD2 1 
ATOM   2455  C  CE1 . TYR A  1 320 ? -4.315  78.977   108.478 1.00 13.64 ? 406  TYR A CE1 1 
ATOM   2456  C  CE2 . TYR A  1 320 ? -2.912  78.259   106.663 1.00 11.24 ? 406  TYR A CE2 1 
ATOM   2457  C  CZ  . TYR A  1 320 ? -3.117  79.042   107.789 1.00 13.45 ? 406  TYR A CZ  1 
ATOM   2458  O  OH  . TYR A  1 320 ? -2.145  79.902   108.237 1.00 13.20 ? 406  TYR A OH  1 
ATOM   2459  N  N   . SER A  1 321 ? -8.750  76.887   104.626 1.00 8.71  ? 407  SER A N   1 
ATOM   2460  C  CA  . SER A  1 321 ? -9.586  76.350   103.570 1.00 9.07  ? 407  SER A CA  1 
ATOM   2461  C  C   . SER A  1 321 ? -8.925  76.875   102.324 1.00 8.38  ? 407  SER A C   1 
ATOM   2462  O  O   . SER A  1 321 ? -8.261  77.899   102.365 1.00 8.74  ? 407  SER A O   1 
ATOM   2463  C  CB  . SER A  1 321 ? -11.043 76.844   103.670 1.00 9.63  ? 407  SER A CB  1 
ATOM   2464  O  OG  . SER A  1 321 ? -11.157 78.239   103.474 1.00 8.85  ? 407  SER A OG  1 
ATOM   2465  N  N   . GLY A  1 322 ? -9.083  76.165   101.223 1.00 8.88  ? 408  GLY A N   1 
ATOM   2466  C  CA  . GLY A  1 322 ? -8.475  76.610   99.992  1.00 8.94  ? 408  GLY A CA  1 
ATOM   2467  C  C   . GLY A  1 322 ? -9.210  76.018   98.822  1.00 10.12 ? 408  GLY A C   1 
ATOM   2468  O  O   . GLY A  1 322 ? -9.981  75.070   98.967  1.00 11.07 ? 408  GLY A O   1 
ATOM   2469  N  N   . SER A  1 323 ? -8.986  76.589   97.653  1.00 10.72 ? 409  SER A N   1 
ATOM   2470  C  CA  . SER A  1 323 ? -9.634  76.088   96.468  1.00 13.16 ? 409  SER A CA  1 
ATOM   2471  C  C   . SER A  1 323 ? -8.699  75.177   95.715  1.00 13.90 ? 409  SER A C   1 
ATOM   2472  O  O   . SER A  1 323 ? -7.479  75.244   95.860  1.00 15.29 ? 409  SER A O   1 
ATOM   2473  C  CB  . SER A  1 323 ? -10.007 77.242   95.539  1.00 14.14 ? 409  SER A CB  1 
ATOM   2474  O  OG  . SER A  1 323 ? -8.837  77.917   95.093  1.00 14.26 ? 409  SER A OG  1 
ATOM   2475  N  N   . PHE A  1 324 ? -9.293  74.295   94.935  1.00 15.43 ? 410  PHE A N   1 
ATOM   2476  C  CA  . PHE A  1 324 ? -8.550  73.427   94.047  1.00 17.59 ? 410  PHE A CA  1 
ATOM   2477  C  C   . PHE A  1 324 ? -9.517  73.227   92.900  1.00 18.33 ? 410  PHE A C   1 
ATOM   2478  O  O   . PHE A  1 324 ? -10.734 73.427   93.042  1.00 18.38 ? 410  PHE A O   1 
ATOM   2479  C  CB  . PHE A  1 324 ? -8.077  72.114   94.702  1.00 18.93 ? 410  PHE A CB  1 
ATOM   2480  C  CG  . PHE A  1 324 ? -9.155  71.102   94.980  1.00 17.85 ? 410  PHE A CG  1 
ATOM   2481  C  CD1 . PHE A  1 324 ? -9.870  71.135   96.169  1.00 18.71 ? 410  PHE A CD1 1 
ATOM   2482  C  CD2 . PHE A  1 324 ? -9.363  70.046   94.106  1.00 17.55 ? 410  PHE A CD2 1 
ATOM   2483  C  CE1 . PHE A  1 324 ? -10.770 70.126   96.487  1.00 17.91 ? 410  PHE A CE1 1 
ATOM   2484  C  CE2 . PHE A  1 324 ? -10.259 69.035   94.416  1.00 18.57 ? 410  PHE A CE2 1 
ATOM   2485  C  CZ  . PHE A  1 324 ? -10.960 69.074   95.611  1.00 17.95 ? 410  PHE A CZ  1 
ATOM   2486  N  N   . VAL A  1 325 ? -8.988  72.859   91.753  1.00 18.48 ? 411  VAL A N   1 
ATOM   2487  C  CA  . VAL A  1 325 ? -9.822  72.743   90.579  1.00 17.79 ? 411  VAL A CA  1 
ATOM   2488  C  C   . VAL A  1 325 ? -9.676  71.394   89.908  1.00 18.04 ? 411  VAL A C   1 
ATOM   2489  O  O   . VAL A  1 325 ? -8.725  70.660   90.171  1.00 18.98 ? 411  VAL A O   1 
ATOM   2490  C  CB  . VAL A  1 325 ? -9.424  73.904   89.621  1.00 19.57 ? 411  VAL A CB  1 
ATOM   2491  C  CG1 . VAL A  1 325 ? -9.162  73.397   88.217  1.00 20.28 ? 411  VAL A CG1 1 
ATOM   2492  C  CG2 . VAL A  1 325 ? -10.483 74.997   89.665  1.00 19.11 ? 411  VAL A CG2 1 
ATOM   2493  N  N   . GLN A  1 326 ? -10.638 71.050   89.064  1.00 17.90 ? 412  GLN A N   1 
ATOM   2494  C  CA  . GLN A  1 326 ? -10.566 69.805   88.322  1.00 18.47 ? 412  GLN A CA  1 
ATOM   2495  C  C   . GLN A  1 326 ? -10.754 70.200   86.879  1.00 18.81 ? 412  GLN A C   1 
ATOM   2496  O  O   . GLN A  1 326 ? -11.790 70.735   86.488  1.00 19.74 ? 412  GLN A O   1 
ATOM   2497  C  CB  . GLN A  1 326 ? -11.637 68.815   88.775  1.00 19.46 ? 412  GLN A CB  1 
ATOM   2498  C  CG  . GLN A  1 326 ? -11.299 68.149   90.104  1.00 19.42 ? 412  GLN A CG  1 
ATOM   2499  C  CD  . GLN A  1 326 ? -12.307 67.093   90.507  1.00 18.80 ? 412  GLN A CD  1 
ATOM   2500  O  OE1 . GLN A  1 326 ? -13.389 67.004   89.937  1.00 18.09 ? 412  GLN A OE1 1 
ATOM   2501  N  NE2 . GLN A  1 326 ? -11.961 66.298   91.509  1.00 20.94 ? 412  GLN A NE2 1 
ATOM   2502  N  N   . HIS A  1 327 A -9.718  69.965   86.093  1.00 19.42 ? 412  HIS A N   1 
ATOM   2503  C  CA  . HIS A  1 327 A -9.731  70.329   84.695  1.00 19.28 ? 412  HIS A CA  1 
ATOM   2504  C  C   . HIS A  1 327 A -10.507 69.370   83.845  1.00 19.51 ? 412  HIS A C   1 
ATOM   2505  O  O   . HIS A  1 327 A -10.652 68.199   84.185  1.00 19.12 ? 412  HIS A O   1 
ATOM   2506  C  CB  . HIS A  1 327 A -8.302  70.411   84.166  1.00 19.74 ? 412  HIS A CB  1 
ATOM   2507  C  CG  . HIS A  1 327 A -7.606  71.680   84.515  1.00 19.21 ? 412  HIS A CG  1 
ATOM   2508  N  ND1 . HIS A  1 327 A -7.542  72.756   83.644  1.00 18.38 ? 412  HIS A ND1 1 
ATOM   2509  C  CD2 . HIS A  1 327 A -6.962  72.069   85.633  1.00 19.25 ? 412  HIS A CD2 1 
ATOM   2510  C  CE1 . HIS A  1 327 A -6.889  73.737   84.220  1.00 19.50 ? 412  HIS A CE1 1 
ATOM   2511  N  NE2 . HIS A  1 327 A -6.520  73.353   85.433  1.00 19.83 ? 412  HIS A NE2 1 
ATOM   2512  N  N   . PRO A  1 328 B -11.028 69.869   82.718  1.00 20.14 ? 412  PRO A N   1 
ATOM   2513  C  CA  . PRO A  1 328 B -11.800 69.057   81.779  1.00 20.95 ? 412  PRO A CA  1 
ATOM   2514  C  C   . PRO A  1 328 B -10.963 67.872   81.286  1.00 21.53 ? 412  PRO A C   1 
ATOM   2515  O  O   . PRO A  1 328 B -11.487 66.814   80.947  1.00 22.77 ? 412  PRO A O   1 
ATOM   2516  C  CB  . PRO A  1 328 B -12.157 70.056   80.669  1.00 20.91 ? 412  PRO A CB  1 
ATOM   2517  C  CG  . PRO A  1 328 B -11.171 71.194   80.848  1.00 20.91 ? 412  PRO A CG  1 
ATOM   2518  C  CD  . PRO A  1 328 B -11.047 71.289   82.330  1.00 20.02 ? 412  PRO A CD  1 
ATOM   2519  N  N   . GLU A  1 329 C -9.649  68.041   81.288  1.00 22.12 ? 412  GLU A N   1 
ATOM   2520  C  CA  . GLU A  1 329 C -8.755  66.983   80.837  1.00 22.84 ? 412  GLU A CA  1 
ATOM   2521  C  C   . GLU A  1 329 C -8.811  65.788   81.800  1.00 21.23 ? 412  GLU A C   1 
ATOM   2522  O  O   . GLU A  1 329 C -8.439  64.670   81.454  1.00 22.51 ? 412  GLU A O   1 
ATOM   2523  C  CB  . GLU A  1 329 C -7.340  67.549   80.727  1.00 24.18 ? 412  GLU A CB  1 
ATOM   2524  C  CG  . GLU A  1 329 C -7.334  69.069   80.485  1.00 27.21 ? 412  GLU A CG  1 
ATOM   2525  C  CD  . GLU A  1 329 C -6.625  69.454   79.213  1.00 30.51 ? 412  GLU A CD  1 
ATOM   2526  O  OE1 . GLU A  1 329 C -5.706  68.714   78.801  1.00 34.10 ? 412  GLU A OE1 1 
ATOM   2527  O  OE2 . GLU A  1 329 C -6.963  70.501   78.628  1.00 32.70 ? 412  GLU A OE2 1 
ATOM   2528  N  N   . LEU A  1 330 D -9.275  66.032   83.018  1.00 19.65 ? 412  LEU A N   1 
ATOM   2529  C  CA  . LEU A  1 330 D -9.416  64.974   84.016  1.00 17.28 ? 412  LEU A CA  1 
ATOM   2530  C  C   . LEU A  1 330 D -10.873 64.528   84.065  1.00 17.50 ? 412  LEU A C   1 
ATOM   2531  O  O   . LEU A  1 330 D -11.179 63.346   84.185  1.00 16.02 ? 412  LEU A O   1 
ATOM   2532  C  CB  . LEU A  1 330 D -9.046  65.496   85.407  1.00 15.24 ? 412  LEU A CB  1 
ATOM   2533  C  CG  . LEU A  1 330 D -9.460  64.609   86.595  1.00 12.69 ? 412  LEU A CG  1 
ATOM   2534  C  CD1 . LEU A  1 330 D -8.526  63.411   86.703  1.00 10.86 ? 412  LEU A CD1 1 
ATOM   2535  C  CD2 . LEU A  1 330 D -9.423  65.421   87.893  1.00 12.88 ? 412  LEU A CD2 1 
ATOM   2536  N  N   . THR A  1 331 ? -11.756 65.514   83.958  1.00 18.53 ? 413  THR A N   1 
ATOM   2537  C  CA  . THR A  1 331 ? -13.200 65.351   84.052  1.00 19.35 ? 413  THR A CA  1 
ATOM   2538  C  C   . THR A  1 331 ? -14.008 64.919   82.839  1.00 20.84 ? 413  THR A C   1 
ATOM   2539  O  O   . THR A  1 331 ? -14.986 64.174   82.974  1.00 20.68 ? 413  THR A O   1 
ATOM   2540  C  CB  . THR A  1 331 ? -13.811 66.655   84.535  1.00 18.73 ? 413  THR A CB  1 
ATOM   2541  O  OG1 . THR A  1 331 ? -13.320 66.945   85.844  1.00 20.68 ? 413  THR A OG1 1 
ATOM   2542  C  CG2 . THR A  1 331 ? -15.295 66.553   84.574  1.00 21.64 ? 413  THR A CG2 1 
ATOM   2543  N  N   . GLY A  1 332 ? -13.617 65.396   81.663  1.00 21.57 ? 414  GLY A N   1 
ATOM   2544  C  CA  . GLY A  1 332 ? -14.365 65.082   80.465  1.00 22.97 ? 414  GLY A CA  1 
ATOM   2545  C  C   . GLY A  1 332 ? -15.339 66.227   80.259  1.00 25.55 ? 414  GLY A C   1 
ATOM   2546  O  O   . GLY A  1 332 ? -15.955 66.350   79.205  1.00 26.59 ? 414  GLY A O   1 
ATOM   2547  N  N   . LEU A  1 333 ? -15.473 67.066   81.287  1.00 27.05 ? 415  LEU A N   1 
ATOM   2548  C  CA  . LEU A  1 333 ? -16.353 68.234   81.258  1.00 27.44 ? 415  LEU A CA  1 
ATOM   2549  C  C   . LEU A  1 333 ? -15.816 69.269   80.268  1.00 28.75 ? 415  LEU A C   1 
ATOM   2550  O  O   . LEU A  1 333 ? -14.675 69.182   79.830  1.00 28.58 ? 415  LEU A O   1 
ATOM   2551  C  CB  . LEU A  1 333 ? -16.441 68.850   82.658  1.00 26.32 ? 415  LEU A CB  1 
ATOM   2552  C  CG  . LEU A  1 333 ? -17.689 68.607   83.525  1.00 27.04 ? 415  LEU A CG  1 
ATOM   2553  C  CD1 . LEU A  1 333 ? -18.229 67.201   83.333  1.00 24.88 ? 415  LEU A CD1 1 
ATOM   2554  C  CD2 . LEU A  1 333 ? -17.344 68.873   84.983  1.00 24.52 ? 415  LEU A CD2 1 
ATOM   2555  N  N   . ASP A  1 334 ? -16.640 70.242   79.907  1.00 31.10 ? 416  ASP A N   1 
ATOM   2556  C  CA  . ASP A  1 334 ? -16.224 71.275   78.963  1.00 33.20 ? 416  ASP A CA  1 
ATOM   2557  C  C   . ASP A  1 334 ? -15.939 72.567   79.717  1.00 33.54 ? 416  ASP A C   1 
ATOM   2558  O  O   . ASP A  1 334 ? -15.905 73.652   79.137  1.00 34.35 ? 416  ASP A O   1 
ATOM   2559  C  CB  . ASP A  1 334 ? -17.322 71.507   77.922  1.00 35.83 ? 416  ASP A CB  1 
ATOM   2560  C  CG  . ASP A  1 334 ? -18.653 71.896   78.550  1.00 40.38 ? 416  ASP A CG  1 
ATOM   2561  O  OD1 . ASP A  1 334 ? -19.178 71.125   79.390  1.00 42.60 ? 416  ASP A OD1 1 
ATOM   2562  O  OD2 . ASP A  1 334 ? -19.181 72.977   78.202  1.00 44.30 ? 416  ASP A OD2 1 
ATOM   2563  N  N   . CYS A  1 335 ? -15.729 72.434   81.020  1.00 32.84 ? 417  CYS A N   1 
ATOM   2564  C  CA  . CYS A  1 335 ? -15.459 73.575   81.873  1.00 32.12 ? 417  CYS A CA  1 
ATOM   2565  C  C   . CYS A  1 335 ? -14.588 73.149   83.047  1.00 30.74 ? 417  CYS A C   1 
ATOM   2566  O  O   . CYS A  1 335 ? -14.330 71.962   83.251  1.00 30.24 ? 417  CYS A O   1 
ATOM   2567  C  CB  . CYS A  1 335 ? -16.779 74.146   82.380  1.00 34.67 ? 417  CYS A CB  1 
ATOM   2568  S  SG  . CYS A  1 335 ? -17.831 72.836   83.088  1.00 40.10 ? 417  CYS A SG  1 
ATOM   2569  N  N   . ILE A  1 336 ? -14.127 74.129   83.813  1.00 29.09 ? 418  ILE A N   1 
ATOM   2570  C  CA  . ILE A  1 336 ? -13.284 73.868   84.969  1.00 26.31 ? 418  ILE A CA  1 
ATOM   2571  C  C   . ILE A  1 336 ? -14.138 73.741   86.216  1.00 25.08 ? 418  ILE A C   1 
ATOM   2572  O  O   . ILE A  1 336 ? -14.967 74.593   86.500  1.00 23.18 ? 418  ILE A O   1 
ATOM   2573  C  CB  . ILE A  1 336 ? -12.269 74.993   85.156  1.00 26.59 ? 418  ILE A CB  1 
ATOM   2574  C  CG1 . ILE A  1 336 ? -11.311 74.993   83.963  1.00 26.14 ? 418  ILE A CG1 1 
ATOM   2575  C  CG2 . ILE A  1 336 ? -11.531 74.823   86.475  1.00 25.65 ? 418  ILE A CG2 1 
ATOM   2576  C  CD1 . ILE A  1 336 ? -10.374 76.158   83.927  1.00 24.84 ? 418  ILE A CD1 1 
ATOM   2577  N  N   . ARG A  1 337 ? -13.917 72.654   86.946  1.00 24.74 ? 419  ARG A N   1 
ATOM   2578  C  CA  . ARG A  1 337 ? -14.644 72.333   88.171  1.00 23.47 ? 419  ARG A CA  1 
ATOM   2579  C  C   . ARG A  1 337 ? -14.104 73.053   89.381  1.00 21.01 ? 419  ARG A C   1 
ATOM   2580  O  O   . ARG A  1 337 ? -12.939 72.918   89.723  1.00 23.16 ? 419  ARG A O   1 
ATOM   2581  C  CB  . ARG A  1 337 ? -14.539 70.837   88.459  1.00 26.62 ? 419  ARG A CB  1 
ATOM   2582  C  CG  . ARG A  1 337 ? -15.819 70.075   88.343  1.00 29.01 ? 419  ARG A CG  1 
ATOM   2583  C  CD  . ARG A  1 337 ? -16.441 69.766   89.687  1.00 28.78 ? 419  ARG A CD  1 
ATOM   2584  N  NE  . ARG A  1 337 ? -17.711 69.084   89.446  1.00 32.07 ? 419  ARG A NE  1 
ATOM   2585  C  CZ  . ARG A  1 337 ? -17.830 67.808   89.096  1.00 31.10 ? 419  ARG A CZ  1 
ATOM   2586  N  NH1 . ARG A  1 337 ? -16.756 67.039   88.961  1.00 30.27 ? 419  ARG A NH1 1 
ATOM   2587  N  NH2 . ARG A  1 337 ? -19.030 67.316   88.828  1.00 32.94 ? 419  ARG A NH2 1 
ATOM   2588  N  N   . PRO A  1 338 ? -14.939 73.835   90.051  1.00 18.83 ? 420  PRO A N   1 
ATOM   2589  C  CA  . PRO A  1 338 ? -14.376 74.497   91.224  1.00 16.95 ? 420  PRO A CA  1 
ATOM   2590  C  C   . PRO A  1 338 ? -14.569 73.587   92.434  1.00 16.43 ? 420  PRO A C   1 
ATOM   2591  O  O   . PRO A  1 338 ? -15.631 73.005   92.601  1.00 16.79 ? 420  PRO A O   1 
ATOM   2592  C  CB  . PRO A  1 338 ? -15.211 75.769   91.322  1.00 16.24 ? 420  PRO A CB  1 
ATOM   2593  C  CG  . PRO A  1 338 ? -16.554 75.306   90.855  1.00 15.80 ? 420  PRO A CG  1 
ATOM   2594  C  CD  . PRO A  1 338 ? -16.212 74.456   89.644  1.00 16.59 ? 420  PRO A CD  1 
ATOM   2595  N  N   . CYS A  1 339 ? -13.547 73.429   93.263  1.00 17.28 ? 421  CYS A N   1 
ATOM   2596  C  CA  . CYS A  1 339 ? -13.689 72.613   94.473  1.00 16.54 ? 421  CYS A CA  1 
ATOM   2597  C  C   . CYS A  1 339 ? -12.943 73.312   95.612  1.00 15.40 ? 421  CYS A C   1 
ATOM   2598  O  O   . CYS A  1 339 ? -12.239 74.304   95.405  1.00 15.83 ? 421  CYS A O   1 
ATOM   2599  C  CB  . CYS A  1 339 ? -13.115 71.201   94.287  1.00 18.52 ? 421  CYS A CB  1 
ATOM   2600  S  SG  . CYS A  1 339 ? -13.692 70.244   92.845  1.00 22.83 ? 421  CYS A SG  1 
ATOM   2601  N  N   . PHE A  1 340 ? -13.101 72.806   96.822  1.00 14.14 ? 422  PHE A N   1 
ATOM   2602  C  CA  . PHE A  1 340 ? -12.421 73.409   97.940  1.00 13.71 ? 422  PHE A CA  1 
ATOM   2603  C  C   . PHE A  1 340 ? -12.247 72.394   99.032  1.00 14.70 ? 422  PHE A C   1 
ATOM   2604  O  O   . PHE A  1 340 ? -12.929 71.371   99.060  1.00 17.16 ? 422  PHE A O   1 
ATOM   2605  C  CB  . PHE A  1 340 ? -13.200 74.621   98.454  1.00 14.63 ? 422  PHE A CB  1 
ATOM   2606  C  CG  . PHE A  1 340 ? -14.491 74.283   99.154  1.00 12.93 ? 422  PHE A CG  1 
ATOM   2607  C  CD1 . PHE A  1 340 ? -14.500 73.942   100.508 1.00 12.76 ? 422  PHE A CD1 1 
ATOM   2608  C  CD2 . PHE A  1 340 ? -15.708 74.356   98.472  1.00 12.72 ? 422  PHE A CD2 1 
ATOM   2609  C  CE1 . PHE A  1 340 ? -15.706 73.684   101.175 1.00 12.77 ? 422  PHE A CE1 1 
ATOM   2610  C  CE2 . PHE A  1 340 ? -16.920 74.100   99.127  1.00 12.57 ? 422  PHE A CE2 1 
ATOM   2611  C  CZ  . PHE A  1 340 ? -16.920 73.765   100.480 1.00 11.46 ? 422  PHE A CZ  1 
ATOM   2612  N  N   . TRP A  1 341 ? -11.311 72.674   99.923  1.00 13.50 ? 423  TRP A N   1 
ATOM   2613  C  CA  . TRP A  1 341 ? -11.036 71.787   101.031 1.00 13.17 ? 423  TRP A CA  1 
ATOM   2614  C  C   . TRP A  1 341 ? -11.074 72.630   102.280 1.00 13.56 ? 423  TRP A C   1 
ATOM   2615  O  O   . TRP A  1 341 ? -10.916 73.853   102.228 1.00 14.28 ? 423  TRP A O   1 
ATOM   2616  C  CB  . TRP A  1 341 ? -9.649  71.149   100.883 1.00 11.25 ? 423  TRP A CB  1 
ATOM   2617  C  CG  . TRP A  1 341 ? -8.573  72.147   100.573 1.00 9.92  ? 423  TRP A CG  1 
ATOM   2618  C  CD1 . TRP A  1 341 ? -8.129  72.523   99.338  1.00 9.36  ? 423  TRP A CD1 1 
ATOM   2619  C  CD2 . TRP A  1 341 ? -7.844  72.924   101.512 1.00 8.38  ? 423  TRP A CD2 1 
ATOM   2620  N  NE1 . TRP A  1 341 ? -7.166  73.490   99.451  1.00 7.83  ? 423  TRP A NE1 1 
ATOM   2621  C  CE2 . TRP A  1 341 ? -6.970  73.756   100.782 1.00 9.74  ? 423  TRP A CE2 1 
ATOM   2622  C  CE3 . TRP A  1 341 ? -7.840  73.001   102.908 1.00 10.07 ? 423  TRP A CE3 1 
ATOM   2623  C  CZ2 . TRP A  1 341 ? -6.095  74.653   101.399 1.00 11.60 ? 423  TRP A CZ2 1 
ATOM   2624  C  CZ3 . TRP A  1 341 ? -6.969  73.892   103.528 1.00 12.49 ? 423  TRP A CZ3 1 
ATOM   2625  C  CH2 . TRP A  1 341 ? -6.108  74.707   102.770 1.00 13.19 ? 423  TRP A CH2 1 
ATOM   2626  N  N   . VAL A  1 342 ? -11.289 71.971   103.406 1.00 13.28 ? 424  VAL A N   1 
ATOM   2627  C  CA  . VAL A  1 342 ? -11.333 72.668   104.670 1.00 13.49 ? 424  VAL A CA  1 
ATOM   2628  C  C   . VAL A  1 342 ? -10.533 71.862   105.671 1.00 13.57 ? 424  VAL A C   1 
ATOM   2629  O  O   . VAL A  1 342 ? -10.700 70.654   105.787 1.00 13.96 ? 424  VAL A O   1 
ATOM   2630  C  CB  . VAL A  1 342 ? -12.781 72.840   105.170 1.00 12.41 ? 424  VAL A CB  1 
ATOM   2631  C  CG1 . VAL A  1 342 ? -12.789 73.695   106.423 1.00 11.02 ? 424  VAL A CG1 1 
ATOM   2632  C  CG2 . VAL A  1 342 ? -13.633 73.478   104.086 1.00 10.42 ? 424  VAL A CG2 1 
ATOM   2633  N  N   . GLU A  1 343 ? -9.641  72.545   106.368 1.00 15.23 ? 425  GLU A N   1 
ATOM   2634  C  CA  . GLU A  1 343 ? -8.790  71.932   107.373 1.00 16.80 ? 425  GLU A CA  1 
ATOM   2635  C  C   . GLU A  1 343 ? -9.560  72.003   108.682 1.00 16.88 ? 425  GLU A C   1 
ATOM   2636  O  O   . GLU A  1 343 ? -10.038 73.065   109.072 1.00 16.11 ? 425  GLU A O   1 
ATOM   2637  C  CB  . GLU A  1 343 ? -7.476  72.717   107.467 1.00 17.91 ? 425  GLU A CB  1 
ATOM   2638  C  CG  . GLU A  1 343 ? -6.592  72.362   108.641 1.00 18.50 ? 425  GLU A CG  1 
ATOM   2639  C  CD  . GLU A  1 343 ? -5.441  73.339   108.796 1.00 20.06 ? 425  GLU A CD  1 
ATOM   2640  O  OE1 . GLU A  1 343 ? -5.698  74.554   108.895 1.00 18.38 ? 425  GLU A OE1 1 
ATOM   2641  O  OE2 . GLU A  1 343 ? -4.279  72.896   108.824 1.00 21.97 ? 425  GLU A OE2 1 
ATOM   2642  N  N   . LEU A  1 344 ? -9.712  70.865   109.347 1.00 17.68 ? 426  LEU A N   1 
ATOM   2643  C  CA  . LEU A  1 344 ? -10.440 70.843   110.603 1.00 17.72 ? 426  LEU A CA  1 
ATOM   2644  C  C   . LEU A  1 344 ? -9.392  70.748   111.694 1.00 18.71 ? 426  LEU A C   1 
ATOM   2645  O  O   . LEU A  1 344 ? -8.889  69.669   112.004 1.00 20.43 ? 426  LEU A O   1 
ATOM   2646  C  CB  . LEU A  1 344 ? -11.406 69.657   110.621 1.00 16.91 ? 426  LEU A CB  1 
ATOM   2647  C  CG  . LEU A  1 344 ? -12.377 69.670   109.422 1.00 17.73 ? 426  LEU A CG  1 
ATOM   2648  C  CD1 . LEU A  1 344 ? -13.382 68.530   109.542 1.00 17.26 ? 426  LEU A CD1 1 
ATOM   2649  C  CD2 . LEU A  1 344 ? -13.111 71.007   109.369 1.00 14.68 ? 426  LEU A CD2 1 
ATOM   2650  N  N   . ILE A  1 345 ? -9.061  71.902   112.262 1.00 17.66 ? 427  ILE A N   1 
ATOM   2651  C  CA  . ILE A  1 345 ? -8.037  71.993   113.284 1.00 17.50 ? 427  ILE A CA  1 
ATOM   2652  C  C   . ILE A  1 345 ? -8.429  71.593   114.697 1.00 17.15 ? 427  ILE A C   1 
ATOM   2653  O  O   . ILE A  1 345 ? -9.353  72.146   115.274 1.00 16.08 ? 427  ILE A O   1 
ATOM   2654  C  CB  . ILE A  1 345 ? -7.448  73.418   113.327 1.00 17.33 ? 427  ILE A CB  1 
ATOM   2655  C  CG1 . ILE A  1 345 ? -6.897  73.789   111.951 1.00 17.55 ? 427  ILE A CG1 1 
ATOM   2656  C  CG2 . ILE A  1 345 ? -6.339  73.495   114.352 1.00 16.36 ? 427  ILE A CG2 1 
ATOM   2657  C  CD1 . ILE A  1 345 ? -6.297  75.174   111.889 1.00 19.05 ? 427  ILE A CD1 1 
ATOM   2658  N  N   . ARG A  1 346 ? -7.694  70.629   115.245 1.00 17.86 ? 428  ARG A N   1 
ATOM   2659  C  CA  . ARG A  1 346 ? -7.918  70.161   116.605 1.00 17.60 ? 428  ARG A CA  1 
ATOM   2660  C  C   . ARG A  1 346 ? -6.656  70.406   117.435 1.00 18.45 ? 428  ARG A C   1 
ATOM   2661  O  O   . ARG A  1 346 ? -5.532  70.460   116.905 1.00 17.30 ? 428  ARG A O   1 
ATOM   2662  C  CB  . ARG A  1 346 ? -8.256  68.666   116.625 1.00 18.58 ? 428  ARG A CB  1 
ATOM   2663  C  CG  . ARG A  1 346 ? -9.504  68.275   115.831 1.00 19.23 ? 428  ARG A CG  1 
ATOM   2664  C  CD  . ARG A  1 346 ? -10.722 69.118   116.229 1.00 19.04 ? 428  ARG A CD  1 
ATOM   2665  N  NE  . ARG A  1 346 ? -11.083 68.979   117.638 1.00 16.43 ? 428  ARG A NE  1 
ATOM   2666  C  CZ  . ARG A  1 346 ? -11.849 68.007   118.126 1.00 17.52 ? 428  ARG A CZ  1 
ATOM   2667  N  NH1 . ARG A  1 346 ? -12.119 67.964   119.426 1.00 17.41 ? 428  ARG A NH1 1 
ATOM   2668  N  NH2 . ARG A  1 346 ? -12.354 67.085   117.319 1.00 16.17 ? 428  ARG A NH2 1 
ATOM   2669  N  N   . GLY A  1 347 ? -6.852  70.569   118.738 1.00 18.84 ? 429  GLY A N   1 
ATOM   2670  C  CA  . GLY A  1 347 ? -5.734  70.793   119.630 1.00 18.83 ? 429  GLY A CA  1 
ATOM   2671  C  C   . GLY A  1 347 ? -5.511  72.257   119.922 1.00 19.56 ? 429  GLY A C   1 
ATOM   2672  O  O   . GLY A  1 347 ? -6.453  73.036   119.992 1.00 19.82 ? 429  GLY A O   1 
ATOM   2673  N  N   . ARG A  1 348 ? -4.248  72.632   120.083 1.00 20.72 ? 430  ARG A N   1 
ATOM   2674  C  CA  . ARG A  1 348 ? -3.889  74.006   120.382 1.00 20.89 ? 430  ARG A CA  1 
ATOM   2675  C  C   . ARG A  1 348 ? -4.191  74.958   119.220 1.00 21.87 ? 430  ARG A C   1 
ATOM   2676  O  O   . ARG A  1 348 ? -4.218  74.552   118.056 1.00 22.29 ? 430  ARG A O   1 
ATOM   2677  C  CB  . ARG A  1 348 ? -2.405  74.049   120.772 1.00 20.70 ? 430  ARG A CB  1 
ATOM   2678  C  CG  . ARG A  1 348 ? -2.156  73.333   122.096 1.00 22.21 ? 430  ARG A CG  1 
ATOM   2679  C  CD  . ARG A  1 348 ? -0.709  72.985   122.355 1.00 22.37 ? 430  ARG A CD  1 
ATOM   2680  N  NE  . ARG A  1 348 ? 0.160   74.153   122.366 1.00 25.72 ? 430  ARG A NE  1 
ATOM   2681  C  CZ  . ARG A  1 348 ? 1.461   74.105   122.644 1.00 25.92 ? 430  ARG A CZ  1 
ATOM   2682  N  NH1 . ARG A  1 348 ? 2.030   72.945   122.941 1.00 27.86 ? 430  ARG A NH1 1 
ATOM   2683  N  NH2 . ARG A  1 348 ? 2.202   75.205   122.597 1.00 26.20 ? 430  ARG A NH2 1 
ATOM   2684  N  N   . PRO A  1 349 ? -4.465  76.235   119.531 1.00 22.12 ? 431  PRO A N   1 
ATOM   2685  C  CA  . PRO A  1 349 ? -4.468  76.801   120.887 1.00 22.59 ? 431  PRO A CA  1 
ATOM   2686  C  C   . PRO A  1 349 ? -5.815  76.709   121.614 1.00 23.91 ? 431  PRO A C   1 
ATOM   2687  O  O   . PRO A  1 349 ? -5.903  77.018   122.798 1.00 24.32 ? 431  PRO A O   1 
ATOM   2688  C  CB  . PRO A  1 349 ? -4.080  78.246   120.646 1.00 21.88 ? 431  PRO A CB  1 
ATOM   2689  C  CG  . PRO A  1 349 ? -4.831  78.549   119.366 1.00 21.49 ? 431  PRO A CG  1 
ATOM   2690  C  CD  . PRO A  1 349 ? -4.567  77.308   118.518 1.00 21.18 ? 431  PRO A CD  1 
ATOM   2691  N  N   . LYS A  1 350 ? -6.851  76.271   120.912 1.00 24.44 ? 432  LYS A N   1 
ATOM   2692  C  CA  . LYS A  1 350 ? -8.186  76.212   121.495 1.00 25.82 ? 432  LYS A CA  1 
ATOM   2693  C  C   . LYS A  1 350 ? -8.520  75.047   122.403 1.00 25.73 ? 432  LYS A C   1 
ATOM   2694  O  O   . LYS A  1 350 ? -9.544  75.081   123.083 1.00 25.73 ? 432  LYS A O   1 
ATOM   2695  C  CB  . LYS A  1 350 ? -9.234  76.270   120.383 1.00 26.28 ? 432  LYS A CB  1 
ATOM   2696  C  CG  . LYS A  1 350 ? -9.197  77.536   119.576 1.00 26.31 ? 432  LYS A CG  1 
ATOM   2697  C  CD  . LYS A  1 350 ? -9.556  78.722   120.435 1.00 27.72 ? 432  LYS A CD  1 
ATOM   2698  C  CE  . LYS A  1 350 ? -9.543  79.996   119.626 1.00 27.99 ? 432  LYS A CE  1 
ATOM   2699  N  NZ  . LYS A  1 350 ? -9.936  81.145   120.483 1.00 31.70 ? 432  LYS A NZ  1 
ATOM   2700  N  N   . GLU A  1 351 ? -7.685  74.014   122.413 1.00 26.06 ? 433  GLU A N   1 
ATOM   2701  C  CA  . GLU A  1 351 ? -7.963  72.846   123.244 1.00 25.41 ? 433  GLU A CA  1 
ATOM   2702  C  C   . GLU A  1 351 ? -6.788  72.485   124.140 1.00 26.03 ? 433  GLU A C   1 
ATOM   2703  O  O   . GLU A  1 351 ? -5.640  72.786   123.829 1.00 25.22 ? 433  GLU A O   1 
ATOM   2704  C  CB  . GLU A  1 351 ? -8.365  71.669   122.353 1.00 23.84 ? 433  GLU A CB  1 
ATOM   2705  C  CG  . GLU A  1 351 ? -9.670  71.927   121.617 1.00 24.15 ? 433  GLU A CG  1 
ATOM   2706  C  CD  . GLU A  1 351 ? -10.027 70.857   120.599 1.00 26.36 ? 433  GLU A CD  1 
ATOM   2707  O  OE1 . GLU A  1 351 ? -9.403  70.833   119.513 1.00 26.57 ? 433  GLU A OE1 1 
ATOM   2708  O  OE2 . GLU A  1 351 ? -10.934 70.043   120.886 1.00 25.22 ? 433  GLU A OE2 1 
ATOM   2709  N  N   . SER A  1 352 ? -7.089  71.840   125.260 1.00 27.33 ? 435  SER A N   1 
ATOM   2710  C  CA  . SER A  1 352 ? -6.071  71.476   126.235 1.00 27.64 ? 435  SER A CA  1 
ATOM   2711  C  C   . SER A  1 352 ? -5.249  70.243   125.894 1.00 26.78 ? 435  SER A C   1 
ATOM   2712  O  O   . SER A  1 352 ? -5.234  69.264   126.646 1.00 28.01 ? 435  SER A O   1 
ATOM   2713  C  CB  . SER A  1 352 ? -6.714  71.306   127.619 1.00 29.75 ? 435  SER A CB  1 
ATOM   2714  O  OG  . SER A  1 352 ? -7.771  70.358   127.575 1.00 33.80 ? 435  SER A OG  1 
ATOM   2715  N  N   . THR A  1 353 ? -4.556  70.296   124.764 1.00 24.65 ? 436  THR A N   1 
ATOM   2716  C  CA  . THR A  1 353 ? -3.698  69.196   124.343 1.00 22.35 ? 436  THR A CA  1 
ATOM   2717  C  C   . THR A  1 353 ? -2.312  69.810   124.266 1.00 20.85 ? 436  THR A C   1 
ATOM   2718  O  O   . THR A  1 353 ? -2.140  70.958   124.663 1.00 21.39 ? 436  THR A O   1 
ATOM   2719  C  CB  . THR A  1 353 ? -4.098  68.659   122.949 1.00 21.95 ? 436  THR A CB  1 
ATOM   2720  O  OG1 . THR A  1 353 ? -3.913  69.683   121.965 1.00 22.29 ? 436  THR A OG1 1 
ATOM   2721  C  CG2 . THR A  1 353 ? -5.549  68.224   122.947 1.00 20.42 ? 436  THR A CG2 1 
ATOM   2722  N  N   . ILE A  1 354 ? -1.327  69.066   123.777 1.00 19.20 ? 437  ILE A N   1 
ATOM   2723  C  CA  . ILE A  1 354 ? 0.018   69.612   123.654 1.00 18.60 ? 437  ILE A CA  1 
ATOM   2724  C  C   . ILE A  1 354 ? 0.352   69.696   122.189 1.00 19.20 ? 437  ILE A C   1 
ATOM   2725  O  O   . ILE A  1 354 ? 1.455   70.091   121.822 1.00 19.45 ? 437  ILE A O   1 
ATOM   2726  C  CB  . ILE A  1 354 ? 1.099   68.712   124.285 1.00 19.53 ? 437  ILE A CB  1 
ATOM   2727  C  CG1 . ILE A  1 354 ? 1.195   67.397   123.500 1.00 19.45 ? 437  ILE A CG1 1 
ATOM   2728  C  CG2 . ILE A  1 354 ? 0.796   68.484   125.752 1.00 18.72 ? 437  ILE A CG2 1 
ATOM   2729  C  CD1 . ILE A  1 354 ? 2.334   66.498   123.918 1.00 19.87 ? 437  ILE A CD1 1 
ATOM   2730  N  N   . TRP A  1 355 ? -0.603  69.315   121.348 1.00 19.30 ? 438  TRP A N   1 
ATOM   2731  C  CA  . TRP A  1 355 ? -0.379  69.316   119.908 1.00 18.85 ? 438  TRP A CA  1 
ATOM   2732  C  C   . TRP A  1 355 ? -1.463  70.015   119.105 1.00 18.65 ? 438  TRP A C   1 
ATOM   2733  O  O   . TRP A  1 355 ? -2.491  70.442   119.639 1.00 17.02 ? 438  TRP A O   1 
ATOM   2734  C  CB  . TRP A  1 355 ? -0.277  67.880   119.406 1.00 19.25 ? 438  TRP A CB  1 
ATOM   2735  C  CG  . TRP A  1 355 ? -1.431  67.050   119.873 1.00 18.95 ? 438  TRP A CG  1 
ATOM   2736  C  CD1 . TRP A  1 355 ? -1.539  66.414   121.067 1.00 17.94 ? 438  TRP A CD1 1 
ATOM   2737  C  CD2 . TRP A  1 355 ? -2.668  66.831   119.184 1.00 18.77 ? 438  TRP A CD2 1 
ATOM   2738  N  NE1 . TRP A  1 355 ? -2.764  65.807   121.173 1.00 19.01 ? 438  TRP A NE1 1 
ATOM   2739  C  CE2 . TRP A  1 355 ? -3.481  66.043   120.025 1.00 19.05 ? 438  TRP A CE2 1 
ATOM   2740  C  CE3 . TRP A  1 355 ? -3.171  67.216   117.932 1.00 18.54 ? 438  TRP A CE3 1 
ATOM   2741  C  CZ2 . TRP A  1 355 ? -4.774  65.640   119.667 1.00 18.18 ? 438  TRP A CZ2 1 
ATOM   2742  C  CZ3 . TRP A  1 355 ? -4.455  66.816   117.573 1.00 19.14 ? 438  TRP A CZ3 1 
ATOM   2743  C  CH2 . TRP A  1 355 ? -5.239  66.030   118.438 1.00 18.45 ? 438  TRP A CH2 1 
ATOM   2744  N  N   . THR A  1 356 ? -1.220  70.090   117.801 1.00 17.76 ? 439  THR A N   1 
ATOM   2745  C  CA  . THR A  1 356 ? -2.135  70.714   116.868 1.00 18.10 ? 439  THR A CA  1 
ATOM   2746  C  C   . THR A  1 356 ? -2.050  70.021   115.527 1.00 18.32 ? 439  THR A C   1 
ATOM   2747  O  O   . THR A  1 356 ? -0.987  69.941   114.929 1.00 21.07 ? 439  THR A O   1 
ATOM   2748  C  CB  . THR A  1 356 ? -1.794  72.205   116.668 1.00 18.22 ? 439  THR A CB  1 
ATOM   2749  O  OG1 . THR A  1 356 ? -2.055  72.915   117.885 1.00 20.68 ? 439  THR A OG1 1 
ATOM   2750  C  CG2 . THR A  1 356 ? -2.635  72.805   115.547 1.00 16.02 ? 439  THR A CG2 1 
ATOM   2751  N  N   . SER A  1 357 ? -3.168  69.505   115.054 1.00 18.02 ? 440  SER A N   1 
ATOM   2752  C  CA  . SER A  1 357 ? -3.179  68.850   113.757 1.00 18.18 ? 440  SER A CA  1 
ATOM   2753  C  C   . SER A  1 357 ? -4.566  69.039   113.197 1.00 17.58 ? 440  SER A C   1 
ATOM   2754  O  O   . SER A  1 357 ? -5.473  69.446   113.926 1.00 18.60 ? 440  SER A O   1 
ATOM   2755  C  CB  . SER A  1 357 ? -2.869  67.359   113.893 1.00 18.66 ? 440  SER A CB  1 
ATOM   2756  O  OG  . SER A  1 357 ? -2.715  66.768   112.610 1.00 19.99 ? 440  SER A OG  1 
ATOM   2757  N  N   . GLY A  1 358 ? -4.745  68.754   111.914 1.00 17.06 ? 441  GLY A N   1 
ATOM   2758  C  CA  . GLY A  1 358 ? -6.064  68.922   111.338 1.00 18.20 ? 441  GLY A CA  1 
ATOM   2759  C  C   . GLY A  1 358 ? -6.520  67.834   110.388 1.00 19.74 ? 441  GLY A C   1 
ATOM   2760  O  O   . GLY A  1 358 ? -5.706  67.150   109.761 1.00 21.13 ? 441  GLY A O   1 
ATOM   2761  N  N   . SER A  1 359 ? -7.836  67.656   110.304 1.00 19.55 ? 442  SER A N   1 
ATOM   2762  C  CA  . SER A  1 359 ? -8.427  66.690   109.388 1.00 18.91 ? 442  SER A CA  1 
ATOM   2763  C  C   . SER A  1 359 ? -8.793  67.515   108.175 1.00 18.93 ? 442  SER A C   1 
ATOM   2764  O  O   . SER A  1 359 ? -8.710  68.744   108.209 1.00 19.03 ? 442  SER A O   1 
ATOM   2765  C  CB  . SER A  1 359 ? -9.715  66.092   109.945 1.00 18.22 ? 442  SER A CB  1 
ATOM   2766  O  OG  . SER A  1 359 ? -9.460  65.191   110.989 1.00 23.88 ? 442  SER A OG  1 
ATOM   2767  N  N   . SER A  1 360 ? -9.211  66.846   107.110 1.00 18.73 ? 443  SER A N   1 
ATOM   2768  C  CA  . SER A  1 360 ? -9.617  67.550   105.914 1.00 19.60 ? 443  SER A CA  1 
ATOM   2769  C  C   . SER A  1 360 ? -10.897 66.949   105.365 1.00 19.90 ? 443  SER A C   1 
ATOM   2770  O  O   . SER A  1 360 ? -11.216 65.786   105.619 1.00 20.46 ? 443  SER A O   1 
ATOM   2771  C  CB  . SER A  1 360 ? -8.516  67.518   104.836 1.00 19.86 ? 443  SER A CB  1 
ATOM   2772  O  OG  . SER A  1 360 ? -8.214  66.205   104.387 1.00 21.33 ? 443  SER A OG  1 
ATOM   2773  N  N   . ILE A  1 361 ? -11.639 67.789   104.655 1.00 18.07 ? 444  ILE A N   1 
ATOM   2774  C  CA  . ILE A  1 361 ? -12.871 67.425   103.995 1.00 17.10 ? 444  ILE A CA  1 
ATOM   2775  C  C   . ILE A  1 361 ? -12.796 68.296   102.758 1.00 16.34 ? 444  ILE A C   1 
ATOM   2776  O  O   . ILE A  1 361 ? -12.156 69.340   102.773 1.00 16.77 ? 444  ILE A O   1 
ATOM   2777  C  CB  . ILE A  1 361 ? -14.129 67.797   104.818 1.00 17.84 ? 444  ILE A CB  1 
ATOM   2778  C  CG1 . ILE A  1 361 ? -14.095 69.280   105.200 1.00 18.29 ? 444  ILE A CG1 1 
ATOM   2779  C  CG2 . ILE A  1 361 ? -14.229 66.905   106.043 1.00 17.80 ? 444  ILE A CG2 1 
ATOM   2780  C  CD1 . ILE A  1 361 ? -15.338 69.750   105.939 1.00 19.14 ? 444  ILE A CD1 1 
ATOM   2781  N  N   . SER A  1 362 ? -13.429 67.868   101.683 1.00 16.29 ? 445  SER A N   1 
ATOM   2782  C  CA  . SER A  1 362 ? -13.395 68.632   100.456 1.00 15.72 ? 445  SER A CA  1 
ATOM   2783  C  C   . SER A  1 362 ? -14.728 68.488   99.775  1.00 16.01 ? 445  SER A C   1 
ATOM   2784  O  O   . SER A  1 362 ? -15.429 67.494   99.975  1.00 15.79 ? 445  SER A O   1 
ATOM   2785  C  CB  . SER A  1 362 ? -12.314 68.085   99.542  1.00 18.23 ? 445  SER A CB  1 
ATOM   2786  O  OG  . SER A  1 362 ? -12.636 66.756   99.166  1.00 19.60 ? 445  SER A OG  1 
ATOM   2787  N  N   . PHE A  1 363 ? -15.069 69.475   98.957  1.00 16.34 ? 446  PHE A N   1 
ATOM   2788  C  CA  . PHE A  1 363 ? -16.333 69.464   98.237  1.00 16.54 ? 446  PHE A CA  1 
ATOM   2789  C  C   . PHE A  1 363 ? -16.081 69.906   96.810  1.00 17.38 ? 446  PHE A C   1 
ATOM   2790  O  O   . PHE A  1 363 ? -15.033 70.483   96.525  1.00 16.87 ? 446  PHE A O   1 
ATOM   2791  C  CB  . PHE A  1 363 ? -17.320 70.423   98.903  1.00 15.04 ? 446  PHE A CB  1 
ATOM   2792  C  CG  . PHE A  1 363 ? -17.615 70.093   100.335 1.00 14.75 ? 446  PHE A CG  1 
ATOM   2793  C  CD1 . PHE A  1 363 ? -16.661 70.298   101.325 1.00 13.67 ? 446  PHE A CD1 1 
ATOM   2794  C  CD2 . PHE A  1 363 ? -18.854 69.577   100.695 1.00 14.77 ? 446  PHE A CD2 1 
ATOM   2795  C  CE1 . PHE A  1 363 ? -16.934 69.994   102.657 1.00 15.11 ? 446  PHE A CE1 1 
ATOM   2796  C  CE2 . PHE A  1 363 ? -19.137 69.269   102.018 1.00 15.25 ? 446  PHE A CE2 1 
ATOM   2797  C  CZ  . PHE A  1 363 ? -18.174 69.477   103.006 1.00 14.72 ? 446  PHE A CZ  1 
ATOM   2798  N  N   . CYS A  1 364 ? -17.020 69.626   95.910  1.00 18.24 ? 447  CYS A N   1 
ATOM   2799  C  CA  . CYS A  1 364 ? -16.855 70.067   94.532  1.00 21.98 ? 447  CYS A CA  1 
ATOM   2800  C  C   . CYS A  1 364 ? -18.106 70.727   93.963  1.00 22.68 ? 447  CYS A C   1 
ATOM   2801  O  O   . CYS A  1 364 ? -19.214 70.500   94.451  1.00 22.53 ? 447  CYS A O   1 
ATOM   2802  C  CB  . CYS A  1 364 ? -16.413 68.911   93.631  1.00 22.15 ? 447  CYS A CB  1 
ATOM   2803  S  SG  . CYS A  1 364 ? -14.608 68.565   93.596  1.00 32.47 ? 447  CYS A SG  1 
ATOM   2804  N  N   . GLY A  1 365 ? -17.888 71.555   92.939  1.00 22.96 ? 448  GLY A N   1 
ATOM   2805  C  CA  . GLY A  1 365 ? -18.934 72.291   92.244  1.00 23.67 ? 448  GLY A CA  1 
ATOM   2806  C  C   . GLY A  1 365 ? -20.295 71.647   92.127  1.00 24.44 ? 448  GLY A C   1 
ATOM   2807  O  O   . GLY A  1 365 ? -21.045 71.682   93.087  1.00 27.79 ? 448  GLY A O   1 
ATOM   2808  N  N   . VAL A  1 366 ? -20.645 71.108   90.961  1.00 24.42 ? 449  VAL A N   1 
ATOM   2809  C  CA  . VAL A  1 366 ? -21.948 70.440   90.778  1.00 25.78 ? 449  VAL A CA  1 
ATOM   2810  C  C   . VAL A  1 366 ? -23.209 71.255   90.382  1.00 27.00 ? 449  VAL A C   1 
ATOM   2811  O  O   . VAL A  1 366 ? -23.543 72.277   90.987  1.00 25.47 ? 449  VAL A O   1 
ATOM   2812  C  CB  . VAL A  1 366 ? -22.279 69.583   92.034  1.00 24.31 ? 449  VAL A CB  1 
ATOM   2813  C  CG1 . VAL A  1 366 ? -23.747 69.223   92.081  1.00 24.21 ? 449  VAL A CG1 1 
ATOM   2814  C  CG2 . VAL A  1 366 ? -21.434 68.325   92.017  1.00 24.08 ? 449  VAL A CG2 1 
ATOM   2815  N  N   . ASN A  1 367 ? -23.907 70.750   89.363  1.00 29.83 ? 450  ASN A N   1 
ATOM   2816  C  CA  . ASN A  1 367 ? -25.139 71.340   88.825  1.00 32.86 ? 450  ASN A CA  1 
ATOM   2817  C  C   . ASN A  1 367 ? -26.336 70.858   89.637  1.00 32.63 ? 450  ASN A C   1 
ATOM   2818  O  O   . ASN A  1 367 ? -27.240 71.623   89.951  1.00 34.44 ? 450  ASN A O   1 
ATOM   2819  C  CB  . ASN A  1 367 ? -25.369 70.884   87.382  1.00 36.10 ? 450  ASN A CB  1 
ATOM   2820  C  CG  . ASN A  1 367 ? -24.286 71.342   86.435  1.00 40.77 ? 450  ASN A CG  1 
ATOM   2821  O  OD1 . ASN A  1 367 ? -23.100 71.368   86.784  1.00 46.35 ? 450  ASN A OD1 1 
ATOM   2822  N  ND2 . ASN A  1 367 ? -24.683 71.688   85.210  1.00 41.85 ? 450  ASN A ND2 1 
ATOM   2823  N  N   . SER A  1 368 ? -26.349 69.564   89.935  1.00 32.34 ? 451  SER A N   1 
ATOM   2824  C  CA  . SER A  1 368 ? -27.421 68.938   90.702  1.00 30.95 ? 451  SER A CA  1 
ATOM   2825  C  C   . SER A  1 368 ? -27.494 69.609   92.059  1.00 30.73 ? 451  SER A C   1 
ATOM   2826  O  O   . SER A  1 368 ? -26.785 70.585   92.289  1.00 29.97 ? 451  SER A O   1 
ATOM   2827  C  CB  . SER A  1 368 ? -27.106 67.462   90.859  1.00 30.97 ? 451  SER A CB  1 
ATOM   2828  O  OG  . SER A  1 368 ? -25.735 67.292   91.153  1.00 28.69 ? 451  SER A OG  1 
ATOM   2829  N  N   . ASP A  1 369 ? -28.333 69.129   92.971  1.00 31.02 ? 452  ASP A N   1 
ATOM   2830  C  CA  . ASP A  1 369 ? -28.336 69.820   94.249  1.00 33.13 ? 452  ASP A CA  1 
ATOM   2831  C  C   . ASP A  1 369 ? -27.670 69.086   95.374  1.00 31.63 ? 452  ASP A C   1 
ATOM   2832  O  O   . ASP A  1 369 ? -27.430 67.889   95.313  1.00 28.65 ? 452  ASP A O   1 
ATOM   2833  C  CB  . ASP A  1 369 ? -29.734 70.252   94.691  1.00 37.51 ? 452  ASP A CB  1 
ATOM   2834  C  CG  . ASP A  1 369 ? -29.711 71.577   95.479  1.00 41.11 ? 452  ASP A CG  1 
ATOM   2835  O  OD1 . ASP A  1 369 ? -29.266 72.610   94.904  1.00 42.14 ? 452  ASP A OD1 1 
ATOM   2836  O  OD2 . ASP A  1 369 ? -30.127 71.587   96.664  1.00 39.84 ? 452  ASP A OD2 1 
ATOM   2837  N  N   . THR A  1 370 ? -27.353 69.853   96.403  1.00 30.84 ? 453  THR A N   1 
ATOM   2838  C  CA  . THR A  1 370 ? -26.685 69.326   97.554  1.00 30.18 ? 453  THR A CA  1 
ATOM   2839  C  C   . THR A  1 370 ? -27.538 69.541   98.770  1.00 28.21 ? 453  THR A C   1 
ATOM   2840  O  O   . THR A  1 370 ? -28.744 69.740   98.668  1.00 28.70 ? 453  THR A O   1 
ATOM   2841  C  CB  . THR A  1 370 ? -25.345 70.028   97.775  1.00 33.45 ? 453  THR A CB  1 
ATOM   2842  O  OG1 . THR A  1 370 ? -24.679 70.204   96.517  1.00 32.58 ? 453  THR A OG1 1 
ATOM   2843  C  CG2 . THR A  1 370 ? -24.471 69.175   98.681  1.00 34.09 ? 453  THR A CG2 1 
ATOM   2844  N  N   . VAL A  1 371 ? -26.893 69.487   99.926  1.00 25.98 ? 454  VAL A N   1 
ATOM   2845  C  CA  . VAL A  1 371 ? -27.562 69.686   101.189 1.00 25.02 ? 454  VAL A CA  1 
ATOM   2846  C  C   . VAL A  1 371 ? -26.521 70.250   102.111 1.00 23.49 ? 454  VAL A C   1 
ATOM   2847  O  O   . VAL A  1 371 ? -25.339 69.924   101.991 1.00 23.85 ? 454  VAL A O   1 
ATOM   2848  C  CB  . VAL A  1 371 ? -28.033 68.372   101.826 1.00 25.74 ? 454  VAL A CB  1 
ATOM   2849  C  CG1 . VAL A  1 371 ? -29.173 68.663   102.785 1.00 26.76 ? 454  VAL A CG1 1 
ATOM   2850  C  CG2 . VAL A  1 371 ? -28.445 67.377   100.758 1.00 30.17 ? 454  VAL A CG2 1 
ATOM   2851  N  N   . GLY A  1 372 ? -26.950 71.112   103.018 1.00 21.31 ? 455  GLY A N   1 
ATOM   2852  C  CA  . GLY A  1 372 ? -26.012 71.651   103.971 1.00 20.87 ? 455  GLY A CA  1 
ATOM   2853  C  C   . GLY A  1 372 ? -25.999 70.643   105.101 1.00 20.33 ? 455  GLY A C   1 
ATOM   2854  O  O   . GLY A  1 372 ? -26.949 69.867   105.259 1.00 19.26 ? 455  GLY A O   1 
ATOM   2855  N  N   . TRP A  1 373 ? -24.927 70.625   105.876 1.00 19.36 ? 456  TRP A N   1 
ATOM   2856  C  CA  . TRP A  1 373 ? -24.849 69.708   107.002 1.00 19.67 ? 456  TRP A CA  1 
ATOM   2857  C  C   . TRP A  1 373 ? -23.599 70.031   107.791 1.00 20.69 ? 456  TRP A C   1 
ATOM   2858  O  O   . TRP A  1 373 ? -23.072 71.147   107.720 1.00 21.33 ? 456  TRP A O   1 
ATOM   2859  C  CB  . TRP A  1 373 ? -24.806 68.250   106.517 1.00 18.89 ? 456  TRP A CB  1 
ATOM   2860  C  CG  . TRP A  1 373 ? -25.293 67.260   107.555 1.00 19.69 ? 456  TRP A CG  1 
ATOM   2861  C  CD1 . TRP A  1 373 ? -26.308 67.449   108.451 1.00 18.04 ? 456  TRP A CD1 1 
ATOM   2862  C  CD2 . TRP A  1 373 ? -24.822 65.922   107.766 1.00 18.94 ? 456  TRP A CD2 1 
ATOM   2863  N  NE1 . TRP A  1 373 ? -26.498 66.323   109.203 1.00 17.73 ? 456  TRP A NE1 1 
ATOM   2864  C  CE2 . TRP A  1 373 ? -25.604 65.367   108.808 1.00 17.58 ? 456  TRP A CE2 1 
ATOM   2865  C  CE3 . TRP A  1 373 ? -23.823 65.137   107.175 1.00 17.62 ? 456  TRP A CE3 1 
ATOM   2866  C  CZ2 . TRP A  1 373 ? -25.413 64.061   109.276 1.00 16.83 ? 456  TRP A CZ2 1 
ATOM   2867  C  CZ3 . TRP A  1 373 ? -23.636 63.836   107.640 1.00 18.70 ? 456  TRP A CZ3 1 
ATOM   2868  C  CH2 . TRP A  1 373 ? -24.429 63.313   108.681 1.00 17.20 ? 456  TRP A CH2 1 
ATOM   2869  N  N   . SER A  1 374 ? -23.117 69.059   108.548 1.00 20.30 ? 457  SER A N   1 
ATOM   2870  C  CA  . SER A  1 374 ? -21.916 69.281   109.320 1.00 19.97 ? 457  SER A CA  1 
ATOM   2871  C  C   . SER A  1 374 ? -21.023 68.053   109.246 1.00 19.56 ? 457  SER A C   1 
ATOM   2872  O  O   . SER A  1 374 ? -21.395 66.969   109.682 1.00 21.21 ? 457  SER A O   1 
ATOM   2873  C  CB  . SER A  1 374 ? -22.278 69.601   110.772 1.00 19.58 ? 457  SER A CB  1 
ATOM   2874  O  OG  . SER A  1 374 ? -21.122 69.936   111.517 1.00 18.73 ? 457  SER A OG  1 
ATOM   2875  N  N   . TRP A  1 375 ? -19.851 68.234   108.661 1.00 19.65 ? 458  TRP A N   1 
ATOM   2876  C  CA  . TRP A  1 375 ? -18.875 67.170   108.536 1.00 19.92 ? 458  TRP A CA  1 
ATOM   2877  C  C   . TRP A  1 375 ? -17.661 67.595   109.351 1.00 20.59 ? 458  TRP A C   1 
ATOM   2878  O  O   . TRP A  1 375 ? -16.631 67.986   108.806 1.00 21.20 ? 458  TRP A O   1 
ATOM   2879  C  CB  . TRP A  1 375 ? -18.490 66.980   107.076 1.00 19.01 ? 458  TRP A CB  1 
ATOM   2880  C  CG  . TRP A  1 375 ? -19.546 66.306   106.273 1.00 18.87 ? 458  TRP A CG  1 
ATOM   2881  C  CD1 . TRP A  1 375 ? -19.728 64.960   106.119 1.00 18.95 ? 458  TRP A CD1 1 
ATOM   2882  C  CD2 . TRP A  1 375 ? -20.553 66.943   105.482 1.00 18.22 ? 458  TRP A CD2 1 
ATOM   2883  N  NE1 . TRP A  1 375 ? -20.784 64.718   105.269 1.00 18.34 ? 458  TRP A NE1 1 
ATOM   2884  C  CE2 . TRP A  1 375 ? -21.308 65.918   104.862 1.00 18.06 ? 458  TRP A CE2 1 
ATOM   2885  C  CE3 . TRP A  1 375 ? -20.892 68.283   105.232 1.00 18.65 ? 458  TRP A CE3 1 
ATOM   2886  C  CZ2 . TRP A  1 375 ? -22.385 66.191   104.005 1.00 18.41 ? 458  TRP A CZ2 1 
ATOM   2887  C  CZ3 . TRP A  1 375 ? -21.959 68.558   104.383 1.00 18.01 ? 458  TRP A CZ3 1 
ATOM   2888  C  CH2 . TRP A  1 375 ? -22.695 67.512   103.776 1.00 19.20 ? 458  TRP A CH2 1 
ATOM   2889  N  N   . PRO A  1 376 ? -17.780 67.531   110.681 1.00 20.79 ? 459  PRO A N   1 
ATOM   2890  C  CA  . PRO A  1 376 ? -16.714 67.904   111.597 1.00 21.31 ? 459  PRO A CA  1 
ATOM   2891  C  C   . PRO A  1 376 ? -15.632 66.848   111.700 1.00 24.23 ? 459  PRO A C   1 
ATOM   2892  O  O   . PRO A  1 376 ? -15.774 65.729   111.205 1.00 23.17 ? 459  PRO A O   1 
ATOM   2893  C  CB  . PRO A  1 376 ? -17.452 68.081   112.909 1.00 21.61 ? 459  PRO A CB  1 
ATOM   2894  C  CG  . PRO A  1 376 ? -18.458 66.987   112.835 1.00 20.22 ? 459  PRO A CG  1 
ATOM   2895  C  CD  . PRO A  1 376 ? -18.978 67.110   111.429 1.00 20.40 ? 459  PRO A CD  1 
ATOM   2896  N  N   . ASP A  1 377 ? -14.539 67.229   112.349 1.00 25.74 ? 460  ASP A N   1 
ATOM   2897  C  CA  . ASP A  1 377 ? -13.419 66.341   112.556 1.00 25.63 ? 460  ASP A CA  1 
ATOM   2898  C  C   . ASP A  1 377 ? -13.895 65.075   113.272 1.00 25.16 ? 460  ASP A C   1 
ATOM   2899  O  O   . ASP A  1 377 ? -13.702 63.973   112.773 1.00 26.37 ? 460  ASP A O   1 
ATOM   2900  C  CB  . ASP A  1 377 ? -12.357 67.066   113.366 1.00 27.88 ? 460  ASP A CB  1 
ATOM   2901  C  CG  . ASP A  1 377 ? -11.407 66.125   114.031 1.00 31.74 ? 460  ASP A CG  1 
ATOM   2902  O  OD1 . ASP A  1 377 ? -11.767 65.609   115.111 1.00 34.07 ? 460  ASP A OD1 1 
ATOM   2903  O  OD2 . ASP A  1 377 ? -10.311 65.894   113.471 1.00 32.87 ? 460  ASP A OD2 1 
ATOM   2904  N  N   . GLY A  1 378 ? -14.503 65.226   114.441 1.00 23.11 ? 461  GLY A N   1 
ATOM   2905  C  CA  . GLY A  1 378 ? -15.019 64.068   115.146 1.00 22.01 ? 461  GLY A CA  1 
ATOM   2906  C  C   . GLY A  1 378 ? -14.123 63.319   116.110 1.00 22.45 ? 461  GLY A C   1 
ATOM   2907  O  O   . GLY A  1 378 ? -14.481 62.236   116.563 1.00 23.56 ? 461  GLY A O   1 
ATOM   2908  N  N   . ALA A  1 379 ? -12.969 63.882   116.441 1.00 22.87 ? 462  ALA A N   1 
ATOM   2909  C  CA  . ALA A  1 379 ? -12.040 63.225   117.357 1.00 22.73 ? 462  ALA A CA  1 
ATOM   2910  C  C   . ALA A  1 379 ? -12.346 63.568   118.809 1.00 22.90 ? 462  ALA A C   1 
ATOM   2911  O  O   . ALA A  1 379 ? -12.806 64.668   119.111 1.00 23.64 ? 462  ALA A O   1 
ATOM   2912  C  CB  . ALA A  1 379 ? -10.610 63.627   117.018 1.00 21.12 ? 462  ALA A CB  1 
ATOM   2913  N  N   . GLU A  1 380 ? -12.096 62.623   119.707 1.00 23.23 ? 463  GLU A N   1 
ATOM   2914  C  CA  . GLU A  1 380 ? -12.337 62.852   121.124 1.00 25.54 ? 463  GLU A CA  1 
ATOM   2915  C  C   . GLU A  1 380 ? -11.056 63.312   121.790 1.00 24.17 ? 463  GLU A C   1 
ATOM   2916  O  O   . GLU A  1 380 ? -10.065 62.586   121.810 1.00 22.71 ? 463  GLU A O   1 
ATOM   2917  C  CB  . GLU A  1 380 ? -12.815 61.578   121.821 1.00 30.26 ? 463  GLU A CB  1 
ATOM   2918  C  CG  . GLU A  1 380 ? -14.235 61.148   121.502 1.00 37.81 ? 463  GLU A CG  1 
ATOM   2919  C  CD  . GLU A  1 380 ? -14.695 59.990   122.393 1.00 43.88 ? 463  GLU A CD  1 
ATOM   2920  O  OE1 . GLU A  1 380 ? -14.647 60.156   123.641 1.00 45.13 ? 463  GLU A OE1 1 
ATOM   2921  O  OE2 . GLU A  1 380 ? -15.100 58.926   121.848 1.00 45.34 ? 463  GLU A OE2 1 
ATOM   2922  N  N   . LEU A  1 381 ? -11.081 64.521   122.337 1.00 22.99 ? 464  LEU A N   1 
ATOM   2923  C  CA  . LEU A  1 381 ? -9.909  65.072   123.010 1.00 22.78 ? 464  LEU A CA  1 
ATOM   2924  C  C   . LEU A  1 381 ? -10.145 65.200   124.507 1.00 21.25 ? 464  LEU A C   1 
ATOM   2925  O  O   . LEU A  1 381 ? -11.275 65.352   124.955 1.00 22.17 ? 464  LEU A O   1 
ATOM   2926  C  CB  . LEU A  1 381 ? -9.552  66.426   122.422 1.00 24.02 ? 464  LEU A CB  1 
ATOM   2927  C  CG  . LEU A  1 381 ? -9.198  66.445   120.942 1.00 24.53 ? 464  LEU A CG  1 
ATOM   2928  C  CD1 . LEU A  1 381 ? -8.778  67.849   120.534 1.00 24.23 ? 464  LEU A CD1 1 
ATOM   2929  C  CD2 . LEU A  1 381 ? -8.076  65.473   120.700 1.00 27.16 ? 464  LEU A CD2 1 
ATOM   2930  N  N   . PRO A  1 382 ? -9.069  65.178   125.300 1.00 20.85 ? 465  PRO A N   1 
ATOM   2931  C  CA  . PRO A  1 382 ? -7.699  64.979   124.818 1.00 20.89 ? 465  PRO A CA  1 
ATOM   2932  C  C   . PRO A  1 382 ? -7.366  63.540   124.464 1.00 19.93 ? 465  PRO A C   1 
ATOM   2933  O  O   . PRO A  1 382 ? -8.167  62.633   124.680 1.00 19.69 ? 465  PRO A O   1 
ATOM   2934  C  CB  . PRO A  1 382 ? -6.859  65.503   125.982 1.00 19.87 ? 465  PRO A CB  1 
ATOM   2935  C  CG  . PRO A  1 382 ? -7.689  65.133   127.164 1.00 20.89 ? 465  PRO A CG  1 
ATOM   2936  C  CD  . PRO A  1 382 ? -9.080  65.527   126.727 1.00 19.97 ? 465  PRO A CD  1 
ATOM   2937  N  N   . PHE A  1 383 ? -6.176  63.351   123.901 1.00 20.46 ? 466  PHE A N   1 
ATOM   2938  C  CA  . PHE A  1 383 ? -5.677  62.041   123.510 1.00 20.12 ? 466  PHE A CA  1 
ATOM   2939  C  C   . PHE A  1 383 ? -4.807  61.537   124.646 1.00 21.31 ? 466  PHE A C   1 
ATOM   2940  O  O   . PHE A  1 383 ? -4.524  62.283   125.591 1.00 20.80 ? 466  PHE A O   1 
ATOM   2941  C  CB  . PHE A  1 383 ? -4.829  62.152   122.236 1.00 18.43 ? 466  PHE A CB  1 
ATOM   2942  C  CG  . PHE A  1 383 ? -5.610  61.978   120.953 1.00 17.62 ? 466  PHE A CG  1 
ATOM   2943  C  CD1 . PHE A  1 383 ? -6.993  62.169   120.918 1.00 16.09 ? 466  PHE A CD1 1 
ATOM   2944  C  CD2 . PHE A  1 383 ? -4.946  61.651   119.760 1.00 16.13 ? 466  PHE A CD2 1 
ATOM   2945  C  CE1 . PHE A  1 383 ? -7.712  62.035   119.709 1.00 15.23 ? 466  PHE A CE1 1 
ATOM   2946  C  CE2 . PHE A  1 383 ? -5.649  61.517   118.550 1.00 15.54 ? 466  PHE A CE2 1 
ATOM   2947  C  CZ  . PHE A  1 383 ? -7.038  61.711   118.524 1.00 14.87 ? 466  PHE A CZ  1 
ATOM   2948  N  N   . THR A  1 384 ? -4.379  60.277   124.556 1.00 23.72 ? 467  THR A N   1 
ATOM   2949  C  CA  . THR A  1 384 ? -3.515  59.687   125.574 1.00 25.21 ? 467  THR A CA  1 
ATOM   2950  C  C   . THR A  1 384 ? -2.357  60.654   125.855 1.00 27.22 ? 467  THR A C   1 
ATOM   2951  O  O   . THR A  1 384 ? -1.648  60.525   126.854 1.00 27.24 ? 467  THR A O   1 
ATOM   2952  C  CB  . THR A  1 384 ? -2.988  58.318   125.109 1.00 24.74 ? 467  THR A CB  1 
ATOM   2953  O  OG1 . THR A  1 384 ? -4.098  57.446   124.879 1.00 24.97 ? 467  THR A OG1 1 
ATOM   2954  C  CG2 . THR A  1 384 ? -2.102  57.684   126.172 1.00 26.06 ? 467  THR A CG2 1 
ATOM   2955  N  N   . ILE A  1 385 ? -2.214  61.636   124.964 1.00 30.45 ? 468  ILE A N   1 
ATOM   2956  C  CA  . ILE A  1 385 ? -1.220  62.707   125.039 1.00 31.88 ? 468  ILE A CA  1 
ATOM   2957  C  C   . ILE A  1 385 ? 0.113   62.284   124.454 1.00 34.22 ? 468  ILE A C   1 
ATOM   2958  O  O   . ILE A  1 385 ? 0.473   62.785   123.359 1.00 34.07 ? 468  ILE A O   1 
ATOM   2959  C  CB  . ILE A  1 385 ? -1.020  63.196   126.503 1.00 30.72 ? 468  ILE A CB  1 
ATOM   2960  C  CG1 . ILE A  1 385 ? -2.226  64.033   126.954 1.00 30.32 ? 468  ILE A CG1 1 
ATOM   2961  C  CG2 . ILE A  1 385 ? 0.261   63.984   126.618 1.00 30.08 ? 468  ILE A CG2 1 
ATOM   2962  C  CD1 . ILE A  1 385 ? -2.267  64.304   128.475 1.00 27.42 ? 468  ILE A CD1 1 
ATOM   2963  N  N   . VAL B  1 1   ? 3.763   35.014   77.573  1.00 40.89 ? 83   VAL B N   1 
ATOM   2964  C  CA  . VAL B  1 1   ? 4.424   33.865   76.894  1.00 41.76 ? 83   VAL B CA  1 
ATOM   2965  C  C   . VAL B  1 1   ? 4.791   32.766   77.895  1.00 40.86 ? 83   VAL B C   1 
ATOM   2966  O  O   . VAL B  1 1   ? 5.657   32.946   78.749  1.00 41.31 ? 83   VAL B O   1 
ATOM   2967  C  CB  . VAL B  1 1   ? 5.693   34.330   76.164  1.00 42.61 ? 83   VAL B CB  1 
ATOM   2968  C  CG1 . VAL B  1 1   ? 6.298   33.177   75.384  1.00 42.07 ? 83   VAL B CG1 1 
ATOM   2969  C  CG2 . VAL B  1 1   ? 5.352   35.488   75.234  1.00 43.94 ? 83   VAL B CG2 1 
ATOM   2970  N  N   . LYS B  1 2   ? 4.124   31.625   77.770  1.00 39.71 ? 84   LYS B N   1 
ATOM   2971  C  CA  . LYS B  1 2   ? 4.331   30.490   78.655  1.00 38.52 ? 84   LYS B CA  1 
ATOM   2972  C  C   . LYS B  1 2   ? 5.793   30.092   78.858  1.00 36.66 ? 84   LYS B C   1 
ATOM   2973  O  O   . LYS B  1 2   ? 6.608   30.107   77.940  1.00 36.35 ? 84   LYS B O   1 
ATOM   2974  C  CB  . LYS B  1 2   ? 3.522   29.296   78.148  1.00 40.23 ? 84   LYS B CB  1 
ATOM   2975  C  CG  . LYS B  1 2   ? 2.036   29.599   77.965  1.00 43.01 ? 84   LYS B CG  1 
ATOM   2976  C  CD  . LYS B  1 2   ? 1.426   28.686   76.898  1.00 46.90 ? 84   LYS B CD  1 
ATOM   2977  C  CE  . LYS B  1 2   ? -0.020  29.061   76.575  1.00 47.22 ? 84   LYS B CE  1 
ATOM   2978  N  NZ  . LYS B  1 2   ? -0.582  28.188   75.507  1.00 48.48 ? 84   LYS B NZ  1 
ATOM   2979  N  N   . LEU B  1 3   ? 6.084   29.728   80.099  1.00 35.15 ? 85   LEU B N   1 
ATOM   2980  C  CA  . LEU B  1 3   ? 7.396   29.324   80.576  1.00 32.91 ? 85   LEU B CA  1 
ATOM   2981  C  C   . LEU B  1 3   ? 7.837   27.967   80.047  1.00 32.20 ? 85   LEU B C   1 
ATOM   2982  O  O   . LEU B  1 3   ? 7.206   26.951   80.330  1.00 31.88 ? 85   LEU B O   1 
ATOM   2983  C  CB  . LEU B  1 3   ? 7.338   29.259   82.097  1.00 31.99 ? 85   LEU B CB  1 
ATOM   2984  C  CG  . LEU B  1 3   ? 8.446   29.800   82.983  1.00 33.21 ? 85   LEU B CG  1 
ATOM   2985  C  CD1 . LEU B  1 3   ? 8.695   31.270   82.669  1.00 31.55 ? 85   LEU B CD1 1 
ATOM   2986  C  CD2 . LEU B  1 3   ? 8.023   29.619   84.438  1.00 30.74 ? 85   LEU B CD2 1 
ATOM   2987  N  N   . ALA B  1 4   ? 8.922   27.942   79.283  1.00 31.70 ? 86   ALA B N   1 
ATOM   2988  C  CA  . ALA B  1 4   ? 9.428   26.672   78.775  1.00 31.79 ? 86   ALA B CA  1 
ATOM   2989  C  C   . ALA B  1 4   ? 10.210  26.029   79.911  1.00 31.69 ? 86   ALA B C   1 
ATOM   2990  O  O   . ALA B  1 4   ? 10.906  26.708   80.652  1.00 33.70 ? 86   ALA B O   1 
ATOM   2991  C  CB  . ALA B  1 4   ? 10.341  26.893   77.572  1.00 30.24 ? 86   ALA B CB  1 
ATOM   2992  N  N   . GLY B  1 5   ? 10.084  24.727   80.082  1.00 30.96 ? 87   GLY B N   1 
ATOM   2993  C  CA  . GLY B  1 5   ? 10.839  24.091   81.140  1.00 32.55 ? 87   GLY B CA  1 
ATOM   2994  C  C   . GLY B  1 5   ? 11.798  23.105   80.514  1.00 32.94 ? 87   GLY B C   1 
ATOM   2995  O  O   . GLY B  1 5   ? 12.187  22.128   81.146  1.00 35.43 ? 87   GLY B O   1 
ATOM   2996  N  N   . ASN B  1 6   ? 12.195  23.375   79.274  1.00 31.95 ? 88   ASN B N   1 
ATOM   2997  C  CA  . ASN B  1 6   ? 13.076  22.480   78.534  1.00 32.00 ? 88   ASN B CA  1 
ATOM   2998  C  C   . ASN B  1 6   ? 14.580  22.504   78.828  1.00 31.48 ? 88   ASN B C   1 
ATOM   2999  O  O   . ASN B  1 6   ? 15.298  21.620   78.363  1.00 31.31 ? 88   ASN B O   1 
ATOM   3000  C  CB  . ASN B  1 6   ? 12.846  22.651   77.015  1.00 32.54 ? 88   ASN B CB  1 
ATOM   3001  C  CG  . ASN B  1 6   ? 13.051  24.089   76.532  1.00 35.65 ? 88   ASN B CG  1 
ATOM   3002  O  OD1 . ASN B  1 6   ? 13.042  24.361   75.325  1.00 37.21 ? 88   ASN B OD1 1 
ATOM   3003  N  ND2 . ASN B  1 6   ? 13.232  25.013   77.471  1.00 37.45 ? 88   ASN B ND2 1 
ATOM   3004  N  N   . SER B  1 7   ? 15.074  23.482   79.585  1.00 29.59 ? 89   SER B N   1 
ATOM   3005  C  CA  . SER B  1 7   ? 16.506  23.509   79.868  1.00 28.34 ? 89   SER B CA  1 
ATOM   3006  C  C   . SER B  1 7   ? 16.810  22.692   81.118  1.00 27.58 ? 89   SER B C   1 
ATOM   3007  O  O   . SER B  1 7   ? 15.893  22.254   81.804  1.00 27.70 ? 89   SER B O   1 
ATOM   3008  C  CB  . SER B  1 7   ? 17.011  24.950   80.021  1.00 27.95 ? 89   SER B CB  1 
ATOM   3009  O  OG  . SER B  1 7   ? 16.327  25.644   81.042  1.00 31.76 ? 89   SER B OG  1 
ATOM   3010  N  N   . SER B  1 8   ? 18.091  22.469   81.396  1.00 26.78 ? 90   SER B N   1 
ATOM   3011  C  CA  . SER B  1 8   ? 18.502  21.690   82.558  1.00 26.92 ? 90   SER B CA  1 
ATOM   3012  C  C   . SER B  1 8   ? 18.890  22.582   83.723  1.00 26.12 ? 90   SER B C   1 
ATOM   3013  O  O   . SER B  1 8   ? 18.967  23.796   83.585  1.00 25.80 ? 90   SER B O   1 
ATOM   3014  C  CB  . SER B  1 8   ? 19.694  20.802   82.204  1.00 26.77 ? 90   SER B CB  1 
ATOM   3015  O  OG  . SER B  1 8   ? 19.356  19.881   81.192  1.00 27.29 ? 90   SER B OG  1 
ATOM   3016  N  N   . LEU B  1 9   ? 19.135  21.973   84.874  1.00 26.35 ? 91   LEU B N   1 
ATOM   3017  C  CA  . LEU B  1 9   ? 19.535  22.735   86.040  1.00 27.14 ? 91   LEU B CA  1 
ATOM   3018  C  C   . LEU B  1 9   ? 20.898  23.335   85.770  1.00 28.34 ? 91   LEU B C   1 
ATOM   3019  O  O   . LEU B  1 9   ? 21.763  22.691   85.164  1.00 30.31 ? 91   LEU B O   1 
ATOM   3020  C  CB  . LEU B  1 9   ? 19.620  21.844   87.280  1.00 24.60 ? 91   LEU B CB  1 
ATOM   3021  C  CG  . LEU B  1 9   ? 18.298  21.421   87.916  1.00 25.65 ? 91   LEU B CG  1 
ATOM   3022  C  CD1 . LEU B  1 9   ? 18.586  20.632   89.188  1.00 25.16 ? 91   LEU B CD1 1 
ATOM   3023  C  CD2 . LEU B  1 9   ? 17.453  22.664   88.233  1.00 24.72 ? 91   LEU B CD2 1 
ATOM   3024  N  N   . CYS B  1 10  ? 21.086  24.576   86.197  1.00 27.85 ? 92   CYS B N   1 
ATOM   3025  C  CA  . CYS B  1 10  ? 22.370  25.217   86.015  1.00 29.83 ? 92   CYS B CA  1 
ATOM   3026  C  C   . CYS B  1 10  ? 23.357  24.451   86.882  1.00 28.42 ? 92   CYS B C   1 
ATOM   3027  O  O   . CYS B  1 10  ? 22.983  23.920   87.927  1.00 27.17 ? 92   CYS B O   1 
ATOM   3028  C  CB  . CYS B  1 10  ? 22.336  26.671   86.496  1.00 32.01 ? 92   CYS B CB  1 
ATOM   3029  S  SG  . CYS B  1 10  ? 21.213  27.791   85.594  1.00 38.46 ? 92   CYS B SG  1 
ATOM   3030  N  N   . PRO B  1 11  ? 24.615  24.340   86.436  1.00 26.82 ? 93   PRO B N   1 
ATOM   3031  C  CA  . PRO B  1 11  ? 25.613  23.631   87.240  1.00 25.97 ? 93   PRO B CA  1 
ATOM   3032  C  C   . PRO B  1 11  ? 25.984  24.619   88.343  1.00 24.40 ? 93   PRO B C   1 
ATOM   3033  O  O   . PRO B  1 11  ? 26.003  25.828   88.104  1.00 23.16 ? 93   PRO B O   1 
ATOM   3034  C  CB  . PRO B  1 11  ? 26.753  23.391   86.252  1.00 26.36 ? 93   PRO B CB  1 
ATOM   3035  C  CG  . PRO B  1 11  ? 26.641  24.571   85.318  1.00 28.01 ? 93   PRO B CG  1 
ATOM   3036  C  CD  . PRO B  1 11  ? 25.141  24.655   85.097  1.00 27.29 ? 93   PRO B CD  1 
ATOM   3037  N  N   . ILE B  1 12  ? 26.273  24.118   89.541  1.00 23.02 ? 94   ILE B N   1 
ATOM   3038  C  CA  . ILE B  1 12  ? 26.595  24.999   90.654  1.00 21.54 ? 94   ILE B CA  1 
ATOM   3039  C  C   . ILE B  1 12  ? 27.675  24.445   91.567  1.00 20.75 ? 94   ILE B C   1 
ATOM   3040  O  O   . ILE B  1 12  ? 27.996  23.262   91.516  1.00 22.88 ? 94   ILE B O   1 
ATOM   3041  C  CB  . ILE B  1 12  ? 25.345  25.256   91.523  1.00 21.49 ? 94   ILE B CB  1 
ATOM   3042  C  CG1 . ILE B  1 12  ? 24.799  23.921   92.026  1.00 19.68 ? 94   ILE B CG1 1 
ATOM   3043  C  CG2 . ILE B  1 12  ? 24.292  26.010   90.726  1.00 18.05 ? 94   ILE B CG2 1 
ATOM   3044  C  CD1 . ILE B  1 12  ? 23.760  24.050   93.109  1.00 21.14 ? 94   ILE B CD1 1 
ATOM   3045  N  N   . ASN B  1 13  ? 28.205  25.313   92.422  1.00 18.85 ? 95   ASN B N   1 
ATOM   3046  C  CA  . ASN B  1 13  ? 29.242  24.943   93.370  1.00 18.10 ? 95   ASN B CA  1 
ATOM   3047  C  C   . ASN B  1 13  ? 28.819  25.221   94.802  1.00 17.26 ? 95   ASN B C   1 
ATOM   3048  O  O   . ASN B  1 13  ? 29.249  24.543   95.736  1.00 16.40 ? 95   ASN B O   1 
ATOM   3049  C  CB  . ASN B  1 13  ? 30.525  25.722   93.074  1.00 19.23 ? 95   ASN B CB  1 
ATOM   3050  C  CG  . ASN B  1 13  ? 31.126  25.341   91.752  1.00 20.70 ? 95   ASN B CG  1 
ATOM   3051  O  OD1 . ASN B  1 13  ? 31.348  24.164   91.485  1.00 23.44 ? 95   ASN B OD1 1 
ATOM   3052  N  ND2 . ASN B  1 13  ? 31.390  26.326   90.910  1.00 20.67 ? 95   ASN B ND2 1 
ATOM   3053  N  N   . GLY B  1 14  ? 27.979  26.230   94.979  1.00 15.89 ? 96   GLY B N   1 
ATOM   3054  C  CA  . GLY B  1 14  ? 27.556  26.566   96.319  1.00 15.21 ? 96   GLY B CA  1 
ATOM   3055  C  C   . GLY B  1 14  ? 26.322  27.422   96.297  1.00 15.14 ? 96   GLY B C   1 
ATOM   3056  O  O   . GLY B  1 14  ? 25.719  27.601   95.253  1.00 13.77 ? 96   GLY B O   1 
ATOM   3057  N  N   . TRP B  1 15  ? 25.964  27.973   97.450  1.00 16.54 ? 97   TRP B N   1 
ATOM   3058  C  CA  . TRP B  1 15  ? 24.767  28.782   97.548  1.00 16.48 ? 97   TRP B CA  1 
ATOM   3059  C  C   . TRP B  1 15  ? 24.990  30.174   98.126  1.00 15.43 ? 97   TRP B C   1 
ATOM   3060  O  O   . TRP B  1 15  ? 25.531  30.332   99.216  1.00 15.06 ? 97   TRP B O   1 
ATOM   3061  C  CB  . TRP B  1 15  ? 23.730  28.025   98.384  1.00 16.90 ? 97   TRP B CB  1 
ATOM   3062  C  CG  . TRP B  1 15  ? 23.628  26.600   97.996  1.00 18.00 ? 97   TRP B CG  1 
ATOM   3063  C  CD1 . TRP B  1 15  ? 24.477  25.589   98.352  1.00 20.32 ? 97   TRP B CD1 1 
ATOM   3064  C  CD2 . TRP B  1 15  ? 22.674  26.025   97.101  1.00 19.69 ? 97   TRP B CD2 1 
ATOM   3065  N  NE1 . TRP B  1 15  ? 24.113  24.416   97.725  1.00 21.30 ? 97   TRP B NE1 1 
ATOM   3066  C  CE2 . TRP B  1 15  ? 23.006  24.661   96.945  1.00 20.32 ? 97   TRP B CE2 1 
ATOM   3067  C  CE3 . TRP B  1 15  ? 21.571  26.532   96.401  1.00 20.06 ? 97   TRP B CE3 1 
ATOM   3068  C  CZ2 . TRP B  1 15  ? 22.277  23.800   96.133  1.00 19.92 ? 97   TRP B CZ2 1 
ATOM   3069  C  CZ3 . TRP B  1 15  ? 20.846  25.674   95.589  1.00 20.04 ? 97   TRP B CZ3 1 
ATOM   3070  C  CH2 . TRP B  1 15  ? 21.205  24.325   95.460  1.00 20.23 ? 97   TRP B CH2 1 
ATOM   3071  N  N   . ALA B  1 16  ? 24.550  31.181   97.384  1.00 14.86 ? 98   ALA B N   1 
ATOM   3072  C  CA  . ALA B  1 16  ? 24.675  32.562   97.817  1.00 15.47 ? 98   ALA B CA  1 
ATOM   3073  C  C   . ALA B  1 16  ? 23.373  32.982   98.507  1.00 15.17 ? 98   ALA B C   1 
ATOM   3074  O  O   . ALA B  1 16  ? 22.291  32.606   98.048  1.00 14.96 ? 98   ALA B O   1 
ATOM   3075  C  CB  . ALA B  1 16  ? 24.939  33.445   96.602  1.00 14.30 ? 98   ALA B CB  1 
ATOM   3076  N  N   . VAL B  1 17  ? 23.470  33.746   99.602  1.00 16.71 ? 99   VAL B N   1 
ATOM   3077  C  CA  . VAL B  1 17  ? 22.268  34.219   100.317 1.00 15.19 ? 99   VAL B CA  1 
ATOM   3078  C  C   . VAL B  1 17  ? 21.482  35.080   99.368  1.00 14.82 ? 99   VAL B C   1 
ATOM   3079  O  O   . VAL B  1 17  ? 22.053  35.921   98.677  1.00 14.48 ? 99   VAL B O   1 
ATOM   3080  C  CB  . VAL B  1 17  ? 22.558  35.139   101.526 1.00 14.62 ? 99   VAL B CB  1 
ATOM   3081  C  CG1 . VAL B  1 17  ? 22.126  34.474   102.800 1.00 16.13 ? 99   VAL B CG1 1 
ATOM   3082  C  CG2 . VAL B  1 17  ? 24.009  35.525   101.570 1.00 15.64 ? 99   VAL B CG2 1 
ATOM   3083  N  N   . TYR B  1 18  ? 20.171  34.877   99.352  1.00 14.96 ? 100  TYR B N   1 
ATOM   3084  C  CA  . TYR B  1 18  ? 19.285  35.631   98.489  1.00 14.38 ? 100  TYR B CA  1 
ATOM   3085  C  C   . TYR B  1 18  ? 18.390  36.555   99.304  1.00 13.64 ? 100  TYR B C   1 
ATOM   3086  O  O   . TYR B  1 18  ? 18.229  37.724   98.958  1.00 14.31 ? 100  TYR B O   1 
ATOM   3087  C  CB  . TYR B  1 18  ? 18.442  34.673   97.655  1.00 14.73 ? 100  TYR B CB  1 
ATOM   3088  C  CG  . TYR B  1 18  ? 17.629  35.343   96.572  1.00 16.24 ? 100  TYR B CG  1 
ATOM   3089  C  CD1 . TYR B  1 18  ? 18.236  36.136   95.605  1.00 16.37 ? 100  TYR B CD1 1 
ATOM   3090  C  CD2 . TYR B  1 18  ? 16.254  35.145   96.489  1.00 18.68 ? 100  TYR B CD2 1 
ATOM   3091  C  CE1 . TYR B  1 18  ? 17.495  36.710   94.580  1.00 18.72 ? 100  TYR B CE1 1 
ATOM   3092  C  CE2 . TYR B  1 18  ? 15.502  35.715   95.469  1.00 19.72 ? 100  TYR B CE2 1 
ATOM   3093  C  CZ  . TYR B  1 18  ? 16.128  36.494   94.519  1.00 20.78 ? 100  TYR B CZ  1 
ATOM   3094  O  OH  . TYR B  1 18  ? 15.375  37.059   93.516  1.00 24.34 ? 100  TYR B OH  1 
ATOM   3095  N  N   . SER B  1 19  ? 17.818  36.048   100.393 1.00 13.60 ? 101  SER B N   1 
ATOM   3096  C  CA  . SER B  1 19  ? 16.951  36.884   101.220 1.00 14.09 ? 101  SER B CA  1 
ATOM   3097  C  C   . SER B  1 19  ? 16.821  36.431   102.659 1.00 13.64 ? 101  SER B C   1 
ATOM   3098  O  O   . SER B  1 19  ? 17.087  35.279   102.983 1.00 14.32 ? 101  SER B O   1 
ATOM   3099  C  CB  . SER B  1 19  ? 15.554  36.946   100.616 1.00 15.90 ? 101  SER B CB  1 
ATOM   3100  O  OG  . SER B  1 19  ? 14.871  35.720   100.813 1.00 18.55 ? 101  SER B OG  1 
ATOM   3101  N  N   . LYS B  1 20  ? 16.415  37.360   103.517 1.00 14.21 ? 102  LYS B N   1 
ATOM   3102  C  CA  . LYS B  1 20  ? 16.188  37.097   104.936 1.00 16.18 ? 102  LYS B CA  1 
ATOM   3103  C  C   . LYS B  1 20  ? 15.137  38.115   105.353 1.00 17.52 ? 102  LYS B C   1 
ATOM   3104  O  O   . LYS B  1 20  ? 15.348  39.310   105.211 1.00 20.48 ? 102  LYS B O   1 
ATOM   3105  C  CB  . LYS B  1 20  ? 17.462  37.302   105.751 1.00 15.86 ? 102  LYS B CB  1 
ATOM   3106  C  CG  . LYS B  1 20  ? 17.327  36.785   107.182 1.00 14.84 ? 102  LYS B CG  1 
ATOM   3107  C  CD  . LYS B  1 20  ? 18.621  36.914   107.954 1.00 15.44 ? 102  LYS B CD  1 
ATOM   3108  C  CE  . LYS B  1 20  ? 18.577  36.115   109.245 1.00 16.13 ? 102  LYS B CE  1 
ATOM   3109  N  NZ  . LYS B  1 20  ? 17.485  36.536   110.154 1.00 15.77 ? 102  LYS B NZ  1 
ATOM   3110  N  N   . ASP B  1 21  ? 14.004  37.660   105.870 1.00 18.97 ? 103  ASP B N   1 
ATOM   3111  C  CA  . ASP B  1 21  ? 12.950  38.598   106.217 1.00 19.27 ? 103  ASP B CA  1 
ATOM   3112  C  C   . ASP B  1 21  ? 12.926  39.142   107.642 1.00 18.46 ? 103  ASP B C   1 
ATOM   3113  O  O   . ASP B  1 21  ? 12.329  40.192   107.890 1.00 18.04 ? 103  ASP B O   1 
ATOM   3114  C  CB  . ASP B  1 21  ? 11.594  37.990   105.863 1.00 22.36 ? 103  ASP B CB  1 
ATOM   3115  C  CG  . ASP B  1 21  ? 11.233  36.817   106.743 1.00 26.56 ? 103  ASP B CG  1 
ATOM   3116  O  OD1 . ASP B  1 21  ? 10.121  36.266   106.572 1.00 30.10 ? 103  ASP B OD1 1 
ATOM   3117  O  OD2 . ASP B  1 21  ? 12.053  36.447   107.611 1.00 30.55 ? 103  ASP B OD2 1 
ATOM   3118  N  N   . ASN B  1 22  ? 13.565  38.446   108.579 1.00 17.87 ? 104  ASN B N   1 
ATOM   3119  C  CA  . ASN B  1 22  ? 13.597  38.913   109.965 1.00 16.69 ? 104  ASN B CA  1 
ATOM   3120  C  C   . ASN B  1 22  ? 12.195  39.216   110.469 1.00 16.59 ? 104  ASN B C   1 
ATOM   3121  O  O   . ASN B  1 22  ? 12.026  40.005   111.389 1.00 17.48 ? 104  ASN B O   1 
ATOM   3122  C  CB  . ASN B  1 22  ? 14.424  40.196   110.061 1.00 15.85 ? 104  ASN B CB  1 
ATOM   3123  C  CG  . ASN B  1 22  ? 15.900  39.962   109.830 1.00 16.07 ? 104  ASN B CG  1 
ATOM   3124  O  OD1 . ASN B  1 22  ? 16.565  40.740   109.138 1.00 17.51 ? 104  ASN B OD1 1 
ATOM   3125  N  ND2 . ASN B  1 22  ? 16.427  38.899   110.422 1.00 13.20 ? 104  ASN B ND2 1 
ATOM   3126  N  N   . SER B  1 23  ? 11.187  38.591   109.878 1.00 17.90 ? 105  SER B N   1 
ATOM   3127  C  CA  . SER B  1 23  ? 9.813   38.878   110.273 1.00 17.41 ? 105  SER B CA  1 
ATOM   3128  C  C   . SER B  1 23  ? 9.559   38.772   111.770 1.00 16.82 ? 105  SER B C   1 
ATOM   3129  O  O   . SER B  1 23  ? 8.868   39.621   112.348 1.00 15.45 ? 105  SER B O   1 
ATOM   3130  C  CB  . SER B  1 23  ? 8.833   37.991   109.500 1.00 16.48 ? 105  SER B CB  1 
ATOM   3131  O  OG  . SER B  1 23  ? 8.966   36.642   109.864 1.00 20.64 ? 105  SER B OG  1 
ATOM   3132  N  N   . ILE B  1 24  ? 10.130  37.758   112.410 1.00 16.27 ? 106  ILE B N   1 
ATOM   3133  C  CA  . ILE B  1 24  ? 9.920   37.586   113.844 1.00 16.05 ? 106  ILE B CA  1 
ATOM   3134  C  C   . ILE B  1 24  ? 10.546  38.703   114.693 1.00 16.58 ? 106  ILE B C   1 
ATOM   3135  O  O   . ILE B  1 24  ? 9.933   39.180   115.655 1.00 16.37 ? 106  ILE B O   1 
ATOM   3136  C  CB  . ILE B  1 24  ? 10.407  36.200   114.280 1.00 15.65 ? 106  ILE B CB  1 
ATOM   3137  C  CG1 . ILE B  1 24  ? 9.669   35.153   113.423 1.00 15.48 ? 106  ILE B CG1 1 
ATOM   3138  C  CG2 . ILE B  1 24  ? 10.152  35.985   115.778 1.00 13.23 ? 106  ILE B CG2 1 
ATOM   3139  C  CD1 . ILE B  1 24  ? 9.919   33.710   113.796 1.00 17.95 ? 106  ILE B CD1 1 
ATOM   3140  N  N   . ARG B  1 25  ? 11.749  39.133   114.327 1.00 15.57 ? 107  ARG B N   1 
ATOM   3141  C  CA  . ARG B  1 25  ? 12.417  40.215   115.046 1.00 17.51 ? 107  ARG B CA  1 
ATOM   3142  C  C   . ARG B  1 25  ? 11.594  41.491   114.887 1.00 17.15 ? 107  ARG B C   1 
ATOM   3143  O  O   . ARG B  1 25  ? 11.384  42.252   115.833 1.00 16.85 ? 107  ARG B O   1 
ATOM   3144  C  CB  . ARG B  1 25  ? 13.823  40.447   114.477 1.00 18.35 ? 107  ARG B CB  1 
ATOM   3145  C  CG  . ARG B  1 25  ? 14.863  39.416   114.908 1.00 19.45 ? 107  ARG B CG  1 
ATOM   3146  C  CD  . ARG B  1 25  ? 16.134  39.525   114.071 1.00 18.28 ? 107  ARG B CD  1 
ATOM   3147  N  NE  . ARG B  1 25  ? 16.777  40.837   114.169 1.00 20.18 ? 107  ARG B NE  1 
ATOM   3148  C  CZ  . ARG B  1 25  ? 17.496  41.251   115.211 1.00 18.86 ? 107  ARG B CZ  1 
ATOM   3149  N  NH1 . ARG B  1 25  ? 18.043  42.461   115.202 1.00 20.31 ? 107  ARG B NH1 1 
ATOM   3150  N  NH2 . ARG B  1 25  ? 17.675  40.458   116.259 1.00 16.65 ? 107  ARG B NH2 1 
ATOM   3151  N  N   . ILE B  1 26  ? 11.122  41.704   113.668 1.00 16.57 ? 108  ILE B N   1 
ATOM   3152  C  CA  . ILE B  1 26  ? 10.338  42.872   113.326 1.00 15.60 ? 108  ILE B CA  1 
ATOM   3153  C  C   . ILE B  1 26  ? 8.950   42.806   113.939 1.00 17.05 ? 108  ILE B C   1 
ATOM   3154  O  O   . ILE B  1 26  ? 8.427   43.807   114.435 1.00 15.57 ? 108  ILE B O   1 
ATOM   3155  C  CB  . ILE B  1 26  ? 10.235  42.968   111.808 1.00 15.03 ? 108  ILE B CB  1 
ATOM   3156  C  CG1 . ILE B  1 26  ? 11.650  43.085   111.229 1.00 13.19 ? 108  ILE B CG1 1 
ATOM   3157  C  CG2 . ILE B  1 26  ? 9.344   44.129   111.413 1.00 15.17 ? 108  ILE B CG2 1 
ATOM   3158  C  CD1 . ILE B  1 26  ? 11.718  43.013   109.714 1.00 14.67 ? 108  ILE B CD1 1 
ATOM   3159  N  N   . GLY B  1 27  ? 8.359   41.612   113.904 1.00 18.72 ? 109  GLY B N   1 
ATOM   3160  C  CA  . GLY B  1 27  ? 7.028   41.420   114.454 1.00 18.10 ? 109  GLY B CA  1 
ATOM   3161  C  C   . GLY B  1 27  ? 6.964   41.717   115.939 1.00 17.09 ? 109  GLY B C   1 
ATOM   3162  O  O   . GLY B  1 27  ? 5.888   41.867   116.507 1.00 17.66 ? 109  GLY B O   1 
ATOM   3163  N  N   . SER B  1 28  ? 8.122   41.803   116.575 1.00 16.98 ? 110  SER B N   1 
ATOM   3164  C  CA  . SER B  1 28  ? 8.171   42.090   117.997 1.00 17.32 ? 110  SER B CA  1 
ATOM   3165  C  C   . SER B  1 28  ? 7.437   43.393   118.329 1.00 17.83 ? 110  SER B C   1 
ATOM   3166  O  O   . SER B  1 28  ? 6.907   43.544   119.428 1.00 18.30 ? 110  SER B O   1 
ATOM   3167  C  CB  . SER B  1 28  ? 9.623   42.175   118.455 1.00 15.37 ? 110  SER B CB  1 
ATOM   3168  O  OG  . SER B  1 28  ? 9.689   42.489   119.830 1.00 16.43 ? 110  SER B OG  1 
ATOM   3169  N  N   . LYS B  1 29  ? 7.426   44.331   117.383 1.00 17.59 ? 111  LYS B N   1 
ATOM   3170  C  CA  . LYS B  1 29  ? 6.741   45.614   117.561 1.00 18.41 ? 111  LYS B CA  1 
ATOM   3171  C  C   . LYS B  1 29  ? 5.791   45.841   116.396 1.00 19.48 ? 111  LYS B C   1 
ATOM   3172  O  O   . LYS B  1 29  ? 4.646   46.267   116.577 1.00 19.73 ? 111  LYS B O   1 
ATOM   3173  C  CB  . LYS B  1 29  ? 7.735   46.774   117.597 1.00 19.60 ? 111  LYS B CB  1 
ATOM   3174  C  CG  . LYS B  1 29  ? 7.071   48.156   117.506 1.00 20.21 ? 111  LYS B CG  1 
ATOM   3175  C  CD  . LYS B  1 29  ? 8.107   49.268   117.604 1.00 21.84 ? 111  LYS B CD  1 
ATOM   3176  C  CE  . LYS B  1 29  ? 7.484   50.643   117.811 1.00 23.48 ? 111  LYS B CE  1 
ATOM   3177  N  NZ  . LYS B  1 29  ? 6.737   51.144   116.634 1.00 25.12 ? 111  LYS B NZ  1 
ATOM   3178  N  N   . GLY B  1 30  ? 6.293   45.554   115.197 1.00 19.15 ? 112  GLY B N   1 
ATOM   3179  C  CA  . GLY B  1 30  ? 5.517   45.724   113.988 1.00 19.10 ? 112  GLY B CA  1 
ATOM   3180  C  C   . GLY B  1 30  ? 4.375   44.734   113.847 1.00 20.36 ? 112  GLY B C   1 
ATOM   3181  O  O   . GLY B  1 30  ? 4.346   43.674   114.478 1.00 21.19 ? 112  GLY B O   1 
ATOM   3182  N  N   . ASP B  1 31  ? 3.415   45.099   113.014 1.00 19.82 ? 113  ASP B N   1 
ATOM   3183  C  CA  . ASP B  1 31  ? 2.271   44.257   112.770 1.00 19.52 ? 113  ASP B CA  1 
ATOM   3184  C  C   . ASP B  1 31  ? 2.656   43.267   111.672 1.00 19.49 ? 113  ASP B C   1 
ATOM   3185  O  O   . ASP B  1 31  ? 2.493   43.540   110.483 1.00 17.82 ? 113  ASP B O   1 
ATOM   3186  C  CB  . ASP B  1 31  ? 1.079   45.122   112.352 1.00 20.36 ? 113  ASP B CB  1 
ATOM   3187  C  CG  . ASP B  1 31  ? 0.840   46.287   113.306 1.00 22.70 ? 113  ASP B CG  1 
ATOM   3188  O  OD1 . ASP B  1 31  ? 1.172   46.162   114.510 1.00 22.57 ? 113  ASP B OD1 1 
ATOM   3189  O  OD2 . ASP B  1 31  ? 0.306   47.323   112.849 1.00 24.08 ? 113  ASP B OD2 1 
ATOM   3190  N  N   . VAL B  1 32  ? 3.189   42.122   112.094 1.00 18.48 ? 114  VAL B N   1 
ATOM   3191  C  CA  . VAL B  1 32  ? 3.605   41.061   111.184 1.00 17.08 ? 114  VAL B CA  1 
ATOM   3192  C  C   . VAL B  1 32  ? 2.792   39.795   111.446 1.00 16.46 ? 114  VAL B C   1 
ATOM   3193  O  O   . VAL B  1 32  ? 2.526   39.442   112.586 1.00 17.97 ? 114  VAL B O   1 
ATOM   3194  C  CB  . VAL B  1 32  ? 5.109   40.736   111.359 1.00 16.85 ? 114  VAL B CB  1 
ATOM   3195  C  CG1 . VAL B  1 32  ? 5.508   39.603   110.436 1.00 17.32 ? 114  VAL B CG1 1 
ATOM   3196  C  CG2 . VAL B  1 32  ? 5.940   41.967   111.070 1.00 16.61 ? 114  VAL B CG2 1 
ATOM   3197  N  N   . PHE B  1 33  ? 2.402   39.110   110.381 1.00 16.35 ? 115  PHE B N   1 
ATOM   3198  C  CA  . PHE B  1 33  ? 1.616   37.885   110.506 1.00 16.86 ? 115  PHE B CA  1 
ATOM   3199  C  C   . PHE B  1 33  ? 2.409   36.757   111.137 1.00 17.99 ? 115  PHE B C   1 
ATOM   3200  O  O   . PHE B  1 33  ? 3.607   36.620   110.891 1.00 19.57 ? 115  PHE B O   1 
ATOM   3201  C  CB  . PHE B  1 33  ? 1.170   37.395   109.128 1.00 14.28 ? 115  PHE B CB  1 
ATOM   3202  C  CG  . PHE B  1 33  ? 0.021   38.153   108.544 1.00 14.17 ? 115  PHE B CG  1 
ATOM   3203  C  CD1 . PHE B  1 33  ? 0.069   38.589   107.224 1.00 14.29 ? 115  PHE B CD1 1 
ATOM   3204  C  CD2 . PHE B  1 33  ? -1.145  38.348   109.274 1.00 15.04 ? 115  PHE B CD2 1 
ATOM   3205  C  CE1 . PHE B  1 33  ? -1.034  39.201   106.633 1.00 15.18 ? 115  PHE B CE1 1 
ATOM   3206  C  CE2 . PHE B  1 33  ? -2.257  38.959   108.698 1.00 15.38 ? 115  PHE B CE2 1 
ATOM   3207  C  CZ  . PHE B  1 33  ? -2.201  39.385   107.373 1.00 15.99 ? 115  PHE B CZ  1 
ATOM   3208  N  N   . VAL B  1 34  ? 1.747   35.948   111.957 1.00 18.00 ? 116  VAL B N   1 
ATOM   3209  C  CA  . VAL B  1 34  ? 2.411   34.786   112.522 1.00 18.43 ? 116  VAL B CA  1 
ATOM   3210  C  C   . VAL B  1 34  ? 2.221   33.781   111.386 1.00 18.71 ? 116  VAL B C   1 
ATOM   3211  O  O   . VAL B  1 34  ? 1.100   33.424   111.038 1.00 17.30 ? 116  VAL B O   1 
ATOM   3212  C  CB  . VAL B  1 34  ? 1.732   34.300   113.815 1.00 17.95 ? 116  VAL B CB  1 
ATOM   3213  C  CG1 . VAL B  1 34  ? 0.245   34.480   113.717 1.00 22.76 ? 116  VAL B CG1 1 
ATOM   3214  C  CG2 . VAL B  1 34  ? 2.056   32.830   114.052 1.00 19.32 ? 116  VAL B CG2 1 
ATOM   3215  N  N   . ILE B  1 35  ? 3.319   33.347   110.781 1.00 19.41 ? 117  ILE B N   1 
ATOM   3216  C  CA  . ILE B  1 35  ? 3.212   32.438   109.652 1.00 20.19 ? 117  ILE B CA  1 
ATOM   3217  C  C   . ILE B  1 35  ? 3.868   31.080   109.819 1.00 20.05 ? 117  ILE B C   1 
ATOM   3218  O  O   . ILE B  1 35  ? 4.484   30.794   110.838 1.00 20.71 ? 117  ILE B O   1 
ATOM   3219  C  CB  . ILE B  1 35  ? 3.829   33.063   108.408 1.00 19.97 ? 117  ILE B CB  1 
ATOM   3220  C  CG1 . ILE B  1 35  ? 5.343   33.125   108.581 1.00 20.46 ? 117  ILE B CG1 1 
ATOM   3221  C  CG2 . ILE B  1 35  ? 3.269   34.443   108.193 1.00 18.09 ? 117  ILE B CG2 1 
ATOM   3222  C  CD1 . ILE B  1 35  ? 6.103   33.316   107.291 1.00 24.09 ? 117  ILE B CD1 1 
ATOM   3223  N  N   . ARG B  1 36  ? 3.718   30.265   108.779 1.00 20.40 ? 118  ARG B N   1 
ATOM   3224  C  CA  . ARG B  1 36  ? 4.283   28.926   108.685 1.00 22.33 ? 118  ARG B CA  1 
ATOM   3225  C  C   . ARG B  1 36  ? 4.551   28.653   107.202 1.00 23.38 ? 118  ARG B C   1 
ATOM   3226  O  O   . ARG B  1 36  ? 3.913   29.236   106.330 1.00 23.87 ? 118  ARG B O   1 
ATOM   3227  C  CB  . ARG B  1 36  ? 3.314   27.866   109.233 1.00 23.13 ? 118  ARG B CB  1 
ATOM   3228  C  CG  . ARG B  1 36  ? 3.270   27.708   110.764 1.00 23.27 ? 118  ARG B CG  1 
ATOM   3229  C  CD  . ARG B  1 36  ? 4.659   27.540   111.385 1.00 24.09 ? 118  ARG B CD  1 
ATOM   3230  N  NE  . ARG B  1 36  ? 5.466   26.495   110.742 1.00 27.32 ? 118  ARG B NE  1 
ATOM   3231  C  CZ  . ARG B  1 36  ? 5.413   25.194   111.034 1.00 27.25 ? 118  ARG B CZ  1 
ATOM   3232  N  NH1 . ARG B  1 36  ? 6.193   24.340   110.383 1.00 25.84 ? 118  ARG B NH1 1 
ATOM   3233  N  NH2 . ARG B  1 36  ? 4.594   24.744   111.981 1.00 27.42 ? 118  ARG B NH2 1 
ATOM   3234  N  N   . GLU B  1 37  ? 5.502   27.772   106.923 1.00 24.62 ? 119  GLU B N   1 
ATOM   3235  C  CA  . GLU B  1 37  ? 5.867   27.414   105.556 1.00 25.52 ? 119  GLU B CA  1 
ATOM   3236  C  C   . GLU B  1 37  ? 5.899   28.572   104.558 1.00 24.50 ? 119  GLU B C   1 
ATOM   3237  O  O   . GLU B  1 37  ? 5.069   28.639   103.649 1.00 24.29 ? 119  GLU B O   1 
ATOM   3238  C  CB  . GLU B  1 37  ? 4.931   26.332   105.026 1.00 27.00 ? 119  GLU B CB  1 
ATOM   3239  C  CG  . GLU B  1 37  ? 3.497   26.777   104.922 1.00 32.04 ? 119  GLU B CG  1 
ATOM   3240  C  CD  . GLU B  1 37  ? 2.589   25.693   104.385 1.00 35.27 ? 119  GLU B CD  1 
ATOM   3241  O  OE1 . GLU B  1 37  ? 1.973   25.915   103.310 1.00 34.20 ? 119  GLU B OE1 1 
ATOM   3242  O  OE2 . GLU B  1 37  ? 2.499   24.626   105.044 1.00 36.50 ? 119  GLU B OE2 1 
ATOM   3243  N  N   . PRO B  1 38  ? 6.858   29.500   104.716 1.00 23.01 ? 120  PRO B N   1 
ATOM   3244  C  CA  . PRO B  1 38  ? 6.972   30.641   103.800 1.00 22.41 ? 120  PRO B CA  1 
ATOM   3245  C  C   . PRO B  1 38  ? 7.707   30.241   102.519 1.00 23.09 ? 120  PRO B C   1 
ATOM   3246  O  O   . PRO B  1 38  ? 8.867   30.601   102.334 1.00 25.57 ? 120  PRO B O   1 
ATOM   3247  C  CB  . PRO B  1 38  ? 7.773   31.651   104.614 1.00 21.44 ? 120  PRO B CB  1 
ATOM   3248  C  CG  . PRO B  1 38  ? 8.702   30.756   105.411 1.00 21.55 ? 120  PRO B CG  1 
ATOM   3249  C  CD  . PRO B  1 38  ? 7.751   29.665   105.880 1.00 21.92 ? 120  PRO B CD  1 
ATOM   3250  N  N   . PHE B  1 39  ? 7.057   29.500   101.629 1.00 21.63 ? 121  PHE B N   1 
ATOM   3251  C  CA  . PHE B  1 39  ? 7.742   29.099   100.408 1.00 20.74 ? 121  PHE B CA  1 
ATOM   3252  C  C   . PHE B  1 39  ? 7.818   30.202   99.365  1.00 21.17 ? 121  PHE B C   1 
ATOM   3253  O  O   . PHE B  1 39  ? 6.922   31.037   99.258  1.00 22.72 ? 121  PHE B O   1 
ATOM   3254  C  CB  . PHE B  1 39  ? 7.099   27.848   99.811  1.00 21.05 ? 121  PHE B CB  1 
ATOM   3255  C  CG  . PHE B  1 39  ? 5.706   28.053   99.297  1.00 20.03 ? 121  PHE B CG  1 
ATOM   3256  C  CD1 . PHE B  1 39  ? 5.485   28.366   97.962  1.00 20.77 ? 121  PHE B CD1 1 
ATOM   3257  C  CD2 . PHE B  1 39  ? 4.612   27.867   100.132 1.00 19.27 ? 121  PHE B CD2 1 
ATOM   3258  C  CE1 . PHE B  1 39  ? 4.193   28.484   97.463  1.00 21.02 ? 121  PHE B CE1 1 
ATOM   3259  C  CE2 . PHE B  1 39  ? 3.319   27.983   99.647  1.00 19.86 ? 121  PHE B CE2 1 
ATOM   3260  C  CZ  . PHE B  1 39  ? 3.106   28.289   98.310  1.00 20.87 ? 121  PHE B CZ  1 
ATOM   3261  N  N   . ILE B  1 40  ? 8.906   30.198   98.601  1.00 20.17 ? 122  ILE B N   1 
ATOM   3262  C  CA  . ILE B  1 40  ? 9.133   31.196   97.568  1.00 18.72 ? 122  ILE B CA  1 
ATOM   3263  C  C   . ILE B  1 40  ? 8.829   30.624   96.198  1.00 19.03 ? 122  ILE B C   1 
ATOM   3264  O  O   . ILE B  1 40  ? 9.129   29.468   95.927  1.00 20.34 ? 122  ILE B O   1 
ATOM   3265  C  CB  . ILE B  1 40  ? 10.613  31.667   97.569  1.00 17.91 ? 122  ILE B CB  1 
ATOM   3266  C  CG1 . ILE B  1 40  ? 10.967  32.307   98.914  1.00 17.36 ? 122  ILE B CG1 1 
ATOM   3267  C  CG2 . ILE B  1 40  ? 10.855  32.643   96.434  1.00 16.83 ? 122  ILE B CG2 1 
ATOM   3268  C  CD1 . ILE B  1 40  ? 12.393  32.839   98.998  1.00 17.54 ? 122  ILE B CD1 1 
ATOM   3269  N  N   . SER B  1 41  ? 8.224   31.431   95.336  1.00 19.63 ? 123  SER B N   1 
ATOM   3270  C  CA  . SER B  1 41  ? 7.923   31.000   93.974  1.00 20.94 ? 123  SER B CA  1 
ATOM   3271  C  C   . SER B  1 41  ? 8.107   32.215   93.088  1.00 21.09 ? 123  SER B C   1 
ATOM   3272  O  O   . SER B  1 41  ? 7.813   33.330   93.507  1.00 22.26 ? 123  SER B O   1 
ATOM   3273  C  CB  . SER B  1 41  ? 6.495   30.476   93.860  1.00 21.71 ? 123  SER B CB  1 
ATOM   3274  O  OG  . SER B  1 41  ? 6.272   29.968   92.555  1.00 22.87 ? 123  SER B OG  1 
ATOM   3275  N  N   . CYS B  1 42  ? 8.592   32.013   91.869  1.00 22.02 ? 124  CYS B N   1 
ATOM   3276  C  CA  . CYS B  1 42  ? 8.846   33.141   90.978  1.00 23.89 ? 124  CYS B CA  1 
ATOM   3277  C  C   . CYS B  1 42  ? 8.089   33.066   89.673  1.00 23.79 ? 124  CYS B C   1 
ATOM   3278  O  O   . CYS B  1 42  ? 7.615   32.014   89.275  1.00 25.25 ? 124  CYS B O   1 
ATOM   3279  C  CB  . CYS B  1 42  ? 10.333  33.227   90.619  1.00 27.02 ? 124  CYS B CB  1 
ATOM   3280  S  SG  . CYS B  1 42  ? 11.564  33.190   91.965  1.00 30.48 ? 124  CYS B SG  1 
ATOM   3281  N  N   . SER B  1 43  ? 8.003   34.203   89.002  1.00 23.97 ? 125  SER B N   1 
ATOM   3282  C  CA  . SER B  1 43  ? 7.347   34.289   87.712  1.00 24.83 ? 125  SER B CA  1 
ATOM   3283  C  C   . SER B  1 43  ? 8.452   34.656   86.732  1.00 25.81 ? 125  SER B C   1 
ATOM   3284  O  O   . SER B  1 43  ? 9.633   34.384   86.975  1.00 26.01 ? 125  SER B O   1 
ATOM   3285  C  CB  . SER B  1 43  ? 6.284   35.388   87.714  1.00 23.83 ? 125  SER B CB  1 
ATOM   3286  O  OG  . SER B  1 43  ? 6.875   36.657   87.898  1.00 23.13 ? 125  SER B OG  1 
ATOM   3287  N  N   . HIS B  1 44  ? 8.068   35.280   85.629  1.00 25.61 ? 126  HIS B N   1 
ATOM   3288  C  CA  . HIS B  1 44  ? 9.032   35.694   84.627  1.00 26.16 ? 126  HIS B CA  1 
ATOM   3289  C  C   . HIS B  1 44  ? 9.464   37.122   84.944  1.00 26.24 ? 126  HIS B C   1 
ATOM   3290  O  O   . HIS B  1 44  ? 10.210  37.738   84.184  1.00 27.10 ? 126  HIS B O   1 
ATOM   3291  C  CB  . HIS B  1 44  ? 8.393   35.647   83.243  1.00 25.73 ? 126  HIS B CB  1 
ATOM   3292  C  CG  . HIS B  1 44  ? 7.247   36.593   83.083  1.00 28.20 ? 126  HIS B CG  1 
ATOM   3293  N  ND1 . HIS B  1 44  ? 6.128   36.552   83.887  1.00 30.12 ? 126  HIS B ND1 1 
ATOM   3294  C  CD2 . HIS B  1 44  ? 7.042   37.608   82.209  1.00 28.96 ? 126  HIS B CD2 1 
ATOM   3295  C  CE1 . HIS B  1 44  ? 5.282   37.495   83.514  1.00 30.22 ? 126  HIS B CE1 1 
ATOM   3296  N  NE2 . HIS B  1 44  ? 5.814   38.150   82.497  1.00 30.93 ? 126  HIS B NE2 1 
ATOM   3297  N  N   . LEU B  1 45  ? 8.998   37.652   86.068  1.00 25.35 ? 127  LEU B N   1 
ATOM   3298  C  CA  . LEU B  1 45  ? 9.345   39.022   86.417  1.00 26.33 ? 127  LEU B CA  1 
ATOM   3299  C  C   . LEU B  1 45  ? 9.740   39.226   87.866  1.00 27.41 ? 127  LEU B C   1 
ATOM   3300  O  O   . LEU B  1 45  ? 10.598  40.057   88.163  1.00 28.15 ? 127  LEU B O   1 
ATOM   3301  C  CB  . LEU B  1 45  ? 8.182   39.966   86.091  1.00 24.01 ? 127  LEU B CB  1 
ATOM   3302  C  CG  . LEU B  1 45  ? 7.720   40.037   84.632  1.00 22.69 ? 127  LEU B CG  1 
ATOM   3303  C  CD1 . LEU B  1 45  ? 6.423   40.843   84.540  1.00 19.19 ? 127  LEU B CD1 1 
ATOM   3304  C  CD2 . LEU B  1 45  ? 8.816   40.656   83.779  1.00 16.15 ? 127  LEU B CD2 1 
ATOM   3305  N  N   . GLU B  1 46  ? 9.126   38.483   88.775  1.00 27.11 ? 128  GLU B N   1 
ATOM   3306  C  CA  . GLU B  1 46  ? 9.455   38.672   90.173  1.00 28.82 ? 128  GLU B CA  1 
ATOM   3307  C  C   . GLU B  1 46  ? 9.350   37.400   90.986  1.00 28.60 ? 128  GLU B C   1 
ATOM   3308  O  O   . GLU B  1 46  ? 8.815   36.394   90.529  1.00 29.66 ? 128  GLU B O   1 
ATOM   3309  C  CB  . GLU B  1 46  ? 8.531   39.735   90.785  1.00 31.12 ? 128  GLU B CB  1 
ATOM   3310  C  CG  . GLU B  1 46  ? 7.090   39.270   90.987  1.00 35.36 ? 128  GLU B CG  1 
ATOM   3311  C  CD  . GLU B  1 46  ? 6.302   40.168   91.942  1.00 39.55 ? 128  GLU B CD  1 
ATOM   3312  O  OE1 . GLU B  1 46  ? 6.931   40.832   92.799  1.00 42.44 ? 128  GLU B OE1 1 
ATOM   3313  O  OE2 . GLU B  1 46  ? 5.053   40.200   91.855  1.00 39.19 ? 128  GLU B OE2 1 
ATOM   3314  N  N   . CYS B  1 47  ? 9.874   37.453   92.200  1.00 27.51 ? 129  CYS B N   1 
ATOM   3315  C  CA  . CYS B  1 47  ? 9.799   36.318   93.096  1.00 28.63 ? 129  CYS B CA  1 
ATOM   3316  C  C   . CYS B  1 47  ? 9.026   36.782   94.326  1.00 26.43 ? 129  CYS B C   1 
ATOM   3317  O  O   . CYS B  1 47  ? 9.290   37.849   94.880  1.00 24.43 ? 129  CYS B O   1 
ATOM   3318  C  CB  . CYS B  1 47  ? 11.195  35.845   93.496  1.00 31.07 ? 129  CYS B CB  1 
ATOM   3319  S  SG  . CYS B  1 47  ? 12.199  35.127   92.144  1.00 38.18 ? 129  CYS B SG  1 
ATOM   3320  N  N   . ARG B  1 48  ? 8.058   35.980   94.745  1.00 24.67 ? 130  ARG B N   1 
ATOM   3321  C  CA  . ARG B  1 48  ? 7.252   36.332   95.895  1.00 24.05 ? 130  ARG B CA  1 
ATOM   3322  C  C   . ARG B  1 48  ? 7.338   35.263   96.962  1.00 24.43 ? 130  ARG B C   1 
ATOM   3323  O  O   . ARG B  1 48  ? 7.758   34.127   96.705  1.00 24.44 ? 130  ARG B O   1 
ATOM   3324  C  CB  . ARG B  1 48  ? 5.791   36.508   95.475  1.00 23.53 ? 130  ARG B CB  1 
ATOM   3325  C  CG  . ARG B  1 48  ? 5.570   37.564   94.401  1.00 24.63 ? 130  ARG B CG  1 
ATOM   3326  C  CD  . ARG B  1 48  ? 4.111   37.627   94.000  1.00 25.63 ? 130  ARG B CD  1 
ATOM   3327  N  NE  . ARG B  1 48  ? 3.252   37.937   95.135  1.00 26.31 ? 130  ARG B NE  1 
ATOM   3328  C  CZ  . ARG B  1 48  ? 3.182   39.127   95.713  1.00 26.57 ? 130  ARG B CZ  1 
ATOM   3329  N  NH1 . ARG B  1 48  ? 2.372   39.320   96.746  1.00 27.06 ? 130  ARG B NH1 1 
ATOM   3330  N  NH2 . ARG B  1 48  ? 3.917   40.127   95.250  1.00 27.86 ? 130  ARG B NH2 1 
ATOM   3331  N  N   . THR B  1 49  ? 6.944   35.639   98.169  1.00 23.15 ? 131  THR B N   1 
ATOM   3332  C  CA  . THR B  1 49  ? 6.933   34.712   99.281  1.00 21.75 ? 131  THR B CA  1 
ATOM   3333  C  C   . THR B  1 49  ? 5.486   34.394   99.619  1.00 20.75 ? 131  THR B C   1 
ATOM   3334  O  O   . THR B  1 49  ? 4.708   35.289   99.935  1.00 20.75 ? 131  THR B O   1 
ATOM   3335  C  CB  . THR B  1 49  ? 7.590   35.313   100.543 1.00 20.57 ? 131  THR B CB  1 
ATOM   3336  O  OG1 . THR B  1 49  ? 8.996   35.452   100.333 1.00 23.36 ? 131  THR B OG1 1 
ATOM   3337  C  CG2 . THR B  1 49  ? 7.378   34.410   101.734 1.00 17.86 ? 131  THR B CG2 1 
ATOM   3338  N  N   . PHE B  1 50  ? 5.121   33.124   99.522  1.00 20.11 ? 132  PHE B N   1 
ATOM   3339  C  CA  . PHE B  1 50  ? 3.784   32.706   99.901  1.00 19.84 ? 132  PHE B CA  1 
ATOM   3340  C  C   . PHE B  1 50  ? 3.918   32.104   101.288 1.00 19.81 ? 132  PHE B C   1 
ATOM   3341  O  O   . PHE B  1 50  ? 4.970   31.579   101.658 1.00 21.54 ? 132  PHE B O   1 
ATOM   3342  C  CB  . PHE B  1 50  ? 3.232   31.652   98.955  1.00 18.96 ? 132  PHE B CB  1 
ATOM   3343  C  CG  . PHE B  1 50  ? 3.055   32.135   97.557  1.00 20.82 ? 132  PHE B CG  1 
ATOM   3344  C  CD1 . PHE B  1 50  ? 4.143   32.247   96.705  1.00 22.20 ? 132  PHE B CD1 1 
ATOM   3345  C  CD2 . PHE B  1 50  ? 1.797   32.468   97.082  1.00 20.08 ? 132  PHE B CD2 1 
ATOM   3346  C  CE1 . PHE B  1 50  ? 3.979   32.680   95.398  1.00 23.22 ? 132  PHE B CE1 1 
ATOM   3347  C  CE2 . PHE B  1 50  ? 1.620   32.903   95.775  1.00 21.01 ? 132  PHE B CE2 1 
ATOM   3348  C  CZ  . PHE B  1 50  ? 2.708   33.008   94.932  1.00 21.72 ? 132  PHE B CZ  1 
ATOM   3349  N  N   . PHE B  1 51  ? 2.852   32.171   102.061 1.00 18.98 ? 133  PHE B N   1 
ATOM   3350  C  CA  . PHE B  1 51  ? 2.895   31.624   103.398 1.00 19.04 ? 133  PHE B CA  1 
ATOM   3351  C  C   . PHE B  1 51  ? 1.474   31.385   103.842 1.00 18.73 ? 133  PHE B C   1 
ATOM   3352  O  O   . PHE B  1 51  ? 0.536   31.796   103.172 1.00 18.28 ? 133  PHE B O   1 
ATOM   3353  C  CB  . PHE B  1 51  ? 3.593   32.616   104.326 1.00 18.41 ? 133  PHE B CB  1 
ATOM   3354  C  CG  . PHE B  1 51  ? 3.061   34.014   104.213 1.00 17.20 ? 133  PHE B CG  1 
ATOM   3355  C  CD1 . PHE B  1 51  ? 2.099   34.478   105.096 1.00 14.55 ? 133  PHE B CD1 1 
ATOM   3356  C  CD2 . PHE B  1 51  ? 3.510   34.862   103.202 1.00 16.70 ? 133  PHE B CD2 1 
ATOM   3357  C  CE1 . PHE B  1 51  ? 1.585   35.763   104.980 1.00 13.15 ? 133  PHE B CE1 1 
ATOM   3358  C  CE2 . PHE B  1 51  ? 2.997   36.159   103.076 1.00 15.61 ? 133  PHE B CE2 1 
ATOM   3359  C  CZ  . PHE B  1 51  ? 2.036   36.606   103.968 1.00 13.81 ? 133  PHE B CZ  1 
ATOM   3360  N  N   . LEU B  1 52  ? 1.324   30.691   104.959 1.00 18.62 ? 134  LEU B N   1 
ATOM   3361  C  CA  . LEU B  1 52  ? 0.012   30.410   105.502 1.00 18.50 ? 134  LEU B CA  1 
ATOM   3362  C  C   . LEU B  1 52  ? -0.091  31.139   106.831 1.00 20.40 ? 134  LEU B C   1 
ATOM   3363  O  O   . LEU B  1 52  ? 0.881   31.190   107.585 1.00 21.17 ? 134  LEU B O   1 
ATOM   3364  C  CB  . LEU B  1 52  ? -0.168  28.905   105.715 1.00 16.61 ? 134  LEU B CB  1 
ATOM   3365  C  CG  . LEU B  1 52  ? -0.288  28.021   104.472 1.00 15.14 ? 134  LEU B CG  1 
ATOM   3366  C  CD1 . LEU B  1 52  ? -0.774  26.622   104.881 1.00 16.03 ? 134  LEU B CD1 1 
ATOM   3367  C  CD2 . LEU B  1 52  ? -1.267  28.637   103.510 1.00 12.80 ? 134  LEU B CD2 1 
ATOM   3368  N  N   . THR B  1 53  ? -1.252  31.713   107.122 1.00 21.04 ? 135  THR B N   1 
ATOM   3369  C  CA  . THR B  1 53  ? -1.415  32.413   108.381 1.00 25.23 ? 135  THR B CA  1 
ATOM   3370  C  C   . THR B  1 53  ? -2.709  32.079   109.088 1.00 27.91 ? 135  THR B C   1 
ATOM   3371  O  O   . THR B  1 53  ? -3.737  31.824   108.453 1.00 30.25 ? 135  THR B O   1 
ATOM   3372  C  CB  . THR B  1 53  ? -1.376  33.936   108.200 1.00 26.23 ? 135  THR B CB  1 
ATOM   3373  O  OG1 . THR B  1 53  ? -2.384  34.337   107.264 1.00 26.98 ? 135  THR B OG1 1 
ATOM   3374  C  CG2 . THR B  1 53  ? -0.023  34.374   107.717 1.00 29.83 ? 135  THR B CG2 1 
ATOM   3375  N  N   . GLN B  1 54  ? -2.647  32.091   110.415 1.00 29.76 ? 136  GLN B N   1 
ATOM   3376  C  CA  . GLN B  1 54  ? -3.811  31.826   111.247 1.00 31.45 ? 136  GLN B CA  1 
ATOM   3377  C  C   . GLN B  1 54  ? -4.643  33.098   111.305 1.00 29.45 ? 136  GLN B C   1 
ATOM   3378  O  O   . GLN B  1 54  ? -5.672  33.144   111.966 1.00 30.98 ? 136  GLN B O   1 
ATOM   3379  C  CB  . GLN B  1 54  ? -3.374  31.445   112.663 1.00 34.96 ? 136  GLN B CB  1 
ATOM   3380  C  CG  . GLN B  1 54  ? -3.061  29.974   112.871 1.00 39.54 ? 136  GLN B CG  1 
ATOM   3381  C  CD  . GLN B  1 54  ? -4.299  29.090   112.773 1.00 42.46 ? 136  GLN B CD  1 
ATOM   3382  O  OE1 . GLN B  1 54  ? -5.357  29.407   113.333 1.00 42.65 ? 136  GLN B OE1 1 
ATOM   3383  N  NE2 . GLN B  1 54  ? -4.167  27.966   112.072 1.00 44.00 ? 136  GLN B NE2 1 
ATOM   3384  N  N   . GLY B  1 55  ? -4.189  34.129   110.607 1.00 28.13 ? 137  GLY B N   1 
ATOM   3385  C  CA  . GLY B  1 55  ? -4.900  35.391   110.622 1.00 27.00 ? 137  GLY B CA  1 
ATOM   3386  C  C   . GLY B  1 55  ? -4.650  36.157   111.911 1.00 26.42 ? 137  GLY B C   1 
ATOM   3387  O  O   . GLY B  1 55  ? -5.528  36.860   112.401 1.00 28.46 ? 137  GLY B O   1 
ATOM   3388  N  N   . ALA B  1 56  ? -3.452  36.021   112.466 1.00 23.44 ? 138  ALA B N   1 
ATOM   3389  C  CA  . ALA B  1 56  ? -3.105  36.707   113.699 1.00 21.41 ? 138  ALA B CA  1 
ATOM   3390  C  C   . ALA B  1 56  ? -1.729  37.358   113.575 1.00 20.54 ? 138  ALA B C   1 
ATOM   3391  O  O   . ALA B  1 56  ? -0.892  36.938   112.776 1.00 20.49 ? 138  ALA B O   1 
ATOM   3392  C  CB  . ALA B  1 56  ? -3.119  35.728   114.858 1.00 21.11 ? 138  ALA B CB  1 
ATOM   3393  N  N   . LEU B  1 57  ? -1.494  38.400   114.354 1.00 18.72 ? 139  LEU B N   1 
ATOM   3394  C  CA  . LEU B  1 57  ? -0.209  39.061   114.290 1.00 16.86 ? 139  LEU B CA  1 
ATOM   3395  C  C   . LEU B  1 57  ? 0.615   38.653   115.498 1.00 16.96 ? 139  LEU B C   1 
ATOM   3396  O  O   . LEU B  1 57  ? 0.069   38.240   116.520 1.00 15.30 ? 139  LEU B O   1 
ATOM   3397  C  CB  . LEU B  1 57  ? -0.389  40.582   114.264 1.00 15.65 ? 139  LEU B CB  1 
ATOM   3398  C  CG  . LEU B  1 57  ? -1.230  41.159   113.115 1.00 15.83 ? 139  LEU B CG  1 
ATOM   3399  C  CD1 . LEU B  1 57  ? -1.214  42.674   113.178 1.00 13.39 ? 139  LEU B CD1 1 
ATOM   3400  C  CD2 . LEU B  1 57  ? -0.681  40.687   111.783 1.00 15.70 ? 139  LEU B CD2 1 
ATOM   3401  N  N   . LEU B  1 58  ? 1.935   38.751   115.358 1.00 16.86 ? 140  LEU B N   1 
ATOM   3402  C  CA  . LEU B  1 58  ? 2.847   38.428   116.437 1.00 16.31 ? 140  LEU B CA  1 
ATOM   3403  C  C   . LEU B  1 58  ? 2.548   39.359   117.596 1.00 16.99 ? 140  LEU B C   1 
ATOM   3404  O  O   . LEU B  1 58  ? 2.081   40.481   117.397 1.00 16.69 ? 140  LEU B O   1 
ATOM   3405  C  CB  . LEU B  1 58  ? 4.297   38.625   115.989 1.00 16.20 ? 140  LEU B CB  1 
ATOM   3406  C  CG  . LEU B  1 58  ? 4.890   37.597   115.018 1.00 15.24 ? 140  LEU B CG  1 
ATOM   3407  C  CD1 . LEU B  1 58  ? 6.295   38.015   114.641 1.00 15.25 ? 140  LEU B CD1 1 
ATOM   3408  C  CD2 . LEU B  1 58  ? 4.917   36.232   115.673 1.00 13.02 ? 140  LEU B CD2 1 
ATOM   3409  N  N   . ASN B  1 59  ? 2.823   38.876   118.802 1.00 18.22 ? 141  ASN B N   1 
ATOM   3410  C  CA  . ASN B  1 59  ? 2.616   39.622   120.034 1.00 18.87 ? 141  ASN B CA  1 
ATOM   3411  C  C   . ASN B  1 59  ? 1.180   40.011   120.315 1.00 20.63 ? 141  ASN B C   1 
ATOM   3412  O  O   . ASN B  1 59  ? 0.931   40.980   121.026 1.00 21.94 ? 141  ASN B O   1 
ATOM   3413  C  CB  . ASN B  1 59  ? 3.489   40.873   120.071 1.00 18.70 ? 141  ASN B CB  1 
ATOM   3414  C  CG  . ASN B  1 59  ? 4.405   40.895   121.283 1.00 20.21 ? 141  ASN B CG  1 
ATOM   3415  O  OD1 . ASN B  1 59  ? 4.119   40.245   122.286 1.00 22.35 ? 141  ASN B OD1 1 
ATOM   3416  N  ND2 . ASN B  1 59  ? 5.503   41.648   121.204 1.00 19.68 ? 141  ASN B ND2 1 
ATOM   3417  N  N   . ASP B  1 60  ? 0.238   39.260   119.760 1.00 20.91 ? 142  ASP B N   1 
ATOM   3418  C  CA  . ASP B  1 60  ? -1.177  39.519   119.990 1.00 22.47 ? 142  ASP B CA  1 
ATOM   3419  C  C   . ASP B  1 60  ? -1.805  38.231   120.498 1.00 23.13 ? 142  ASP B C   1 
ATOM   3420  O  O   . ASP B  1 60  ? -1.328  37.137   120.190 1.00 23.34 ? 142  ASP B O   1 
ATOM   3421  C  CB  . ASP B  1 60  ? -1.882  39.952   118.710 1.00 24.73 ? 142  ASP B CB  1 
ATOM   3422  C  CG  . ASP B  1 60  ? -3.368  40.229   118.930 1.00 28.39 ? 142  ASP B CG  1 
ATOM   3423  O  OD1 . ASP B  1 60  ? -3.705  41.231   119.610 1.00 28.47 ? 142  ASP B OD1 1 
ATOM   3424  O  OD2 . ASP B  1 60  ? -4.203  39.440   118.428 1.00 30.34 ? 142  ASP B OD2 1 
ATOM   3425  N  N   . LYS B  1 61  ? -2.881  38.360   121.265 1.00 23.37 ? 143  LYS B N   1 
ATOM   3426  C  CA  . LYS B  1 61  ? -3.550  37.204   121.850 1.00 22.99 ? 143  LYS B CA  1 
ATOM   3427  C  C   . LYS B  1 61  ? -4.086  36.188   120.848 1.00 23.22 ? 143  LYS B C   1 
ATOM   3428  O  O   . LYS B  1 61  ? -4.235  35.011   121.167 1.00 23.59 ? 143  LYS B O   1 
ATOM   3429  C  CB  . LYS B  1 61  ? -4.685  37.668   122.756 1.00 21.74 ? 143  LYS B CB  1 
ATOM   3430  C  CG  . LYS B  1 61  ? -5.896  38.232   122.037 1.00 18.54 ? 143  LYS B CG  1 
ATOM   3431  C  CD  . LYS B  1 61  ? -6.969  38.544   123.071 1.00 18.94 ? 143  LYS B CD  1 
ATOM   3432  C  CE  . LYS B  1 61  ? -8.282  38.944   122.432 1.00 19.80 ? 143  LYS B CE  1 
ATOM   3433  N  NZ  . LYS B  1 61  ? -9.297  39.320   123.462 1.00 19.97 ? 143  LYS B NZ  1 
ATOM   3434  N  N   . HIS B  1 62  ? -4.373  36.630   119.635 1.00 23.66 ? 144  HIS B N   1 
ATOM   3435  C  CA  . HIS B  1 62  ? -4.898  35.715   118.637 1.00 24.83 ? 144  HIS B CA  1 
ATOM   3436  C  C   . HIS B  1 62  ? -3.845  34.774   118.074 1.00 25.45 ? 144  HIS B C   1 
ATOM   3437  O  O   . HIS B  1 62  ? -4.161  33.884   117.287 1.00 24.66 ? 144  HIS B O   1 
ATOM   3438  C  CB  . HIS B  1 62  ? -5.576  36.508   117.520 1.00 25.60 ? 144  HIS B CB  1 
ATOM   3439  C  CG  . HIS B  1 62  ? -6.790  37.250   117.978 1.00 24.37 ? 144  HIS B CG  1 
ATOM   3440  N  ND1 . HIS B  1 62  ? -7.961  36.615   118.325 1.00 25.75 ? 144  HIS B ND1 1 
ATOM   3441  C  CD2 . HIS B  1 62  ? -6.995  38.567   118.217 1.00 23.89 ? 144  HIS B CD2 1 
ATOM   3442  C  CE1 . HIS B  1 62  ? -8.834  37.505   118.761 1.00 25.10 ? 144  HIS B CE1 1 
ATOM   3443  N  NE2 . HIS B  1 62  ? -8.271  38.698   118.706 1.00 24.52 ? 144  HIS B NE2 1 
ATOM   3444  N  N   . SER B  1 63  ? -2.597  34.965   118.485 1.00 27.12 ? 145  SER B N   1 
ATOM   3445  C  CA  . SER B  1 63  ? -1.518  34.102   118.029 1.00 29.04 ? 145  SER B CA  1 
ATOM   3446  C  C   . SER B  1 63  ? -1.392  32.917   118.981 1.00 29.96 ? 145  SER B C   1 
ATOM   3447  O  O   . SER B  1 63  ? -0.485  32.106   118.841 1.00 28.82 ? 145  SER B O   1 
ATOM   3448  C  CB  . SER B  1 63  ? -0.193  34.865   118.003 1.00 29.69 ? 145  SER B CB  1 
ATOM   3449  O  OG  . SER B  1 63  ? 0.287   35.092   119.317 1.00 30.92 ? 145  SER B OG  1 
ATOM   3450  N  N   . ASN B  1 64  ? -2.321  32.828   119.933 1.00 33.74 ? 146  ASN B N   1 
ATOM   3451  C  CA  . ASN B  1 64  ? -2.356  31.775   120.954 1.00 37.43 ? 146  ASN B CA  1 
ATOM   3452  C  C   . ASN B  1 64  ? -1.923  30.391   120.488 1.00 40.16 ? 146  ASN B C   1 
ATOM   3453  O  O   . ASN B  1 64  ? -1.482  29.580   121.288 1.00 42.07 ? 146  ASN B O   1 
ATOM   3454  C  CB  . ASN B  1 64  ? -3.746  31.683   121.569 1.00 38.03 ? 146  ASN B CB  1 
ATOM   3455  C  CG  . ASN B  1 64  ? -3.719  31.169   122.998 1.00 38.91 ? 146  ASN B CG  1 
ATOM   3456  O  OD1 . ASN B  1 64  ? -3.110  30.143   123.292 1.00 36.91 ? 146  ASN B OD1 1 
ATOM   3457  N  ND2 . ASN B  1 64  ? -4.395  31.882   123.894 1.00 41.21 ? 146  ASN B ND2 1 
ATOM   3458  N  N   . GLY B  1 65  ? -2.083  30.102   119.207 1.00 43.06 ? 147  GLY B N   1 
ATOM   3459  C  CA  . GLY B  1 65  ? -1.624  28.826   118.672 1.00 46.78 ? 147  GLY B CA  1 
ATOM   3460  C  C   . GLY B  1 65  ? -2.055  27.479   119.233 1.00 48.53 ? 147  GLY B C   1 
ATOM   3461  O  O   . GLY B  1 65  ? -1.604  26.445   118.740 1.00 49.24 ? 147  GLY B O   1 
ATOM   3462  N  N   . THR B  1 66  ? -2.895  27.447   120.257 1.00 50.96 ? 148  THR B N   1 
ATOM   3463  C  CA  . THR B  1 66  ? -3.333  26.150   120.759 1.00 53.92 ? 148  THR B CA  1 
ATOM   3464  C  C   . THR B  1 66  ? -4.299  25.592   119.707 1.00 55.10 ? 148  THR B C   1 
ATOM   3465  O  O   . THR B  1 66  ? -4.678  24.423   119.736 1.00 55.93 ? 148  THR B O   1 
ATOM   3466  C  CB  . THR B  1 66  ? -4.050  26.266   122.142 1.00 54.94 ? 148  THR B CB  1 
ATOM   3467  O  OG1 . THR B  1 66  ? -5.160  27.172   122.047 1.00 54.93 ? 148  THR B OG1 1 
ATOM   3468  C  CG2 . THR B  1 66  ? -3.069  26.758   123.217 1.00 53.94 ? 148  THR B CG2 1 
ATOM   3469  N  N   . VAL B  1 67  ? -4.661  26.451   118.759 1.00 56.10 ? 149  VAL B N   1 
ATOM   3470  C  CA  . VAL B  1 67  ? -5.574  26.111   117.674 1.00 56.55 ? 149  VAL B CA  1 
ATOM   3471  C  C   . VAL B  1 67  ? -5.096  24.960   116.778 1.00 57.05 ? 149  VAL B C   1 
ATOM   3472  O  O   . VAL B  1 67  ? -3.895  24.776   116.550 1.00 57.29 ? 149  VAL B O   1 
ATOM   3473  C  CB  . VAL B  1 67  ? -5.820  27.340   116.763 1.00 56.29 ? 149  VAL B CB  1 
ATOM   3474  C  CG1 . VAL B  1 67  ? -6.974  27.063   115.806 1.00 56.69 ? 149  VAL B CG1 1 
ATOM   3475  C  CG2 . VAL B  1 67  ? -6.098  28.568   117.611 1.00 56.42 ? 149  VAL B CG2 1 
ATOM   3476  N  N   . LYS B  1 68  ? -6.057  24.191   116.275 1.00 56.75 ? 150  LYS B N   1 
ATOM   3477  C  CA  . LYS B  1 68  ? -5.783  23.081   115.371 1.00 55.66 ? 150  LYS B CA  1 
ATOM   3478  C  C   . LYS B  1 68  ? -5.001  23.630   114.175 1.00 54.64 ? 150  LYS B C   1 
ATOM   3479  O  O   . LYS B  1 68  ? -5.298  24.726   113.691 1.00 54.80 ? 150  LYS B O   1 
ATOM   3480  C  CB  . LYS B  1 68  ? -7.106  22.486   114.884 1.00 56.80 ? 150  LYS B CB  1 
ATOM   3481  C  CG  . LYS B  1 68  ? -8.190  23.549   114.686 1.00 59.21 ? 150  LYS B CG  1 
ATOM   3482  C  CD  . LYS B  1 68  ? -9.178  23.211   113.574 1.00 61.16 ? 150  LYS B CD  1 
ATOM   3483  C  CE  . LYS B  1 68  ? -9.996  21.964   113.875 1.00 63.20 ? 150  LYS B CE  1 
ATOM   3484  N  NZ  . LYS B  1 68  ? -10.945 21.654   112.757 1.00 64.30 ? 150  LYS B NZ  1 
ATOM   3485  N  N   . ASP B  1 69  ? -4.001  22.880   113.710 1.00 52.54 ? 151  ASP B N   1 
ATOM   3486  C  CA  . ASP B  1 69  ? -3.193  23.295   112.559 1.00 49.21 ? 151  ASP B CA  1 
ATOM   3487  C  C   . ASP B  1 69  ? -4.105  23.658   111.391 1.00 45.38 ? 151  ASP B C   1 
ATOM   3488  O  O   . ASP B  1 69  ? -3.891  24.647   110.697 1.00 44.38 ? 151  ASP B O   1 
ATOM   3489  C  CB  . ASP B  1 69  ? -2.269  22.159   112.104 1.00 52.58 ? 151  ASP B CB  1 
ATOM   3490  C  CG  . ASP B  1 69  ? -1.138  21.887   113.079 1.00 56.21 ? 151  ASP B CG  1 
ATOM   3491  O  OD1 . ASP B  1 69  ? -0.311  22.802   113.296 1.00 57.77 ? 151  ASP B OD1 1 
ATOM   3492  O  OD2 . ASP B  1 69  ? -1.074  20.758   113.620 1.00 56.81 ? 151  ASP B OD2 1 
ATOM   3493  N  N   . ARG B  1 70  ? -5.129  22.840   111.187 1.00 41.18 ? 152  ARG B N   1 
ATOM   3494  C  CA  . ARG B  1 70  ? -6.066  23.037   110.095 1.00 36.66 ? 152  ARG B CA  1 
ATOM   3495  C  C   . ARG B  1 70  ? -7.321  23.791   110.520 1.00 35.12 ? 152  ARG B C   1 
ATOM   3496  O  O   . ARG B  1 70  ? -8.398  23.203   110.619 1.00 36.43 ? 152  ARG B O   1 
ATOM   3497  C  CB  . ARG B  1 70  ? -6.447  21.675   109.507 1.00 34.31 ? 152  ARG B CB  1 
ATOM   3498  C  CG  . ARG B  1 70  ? -5.267  20.891   108.940 1.00 30.96 ? 152  ARG B CG  1 
ATOM   3499  C  CD  . ARG B  1 70  ? -5.705  19.539   108.402 1.00 30.13 ? 152  ARG B CD  1 
ATOM   3500  N  NE  . ARG B  1 70  ? -6.030  18.602   109.472 1.00 27.67 ? 152  ARG B NE  1 
ATOM   3501  C  CZ  . ARG B  1 70  ? -5.139  18.114   110.331 1.00 26.76 ? 152  ARG B CZ  1 
ATOM   3502  N  NH1 . ARG B  1 70  ? -5.520  17.269   111.276 1.00 26.64 ? 152  ARG B NH1 1 
ATOM   3503  N  NH2 . ARG B  1 70  ? -3.867  18.463   110.242 1.00 24.43 ? 152  ARG B NH2 1 
ATOM   3504  N  N   . SER B  1 71  ? -7.197  25.091   110.768 1.00 31.53 ? 153  SER B N   1 
ATOM   3505  C  CA  . SER B  1 71  ? -8.362  25.864   111.174 1.00 28.81 ? 153  SER B CA  1 
ATOM   3506  C  C   . SER B  1 71  ? -8.960  26.558   109.963 1.00 26.97 ? 153  SER B C   1 
ATOM   3507  O  O   . SER B  1 71  ? -8.349  26.599   108.900 1.00 27.14 ? 153  SER B O   1 
ATOM   3508  C  CB  . SER B  1 71  ? -7.991  26.901   112.242 1.00 28.47 ? 153  SER B CB  1 
ATOM   3509  O  OG  . SER B  1 71  ? -7.582  28.123   111.662 1.00 27.66 ? 153  SER B OG  1 
ATOM   3510  N  N   . PRO B  1 72  ? -10.179 27.097   110.102 1.00 25.95 ? 154  PRO B N   1 
ATOM   3511  C  CA  . PRO B  1 72  ? -10.816 27.782   108.977 1.00 24.22 ? 154  PRO B CA  1 
ATOM   3512  C  C   . PRO B  1 72  ? -10.300 29.196   108.773 1.00 23.00 ? 154  PRO B C   1 
ATOM   3513  O  O   . PRO B  1 72  ? -10.743 29.893   107.877 1.00 23.27 ? 154  PRO B O   1 
ATOM   3514  C  CB  . PRO B  1 72  ? -12.296 27.744   109.346 1.00 24.70 ? 154  PRO B CB  1 
ATOM   3515  C  CG  . PRO B  1 72  ? -12.266 27.823   110.833 1.00 24.66 ? 154  PRO B CG  1 
ATOM   3516  C  CD  . PRO B  1 72  ? -11.142 26.877   111.196 1.00 25.11 ? 154  PRO B CD  1 
ATOM   3517  N  N   . HIS B  1 73  ? -9.351  29.610   109.601 1.00 23.23 ? 155  HIS B N   1 
ATOM   3518  C  CA  . HIS B  1 73  ? -8.777  30.950   109.504 1.00 23.62 ? 155  HIS B CA  1 
ATOM   3519  C  C   . HIS B  1 73  ? -7.458  30.932   108.737 1.00 23.71 ? 155  HIS B C   1 
ATOM   3520  O  O   . HIS B  1 73  ? -6.946  31.977   108.334 1.00 24.52 ? 155  HIS B O   1 
ATOM   3521  C  CB  . HIS B  1 73  ? -8.535  31.504   110.902 1.00 24.38 ? 155  HIS B CB  1 
ATOM   3522  C  CG  . HIS B  1 73  ? -9.752  31.492   111.767 1.00 27.39 ? 155  HIS B CG  1 
ATOM   3523  N  ND1 . HIS B  1 73  ? -9.725  31.075   113.079 1.00 29.85 ? 155  HIS B ND1 1 
ATOM   3524  C  CD2 . HIS B  1 73  ? -11.033 31.848   111.511 1.00 28.23 ? 155  HIS B CD2 1 
ATOM   3525  C  CE1 . HIS B  1 73  ? -10.938 31.175   113.596 1.00 29.88 ? 155  HIS B CE1 1 
ATOM   3526  N  NE2 . HIS B  1 73  ? -11.750 31.641   112.665 1.00 29.13 ? 155  HIS B NE2 1 
ATOM   3527  N  N   . ARG B  1 74  ? -6.903  29.739   108.556 1.00 22.15 ? 156  ARG B N   1 
ATOM   3528  C  CA  . ARG B  1 74  ? -5.650  29.590   107.839 1.00 20.46 ? 156  ARG B CA  1 
ATOM   3529  C  C   . ARG B  1 74  ? -5.860  30.096   106.409 1.00 19.13 ? 156  ARG B C   1 
ATOM   3530  O  O   . ARG B  1 74  ? -6.761  29.648   105.702 1.00 16.52 ? 156  ARG B O   1 
ATOM   3531  C  CB  . ARG B  1 74  ? -5.236  28.114   107.827 1.00 21.16 ? 156  ARG B CB  1 
ATOM   3532  C  CG  . ARG B  1 74  ? -3.736  27.854   107.779 1.00 22.98 ? 156  ARG B CG  1 
ATOM   3533  C  CD  . ARG B  1 74  ? -3.132  27.865   109.177 1.00 25.69 ? 156  ARG B CD  1 
ATOM   3534  N  NE  . ARG B  1 74  ? -1.687  27.596   109.199 1.00 29.02 ? 156  ARG B NE  1 
ATOM   3535  C  CZ  . ARG B  1 74  ? -1.111  26.464   108.791 1.00 29.03 ? 156  ARG B CZ  1 
ATOM   3536  N  NH1 . ARG B  1 74  ? 0.209   26.328   108.864 1.00 29.84 ? 156  ARG B NH1 1 
ATOM   3537  N  NH2 . ARG B  1 74  ? -1.842  25.471   108.299 1.00 29.14 ? 156  ARG B NH2 1 
ATOM   3538  N  N   . THR B  1 75  ? -5.037  31.045   105.983 1.00 18.69 ? 157  THR B N   1 
ATOM   3539  C  CA  . THR B  1 75  ? -5.171  31.565   104.630 1.00 20.12 ? 157  THR B CA  1 
ATOM   3540  C  C   . THR B  1 75  ? -3.818  31.610   103.935 1.00 20.19 ? 157  THR B C   1 
ATOM   3541  O  O   . THR B  1 75  ? -2.777  31.715   104.584 1.00 21.41 ? 157  THR B O   1 
ATOM   3542  C  CB  . THR B  1 75  ? -5.759  32.997   104.619 1.00 21.29 ? 157  THR B CB  1 
ATOM   3543  O  OG1 . THR B  1 75  ? -4.883  33.879   105.336 1.00 22.15 ? 157  THR B OG1 1 
ATOM   3544  C  CG2 . THR B  1 75  ? -7.152  33.022   105.262 1.00 20.07 ? 157  THR B CG2 1 
ATOM   3545  N  N   . LEU B  1 76  ? -3.840  31.513   102.611 1.00 19.18 ? 158  LEU B N   1 
ATOM   3546  C  CA  . LEU B  1 76  ? -2.622  31.584   101.826 1.00 18.37 ? 158  LEU B CA  1 
ATOM   3547  C  C   . LEU B  1 76  ? -2.482  33.010   101.312 1.00 19.43 ? 158  LEU B C   1 
ATOM   3548  O  O   . LEU B  1 76  ? -3.405  33.560   100.699 1.00 17.58 ? 158  LEU B O   1 
ATOM   3549  C  CB  . LEU B  1 76  ? -2.658  30.632   100.630 1.00 16.26 ? 158  LEU B CB  1 
ATOM   3550  C  CG  . LEU B  1 76  ? -1.457  30.906   99.716  1.00 14.88 ? 158  LEU B CG  1 
ATOM   3551  C  CD1 . LEU B  1 76  ? -0.176  30.449   100.407 1.00 14.50 ? 158  LEU B CD1 1 
ATOM   3552  C  CD2 . LEU B  1 76  ? -1.629  30.212   98.391  1.00 14.77 ? 158  LEU B CD2 1 
ATOM   3553  N  N   . MET B  1 77  ? -1.315  33.594   101.558 1.00 20.08 ? 159  MET B N   1 
ATOM   3554  C  CA  . MET B  1 77  ? -1.026  34.953   101.137 1.00 20.68 ? 159  MET B CA  1 
ATOM   3555  C  C   . MET B  1 77  ? 0.406   35.065   100.655 1.00 20.45 ? 159  MET B C   1 
ATOM   3556  O  O   . MET B  1 77  ? 1.219   34.165   100.873 1.00 19.32 ? 159  MET B O   1 
ATOM   3557  C  CB  . MET B  1 77  ? -1.237  35.908   102.301 1.00 21.14 ? 159  MET B CB  1 
ATOM   3558  C  CG  . MET B  1 77  ? -2.645  35.893   102.821 1.00 24.00 ? 159  MET B CG  1 
ATOM   3559  S  SD  . MET B  1 77  ? -2.893  37.242   103.957 1.00 27.52 ? 159  MET B SD  1 
ATOM   3560  C  CE  . MET B  1 77  ? -2.297  36.486   105.432 1.00 28.52 ? 159  MET B CE  1 
ATOM   3561  N  N   . SER B  1 78  ? 0.709   36.178   99.996  1.00 19.83 ? 160  SER B N   1 
ATOM   3562  C  CA  . SER B  1 78  ? 2.058   36.403   99.505  1.00 19.00 ? 160  SER B CA  1 
ATOM   3563  C  C   . SER B  1 78  ? 2.465   37.861   99.589  1.00 18.57 ? 160  SER B C   1 
ATOM   3564  O  O   . SER B  1 78  ? 1.629   38.766   99.669  1.00 16.28 ? 160  SER B O   1 
ATOM   3565  C  CB  . SER B  1 78  ? 2.192   35.929   98.061  1.00 18.31 ? 160  SER B CB  1 
ATOM   3566  O  OG  . SER B  1 78  ? 1.415   36.728   97.200  1.00 19.54 ? 160  SER B OG  1 
ATOM   3567  N  N   . CYS B  1 79  ? 3.771   38.075   99.575  1.00 18.51 ? 161  CYS B N   1 
ATOM   3568  C  CA  . CYS B  1 79  ? 4.324   39.410   99.630  1.00 20.97 ? 161  CYS B CA  1 
ATOM   3569  C  C   . CYS B  1 79  ? 5.680   39.298   98.973  1.00 21.75 ? 161  CYS B C   1 
ATOM   3570  O  O   . CYS B  1 79  ? 6.212   38.199   98.839  1.00 23.44 ? 161  CYS B O   1 
ATOM   3571  C  CB  . CYS B  1 79  ? 4.470   39.875   101.082 1.00 21.13 ? 161  CYS B CB  1 
ATOM   3572  S  SG  . CYS B  1 79  ? 5.674   38.967   102.056 1.00 24.22 ? 161  CYS B SG  1 
ATOM   3573  N  N   . PRO B  1 80  ? 6.256   40.424   98.537  1.00 22.32 ? 162  PRO B N   1 
ATOM   3574  C  CA  . PRO B  1 80  ? 7.572   40.335   97.898  1.00 21.30 ? 162  PRO B CA  1 
ATOM   3575  C  C   . PRO B  1 80  ? 8.629   39.668   98.768  1.00 20.21 ? 162  PRO B C   1 
ATOM   3576  O  O   . PRO B  1 80  ? 8.625   39.802   99.990  1.00 20.21 ? 162  PRO B O   1 
ATOM   3577  C  CB  . PRO B  1 80  ? 7.900   41.789   97.551  1.00 21.52 ? 162  PRO B CB  1 
ATOM   3578  C  CG  . PRO B  1 80  ? 6.992   42.594   98.439  1.00 23.73 ? 162  PRO B CG  1 
ATOM   3579  C  CD  . PRO B  1 80  ? 5.731   41.797   98.500  1.00 22.45 ? 162  PRO B CD  1 
ATOM   3580  N  N   . VAL B  1 81  ? 9.521   38.934   98.115  1.00 20.65 ? 163  VAL B N   1 
ATOM   3581  C  CA  . VAL B  1 81  ? 10.605  38.223   98.782  1.00 21.75 ? 163  VAL B CA  1 
ATOM   3582  C  C   . VAL B  1 81  ? 11.447  39.128   99.674  1.00 22.18 ? 163  VAL B C   1 
ATOM   3583  O  O   . VAL B  1 81  ? 11.794  40.244   99.293  1.00 21.91 ? 163  VAL B O   1 
ATOM   3584  C  CB  . VAL B  1 81  ? 11.563  37.552   97.747  1.00 22.16 ? 163  VAL B CB  1 
ATOM   3585  C  CG1 . VAL B  1 81  ? 12.757  36.929   98.456  1.00 23.23 ? 163  VAL B CG1 1 
ATOM   3586  C  CG2 . VAL B  1 81  ? 10.832  36.477   96.974  1.00 22.92 ? 163  VAL B CG2 1 
ATOM   3587  N  N   . GLY B  1 82  ? 11.776  38.629   100.862 1.00 22.07 ? 164  GLY B N   1 
ATOM   3588  C  CA  . GLY B  1 82  ? 12.609  39.385   101.773 1.00 22.20 ? 164  GLY B CA  1 
ATOM   3589  C  C   . GLY B  1 82  ? 11.885  40.374   102.652 1.00 23.36 ? 164  GLY B C   1 
ATOM   3590  O  O   . GLY B  1 82  ? 12.494  40.952   103.551 1.00 24.50 ? 164  GLY B O   1 
ATOM   3591  N  N   . GLU B  1 83  ? 10.598  40.590   102.405 1.00 23.84 ? 165  GLU B N   1 
ATOM   3592  C  CA  . GLU B  1 83  ? 9.844   41.529   103.228 1.00 24.36 ? 165  GLU B CA  1 
ATOM   3593  C  C   . GLU B  1 83  ? 9.102   40.794   104.338 1.00 23.35 ? 165  GLU B C   1 
ATOM   3594  O  O   . GLU B  1 83  ? 8.723   39.640   104.178 1.00 23.00 ? 165  GLU B O   1 
ATOM   3595  C  CB  . GLU B  1 83  ? 8.862   42.314   102.359 1.00 26.84 ? 165  GLU B CB  1 
ATOM   3596  C  CG  . GLU B  1 83  ? 9.545   43.361   101.493 1.00 29.91 ? 165  GLU B CG  1 
ATOM   3597  C  CD  . GLU B  1 83  ? 8.599   44.032   100.524 1.00 31.50 ? 165  GLU B CD  1 
ATOM   3598  O  OE1 . GLU B  1 83  ? 7.447   44.319   100.912 1.00 33.24 ? 165  GLU B OE1 1 
ATOM   3599  O  OE2 . GLU B  1 83  ? 9.009   44.282   99.372  1.00 33.59 ? 165  GLU B OE2 1 
ATOM   3600  N  N   . ALA B  1 84  ? 8.911   41.447   105.474 1.00 21.74 ? 166  ALA B N   1 
ATOM   3601  C  CA  . ALA B  1 84  ? 8.198   40.792   106.560 1.00 20.77 ? 166  ALA B CA  1 
ATOM   3602  C  C   . ALA B  1 84  ? 6.713   40.743   106.199 1.00 19.33 ? 166  ALA B C   1 
ATOM   3603  O  O   . ALA B  1 84  ? 6.139   41.752   105.793 1.00 20.03 ? 166  ALA B O   1 
ATOM   3604  C  CB  . ALA B  1 84  ? 8.410   41.562   107.866 1.00 18.21 ? 166  ALA B CB  1 
ATOM   3605  N  N   . PRO B  1 85  ? 6.071   39.569   106.334 1.00 19.08 ? 167  PRO B N   1 
ATOM   3606  C  CA  . PRO B  1 85  ? 4.642   39.505   105.992 1.00 18.79 ? 167  PRO B CA  1 
ATOM   3607  C  C   . PRO B  1 85  ? 3.732   40.254   106.974 1.00 18.62 ? 167  PRO B C   1 
ATOM   3608  O  O   . PRO B  1 85  ? 3.660   39.935   108.167 1.00 17.86 ? 167  PRO B O   1 
ATOM   3609  C  CB  . PRO B  1 85  ? 4.358   38.004   105.957 1.00 17.58 ? 167  PRO B CB  1 
ATOM   3610  C  CG  . PRO B  1 85  ? 5.282   37.465   106.996 1.00 18.36 ? 167  PRO B CG  1 
ATOM   3611  C  CD  . PRO B  1 85  ? 6.572   38.244   106.745 1.00 19.78 ? 167  PRO B CD  1 
ATOM   3612  N  N   . SER B  1 86  ? 3.049   41.271   106.467 1.00 17.46 ? 168  SER B N   1 
ATOM   3613  C  CA  . SER B  1 86  ? 2.143   42.037   107.296 1.00 16.88 ? 168  SER B CA  1 
ATOM   3614  C  C   . SER B  1 86  ? 0.916   42.314   106.465 1.00 16.82 ? 168  SER B C   1 
ATOM   3615  O  O   . SER B  1 86  ? 0.950   42.271   105.232 1.00 16.54 ? 168  SER B O   1 
ATOM   3616  C  CB  . SER B  1 86  ? 2.767   43.354   107.726 1.00 17.41 ? 168  SER B CB  1 
ATOM   3617  O  OG  . SER B  1 86  ? 2.495   44.361   106.770 1.00 18.29 ? 168  SER B OG  1 
ATOM   3618  N  N   . PRO B  1 87  ? -0.200  42.618   107.129 1.00 17.32 ? 169  PRO B N   1 
ATOM   3619  C  CA  . PRO B  1 87  ? -1.432  42.896   106.387 1.00 17.23 ? 169  PRO B CA  1 
ATOM   3620  C  C   . PRO B  1 87  ? -1.304  44.102   105.446 1.00 17.14 ? 169  PRO B C   1 
ATOM   3621  O  O   . PRO B  1 87  ? -2.051  44.237   104.465 1.00 18.17 ? 169  PRO B O   1 
ATOM   3622  C  CB  . PRO B  1 87  ? -2.447  43.118   107.502 1.00 17.21 ? 169  PRO B CB  1 
ATOM   3623  C  CG  . PRO B  1 87  ? -1.606  43.670   108.610 1.00 16.77 ? 169  PRO B CG  1 
ATOM   3624  C  CD  . PRO B  1 87  ? -0.434  42.733   108.577 1.00 16.97 ? 169  PRO B CD  1 
ATOM   3625  N  N   . TYR B  1 88  A -0.313  44.939   105.734 1.00 16.38 ? 169  TYR B N   1 
ATOM   3626  C  CA  . TYR B  1 88  A -0.019  46.149   104.968 1.00 16.22 ? 169  TYR B CA  1 
ATOM   3627  C  C   . TYR B  1 88  A 0.784   45.917   103.724 1.00 18.25 ? 169  TYR B C   1 
ATOM   3628  O  O   . TYR B  1 88  A 0.947   46.823   102.906 1.00 17.40 ? 169  TYR B O   1 
ATOM   3629  C  CB  . TYR B  1 88  A 0.757   47.104   105.827 1.00 15.01 ? 169  TYR B CB  1 
ATOM   3630  C  CG  . TYR B  1 88  A 0.156   47.257   107.191 1.00 15.16 ? 169  TYR B CG  1 
ATOM   3631  C  CD1 . TYR B  1 88  A 0.949   47.583   108.230 1.00 13.66 ? 169  TYR B CD1 1 
ATOM   3632  C  CD2 . TYR B  1 88  A -1.172  47.037   107.440 1.00 14.76 ? 169  TYR B CD2 1 
ATOM   3633  C  CE1 . TYR B  1 88  A 0.500   47.661   109.514 1.00 15.98 ? 169  TYR B CE1 1 
ATOM   3634  C  CE2 . TYR B  1 88  A -1.693  47.123   108.762 1.00 14.12 ? 169  TYR B CE2 1 
ATOM   3635  C  CZ  . TYR B  1 88  A -0.858  47.434   109.789 1.00 15.63 ? 169  TYR B CZ  1 
ATOM   3636  O  OH  . TYR B  1 88  A -1.423  47.454   111.047 1.00 19.51 ? 169  TYR B OH  1 
ATOM   3637  N  N   . ASN B  1 89  ? 1.283   44.704   103.562 1.00 19.45 ? 170  ASN B N   1 
ATOM   3638  C  CA  . ASN B  1 89  ? 2.065   44.436   102.368 1.00 21.85 ? 170  ASN B CA  1 
ATOM   3639  C  C   . ASN B  1 89  ? 1.809   43.086   101.712 1.00 20.88 ? 170  ASN B C   1 
ATOM   3640  O  O   . ASN B  1 89  ? 2.372   42.789   100.662 1.00 19.96 ? 170  ASN B O   1 
ATOM   3641  C  CB  . ASN B  1 89  ? 3.549   44.593   102.687 1.00 23.00 ? 170  ASN B CB  1 
ATOM   3642  C  CG  . ASN B  1 89  ? 4.138   43.366   103.342 1.00 25.46 ? 170  ASN B CG  1 
ATOM   3643  O  OD1 . ASN B  1 89  ? 3.485   42.699   104.149 1.00 27.37 ? 170  ASN B OD1 1 
ATOM   3644  N  ND2 . ASN B  1 89  ? 5.391   43.066   103.011 1.00 27.05 ? 170  ASN B ND2 1 
ATOM   3645  N  N   . SER B  1 90  ? 0.951   42.274   102.314 1.00 20.09 ? 171  SER B N   1 
ATOM   3646  C  CA  . SER B  1 90  ? 0.671   40.973   101.739 1.00 21.14 ? 171  SER B CA  1 
ATOM   3647  C  C   . SER B  1 90  ? -0.592  40.947   100.897 1.00 21.70 ? 171  SER B C   1 
ATOM   3648  O  O   . SER B  1 90  ? -1.586  41.590   101.214 1.00 22.03 ? 171  SER B O   1 
ATOM   3649  C  CB  . SER B  1 90  ? 0.557   39.923   102.839 1.00 21.25 ? 171  SER B CB  1 
ATOM   3650  O  OG  . SER B  1 90  ? 1.725   39.874   103.639 1.00 24.59 ? 171  SER B OG  1 
ATOM   3651  N  N   . ARG B  1 91  ? -0.541  40.179   99.820  1.00 21.38 ? 172  ARG B N   1 
ATOM   3652  C  CA  . ARG B  1 91  ? -1.682  40.029   98.929  1.00 22.81 ? 172  ARG B CA  1 
ATOM   3653  C  C   . ARG B  1 91  ? -2.457  38.775   99.390  1.00 22.20 ? 172  ARG B C   1 
ATOM   3654  O  O   . ARG B  1 91  ? -1.854  37.816   99.879  1.00 24.40 ? 172  ARG B O   1 
ATOM   3655  C  CB  . ARG B  1 91  ? -1.173  39.861   97.488  1.00 24.67 ? 172  ARG B CB  1 
ATOM   3656  C  CG  . ARG B  1 91  ? -2.232  39.595   96.444  1.00 29.08 ? 172  ARG B CG  1 
ATOM   3657  C  CD  . ARG B  1 91  ? -1.659  38.784   95.283  1.00 32.44 ? 172  ARG B CD  1 
ATOM   3658  N  NE  . ARG B  1 91  ? -0.732  39.543   94.447  1.00 34.43 ? 172  ARG B NE  1 
ATOM   3659  C  CZ  . ARG B  1 91  ? 0.112   38.991   93.570  1.00 35.98 ? 172  ARG B CZ  1 
ATOM   3660  N  NH1 . ARG B  1 91  ? 0.914   39.766   92.844  1.00 34.06 ? 172  ARG B NH1 1 
ATOM   3661  N  NH2 . ARG B  1 91  ? 0.174   37.664   93.433  1.00 33.82 ? 172  ARG B NH2 1 
ATOM   3662  N  N   . PHE B  1 92  ? -3.782  38.781   99.280  1.00 19.47 ? 173  PHE B N   1 
ATOM   3663  C  CA  . PHE B  1 92  ? -4.550  37.606   99.684  1.00 19.05 ? 173  PHE B CA  1 
ATOM   3664  C  C   . PHE B  1 92  ? -4.579  36.617   98.529  1.00 19.32 ? 173  PHE B C   1 
ATOM   3665  O  O   . PHE B  1 92  ? -4.899  36.985   97.404  1.00 19.28 ? 173  PHE B O   1 
ATOM   3666  C  CB  . PHE B  1 92  ? -5.998  37.952   100.041 1.00 17.45 ? 173  PHE B CB  1 
ATOM   3667  C  CG  . PHE B  1 92  ? -6.845  36.738   100.299 1.00 15.96 ? 173  PHE B CG  1 
ATOM   3668  C  CD1 . PHE B  1 92  ? -6.776  36.069   101.522 1.00 15.78 ? 173  PHE B CD1 1 
ATOM   3669  C  CD2 . PHE B  1 92  ? -7.660  36.214   99.294  1.00 14.65 ? 173  PHE B CD2 1 
ATOM   3670  C  CE1 . PHE B  1 92  ? -7.504  34.891   101.736 1.00 14.68 ? 173  PHE B CE1 1 
ATOM   3671  C  CE2 . PHE B  1 92  ? -8.395  35.036   99.494  1.00 13.12 ? 173  PHE B CE2 1 
ATOM   3672  C  CZ  . PHE B  1 92  ? -8.317  34.373   100.712 1.00 13.15 ? 173  PHE B CZ  1 
ATOM   3673  N  N   . GLU B  1 93  ? -4.261  35.359   98.802  1.00 18.72 ? 174  GLU B N   1 
ATOM   3674  C  CA  . GLU B  1 93  ? -4.262  34.367   97.747  1.00 18.55 ? 174  GLU B CA  1 
ATOM   3675  C  C   . GLU B  1 93  ? -5.440  33.421   97.847  1.00 18.07 ? 174  GLU B C   1 
ATOM   3676  O  O   . GLU B  1 93  ? -6.243  33.324   96.927  1.00 18.39 ? 174  GLU B O   1 
ATOM   3677  C  CB  . GLU B  1 93  ? -2.965  33.550   97.762  1.00 18.33 ? 174  GLU B CB  1 
ATOM   3678  C  CG  . GLU B  1 93  ? -1.703  34.358   97.532  1.00 21.23 ? 174  GLU B CG  1 
ATOM   3679  C  CD  . GLU B  1 93  ? -1.685  35.047   96.187  1.00 22.51 ? 174  GLU B CD  1 
ATOM   3680  O  OE1 . GLU B  1 93  ? -0.793  35.901   95.959  1.00 23.69 ? 174  GLU B OE1 1 
ATOM   3681  O  OE2 . GLU B  1 93  ? -2.562  34.729   95.355  1.00 24.94 ? 174  GLU B OE2 1 
ATOM   3682  N  N   . SER B  1 94  ? -5.550  32.721   98.967  1.00 19.46 ? 175  SER B N   1 
ATOM   3683  C  CA  . SER B  1 94  ? -6.624  31.754   99.117  1.00 19.32 ? 175  SER B CA  1 
ATOM   3684  C  C   . SER B  1 94  ? -6.843  31.331   100.555 1.00 16.37 ? 175  SER B C   1 
ATOM   3685  O  O   . SER B  1 94  ? -5.979  31.516   101.402 1.00 15.55 ? 175  SER B O   1 
ATOM   3686  C  CB  . SER B  1 94  ? -6.292  30.524   98.266  1.00 22.55 ? 175  SER B CB  1 
ATOM   3687  O  OG  . SER B  1 94  ? -7.354  29.596   98.258  1.00 28.41 ? 175  SER B OG  1 
ATOM   3688  N  N   . VAL B  1 95  ? -8.018  30.779   100.832 1.00 15.69 ? 176  VAL B N   1 
ATOM   3689  C  CA  . VAL B  1 95  ? -8.321  30.299   102.172 1.00 16.53 ? 176  VAL B CA  1 
ATOM   3690  C  C   . VAL B  1 95  ? -7.715  28.909   102.183 1.00 16.98 ? 176  VAL B C   1 
ATOM   3691  O  O   . VAL B  1 95  ? -8.078  28.076   101.355 1.00 19.33 ? 176  VAL B O   1 
ATOM   3692  C  CB  . VAL B  1 95  ? -9.826  30.192   102.401 1.00 16.18 ? 176  VAL B CB  1 
ATOM   3693  C  CG1 . VAL B  1 95  ? -10.095 29.682   103.792 1.00 14.98 ? 176  VAL B CG1 1 
ATOM   3694  C  CG2 . VAL B  1 95  ? -10.479 31.554   102.201 1.00 16.76 ? 176  VAL B CG2 1 
ATOM   3695  N  N   . ALA B  1 96  ? -6.784  28.639   103.092 1.00 16.08 ? 177  ALA B N   1 
ATOM   3696  C  CA  . ALA B  1 96  ? -6.169  27.324   103.069 1.00 15.14 ? 177  ALA B CA  1 
ATOM   3697  C  C   . ALA B  1 96  ? -5.313  26.961   104.260 1.00 14.16 ? 177  ALA B C   1 
ATOM   3698  O  O   . ALA B  1 96  ? -4.632  27.809   104.832 1.00 13.02 ? 177  ALA B O   1 
ATOM   3699  C  CB  . ALA B  1 96  ? -5.331  27.186   101.797 1.00 14.75 ? 177  ALA B CB  1 
ATOM   3700  N  N   . TRP B  1 97  ? -5.357  25.685   104.632 1.00 13.71 ? 178  TRP B N   1 
ATOM   3701  C  CA  . TRP B  1 97  ? -4.518  25.208   105.710 1.00 13.94 ? 178  TRP B CA  1 
ATOM   3702  C  C   . TRP B  1 97  ? -3.457  24.289   105.099 1.00 13.45 ? 178  TRP B C   1 
ATOM   3703  O  O   . TRP B  1 97  ? -2.744  23.582   105.795 1.00 14.77 ? 178  TRP B O   1 
ATOM   3704  C  CB  . TRP B  1 97  ? -5.329  24.505   106.811 1.00 13.83 ? 178  TRP B CB  1 
ATOM   3705  C  CG  . TRP B  1 97  ? -6.454  23.622   106.374 1.00 15.50 ? 178  TRP B CG  1 
ATOM   3706  C  CD1 . TRP B  1 97  ? -7.784  23.878   106.511 1.00 15.40 ? 178  TRP B CD1 1 
ATOM   3707  C  CD2 . TRP B  1 97  ? -6.354  22.306   105.813 1.00 16.66 ? 178  TRP B CD2 1 
ATOM   3708  N  NE1 . TRP B  1 97  ? -8.522  22.804   106.080 1.00 17.88 ? 178  TRP B NE1 1 
ATOM   3709  C  CE2 . TRP B  1 97  ? -7.666  21.824   105.643 1.00 17.03 ? 178  TRP B CE2 1 
ATOM   3710  C  CE3 . TRP B  1 97  ? -5.278  21.487   105.438 1.00 17.60 ? 178  TRP B CE3 1 
ATOM   3711  C  CZ2 . TRP B  1 97  ? -7.941  20.556   105.113 1.00 17.87 ? 178  TRP B CZ2 1 
ATOM   3712  C  CZ3 . TRP B  1 97  ? -5.550  20.226   104.910 1.00 19.42 ? 178  TRP B CZ3 1 
ATOM   3713  C  CH2 . TRP B  1 97  ? -6.873  19.774   104.753 1.00 17.47 ? 178  TRP B CH2 1 
ATOM   3714  N  N   . SER B  1 98  ? -3.375  24.331   103.774 1.00 13.28 ? 179  SER B N   1 
ATOM   3715  C  CA  . SER B  1 98  ? -2.395  23.587   102.988 1.00 14.10 ? 179  SER B CA  1 
ATOM   3716  C  C   . SER B  1 98  ? -2.483  24.161   101.578 1.00 13.99 ? 179  SER B C   1 
ATOM   3717  O  O   . SER B  1 98  ? -3.578  24.318   101.044 1.00 14.29 ? 179  SER B O   1 
ATOM   3718  C  CB  . SER B  1 98  ? -2.712  22.090   102.969 1.00 15.60 ? 179  SER B CB  1 
ATOM   3719  O  OG  . SER B  1 98  ? -1.749  21.363   102.212 1.00 13.55 ? 179  SER B OG  1 
ATOM   3720  N  N   . ALA B  1 99  ? -1.341  24.478   100.979 1.00 14.59 ? 180  ALA B N   1 
ATOM   3721  C  CA  . ALA B  1 99  ? -1.332  25.063   99.636  1.00 16.73 ? 180  ALA B CA  1 
ATOM   3722  C  C   . ALA B  1 99  ? -0.049  24.841   98.857  1.00 17.08 ? 180  ALA B C   1 
ATOM   3723  O  O   . ALA B  1 99  ? 0.881   24.186   99.323  1.00 18.06 ? 180  ALA B O   1 
ATOM   3724  C  CB  . ALA B  1 99  ? -1.578  26.568   99.736  1.00 15.08 ? 180  ALA B CB  1 
ATOM   3725  N  N   . SER B  1 100 ? -0.024  25.413   97.659  1.00 19.06 ? 181  SER B N   1 
ATOM   3726  C  CA  . SER B  1 100 ? 1.140   25.397   96.771  1.00 20.25 ? 181  SER B CA  1 
ATOM   3727  C  C   . SER B  1 100 ? 0.863   26.479   95.737  1.00 19.40 ? 181  SER B C   1 
ATOM   3728  O  O   . SER B  1 100 ? -0.276  26.906   95.568  1.00 20.41 ? 181  SER B O   1 
ATOM   3729  C  CB  . SER B  1 100 ? 1.305   24.055   96.069  1.00 21.42 ? 181  SER B CB  1 
ATOM   3730  O  OG  . SER B  1 100 ? 0.363   23.917   95.030  1.00 27.66 ? 181  SER B OG  1 
ATOM   3731  N  N   . ALA B  1 101 ? 1.891   26.936   95.048  1.00 19.08 ? 182  ALA B N   1 
ATOM   3732  C  CA  . ALA B  1 101 ? 1.683   27.967   94.056  1.00 18.74 ? 182  ALA B CA  1 
ATOM   3733  C  C   . ALA B  1 101 ? 2.807   27.973   93.041  1.00 19.77 ? 182  ALA B C   1 
ATOM   3734  O  O   . ALA B  1 101 ? 3.907   27.478   93.306  1.00 21.23 ? 182  ALA B O   1 
ATOM   3735  C  CB  . ALA B  1 101 ? 1.577   29.323   94.733  1.00 17.19 ? 182  ALA B CB  1 
ATOM   3736  N  N   . CYS B  1 102 ? 2.514   28.524   91.871  1.00 19.82 ? 183  CYS B N   1 
ATOM   3737  C  CA  . CYS B  1 102 ? 3.482   28.618   90.790  1.00 20.55 ? 183  CYS B CA  1 
ATOM   3738  C  C   . CYS B  1 102 ? 2.925   29.471   89.670  1.00 20.04 ? 183  CYS B C   1 
ATOM   3739  O  O   . CYS B  1 102 ? 1.709   29.627   89.529  1.00 19.90 ? 183  CYS B O   1 
ATOM   3740  C  CB  . CYS B  1 102 ? 3.840   27.229   90.251  1.00 21.77 ? 183  CYS B CB  1 
ATOM   3741  S  SG  . CYS B  1 102 ? 2.409   26.151   89.930  1.00 26.06 ? 183  CYS B SG  1 
ATOM   3742  N  N   . HIS B  1 103 ? 3.835   30.017   88.876  1.00 19.84 ? 184  HIS B N   1 
ATOM   3743  C  CA  . HIS B  1 103 ? 3.497   30.872   87.748  1.00 20.32 ? 184  HIS B CA  1 
ATOM   3744  C  C   . HIS B  1 103 ? 3.892   30.115   86.479  1.00 20.46 ? 184  HIS B C   1 
ATOM   3745  O  O   . HIS B  1 103 ? 4.986   29.562   86.410  1.00 22.16 ? 184  HIS B O   1 
ATOM   3746  C  CB  . HIS B  1 103 ? 4.300   32.162   87.867  1.00 20.32 ? 184  HIS B CB  1 
ATOM   3747  C  CG  . HIS B  1 103 ? 3.854   33.253   86.948  1.00 21.05 ? 184  HIS B CG  1 
ATOM   3748  N  ND1 . HIS B  1 103 ? 3.032   34.280   87.359  1.00 21.75 ? 184  HIS B ND1 1 
ATOM   3749  C  CD2 . HIS B  1 103 ? 4.155   33.506   85.653  1.00 20.26 ? 184  HIS B CD2 1 
ATOM   3750  C  CE1 . HIS B  1 103 ? 2.849   35.122   86.356  1.00 21.52 ? 184  HIS B CE1 1 
ATOM   3751  N  NE2 . HIS B  1 103 ? 3.520   34.673   85.311  1.00 21.58 ? 184  HIS B NE2 1 
ATOM   3752  N  N   . ASP B  1 104 ? 3.019   30.093   85.477  1.00 20.11 ? 185  ASP B N   1 
ATOM   3753  C  CA  . ASP B  1 104 ? 3.316   29.383   84.233  1.00 19.53 ? 185  ASP B CA  1 
ATOM   3754  C  C   . ASP B  1 104 ? 3.867   30.276   83.133  1.00 21.17 ? 185  ASP B C   1 
ATOM   3755  O  O   . ASP B  1 104 ? 3.881   29.882   81.968  1.00 21.92 ? 185  ASP B O   1 
ATOM   3756  C  CB  . ASP B  1 104 ? 2.056   28.692   83.708  1.00 19.40 ? 185  ASP B CB  1 
ATOM   3757  C  CG  . ASP B  1 104 ? 0.980   29.679   83.263  1.00 21.70 ? 185  ASP B CG  1 
ATOM   3758  O  OD1 . ASP B  1 104 ? 1.148   30.905   83.466  1.00 23.11 ? 185  ASP B OD1 1 
ATOM   3759  O  OD2 . ASP B  1 104 ? -0.046  29.228   82.708  1.00 20.12 ? 185  ASP B OD2 1 
ATOM   3760  N  N   . GLY B  1 105 ? 4.319   31.475   83.493  1.00 22.13 ? 186  GLY B N   1 
ATOM   3761  C  CA  . GLY B  1 105 ? 4.835   32.401   82.499  1.00 21.28 ? 186  GLY B CA  1 
ATOM   3762  C  C   . GLY B  1 105 ? 3.803   33.457   82.114  1.00 23.40 ? 186  GLY B C   1 
ATOM   3763  O  O   . GLY B  1 105 ? 4.146   34.505   81.541  1.00 24.32 ? 186  GLY B O   1 
ATOM   3764  N  N   . THR B  1 106 ? 2.533   33.184   82.417  1.00 22.21 ? 187  THR B N   1 
ATOM   3765  C  CA  . THR B  1 106 ? 1.451   34.114   82.109  1.00 21.15 ? 187  THR B CA  1 
ATOM   3766  C  C   . THR B  1 106 ? 0.786   34.614   83.389  1.00 21.36 ? 187  THR B C   1 
ATOM   3767  O  O   . THR B  1 106 ? 0.804   35.803   83.680  1.00 20.52 ? 187  THR B O   1 
ATOM   3768  C  CB  . THR B  1 106 ? 0.371   33.454   81.209  1.00 22.76 ? 187  THR B CB  1 
ATOM   3769  O  OG1 . THR B  1 106 ? 0.925   33.162   79.917  1.00 25.43 ? 187  THR B OG1 1 
ATOM   3770  C  CG2 . THR B  1 106 ? -0.827  34.382   81.034  1.00 19.98 ? 187  THR B CG2 1 
ATOM   3771  N  N   . SER B  1 107 ? 0.196   33.701   84.154  1.00 21.78 ? 188  SER B N   1 
ATOM   3772  C  CA  . SER B  1 107 ? -0.469  34.070   85.401  1.00 21.98 ? 188  SER B CA  1 
ATOM   3773  C  C   . SER B  1 107 ? -0.089  33.110   86.523  1.00 20.88 ? 188  SER B C   1 
ATOM   3774  O  O   . SER B  1 107 ? 0.427   32.025   86.270  1.00 21.73 ? 188  SER B O   1 
ATOM   3775  C  CB  . SER B  1 107 ? -1.992  34.045   85.222  1.00 22.61 ? 188  SER B CB  1 
ATOM   3776  O  OG  . SER B  1 107 ? -2.411  34.852   84.140  1.00 22.80 ? 188  SER B OG  1 
ATOM   3777  N  N   . TRP B  1 108 ? -0.347  33.521   87.759  1.00 19.59 ? 189  TRP B N   1 
ATOM   3778  C  CA  . TRP B  1 108 ? -0.061  32.699   88.929  1.00 20.02 ? 189  TRP B CA  1 
ATOM   3779  C  C   . TRP B  1 108 ? -1.152  31.661   89.140  1.00 20.13 ? 189  TRP B C   1 
ATOM   3780  O  O   . TRP B  1 108 ? -2.333  31.940   88.936  1.00 22.01 ? 189  TRP B O   1 
ATOM   3781  C  CB  . TRP B  1 108 ? -0.024  33.547   90.193  1.00 20.61 ? 189  TRP B CB  1 
ATOM   3782  C  CG  . TRP B  1 108 ? 1.212   34.336   90.402  1.00 23.57 ? 189  TRP B CG  1 
ATOM   3783  C  CD1 . TRP B  1 108 ? 1.359   35.688   90.267  1.00 22.93 ? 189  TRP B CD1 1 
ATOM   3784  C  CD2 . TRP B  1 108 ? 2.460   33.842   90.893  1.00 23.71 ? 189  TRP B CD2 1 
ATOM   3785  N  NE1 . TRP B  1 108 ? 2.623   36.068   90.658  1.00 23.89 ? 189  TRP B NE1 1 
ATOM   3786  C  CE2 . TRP B  1 108 ? 3.321   34.952   91.045  1.00 23.43 ? 189  TRP B CE2 1 
ATOM   3787  C  CE3 . TRP B  1 108 ? 2.936   32.567   91.224  1.00 23.00 ? 189  TRP B CE3 1 
ATOM   3788  C  CZ2 . TRP B  1 108 ? 4.631   34.828   91.515  1.00 24.19 ? 189  TRP B CZ2 1 
ATOM   3789  C  CZ3 . TRP B  1 108 ? 4.240   32.442   91.695  1.00 24.56 ? 189  TRP B CZ3 1 
ATOM   3790  C  CH2 . TRP B  1 108 ? 5.072   33.568   91.835  1.00 23.94 ? 189  TRP B CH2 1 
ATOM   3791  N  N   . LEU B  1 109 ? -0.758  30.469   89.564  1.00 18.54 ? 190  LEU B N   1 
ATOM   3792  C  CA  . LEU B  1 109 ? -1.708  29.409   89.862  1.00 16.40 ? 190  LEU B CA  1 
ATOM   3793  C  C   . LEU B  1 109 ? -1.547  29.176   91.354  1.00 15.76 ? 190  LEU B C   1 
ATOM   3794  O  O   . LEU B  1 109 ? -0.438  28.953   91.821  1.00 16.77 ? 190  LEU B O   1 
ATOM   3795  C  CB  . LEU B  1 109 ? -1.340  28.130   89.108  1.00 17.97 ? 190  LEU B CB  1 
ATOM   3796  C  CG  . LEU B  1 109 ? -1.833  26.809   89.727  1.00 19.58 ? 190  LEU B CG  1 
ATOM   3797  C  CD1 . LEU B  1 109 ? -3.350  26.710   89.599  1.00 19.52 ? 190  LEU B CD1 1 
ATOM   3798  C  CD2 . LEU B  1 109 ? -1.170  25.623   89.032  1.00 17.92 ? 190  LEU B CD2 1 
ATOM   3799  N  N   . THR B  1 110 ? -2.622  29.275   92.119  1.00 15.24 ? 191  THR B N   1 
ATOM   3800  C  CA  . THR B  1 110 ? -2.505  29.014   93.546  1.00 15.00 ? 191  THR B CA  1 
ATOM   3801  C  C   . THR B  1 110 ? -3.455  27.880   93.871  1.00 15.53 ? 191  THR B C   1 
ATOM   3802  O  O   . THR B  1 110 ? -4.537  27.770   93.292  1.00 14.92 ? 191  THR B O   1 
ATOM   3803  C  CB  . THR B  1 110 ? -2.878  30.227   94.421  1.00 15.17 ? 191  THR B CB  1 
ATOM   3804  O  OG1 . THR B  1 110 ? -4.253  30.555   94.218  1.00 16.96 ? 191  THR B OG1 1 
ATOM   3805  C  CG2 . THR B  1 110 ? -2.000  31.426   94.086  1.00 16.09 ? 191  THR B CG2 1 
ATOM   3806  N  N   . ILE B  1 111 ? -3.034  27.028   94.792  1.00 15.52 ? 192  ILE B N   1 
ATOM   3807  C  CA  . ILE B  1 111 ? -3.829  25.892   95.197  1.00 15.17 ? 192  ILE B CA  1 
ATOM   3808  C  C   . ILE B  1 111 ? -3.969  25.955   96.702  1.00 15.80 ? 192  ILE B C   1 
ATOM   3809  O  O   . ILE B  1 111 ? -2.986  25.805   97.429  1.00 17.37 ? 192  ILE B O   1 
ATOM   3810  C  CB  . ILE B  1 111 ? -3.134  24.580   94.820  1.00 16.45 ? 192  ILE B CB  1 
ATOM   3811  C  CG1 . ILE B  1 111 ? -2.919  24.531   93.311  1.00 17.18 ? 192  ILE B CG1 1 
ATOM   3812  C  CG2 . ILE B  1 111 ? -3.966  23.396   95.277  1.00 16.08 ? 192  ILE B CG2 1 
ATOM   3813  C  CD1 . ILE B  1 111 ? -1.831  23.583   92.891  1.00 18.01 ? 192  ILE B CD1 1 
ATOM   3814  N  N   . GLY B  1 112 ? -5.188  26.199   97.162  1.00 13.51 ? 193  GLY B N   1 
ATOM   3815  C  CA  . GLY B  1 112 ? -5.435  26.261   98.583  1.00 13.72 ? 193  GLY B CA  1 
ATOM   3816  C  C   . GLY B  1 112 ? -6.465  25.210   98.945  1.00 13.78 ? 193  GLY B C   1 
ATOM   3817  O  O   . GLY B  1 112 ? -7.475  25.054   98.263  1.00 14.18 ? 193  GLY B O   1 
ATOM   3818  N  N   . ILE B  1 113 ? -6.199  24.479   100.015 1.00 12.05 ? 194  ILE B N   1 
ATOM   3819  C  CA  . ILE B  1 113 ? -7.094  23.443   100.465 1.00 12.15 ? 194  ILE B CA  1 
ATOM   3820  C  C   . ILE B  1 113 ? -7.665  23.898   101.784 1.00 13.25 ? 194  ILE B C   1 
ATOM   3821  O  O   . ILE B  1 113 ? -6.942  24.374   102.664 1.00 12.25 ? 194  ILE B O   1 
ATOM   3822  C  CB  . ILE B  1 113 ? -6.346  22.107   100.698 1.00 13.59 ? 194  ILE B CB  1 
ATOM   3823  C  CG1 . ILE B  1 113 ? -5.787  21.572   99.378  1.00 13.38 ? 194  ILE B CG1 1 
ATOM   3824  C  CG2 . ILE B  1 113 ? -7.280  21.084   101.333 1.00 12.73 ? 194  ILE B CG2 1 
ATOM   3825  C  CD1 . ILE B  1 113 ? -4.782  20.466   99.575  1.00 12.48 ? 194  ILE B CD1 1 
ATOM   3826  N  N   . SER B  1 114 ? -8.973  23.758   101.918 1.00 13.60 ? 195  SER B N   1 
ATOM   3827  C  CA  . SER B  1 114 ? -9.639  24.134   103.143 1.00 14.77 ? 195  SER B CA  1 
ATOM   3828  C  C   . SER B  1 114 ? -10.774 23.139   103.327 1.00 15.30 ? 195  SER B C   1 
ATOM   3829  O  O   . SER B  1 114 ? -10.944 22.236   102.505 1.00 15.41 ? 195  SER B O   1 
ATOM   3830  C  CB  . SER B  1 114 ? -10.165 25.569   103.046 1.00 14.44 ? 195  SER B CB  1 
ATOM   3831  O  OG  . SER B  1 114 ? -10.546 26.047   104.326 1.00 16.29 ? 195  SER B OG  1 
ATOM   3832  N  N   . GLY B  1 115 ? -11.544 23.288   104.397 1.00 15.42 ? 196  GLY B N   1 
ATOM   3833  C  CA  . GLY B  1 115 ? -12.633 22.361   104.625 1.00 16.15 ? 196  GLY B CA  1 
ATOM   3834  C  C   . GLY B  1 115 ? -12.303 21.423   105.758 1.00 16.40 ? 196  GLY B C   1 
ATOM   3835  O  O   . GLY B  1 115 ? -11.252 21.540   106.376 1.00 16.88 ? 196  GLY B O   1 
ATOM   3836  N  N   . PRO B  1 116 ? -13.186 20.469   106.050 1.00 17.92 ? 197  PRO B N   1 
ATOM   3837  C  CA  . PRO B  1 116 ? -12.977 19.503   107.135 1.00 19.02 ? 197  PRO B CA  1 
ATOM   3838  C  C   . PRO B  1 116 ? -12.051 18.356   106.736 1.00 20.80 ? 197  PRO B C   1 
ATOM   3839  O  O   . PRO B  1 116 ? -11.922 18.031   105.547 1.00 19.49 ? 197  PRO B O   1 
ATOM   3840  C  CB  . PRO B  1 116 ? -14.389 19.029   107.430 1.00 16.38 ? 197  PRO B CB  1 
ATOM   3841  C  CG  . PRO B  1 116 ? -14.969 18.962   106.056 1.00 16.98 ? 197  PRO B CG  1 
ATOM   3842  C  CD  . PRO B  1 116 ? -14.489 20.255   105.400 1.00 16.92 ? 197  PRO B CD  1 
ATOM   3843  N  N   . ASP B  1 117 ? -11.416 17.750   107.739 1.00 22.63 ? 198  ASP B N   1 
ATOM   3844  C  CA  . ASP B  1 117 ? -10.495 16.645   107.512 1.00 22.77 ? 198  ASP B CA  1 
ATOM   3845  C  C   . ASP B  1 117 ? -11.099 15.515   106.696 1.00 23.89 ? 198  ASP B C   1 
ATOM   3846  O  O   . ASP B  1 117 ? -10.413 14.916   105.861 1.00 23.93 ? 198  ASP B O   1 
ATOM   3847  C  CB  . ASP B  1 117 ? -9.992  16.094   108.841 1.00 22.73 ? 198  ASP B CB  1 
ATOM   3848  C  CG  . ASP B  1 117 ? -9.063  17.060   109.559 1.00 25.43 ? 198  ASP B CG  1 
ATOM   3849  O  OD1 . ASP B  1 117 ? -8.722  18.114   108.977 1.00 24.76 ? 198  ASP B OD1 1 
ATOM   3850  O  OD2 . ASP B  1 117 ? -8.661  16.765   110.706 1.00 26.72 ? 198  ASP B OD2 1 
ATOM   3851  N  N   . ASN B  1 118 ? -12.382 15.231   106.910 1.00 23.83 ? 199  ASN B N   1 
ATOM   3852  C  CA  . ASN B  1 118 ? -13.027 14.136   106.188 1.00 24.70 ? 199  ASN B CA  1 
ATOM   3853  C  C   . ASN B  1 118 ? -13.550 14.494   104.806 1.00 25.20 ? 199  ASN B C   1 
ATOM   3854  O  O   . ASN B  1 118 ? -14.386 13.778   104.255 1.00 26.13 ? 199  ASN B O   1 
ATOM   3855  C  CB  . ASN B  1 118 ? -14.174 13.554   107.013 1.00 24.26 ? 199  ASN B CB  1 
ATOM   3856  C  CG  . ASN B  1 118 ? -15.325 14.515   107.166 1.00 24.27 ? 199  ASN B CG  1 
ATOM   3857  O  OD1 . ASN B  1 118 ? -15.369 15.561   106.519 1.00 23.64 ? 199  ASN B OD1 1 
ATOM   3858  N  ND2 . ASN B  1 118 ? -16.277 14.161   108.017 1.00 25.00 ? 199  ASN B ND2 1 
ATOM   3859  N  N   . GLY B  1 119 ? -13.071 15.591   104.236 1.00 24.55 ? 200  GLY B N   1 
ATOM   3860  C  CA  . GLY B  1 119 ? -13.548 15.957   102.917 1.00 23.66 ? 200  GLY B CA  1 
ATOM   3861  C  C   . GLY B  1 119 ? -13.075 17.314   102.451 1.00 24.08 ? 200  GLY B C   1 
ATOM   3862  O  O   . GLY B  1 119 ? -13.847 18.073   101.872 1.00 24.22 ? 200  GLY B O   1 
ATOM   3863  N  N   . ALA B  1 120 ? -11.806 17.618   102.704 1.00 23.18 ? 201  ALA B N   1 
ATOM   3864  C  CA  . ALA B  1 120 ? -11.220 18.887   102.303 1.00 22.17 ? 201  ALA B CA  1 
ATOM   3865  C  C   . ALA B  1 120 ? -11.284 19.060   100.788 1.00 22.48 ? 201  ALA B C   1 
ATOM   3866  O  O   . ALA B  1 120 ? -11.360 18.086   100.029 1.00 22.02 ? 201  ALA B O   1 
ATOM   3867  C  CB  . ALA B  1 120 ? -9.781  18.956   102.767 1.00 22.92 ? 201  ALA B CB  1 
ATOM   3868  N  N   . VAL B  1 121 ? -11.248 20.308   100.343 1.00 20.45 ? 202  VAL B N   1 
ATOM   3869  C  CA  . VAL B  1 121 ? -11.303 20.577   98.919  1.00 19.27 ? 202  VAL B CA  1 
ATOM   3870  C  C   . VAL B  1 121 ? -10.244 21.576   98.486  1.00 18.67 ? 202  VAL B C   1 
ATOM   3871  O  O   . VAL B  1 121 ? -10.115 22.656   99.064  1.00 16.79 ? 202  VAL B O   1 
ATOM   3872  C  CB  . VAL B  1 121 ? -12.677 21.124   98.509  1.00 20.05 ? 202  VAL B CB  1 
ATOM   3873  C  CG1 . VAL B  1 121 ? -12.988 22.372   99.299  1.00 22.41 ? 202  VAL B CG1 1 
ATOM   3874  C  CG2 . VAL B  1 121 ? -12.683 21.434   97.027  1.00 18.47 ? 202  VAL B CG2 1 
ATOM   3875  N  N   . ALA B  1 122 ? -9.488  21.203   97.458  1.00 17.17 ? 203  ALA B N   1 
ATOM   3876  C  CA  . ALA B  1 122 ? -8.449  22.066   96.933  1.00 17.96 ? 203  ALA B CA  1 
ATOM   3877  C  C   . ALA B  1 122 ? -9.079  23.014   95.935  1.00 17.62 ? 203  ALA B C   1 
ATOM   3878  O  O   . ALA B  1 122 ? -9.688  22.581   94.957  1.00 19.37 ? 203  ALA B O   1 
ATOM   3879  C  CB  . ALA B  1 122 ? -7.358  21.237   96.252  1.00 15.89 ? 203  ALA B CB  1 
ATOM   3880  N  N   . VAL B  1 123 ? -8.946  24.308   96.194  1.00 17.72 ? 204  VAL B N   1 
ATOM   3881  C  CA  . VAL B  1 123 ? -9.489  25.317   95.297  1.00 18.08 ? 204  VAL B CA  1 
ATOM   3882  C  C   . VAL B  1 123 ? -8.379  25.844   94.396  1.00 18.36 ? 204  VAL B C   1 
ATOM   3883  O  O   . VAL B  1 123 ? -7.422  26.453   94.873  1.00 16.63 ? 204  VAL B O   1 
ATOM   3884  C  CB  . VAL B  1 123 ? -10.073 26.513   96.069  1.00 18.28 ? 204  VAL B CB  1 
ATOM   3885  C  CG1 . VAL B  1 123 ? -10.386 27.642   95.097  1.00 17.22 ? 204  VAL B CG1 1 
ATOM   3886  C  CG2 . VAL B  1 123 ? -11.328 26.084   96.836  1.00 17.87 ? 204  VAL B CG2 1 
ATOM   3887  N  N   . LEU B  1 124 ? -8.500  25.607   93.095  1.00 18.60 ? 205  LEU B N   1 
ATOM   3888  C  CA  . LEU B  1 124 ? -7.493  26.094   92.171  1.00 17.94 ? 205  LEU B CA  1 
ATOM   3889  C  C   . LEU B  1 124 ? -7.915  27.453   91.642  1.00 17.58 ? 205  LEU B C   1 
ATOM   3890  O  O   . LEU B  1 124 ? -9.062  27.648   91.230  1.00 17.00 ? 205  LEU B O   1 
ATOM   3891  C  CB  . LEU B  1 124 ? -7.296  25.116   91.008  1.00 18.90 ? 205  LEU B CB  1 
ATOM   3892  C  CG  . LEU B  1 124 ? -7.073  23.645   91.371  1.00 19.81 ? 205  LEU B CG  1 
ATOM   3893  C  CD1 . LEU B  1 124 ? -6.413  22.941   90.209  1.00 20.81 ? 205  LEU B CD1 1 
ATOM   3894  C  CD2 . LEU B  1 124 ? -6.205  23.528   92.595  1.00 20.67 ? 205  LEU B CD2 1 
ATOM   3895  N  N   . LYS B  1 125 ? -6.976  28.391   91.680  1.00 18.13 ? 206  LYS B N   1 
ATOM   3896  C  CA  . LYS B  1 125 ? -7.193  29.750   91.197  1.00 18.19 ? 206  LYS B CA  1 
ATOM   3897  C  C   . LYS B  1 125 ? -6.129  30.090   90.162  1.00 17.90 ? 206  LYS B C   1 
ATOM   3898  O  O   . LYS B  1 125 ? -4.945  29.796   90.340  1.00 17.85 ? 206  LYS B O   1 
ATOM   3899  C  CB  . LYS B  1 125 ? -7.108  30.765   92.343  1.00 17.10 ? 206  LYS B CB  1 
ATOM   3900  C  CG  . LYS B  1 125 ? -8.229  30.684   93.369  1.00 19.22 ? 206  LYS B CG  1 
ATOM   3901  C  CD  . LYS B  1 125 ? -8.118  31.833   94.358  1.00 19.61 ? 206  LYS B CD  1 
ATOM   3902  C  CE  . LYS B  1 125 ? -9.178  31.765   95.436  1.00 20.68 ? 206  LYS B CE  1 
ATOM   3903  N  NZ  . LYS B  1 125 ? -9.075  32.923   96.371  1.00 20.72 ? 206  LYS B NZ  1 
ATOM   3904  N  N   . TYR B  1 126 ? -6.557  30.702   89.070  1.00 17.85 ? 207  TYR B N   1 
ATOM   3905  C  CA  . TYR B  1 126 ? -5.635  31.102   88.023  1.00 17.86 ? 207  TYR B CA  1 
ATOM   3906  C  C   . TYR B  1 126 ? -5.827  32.609   87.861  1.00 19.94 ? 207  TYR B C   1 
ATOM   3907  O  O   . TYR B  1 126 ? -6.895  33.075   87.450  1.00 21.71 ? 207  TYR B O   1 
ATOM   3908  C  CB  . TYR B  1 126 ? -5.960  30.366   86.731  1.00 15.35 ? 207  TYR B CB  1 
ATOM   3909  C  CG  . TYR B  1 126 ? -4.910  30.540   85.673  1.00 15.68 ? 207  TYR B CG  1 
ATOM   3910  C  CD1 . TYR B  1 126 ? -5.073  31.467   84.644  1.00 13.41 ? 207  TYR B CD1 1 
ATOM   3911  C  CD2 . TYR B  1 126 ? -3.735  29.784   85.704  1.00 14.80 ? 207  TYR B CD2 1 
ATOM   3912  C  CE1 . TYR B  1 126 ? -4.097  31.636   83.671  1.00 11.79 ? 207  TYR B CE1 1 
ATOM   3913  C  CE2 . TYR B  1 126 ? -2.754  29.946   84.738  1.00 12.50 ? 207  TYR B CE2 1 
ATOM   3914  C  CZ  . TYR B  1 126 ? -2.942  30.870   83.723  1.00 13.20 ? 207  TYR B CZ  1 
ATOM   3915  O  OH  . TYR B  1 126 ? -1.983  31.007   82.748  1.00 13.70 ? 207  TYR B OH  1 
ATOM   3916  N  N   . ASN B  1 127 ? -4.792  33.365   88.203  1.00 19.63 ? 208  ASN B N   1 
ATOM   3917  C  CA  . ASN B  1 127 ? -4.840  34.817   88.143  1.00 19.73 ? 208  ASN B CA  1 
ATOM   3918  C  C   . ASN B  1 127 ? -5.938  35.333   89.075  1.00 18.89 ? 208  ASN B C   1 
ATOM   3919  O  O   . ASN B  1 127 ? -6.718  36.210   88.711  1.00 17.03 ? 208  ASN B O   1 
ATOM   3920  C  CB  . ASN B  1 127 ? -5.101  35.313   86.718  1.00 21.40 ? 208  ASN B CB  1 
ATOM   3921  C  CG  . ASN B  1 127 ? -4.688  36.773   86.530  1.00 25.49 ? 208  ASN B CG  1 
ATOM   3922  O  OD1 . ASN B  1 127 ? -4.666  37.555   87.482  1.00 26.40 ? 208  ASN B OD1 1 
ATOM   3923  N  ND2 . ASN B  1 127 ? -4.366  37.143   85.300  1.00 29.42 ? 208  ASN B ND2 1 
ATOM   3924  N  N   . GLY B  1 128 ? -6.015  34.752   90.268  1.00 19.43 ? 209  GLY B N   1 
ATOM   3925  C  CA  . GLY B  1 128 ? -6.990  35.194   91.250  1.00 21.10 ? 209  GLY B CA  1 
ATOM   3926  C  C   . GLY B  1 128 ? -8.425  34.711   91.133  1.00 23.08 ? 209  GLY B C   1 
ATOM   3927  O  O   . GLY B  1 128 ? -9.206  34.911   92.069  1.00 25.09 ? 209  GLY B O   1 
ATOM   3928  N  N   . ILE B  1 129 ? -8.795  34.094   90.013  1.00 21.24 ? 210  ILE B N   1 
ATOM   3929  C  CA  . ILE B  1 129 ? -10.160 33.607   89.877  1.00 20.35 ? 210  ILE B CA  1 
ATOM   3930  C  C   . ILE B  1 129 ? -10.207 32.071   89.877  1.00 19.30 ? 210  ILE B C   1 
ATOM   3931  O  O   . ILE B  1 129 ? -9.426  31.411   89.196  1.00 19.44 ? 210  ILE B O   1 
ATOM   3932  C  CB  . ILE B  1 129 ? -10.850 34.185   88.597  1.00 21.84 ? 210  ILE B CB  1 
ATOM   3933  C  CG1 . ILE B  1 129 ? -10.749 33.204   87.443  1.00 23.56 ? 210  ILE B CG1 1 
ATOM   3934  C  CG2 . ILE B  1 129 ? -10.211 35.513   88.199  1.00 17.39 ? 210  ILE B CG2 1 
ATOM   3935  C  CD1 . ILE B  1 129 ? -11.603 33.586   86.267  1.00 27.17 ? 210  ILE B CD1 1 
ATOM   3936  N  N   . ILE B  1 130 ? -11.117 31.509   90.664  1.00 18.26 ? 211  ILE B N   1 
ATOM   3937  C  CA  . ILE B  1 130 ? -11.259 30.063   90.770  1.00 16.11 ? 211  ILE B CA  1 
ATOM   3938  C  C   . ILE B  1 130 ? -11.433 29.443   89.403  1.00 17.32 ? 211  ILE B C   1 
ATOM   3939  O  O   . ILE B  1 130 ? -12.263 29.897   88.620  1.00 16.81 ? 211  ILE B O   1 
ATOM   3940  C  CB  . ILE B  1 130 ? -12.457 29.706   91.646  1.00 15.61 ? 211  ILE B CB  1 
ATOM   3941  C  CG1 . ILE B  1 130 ? -12.248 30.305   93.039  1.00 11.86 ? 211  ILE B CG1 1 
ATOM   3942  C  CG2 . ILE B  1 130 ? -12.624 28.183   91.720  1.00 15.57 ? 211  ILE B CG2 1 
ATOM   3943  C  CD1 . ILE B  1 130 ? -13.325 29.960   94.010  1.00 13.04 ? 211  ILE B CD1 1 
ATOM   3944  N  N   . THR B  1 131 ? -10.647 28.404   89.119  1.00 18.50 ? 212  THR B N   1 
ATOM   3945  C  CA  . THR B  1 131 ? -10.696 27.732   87.816  1.00 17.82 ? 212  THR B CA  1 
ATOM   3946  C  C   . THR B  1 131 ? -11.015 26.244   87.888  1.00 19.84 ? 212  THR B C   1 
ATOM   3947  O  O   . THR B  1 131 ? -11.325 25.618   86.869  1.00 21.00 ? 212  THR B O   1 
ATOM   3948  C  CB  . THR B  1 131 ? -9.371  27.890   87.069  1.00 15.96 ? 212  THR B CB  1 
ATOM   3949  O  OG1 . THR B  1 131 ? -8.294  27.494   87.928  1.00 15.72 ? 212  THR B OG1 1 
ATOM   3950  C  CG2 . THR B  1 131 ? -9.181  29.331   86.634  1.00 14.59 ? 212  THR B CG2 1 
ATOM   3951  N  N   . ASP B  1 132 ? -10.938 25.677   89.087  1.00 20.50 ? 213  ASP B N   1 
ATOM   3952  C  CA  . ASP B  1 132 ? -11.235 24.266   89.256  1.00 21.66 ? 213  ASP B CA  1 
ATOM   3953  C  C   . ASP B  1 132 ? -11.263 23.884   90.733  1.00 21.64 ? 213  ASP B C   1 
ATOM   3954  O  O   . ASP B  1 132 ? -10.897 24.678   91.601  1.00 20.74 ? 213  ASP B O   1 
ATOM   3955  C  CB  . ASP B  1 132 ? -10.196 23.416   88.500  1.00 24.34 ? 213  ASP B CB  1 
ATOM   3956  C  CG  . ASP B  1 132 ? -10.691 22.006   88.217  1.00 26.62 ? 213  ASP B CG  1 
ATOM   3957  O  OD1 . ASP B  1 132 ? -11.890 21.742   88.466  1.00 27.70 ? 213  ASP B OD1 1 
ATOM   3958  O  OD2 . ASP B  1 132 ? -9.892  21.165   87.744  1.00 26.84 ? 213  ASP B OD2 1 
ATOM   3959  N  N   . THR B  1 133 ? -11.699 22.658   91.002  1.00 21.24 ? 214  THR B N   1 
ATOM   3960  C  CA  . THR B  1 133 ? -11.789 22.128   92.362  1.00 21.43 ? 214  THR B CA  1 
ATOM   3961  C  C   . THR B  1 133 ? -11.341 20.667   92.377  1.00 20.60 ? 214  THR B C   1 
ATOM   3962  O  O   . THR B  1 133 ? -11.462 19.967   91.374  1.00 20.37 ? 214  THR B O   1 
ATOM   3963  C  CB  . THR B  1 133 ? -13.250 22.184   92.868  1.00 23.73 ? 214  THR B CB  1 
ATOM   3964  O  OG1 . THR B  1 133 ? -13.565 23.511   93.302  1.00 25.34 ? 214  THR B OG1 1 
ATOM   3965  C  CG2 . THR B  1 133 ? -13.465 21.216   93.991  1.00 25.39 ? 214  THR B CG2 1 
ATOM   3966  N  N   . ILE B  1 134 ? -10.814 20.210   93.507  1.00 19.23 ? 215  ILE B N   1 
ATOM   3967  C  CA  . ILE B  1 134 ? -10.403 18.817   93.639  1.00 18.88 ? 215  ILE B CA  1 
ATOM   3968  C  C   . ILE B  1 134 ? -10.780 18.377   95.050  1.00 20.13 ? 215  ILE B C   1 
ATOM   3969  O  O   . ILE B  1 134 ? -10.278 18.936   96.020  1.00 20.03 ? 215  ILE B O   1 
ATOM   3970  C  CB  . ILE B  1 134 ? -8.879  18.641   93.474  1.00 20.82 ? 215  ILE B CB  1 
ATOM   3971  C  CG1 . ILE B  1 134 ? -8.369  19.424   92.264  1.00 19.52 ? 215  ILE B CG1 1 
ATOM   3972  C  CG2 . ILE B  1 134 ? -8.549  17.164   93.301  1.00 19.78 ? 215  ILE B CG2 1 
ATOM   3973  C  CD1 . ILE B  1 134 ? -6.872  19.231   92.017  1.00 20.26 ? 215  ILE B CD1 1 
ATOM   3974  N  N   . LYS B  1 135 ? -11.672 17.397   95.173  1.00 20.60 ? 216  LYS B N   1 
ATOM   3975  C  CA  . LYS B  1 135 ? -12.093 16.915   96.493  1.00 20.85 ? 216  LYS B CA  1 
ATOM   3976  C  C   . LYS B  1 135 ? -11.255 15.750   97.006  1.00 19.71 ? 216  LYS B C   1 
ATOM   3977  O  O   . LYS B  1 135 ? -10.766 14.923   96.239  1.00 18.94 ? 216  LYS B O   1 
ATOM   3978  C  CB  . LYS B  1 135 ? -13.554 16.454   96.469  1.00 24.29 ? 216  LYS B CB  1 
ATOM   3979  C  CG  . LYS B  1 135 ? -14.606 17.556   96.499  1.00 30.28 ? 216  LYS B CG  1 
ATOM   3980  C  CD  . LYS B  1 135 ? -15.799 17.220   95.565  1.00 31.38 ? 216  LYS B CD  1 
ATOM   3981  C  CE  . LYS B  1 135 ? -15.418 17.386   94.079  1.00 29.55 ? 216  LYS B CE  1 
ATOM   3982  N  NZ  . LYS B  1 135 ? -16.439 16.858   93.128  1.00 26.36 ? 216  LYS B NZ  1 
ATOM   3983  N  N   . SER B  1 136 ? -11.115 15.694   98.323  1.00 18.96 ? 217  SER B N   1 
ATOM   3984  C  CA  . SER B  1 136 ? -10.391 14.623   98.982  1.00 19.36 ? 217  SER B CA  1 
ATOM   3985  C  C   . SER B  1 136 ? -11.009 13.339   98.450  1.00 20.19 ? 217  SER B C   1 
ATOM   3986  O  O   . SER B  1 136 ? -12.228 13.235   98.361  1.00 21.05 ? 217  SER B O   1 
ATOM   3987  C  CB  . SER B  1 136 ? -10.597 14.737   100.492 1.00 17.64 ? 217  SER B CB  1 
ATOM   3988  O  OG  . SER B  1 136 ? -10.276 13.533   101.148 1.00 18.22 ? 217  SER B OG  1 
ATOM   3989  N  N   . TRP B  1 137 ? -10.180 12.374   98.068  1.00 20.65 ? 218  TRP B N   1 
ATOM   3990  C  CA  . TRP B  1 137 ? -10.695 11.120   97.528  1.00 20.95 ? 218  TRP B CA  1 
ATOM   3991  C  C   . TRP B  1 137 ? -10.525 9.968    98.508  1.00 21.49 ? 218  TRP B C   1 
ATOM   3992  O  O   . TRP B  1 137 ? -10.874 8.828    98.203  1.00 20.13 ? 218  TRP B O   1 
ATOM   3993  C  CB  . TRP B  1 137 ? -10.002 10.799   96.204  1.00 21.03 ? 218  TRP B CB  1 
ATOM   3994  C  CG  . TRP B  1 137 ? -8.533  10.547   96.333  1.00 23.85 ? 218  TRP B CG  1 
ATOM   3995  C  CD1 . TRP B  1 137 ? -7.926  9.352    96.599  1.00 24.51 ? 218  TRP B CD1 1 
ATOM   3996  C  CD2 . TRP B  1 137 ? -7.481  11.508   96.200  1.00 23.46 ? 218  TRP B CD2 1 
ATOM   3997  N  NE1 . TRP B  1 137 ? -6.565  9.508    96.636  1.00 24.67 ? 218  TRP B NE1 1 
ATOM   3998  C  CE2 . TRP B  1 137 ? -6.263  10.822   96.397  1.00 24.55 ? 218  TRP B CE2 1 
ATOM   3999  C  CE3 . TRP B  1 137 ? -7.449  12.884   95.938  1.00 24.55 ? 218  TRP B CE3 1 
ATOM   4000  C  CZ2 . TRP B  1 137 ? -5.019  11.465   96.333  1.00 24.24 ? 218  TRP B CZ2 1 
ATOM   4001  C  CZ3 . TRP B  1 137 ? -6.206  13.525   95.874  1.00 24.96 ? 218  TRP B CZ3 1 
ATOM   4002  C  CH2 . TRP B  1 137 ? -5.011  12.811   96.074  1.00 23.48 ? 218  TRP B CH2 1 
ATOM   4003  N  N   . ARG B  1 138 ? -9.992  10.282   99.686  1.00 23.26 ? 219  ARG B N   1 
ATOM   4004  C  CA  . ARG B  1 138 ? -9.780  9.305    100.750 1.00 26.34 ? 219  ARG B CA  1 
ATOM   4005  C  C   . ARG B  1 138 ? -10.391 9.813    102.046 1.00 26.09 ? 219  ARG B C   1 
ATOM   4006  O  O   . ARG B  1 138 ? -10.336 9.138    103.070 1.00 27.71 ? 219  ARG B O   1 
ATOM   4007  C  CB  . ARG B  1 138 ? -8.288  9.072    100.984 1.00 31.21 ? 219  ARG B CB  1 
ATOM   4008  C  CG  . ARG B  1 138 ? -7.574  8.301    99.898  1.00 35.34 ? 219  ARG B CG  1 
ATOM   4009  C  CD  . ARG B  1 138 ? -7.980  6.839    99.892  1.00 39.91 ? 219  ARG B CD  1 
ATOM   4010  N  NE  . ARG B  1 138 ? -7.293  6.139    98.816  1.00 44.23 ? 219  ARG B NE  1 
ATOM   4011  C  CZ  . ARG B  1 138 ? -7.732  5.024    98.247  1.00 46.69 ? 219  ARG B CZ  1 
ATOM   4012  N  NH1 . ARG B  1 138 ? -8.870  4.469    98.659  1.00 47.81 ? 219  ARG B NH1 1 
ATOM   4013  N  NH2 . ARG B  1 138 ? -7.044  4.481    97.247  1.00 47.20 ? 219  ARG B NH2 1 
ATOM   4014  N  N   . ASN B  1 139 ? -10.957 11.013   101.994 1.00 25.17 ? 220  ASN B N   1 
ATOM   4015  C  CA  . ASN B  1 139 ? -11.585 11.648   103.150 1.00 23.88 ? 220  ASN B CA  1 
ATOM   4016  C  C   . ASN B  1 139 ? -10.708 11.620   104.392 1.00 23.21 ? 220  ASN B C   1 
ATOM   4017  O  O   . ASN B  1 139 ? -11.212 11.508   105.513 1.00 24.61 ? 220  ASN B O   1 
ATOM   4018  C  CB  . ASN B  1 139 ? -12.925 10.981   103.479 1.00 23.23 ? 220  ASN B CB  1 
ATOM   4019  C  CG  . ASN B  1 139 ? -13.821 10.847   102.272 1.00 24.58 ? 220  ASN B CG  1 
ATOM   4020  O  OD1 . ASN B  1 139 ? -13.765 11.649   101.343 1.00 25.14 ? 220  ASN B OD1 1 
ATOM   4021  N  ND2 . ASN B  1 139 ? -14.673 9.834    102.286 1.00 27.88 ? 220  ASN B ND2 1 
ATOM   4022  N  N   . ASN B  1 140 ? -9.398  11.722   104.206 1.00 22.30 ? 221  ASN B N   1 
ATOM   4023  C  CA  . ASN B  1 140 ? -8.484  11.715   105.345 1.00 20.46 ? 221  ASN B CA  1 
ATOM   4024  C  C   . ASN B  1 140 ? -7.363  12.729   105.158 1.00 19.40 ? 221  ASN B C   1 
ATOM   4025  O  O   . ASN B  1 140 ? -6.217  12.383   104.882 1.00 18.27 ? 221  ASN B O   1 
ATOM   4026  C  CB  . ASN B  1 140 ? -7.915  10.314   105.565 1.00 20.29 ? 221  ASN B CB  1 
ATOM   4027  C  CG  . ASN B  1 140 ? -6.957  10.246   106.746 1.00 22.20 ? 221  ASN B CG  1 
ATOM   4028  O  OD1 . ASN B  1 140 ? -6.821  11.206   107.508 1.00 22.47 ? 221  ASN B OD1 1 
ATOM   4029  N  ND2 . ASN B  1 140 ? -6.286  9.101    106.904 1.00 22.28 ? 221  ASN B ND2 1 
ATOM   4030  N  N   . ILE B  1 141 ? -7.749  13.993   105.300 1.00 19.51 ? 222  ILE B N   1 
ATOM   4031  C  CA  . ILE B  1 141 ? -6.885  15.165   105.203 1.00 16.62 ? 222  ILE B CA  1 
ATOM   4032  C  C   . ILE B  1 141 ? -6.139  15.337   103.893 1.00 17.53 ? 222  ILE B C   1 
ATOM   4033  O  O   . ILE B  1 141 ? -4.953  15.028   103.787 1.00 17.50 ? 222  ILE B O   1 
ATOM   4034  C  CB  . ILE B  1 141 ? -5.869  15.204   106.372 1.00 16.79 ? 222  ILE B CB  1 
ATOM   4035  C  CG1 . ILE B  1 141 ? -6.593  14.940   107.696 1.00 14.14 ? 222  ILE B CG1 1 
ATOM   4036  C  CG2 . ILE B  1 141 ? -5.184  16.576   106.433 1.00 16.19 ? 222  ILE B CG2 1 
ATOM   4037  C  CD1 . ILE B  1 141 ? -5.695  14.970   108.904 1.00 10.77 ? 222  ILE B CD1 1 
ATOM   4038  N  N   . LEU B  1 142 ? -6.836  15.843   102.883 1.00 19.18 ? 223  LEU B N   1 
ATOM   4039  C  CA  . LEU B  1 142 ? -6.188  16.088   101.603 1.00 19.08 ? 223  LEU B CA  1 
ATOM   4040  C  C   . LEU B  1 142 ? -5.146  17.170   101.869 1.00 19.67 ? 223  LEU B C   1 
ATOM   4041  O  O   . LEU B  1 142 ? -5.422  18.152   102.561 1.00 20.22 ? 223  LEU B O   1 
ATOM   4042  C  CB  . LEU B  1 142 ? -7.199  16.583   100.577 1.00 18.65 ? 223  LEU B CB  1 
ATOM   4043  C  CG  . LEU B  1 142 ? -6.629  17.035   99.232  1.00 20.01 ? 223  LEU B CG  1 
ATOM   4044  C  CD1 . LEU B  1 142 ? -5.956  15.860   98.529  1.00 19.87 ? 223  LEU B CD1 1 
ATOM   4045  C  CD2 . LEU B  1 142 ? -7.757  17.596   98.369  1.00 19.05 ? 223  LEU B CD2 1 
ATOM   4046  N  N   . ARG B  1 143 ? -3.947  16.985   101.334 1.00 18.96 ? 224  ARG B N   1 
ATOM   4047  C  CA  . ARG B  1 143 ? -2.878  17.947   101.539 1.00 19.92 ? 224  ARG B CA  1 
ATOM   4048  C  C   . ARG B  1 143 ? -1.942  18.032   100.339 1.00 20.05 ? 224  ARG B C   1 
ATOM   4049  O  O   . ARG B  1 143 ? -1.859  17.103   99.535  1.00 23.04 ? 224  ARG B O   1 
ATOM   4050  C  CB  . ARG B  1 143 ? -2.101  17.602   102.824 1.00 18.75 ? 224  ARG B CB  1 
ATOM   4051  C  CG  . ARG B  1 143 ? -1.770  16.121   103.026 1.00 18.17 ? 224  ARG B CG  1 
ATOM   4052  C  CD  . ARG B  1 143 ? -1.528  15.810   104.511 1.00 18.85 ? 224  ARG B CD  1 
ATOM   4053  N  NE  . ARG B  1 143 ? -1.015  14.459   104.713 1.00 21.41 ? 224  ARG B NE  1 
ATOM   4054  C  CZ  . ARG B  1 143 ? -1.743  13.353   104.591 1.00 22.41 ? 224  ARG B CZ  1 
ATOM   4055  N  NH1 . ARG B  1 143 ? -1.179  12.167   104.779 1.00 21.20 ? 224  ARG B NH1 1 
ATOM   4056  N  NH2 . ARG B  1 143 ? -3.038  13.428   104.307 1.00 21.82 ? 224  ARG B NH2 1 
ATOM   4057  N  N   . THR B  1 144 ? -1.253  19.156   100.200 1.00 19.54 ? 225  THR B N   1 
ATOM   4058  C  CA  . THR B  1 144 ? -0.348  19.320   99.079  1.00 19.55 ? 225  THR B CA  1 
ATOM   4059  C  C   . THR B  1 144 ? 1.070   19.733   99.513  1.00 17.90 ? 225  THR B C   1 
ATOM   4060  O  O   . THR B  1 144 ? 1.437   19.592   100.678 1.00 18.74 ? 225  THR B O   1 
ATOM   4061  C  CB  . THR B  1 144 ? -0.972  20.296   98.020  1.00 21.03 ? 225  THR B CB  1 
ATOM   4062  O  OG1 . THR B  1 144 ? -0.089  20.422   96.898  1.00 22.03 ? 225  THR B OG1 1 
ATOM   4063  C  CG2 . THR B  1 144 ? -1.268  21.662   98.633  1.00 19.96 ? 225  THR B CG2 1 
ATOM   4064  N  N   . GLN B  1 145 ? 1.859   20.229   98.571  1.00 18.00 ? 226  GLN B N   1 
ATOM   4065  C  CA  . GLN B  1 145 ? 3.268   20.589   98.784  1.00 17.04 ? 226  GLN B CA  1 
ATOM   4066  C  C   . GLN B  1 145 ? 3.747   21.507   99.917  1.00 17.58 ? 226  GLN B C   1 
ATOM   4067  O  O   . GLN B  1 145 ? 4.701   21.172   100.621 1.00 16.92 ? 226  GLN B O   1 
ATOM   4068  C  CB  . GLN B  1 145 ? 3.828   21.144   97.482  1.00 17.32 ? 226  GLN B CB  1 
ATOM   4069  C  CG  . GLN B  1 145 ? 3.581   20.276   96.269  1.00 18.34 ? 226  GLN B CG  1 
ATOM   4070  C  CD  . GLN B  1 145 ? 4.121   20.920   95.009  1.00 20.35 ? 226  GLN B CD  1 
ATOM   4071  O  OE1 . GLN B  1 145 ? 5.312   21.216   94.910  1.00 23.00 ? 226  GLN B OE1 1 
ATOM   4072  N  NE2 . GLN B  1 145 ? 3.250   21.144   94.039  1.00 22.34 ? 226  GLN B NE2 1 
ATOM   4073  N  N   . GLU B  1 146 ? 3.105   22.661   100.078 1.00 17.91 ? 227  GLU B N   1 
ATOM   4074  C  CA  . GLU B  1 146 ? 3.503   23.658   101.071 1.00 17.51 ? 227  GLU B CA  1 
ATOM   4075  C  C   . GLU B  1 146 ? 4.758   24.296   100.502 1.00 17.81 ? 227  GLU B C   1 
ATOM   4076  O  O   . GLU B  1 146 ? 5.615   24.786   101.228 1.00 17.60 ? 227  GLU B O   1 
ATOM   4077  C  CB  . GLU B  1 146 ? 3.826   23.040   102.431 1.00 18.97 ? 227  GLU B CB  1 
ATOM   4078  C  CG  . GLU B  1 146 ? 2.837   22.018   102.924 1.00 22.38 ? 227  GLU B CG  1 
ATOM   4079  C  CD  . GLU B  1 146 ? 1.392   22.452   102.769 1.00 25.71 ? 227  GLU B CD  1 
ATOM   4080  O  OE1 . GLU B  1 146 ? 1.134   23.627   102.415 1.00 26.51 ? 227  GLU B OE1 1 
ATOM   4081  O  OE2 . GLU B  1 146 ? 0.507   21.602   103.009 1.00 27.80 ? 227  GLU B OE2 1 
ATOM   4082  N  N   . SER B  1 147 ? 4.862   24.243   99.182  1.00 18.52 ? 228  SER B N   1 
ATOM   4083  C  CA  . SER B  1 147 ? 5.971   24.832   98.461  1.00 19.93 ? 228  SER B CA  1 
ATOM   4084  C  C   . SER B  1 147 ? 5.540   24.965   97.011  1.00 20.33 ? 228  SER B C   1 
ATOM   4085  O  O   . SER B  1 147 ? 4.478   24.486   96.620  1.00 19.39 ? 228  SER B O   1 
ATOM   4086  C  CB  . SER B  1 147 ? 7.234   23.969   98.565  1.00 21.74 ? 228  SER B CB  1 
ATOM   4087  O  OG  . SER B  1 147 ? 7.388   23.117   97.445  1.00 24.10 ? 228  SER B OG  1 
ATOM   4088  N  N   . GLU B  1 148 ? 6.378   25.630   96.232  1.00 20.84 ? 229  GLU B N   1 
ATOM   4089  C  CA  . GLU B  1 148 ? 6.146   25.898   94.819  1.00 23.16 ? 229  GLU B CA  1 
ATOM   4090  C  C   . GLU B  1 148 ? 5.845   24.679   93.951  1.00 23.71 ? 229  GLU B C   1 
ATOM   4091  O  O   . GLU B  1 148 ? 6.454   23.624   94.128  1.00 23.52 ? 229  GLU B O   1 
ATOM   4092  C  CB  . GLU B  1 148 ? 7.378   26.625   94.277  1.00 24.63 ? 229  GLU B CB  1 
ATOM   4093  C  CG  . GLU B  1 148 ? 7.465   26.771   92.779  1.00 29.68 ? 229  GLU B CG  1 
ATOM   4094  C  CD  . GLU B  1 148 ? 8.862   27.184   92.325  1.00 32.56 ? 229  GLU B CD  1 
ATOM   4095  O  OE1 . GLU B  1 148 ? 9.795   26.346   92.430  1.00 32.48 ? 229  GLU B OE1 1 
ATOM   4096  O  OE2 . GLU B  1 148 ? 9.024   28.345   91.871  1.00 33.74 ? 229  GLU B OE2 1 
ATOM   4097  N  N   . CYS B  1 149 ? 4.896   24.824   93.021  1.00 24.54 ? 230  CYS B N   1 
ATOM   4098  C  CA  . CYS B  1 149 ? 4.586   23.737   92.091  1.00 25.72 ? 230  CYS B CA  1 
ATOM   4099  C  C   . CYS B  1 149 ? 5.482   23.939   90.876  1.00 25.21 ? 230  CYS B C   1 
ATOM   4100  O  O   . CYS B  1 149 ? 6.088   24.996   90.732  1.00 25.05 ? 230  CYS B O   1 
ATOM   4101  C  CB  . CYS B  1 149 ? 3.106   23.713   91.662  1.00 25.30 ? 230  CYS B CB  1 
ATOM   4102  S  SG  . CYS B  1 149 ? 2.124   25.246   91.734  1.00 30.75 ? 230  CYS B SG  1 
ATOM   4103  N  N   . ALA B  1 150 ? 5.576   22.934   90.010  1.00 25.22 ? 231  ALA B N   1 
ATOM   4104  C  CA  . ALA B  1 150 ? 6.448   23.029   88.845  1.00 25.16 ? 231  ALA B CA  1 
ATOM   4105  C  C   . ALA B  1 150 ? 5.707   23.194   87.531  1.00 25.71 ? 231  ALA B C   1 
ATOM   4106  O  O   . ALA B  1 150 ? 4.799   22.423   87.230  1.00 23.80 ? 231  ALA B O   1 
ATOM   4107  C  CB  . ALA B  1 150 ? 7.351   21.797   88.779  1.00 24.40 ? 231  ALA B CB  1 
ATOM   4108  N  N   . CYS B  1 151 ? 6.101   24.195   86.744  1.00 26.45 ? 232  CYS B N   1 
ATOM   4109  C  CA  . CYS B  1 151 ? 5.457   24.423   85.454  1.00 29.62 ? 232  CYS B CA  1 
ATOM   4110  C  C   . CYS B  1 151 ? 6.421   24.184   84.291  1.00 29.92 ? 232  CYS B C   1 
ATOM   4111  O  O   . CYS B  1 151 ? 7.604   24.506   84.379  1.00 31.25 ? 232  CYS B O   1 
ATOM   4112  C  CB  . CYS B  1 151 ? 4.894   25.849   85.362  1.00 30.32 ? 232  CYS B CB  1 
ATOM   4113  S  SG  . CYS B  1 151 ? 3.719   26.366   86.675  1.00 34.78 ? 232  CYS B SG  1 
ATOM   4114  N  N   . VAL B  1 152 ? 5.899   23.612   83.206  1.00 29.82 ? 233  VAL B N   1 
ATOM   4115  C  CA  . VAL B  1 152 ? 6.672   23.315   82.001  1.00 28.65 ? 233  VAL B CA  1 
ATOM   4116  C  C   . VAL B  1 152 ? 5.783   23.422   80.755  1.00 28.93 ? 233  VAL B C   1 
ATOM   4117  O  O   . VAL B  1 152 ? 4.656   22.931   80.742  1.00 30.16 ? 233  VAL B O   1 
ATOM   4118  C  CB  . VAL B  1 152 ? 7.264   21.875   82.047  1.00 28.12 ? 233  VAL B CB  1 
ATOM   4119  C  CG1 . VAL B  1 152 ? 8.036   21.585   80.786  1.00 27.85 ? 233  VAL B CG1 1 
ATOM   4120  C  CG2 . VAL B  1 152 ? 8.172   21.719   83.239  1.00 27.95 ? 233  VAL B CG2 1 
ATOM   4121  N  N   . ASN B  1 153 ? 6.291   24.081   79.718  1.00 28.99 ? 234  ASN B N   1 
ATOM   4122  C  CA  . ASN B  1 153 ? 5.573   24.225   78.452  1.00 29.19 ? 234  ASN B CA  1 
ATOM   4123  C  C   . ASN B  1 153 ? 4.088   24.598   78.604  1.00 28.76 ? 234  ASN B C   1 
ATOM   4124  O  O   . ASN B  1 153 ? 3.249   24.169   77.821  1.00 29.13 ? 234  ASN B O   1 
ATOM   4125  C  CB  . ASN B  1 153 ? 5.744   22.923   77.628  1.00 29.66 ? 234  ASN B CB  1 
ATOM   4126  C  CG  . ASN B  1 153 ? 5.091   22.990   76.237  1.00 31.11 ? 234  ASN B CG  1 
ATOM   4127  O  OD1 . ASN B  1 153 ? 5.099   24.036   75.577  1.00 29.42 ? 234  ASN B OD1 1 
ATOM   4128  N  ND2 . ASN B  1 153 ? 4.536   21.858   75.785  1.00 30.22 ? 234  ASN B ND2 1 
ATOM   4129  N  N   . GLY B  1 154 ? 3.761   25.398   79.611  1.00 28.18 ? 235  GLY B N   1 
ATOM   4130  C  CA  . GLY B  1 154 ? 2.377   25.817   79.773  1.00 26.87 ? 235  GLY B CA  1 
ATOM   4131  C  C   . GLY B  1 154 ? 1.468   24.900   80.569  1.00 26.67 ? 235  GLY B C   1 
ATOM   4132  O  O   . GLY B  1 154 ? 0.241   24.993   80.484  1.00 26.41 ? 235  GLY B O   1 
ATOM   4133  N  N   . SER B  1 155 ? 2.066   23.996   81.330  1.00 25.21 ? 236  SER B N   1 
ATOM   4134  C  CA  . SER B  1 155 ? 1.302   23.087   82.168  1.00 25.47 ? 236  SER B CA  1 
ATOM   4135  C  C   . SER B  1 155 ? 2.034   23.151   83.486  1.00 25.27 ? 236  SER B C   1 
ATOM   4136  O  O   . SER B  1 155 ? 3.243   23.351   83.500  1.00 25.63 ? 236  SER B O   1 
ATOM   4137  C  CB  . SER B  1 155 ? 1.344   21.658   81.620  1.00 25.86 ? 236  SER B CB  1 
ATOM   4138  O  OG  . SER B  1 155 ? 0.776   21.585   80.323  1.00 26.92 ? 236  SER B OG  1 
ATOM   4139  N  N   . CYS B  1 156 ? 1.314   23.024   84.591  1.00 24.54 ? 237  CYS B N   1 
ATOM   4140  C  CA  . CYS B  1 156 ? 1.955   23.054   85.898  1.00 25.12 ? 237  CYS B CA  1 
ATOM   4141  C  C   . CYS B  1 156 ? 1.598   21.760   86.600  1.00 23.43 ? 237  CYS B C   1 
ATOM   4142  O  O   . CYS B  1 156 ? 0.540   21.184   86.349  1.00 24.53 ? 237  CYS B O   1 
ATOM   4143  C  CB  . CYS B  1 156 ? 1.478   24.253   86.718  1.00 27.16 ? 237  CYS B CB  1 
ATOM   4144  S  SG  . CYS B  1 156 ? 1.851   25.890   85.993  1.00 30.34 ? 237  CYS B SG  1 
ATOM   4145  N  N   . PHE B  1 157 ? 2.474   21.298   87.481  1.00 21.05 ? 238  PHE B N   1 
ATOM   4146  C  CA  . PHE B  1 157 ? 2.225   20.047   88.171  1.00 17.84 ? 238  PHE B CA  1 
ATOM   4147  C  C   . PHE B  1 157 ? 2.357   20.156   89.668  1.00 17.97 ? 238  PHE B C   1 
ATOM   4148  O  O   . PHE B  1 157 ? 3.163   20.934   90.179  1.00 17.68 ? 238  PHE B O   1 
ATOM   4149  C  CB  . PHE B  1 157 ? 3.186   18.971   87.664  1.00 15.87 ? 238  PHE B CB  1 
ATOM   4150  C  CG  . PHE B  1 157 ? 3.216   18.848   86.177  1.00 13.09 ? 238  PHE B CG  1 
ATOM   4151  C  CD1 . PHE B  1 157 ? 3.886   19.789   85.410  1.00 11.14 ? 238  PHE B CD1 1 
ATOM   4152  C  CD2 . PHE B  1 157 ? 2.547   17.809   85.540  1.00 13.58 ? 238  PHE B CD2 1 
ATOM   4153  C  CE1 . PHE B  1 157 ? 3.897   19.703   84.028  1.00 13.81 ? 238  PHE B CE1 1 
ATOM   4154  C  CE2 . PHE B  1 157 ? 2.546   17.704   84.151  1.00 12.69 ? 238  PHE B CE2 1 
ATOM   4155  C  CZ  . PHE B  1 157 ? 3.223   18.655   83.390  1.00 15.22 ? 238  PHE B CZ  1 
ATOM   4156  N  N   . THR B  1 158 ? 1.558   19.364   90.371  1.00 17.87 ? 239  THR B N   1 
ATOM   4157  C  CA  . THR B  1 158 ? 1.616   19.356   91.820  1.00 18.90 ? 239  THR B CA  1 
ATOM   4158  C  C   . THR B  1 158 ? 1.347   17.950   92.344  1.00 19.36 ? 239  THR B C   1 
ATOM   4159  O  O   . THR B  1 158 ? 0.828   17.095   91.622  1.00 21.47 ? 239  THR B O   1 
ATOM   4160  C  CB  . THR B  1 158 ? 0.594   20.332   92.429  1.00 17.74 ? 239  THR B CB  1 
ATOM   4161  O  OG1 . THR B  1 158 ? 0.909   20.521   93.810  1.00 20.81 ? 239  THR B OG1 1 
ATOM   4162  C  CG2 . THR B  1 158 ? -0.836  19.786   92.315  1.00 15.42 ? 239  THR B CG2 1 
ATOM   4163  N  N   . VAL B  1 159 ? 1.695   17.706   93.599  1.00 17.49 ? 240  VAL B N   1 
ATOM   4164  C  CA  . VAL B  1 159 ? 1.470   16.392   94.174  1.00 16.02 ? 240  VAL B CA  1 
ATOM   4165  C  C   . VAL B  1 159 ? 0.660   16.500   95.449  1.00 16.32 ? 240  VAL B C   1 
ATOM   4166  O  O   . VAL B  1 159 ? 1.034   17.210   96.372  1.00 17.67 ? 240  VAL B O   1 
ATOM   4167  C  CB  . VAL B  1 159 ? 2.802   15.690   94.486  1.00 14.01 ? 240  VAL B CB  1 
ATOM   4168  C  CG1 . VAL B  1 159 ? 2.544   14.300   95.056  1.00 12.32 ? 240  VAL B CG1 1 
ATOM   4169  C  CG2 . VAL B  1 159 ? 3.632   15.604   93.232  1.00 12.61 ? 240  VAL B CG2 1 
ATOM   4170  N  N   . MET B  1 160 ? -0.460  15.797   95.503  1.00 18.36 ? 241  MET B N   1 
ATOM   4171  C  CA  . MET B  1 160 ? -1.293  15.836   96.698  1.00 20.76 ? 241  MET B CA  1 
ATOM   4172  C  C   . MET B  1 160 ? -1.350  14.464   97.344  1.00 20.04 ? 241  MET B C   1 
ATOM   4173  O  O   . MET B  1 160 ? -1.214  13.441   96.669  1.00 20.06 ? 241  MET B O   1 
ATOM   4174  C  CB  . MET B  1 160 ? -2.711  16.286   96.353  1.00 22.26 ? 241  MET B CB  1 
ATOM   4175  C  CG  . MET B  1 160 ? -2.795  17.531   95.500  1.00 24.69 ? 241  MET B CG  1 
ATOM   4176  S  SD  . MET B  1 160 ? -4.444  18.258   95.650  1.00 28.13 ? 241  MET B SD  1 
ATOM   4177  C  CE  . MET B  1 160 ? -4.032  19.993   95.466  1.00 27.40 ? 241  MET B CE  1 
ATOM   4178  N  N   . THR B  1 161 ? -1.549  14.452   98.655  1.00 19.05 ? 242  THR B N   1 
ATOM   4179  C  CA  . THR B  1 161 ? -1.632  13.213   99.402  1.00 19.04 ? 242  THR B CA  1 
ATOM   4180  C  C   . THR B  1 161 ? -2.942  13.164   100.148 1.00 19.59 ? 242  THR B C   1 
ATOM   4181  O  O   . THR B  1 161 ? -3.453  14.185   100.586 1.00 21.80 ? 242  THR B O   1 
ATOM   4182  C  CB  . THR B  1 161 ? -0.500  13.104   100.435 1.00 17.97 ? 242  THR B CB  1 
ATOM   4183  O  OG1 . THR B  1 161 ? 0.743   12.956   99.750  1.00 20.68 ? 242  THR B OG1 1 
ATOM   4184  C  CG2 . THR B  1 161 ? -0.710  11.905   101.362 1.00 16.41 ? 242  THR B CG2 1 
ATOM   4185  N  N   . ASP B  1 162 ? -3.488  11.969   100.288 1.00 20.07 ? 243  ASP B N   1 
ATOM   4186  C  CA  . ASP B  1 162 ? -4.728  11.796   101.021 1.00 20.29 ? 243  ASP B CA  1 
ATOM   4187  C  C   . ASP B  1 162 ? -4.616  10.448   101.706 1.00 19.14 ? 243  ASP B C   1 
ATOM   4188  O  O   . ASP B  1 162 ? -4.251  9.447    101.082 1.00 20.11 ? 243  ASP B O   1 
ATOM   4189  C  CB  . ASP B  1 162 ? -5.933  11.839   100.078 1.00 21.03 ? 243  ASP B CB  1 
ATOM   4190  C  CG  . ASP B  1 162 ? -7.241  12.123   100.809 1.00 21.78 ? 243  ASP B CG  1 
ATOM   4191  O  OD1 . ASP B  1 162 ? -8.244  12.405   100.117 1.00 23.20 ? 243  ASP B OD1 1 
ATOM   4192  O  OD2 . ASP B  1 162 ? -7.270  12.064   102.063 1.00 19.63 ? 243  ASP B OD2 1 
ATOM   4193  N  N   . GLY B  1 163 ? -4.900  10.435   102.998 1.00 18.49 ? 244  GLY B N   1 
ATOM   4194  C  CA  . GLY B  1 163 ? -4.801  9.213    103.756 1.00 19.81 ? 244  GLY B CA  1 
ATOM   4195  C  C   . GLY B  1 163 ? -4.083  9.491    105.052 1.00 20.89 ? 244  GLY B C   1 
ATOM   4196  O  O   . GLY B  1 163 ? -3.839  10.643   105.386 1.00 21.97 ? 244  GLY B O   1 
ATOM   4197  N  N   . PRO B  1 164 ? -3.719  8.452    105.804 1.00 22.36 ? 245  PRO B N   1 
ATOM   4198  C  CA  . PRO B  1 164 ? -3.021  8.614    107.083 1.00 23.86 ? 245  PRO B CA  1 
ATOM   4199  C  C   . PRO B  1 164 ? -1.589  9.138    106.936 1.00 23.88 ? 245  PRO B C   1 
ATOM   4200  O  O   . PRO B  1 164 ? -0.937  8.926    105.919 1.00 24.00 ? 245  PRO B O   1 
ATOM   4201  C  CB  . PRO B  1 164 ? -3.056  7.205    107.660 1.00 24.01 ? 245  PRO B CB  1 
ATOM   4202  C  CG  . PRO B  1 164 ? -2.858  6.376    106.422 1.00 23.75 ? 245  PRO B CG  1 
ATOM   4203  C  CD  . PRO B  1 164 ? -3.814  7.028    105.435 1.00 21.80 ? 245  PRO B CD  1 
ATOM   4204  N  N   . SER B  1 165 ? -1.107  9.830    107.960 1.00 25.19 ? 246  SER B N   1 
ATOM   4205  C  CA  . SER B  1 165 ? 0.253   10.340   107.935 1.00 25.58 ? 246  SER B CA  1 
ATOM   4206  C  C   . SER B  1 165 ? 1.170   9.289    108.561 1.00 26.43 ? 246  SER B C   1 
ATOM   4207  O  O   . SER B  1 165 ? 2.310   9.576    108.900 1.00 27.95 ? 246  SER B O   1 
ATOM   4208  C  CB  . SER B  1 165 ? 0.351   11.673   108.679 1.00 25.25 ? 246  SER B CB  1 
ATOM   4209  O  OG  . SER B  1 165 ? -0.044  11.534   110.032 1.00 28.33 ? 246  SER B OG  1 
ATOM   4210  N  N   . ASN B  1 166 ? 0.641   8.077    108.729 1.00 27.81 ? 247  ASN B N   1 
ATOM   4211  C  CA  . ASN B  1 166 ? 1.404   6.931    109.229 1.00 27.14 ? 247  ASN B CA  1 
ATOM   4212  C  C   . ASN B  1 166 ? 1.382   5.955    108.069 1.00 26.77 ? 247  ASN B C   1 
ATOM   4213  O  O   . ASN B  1 166 ? 1.806   6.286    106.966 1.00 29.83 ? 247  ASN B O   1 
ATOM   4214  C  CB  . ASN B  1 166 ? 0.733   6.265    110.413 1.00 28.33 ? 247  ASN B CB  1 
ATOM   4215  C  CG  . ASN B  1 166 ? 0.395   7.234    111.482 1.00 29.40 ? 247  ASN B CG  1 
ATOM   4216  O  OD1 . ASN B  1 166 ? 1.212   8.087    111.822 1.00 30.01 ? 247  ASN B OD1 1 
ATOM   4217  N  ND2 . ASN B  1 166 ? -0.808  7.119    112.034 1.00 26.37 ? 247  ASN B ND2 1 
ATOM   4218  N  N   . GLY B  1 167 ? 0.860   4.763    108.308 1.00 25.25 ? 248  GLY B N   1 
ATOM   4219  C  CA  . GLY B  1 167 ? 0.796   3.755    107.259 1.00 24.68 ? 248  GLY B CA  1 
ATOM   4220  C  C   . GLY B  1 167 ? 0.513   4.222    105.839 1.00 22.41 ? 248  GLY B C   1 
ATOM   4221  O  O   . GLY B  1 167 ? 0.401   5.405    105.559 1.00 21.54 ? 248  GLY B O   1 
ATOM   4222  N  N   . GLN B  1 168 ? 0.407   3.263    104.930 1.00 22.58 ? 249  GLN B N   1 
ATOM   4223  C  CA  . GLN B  1 168 ? 0.124   3.554    103.534 1.00 22.16 ? 249  GLN B CA  1 
ATOM   4224  C  C   . GLN B  1 168 ? -0.898  4.668    103.407 1.00 20.89 ? 249  GLN B C   1 
ATOM   4225  O  O   . GLN B  1 168 ? -1.827  4.756    104.213 1.00 19.65 ? 249  GLN B O   1 
ATOM   4226  C  CB  . GLN B  1 168 ? -0.429  2.315    102.844 1.00 22.03 ? 249  GLN B CB  1 
ATOM   4227  C  CG  . GLN B  1 168 ? 0.587   1.548    102.063 1.00 27.05 ? 249  GLN B CG  1 
ATOM   4228  C  CD  . GLN B  1 168 ? 1.053   2.318    100.870 1.00 27.91 ? 249  GLN B CD  1 
ATOM   4229  O  OE1 . GLN B  1 168 ? 0.267   2.991    100.211 1.00 31.50 ? 249  GLN B OE1 1 
ATOM   4230  N  NE2 . GLN B  1 168 ? 2.332   2.221    100.570 1.00 30.82 ? 249  GLN B NE2 1 
ATOM   4231  N  N   . ALA B  1 169 ? -0.707  5.514    102.396 1.00 18.89 ? 250  ALA B N   1 
ATOM   4232  C  CA  . ALA B  1 169 ? -1.620  6.610    102.103 1.00 18.38 ? 250  ALA B CA  1 
ATOM   4233  C  C   . ALA B  1 169 ? -1.773  6.607    100.602 1.00 19.09 ? 250  ALA B C   1 
ATOM   4234  O  O   . ALA B  1 169 ? -1.161  5.786    99.917  1.00 19.45 ? 250  ALA B O   1 
ATOM   4235  C  CB  . ALA B  1 169 ? -1.050  7.925    102.563 1.00 17.45 ? 250  ALA B CB  1 
ATOM   4236  N  N   . SER B  1 170 ? -2.595  7.511    100.083 1.00 19.94 ? 251  SER B N   1 
ATOM   4237  C  CA  . SER B  1 170 ? -2.807  7.589    98.645  1.00 19.67 ? 251  SER B CA  1 
ATOM   4238  C  C   . SER B  1 170 ? -2.054  8.805    98.113  1.00 19.93 ? 251  SER B C   1 
ATOM   4239  O  O   . SER B  1 170 ? -2.030  9.847    98.771  1.00 19.93 ? 251  SER B O   1 
ATOM   4240  C  CB  . SER B  1 170 ? -4.300  7.713    98.362  1.00 19.55 ? 251  SER B CB  1 
ATOM   4241  O  OG  . SER B  1 170 ? -4.550  7.774    96.967  1.00 21.71 ? 251  SER B OG  1 
ATOM   4242  N  N   . TYR B  1 171 ? -1.447  8.678    96.931  1.00 19.88 ? 252  TYR B N   1 
ATOM   4243  C  CA  . TYR B  1 171 ? -0.667  9.776    96.338  1.00 20.03 ? 252  TYR B CA  1 
ATOM   4244  C  C   . TYR B  1 171 ? -0.978  9.992    94.866  1.00 21.26 ? 252  TYR B C   1 
ATOM   4245  O  O   . TYR B  1 171 ? -0.937  9.043    94.070  1.00 23.72 ? 252  TYR B O   1 
ATOM   4246  C  CB  . TYR B  1 171 ? 0.831   9.488    96.479  1.00 18.55 ? 252  TYR B CB  1 
ATOM   4247  C  CG  . TYR B  1 171 ? 1.189   8.782    97.765  1.00 17.85 ? 252  TYR B CG  1 
ATOM   4248  C  CD1 . TYR B  1 171 ? 1.571   7.439    97.768  1.00 16.56 ? 252  TYR B CD1 1 
ATOM   4249  C  CD2 . TYR B  1 171 ? 1.076   9.438    98.990  1.00 16.02 ? 252  TYR B CD2 1 
ATOM   4250  C  CE1 . TYR B  1 171 ? 1.823   6.759    98.971  1.00 16.22 ? 252  TYR B CE1 1 
ATOM   4251  C  CE2 . TYR B  1 171 ? 1.324   8.775    100.188 1.00 16.26 ? 252  TYR B CE2 1 
ATOM   4252  C  CZ  . TYR B  1 171 ? 1.690   7.437    100.177 1.00 15.81 ? 252  TYR B CZ  1 
ATOM   4253  O  OH  . TYR B  1 171 ? 1.871   6.788    101.381 1.00 12.74 ? 252  TYR B OH  1 
ATOM   4254  N  N   . LYS B  1 172 ? -1.263  11.239   94.494  1.00 21.71 ? 253  LYS B N   1 
ATOM   4255  C  CA  . LYS B  1 172 ? -1.584  11.562   93.103  1.00 22.32 ? 253  LYS B CA  1 
ATOM   4256  C  C   . LYS B  1 172 ? -0.829  12.768   92.571  1.00 21.99 ? 253  LYS B C   1 
ATOM   4257  O  O   . LYS B  1 172 ? -0.513  13.696   93.313  1.00 21.97 ? 253  LYS B O   1 
ATOM   4258  C  CB  . LYS B  1 172 ? -3.075  11.844   92.938  1.00 24.07 ? 253  LYS B CB  1 
ATOM   4259  C  CG  . LYS B  1 172 ? -4.004  10.691   93.271  1.00 25.29 ? 253  LYS B CG  1 
ATOM   4260  C  CD  . LYS B  1 172 ? -5.443  11.050   92.892  1.00 26.15 ? 253  LYS B CD  1 
ATOM   4261  C  CE  . LYS B  1 172 ? -6.402  9.904    93.186  1.00 27.51 ? 253  LYS B CE  1 
ATOM   4262  N  NZ  . LYS B  1 172 ? -7.733  10.162   92.575  1.00 29.09 ? 253  LYS B NZ  1 
ATOM   4263  N  N   . ILE B  1 173 ? -0.543  12.738   91.273  1.00 21.80 ? 254  ILE B N   1 
ATOM   4264  C  CA  . ILE B  1 173 ? 0.140   13.831   90.601  1.00 20.72 ? 254  ILE B CA  1 
ATOM   4265  C  C   . ILE B  1 173 ? -0.939  14.462   89.747  1.00 21.73 ? 254  ILE B C   1 
ATOM   4266  O  O   . ILE B  1 173 ? -1.766  13.750   89.166  1.00 22.28 ? 254  ILE B O   1 
ATOM   4267  C  CB  . ILE B  1 173 ? 1.189   13.354   89.613  1.00 21.27 ? 254  ILE B CB  1 
ATOM   4268  C  CG1 . ILE B  1 173 ? 2.185   12.413   90.271  1.00 19.54 ? 254  ILE B CG1 1 
ATOM   4269  C  CG2 . ILE B  1 173 ? 1.893   14.556   89.024  1.00 23.34 ? 254  ILE B CG2 1 
ATOM   4270  C  CD1 . ILE B  1 173 ? 3.040   11.725   89.234  1.00 17.92 ? 254  ILE B CD1 1 
ATOM   4271  N  N   . PHE B  1 174 ? -0.938  15.787   89.663  1.00 21.53 ? 255  PHE B N   1 
ATOM   4272  C  CA  . PHE B  1 174 ? -1.924  16.476   88.848  1.00 20.79 ? 255  PHE B CA  1 
ATOM   4273  C  C   . PHE B  1 174 ? -1.230  17.372   87.836  1.00 21.03 ? 255  PHE B C   1 
ATOM   4274  O  O   . PHE B  1 174 ? -0.161  17.917   88.094  1.00 21.43 ? 255  PHE B O   1 
ATOM   4275  C  CB  . PHE B  1 174 ? -2.863  17.330   89.708  1.00 19.42 ? 255  PHE B CB  1 
ATOM   4276  C  CG  . PHE B  1 174 ? -3.671  16.547   90.703  1.00 18.18 ? 255  PHE B CG  1 
ATOM   4277  C  CD1 . PHE B  1 174 ? -3.140  16.213   91.944  1.00 17.03 ? 255  PHE B CD1 1 
ATOM   4278  C  CD2 . PHE B  1 174 ? -4.976  16.161   90.408  1.00 17.92 ? 255  PHE B CD2 1 
ATOM   4279  C  CE1 . PHE B  1 174 ? -3.902  15.514   92.878  1.00 16.92 ? 255  PHE B CE1 1 
ATOM   4280  C  CE2 . PHE B  1 174 ? -5.744  15.459   91.336  1.00 16.39 ? 255  PHE B CE2 1 
ATOM   4281  C  CZ  . PHE B  1 174 ? -5.207  15.136   92.574  1.00 15.43 ? 255  PHE B CZ  1 
ATOM   4282  N  N   . LYS B  1 175 ? -1.850  17.508   86.675  1.00 21.19 ? 256  LYS B N   1 
ATOM   4283  C  CA  . LYS B  1 175 ? -1.334  18.352   85.618  1.00 21.59 ? 256  LYS B CA  1 
ATOM   4284  C  C   . LYS B  1 175 ? -2.433  19.349   85.325  1.00 22.86 ? 256  LYS B C   1 
ATOM   4285  O  O   . LYS B  1 175 ? -3.550  18.951   85.009  1.00 24.14 ? 256  LYS B O   1 
ATOM   4286  C  CB  . LYS B  1 175 ? -1.053  17.524   84.363  1.00 20.77 ? 256  LYS B CB  1 
ATOM   4287  C  CG  . LYS B  1 175 ? -0.773  18.342   83.111  1.00 18.50 ? 256  LYS B CG  1 
ATOM   4288  C  CD  . LYS B  1 175 ? -0.460  17.434   81.927  1.00 20.39 ? 256  LYS B CD  1 
ATOM   4289  C  CE  . LYS B  1 175 ? -0.239  18.230   80.643  1.00 20.26 ? 256  LYS B CE  1 
ATOM   4290  N  NZ  . LYS B  1 175 ? 0.095   17.344   79.496  1.00 19.66 ? 256  LYS B NZ  1 
ATOM   4291  N  N   . MET B  1 176 ? -2.151  20.637   85.457  1.00 23.18 ? 257  MET B N   1 
ATOM   4292  C  CA  . MET B  1 176 ? -3.189  21.603   85.146  1.00 25.70 ? 257  MET B CA  1 
ATOM   4293  C  C   . MET B  1 176 ? -2.754  22.645   84.125  1.00 24.88 ? 257  MET B C   1 
ATOM   4294  O  O   . MET B  1 176 ? -1.567  22.925   83.964  1.00 22.92 ? 257  MET B O   1 
ATOM   4295  C  CB  . MET B  1 176 ? -3.725  22.262   86.424  1.00 27.64 ? 257  MET B CB  1 
ATOM   4296  C  CG  . MET B  1 176 ? -2.701  22.535   87.489  1.00 31.00 ? 257  MET B CG  1 
ATOM   4297  S  SD  . MET B  1 176 ? -3.180  21.824   89.090  1.00 32.95 ? 257  MET B SD  1 
ATOM   4298  C  CE  . MET B  1 176 ? -1.609  21.919   89.941  1.00 30.34 ? 257  MET B CE  1 
ATOM   4299  N  N   . GLU B  1 177 ? -3.739  23.174   83.406  1.00 24.86 ? 258  GLU B N   1 
ATOM   4300  C  CA  . GLU B  1 177 ? -3.514  24.184   82.386  1.00 25.81 ? 258  GLU B CA  1 
ATOM   4301  C  C   . GLU B  1 177 ? -4.528  25.289   82.599  1.00 26.92 ? 258  GLU B C   1 
ATOM   4302  O  O   . GLU B  1 177 ? -5.740  25.071   82.515  1.00 26.99 ? 258  GLU B O   1 
ATOM   4303  C  CB  . GLU B  1 177 ? -3.638  23.555   81.003  1.00 25.18 ? 258  GLU B CB  1 
ATOM   4304  C  CG  . GLU B  1 177 ? -2.523  22.550   80.778  1.00 28.95 ? 258  GLU B CG  1 
ATOM   4305  C  CD  . GLU B  1 177 ? -2.647  21.764   79.491  1.00 31.12 ? 258  GLU B CD  1 
ATOM   4306  O  OE1 . GLU B  1 177 ? -1.705  21.006   79.183  1.00 32.07 ? 258  GLU B OE1 1 
ATOM   4307  O  OE2 . GLU B  1 177 ? -3.675  21.890   78.792  1.00 34.10 ? 258  GLU B OE2 1 
ATOM   4308  N  N   . LYS B  1 178 ? -4.012  26.479   82.896  1.00 28.11 ? 259  LYS B N   1 
ATOM   4309  C  CA  . LYS B  1 178 ? -4.842  27.637   83.187  1.00 28.67 ? 259  LYS B CA  1 
ATOM   4310  C  C   . LYS B  1 178 ? -5.652  27.319   84.442  1.00 27.82 ? 259  LYS B C   1 
ATOM   4311  O  O   . LYS B  1 178 ? -6.839  27.629   84.524  1.00 27.52 ? 259  LYS B O   1 
ATOM   4312  C  CB  . LYS B  1 178 ? -5.774  27.955   82.015  1.00 31.21 ? 259  LYS B CB  1 
ATOM   4313  C  CG  . LYS B  1 178 ? -5.036  28.376   80.756  1.00 36.42 ? 259  LYS B CG  1 
ATOM   4314  C  CD  . LYS B  1 178 ? -5.984  28.879   79.661  1.00 40.99 ? 259  LYS B CD  1 
ATOM   4315  C  CE  . LYS B  1 178 ? -5.204  29.270   78.393  1.00 43.27 ? 259  LYS B CE  1 
ATOM   4316  N  NZ  . LYS B  1 178 ? -6.074  29.753   77.277  1.00 43.25 ? 259  LYS B NZ  1 
ATOM   4317  N  N   . GLY B  1 179 ? -4.996  26.675   85.408  1.00 25.87 ? 260  GLY B N   1 
ATOM   4318  C  CA  . GLY B  1 179 ? -5.646  26.327   86.660  1.00 24.52 ? 260  GLY B CA  1 
ATOM   4319  C  C   . GLY B  1 179 ? -6.693  25.226   86.608  1.00 24.40 ? 260  GLY B C   1 
ATOM   4320  O  O   . GLY B  1 179 ? -7.425  25.019   87.580  1.00 23.25 ? 260  GLY B O   1 
ATOM   4321  N  N   . LYS B  1 180 ? -6.774  24.517   85.486  1.00 24.37 ? 261  LYS B N   1 
ATOM   4322  C  CA  . LYS B  1 180 ? -7.745  23.438   85.344  1.00 24.52 ? 261  LYS B CA  1 
ATOM   4323  C  C   . LYS B  1 180 ? -7.057  22.078   85.229  1.00 23.99 ? 261  LYS B C   1 
ATOM   4324  O  O   . LYS B  1 180 ? -6.189  21.876   84.382  1.00 26.58 ? 261  LYS B O   1 
ATOM   4325  C  CB  . LYS B  1 180 ? -8.630  23.676   84.119  1.00 24.09 ? 261  LYS B CB  1 
ATOM   4326  C  CG  . LYS B  1 180 ? -9.614  22.551   83.852  1.00 28.05 ? 261  LYS B CG  1 
ATOM   4327  C  CD  . LYS B  1 180 ? -10.628 22.907   82.769  1.00 32.63 ? 261  LYS B CD  1 
ATOM   4328  C  CE  . LYS B  1 180 ? -11.614 23.976   83.252  1.00 36.61 ? 261  LYS B CE  1 
ATOM   4329  N  NZ  . LYS B  1 180 ? -12.607 24.405   82.207  1.00 37.92 ? 261  LYS B NZ  1 
ATOM   4330  N  N   . VAL B  1 181 ? -7.429  21.146   86.093  1.00 21.92 ? 262  VAL B N   1 
ATOM   4331  C  CA  . VAL B  1 181 ? -6.828  19.828   86.037  1.00 21.07 ? 262  VAL B CA  1 
ATOM   4332  C  C   . VAL B  1 181 ? -7.178  19.203   84.694  1.00 22.05 ? 262  VAL B C   1 
ATOM   4333  O  O   . VAL B  1 181 ? -8.351  19.130   84.327  1.00 21.45 ? 262  VAL B O   1 
ATOM   4334  C  CB  . VAL B  1 181 ? -7.362  18.926   87.153  1.00 19.47 ? 262  VAL B CB  1 
ATOM   4335  C  CG1 . VAL B  1 181 ? -6.749  17.547   87.034  1.00 18.40 ? 262  VAL B CG1 1 
ATOM   4336  C  CG2 . VAL B  1 181 ? -7.047  19.531   88.497  1.00 19.56 ? 262  VAL B CG2 1 
ATOM   4337  N  N   . VAL B  1 182 ? -6.168  18.767   83.949  1.00 22.17 ? 263  VAL B N   1 
ATOM   4338  C  CA  . VAL B  1 182 ? -6.435  18.142   82.659  1.00 23.04 ? 263  VAL B CA  1 
ATOM   4339  C  C   . VAL B  1 182 ? -6.055  16.685   82.704  1.00 22.97 ? 263  VAL B C   1 
ATOM   4340  O  O   . VAL B  1 182 ? -6.331  15.935   81.774  1.00 24.62 ? 263  VAL B O   1 
ATOM   4341  C  CB  . VAL B  1 182 ? -5.662  18.807   81.516  1.00 21.84 ? 263  VAL B CB  1 
ATOM   4342  C  CG1 . VAL B  1 182 ? -6.179  20.224   81.302  1.00 22.46 ? 263  VAL B CG1 1 
ATOM   4343  C  CG2 . VAL B  1 182 ? -4.182  18.806   81.831  1.00 22.42 ? 263  VAL B CG2 1 
ATOM   4344  N  N   . LYS B  1 183 ? -5.423  16.282   83.797  1.00 23.01 ? 264  LYS B N   1 
ATOM   4345  C  CA  . LYS B  1 183 ? -5.014  14.897   83.953  1.00 22.71 ? 264  LYS B CA  1 
ATOM   4346  C  C   . LYS B  1 183 ? -4.423  14.665   85.323  1.00 21.84 ? 264  LYS B C   1 
ATOM   4347  O  O   . LYS B  1 183 ? -3.721  15.516   85.854  1.00 21.19 ? 264  LYS B O   1 
ATOM   4348  C  CB  . LYS B  1 183 ? -3.989  14.513   82.882  1.00 22.63 ? 264  LYS B CB  1 
ATOM   4349  C  CG  . LYS B  1 183 ? -3.456  13.091   83.040  1.00 23.07 ? 264  LYS B CG  1 
ATOM   4350  C  CD  . LYS B  1 183 ? -2.677  12.619   81.827  1.00 21.90 ? 264  LYS B CD  1 
ATOM   4351  C  CE  . LYS B  1 183 ? -2.282  11.160   82.000  1.00 23.39 ? 264  LYS B CE  1 
ATOM   4352  N  NZ  . LYS B  1 183 ? -1.907  10.512   80.712  1.00 25.49 ? 264  LYS B NZ  1 
ATOM   4353  N  N   . SER B  1 184 ? -4.741  13.519   85.909  1.00 22.56 ? 265  SER B N   1 
ATOM   4354  C  CA  . SER B  1 184 ? -4.203  13.165   87.214  1.00 23.29 ? 265  SER B CA  1 
ATOM   4355  C  C   . SER B  1 184 ? -3.868  11.686   87.168  1.00 22.42 ? 265  SER B C   1 
ATOM   4356  O  O   . SER B  1 184 ? -4.409  10.936   86.353  1.00 22.80 ? 265  SER B O   1 
ATOM   4357  C  CB  . SER B  1 184 ? -5.212  13.458   88.339  1.00 23.76 ? 265  SER B CB  1 
ATOM   4358  O  OG  . SER B  1 184 ? -6.218  12.465   88.422  1.00 25.15 ? 265  SER B OG  1 
ATOM   4359  N  N   . VAL B  1 185 ? -2.965  11.270   88.038  1.00 22.11 ? 266  VAL B N   1 
ATOM   4360  C  CA  . VAL B  1 185 ? -2.550  9.885    88.079  1.00 22.41 ? 266  VAL B CA  1 
ATOM   4361  C  C   . VAL B  1 185 ? -2.190  9.503    89.496  1.00 23.48 ? 266  VAL B C   1 
ATOM   4362  O  O   . VAL B  1 185 ? -1.505  10.251   90.199  1.00 23.58 ? 266  VAL B O   1 
ATOM   4363  C  CB  . VAL B  1 185 ? -1.321  9.648    87.171  1.00 23.67 ? 266  VAL B CB  1 
ATOM   4364  C  CG1 . VAL B  1 185 ? -0.645  8.336    87.533  1.00 23.28 ? 266  VAL B CG1 1 
ATOM   4365  C  CG2 . VAL B  1 185 ? -1.754  9.635    85.705  1.00 23.06 ? 266  VAL B CG2 1 
ATOM   4366  N  N   . GLU B  1 186 ? -2.671  8.341    89.923  1.00 23.41 ? 267  GLU B N   1 
ATOM   4367  C  CA  . GLU B  1 186 ? -2.356  7.874    91.252  1.00 23.28 ? 267  GLU B CA  1 
ATOM   4368  C  C   . GLU B  1 186 ? -1.072  7.074    91.153  1.00 24.08 ? 267  GLU B C   1 
ATOM   4369  O  O   . GLU B  1 186 ? -0.878  6.293    90.217  1.00 23.76 ? 267  GLU B O   1 
ATOM   4370  C  CB  . GLU B  1 186 ? -3.479  7.009    91.818  1.00 22.85 ? 267  GLU B CB  1 
ATOM   4371  C  CG  . GLU B  1 186 ? -3.107  6.357    93.144  1.00 24.39 ? 267  GLU B CG  1 
ATOM   4372  C  CD  . GLU B  1 186 ? -4.314  5.969    93.978  1.00 26.68 ? 267  GLU B CD  1 
ATOM   4373  O  OE1 . GLU B  1 186 ? -5.315  5.461    93.410  1.00 28.76 ? 267  GLU B OE1 1 
ATOM   4374  O  OE2 . GLU B  1 186 ? -4.252  6.158    95.211  1.00 25.63 ? 267  GLU B OE2 1 
ATOM   4375  N  N   . LEU B  1 187 ? -0.182  7.297    92.111  1.00 24.21 ? 268  LEU B N   1 
ATOM   4376  C  CA  . LEU B  1 187 ? 1.082   6.590    92.136  1.00 23.18 ? 268  LEU B CA  1 
ATOM   4377  C  C   . LEU B  1 187 ? 0.866   5.205    92.701  1.00 23.48 ? 268  LEU B C   1 
ATOM   4378  O  O   . LEU B  1 187 ? 0.120   5.033    93.664  1.00 22.92 ? 268  LEU B O   1 
ATOM   4379  C  CB  . LEU B  1 187 ? 2.087   7.315    93.024  1.00 20.87 ? 268  LEU B CB  1 
ATOM   4380  C  CG  . LEU B  1 187 ? 2.508   8.710    92.588  1.00 21.95 ? 268  LEU B CG  1 
ATOM   4381  C  CD1 . LEU B  1 187 ? 3.575   9.198    93.552  1.00 21.15 ? 268  LEU B CD1 1 
ATOM   4382  C  CD2 . LEU B  1 187 ? 3.018   8.698    91.145  1.00 20.06 ? 268  LEU B CD2 1 
ATOM   4383  N  N   . ASP B  1 188 ? 1.513   4.218    92.097  1.00 24.54 ? 269  ASP B N   1 
ATOM   4384  C  CA  . ASP B  1 188 ? 1.422   2.854    92.594  1.00 25.61 ? 269  ASP B CA  1 
ATOM   4385  C  C   . ASP B  1 188 ? 2.651   2.720    93.484  1.00 24.90 ? 269  ASP B C   1 
ATOM   4386  O  O   . ASP B  1 188 ? 3.653   2.108    93.107  1.00 25.02 ? 269  ASP B O   1 
ATOM   4387  C  CB  . ASP B  1 188 ? 1.467   1.859    91.431  1.00 27.75 ? 269  ASP B CB  1 
ATOM   4388  C  CG  . ASP B  1 188 ? 1.273   0.422    91.884  1.00 29.38 ? 269  ASP B CG  1 
ATOM   4389  O  OD1 . ASP B  1 188 ? 0.602   0.202    92.916  1.00 28.83 ? 269  ASP B OD1 1 
ATOM   4390  O  OD2 . ASP B  1 188 ? 1.782   -0.486   91.195  1.00 31.05 ? 269  ASP B OD2 1 
ATOM   4391  N  N   . ALA B  1 189 ? 2.566   3.314    94.670  1.00 23.88 ? 270  ALA B N   1 
ATOM   4392  C  CA  . ALA B  1 189 ? 3.686   3.319    95.600  1.00 23.54 ? 270  ALA B CA  1 
ATOM   4393  C  C   . ALA B  1 189 ? 3.500   2.545    96.901  1.00 23.26 ? 270  ALA B C   1 
ATOM   4394  O  O   . ALA B  1 189 ? 3.601   3.111    97.987  1.00 20.79 ? 270  ALA B O   1 
ATOM   4395  C  CB  . ALA B  1 189 ? 4.069   4.759    95.915  1.00 23.52 ? 270  ALA B CB  1 
ATOM   4396  N  N   . PRO B  1 190 ? 3.223   1.239    96.813  1.00 23.71 ? 271  PRO B N   1 
ATOM   4397  C  CA  . PRO B  1 190 ? 3.061   0.519    98.076  1.00 23.77 ? 271  PRO B CA  1 
ATOM   4398  C  C   . PRO B  1 190 ? 4.369   0.599    98.847  1.00 23.34 ? 271  PRO B C   1 
ATOM   4399  O  O   . PRO B  1 190 ? 5.446   0.474    98.273  1.00 25.23 ? 271  PRO B O   1 
ATOM   4400  C  CB  . PRO B  1 190 ? 2.725   -0.899   97.623  1.00 23.48 ? 271  PRO B CB  1 
ATOM   4401  C  CG  . PRO B  1 190 ? 3.426   -1.008   96.303  1.00 23.45 ? 271  PRO B CG  1 
ATOM   4402  C  CD  . PRO B  1 190 ? 3.098   0.324    95.667  1.00 24.36 ? 271  PRO B CD  1 
ATOM   4403  N  N   . ASN B  1 191 ? 4.258   0.831    100.144 1.00 23.49 ? 272  ASN B N   1 
ATOM   4404  C  CA  . ASN B  1 191 ? 5.391   0.958    101.051 1.00 22.77 ? 272  ASN B CA  1 
ATOM   4405  C  C   . ASN B  1 191 ? 6.093   2.316    100.989 1.00 24.30 ? 272  ASN B C   1 
ATOM   4406  O  O   . ASN B  1 191 ? 7.086   2.543    101.685 1.00 23.62 ? 272  ASN B O   1 
ATOM   4407  C  CB  . ASN B  1 191 ? 6.407   -0.156   100.831 1.00 20.92 ? 272  ASN B CB  1 
ATOM   4408  C  CG  . ASN B  1 191 ? 7.257   -0.390   102.062 1.00 22.30 ? 272  ASN B CG  1 
ATOM   4409  O  OD1 . ASN B  1 191 ? 6.735   -0.382   103.175 1.00 22.26 ? 272  ASN B OD1 1 
ATOM   4410  N  ND2 . ASN B  1 191 ? 8.559   -0.600   101.878 1.00 20.70 ? 272  ASN B ND2 1 
ATOM   4411  N  N   . TYR B  1 192 ? 5.584   3.217    100.155 1.00 24.97 ? 273  TYR B N   1 
ATOM   4412  C  CA  . TYR B  1 192 ? 6.152   4.561    100.065 1.00 25.51 ? 273  TYR B CA  1 
ATOM   4413  C  C   . TYR B  1 192 ? 5.237   5.482    100.850 1.00 25.77 ? 273  TYR B C   1 
ATOM   4414  O  O   . TYR B  1 192 ? 4.111   5.111    101.181 1.00 26.11 ? 273  TYR B O   1 
ATOM   4415  C  CB  . TYR B  1 192 ? 6.182   5.066    98.626  1.00 24.86 ? 273  TYR B CB  1 
ATOM   4416  C  CG  . TYR B  1 192 ? 7.276   4.508    97.770  1.00 27.20 ? 273  TYR B CG  1 
ATOM   4417  C  CD1 . TYR B  1 192 ? 7.257   3.179    97.358  1.00 28.56 ? 273  TYR B CD1 1 
ATOM   4418  C  CD2 . TYR B  1 192 ? 8.320   5.322    97.336  1.00 27.45 ? 273  TYR B CD2 1 
ATOM   4419  C  CE1 . TYR B  1 192 ? 8.257   2.675    96.522  1.00 31.01 ? 273  TYR B CE1 1 
ATOM   4420  C  CE2 . TYR B  1 192 ? 9.321   4.827    96.505  1.00 29.81 ? 273  TYR B CE2 1 
ATOM   4421  C  CZ  . TYR B  1 192 ? 9.282   3.504    96.101  1.00 29.78 ? 273  TYR B CZ  1 
ATOM   4422  O  OH  . TYR B  1 192 ? 10.258  3.009    95.269  1.00 30.60 ? 273  TYR B OH  1 
ATOM   4423  N  N   . HIS B  1 193 ? 5.720   6.682    101.143 1.00 25.49 ? 274  HIS B N   1 
ATOM   4424  C  CA  . HIS B  1 193 ? 4.913   7.673    101.839 1.00 25.48 ? 274  HIS B CA  1 
ATOM   4425  C  C   . HIS B  1 193 ? 5.333   9.047    101.354 1.00 25.95 ? 274  HIS B C   1 
ATOM   4426  O  O   . HIS B  1 193 ? 6.478   9.457    101.568 1.00 27.32 ? 274  HIS B O   1 
ATOM   4427  C  CB  . HIS B  1 193 ? 5.094   7.579    103.355 1.00 25.38 ? 274  HIS B CB  1 
ATOM   4428  C  CG  . HIS B  1 193 ? 4.017   8.282    104.126 1.00 25.22 ? 274  HIS B CG  1 
ATOM   4429  N  ND1 . HIS B  1 193 ? 4.243   9.447    104.829 1.00 27.10 ? 274  HIS B ND1 1 
ATOM   4430  C  CD2 . HIS B  1 193 ? 2.705   8.001    104.274 1.00 24.48 ? 274  HIS B CD2 1 
ATOM   4431  C  CE1 . HIS B  1 193 ? 3.112   9.851    105.378 1.00 25.17 ? 274  HIS B CE1 1 
ATOM   4432  N  NE2 . HIS B  1 193 ? 2.162   8.994    105.058 1.00 24.49 ? 274  HIS B NE2 1 
ATOM   4433  N  N   . TYR B  1 194 ? 4.420   9.749    100.684 1.00 24.64 ? 275  TYR B N   1 
ATOM   4434  C  CA  . TYR B  1 194 ? 4.720   11.084   100.178 1.00 24.47 ? 275  TYR B CA  1 
ATOM   4435  C  C   . TYR B  1 194 ? 3.920   12.165   100.887 1.00 25.25 ? 275  TYR B C   1 
ATOM   4436  O  O   . TYR B  1 194 ? 2.719   12.012   101.133 1.00 23.27 ? 275  TYR B O   1 
ATOM   4437  C  CB  . TYR B  1 194 ? 4.455   11.185   98.673  1.00 22.64 ? 275  TYR B CB  1 
ATOM   4438  C  CG  . TYR B  1 194 ? 5.364   10.329   97.821  1.00 23.91 ? 275  TYR B CG  1 
ATOM   4439  C  CD1 . TYR B  1 194 ? 5.058   8.992    97.560  1.00 23.12 ? 275  TYR B CD1 1 
ATOM   4440  C  CD2 . TYR B  1 194 ? 6.535   10.859   97.263  1.00 23.16 ? 275  TYR B CD2 1 
ATOM   4441  C  CE1 . TYR B  1 194 ? 5.890   8.203    96.758  1.00 22.58 ? 275  TYR B CE1 1 
ATOM   4442  C  CE2 . TYR B  1 194 ? 7.378   10.077   96.465  1.00 20.95 ? 275  TYR B CE2 1 
ATOM   4443  C  CZ  . TYR B  1 194 ? 7.049   8.752    96.211  1.00 22.64 ? 275  TYR B CZ  1 
ATOM   4444  O  OH  . TYR B  1 194 ? 7.858   7.983    95.397  1.00 20.00 ? 275  TYR B OH  1 
ATOM   4445  N  N   . GLU B  1 195 ? 4.616   13.255   101.205 1.00 25.94 ? 276  GLU B N   1 
ATOM   4446  C  CA  . GLU B  1 195 ? 4.047   14.416   101.877 1.00 25.94 ? 276  GLU B CA  1 
ATOM   4447  C  C   . GLU B  1 195 ? 4.901   15.644   101.632 1.00 25.02 ? 276  GLU B C   1 
ATOM   4448  O  O   . GLU B  1 195 ? 6.126   15.545   101.496 1.00 26.03 ? 276  GLU B O   1 
ATOM   4449  C  CB  . GLU B  1 195 ? 3.955   14.192   103.389 1.00 27.00 ? 276  GLU B CB  1 
ATOM   4450  C  CG  . GLU B  1 195 ? 2.673   13.540   103.845 1.00 30.45 ? 276  GLU B CG  1 
ATOM   4451  C  CD  . GLU B  1 195 ? 2.480   13.635   105.342 1.00 33.32 ? 276  GLU B CD  1 
ATOM   4452  O  OE1 . GLU B  1 195 ? 1.366   13.314   105.814 1.00 36.08 ? 276  GLU B OE1 1 
ATOM   4453  O  OE2 . GLU B  1 195 ? 3.441   14.030   106.045 1.00 34.76 ? 276  GLU B OE2 1 
ATOM   4454  N  N   . GLU B  1 196 ? 4.242   16.797   101.578 1.00 23.32 ? 277  GLU B N   1 
ATOM   4455  C  CA  . GLU B  1 196 ? 4.906   18.079   101.386 1.00 22.35 ? 277  GLU B CA  1 
ATOM   4456  C  C   . GLU B  1 196 ? 6.068   17.981   100.403 1.00 21.72 ? 277  GLU B C   1 
ATOM   4457  O  O   . GLU B  1 196 ? 7.226   18.185   100.759 1.00 24.25 ? 277  GLU B O   1 
ATOM   4458  C  CB  . GLU B  1 196 ? 5.404   18.589   102.742 1.00 21.97 ? 277  GLU B CB  1 
ATOM   4459  C  CG  . GLU B  1 196 ? 4.375   18.452   103.839 1.00 21.70 ? 277  GLU B CG  1 
ATOM   4460  C  CD  . GLU B  1 196 ? 4.890   18.859   105.197 1.00 23.34 ? 277  GLU B CD  1 
ATOM   4461  O  OE1 . GLU B  1 196 ? 6.088   18.642   105.472 1.00 24.31 ? 277  GLU B OE1 1 
ATOM   4462  O  OE2 . GLU B  1 196 ? 4.091   19.379   106.004 1.00 25.94 ? 277  GLU B OE2 1 
ATOM   4463  N  N   . CYS B  1 197 ? 5.746   17.678   99.160  1.00 19.84 ? 278  CYS B N   1 
ATOM   4464  C  CA  . CYS B  1 197 ? 6.743   17.539   98.118  1.00 19.16 ? 278  CYS B CA  1 
ATOM   4465  C  C   . CYS B  1 197 ? 7.329   18.841   97.601  1.00 19.91 ? 278  CYS B C   1 
ATOM   4466  O  O   . CYS B  1 197 ? 6.599   19.798   97.334  1.00 18.56 ? 278  CYS B O   1 
ATOM   4467  C  CB  . CYS B  1 197 ? 6.137   16.809   96.928  1.00 19.42 ? 278  CYS B CB  1 
ATOM   4468  S  SG  . CYS B  1 197 ? 5.859   15.026   97.144  1.00 25.26 ? 278  CYS B SG  1 
ATOM   4469  N  N   . SER B  1 198 ? 8.653   18.864   97.450  1.00 20.68 ? 279  SER B N   1 
ATOM   4470  C  CA  . SER B  1 198 ? 9.355   20.017   96.889  1.00 20.79 ? 279  SER B CA  1 
ATOM   4471  C  C   . SER B  1 198 ? 9.664   19.543   95.479  1.00 20.86 ? 279  SER B C   1 
ATOM   4472  O  O   . SER B  1 198 ? 10.459  18.625   95.291  1.00 22.75 ? 279  SER B O   1 
ATOM   4473  C  CB  . SER B  1 198 ? 10.656  20.300   97.636  1.00 19.93 ? 279  SER B CB  1 
ATOM   4474  O  OG  . SER B  1 198 ? 10.393  20.645   98.979  1.00 20.61 ? 279  SER B OG  1 
ATOM   4475  N  N   . CYS B  1 199 ? 9.017   20.147   94.492  1.00 20.71 ? 280  CYS B N   1 
ATOM   4476  C  CA  . CYS B  1 199 ? 9.210   19.740   93.110  1.00 21.92 ? 280  CYS B CA  1 
ATOM   4477  C  C   . CYS B  1 199 ? 9.872   20.827   92.288  1.00 21.27 ? 280  CYS B C   1 
ATOM   4478  O  O   . CYS B  1 199 ? 9.903   21.992   92.682  1.00 22.90 ? 280  CYS B O   1 
ATOM   4479  C  CB  . CYS B  1 199 ? 7.868   19.408   92.448  1.00 23.74 ? 280  CYS B CB  1 
ATOM   4480  S  SG  . CYS B  1 199 ? 6.769   18.160   93.218  1.00 26.41 ? 280  CYS B SG  1 
ATOM   4481  N  N   . TYR B  1 200 ? 10.386  20.443   91.127  1.00 19.35 ? 281  TYR B N   1 
ATOM   4482  C  CA  . TYR B  1 200 ? 11.031  21.394   90.248  1.00 17.97 ? 281  TYR B CA  1 
ATOM   4483  C  C   . TYR B  1 200 ? 11.175  20.811   88.855  1.00 19.50 ? 281  TYR B C   1 
ATOM   4484  O  O   . TYR B  1 200 ? 11.322  19.594   88.688  1.00 20.92 ? 281  TYR B O   1 
ATOM   4485  C  CB  . TYR B  1 200 ? 12.405  21.780   90.795  1.00 16.39 ? 281  TYR B CB  1 
ATOM   4486  C  CG  . TYR B  1 200 ? 13.391  20.637   90.898  1.00 16.05 ? 281  TYR B CG  1 
ATOM   4487  C  CD1 . TYR B  1 200 ? 13.550  19.927   92.092  1.00 14.68 ? 281  TYR B CD1 1 
ATOM   4488  C  CD2 . TYR B  1 200 ? 14.178  20.270   89.804  1.00 14.75 ? 281  TYR B CD2 1 
ATOM   4489  C  CE1 . TYR B  1 200 ? 14.474  18.885   92.195  1.00 13.67 ? 281  TYR B CE1 1 
ATOM   4490  C  CE2 . TYR B  1 200 ? 15.100  19.226   89.899  1.00 14.64 ? 281  TYR B CE2 1 
ATOM   4491  C  CZ  . TYR B  1 200 ? 15.245  18.545   91.094  1.00 13.92 ? 281  TYR B CZ  1 
ATOM   4492  O  OH  . TYR B  1 200 ? 16.198  17.552   91.192  1.00 18.62 ? 281  TYR B OH  1 
ATOM   4493  N  N   . PRO B  1 201 ? 11.123  21.672   87.826  1.00 20.31 ? 282  PRO B N   1 
ATOM   4494  C  CA  . PRO B  1 201 ? 11.250  21.240   86.433  1.00 20.03 ? 282  PRO B CA  1 
ATOM   4495  C  C   . PRO B  1 201 ? 12.717  21.122   86.044  1.00 21.95 ? 282  PRO B C   1 
ATOM   4496  O  O   . PRO B  1 201 ? 13.568  21.862   86.542  1.00 21.93 ? 282  PRO B O   1 
ATOM   4497  C  CB  . PRO B  1 201 ? 10.534  22.347   85.671  1.00 17.79 ? 282  PRO B CB  1 
ATOM   4498  C  CG  . PRO B  1 201 ? 10.950  23.562   86.449  1.00 18.68 ? 282  PRO B CG  1 
ATOM   4499  C  CD  . PRO B  1 201 ? 10.804  23.110   87.899  1.00 18.88 ? 282  PRO B CD  1 
ATOM   4500  N  N   . ASN B  1 202 ? 13.001  20.196   85.140  1.00 23.75 ? 283  ASN B N   1 
ATOM   4501  C  CA  . ASN B  1 202 ? 14.358  19.959   84.674  1.00 25.43 ? 283  ASN B CA  1 
ATOM   4502  C  C   . ASN B  1 202 ? 14.220  19.266   83.330  1.00 26.50 ? 283  ASN B C   1 
ATOM   4503  O  O   . ASN B  1 202 ? 13.644  18.180   83.238  1.00 27.37 ? 283  ASN B O   1 
ATOM   4504  C  CB  . ASN B  1 202 ? 15.104  19.043   85.660  1.00 26.19 ? 283  ASN B CB  1 
ATOM   4505  C  CG  . ASN B  1 202 ? 16.605  18.970   85.390  1.00 28.21 ? 283  ASN B CG  1 
ATOM   4506  O  OD1 . ASN B  1 202 ? 17.088  19.395   84.338  1.00 29.27 ? 283  ASN B OD1 1 
ATOM   4507  N  ND2 . ASN B  1 202 ? 17.347  18.418   86.346  1.00 29.48 ? 283  ASN B ND2 1 
ATOM   4508  N  N   . ALA B  1 203 ? 14.730  19.894   82.283  1.00 26.49 ? 284  ALA B N   1 
ATOM   4509  C  CA  . ALA B  1 203 ? 14.660  19.299   80.960  1.00 27.23 ? 284  ALA B CA  1 
ATOM   4510  C  C   . ALA B  1 203 ? 13.266  18.750   80.679  1.00 28.06 ? 284  ALA B C   1 
ATOM   4511  O  O   . ALA B  1 203 ? 13.093  17.555   80.420  1.00 29.33 ? 284  ALA B O   1 
ATOM   4512  C  CB  . ALA B  1 203 ? 15.697  18.183   80.836  1.00 26.32 ? 284  ALA B CB  1 
ATOM   4513  N  N   . GLY B  1 204 ? 12.275  19.629   80.752  1.00 27.66 ? 285  GLY B N   1 
ATOM   4514  C  CA  . GLY B  1 204 ? 10.906  19.246   80.469  1.00 27.04 ? 285  GLY B CA  1 
ATOM   4515  C  C   . GLY B  1 204 ? 10.254  18.217   81.365  1.00 27.27 ? 285  GLY B C   1 
ATOM   4516  O  O   . GLY B  1 204 ? 9.140   17.789   81.082  1.00 28.64 ? 285  GLY B O   1 
ATOM   4517  N  N   . GLU B  1 205 ? 10.925  17.810   82.434  1.00 27.56 ? 286  GLU B N   1 
ATOM   4518  C  CA  . GLU B  1 205 ? 10.350  16.830   83.350  1.00 28.14 ? 286  GLU B CA  1 
ATOM   4519  C  C   . GLU B  1 205 ? 10.419  17.355   84.775  1.00 26.44 ? 286  GLU B C   1 
ATOM   4520  O  O   . GLU B  1 205 ? 11.226  18.229   85.080  1.00 27.01 ? 286  GLU B O   1 
ATOM   4521  C  CB  . GLU B  1 205 ? 11.104  15.508   83.255  1.00 31.51 ? 286  GLU B CB  1 
ATOM   4522  C  CG  . GLU B  1 205 ? 11.308  15.028   81.830  1.00 37.12 ? 286  GLU B CG  1 
ATOM   4523  C  CD  . GLU B  1 205 ? 11.330  13.510   81.732  1.00 41.12 ? 286  GLU B CD  1 
ATOM   4524  O  OE1 . GLU B  1 205 ? 11.768  12.852   82.708  1.00 41.88 ? 286  GLU B OE1 1 
ATOM   4525  O  OE2 . GLU B  1 205 ? 10.917  12.977   80.675  1.00 43.97 ? 286  GLU B OE2 1 
ATOM   4526  N  N   . ILE B  1 206 ? 9.586   16.818   85.654  1.00 24.14 ? 287  ILE B N   1 
ATOM   4527  C  CA  . ILE B  1 206 ? 9.576   17.280   87.032  1.00 22.55 ? 287  ILE B CA  1 
ATOM   4528  C  C   . ILE B  1 206 ? 10.175  16.276   87.993  1.00 22.05 ? 287  ILE B C   1 
ATOM   4529  O  O   . ILE B  1 206 ? 10.051  15.071   87.799  1.00 23.97 ? 287  ILE B O   1 
ATOM   4530  C  CB  . ILE B  1 206 ? 8.138   17.585   87.507  1.00 22.70 ? 287  ILE B CB  1 
ATOM   4531  C  CG1 . ILE B  1 206 ? 7.521   18.669   86.624  1.00 22.97 ? 287  ILE B CG1 1 
ATOM   4532  C  CG2 . ILE B  1 206 ? 8.145   18.024   88.962  1.00 21.00 ? 287  ILE B CG2 1 
ATOM   4533  C  CD1 . ILE B  1 206 ? 7.157   18.181   85.251  1.00 23.70 ? 287  ILE B CD1 1 
ATOM   4534  N  N   . THR B  1 207 ? 10.827  16.778   89.034  1.00 19.99 ? 288  THR B N   1 
ATOM   4535  C  CA  . THR B  1 207 ? 11.407  15.915   90.048  1.00 17.96 ? 288  THR B CA  1 
ATOM   4536  C  C   . THR B  1 207 ? 10.952  16.426   91.406  1.00 17.83 ? 288  THR B C   1 
ATOM   4537  O  O   . THR B  1 207 ? 11.040  17.621   91.687  1.00 17.32 ? 288  THR B O   1 
ATOM   4538  C  CB  . THR B  1 207 ? 12.927  15.942   90.002  1.00 17.19 ? 288  THR B CB  1 
ATOM   4539  O  OG1 . THR B  1 207 ? 13.363  15.681   88.665  1.00 20.42 ? 288  THR B OG1 1 
ATOM   4540  C  CG2 . THR B  1 207 ? 13.489  14.890   90.915  1.00 13.20 ? 288  THR B CG2 1 
ATOM   4541  N  N   . CYS B  1 208 ? 10.452  15.527   92.245  1.00 16.57 ? 289  CYS B N   1 
ATOM   4542  C  CA  . CYS B  1 208 ? 9.991   15.931   93.556  1.00 17.21 ? 289  CYS B CA  1 
ATOM   4543  C  C   . CYS B  1 208 ? 10.682  15.117   94.618  1.00 16.48 ? 289  CYS B C   1 
ATOM   4544  O  O   . CYS B  1 208 ? 10.799  13.910   94.487  1.00 16.06 ? 289  CYS B O   1 
ATOM   4545  C  CB  . CYS B  1 208 ? 8.491   15.700   93.711  1.00 20.01 ? 289  CYS B CB  1 
ATOM   4546  S  SG  . CYS B  1 208 ? 7.392   16.381   92.440  1.00 21.78 ? 289  CYS B SG  1 
ATOM   4547  N  N   . VAL B  1 209 ? 11.126  15.786   95.675  1.00 16.21 ? 290  VAL B N   1 
ATOM   4548  C  CA  . VAL B  1 209 ? 11.775  15.125   96.795  1.00 15.39 ? 290  VAL B CA  1 
ATOM   4549  C  C   . VAL B  1 209 ? 10.841  15.498   97.926  1.00 17.09 ? 290  VAL B C   1 
ATOM   4550  O  O   . VAL B  1 209 ? 10.587  16.675   98.171  1.00 19.42 ? 290  VAL B O   1 
ATOM   4551  C  CB  . VAL B  1 209 ? 13.178  15.677   96.993  1.00 15.59 ? 290  VAL B CB  1 
ATOM   4552  C  CG1 . VAL B  1 209 ? 13.783  15.140   98.276  1.00 15.63 ? 290  VAL B CG1 1 
ATOM   4553  C  CG2 . VAL B  1 209 ? 14.036  15.293   95.775  1.00 14.57 ? 290  VAL B CG2 1 
ATOM   4554  N  N   . CYS B  1 210 ? 10.314  14.499   98.616  1.00 17.38 ? 291  CYS B N   1 
ATOM   4555  C  CA  . CYS B  1 210 ? 9.327   14.778   99.625  1.00 17.95 ? 291  CYS B CA  1 
ATOM   4556  C  C   . CYS B  1 210 ? 9.605   14.315   101.038 1.00 18.14 ? 291  CYS B C   1 
ATOM   4557  O  O   . CYS B  1 210 ? 10.740  14.038   101.420 1.00 19.39 ? 291  CYS B O   1 
ATOM   4558  C  CB  . CYS B  1 210 ? 8.001   14.202   99.151  1.00 18.01 ? 291  CYS B CB  1 
ATOM   4559  S  SG  . CYS B  1 210 ? 7.762   14.277   97.340  1.00 19.57 ? 291  CYS B SG  1 
ATOM   4560  N  N   . ARG B  1 211 ? 8.534   14.233   101.813 1.00 17.70 ? 292  ARG B N   1 
ATOM   4561  C  CA  . ARG B  1 211 ? 8.624   13.843   103.203 1.00 17.27 ? 292  ARG B CA  1 
ATOM   4562  C  C   . ARG B  1 211 ? 7.923   12.530   103.496 1.00 17.62 ? 292  ARG B C   1 
ATOM   4563  O  O   . ARG B  1 211 ? 6.742   12.376   103.196 1.00 18.82 ? 292  ARG B O   1 
ATOM   4564  C  CB  . ARG B  1 211 ? 8.020   14.951   104.063 1.00 16.27 ? 292  ARG B CB  1 
ATOM   4565  C  CG  . ARG B  1 211 ? 7.804   14.602   105.516 1.00 15.49 ? 292  ARG B CG  1 
ATOM   4566  C  CD  . ARG B  1 211 ? 7.246   15.809   106.259 1.00 14.75 ? 292  ARG B CD  1 
ATOM   4567  N  NE  . ARG B  1 211 ? 6.838   15.484   107.617 1.00 15.23 ? 292  ARG B NE  1 
ATOM   4568  C  CZ  . ARG B  1 211 ? 6.414   16.382   108.499 1.00 15.82 ? 292  ARG B CZ  1 
ATOM   4569  N  NH1 . ARG B  1 211 ? 6.054   15.998   109.717 1.00 17.57 ? 292  ARG B NH1 1 
ATOM   4570  N  NH2 . ARG B  1 211 ? 6.361   17.663   108.169 1.00 16.55 ? 292  ARG B NH2 1 
ATOM   4571  N  N   . ASP B  1 212 ? 8.665   11.577   104.055 1.00 17.93 ? 293  ASP B N   1 
ATOM   4572  C  CA  . ASP B  1 212 ? 8.093   10.295   104.442 1.00 17.32 ? 293  ASP B CA  1 
ATOM   4573  C  C   . ASP B  1 212 ? 7.912   10.459   105.945 1.00 16.83 ? 293  ASP B C   1 
ATOM   4574  O  O   . ASP B  1 212 ? 8.880   10.423   106.705 1.00 16.64 ? 293  ASP B O   1 
ATOM   4575  C  CB  . ASP B  1 212 ? 9.048   9.143    104.126 1.00 18.40 ? 293  ASP B CB  1 
ATOM   4576  C  CG  . ASP B  1 212 ? 8.561   7.806    104.677 1.00 21.86 ? 293  ASP B CG  1 
ATOM   4577  O  OD1 . ASP B  1 212 ? 8.815   6.762    104.028 1.00 20.27 ? 293  ASP B OD1 1 
ATOM   4578  O  OD2 . ASP B  1 212 ? 7.940   7.796    105.767 1.00 22.28 ? 293  ASP B OD2 1 
ATOM   4579  N  N   . ASN B  1 213 ? 6.665   10.669   106.354 1.00 16.90 ? 294  ASN B N   1 
ATOM   4580  C  CA  . ASN B  1 213 ? 6.323   10.889   107.750 1.00 18.39 ? 294  ASN B CA  1 
ATOM   4581  C  C   . ASN B  1 213 ? 5.915   9.577    108.383 1.00 19.41 ? 294  ASN B C   1 
ATOM   4582  O  O   . ASN B  1 213 ? 5.653   9.499    109.586 1.00 20.11 ? 294  ASN B O   1 
ATOM   4583  C  CB  . ASN B  1 213 ? 5.158   11.873   107.842 1.00 18.12 ? 294  ASN B CB  1 
ATOM   4584  C  CG  . ASN B  1 213 ? 5.067   12.544   109.192 1.00 18.36 ? 294  ASN B CG  1 
ATOM   4585  O  OD1 . ASN B  1 213 ? 5.957   13.300   109.571 1.00 20.62 ? 294  ASN B OD1 1 
ATOM   4586  N  ND2 . ASN B  1 213 ? 3.990   12.278   109.923 1.00 17.48 ? 294  ASN B ND2 1 
ATOM   4587  N  N   . TRP B  1 214 ? 5.870   8.544    107.556 1.00 18.96 ? 295  TRP B N   1 
ATOM   4588  C  CA  . TRP B  1 214 ? 5.463   7.226    108.002 1.00 18.86 ? 295  TRP B CA  1 
ATOM   4589  C  C   . TRP B  1 214 ? 6.585   6.388    108.609 1.00 19.73 ? 295  TRP B C   1 
ATOM   4590  O  O   . TRP B  1 214 ? 6.597   6.144    109.817 1.00 20.34 ? 295  TRP B O   1 
ATOM   4591  C  CB  . TRP B  1 214 ? 4.827   6.485    106.823 1.00 17.39 ? 295  TRP B CB  1 
ATOM   4592  C  CG  . TRP B  1 214 ? 4.433   5.071    107.083 1.00 15.61 ? 295  TRP B CG  1 
ATOM   4593  C  CD1 . TRP B  1 214 ? 4.230   4.469    108.301 1.00 14.69 ? 295  TRP B CD1 1 
ATOM   4594  C  CD2 . TRP B  1 214 ? 4.145   4.085    106.098 1.00 15.71 ? 295  TRP B CD2 1 
ATOM   4595  N  NE1 . TRP B  1 214 ? 3.834   3.166    108.126 1.00 13.60 ? 295  TRP B NE1 1 
ATOM   4596  C  CE2 . TRP B  1 214 ? 3.775   2.901    106.778 1.00 14.74 ? 295  TRP B CE2 1 
ATOM   4597  C  CE3 . TRP B  1 214 ? 4.166   4.078    104.693 1.00 15.31 ? 295  TRP B CE3 1 
ATOM   4598  C  CZ2 . TRP B  1 214 ? 3.426   1.730    106.107 1.00 14.81 ? 295  TRP B CZ2 1 
ATOM   4599  C  CZ3 . TRP B  1 214 ? 3.819   2.911    104.025 1.00 14.45 ? 295  TRP B CZ3 1 
ATOM   4600  C  CH2 . TRP B  1 214 ? 3.456   1.754    104.731 1.00 14.93 ? 295  TRP B CH2 1 
ATOM   4601  N  N   . HIS B  1 215 ? 7.539   5.969    107.781 1.00 19.77 ? 296  HIS B N   1 
ATOM   4602  C  CA  . HIS B  1 215 ? 8.609   5.107    108.264 1.00 18.91 ? 296  HIS B CA  1 
ATOM   4603  C  C   . HIS B  1 215 ? 9.968   5.245    107.548 1.00 18.68 ? 296  HIS B C   1 
ATOM   4604  O  O   . HIS B  1 215 ? 10.724  4.272    107.454 1.00 17.45 ? 296  HIS B O   1 
ATOM   4605  C  CB  . HIS B  1 215 ? 8.112   3.654    108.176 1.00 18.70 ? 296  HIS B CB  1 
ATOM   4606  C  CG  . HIS B  1 215 ? 7.629   3.272    106.812 1.00 17.39 ? 296  HIS B CG  1 
ATOM   4607  N  ND1 . HIS B  1 215 ? 7.887   4.028    105.691 1.00 17.59 ? 296  HIS B ND1 1 
ATOM   4608  C  CD2 . HIS B  1 215 ? 6.941   2.186    106.372 1.00 18.77 ? 296  HIS B CD2 1 
ATOM   4609  C  CE1 . HIS B  1 215 ? 7.388   3.433    104.622 1.00 16.97 ? 296  HIS B CE1 1 
ATOM   4610  N  NE2 . HIS B  1 215 ? 6.808   2.310    105.013 1.00 18.09 ? 296  HIS B NE2 1 
ATOM   4611  N  N   . GLY B  1 216 ? 10.280  6.442    107.052 1.00 19.06 ? 297  GLY B N   1 
ATOM   4612  C  CA  . GLY B  1 216 ? 11.552  6.651    106.370 1.00 20.76 ? 297  GLY B CA  1 
ATOM   4613  C  C   . GLY B  1 216 ? 12.389  7.829    106.855 1.00 21.18 ? 297  GLY B C   1 
ATOM   4614  O  O   . GLY B  1 216 ? 11.861  8.905    107.129 1.00 23.04 ? 297  GLY B O   1 
ATOM   4615  N  N   . SER B  1 217 ? 13.700  7.618    106.937 1.00 22.14 ? 298  SER B N   1 
ATOM   4616  C  CA  . SER B  1 217 ? 14.658  8.631    107.372 1.00 22.37 ? 298  SER B CA  1 
ATOM   4617  C  C   . SER B  1 217 ? 15.266  9.315    106.141 1.00 20.76 ? 298  SER B C   1 
ATOM   4618  O  O   . SER B  1 217 ? 15.783  10.434   106.216 1.00 21.01 ? 298  SER B O   1 
ATOM   4619  C  CB  . SER B  1 217 ? 15.741  7.971    108.223 1.00 24.31 ? 298  SER B CB  1 
ATOM   4620  O  OG  . SER B  1 217 ? 15.414  8.069    109.611 1.00 27.92 ? 298  SER B OG  1 
ATOM   4621  N  N   . ASN B  1 218 ? 15.197  8.634    105.005 1.00 18.74 ? 299  ASN B N   1 
ATOM   4622  C  CA  . ASN B  1 218 ? 15.678  9.195    103.747 1.00 19.07 ? 299  ASN B CA  1 
ATOM   4623  C  C   . ASN B  1 218 ? 14.450  9.814    103.080 1.00 18.75 ? 299  ASN B C   1 
ATOM   4624  O  O   . ASN B  1 218 ? 13.322  9.570    103.495 1.00 19.03 ? 299  ASN B O   1 
ATOM   4625  C  CB  . ASN B  1 218 ? 16.271  8.090    102.866 1.00 19.43 ? 299  ASN B CB  1 
ATOM   4626  C  CG  . ASN B  1 218 ? 15.435  6.818    102.882 1.00 20.18 ? 299  ASN B CG  1 
ATOM   4627  O  OD1 . ASN B  1 218 ? 14.730  6.547    103.850 1.00 19.91 ? 299  ASN B OD1 1 
ATOM   4628  N  ND2 . ASN B  1 218 ? 15.534  6.022    101.821 1.00 21.49 ? 299  ASN B ND2 1 
ATOM   4629  N  N   . ARG B  1 219 ? 14.655  10.624   102.058 1.00 18.83 ? 300  ARG B N   1 
ATOM   4630  C  CA  . ARG B  1 219 ? 13.524  11.238   101.406 1.00 18.93 ? 300  ARG B CA  1 
ATOM   4631  C  C   . ARG B  1 219 ? 13.154  10.487   100.156 1.00 19.33 ? 300  ARG B C   1 
ATOM   4632  O  O   . ARG B  1 219 ? 14.022  10.027   99.416  1.00 20.43 ? 300  ARG B O   1 
ATOM   4633  C  CB  . ARG B  1 219 ? 13.819  12.698   101.070 1.00 17.43 ? 300  ARG B CB  1 
ATOM   4634  C  CG  . ARG B  1 219 ? 13.874  13.572   102.300 1.00 17.66 ? 300  ARG B CG  1 
ATOM   4635  C  CD  . ARG B  1 219 ? 13.978  15.038   101.929 1.00 19.79 ? 300  ARG B CD  1 
ATOM   4636  N  NE  . ARG B  1 219 ? 14.055  15.864   103.125 1.00 20.31 ? 300  ARG B NE  1 
ATOM   4637  C  CZ  . ARG B  1 219 ? 13.028  16.088   103.931 1.00 21.41 ? 300  ARG B CZ  1 
ATOM   4638  N  NH1 . ARG B  1 219 ? 13.179  16.848   105.010 1.00 20.70 ? 300  ARG B NH1 1 
ATOM   4639  N  NH2 . ARG B  1 219 ? 11.847  15.560   103.642 1.00 22.23 ? 300  ARG B NH2 1 
ATOM   4640  N  N   . PRO B  1 220 ? 11.843  10.341   99.921  1.00 18.89 ? 301  PRO B N   1 
ATOM   4641  C  CA  . PRO B  1 220 ? 11.244  9.660    98.777  1.00 17.85 ? 301  PRO B CA  1 
ATOM   4642  C  C   . PRO B  1 220 ? 11.143  10.654   97.638  1.00 17.55 ? 301  PRO B C   1 
ATOM   4643  O  O   . PRO B  1 220 ? 11.046  11.852   97.868  1.00 16.87 ? 301  PRO B O   1 
ATOM   4644  C  CB  . PRO B  1 220 ? 9.874   9.279    99.306  1.00 18.41 ? 301  PRO B CB  1 
ATOM   4645  C  CG  . PRO B  1 220 ? 9.537   10.467   100.151 1.00 17.19 ? 301  PRO B CG  1 
ATOM   4646  C  CD  . PRO B  1 220 ? 10.810  10.697   100.913 1.00 16.88 ? 301  PRO B CD  1 
ATOM   4647  N  N   . TRP B  1 221 ? 11.164  10.162   96.410  1.00 18.53 ? 302  TRP B N   1 
ATOM   4648  C  CA  . TRP B  1 221 ? 11.063  11.044   95.267  1.00 18.72 ? 302  TRP B CA  1 
ATOM   4649  C  C   . TRP B  1 221 ? 10.164  10.478   94.197  1.00 19.42 ? 302  TRP B C   1 
ATOM   4650  O  O   . TRP B  1 221 ? 9.851   9.291    94.195  1.00 22.39 ? 302  TRP B O   1 
ATOM   4651  C  CB  . TRP B  1 221 ? 12.437  11.318   94.662  1.00 17.78 ? 302  TRP B CB  1 
ATOM   4652  C  CG  . TRP B  1 221 ? 13.203  10.096   94.242  1.00 19.36 ? 302  TRP B CG  1 
ATOM   4653  C  CD1 . TRP B  1 221 ? 14.205  9.474    94.945  1.00 21.14 ? 302  TRP B CD1 1 
ATOM   4654  C  CD2 . TRP B  1 221 ? 13.081  9.380    93.004  1.00 18.24 ? 302  TRP B CD2 1 
ATOM   4655  N  NE1 . TRP B  1 221 ? 14.716  8.425    94.216  1.00 21.39 ? 302  TRP B NE1 1 
ATOM   4656  C  CE2 . TRP B  1 221 ? 14.044  8.342    93.022  1.00 18.67 ? 302  TRP B CE2 1 
ATOM   4657  C  CE3 . TRP B  1 221 ? 12.253  9.515    91.878  1.00 18.55 ? 302  TRP B CE3 1 
ATOM   4658  C  CZ2 . TRP B  1 221 ? 14.202  7.446    91.962  1.00 16.42 ? 302  TRP B CZ2 1 
ATOM   4659  C  CZ3 . TRP B  1 221 ? 12.410  8.623    90.819  1.00 17.41 ? 302  TRP B CZ3 1 
ATOM   4660  C  CH2 . TRP B  1 221 ? 13.381  7.600    90.872  1.00 17.95 ? 302  TRP B CH2 1 
ATOM   4661  N  N   . VAL B  1 222 ? 9.738   11.352   93.298  1.00 19.09 ? 303  VAL B N   1 
ATOM   4662  C  CA  . VAL B  1 222 ? 8.898   10.980   92.177  1.00 20.51 ? 303  VAL B CA  1 
ATOM   4663  C  C   . VAL B  1 222 ? 9.370   11.884   91.069  1.00 21.00 ? 303  VAL B C   1 
ATOM   4664  O  O   . VAL B  1 222 ? 9.640   13.064   91.302  1.00 22.10 ? 303  VAL B O   1 
ATOM   4665  C  CB  . VAL B  1 222 ? 7.401   11.327   92.379  1.00 21.41 ? 303  VAL B CB  1 
ATOM   4666  C  CG1 . VAL B  1 222 ? 6.560   10.601   91.334  1.00 20.05 ? 303  VAL B CG1 1 
ATOM   4667  C  CG2 . VAL B  1 222 ? 6.958   10.982   93.756  1.00 21.86 ? 303  VAL B CG2 1 
ATOM   4668  N  N   . SER B  1 223 ? 9.488   11.342   89.873  1.00 20.10 ? 304  SER B N   1 
ATOM   4669  C  CA  . SER B  1 223 ? 9.881   12.159   88.749  1.00 21.67 ? 304  SER B CA  1 
ATOM   4670  C  C   . SER B  1 223 ? 8.944   11.710   87.657  1.00 21.33 ? 304  SER B C   1 
ATOM   4671  O  O   . SER B  1 223 ? 8.637   10.522   87.546  1.00 21.35 ? 304  SER B O   1 
ATOM   4672  C  CB  . SER B  1 223 ? 11.349  11.931   88.372  1.00 23.42 ? 304  SER B CB  1 
ATOM   4673  O  OG  . SER B  1 223 ? 11.603  10.583   88.030  1.00 29.50 ? 304  SER B OG  1 
ATOM   4674  N  N   . PHE B  1 224 ? 8.462   12.662   86.872  1.00 20.84 ? 305  PHE B N   1 
ATOM   4675  C  CA  . PHE B  1 224 ? 7.529   12.342   85.814  1.00 19.79 ? 305  PHE B CA  1 
ATOM   4676  C  C   . PHE B  1 224 ? 7.595   13.318   84.651  1.00 20.49 ? 305  PHE B C   1 
ATOM   4677  O  O   . PHE B  1 224 ? 8.045   14.454   84.791  1.00 19.49 ? 305  PHE B O   1 
ATOM   4678  C  CB  . PHE B  1 224 ? 6.111   12.285   86.395  1.00 17.31 ? 305  PHE B CB  1 
ATOM   4679  C  CG  . PHE B  1 224 ? 5.730   13.503   87.190  1.00 16.64 ? 305  PHE B CG  1 
ATOM   4680  C  CD1 . PHE B  1 224 ? 5.269   14.656   86.554  1.00 16.99 ? 305  PHE B CD1 1 
ATOM   4681  C  CD2 . PHE B  1 224 ? 5.828   13.500   88.580  1.00 16.59 ? 305  PHE B CD2 1 
ATOM   4682  C  CE1 . PHE B  1 224 ? 4.908   15.789   87.297  1.00 17.59 ? 305  PHE B CE1 1 
ATOM   4683  C  CE2 . PHE B  1 224 ? 5.471   14.629   89.335  1.00 16.31 ? 305  PHE B CE2 1 
ATOM   4684  C  CZ  . PHE B  1 224 ? 5.010   15.772   88.693  1.00 16.16 ? 305  PHE B CZ  1 
ATOM   4685  N  N   . ASN B  1 225 ? 7.147   12.838   83.499  1.00 22.93 ? 306  ASN B N   1 
ATOM   4686  C  CA  . ASN B  1 225 ? 7.119   13.605   82.272  1.00 25.29 ? 306  ASN B CA  1 
ATOM   4687  C  C   . ASN B  1 225 ? 5.793   14.374   82.210  1.00 26.01 ? 306  ASN B C   1 
ATOM   4688  O  O   . ASN B  1 225 ? 4.957   14.262   83.106  1.00 24.34 ? 306  ASN B O   1 
ATOM   4689  C  CB  . ASN B  1 225 ? 7.288   12.635   81.092  1.00 29.00 ? 306  ASN B CB  1 
ATOM   4690  C  CG  . ASN B  1 225 ? 7.035   13.287   79.743  1.00 36.46 ? 306  ASN B CG  1 
ATOM   4691  O  OD1 . ASN B  1 225 ? 7.511   14.402   79.462  1.00 39.39 ? 306  ASN B OD1 1 
ATOM   4692  N  ND2 . ASN B  1 225 ? 6.291   12.586   78.888  1.00 38.73 ? 306  ASN B ND2 1 
ATOM   4693  N  N   . GLN B  1 226 ? 5.604   15.155   81.155  1.00 27.13 ? 308  GLN B N   1 
ATOM   4694  C  CA  . GLN B  1 226 ? 4.396   15.945   80.995  1.00 29.14 ? 308  GLN B CA  1 
ATOM   4695  C  C   . GLN B  1 226 ? 3.121   15.128   80.819  1.00 30.50 ? 308  GLN B C   1 
ATOM   4696  O  O   . GLN B  1 226 ? 2.022   15.683   80.812  1.00 32.09 ? 308  GLN B O   1 
ATOM   4697  C  CB  . GLN B  1 226 ? 4.583   16.936   79.837  1.00 29.52 ? 308  GLN B CB  1 
ATOM   4698  C  CG  . GLN B  1 226 ? 5.652   17.978   80.144  1.00 30.03 ? 308  GLN B CG  1 
ATOM   4699  C  CD  . GLN B  1 226 ? 6.024   18.845   78.958  1.00 32.02 ? 308  GLN B CD  1 
ATOM   4700  O  OE1 . GLN B  1 226 ? 5.171   19.515   78.373  1.00 33.49 ? 308  GLN B OE1 1 
ATOM   4701  N  NE2 . GLN B  1 226 ? 7.315   18.846   78.602  1.00 31.90 ? 308  GLN B NE2 1 
ATOM   4702  N  N   . ASN B  1 227 ? 3.256   13.813   80.687  1.00 32.03 ? 309  ASN B N   1 
ATOM   4703  C  CA  . ASN B  1 227 ? 2.088   12.946   80.548  1.00 32.47 ? 309  ASN B CA  1 
ATOM   4704  C  C   . ASN B  1 227 ? 1.891   12.091   81.793  1.00 31.93 ? 309  ASN B C   1 
ATOM   4705  O  O   . ASN B  1 227 ? 1.250   11.036   81.758  1.00 31.63 ? 309  ASN B O   1 
ATOM   4706  C  CB  . ASN B  1 227 ? 2.224   12.062   79.319  1.00 36.18 ? 309  ASN B CB  1 
ATOM   4707  C  CG  . ASN B  1 227 ? 1.944   12.814   78.043  1.00 41.84 ? 309  ASN B CG  1 
ATOM   4708  O  OD1 . ASN B  1 227 ? 0.846   13.363   77.855  1.00 44.41 ? 309  ASN B OD1 1 
ATOM   4709  N  ND2 . ASN B  1 227 ? 2.933   12.857   77.153  1.00 44.88 ? 309  ASN B ND2 1 
ATOM   4710  N  N   . LEU B  1 228 ? 2.458   12.562   82.896  1.00 30.48 ? 310  LEU B N   1 
ATOM   4711  C  CA  . LEU B  1 228 ? 2.342   11.890   84.173  1.00 28.62 ? 310  LEU B CA  1 
ATOM   4712  C  C   . LEU B  1 228 ? 2.837   10.446   84.195  1.00 28.11 ? 310  LEU B C   1 
ATOM   4713  O  O   . LEU B  1 228 ? 2.435   9.647    85.044  1.00 27.15 ? 310  LEU B O   1 
ATOM   4714  C  CB  . LEU B  1 228 ? 0.899   11.992   84.655  1.00 27.76 ? 310  LEU B CB  1 
ATOM   4715  C  CG  . LEU B  1 228 ? 0.544   13.337   85.301  1.00 28.68 ? 310  LEU B CG  1 
ATOM   4716  C  CD1 . LEU B  1 228 ? 1.204   14.494   84.568  1.00 26.66 ? 310  LEU B CD1 1 
ATOM   4717  C  CD2 . LEU B  1 228 ? -0.966  13.488   85.323  1.00 27.88 ? 310  LEU B CD2 1 
ATOM   4718  N  N   . GLU B  1 229 ? 3.697   10.109   83.241  1.00 27.71 ? 311  GLU B N   1 
ATOM   4719  C  CA  . GLU B  1 229 ? 4.311   8.786    83.201  1.00 27.18 ? 311  GLU B CA  1 
ATOM   4720  C  C   . GLU B  1 229 ? 5.417   9.041    84.232  1.00 26.62 ? 311  GLU B C   1 
ATOM   4721  O  O   . GLU B  1 229 ? 6.151   10.019   84.115  1.00 27.40 ? 311  GLU B O   1 
ATOM   4722  C  CB  . GLU B  1 229 ? 4.866   8.509    81.799  1.00 27.89 ? 311  GLU B CB  1 
ATOM   4723  C  CG  . GLU B  1 229 ? 3.822   8.777    80.701  1.00 30.94 ? 311  GLU B CG  1 
ATOM   4724  C  CD  . GLU B  1 229 ? 4.276   8.390    79.296  1.00 32.98 ? 311  GLU B CD  1 
ATOM   4725  O  OE1 . GLU B  1 229 ? 5.378   8.792    78.880  1.00 34.44 ? 311  GLU B OE1 1 
ATOM   4726  O  OE2 . GLU B  1 229 ? 3.518   7.685    78.593  1.00 36.97 ? 311  GLU B OE2 1 
ATOM   4727  N  N   . TYR B  1 230 ? 5.526   8.189    85.247  1.00 24.76 ? 312  TYR B N   1 
ATOM   4728  C  CA  . TYR B  1 230 ? 6.485   8.429    86.320  1.00 24.04 ? 312  TYR B CA  1 
ATOM   4729  C  C   . TYR B  1 230 ? 7.392   7.291    86.746  1.00 24.87 ? 312  TYR B C   1 
ATOM   4730  O  O   . TYR B  1 230 ? 7.395   6.205    86.170  1.00 26.16 ? 312  TYR B O   1 
ATOM   4731  C  CB  . TYR B  1 230 ? 5.714   8.869    87.560  1.00 22.92 ? 312  TYR B CB  1 
ATOM   4732  C  CG  . TYR B  1 230 ? 4.797   7.777    88.075  1.00 20.31 ? 312  TYR B CG  1 
ATOM   4733  C  CD1 . TYR B  1 230 ? 5.209   6.899    89.077  1.00 18.28 ? 312  TYR B CD1 1 
ATOM   4734  C  CD2 . TYR B  1 230 ? 3.531   7.584    87.513  1.00 20.63 ? 312  TYR B CD2 1 
ATOM   4735  C  CE1 . TYR B  1 230 ? 4.380   5.852    89.503  1.00 17.40 ? 312  TYR B CE1 1 
ATOM   4736  C  CE2 . TYR B  1 230 ? 2.698   6.541    87.932  1.00 16.44 ? 312  TYR B CE2 1 
ATOM   4737  C  CZ  . TYR B  1 230 ? 3.126   5.685    88.922  1.00 17.74 ? 312  TYR B CZ  1 
ATOM   4738  O  OH  . TYR B  1 230 ? 2.290   4.675    89.336  1.00 19.74 ? 312  TYR B OH  1 
ATOM   4739  N  N   . GLN B  1 231 ? 8.147   7.581    87.802  1.00 24.39 ? 313  GLN B N   1 
ATOM   4740  C  CA  . GLN B  1 231 ? 9.069   6.653    88.436  1.00 25.01 ? 313  GLN B CA  1 
ATOM   4741  C  C   . GLN B  1 231 ? 9.138   7.114    89.881  1.00 23.29 ? 313  GLN B C   1 
ATOM   4742  O  O   . GLN B  1 231 ? 8.885   8.282    90.174  1.00 23.57 ? 313  GLN B O   1 
ATOM   4743  C  CB  . GLN B  1 231 ? 10.466  6.737    87.822  1.00 27.44 ? 313  GLN B CB  1 
ATOM   4744  C  CG  . GLN B  1 231 ? 10.572  6.315    86.376  1.00 31.89 ? 313  GLN B CG  1 
ATOM   4745  C  CD  . GLN B  1 231 ? 12.013  6.304    85.902  1.00 36.51 ? 313  GLN B CD  1 
ATOM   4746  O  OE1 . GLN B  1 231 ? 12.288  6.229    84.701  1.00 39.00 ? 313  GLN B OE1 1 
ATOM   4747  N  NE2 . GLN B  1 231 ? 12.946  6.371    86.848  1.00 37.82 ? 313  GLN B NE2 1 
ATOM   4748  N  N   . ILE B  1 232 ? 9.477   6.209    90.785  1.00 21.38 ? 314  ILE B N   1 
ATOM   4749  C  CA  . ILE B  1 232 ? 9.572   6.575    92.186  1.00 21.55 ? 314  ILE B CA  1 
ATOM   4750  C  C   . ILE B  1 232 ? 10.769  5.905    92.828  1.00 21.93 ? 314  ILE B C   1 
ATOM   4751  O  O   . ILE B  1 232 ? 11.463  5.111    92.189  1.00 23.34 ? 314  ILE B O   1 
ATOM   4752  C  CB  . ILE B  1 232 ? 8.304   6.168    92.960  1.00 21.04 ? 314  ILE B CB  1 
ATOM   4753  C  CG1 . ILE B  1 232 ? 8.101   4.657    92.865  1.00 21.30 ? 314  ILE B CG1 1 
ATOM   4754  C  CG2 . ILE B  1 232 ? 7.097   6.909    92.409  1.00 19.59 ? 314  ILE B CG2 1 
ATOM   4755  C  CD1 . ILE B  1 232 ? 6.951   4.131    93.709  1.00 20.61 ? 314  ILE B CD1 1 
ATOM   4756  N  N   . GLY B  1 233 ? 11.011  6.235    94.091  1.00 20.58 ? 315  GLY B N   1 
ATOM   4757  C  CA  . GLY B  1 233 ? 12.122  5.645    94.809  1.00 19.95 ? 315  GLY B CA  1 
ATOM   4758  C  C   . GLY B  1 233 ? 12.532  6.485    95.996  1.00 20.02 ? 315  GLY B C   1 
ATOM   4759  O  O   . GLY B  1 233 ? 11.790  7.358    96.435  1.00 21.78 ? 315  GLY B O   1 
ATOM   4760  N  N   . TYR B  1 234 ? 13.708  6.208    96.534  1.00 19.30 ? 316  TYR B N   1 
ATOM   4761  C  CA  . TYR B  1 234 ? 14.220  6.974    97.654  1.00 20.08 ? 316  TYR B CA  1 
ATOM   4762  C  C   . TYR B  1 234 ? 15.661  7.381    97.365  1.00 21.11 ? 316  TYR B C   1 
ATOM   4763  O  O   . TYR B  1 234 ? 16.341  6.780    96.523  1.00 22.28 ? 316  TYR B O   1 
ATOM   4764  C  CB  . TYR B  1 234 ? 14.170  6.160    98.953  1.00 19.29 ? 316  TYR B CB  1 
ATOM   4765  C  CG  . TYR B  1 234 ? 12.827  6.154    99.662  1.00 19.84 ? 316  TYR B CG  1 
ATOM   4766  C  CD1 . TYR B  1 234 ? 11.713  5.534    99.099  1.00 21.07 ? 316  TYR B CD1 1 
ATOM   4767  C  CD2 . TYR B  1 234 ? 12.672  6.767    100.905 1.00 19.52 ? 316  TYR B CD2 1 
ATOM   4768  C  CE1 . TYR B  1 234 ? 10.478  5.525    99.761  1.00 19.38 ? 316  TYR B CE1 1 
ATOM   4769  C  CE2 . TYR B  1 234 ? 11.443  6.765    101.566 1.00 19.48 ? 316  TYR B CE2 1 
ATOM   4770  C  CZ  . TYR B  1 234 ? 10.358  6.144    100.990 1.00 19.46 ? 316  TYR B CZ  1 
ATOM   4771  O  OH  . TYR B  1 234 ? 9.151   6.138    101.644 1.00 19.95 ? 316  TYR B OH  1 
ATOM   4772  N  N   . ILE B  1 235 ? 16.117  8.424    98.047  1.00 20.99 ? 317  ILE B N   1 
ATOM   4773  C  CA  . ILE B  1 235 ? 17.486  8.878    97.887  1.00 19.39 ? 317  ILE B CA  1 
ATOM   4774  C  C   . ILE B  1 235 ? 18.271  7.835    98.661  1.00 18.76 ? 317  ILE B C   1 
ATOM   4775  O  O   . ILE B  1 235 ? 18.050  7.640    99.853  1.00 17.82 ? 317  ILE B O   1 
ATOM   4776  C  CB  . ILE B  1 235 ? 17.645  10.302   98.473  1.00 19.33 ? 317  ILE B CB  1 
ATOM   4777  C  CG1 . ILE B  1 235 ? 16.859  11.275   97.587  1.00 18.77 ? 317  ILE B CG1 1 
ATOM   4778  C  CG2 . ILE B  1 235 ? 19.124  10.706   98.553  1.00 17.95 ? 317  ILE B CG2 1 
ATOM   4779  C  CD1 . ILE B  1 235 ? 16.982  12.714   97.993  1.00 19.03 ? 317  ILE B CD1 1 
ATOM   4780  N  N   . CYS B  1 236 ? 19.176  7.146    97.980  1.00 19.59 ? 318  CYS B N   1 
ATOM   4781  C  CA  . CYS B  1 236 ? 19.917  6.079    98.642  1.00 22.54 ? 318  CYS B CA  1 
ATOM   4782  C  C   . CYS B  1 236 ? 21.059  6.503    99.549  1.00 21.32 ? 318  CYS B C   1 
ATOM   4783  O  O   . CYS B  1 236 ? 21.490  5.713    100.390 1.00 21.05 ? 318  CYS B O   1 
ATOM   4784  C  CB  . CYS B  1 236 ? 20.456  5.081    97.617  1.00 24.81 ? 318  CYS B CB  1 
ATOM   4785  S  SG  . CYS B  1 236 ? 19.466  4.833    96.105  1.00 33.39 ? 318  CYS B SG  1 
ATOM   4786  N  N   . SER B  1 237 ? 21.545  7.734    99.385  1.00 20.47 ? 319  SER B N   1 
ATOM   4787  C  CA  . SER B  1 237 ? 22.655  8.232    100.190 1.00 19.44 ? 319  SER B CA  1 
ATOM   4788  C  C   . SER B  1 237 ? 22.527  7.955    101.679 1.00 20.41 ? 319  SER B C   1 
ATOM   4789  O  O   . SER B  1 237 ? 21.436  8.010    102.242 1.00 21.61 ? 319  SER B O   1 
ATOM   4790  C  CB  . SER B  1 237 ? 22.831  9.735    99.985  1.00 19.73 ? 319  SER B CB  1 
ATOM   4791  O  OG  . SER B  1 237 ? 23.716  10.274   100.956 1.00 17.82 ? 319  SER B OG  1 
ATOM   4792  N  N   . GLY B  1 238 ? 23.657  7.657    102.312 1.00 21.14 ? 320  GLY B N   1 
ATOM   4793  C  CA  . GLY B  1 238 ? 23.665  7.393    103.741 1.00 21.82 ? 320  GLY B CA  1 
ATOM   4794  C  C   . GLY B  1 238 ? 23.632  8.706    104.495 1.00 23.93 ? 320  GLY B C   1 
ATOM   4795  O  O   . GLY B  1 238 ? 23.681  8.731    105.729 1.00 25.32 ? 320  GLY B O   1 
ATOM   4796  N  N   . VAL B  1 239 ? 23.585  9.802    103.735 1.00 23.59 ? 321  VAL B N   1 
ATOM   4797  C  CA  . VAL B  1 239 ? 23.491  11.149   104.292 1.00 23.53 ? 321  VAL B CA  1 
ATOM   4798  C  C   . VAL B  1 239 ? 21.982  11.419   104.350 1.00 23.81 ? 321  VAL B C   1 
ATOM   4799  O  O   . VAL B  1 239 ? 21.421  12.130   103.509 1.00 22.11 ? 321  VAL B O   1 
ATOM   4800  C  CB  . VAL B  1 239 ? 24.171  12.188   103.372 1.00 22.41 ? 321  VAL B CB  1 
ATOM   4801  C  CG1 . VAL B  1 239 ? 23.886  13.590   103.861 1.00 21.31 ? 321  VAL B CG1 1 
ATOM   4802  C  CG2 . VAL B  1 239 ? 25.658  11.944   103.342 1.00 23.32 ? 321  VAL B CG2 1 
ATOM   4803  N  N   . PHE B  1 240 ? 21.339  10.809   105.340 1.00 23.01 ? 322  PHE B N   1 
ATOM   4804  C  CA  . PHE B  1 240 ? 19.906  10.913   105.536 1.00 24.34 ? 322  PHE B CA  1 
ATOM   4805  C  C   . PHE B  1 240 ? 19.438  12.359   105.517 1.00 24.27 ? 322  PHE B C   1 
ATOM   4806  O  O   . PHE B  1 240 ? 20.005  13.206   106.213 1.00 26.10 ? 322  PHE B O   1 
ATOM   4807  C  CB  . PHE B  1 240 ? 19.548  10.231   106.852 1.00 25.44 ? 322  PHE B CB  1 
ATOM   4808  C  CG  . PHE B  1 240 ? 20.057  8.822    106.950 1.00 26.75 ? 322  PHE B CG  1 
ATOM   4809  C  CD1 . PHE B  1 240 ? 20.919  8.447    107.979 1.00 27.25 ? 322  PHE B CD1 1 
ATOM   4810  C  CD2 . PHE B  1 240 ? 19.693  7.869    105.998 1.00 27.22 ? 322  PHE B CD2 1 
ATOM   4811  C  CE1 . PHE B  1 240 ? 21.412  7.145    108.057 1.00 25.49 ? 322  PHE B CE1 1 
ATOM   4812  C  CE2 . PHE B  1 240 ? 20.180  6.562    106.068 1.00 26.45 ? 322  PHE B CE2 1 
ATOM   4813  C  CZ  . PHE B  1 240 ? 21.040  6.201    107.097 1.00 26.33 ? 322  PHE B CZ  1 
ATOM   4814  N  N   . GLY B  1 241 ? 18.395  12.630   104.734 1.00 23.13 ? 323  GLY B N   1 
ATOM   4815  C  CA  . GLY B  1 241 ? 17.891  13.988   104.611 1.00 22.79 ? 323  GLY B CA  1 
ATOM   4816  C  C   . GLY B  1 241 ? 16.674  14.414   105.416 1.00 21.96 ? 323  GLY B C   1 
ATOM   4817  O  O   . GLY B  1 241 ? 16.345  15.597   105.448 1.00 22.83 ? 323  GLY B O   1 
ATOM   4818  N  N   . ASP B  1 242 ? 16.003  13.480   106.074 1.00 21.86 ? 324  ASP B N   1 
ATOM   4819  C  CA  . ASP B  1 242 ? 14.818  13.829   106.852 1.00 21.58 ? 324  ASP B CA  1 
ATOM   4820  C  C   . ASP B  1 242 ? 15.229  14.175   108.278 1.00 21.62 ? 324  ASP B C   1 
ATOM   4821  O  O   . ASP B  1 242 ? 16.399  14.066   108.650 1.00 20.57 ? 324  ASP B O   1 
ATOM   4822  C  CB  . ASP B  1 242 ? 13.833  12.640   106.857 1.00 21.90 ? 324  ASP B CB  1 
ATOM   4823  C  CG  . ASP B  1 242 ? 12.370  13.062   107.013 1.00 22.47 ? 324  ASP B CG  1 
ATOM   4824  O  OD1 . ASP B  1 242 ? 11.486  12.187   106.873 1.00 22.62 ? 324  ASP B OD1 1 
ATOM   4825  O  OD2 . ASP B  1 242 ? 12.097  14.251   107.269 1.00 22.94 ? 324  ASP B OD2 1 
ATOM   4826  N  N   . ASN B  1 243 ? 14.254  14.607   109.068 1.00 22.40 ? 325  ASN B N   1 
ATOM   4827  C  CA  . ASN B  1 243 ? 14.468  14.930   110.462 1.00 22.10 ? 325  ASN B CA  1 
ATOM   4828  C  C   . ASN B  1 243 ? 13.168  14.708   111.213 1.00 21.53 ? 325  ASN B C   1 
ATOM   4829  O  O   . ASN B  1 243 ? 12.133  15.264   110.845 1.00 22.41 ? 325  ASN B O   1 
ATOM   4830  C  CB  . ASN B  1 243 ? 14.899  16.391   110.637 1.00 23.13 ? 325  ASN B CB  1 
ATOM   4831  C  CG  . ASN B  1 243 ? 15.012  16.791   112.095 1.00 23.48 ? 325  ASN B CG  1 
ATOM   4832  O  OD1 . ASN B  1 243 ? 14.017  17.122   112.736 1.00 25.80 ? 325  ASN B OD1 1 
ATOM   4833  N  ND2 . ASN B  1 243 ? 16.224  16.738   112.634 1.00 23.80 ? 325  ASN B ND2 1 
ATOM   4834  N  N   . PRO B  1 244 ? 13.186  13.826   112.226 1.00 20.57 ? 326  PRO B N   1 
ATOM   4835  C  CA  . PRO B  1 244 ? 14.367  13.111   112.731 1.00 19.42 ? 326  PRO B CA  1 
ATOM   4836  C  C   . PRO B  1 244 ? 14.981  12.122   111.734 1.00 18.46 ? 326  PRO B C   1 
ATOM   4837  O  O   . PRO B  1 244 ? 14.455  11.898   110.648 1.00 16.83 ? 326  PRO B O   1 
ATOM   4838  C  CB  . PRO B  1 244 ? 13.838  12.408   113.978 1.00 19.13 ? 326  PRO B CB  1 
ATOM   4839  C  CG  . PRO B  1 244 ? 12.403  12.137   113.614 1.00 20.22 ? 326  PRO B CG  1 
ATOM   4840  C  CD  . PRO B  1 244 ? 11.980  13.442   112.980 1.00 20.80 ? 326  PRO B CD  1 
ATOM   4841  N  N   . ARG B  1 245 ? 16.111  11.547   112.136 1.00 19.65 ? 327  ARG B N   1 
ATOM   4842  C  CA  . ARG B  1 245 ? 16.864  10.587   111.328 1.00 19.70 ? 327  ARG B CA  1 
ATOM   4843  C  C   . ARG B  1 245 ? 17.980  10.042   112.211 1.00 19.41 ? 327  ARG B C   1 
ATOM   4844  O  O   . ARG B  1 245 ? 18.205  10.545   113.309 1.00 18.43 ? 327  ARG B O   1 
ATOM   4845  C  CB  . ARG B  1 245 ? 17.504  11.286   110.124 1.00 20.79 ? 327  ARG B CB  1 
ATOM   4846  C  CG  . ARG B  1 245 ? 18.531  12.362   110.516 1.00 20.40 ? 327  ARG B CG  1 
ATOM   4847  C  CD  . ARG B  1 245 ? 19.348  12.845   109.315 1.00 22.46 ? 327  ARG B CD  1 
ATOM   4848  N  NE  . ARG B  1 245 ? 20.370  13.824   109.696 1.00 22.77 ? 327  ARG B NE  1 
ATOM   4849  C  CZ  . ARG B  1 245 ? 20.160  15.132   109.830 1.00 24.43 ? 327  ARG B CZ  1 
ATOM   4850  N  NH1 . ARG B  1 245 ? 21.156  15.930   110.185 1.00 26.26 ? 327  ARG B NH1 1 
ATOM   4851  N  NH2 . ARG B  1 245 ? 18.964  15.655   109.591 1.00 25.44 ? 327  ARG B NH2 1 
ATOM   4852  N  N   . PRO B  1 246 ? 18.682  8.998    111.748 1.00 20.23 ? 328  PRO B N   1 
ATOM   4853  C  CA  . PRO B  1 246 ? 19.774  8.434    112.544 1.00 20.52 ? 328  PRO B CA  1 
ATOM   4854  C  C   . PRO B  1 246 ? 21.091  9.067    112.094 1.00 21.86 ? 328  PRO B C   1 
ATOM   4855  O  O   . PRO B  1 246 ? 21.114  9.837    111.125 1.00 20.58 ? 328  PRO B O   1 
ATOM   4856  C  CB  . PRO B  1 246 ? 19.696  6.954    112.209 1.00 20.17 ? 328  PRO B CB  1 
ATOM   4857  C  CG  . PRO B  1 246 ? 19.349  6.980    110.755 1.00 19.62 ? 328  PRO B CG  1 
ATOM   4858  C  CD  . PRO B  1 246 ? 18.325  8.101    110.629 1.00 19.35 ? 328  PRO B CD  1 
ATOM   4859  N  N   . ASN B  1 247 ? 22.184  8.759    112.789 1.00 23.07 ? 329  ASN B N   1 
ATOM   4860  C  CA  . ASN B  1 247 ? 23.480  9.296    112.384 1.00 24.26 ? 329  ASN B CA  1 
ATOM   4861  C  C   . ASN B  1 247 ? 23.756  8.728    111.000 1.00 25.09 ? 329  ASN B C   1 
ATOM   4862  O  O   . ASN B  1 247 ? 23.334  7.613    110.702 1.00 26.87 ? 329  ASN B O   1 
ATOM   4863  C  CB  . ASN B  1 247 ? 24.573  8.881    113.367 1.00 24.78 ? 329  ASN B CB  1 
ATOM   4864  C  CG  . ASN B  1 247 ? 24.347  9.452    114.748 1.00 27.56 ? 329  ASN B CG  1 
ATOM   4865  O  OD1 . ASN B  1 247 ? 24.005  10.629   114.896 1.00 29.60 ? 329  ASN B OD1 1 
ATOM   4866  N  ND2 . ASN B  1 247 ? 24.543  8.632    115.768 1.00 26.48 ? 329  ASN B ND2 1 
ATOM   4867  N  N   . ASP B  1 248 ? 24.448  9.489    110.158 1.00 26.52 ? 330  ASP B N   1 
ATOM   4868  C  CA  . ASP B  1 248 ? 24.724  9.060    108.788 1.00 28.86 ? 330  ASP B CA  1 
ATOM   4869  C  C   . ASP B  1 248 ? 25.426  7.719    108.638 1.00 29.03 ? 330  ASP B C   1 
ATOM   4870  O  O   . ASP B  1 248 ? 26.644  7.637    108.732 1.00 31.56 ? 330  ASP B O   1 
ATOM   4871  C  CB  . ASP B  1 248 ? 25.544  10.114   108.047 1.00 30.12 ? 330  ASP B CB  1 
ATOM   4872  C  CG  . ASP B  1 248 ? 24.823  11.431   107.907 1.00 32.20 ? 330  ASP B CG  1 
ATOM   4873  O  OD1 . ASP B  1 248 ? 23.570  11.448   107.912 1.00 31.58 ? 330  ASP B OD1 1 
ATOM   4874  O  OD2 . ASP B  1 248 ? 25.530  12.453   107.772 1.00 34.12 ? 330  ASP B OD2 1 
ATOM   4875  N  N   . GLY B  1 249 ? 24.659  6.674    108.371 1.00 28.38 ? 331  GLY B N   1 
ATOM   4876  C  CA  . GLY B  1 249 ? 25.253  5.367    108.206 1.00 27.76 ? 331  GLY B CA  1 
ATOM   4877  C  C   . GLY B  1 249 ? 25.110  4.916    106.772 1.00 27.39 ? 331  GLY B C   1 
ATOM   4878  O  O   . GLY B  1 249 ? 25.432  5.649    105.844 1.00 28.31 ? 331  GLY B O   1 
ATOM   4879  N  N   . THR B  1 250 ? 24.628  3.697    106.596 1.00 27.50 ? 332  THR B N   1 
ATOM   4880  C  CA  . THR B  1 250 ? 24.414  3.146    105.273 1.00 27.55 ? 332  THR B CA  1 
ATOM   4881  C  C   . THR B  1 250 ? 22.930  3.278    104.960 1.00 27.66 ? 332  THR B C   1 
ATOM   4882  O  O   . THR B  1 250 ? 22.075  2.860    105.741 1.00 28.43 ? 332  THR B O   1 
ATOM   4883  C  CB  . THR B  1 250 ? 24.834  1.667    105.218 1.00 28.00 ? 332  THR B CB  1 
ATOM   4884  O  OG1 . THR B  1 250 ? 26.247  1.566    105.438 1.00 28.14 ? 332  THR B OG1 1 
ATOM   4885  C  CG2 . THR B  1 250 ? 24.497  1.070    103.873 1.00 26.02 ? 332  THR B CG2 1 
ATOM   4886  N  N   . GLY B  1 251 ? 22.630  3.887    103.822 1.00 27.89 ? 333  GLY B N   1 
ATOM   4887  C  CA  . GLY B  1 251 ? 21.250  4.072    103.438 1.00 27.89 ? 333  GLY B CA  1 
ATOM   4888  C  C   . GLY B  1 251 ? 20.783  2.982    102.506 1.00 28.24 ? 333  GLY B C   1 
ATOM   4889  O  O   . GLY B  1 251 ? 21.427  1.943    102.375 1.00 29.15 ? 333  GLY B O   1 
ATOM   4890  N  N   . SER B  1 252 ? 19.646  3.221    101.867 1.00 27.52 ? 335  SER B N   1 
ATOM   4891  C  CA  . SER B  1 252 ? 19.083  2.273    100.923 1.00 27.37 ? 335  SER B CA  1 
ATOM   4892  C  C   . SER B  1 252 ? 18.134  3.057    100.055 1.00 26.35 ? 335  SER B C   1 
ATOM   4893  O  O   . SER B  1 252 ? 17.762  4.177    100.396 1.00 27.17 ? 335  SER B O   1 
ATOM   4894  C  CB  . SER B  1 252 ? 18.319  1.176    101.645 1.00 27.06 ? 335  SER B CB  1 
ATOM   4895  O  OG  . SER B  1 252 ? 16.982  1.553    101.826 1.00 23.81 ? 335  SER B OG  1 
ATOM   4896  N  N   . CYS B  1 253 ? 17.731  2.481    98.936  1.00 26.24 ? 336  CYS B N   1 
ATOM   4897  C  CA  . CYS B  1 253 ? 16.833  3.200    98.063  1.00 28.76 ? 336  CYS B CA  1 
ATOM   4898  C  C   . CYS B  1 253 ? 15.382  2.912    98.415  1.00 27.57 ? 336  CYS B C   1 
ATOM   4899  O  O   . CYS B  1 253 ? 14.477  3.062    97.596  1.00 27.22 ? 336  CYS B O   1 
ATOM   4900  C  CB  . CYS B  1 253 ? 17.103  2.829    96.622  1.00 31.72 ? 336  CYS B CB  1 
ATOM   4901  S  SG  . CYS B  1 253 ? 18.853  2.881    96.107  1.00 41.33 ? 336  CYS B SG  1 
ATOM   4902  N  N   . GLY B  1 254 ? 15.180  2.503    99.656  1.00 26.64 ? 339  GLY B N   1 
ATOM   4903  C  CA  . GLY B  1 254 ? 13.857  2.207    100.136 1.00 25.26 ? 339  GLY B CA  1 
ATOM   4904  C  C   . GLY B  1 254 ? 13.850  2.683    101.566 1.00 24.64 ? 339  GLY B C   1 
ATOM   4905  O  O   . GLY B  1 254 ? 14.802  2.455    102.303 1.00 28.01 ? 339  GLY B O   1 
ATOM   4906  N  N   . PRO B  1 255 ? 12.769  3.317    101.999 1.00 23.59 ? 340  PRO B N   1 
ATOM   4907  C  CA  . PRO B  1 255 ? 12.606  3.843    103.354 1.00 22.38 ? 340  PRO B CA  1 
ATOM   4908  C  C   . PRO B  1 255 ? 13.518  3.288    104.456 1.00 20.70 ? 340  PRO B C   1 
ATOM   4909  O  O   . PRO B  1 255 ? 13.455  2.117    104.804 1.00 19.53 ? 340  PRO B O   1 
ATOM   4910  C  CB  . PRO B  1 255 ? 11.126  3.570    103.648 1.00 22.05 ? 340  PRO B CB  1 
ATOM   4911  C  CG  . PRO B  1 255 ? 10.759  2.477    102.670 1.00 21.22 ? 340  PRO B CG  1 
ATOM   4912  C  CD  . PRO B  1 255 ? 11.459  2.958    101.445 1.00 22.63 ? 340  PRO B CD  1 
ATOM   4913  N  N   . VAL B  1 256 ? 14.369  4.150    105.001 1.00 19.96 ? 341  VAL B N   1 
ATOM   4914  C  CA  . VAL B  1 256 ? 15.239  3.761    106.102 1.00 20.59 ? 341  VAL B CA  1 
ATOM   4915  C  C   . VAL B  1 256 ? 14.343  3.919    107.334 1.00 21.45 ? 341  VAL B C   1 
ATOM   4916  O  O   . VAL B  1 256 ? 13.958  5.034    107.686 1.00 20.84 ? 341  VAL B O   1 
ATOM   4917  C  CB  . VAL B  1 256 ? 16.464  4.707    106.264 1.00 20.46 ? 341  VAL B CB  1 
ATOM   4918  C  CG1 . VAL B  1 256 ? 17.324  4.258    107.448 1.00 17.71 ? 341  VAL B CG1 1 
ATOM   4919  C  CG2 . VAL B  1 256 ? 17.269  4.722    104.974 1.00 20.49 ? 341  VAL B CG2 1 
ATOM   4920  N  N   . SER B  1 257 ? 14.020  2.815    108.001 1.00 22.00 ? 342  SER B N   1 
ATOM   4921  C  CA  . SER B  1 257 ? 13.139  2.847    109.178 1.00 25.07 ? 342  SER B CA  1 
ATOM   4922  C  C   . SER B  1 257 ? 13.715  3.414    110.466 1.00 26.40 ? 342  SER B C   1 
ATOM   4923  O  O   . SER B  1 257 ? 13.001  4.068    111.223 1.00 26.65 ? 342  SER B O   1 
ATOM   4924  C  CB  . SER B  1 257 ? 12.596  1.444    109.445 1.00 25.42 ? 342  SER B CB  1 
ATOM   4925  O  OG  . SER B  1 257 ? 13.660  0.604    109.846 1.00 25.32 ? 342  SER B OG  1 
ATOM   4926  N  N   . SER B  1 258 ? 15.005  3.176    110.698 1.00 29.37 ? 343  SER B N   1 
ATOM   4927  C  CA  . SER B  1 258 ? 15.731  3.656    111.905 1.00 34.52 ? 343  SER B CA  1 
ATOM   4928  C  C   . SER B  1 258 ? 15.574  5.139    112.321 1.00 36.60 ? 343  SER B C   1 
ATOM   4929  O  O   . SER B  1 258 ? 16.419  5.993    112.017 1.00 39.47 ? 343  SER B O   1 
ATOM   4930  C  CB  . SER B  1 258 ? 17.242  3.339    111.787 1.00 34.78 ? 343  SER B CB  1 
ATOM   4931  O  OG  . SER B  1 258 ? 17.819  3.923    110.619 1.00 41.28 ? 343  SER B OG  1 
ATOM   4932  N  N   . ASN B  1 259 ? 14.450  5.456    112.938 1.00 36.91 ? 344  ASN B N   1 
ATOM   4933  C  CA  . ASN B  1 259 ? 14.240  6.804    113.408 1.00 37.81 ? 344  ASN B CA  1 
ATOM   4934  C  C   . ASN B  1 259 ? 13.472  7.694    112.474 1.00 38.17 ? 344  ASN B C   1 
ATOM   4935  O  O   . ASN B  1 259 ? 13.089  8.796    112.834 1.00 37.46 ? 344  ASN B O   1 
ATOM   4936  C  CB  . ASN B  1 259 ? 15.584  7.466    113.730 1.00 39.30 ? 344  ASN B CB  1 
ATOM   4937  C  CG  . ASN B  1 259 ? 15.508  8.343    114.937 1.00 39.63 ? 344  ASN B CG  1 
ATOM   4938  O  OD1 . ASN B  1 259 ? 14.491  8.988    115.165 1.00 43.98 ? 344  ASN B OD1 1 
ATOM   4939  N  ND2 . ASN B  1 259 ? 16.580  8.395    115.714 1.00 41.26 ? 344  ASN B ND2 1 
ATOM   4940  N  N   . GLY B  1 260 ? 13.268  7.238    111.259 1.00 38.21 ? 345  GLY B N   1 
ATOM   4941  C  CA  . GLY B  1 260 ? 12.535  8.078    110.349 1.00 38.84 ? 345  GLY B CA  1 
ATOM   4942  C  C   . GLY B  1 260 ? 11.041  7.813    110.472 1.00 38.26 ? 345  GLY B C   1 
ATOM   4943  O  O   . GLY B  1 260 ? 10.382  7.548    109.475 1.00 37.76 ? 345  GLY B O   1 
ATOM   4944  N  N   . ALA B  1 261 ? 10.483  7.852    111.676 1.00 38.49 ? 346  ALA B N   1 
ATOM   4945  C  CA  . ALA B  1 261 ? 9.056   7.599    111.825 1.00 36.44 ? 346  ALA B CA  1 
ATOM   4946  C  C   . ALA B  1 261 ? 8.287   8.877    112.066 1.00 34.87 ? 346  ALA B C   1 
ATOM   4947  O  O   . ALA B  1 261 ? 7.274   8.865    112.755 1.00 37.04 ? 346  ALA B O   1 
ATOM   4948  C  CB  . ALA B  1 261 ? 8.823   6.615    112.959 1.00 38.11 ? 346  ALA B CB  1 
ATOM   4949  N  N   . TYR B  1 262 ? 8.782   9.974    111.502 1.00 32.04 ? 347  TYR B N   1 
ATOM   4950  C  CA  . TYR B  1 262 ? 8.132   11.285   111.603 1.00 28.49 ? 347  TYR B CA  1 
ATOM   4951  C  C   . TYR B  1 262 ? 8.796   12.082   110.472 1.00 26.34 ? 347  TYR B C   1 
ATOM   4952  O  O   . TYR B  1 262 ? 9.020   11.524   109.392 1.00 26.49 ? 347  TYR B O   1 
ATOM   4953  C  CB  . TYR B  1 262 ? 8.398   11.907   112.975 1.00 28.74 ? 347  TYR B CB  1 
ATOM   4954  C  CG  . TYR B  1 262 ? 7.855   13.299   113.171 1.00 30.17 ? 347  TYR B CG  1 
ATOM   4955  C  CD1 . TYR B  1 262 ? 6.540   13.620   112.832 1.00 31.43 ? 347  TYR B CD1 1 
ATOM   4956  C  CD2 . TYR B  1 262 ? 8.664   14.311   113.696 1.00 31.44 ? 347  TYR B CD2 1 
ATOM   4957  C  CE1 . TYR B  1 262 ? 6.049   14.930   113.007 1.00 30.65 ? 347  TYR B CE1 1 
ATOM   4958  C  CE2 . TYR B  1 262 ? 8.184   15.607   113.873 1.00 29.67 ? 347  TYR B CE2 1 
ATOM   4959  C  CZ  . TYR B  1 262 ? 6.883   15.910   113.525 1.00 30.65 ? 347  TYR B CZ  1 
ATOM   4960  O  OH  . TYR B  1 262 ? 6.440   17.207   113.674 1.00 30.88 ? 347  TYR B OH  1 
ATOM   4961  N  N   . GLY B  1 263 ? 9.111   13.359   110.669 1.00 23.55 ? 348  GLY B N   1 
ATOM   4962  C  CA  . GLY B  1 263 ? 9.762   14.069   109.581 1.00 21.77 ? 348  GLY B CA  1 
ATOM   4963  C  C   . GLY B  1 263 ? 9.690   15.575   109.541 1.00 19.66 ? 348  GLY B C   1 
ATOM   4964  O  O   . GLY B  1 263 ? 9.272   16.216   110.496 1.00 19.99 ? 348  GLY B O   1 
ATOM   4965  N  N   . VAL B  1 264 ? 10.126  16.128   108.414 1.00 18.23 ? 349  VAL B N   1 
ATOM   4966  C  CA  . VAL B  1 264 ? 10.126  17.569   108.185 1.00 18.07 ? 349  VAL B CA  1 
ATOM   4967  C  C   . VAL B  1 264 ? 10.156  17.798   106.684 1.00 17.18 ? 349  VAL B C   1 
ATOM   4968  O  O   . VAL B  1 264 ? 10.810  17.051   105.956 1.00 15.07 ? 349  VAL B O   1 
ATOM   4969  C  CB  . VAL B  1 264 ? 11.376  18.266   108.816 1.00 20.02 ? 349  VAL B CB  1 
ATOM   4970  C  CG1 . VAL B  1 264 ? 12.644  17.885   108.049 1.00 19.42 ? 349  VAL B CG1 1 
ATOM   4971  C  CG2 . VAL B  1 264 ? 11.196  19.785   108.821 1.00 16.83 ? 349  VAL B CG2 1 
ATOM   4972  N  N   . LYS B  1 265 ? 9.434   18.813   106.213 1.00 17.62 ? 350  LYS B N   1 
ATOM   4973  C  CA  . LYS B  1 265 ? 9.430   19.100   104.784 1.00 18.20 ? 350  LYS B CA  1 
ATOM   4974  C  C   . LYS B  1 265 ? 10.862  19.452   104.414 1.00 19.15 ? 350  LYS B C   1 
ATOM   4975  O  O   . LYS B  1 265 ? 11.573  20.093   105.191 1.00 20.23 ? 350  LYS B O   1 
ATOM   4976  C  CB  . LYS B  1 265 ? 8.507   20.275   104.439 1.00 17.11 ? 350  LYS B CB  1 
ATOM   4977  C  CG  . LYS B  1 265 ? 8.511   20.619   102.941 1.00 17.02 ? 350  LYS B CG  1 
ATOM   4978  C  CD  . LYS B  1 265 ? 7.616   21.797   102.616 1.00 15.08 ? 350  LYS B CD  1 
ATOM   4979  C  CE  . LYS B  1 265 ? 7.884   22.337   101.215 1.00 15.10 ? 350  LYS B CE  1 
ATOM   4980  N  NZ  . LYS B  1 265 ? 7.551   21.389   100.106 1.00 16.39 ? 350  LYS B NZ  1 
ATOM   4981  N  N   . GLY B  1 266 ? 11.288  19.015   103.236 1.00 18.14 ? 351  GLY B N   1 
ATOM   4982  C  CA  . GLY B  1 266 ? 12.637  19.297   102.798 1.00 17.10 ? 351  GLY B CA  1 
ATOM   4983  C  C   . GLY B  1 266 ? 12.735  19.174   101.297 1.00 17.89 ? 351  GLY B C   1 
ATOM   4984  O  O   . GLY B  1 266 ? 11.722  19.039   100.608 1.00 18.87 ? 351  GLY B O   1 
ATOM   4985  N  N   . PHE B  1 267 ? 13.957  19.211   100.784 1.00 16.26 ? 352  PHE B N   1 
ATOM   4986  C  CA  . PHE B  1 267 ? 14.167  19.114   99.354  1.00 15.13 ? 352  PHE B CA  1 
ATOM   4987  C  C   . PHE B  1 267 ? 15.547  18.546   99.050  1.00 14.55 ? 352  PHE B C   1 
ATOM   4988  O  O   . PHE B  1 267 ? 16.344  18.269   99.948  1.00 12.79 ? 352  PHE B O   1 
ATOM   4989  C  CB  . PHE B  1 267 ? 14.085  20.498   98.736  1.00 15.71 ? 352  PHE B CB  1 
ATOM   4990  C  CG  . PHE B  1 267 ? 15.251  21.357   99.088  1.00 17.19 ? 352  PHE B CG  1 
ATOM   4991  C  CD1 . PHE B  1 267 ? 15.402  21.842   100.387 1.00 16.82 ? 352  PHE B CD1 1 
ATOM   4992  C  CD2 . PHE B  1 267 ? 16.247  21.621   98.147  1.00 17.65 ? 352  PHE B CD2 1 
ATOM   4993  C  CE1 . PHE B  1 267 ? 16.534  22.576   100.751 1.00 18.23 ? 352  PHE B CE1 1 
ATOM   4994  C  CE2 . PHE B  1 267 ? 17.390  22.358   98.499  1.00 18.14 ? 352  PHE B CE2 1 
ATOM   4995  C  CZ  . PHE B  1 267 ? 17.532  22.835   99.807  1.00 17.14 ? 352  PHE B CZ  1 
ATOM   4996  N  N   . SER B  1 268 ? 15.817  18.401   97.757  1.00 14.79 ? 353  SER B N   1 
ATOM   4997  C  CA  . SER B  1 268 ? 17.096  17.915   97.268  1.00 13.84 ? 353  SER B CA  1 
ATOM   4998  C  C   . SER B  1 268 ? 17.121  18.114   95.770  1.00 13.77 ? 353  SER B C   1 
ATOM   4999  O  O   . SER B  1 268 ? 16.103  17.943   95.105  1.00 13.00 ? 353  SER B O   1 
ATOM   5000  C  CB  . SER B  1 268 ? 17.274  16.434   97.588  1.00 13.53 ? 353  SER B CB  1 
ATOM   5001  O  OG  . SER B  1 268 ? 17.525  16.232   98.967  1.00 13.44 ? 353  SER B OG  1 
ATOM   5002  N  N   . PHE B  1 269 ? 18.274  18.507   95.241  1.00 14.01 ? 354  PHE B N   1 
ATOM   5003  C  CA  . PHE B  1 269 ? 18.410  18.685   93.805  1.00 15.69 ? 354  PHE B CA  1 
ATOM   5004  C  C   . PHE B  1 269 ? 19.228  17.548   93.210  1.00 17.27 ? 354  PHE B C   1 
ATOM   5005  O  O   . PHE B  1 269 ? 20.290  17.183   93.717  1.00 17.89 ? 354  PHE B O   1 
ATOM   5006  C  CB  . PHE B  1 269 ? 19.063  20.025   93.482  1.00 15.74 ? 354  PHE B CB  1 
ATOM   5007  C  CG  . PHE B  1 269 ? 18.169  21.196   93.740  1.00 16.76 ? 354  PHE B CG  1 
ATOM   5008  C  CD1 . PHE B  1 269 ? 18.293  21.940   94.911  1.00 17.65 ? 354  PHE B CD1 1 
ATOM   5009  C  CD2 . PHE B  1 269 ? 17.179  21.541   92.822  1.00 17.23 ? 354  PHE B CD2 1 
ATOM   5010  C  CE1 . PHE B  1 269 ? 17.452  23.012   95.168  1.00 17.61 ? 354  PHE B CE1 1 
ATOM   5011  C  CE2 . PHE B  1 269 ? 16.327  22.612   93.067  1.00 18.67 ? 354  PHE B CE2 1 
ATOM   5012  C  CZ  . PHE B  1 269 ? 16.463  23.352   94.244  1.00 18.77 ? 354  PHE B CZ  1 
ATOM   5013  N  N   . LYS B  1 270 ? 18.723  16.983   92.125  1.00 19.26 ? 355  LYS B N   1 
ATOM   5014  C  CA  . LYS B  1 270 ? 19.401  15.882   91.475  1.00 20.66 ? 355  LYS B CA  1 
ATOM   5015  C  C   . LYS B  1 270 ? 20.257  16.336   90.298  1.00 21.88 ? 355  LYS B C   1 
ATOM   5016  O  O   . LYS B  1 270 ? 19.807  17.114   89.459  1.00 22.61 ? 355  LYS B O   1 
ATOM   5017  C  CB  . LYS B  1 270 ? 18.362  14.861   91.009  1.00 20.94 ? 355  LYS B CB  1 
ATOM   5018  C  CG  . LYS B  1 270 ? 18.900  13.810   90.063  1.00 20.78 ? 355  LYS B CG  1 
ATOM   5019  C  CD  . LYS B  1 270 ? 17.811  12.855   89.642  1.00 19.87 ? 355  LYS B CD  1 
ATOM   5020  C  CE  . LYS B  1 270 ? 18.183  12.159   88.352  1.00 19.11 ? 355  LYS B CE  1 
ATOM   5021  N  NZ  . LYS B  1 270 ? 19.474  11.478   88.484  1.00 19.98 ? 355  LYS B NZ  1 
ATOM   5022  N  N   . TYR B  1 271 ? 21.498  15.853   90.262  1.00 23.80 ? 356  TYR B N   1 
ATOM   5023  C  CA  . TYR B  1 271 ? 22.451  16.149   89.185  1.00 24.51 ? 356  TYR B CA  1 
ATOM   5024  C  C   . TYR B  1 271 ? 23.143  14.829   88.850  1.00 24.78 ? 356  TYR B C   1 
ATOM   5025  O  O   . TYR B  1 271 ? 24.036  14.383   89.580  1.00 25.32 ? 356  TYR B O   1 
ATOM   5026  C  CB  . TYR B  1 271 ? 23.511  17.160   89.636  1.00 25.41 ? 356  TYR B CB  1 
ATOM   5027  C  CG  . TYR B  1 271 ? 23.050  18.600   89.703  1.00 25.97 ? 356  TYR B CG  1 
ATOM   5028  C  CD1 . TYR B  1 271 ? 22.376  19.087   90.820  1.00 25.36 ? 356  TYR B CD1 1 
ATOM   5029  C  CD2 . TYR B  1 271 ? 23.295  19.479   88.646  1.00 25.32 ? 356  TYR B CD2 1 
ATOM   5030  C  CE1 . TYR B  1 271 ? 21.957  20.410   90.888  1.00 25.41 ? 356  TYR B CE1 1 
ATOM   5031  C  CE2 . TYR B  1 271 ? 22.878  20.800   88.701  1.00 25.42 ? 356  TYR B CE2 1 
ATOM   5032  C  CZ  . TYR B  1 271 ? 22.211  21.260   89.828  1.00 26.22 ? 356  TYR B CZ  1 
ATOM   5033  O  OH  . TYR B  1 271 ? 21.800  22.573   89.892  1.00 28.26 ? 356  TYR B OH  1 
ATOM   5034  N  N   . GLY B  1 272 ? 22.738  14.202   87.750  1.00 24.61 ? 357  GLY B N   1 
ATOM   5035  C  CA  . GLY B  1 272 ? 23.329  12.924   87.387  1.00 23.09 ? 357  GLY B CA  1 
ATOM   5036  C  C   . GLY B  1 272 ? 22.982  11.948   88.493  1.00 21.36 ? 357  GLY B C   1 
ATOM   5037  O  O   . GLY B  1 272 ? 21.816  11.793   88.814  1.00 21.56 ? 357  GLY B O   1 
ATOM   5038  N  N   . ASN B  1 273 ? 23.980  11.292   89.073  1.00 20.75 ? 358  ASN B N   1 
ATOM   5039  C  CA  . ASN B  1 273 ? 23.736  10.365   90.173  1.00 20.24 ? 358  ASN B CA  1 
ATOM   5040  C  C   . ASN B  1 273 ? 24.045  11.091   91.466  1.00 19.50 ? 358  ASN B C   1 
ATOM   5041  O  O   . ASN B  1 273 ? 24.030  10.490   92.538  1.00 17.53 ? 358  ASN B O   1 
ATOM   5042  C  CB  . ASN B  1 273 ? 24.657  9.153    90.106  1.00 23.08 ? 358  ASN B CB  1 
ATOM   5043  C  CG  . ASN B  1 273 ? 24.407  8.300    88.912  1.00 25.39 ? 358  ASN B CG  1 
ATOM   5044  O  OD1 . ASN B  1 273 ? 23.290  7.823    88.694  1.00 28.39 ? 358  ASN B OD1 1 
ATOM   5045  N  ND2 . ASN B  1 273 ? 25.450  8.087    88.117  1.00 27.52 ? 358  ASN B ND2 1 
ATOM   5046  N  N   . GLY B  1 274 ? 24.357  12.377   91.355  1.00 18.82 ? 359  GLY B N   1 
ATOM   5047  C  CA  . GLY B  1 274 ? 24.686  13.155   92.533  1.00 18.96 ? 359  GLY B CA  1 
ATOM   5048  C  C   . GLY B  1 274 ? 23.479  13.861   93.102  1.00 18.33 ? 359  GLY B C   1 
ATOM   5049  O  O   . GLY B  1 274 ? 22.440  13.929   92.453  1.00 17.78 ? 359  GLY B O   1 
ATOM   5050  N  N   . VAL B  1 275 ? 23.609  14.385   94.315  1.00 17.44 ? 360  VAL B N   1 
ATOM   5051  C  CA  . VAL B  1 275 ? 22.497  15.079   94.936  1.00 18.47 ? 360  VAL B CA  1 
ATOM   5052  C  C   . VAL B  1 275 ? 22.913  16.165   95.907  1.00 19.01 ? 360  VAL B C   1 
ATOM   5053  O  O   . VAL B  1 275 ? 23.809  15.968   96.736  1.00 19.52 ? 360  VAL B O   1 
ATOM   5054  C  CB  . VAL B  1 275 ? 21.604  14.132   95.759  1.00 18.11 ? 360  VAL B CB  1 
ATOM   5055  C  CG1 . VAL B  1 275 ? 20.167  14.619   95.731  1.00 17.95 ? 360  VAL B CG1 1 
ATOM   5056  C  CG2 . VAL B  1 275 ? 21.718  12.742   95.252  1.00 19.84 ? 360  VAL B CG2 1 
ATOM   5057  N  N   . TRP B  1 276 ? 22.252  17.313   95.798  1.00 17.81 ? 361  TRP B N   1 
ATOM   5058  C  CA  . TRP B  1 276 ? 22.487  18.396   96.729  1.00 17.46 ? 361  TRP B CA  1 
ATOM   5059  C  C   . TRP B  1 276 ? 21.413  18.144   97.778  1.00 17.22 ? 361  TRP B C   1 
ATOM   5060  O  O   . TRP B  1 276 ? 20.214  18.152   97.487  1.00 17.76 ? 361  TRP B O   1 
ATOM   5061  C  CB  . TRP B  1 276 ? 22.289  19.758   96.068  1.00 16.17 ? 361  TRP B CB  1 
ATOM   5062  C  CG  . TRP B  1 276 ? 23.554  20.331   95.526  1.00 16.61 ? 361  TRP B CG  1 
ATOM   5063  C  CD1 . TRP B  1 276 ? 23.928  20.405   94.216  1.00 17.01 ? 361  TRP B CD1 1 
ATOM   5064  C  CD2 . TRP B  1 276 ? 24.625  20.901   96.282  1.00 15.80 ? 361  TRP B CD2 1 
ATOM   5065  N  NE1 . TRP B  1 276 ? 25.168  20.987   94.108  1.00 16.56 ? 361  TRP B NE1 1 
ATOM   5066  C  CE2 . TRP B  1 276 ? 25.619  21.304   95.364  1.00 16.13 ? 361  TRP B CE2 1 
ATOM   5067  C  CE3 . TRP B  1 276 ? 24.841  21.116   97.653  1.00 16.34 ? 361  TRP B CE3 1 
ATOM   5068  C  CZ2 . TRP B  1 276 ? 26.814  21.908   95.767  1.00 17.65 ? 361  TRP B CZ2 1 
ATOM   5069  C  CZ3 . TRP B  1 276 ? 26.026  21.715   98.060  1.00 16.89 ? 361  TRP B CZ3 1 
ATOM   5070  C  CH2 . TRP B  1 276 ? 26.999  22.108   97.118  1.00 19.05 ? 361  TRP B CH2 1 
ATOM   5071  N  N   . ILE B  1 277 ? 21.847  17.887   98.996  1.00 16.54 ? 362  ILE B N   1 
ATOM   5072  C  CA  . ILE B  1 277 ? 20.923  17.606   100.061 1.00 16.62 ? 362  ILE B CA  1 
ATOM   5073  C  C   . ILE B  1 277 ? 20.836  18.763   101.030 1.00 18.14 ? 362  ILE B C   1 
ATOM   5074  O  O   . ILE B  1 277 ? 21.857  19.269   101.504 1.00 18.85 ? 362  ILE B O   1 
ATOM   5075  C  CB  . ILE B  1 277 ? 21.364  16.355   100.823 1.00 17.19 ? 362  ILE B CB  1 
ATOM   5076  C  CG1 . ILE B  1 277 ? 21.247  15.136   99.904  1.00 16.90 ? 362  ILE B CG1 1 
ATOM   5077  C  CG2 . ILE B  1 277 ? 20.562  16.211   102.110 1.00 14.50 ? 362  ILE B CG2 1 
ATOM   5078  C  CD1 . ILE B  1 277 ? 21.832  13.867   100.497 1.00 20.08 ? 362  ILE B CD1 1 
ATOM   5079  N  N   . GLY B  1 278 ? 19.612  19.198   101.305 1.00 17.52 ? 363  GLY B N   1 
ATOM   5080  C  CA  . GLY B  1 278 ? 19.420  20.268   102.258 1.00 16.31 ? 363  GLY B CA  1 
ATOM   5081  C  C   . GLY B  1 278 ? 18.874  19.568   103.481 1.00 16.34 ? 363  GLY B C   1 
ATOM   5082  O  O   . GLY B  1 278 ? 17.955  18.757   103.354 1.00 18.78 ? 363  GLY B O   1 
ATOM   5083  N  N   . ARG B  1 279 ? 19.424  19.842   104.657 1.00 14.14 ? 364  ARG B N   1 
ATOM   5084  C  CA  . ARG B  1 279 ? 18.921  19.187   105.849 1.00 13.52 ? 364  ARG B CA  1 
ATOM   5085  C  C   . ARG B  1 279 ? 19.322  19.914   107.112 1.00 15.52 ? 364  ARG B C   1 
ATOM   5086  O  O   . ARG B  1 279 ? 20.191  20.791   107.094 1.00 13.94 ? 364  ARG B O   1 
ATOM   5087  C  CB  . ARG B  1 279 ? 19.442  17.762   105.928 1.00 14.29 ? 364  ARG B CB  1 
ATOM   5088  C  CG  . ARG B  1 279 ? 20.833  17.653   106.516 1.00 13.94 ? 364  ARG B CG  1 
ATOM   5089  C  CD  . ARG B  1 279 ? 21.340  16.228   106.433 1.00 14.27 ? 364  ARG B CD  1 
ATOM   5090  N  NE  . ARG B  1 279 ? 22.612  16.059   107.124 1.00 14.83 ? 364  ARG B NE  1 
ATOM   5091  C  CZ  . ARG B  1 279 ? 23.290  14.917   107.173 1.00 14.80 ? 364  ARG B CZ  1 
ATOM   5092  N  NH1 . ARG B  1 279 ? 24.438  14.858   107.826 1.00 14.21 ? 364  ARG B NH1 1 
ATOM   5093  N  NH2 . ARG B  1 279 ? 22.822  13.836   106.568 1.00 14.71 ? 364  ARG B NH2 1 
ATOM   5094  N  N   . THR B  1 280 ? 18.676  19.532   108.209 1.00 16.02 ? 365  THR B N   1 
ATOM   5095  C  CA  . THR B  1 280 ? 18.945  20.111   109.507 1.00 17.15 ? 365  THR B CA  1 
ATOM   5096  C  C   . THR B  1 280 ? 20.287  19.551   109.939 1.00 18.73 ? 365  THR B C   1 
ATOM   5097  O  O   . THR B  1 280 ? 20.763  18.575   109.357 1.00 18.01 ? 365  THR B O   1 
ATOM   5098  C  CB  . THR B  1 280 ? 17.895  19.666   110.512 1.00 19.09 ? 365  THR B CB  1 
ATOM   5099  O  OG1 . THR B  1 280 ? 18.149  18.309   110.896 1.00 18.89 ? 365  THR B OG1 1 
ATOM   5100  C  CG2 . THR B  1 280 ? 16.515  19.753   109.889 1.00 17.47 ? 365  THR B CG2 1 
ATOM   5101  N  N   . LYS B  1 281 ? 20.900  20.159   110.947 1.00 19.76 ? 366  LYS B N   1 
ATOM   5102  C  CA  . LYS B  1 281 ? 22.183  19.663   111.421 1.00 22.04 ? 366  LYS B CA  1 
ATOM   5103  C  C   . LYS B  1 281 ? 21.959  18.678   112.561 1.00 22.57 ? 366  LYS B C   1 
ATOM   5104  O  O   . LYS B  1 281 ? 22.760  17.766   112.764 1.00 24.19 ? 366  LYS B O   1 
ATOM   5105  C  CB  . LYS B  1 281 ? 23.081  20.813   111.879 1.00 22.13 ? 366  LYS B CB  1 
ATOM   5106  C  CG  . LYS B  1 281 ? 23.530  21.717   110.754 1.00 23.66 ? 366  LYS B CG  1 
ATOM   5107  C  CD  . LYS B  1 281 ? 24.303  22.907   111.295 1.00 24.48 ? 366  LYS B CD  1 
ATOM   5108  C  CE  . LYS B  1 281 ? 25.776  22.699   111.180 1.00 25.06 ? 366  LYS B CE  1 
ATOM   5109  N  NZ  . LYS B  1 281 ? 26.119  22.579   109.749 1.00 26.67 ? 366  LYS B NZ  1 
ATOM   5110  N  N   . SER B  1 282 ? 20.873  18.864   113.304 1.00 22.23 ? 367  SER B N   1 
ATOM   5111  C  CA  . SER B  1 282 ? 20.542  17.960   114.400 1.00 22.73 ? 367  SER B CA  1 
ATOM   5112  C  C   . SER B  1 282 ? 19.797  16.761   113.816 1.00 22.40 ? 367  SER B C   1 
ATOM   5113  O  O   . SER B  1 282 ? 19.180  16.874   112.765 1.00 21.42 ? 367  SER B O   1 
ATOM   5114  C  CB  . SER B  1 282 ? 19.653  18.665   115.422 1.00 23.44 ? 367  SER B CB  1 
ATOM   5115  O  OG  . SER B  1 282 ? 19.108  17.738   116.351 1.00 28.02 ? 367  SER B OG  1 
ATOM   5116  N  N   . THR B  1 283 ? 19.865  15.616   114.487 1.00 23.10 ? 368  THR B N   1 
ATOM   5117  C  CA  . THR B  1 283 ? 19.175  14.423   114.008 1.00 25.10 ? 368  THR B CA  1 
ATOM   5118  C  C   . THR B  1 283 ? 17.854  14.266   114.733 1.00 25.48 ? 368  THR B C   1 
ATOM   5119  O  O   . THR B  1 283 ? 17.044  13.422   114.366 1.00 25.02 ? 368  THR B O   1 
ATOM   5120  C  CB  . THR B  1 283 ? 19.976  13.113   114.264 1.00 25.29 ? 368  THR B CB  1 
ATOM   5121  O  OG1 . THR B  1 283 ? 20.116  12.900   115.676 1.00 27.09 ? 368  THR B OG1 1 
ATOM   5122  C  CG2 . THR B  1 283 ? 21.342  13.175   113.626 1.00 24.57 ? 368  THR B CG2 1 
ATOM   5123  N  N   . ASN B  1 284 ? 17.641  15.072   115.770 1.00 28.16 ? 369  ASN B N   1 
ATOM   5124  C  CA  . ASN B  1 284 ? 16.418  14.976   116.555 1.00 30.69 ? 369  ASN B CA  1 
ATOM   5125  C  C   . ASN B  1 284 ? 15.509  16.201   116.510 1.00 31.06 ? 369  ASN B C   1 
ATOM   5126  O  O   . ASN B  1 284 ? 14.288  16.069   116.589 1.00 31.35 ? 369  ASN B O   1 
ATOM   5127  C  CB  . ASN B  1 284 ? 16.765  14.661   118.009 1.00 33.10 ? 369  ASN B CB  1 
ATOM   5128  C  CG  . ASN B  1 284 ? 17.555  13.370   118.152 1.00 39.01 ? 369  ASN B CG  1 
ATOM   5129  O  OD1 . ASN B  1 284 ? 17.127  12.303   117.687 1.00 42.31 ? 369  ASN B OD1 1 
ATOM   5130  N  ND2 . ASN B  1 284 ? 18.716  13.455   118.800 1.00 40.85 ? 369  ASN B ND2 1 
ATOM   5131  N  N   . SER B  1 285 ? 16.091  17.388   116.392 1.00 30.66 ? 370  SER B N   1 
ATOM   5132  C  CA  . SER B  1 285 ? 15.291  18.608   116.360 1.00 29.25 ? 370  SER B CA  1 
ATOM   5133  C  C   . SER B  1 285 ? 15.431  19.291   115.027 1.00 27.68 ? 370  SER B C   1 
ATOM   5134  O  O   . SER B  1 285 ? 16.309  18.965   114.237 1.00 27.78 ? 370  SER B O   1 
ATOM   5135  C  CB  . SER B  1 285 ? 15.755  19.602   117.428 1.00 31.15 ? 370  SER B CB  1 
ATOM   5136  O  OG  . SER B  1 285 ? 15.955  18.983   118.685 1.00 36.05 ? 370  SER B OG  1 
ATOM   5137  N  N   . ARG B  1 286 ? 14.553  20.253   114.791 1.00 26.81 ? 371  ARG B N   1 
ATOM   5138  C  CA  . ARG B  1 286 ? 14.589  21.040   113.576 1.00 24.76 ? 371  ARG B CA  1 
ATOM   5139  C  C   . ARG B  1 286 ? 15.496  22.207   113.940 1.00 24.74 ? 371  ARG B C   1 
ATOM   5140  O  O   . ARG B  1 286 ? 15.050  23.332   114.147 1.00 25.70 ? 371  ARG B O   1 
ATOM   5141  C  CB  . ARG B  1 286 ? 13.184  21.519   113.218 1.00 22.87 ? 371  ARG B CB  1 
ATOM   5142  C  CG  . ARG B  1 286 ? 12.227  20.369   112.952 1.00 21.39 ? 371  ARG B CG  1 
ATOM   5143  C  CD  . ARG B  1 286 ? 10.848  20.824   112.526 1.00 19.33 ? 371  ARG B CD  1 
ATOM   5144  N  NE  . ARG B  1 286 ? 10.027  19.697   112.093 1.00 19.04 ? 371  ARG B NE  1 
ATOM   5145  C  CZ  . ARG B  1 286 ? 8.728   19.776   111.812 1.00 19.33 ? 371  ARG B CZ  1 
ATOM   5146  N  NH1 . ARG B  1 286 ? 8.065   18.690   111.422 1.00 17.80 ? 371  ARG B NH1 1 
ATOM   5147  N  NH2 . ARG B  1 286 ? 8.088   20.935   111.932 1.00 17.43 ? 371  ARG B NH2 1 
ATOM   5148  N  N   . SER B  1 287 ? 16.783  21.908   114.053 1.00 24.12 ? 372  SER B N   1 
ATOM   5149  C  CA  . SER B  1 287 ? 17.773  22.912   114.399 1.00 24.30 ? 372  SER B CA  1 
ATOM   5150  C  C   . SER B  1 287 ? 18.903  22.869   113.396 1.00 22.26 ? 372  SER B C   1 
ATOM   5151  O  O   . SER B  1 287 ? 19.279  21.801   112.912 1.00 21.72 ? 372  SER B O   1 
ATOM   5152  C  CB  . SER B  1 287 ? 18.321  22.671   115.810 1.00 25.85 ? 372  SER B CB  1 
ATOM   5153  O  OG  . SER B  1 287 ? 17.800  21.466   116.357 1.00 28.59 ? 372  SER B OG  1 
ATOM   5154  N  N   . GLY B  1 288 ? 19.428  24.048   113.082 1.00 20.98 ? 373  GLY B N   1 
ATOM   5155  C  CA  . GLY B  1 288 ? 20.512  24.157   112.130 1.00 18.52 ? 373  GLY B CA  1 
ATOM   5156  C  C   . GLY B  1 288 ? 20.097  23.716   110.746 1.00 17.80 ? 373  GLY B C   1 
ATOM   5157  O  O   . GLY B  1 288 ? 19.037  23.110   110.553 1.00 17.00 ? 373  GLY B O   1 
ATOM   5158  N  N   . PHE B  1 289 ? 20.935  24.034   109.771 1.00 16.14 ? 374  PHE B N   1 
ATOM   5159  C  CA  . PHE B  1 289 ? 20.673  23.649   108.396 1.00 15.21 ? 374  PHE B CA  1 
ATOM   5160  C  C   . PHE B  1 289 ? 22.007  23.661   107.686 1.00 16.05 ? 374  PHE B C   1 
ATOM   5161  O  O   . PHE B  1 289 ? 22.906  24.397   108.083 1.00 16.82 ? 374  PHE B O   1 
ATOM   5162  C  CB  . PHE B  1 289 ? 19.715  24.621   107.723 1.00 12.47 ? 374  PHE B CB  1 
ATOM   5163  C  CG  . PHE B  1 289 ? 19.032  24.044   106.521 1.00 10.32 ? 374  PHE B CG  1 
ATOM   5164  C  CD1 . PHE B  1 289 ? 17.946  23.186   106.672 1.00 7.35  ? 374  PHE B CD1 1 
ATOM   5165  C  CD2 . PHE B  1 289 ? 19.513  24.308   105.238 1.00 7.86  ? 374  PHE B CD2 1 
ATOM   5166  C  CE1 . PHE B  1 289 ? 17.348  22.591   105.558 1.00 9.21  ? 374  PHE B CE1 1 
ATOM   5167  C  CE2 . PHE B  1 289 ? 18.927  23.721   104.117 1.00 7.68  ? 374  PHE B CE2 1 
ATOM   5168  C  CZ  . PHE B  1 289 ? 17.843  22.859   104.270 1.00 8.22  ? 374  PHE B CZ  1 
ATOM   5169  N  N   . GLU B  1 290 ? 22.132  22.853   106.635 1.00 17.30 ? 375  GLU B N   1 
ATOM   5170  C  CA  . GLU B  1 290 ? 23.381  22.728   105.882 1.00 16.93 ? 375  GLU B CA  1 
ATOM   5171  C  C   . GLU B  1 290 ? 23.097  22.139   104.510 1.00 16.88 ? 375  GLU B C   1 
ATOM   5172  O  O   . GLU B  1 290 ? 22.168  21.358   104.354 1.00 18.70 ? 375  GLU B O   1 
ATOM   5173  C  CB  . GLU B  1 290 ? 24.317  21.770   106.621 1.00 18.48 ? 375  GLU B CB  1 
ATOM   5174  C  CG  . GLU B  1 290 ? 23.710  20.362   106.759 1.00 20.51 ? 375  GLU B CG  1 
ATOM   5175  C  CD  . GLU B  1 290 ? 24.560  19.391   107.567 1.00 21.29 ? 375  GLU B CD  1 
ATOM   5176  O  OE1 . GLU B  1 290 ? 25.450  19.856   108.302 1.00 24.37 ? 375  GLU B OE1 1 
ATOM   5177  O  OE2 . GLU B  1 290 ? 24.327  18.162   107.482 1.00 19.43 ? 375  GLU B OE2 1 
ATOM   5178  N  N   . MET B  1 291 ? 23.894  22.505   103.515 1.00 16.50 ? 376  MET B N   1 
ATOM   5179  C  CA  . MET B  1 291 ? 23.727  21.953   102.181 1.00 16.92 ? 376  MET B CA  1 
ATOM   5180  C  C   . MET B  1 291 ? 24.883  20.993   101.928 1.00 18.12 ? 376  MET B C   1 
ATOM   5181  O  O   . MET B  1 291 ? 26.052  21.370   102.031 1.00 18.76 ? 376  MET B O   1 
ATOM   5182  C  CB  . MET B  1 291 ? 23.739  23.056   101.127 1.00 19.05 ? 376  MET B CB  1 
ATOM   5183  C  CG  . MET B  1 291 ? 22.523  23.945   101.142 1.00 19.24 ? 376  MET B CG  1 
ATOM   5184  S  SD  . MET B  1 291 ? 21.017  23.017   100.826 1.00 23.23 ? 376  MET B SD  1 
ATOM   5185  C  CE  . MET B  1 291 ? 21.207  22.646   99.085  1.00 19.55 ? 376  MET B CE  1 
ATOM   5186  N  N   . ILE B  1 292 ? 24.555  19.748   101.602 1.00 18.58 ? 377  ILE B N   1 
ATOM   5187  C  CA  . ILE B  1 292 ? 25.565  18.745   101.334 1.00 19.21 ? 377  ILE B CA  1 
ATOM   5188  C  C   . ILE B  1 292 ? 25.490  18.236   99.901  1.00 20.71 ? 377  ILE B C   1 
ATOM   5189  O  O   . ILE B  1 292 ? 24.415  17.902   99.400  1.00 21.43 ? 377  ILE B O   1 
ATOM   5190  C  CB  . ILE B  1 292 ? 25.423  17.559   102.297 1.00 20.05 ? 377  ILE B CB  1 
ATOM   5191  C  CG1 . ILE B  1 292 ? 25.779  18.019   103.713 1.00 20.71 ? 377  ILE B CG1 1 
ATOM   5192  C  CG2 . ILE B  1 292 ? 26.301  16.387   101.827 1.00 16.67 ? 377  ILE B CG2 1 
ATOM   5193  C  CD1 . ILE B  1 292 ? 25.599  16.957   104.776 1.00 22.86 ? 377  ILE B CD1 1 
ATOM   5194  N  N   . TRP B  1 293 ? 26.640  18.203   99.237  1.00 20.26 ? 378  TRP B N   1 
ATOM   5195  C  CA  . TRP B  1 293 ? 26.718  17.712   97.873  1.00 21.30 ? 378  TRP B CA  1 
ATOM   5196  C  C   . TRP B  1 293 ? 27.320  16.317   97.889  1.00 22.96 ? 378  TRP B C   1 
ATOM   5197  O  O   . TRP B  1 293 ? 28.522  16.146   98.096  1.00 21.91 ? 378  TRP B O   1 
ATOM   5198  C  CB  . TRP B  1 293 ? 27.593  18.615   97.015  1.00 20.51 ? 378  TRP B CB  1 
ATOM   5199  C  CG  . TRP B  1 293 ? 28.071  17.946   95.744  1.00 21.44 ? 378  TRP B CG  1 
ATOM   5200  C  CD1 . TRP B  1 293 ? 29.369  17.669   95.397  1.00 22.44 ? 378  TRP B CD1 1 
ATOM   5201  C  CD2 . TRP B  1 293 ? 27.264  17.493   94.651  1.00 19.78 ? 378  TRP B CD2 1 
ATOM   5202  N  NE1 . TRP B  1 293 ? 29.417  17.078   94.154  1.00 20.80 ? 378  TRP B NE1 1 
ATOM   5203  C  CE2 . TRP B  1 293 ? 28.138  16.957   93.674  1.00 20.49 ? 378  TRP B CE2 1 
ATOM   5204  C  CE3 . TRP B  1 293 ? 25.886  17.487   94.399  1.00 20.06 ? 378  TRP B CE3 1 
ATOM   5205  C  CZ2 . TRP B  1 293 ? 27.681  16.424   92.464  1.00 18.83 ? 378  TRP B CZ2 1 
ATOM   5206  C  CZ3 . TRP B  1 293 ? 25.427  16.955   93.190  1.00 19.26 ? 378  TRP B CZ3 1 
ATOM   5207  C  CH2 . TRP B  1 293 ? 26.326  16.432   92.240  1.00 18.36 ? 378  TRP B CH2 1 
ATOM   5208  N  N   . ASP B  1 294 ? 26.475  15.320   97.677  1.00 24.38 ? 379  ASP B N   1 
ATOM   5209  C  CA  . ASP B  1 294 ? 26.926  13.940   97.654  1.00 26.30 ? 379  ASP B CA  1 
ATOM   5210  C  C   . ASP B  1 294 ? 26.907  13.461   96.217  1.00 26.52 ? 379  ASP B C   1 
ATOM   5211  O  O   . ASP B  1 294 ? 25.893  12.959   95.743  1.00 27.62 ? 379  ASP B O   1 
ATOM   5212  C  CB  . ASP B  1 294 ? 26.010  13.062   98.510  1.00 26.17 ? 379  ASP B CB  1 
ATOM   5213  C  CG  . ASP B  1 294 ? 26.451  11.615   98.534  1.00 27.15 ? 379  ASP B CG  1 
ATOM   5214  O  OD1 . ASP B  1 294 ? 27.515  11.306   97.959  1.00 26.63 ? 379  ASP B OD1 1 
ATOM   5215  O  OD2 . ASP B  1 294 ? 25.734  10.788   99.132  1.00 28.36 ? 379  ASP B OD2 1 
ATOM   5216  N  N   . PRO B  1 295 ? 28.033  13.610   95.498  1.00 28.44 ? 380  PRO B N   1 
ATOM   5217  C  CA  . PRO B  1 295 ? 28.018  13.148   94.105  1.00 29.58 ? 380  PRO B CA  1 
ATOM   5218  C  C   . PRO B  1 295 ? 27.672  11.683   94.186  1.00 30.86 ? 380  PRO B C   1 
ATOM   5219  O  O   . PRO B  1 295 ? 27.710  11.109   95.270  1.00 32.16 ? 380  PRO B O   1 
ATOM   5220  C  CB  . PRO B  1 295 ? 29.453  13.380   93.652  1.00 27.60 ? 380  PRO B CB  1 
ATOM   5221  C  CG  . PRO B  1 295 ? 30.233  13.092   94.900  1.00 26.20 ? 380  PRO B CG  1 
ATOM   5222  C  CD  . PRO B  1 295 ? 29.419  13.794   95.974  1.00 27.53 ? 380  PRO B CD  1 
ATOM   5223  N  N   . ASN B  1 296 ? 27.316  11.075   93.070  1.00 32.70 ? 381  ASN B N   1 
ATOM   5224  C  CA  . ASN B  1 296 ? 26.986  9.656    93.103  1.00 36.53 ? 381  ASN B CA  1 
ATOM   5225  C  C   . ASN B  1 296 ? 26.474  9.284    94.502  1.00 36.35 ? 381  ASN B C   1 
ATOM   5226  O  O   . ASN B  1 296 ? 27.126  8.529    95.242  1.00 36.84 ? 381  ASN B O   1 
ATOM   5227  C  CB  . ASN B  1 296 ? 28.235  8.839    92.732  1.00 39.97 ? 381  ASN B CB  1 
ATOM   5228  C  CG  . ASN B  1 296 ? 28.927  9.369    91.459  1.00 43.27 ? 381  ASN B CG  1 
ATOM   5229  O  OD1 . ASN B  1 296 ? 28.331  9.391    90.373  1.00 44.03 ? 381  ASN B OD1 1 
ATOM   5230  N  ND2 . ASN B  1 296 ? 30.183  9.808    91.598  1.00 41.75 ? 381  ASN B ND2 1 
ATOM   5231  N  N   . GLY B  1 297 ? 25.317  9.863    94.848  1.00 34.56 ? 382  GLY B N   1 
ATOM   5232  C  CA  . GLY B  1 297 ? 24.667  9.644    96.134  1.00 33.07 ? 382  GLY B CA  1 
ATOM   5233  C  C   . GLY B  1 297 ? 23.138  9.616    96.044  1.00 33.40 ? 382  GLY B C   1 
ATOM   5234  O  O   . GLY B  1 297 ? 22.428  9.573    97.054  1.00 32.88 ? 382  GLY B O   1 
ATOM   5235  N  N   . TRP B  1 298 ? 22.626  9.649    94.821  1.00 32.00 ? 383  TRP B N   1 
ATOM   5236  C  CA  . TRP B  1 298 ? 21.192  9.595    94.574  1.00 30.86 ? 383  TRP B CA  1 
ATOM   5237  C  C   . TRP B  1 298 ? 20.827  8.146    94.281  1.00 31.72 ? 383  TRP B C   1 
ATOM   5238  O  O   . TRP B  1 298 ? 19.683  7.728    94.473  1.00 31.82 ? 383  TRP B O   1 
ATOM   5239  C  CB  . TRP B  1 298 ? 20.840  10.473   93.368  1.00 30.97 ? 383  TRP B CB  1 
ATOM   5240  C  CG  . TRP B  1 298 ? 19.437  10.319   92.854  1.00 29.17 ? 383  TRP B CG  1 
ATOM   5241  C  CD1 . TRP B  1 298 ? 18.965  9.323    92.058  1.00 29.40 ? 383  TRP B CD1 1 
ATOM   5242  C  CD2 . TRP B  1 298 ? 18.334  11.199   93.089  1.00 28.40 ? 383  TRP B CD2 1 
ATOM   5243  N  NE1 . TRP B  1 298 ? 17.636  9.521    91.785  1.00 28.40 ? 383  TRP B NE1 1 
ATOM   5244  C  CE2 . TRP B  1 298 ? 17.218  10.665   92.418  1.00 28.58 ? 383  TRP B CE2 1 
ATOM   5245  C  CE3 . TRP B  1 298 ? 18.167  12.380   93.825  1.00 28.21 ? 383  TRP B CE3 1 
ATOM   5246  C  CZ2 . TRP B  1 298 ? 15.965  11.279   92.428  1.00 27.60 ? 383  TRP B CZ2 1 
ATOM   5247  C  CZ3 . TRP B  1 298 ? 16.917  12.993   93.837  1.00 27.12 ? 383  TRP B CZ3 1 
ATOM   5248  C  CH2 . TRP B  1 298 ? 15.833  12.434   93.153  1.00 25.40 ? 383  TRP B CH2 1 
ATOM   5249  N  N   . THR B  1 299 ? 21.825  7.391    93.827  1.00 31.27 ? 384  THR B N   1 
ATOM   5250  C  CA  . THR B  1 299 ? 21.668  5.990    93.470  1.00 31.40 ? 384  THR B CA  1 
ATOM   5251  C  C   . THR B  1 299 ? 22.575  5.076    94.283  1.00 31.74 ? 384  THR B C   1 
ATOM   5252  O  O   . THR B  1 299 ? 22.430  3.861    94.241  1.00 32.89 ? 384  THR B O   1 
ATOM   5253  C  CB  . THR B  1 299 ? 22.008  5.770    91.991  1.00 32.16 ? 384  THR B CB  1 
ATOM   5254  O  OG1 . THR B  1 299 ? 23.379  6.119    91.763  1.00 31.59 ? 384  THR B OG1 1 
ATOM   5255  C  CG2 . THR B  1 299 ? 21.126  6.633    91.103  1.00 32.17 ? 384  THR B CG2 1 
ATOM   5256  N  N   . GLU B  1 300 ? 23.513  5.657    95.016  1.00 32.46 ? 385  GLU B N   1 
ATOM   5257  C  CA  . GLU B  1 300 ? 24.443  4.871    95.815  1.00 32.88 ? 385  GLU B CA  1 
ATOM   5258  C  C   . GLU B  1 300 ? 24.217  5.082    97.291  1.00 32.79 ? 385  GLU B C   1 
ATOM   5259  O  O   . GLU B  1 300 ? 23.551  6.026    97.692  1.00 34.00 ? 385  GLU B O   1 
ATOM   5260  C  CB  . GLU B  1 300 ? 25.889  5.253    95.493  1.00 33.71 ? 385  GLU B CB  1 
ATOM   5261  C  CG  . GLU B  1 300 ? 26.336  4.938    94.085  1.00 36.22 ? 385  GLU B CG  1 
ATOM   5262  C  CD  . GLU B  1 300 ? 26.160  3.479    93.744  1.00 38.98 ? 385  GLU B CD  1 
ATOM   5263  O  OE1 . GLU B  1 300 ? 26.514  2.618    94.583  1.00 40.17 ? 385  GLU B OE1 1 
ATOM   5264  O  OE2 . GLU B  1 300 ? 25.673  3.195    92.633  1.00 40.73 ? 385  GLU B OE2 1 
ATOM   5265  N  N   . THR B  1 301 ? 24.789  4.198    98.096  1.00 33.69 ? 386  THR B N   1 
ATOM   5266  C  CA  . THR B  1 301 ? 24.679  4.293    99.542  1.00 35.60 ? 386  THR B CA  1 
ATOM   5267  C  C   . THR B  1 301 ? 26.068  4.499    100.138 1.00 38.26 ? 386  THR B C   1 
ATOM   5268  O  O   . THR B  1 301 ? 26.948  3.658    99.974  1.00 41.84 ? 386  THR B O   1 
ATOM   5269  C  CB  . THR B  1 301 ? 24.126  3.011    100.167 1.00 35.45 ? 386  THR B CB  1 
ATOM   5270  O  OG1 . THR B  1 301 ? 22.824  2.716    99.646  1.00 31.60 ? 386  THR B OG1 1 
ATOM   5271  C  CG2 . THR B  1 301 ? 24.047  3.197    101.659 1.00 36.09 ? 386  THR B CG2 1 
ATOM   5272  N  N   . ASP B  1 302 ? 26.269  5.610    100.830 1.00 39.40 ? 387  ASP B N   1 
ATOM   5273  C  CA  . ASP B  1 302 ? 27.554  5.897    101.452 1.00 40.01 ? 387  ASP B CA  1 
ATOM   5274  C  C   . ASP B  1 302 ? 27.285  6.778    102.641 1.00 40.61 ? 387  ASP B C   1 
ATOM   5275  O  O   . ASP B  1 302 ? 26.155  6.931    103.063 1.00 43.52 ? 387  ASP B O   1 
ATOM   5276  C  CB  . ASP B  1 302 ? 28.477  6.653    100.495 1.00 41.45 ? 387  ASP B CB  1 
ATOM   5277  C  CG  . ASP B  1 302 ? 28.974  5.791    99.365  1.00 43.39 ? 387  ASP B CG  1 
ATOM   5278  O  OD1 . ASP B  1 302 ? 29.473  4.682    99.649  1.00 47.00 ? 387  ASP B OD1 1 
ATOM   5279  O  OD2 . ASP B  1 302 ? 28.880  6.219    98.196  1.00 43.39 ? 387  ASP B OD2 1 
ATOM   5280  N  N   . SER B  1 303 ? 28.338  7.355    103.188 1.00 40.54 ? 388  SER B N   1 
ATOM   5281  C  CA  . SER B  1 303 ? 28.210  8.268    104.307 1.00 39.46 ? 388  SER B CA  1 
ATOM   5282  C  C   . SER B  1 303 ? 29.136  9.367    103.858 1.00 38.78 ? 388  SER B C   1 
ATOM   5283  O  O   . SER B  1 303 ? 29.279  10.394   104.521 1.00 41.23 ? 388  SER B O   1 
ATOM   5284  C  CB  . SER B  1 303 ? 28.739  7.644    105.599 1.00 39.89 ? 388  SER B CB  1 
ATOM   5285  O  OG  . SER B  1 303 ? 28.074  6.430    105.899 1.00 41.41 ? 388  SER B OG  1 
ATOM   5286  N  N   . SER B  1 304 ? 29.764  9.130    102.708 1.00 36.98 ? 389  SER B N   1 
ATOM   5287  C  CA  . SER B  1 304 ? 30.712  10.077   102.143 1.00 36.03 ? 389  SER B CA  1 
ATOM   5288  C  C   . SER B  1 304 ? 30.122  10.938   101.046 1.00 34.01 ? 389  SER B C   1 
ATOM   5289  O  O   . SER B  1 304 ? 29.353  10.474   100.203 1.00 34.06 ? 389  SER B O   1 
ATOM   5290  C  CB  . SER B  1 304 ? 31.949  9.349    101.611 1.00 35.11 ? 389  SER B CB  1 
ATOM   5291  O  OG  . SER B  1 304 ? 31.633  8.596    100.459 1.00 36.64 ? 389  SER B OG  1 
ATOM   5292  N  N   . PHE B  1 305 ? 30.524  12.202   101.085 1.00 32.94 ? 390  PHE B N   1 
ATOM   5293  C  CA  . PHE B  1 305 ? 30.098  13.236   100.158 1.00 31.89 ? 390  PHE B CA  1 
ATOM   5294  C  C   . PHE B  1 305 ? 31.310  14.161   100.027 1.00 31.14 ? 390  PHE B C   1 
ATOM   5295  O  O   . PHE B  1 305 ? 32.283  13.986   100.756 1.00 29.60 ? 390  PHE B O   1 
ATOM   5296  C  CB  . PHE B  1 305 ? 28.914  13.981   100.769 1.00 31.77 ? 390  PHE B CB  1 
ATOM   5297  C  CG  . PHE B  1 305 ? 29.222  14.608   102.102 1.00 30.27 ? 390  PHE B CG  1 
ATOM   5298  C  CD1 . PHE B  1 305 ? 29.674  15.920   102.180 1.00 30.33 ? 390  PHE B CD1 1 
ATOM   5299  C  CD2 . PHE B  1 305 ? 29.087  13.877   103.278 1.00 29.79 ? 390  PHE B CD2 1 
ATOM   5300  C  CE1 . PHE B  1 305 ? 29.992  16.497   103.410 1.00 29.92 ? 390  PHE B CE1 1 
ATOM   5301  C  CE2 . PHE B  1 305 ? 29.402  14.444   104.512 1.00 30.22 ? 390  PHE B CE2 1 
ATOM   5302  C  CZ  . PHE B  1 305 ? 29.855  15.759   104.578 1.00 29.00 ? 390  PHE B CZ  1 
ATOM   5303  N  N   . SER B  1 306 ? 31.259  15.146   99.129  1.00 30.74 ? 391  SER B N   1 
ATOM   5304  C  CA  . SER B  1 306 ? 32.403  16.045   98.955  1.00 31.05 ? 391  SER B CA  1 
ATOM   5305  C  C   . SER B  1 306 ? 32.294  17.424   99.582  1.00 30.23 ? 391  SER B C   1 
ATOM   5306  O  O   . SER B  1 306 ? 33.281  17.934   100.103 1.00 30.69 ? 391  SER B O   1 
ATOM   5307  C  CB  . SER B  1 306 ? 32.745  16.233   97.470  1.00 30.51 ? 391  SER B CB  1 
ATOM   5308  O  OG  . SER B  1 306 ? 31.914  15.459   96.633  1.00 32.67 ? 391  SER B OG  1 
ATOM   5309  N  N   . VAL B  1 307 ? 31.114  18.034   99.532  1.00 29.24 ? 392  VAL B N   1 
ATOM   5310  C  CA  . VAL B  1 307 ? 30.964  19.371   100.086 1.00 27.64 ? 392  VAL B CA  1 
ATOM   5311  C  C   . VAL B  1 307 ? 29.845  19.555   101.095 1.00 27.92 ? 392  VAL B C   1 
ATOM   5312  O  O   . VAL B  1 307 ? 28.748  19.025   100.940 1.00 29.05 ? 392  VAL B O   1 
ATOM   5313  C  CB  . VAL B  1 307 ? 30.764  20.406   98.971  1.00 27.64 ? 392  VAL B CB  1 
ATOM   5314  C  CG1 . VAL B  1 307 ? 30.865  21.813   99.547  1.00 27.85 ? 392  VAL B CG1 1 
ATOM   5315  C  CG2 . VAL B  1 307 ? 31.797  20.201   97.888  1.00 25.81 ? 392  VAL B CG2 1 
ATOM   5316  N  N   . LYS B  1 308 ? 30.144  20.336   102.125 1.00 28.38 ? 394  LYS B N   1 
ATOM   5317  C  CA  . LYS B  1 308 ? 29.201  20.646   103.191 1.00 28.29 ? 394  LYS B CA  1 
ATOM   5318  C  C   . LYS B  1 308 ? 29.255  22.151   103.387 1.00 26.27 ? 394  LYS B C   1 
ATOM   5319  O  O   . LYS B  1 308 ? 30.305  22.681   103.732 1.00 27.61 ? 394  LYS B O   1 
ATOM   5320  C  CB  . LYS B  1 308 ? 29.629  19.969   104.493 1.00 30.21 ? 394  LYS B CB  1 
ATOM   5321  C  CG  . LYS B  1 308 ? 28.705  20.222   105.677 1.00 32.54 ? 394  LYS B CG  1 
ATOM   5322  C  CD  . LYS B  1 308 ? 29.436  19.951   106.977 1.00 37.43 ? 394  LYS B CD  1 
ATOM   5323  C  CE  . LYS B  1 308 ? 28.477  19.736   108.140 1.00 41.51 ? 394  LYS B CE  1 
ATOM   5324  N  NZ  . LYS B  1 308 ? 27.719  18.446   108.012 1.00 43.56 ? 394  LYS B NZ  1 
ATOM   5325  N  N   . GLN B  1 309 ? 28.140  22.834   103.156 1.00 23.36 ? 395  GLN B N   1 
ATOM   5326  C  CA  . GLN B  1 309 ? 28.084  24.280   103.337 1.00 20.82 ? 395  GLN B CA  1 
ATOM   5327  C  C   . GLN B  1 309 ? 27.077  24.632   104.427 1.00 20.55 ? 395  GLN B C   1 
ATOM   5328  O  O   . GLN B  1 309 ? 25.894  24.343   104.290 1.00 20.81 ? 395  GLN B O   1 
ATOM   5329  C  CB  . GLN B  1 309 ? 27.680  24.973   102.038 1.00 17.85 ? 395  GLN B CB  1 
ATOM   5330  C  CG  . GLN B  1 309 ? 27.585  26.481   102.190 1.00 15.31 ? 395  GLN B CG  1 
ATOM   5331  C  CD  . GLN B  1 309 ? 27.137  27.186   100.925 1.00 15.23 ? 395  GLN B CD  1 
ATOM   5332  O  OE1 . GLN B  1 309 ? 26.850  28.378   100.946 1.00 16.04 ? 395  GLN B OE1 1 
ATOM   5333  N  NE2 . GLN B  1 309 ? 27.085  26.459   99.816  1.00 13.63 ? 395  GLN B NE2 1 
ATOM   5334  N  N   . ASP B  1 310 ? 27.535  25.266   105.502 1.00 19.87 ? 396  ASP B N   1 
ATOM   5335  C  CA  . ASP B  1 310 ? 26.636  25.621   106.592 1.00 22.28 ? 396  ASP B CA  1 
ATOM   5336  C  C   . ASP B  1 310 ? 25.672  26.754   106.236 1.00 22.12 ? 396  ASP B C   1 
ATOM   5337  O  O   . ASP B  1 310 ? 25.986  27.627   105.436 1.00 22.08 ? 396  ASP B O   1 
ATOM   5338  C  CB  . ASP B  1 310 ? 27.432  25.999   107.842 1.00 25.62 ? 396  ASP B CB  1 
ATOM   5339  C  CG  . ASP B  1 310 ? 28.408  24.911   108.267 1.00 30.07 ? 396  ASP B CG  1 
ATOM   5340  O  OD1 . ASP B  1 310 ? 28.116  23.705   108.058 1.00 32.83 ? 396  ASP B OD1 1 
ATOM   5341  O  OD2 . ASP B  1 310 ? 29.468  25.262   108.830 1.00 30.60 ? 396  ASP B OD2 1 
ATOM   5342  N  N   . ILE B  1 311 ? 24.488  26.722   106.833 1.00 19.74 ? 397  ILE B N   1 
ATOM   5343  C  CA  . ILE B  1 311 ? 23.482  27.742   106.587 1.00 18.80 ? 397  ILE B CA  1 
ATOM   5344  C  C   . ILE B  1 311 ? 22.885  28.239   107.901 1.00 17.69 ? 397  ILE B C   1 
ATOM   5345  O  O   . ILE B  1 311 ? 22.580  29.417   108.039 1.00 17.41 ? 397  ILE B O   1 
ATOM   5346  C  CB  . ILE B  1 311 ? 22.402  27.189   105.660 1.00 20.67 ? 397  ILE B CB  1 
ATOM   5347  C  CG1 . ILE B  1 311 ? 23.047  26.909   104.304 1.00 21.06 ? 397  ILE B CG1 1 
ATOM   5348  C  CG2 . ILE B  1 311 ? 21.227  28.166   105.539 1.00 17.34 ? 397  ILE B CG2 1 
ATOM   5349  C  CD1 . ILE B  1 311 ? 22.209  26.060   103.418 1.00 25.90 ? 397  ILE B CD1 1 
ATOM   5350  N  N   . VAL B  1 312 ? 22.727  27.340   108.863 1.00 15.81 ? 398  VAL B N   1 
ATOM   5351  C  CA  . VAL B  1 312 ? 22.218  27.709   110.174 1.00 15.91 ? 398  VAL B CA  1 
ATOM   5352  C  C   . VAL B  1 312 ? 22.905  26.831   111.207 1.00 16.04 ? 398  VAL B C   1 
ATOM   5353  O  O   . VAL B  1 312 ? 22.882  25.608   111.105 1.00 15.70 ? 398  VAL B O   1 
ATOM   5354  C  CB  . VAL B  1 312 ? 20.681  27.520   110.299 1.00 15.59 ? 398  VAL B CB  1 
ATOM   5355  C  CG1 . VAL B  1 312 ? 20.224  27.990   111.675 1.00 13.48 ? 398  VAL B CG1 1 
ATOM   5356  C  CG2 . VAL B  1 312 ? 19.959  28.310   109.211 1.00 13.41 ? 398  VAL B CG2 1 
ATOM   5357  N  N   . ALA B  1 313 ? 23.522  27.464   112.197 1.00 17.49 ? 399  ALA B N   1 
ATOM   5358  C  CA  . ALA B  1 313 ? 24.226  26.744   113.245 1.00 17.88 ? 399  ALA B CA  1 
ATOM   5359  C  C   . ALA B  1 313 ? 23.304  25.759   113.961 1.00 19.06 ? 399  ALA B C   1 
ATOM   5360  O  O   . ALA B  1 313 ? 22.096  25.987   114.086 1.00 16.74 ? 399  ALA B O   1 
ATOM   5361  C  CB  . ALA B  1 313 ? 24.819  27.737   114.240 1.00 17.44 ? 399  ALA B CB  1 
ATOM   5362  N  N   . ILE B  1 314 ? 23.883  24.660   114.430 1.00 20.88 ? 400  ILE B N   1 
ATOM   5363  C  CA  . ILE B  1 314 ? 23.115  23.647   115.130 1.00 24.72 ? 400  ILE B CA  1 
ATOM   5364  C  C   . ILE B  1 314 ? 22.480  24.312   116.347 1.00 24.71 ? 400  ILE B C   1 
ATOM   5365  O  O   . ILE B  1 314 ? 21.423  23.894   116.820 1.00 24.25 ? 400  ILE B O   1 
ATOM   5366  C  CB  . ILE B  1 314 ? 24.035  22.474   115.578 1.00 28.78 ? 400  ILE B CB  1 
ATOM   5367  C  CG1 . ILE B  1 314 ? 24.952  22.076   114.410 1.00 34.77 ? 400  ILE B CG1 1 
ATOM   5368  C  CG2 . ILE B  1 314 ? 23.192  21.251   115.979 1.00 28.53 ? 400  ILE B CG2 1 
ATOM   5369  C  CD1 . ILE B  1 314 ? 26.066  21.049   114.747 1.00 38.13 ? 400  ILE B CD1 1 
ATOM   5370  N  N   . THR B  1 315 ? 23.118  25.373   116.832 1.00 24.65 ? 401  THR B N   1 
ATOM   5371  C  CA  . THR B  1 315 ? 22.620  26.086   118.004 1.00 25.37 ? 401  THR B CA  1 
ATOM   5372  C  C   . THR B  1 315 ? 21.378  26.935   117.804 1.00 24.78 ? 401  THR B C   1 
ATOM   5373  O  O   . THR B  1 315 ? 20.850  27.478   118.769 1.00 25.87 ? 401  THR B O   1 
ATOM   5374  C  CB  . THR B  1 315 ? 23.689  27.001   118.588 1.00 26.28 ? 401  THR B CB  1 
ATOM   5375  O  OG1 . THR B  1 315 ? 24.236  27.820   117.543 1.00 25.97 ? 401  THR B OG1 1 
ATOM   5376  C  CG2 . THR B  1 315 ? 24.783  26.174   119.253 1.00 26.30 ? 401  THR B CG2 1 
ATOM   5377  N  N   . ASP B  1 316 ? 20.916  27.064   116.567 1.00 23.81 ? 402  ASP B N   1 
ATOM   5378  C  CA  . ASP B  1 316 ? 19.729  27.872   116.289 1.00 23.55 ? 402  ASP B CA  1 
ATOM   5379  C  C   . ASP B  1 316 ? 18.636  27.033   115.634 1.00 22.57 ? 402  ASP B C   1 
ATOM   5380  O  O   . ASP B  1 316 ? 18.916  26.002   115.023 1.00 23.57 ? 402  ASP B O   1 
ATOM   5381  C  CB  . ASP B  1 316 ? 20.094  29.050   115.379 1.00 24.17 ? 402  ASP B CB  1 
ATOM   5382  C  CG  . ASP B  1 316 ? 21.056  30.023   116.040 1.00 25.62 ? 402  ASP B CG  1 
ATOM   5383  O  OD1 . ASP B  1 316 ? 20.616  30.801   116.911 1.00 24.62 ? 402  ASP B OD1 1 
ATOM   5384  O  OD2 . ASP B  1 316 ? 22.259  30.006   115.690 1.00 28.49 ? 402  ASP B OD2 1 
ATOM   5385  N  N   . TRP B  1 317 ? 17.394  27.481   115.754 1.00 20.75 ? 403  TRP B N   1 
ATOM   5386  C  CA  . TRP B  1 317 ? 16.272  26.756   115.183 1.00 20.10 ? 403  TRP B CA  1 
ATOM   5387  C  C   . TRP B  1 317 ? 16.117  26.956   113.683 1.00 20.64 ? 403  TRP B C   1 
ATOM   5388  O  O   . TRP B  1 317 ? 16.425  28.022   113.152 1.00 23.05 ? 403  TRP B O   1 
ATOM   5389  C  CB  . TRP B  1 317 ? 14.981  27.189   115.865 1.00 20.92 ? 403  TRP B CB  1 
ATOM   5390  C  CG  . TRP B  1 317 ? 14.987  26.947   117.335 1.00 21.84 ? 403  TRP B CG  1 
ATOM   5391  C  CD1 . TRP B  1 317 ? 15.091  27.882   118.323 1.00 20.69 ? 403  TRP B CD1 1 
ATOM   5392  C  CD2 . TRP B  1 317 ? 14.956  25.674   117.987 1.00 22.23 ? 403  TRP B CD2 1 
ATOM   5393  N  NE1 . TRP B  1 317 ? 15.132  27.270   119.553 1.00 21.86 ? 403  TRP B NE1 1 
ATOM   5394  C  CE2 . TRP B  1 317 ? 15.054  25.913   119.376 1.00 22.35 ? 403  TRP B CE2 1 
ATOM   5395  C  CE3 . TRP B  1 317 ? 14.864  24.351   117.531 1.00 21.36 ? 403  TRP B CE3 1 
ATOM   5396  C  CZ2 . TRP B  1 317 ? 15.061  24.879   120.318 1.00 23.07 ? 403  TRP B CZ2 1 
ATOM   5397  C  CZ3 . TRP B  1 317 ? 14.872  23.319   118.467 1.00 22.69 ? 403  TRP B CZ3 1 
ATOM   5398  C  CH2 . TRP B  1 317 ? 14.972  23.590   119.845 1.00 23.34 ? 403  TRP B CH2 1 
ATOM   5399  N  N   . SER B  1 318 ? 15.659  25.914   112.997 1.00 18.93 ? 404  SER B N   1 
ATOM   5400  C  CA  . SER B  1 318 ? 15.401  25.993   111.563 1.00 16.56 ? 404  SER B CA  1 
ATOM   5401  C  C   . SER B  1 318 ? 14.000  25.416   111.430 1.00 14.45 ? 404  SER B C   1 
ATOM   5402  O  O   . SER B  1 318 ? 13.180  25.623   112.310 1.00 17.01 ? 404  SER B O   1 
ATOM   5403  C  CB  . SER B  1 318 ? 16.430  25.190   110.749 1.00 17.10 ? 404  SER B CB  1 
ATOM   5404  O  OG  . SER B  1 318 ? 16.492  23.825   111.132 1.00 17.22 ? 404  SER B OG  1 
ATOM   5405  N  N   . GLY B  1 319 ? 13.710  24.697   110.358 1.00 12.48 ? 405  GLY B N   1 
ATOM   5406  C  CA  . GLY B  1 319 ? 12.381  24.138   110.203 1.00 9.75  ? 405  GLY B CA  1 
ATOM   5407  C  C   . GLY B  1 319 ? 12.203  23.645   108.788 1.00 9.43  ? 405  GLY B C   1 
ATOM   5408  O  O   . GLY B  1 319 ? 13.109  23.043   108.217 1.00 10.83 ? 405  GLY B O   1 
ATOM   5409  N  N   . TYR B  1 320 ? 11.040  23.899   108.209 1.00 8.59  ? 406  TYR B N   1 
ATOM   5410  C  CA  . TYR B  1 320 ? 10.778  23.467   106.845 1.00 8.63  ? 406  TYR B CA  1 
ATOM   5411  C  C   . TYR B  1 320 ? 11.757  24.122   105.892 1.00 7.26  ? 406  TYR B C   1 
ATOM   5412  O  O   . TYR B  1 320 ? 12.315  25.166   106.179 1.00 8.65  ? 406  TYR B O   1 
ATOM   5413  C  CB  . TYR B  1 320 ? 9.361   23.861   106.424 1.00 9.28  ? 406  TYR B CB  1 
ATOM   5414  C  CG  . TYR B  1 320 ? 8.271   22.945   106.906 1.00 12.43 ? 406  TYR B CG  1 
ATOM   5415  C  CD1 . TYR B  1 320 ? 8.468   22.101   107.997 1.00 12.39 ? 406  TYR B CD1 1 
ATOM   5416  C  CD2 . TYR B  1 320 ? 7.019   22.939   106.278 1.00 13.33 ? 406  TYR B CD2 1 
ATOM   5417  C  CE1 . TYR B  1 320 ? 7.443   21.267   108.452 1.00 15.36 ? 406  TYR B CE1 1 
ATOM   5418  C  CE2 . TYR B  1 320 ? 5.995   22.116   106.718 1.00 13.99 ? 406  TYR B CE2 1 
ATOM   5419  C  CZ  . TYR B  1 320 ? 6.211   21.278   107.805 1.00 16.32 ? 406  TYR B CZ  1 
ATOM   5420  O  OH  . TYR B  1 320 ? 5.211   20.424   108.225 1.00 17.22 ? 406  TYR B OH  1 
ATOM   5421  N  N   . SER B  1 321 ? 11.961  23.503   104.749 1.00 6.26  ? 407  SER B N   1 
ATOM   5422  C  CA  . SER B  1 321 ? 12.836  24.068   103.745 1.00 7.30  ? 407  SER B CA  1 
ATOM   5423  C  C   . SER B  1 321 ? 12.234  23.553   102.469 1.00 7.94  ? 407  SER B C   1 
ATOM   5424  O  O   . SER B  1 321 ? 11.550  22.537   102.476 1.00 9.17  ? 407  SER B O   1 
ATOM   5425  C  CB  . SER B  1 321 ? 14.269  23.560   103.902 1.00 7.80  ? 407  SER B CB  1 
ATOM   5426  O  OG  . SER B  1 321 ? 14.323  22.164   103.729 1.00 8.71  ? 407  SER B OG  1 
ATOM   5427  N  N   . GLY B  1 322 ? 12.458  24.253   101.371 1.00 8.78  ? 408  GLY B N   1 
ATOM   5428  C  CA  . GLY B  1 322 ? 11.887  23.789   100.132 1.00 9.93  ? 408  GLY B CA  1 
ATOM   5429  C  C   . GLY B  1 322 ? 12.603  24.381   98.956  1.00 11.85 ? 408  GLY B C   1 
ATOM   5430  O  O   . GLY B  1 322 ? 13.288  25.390   99.073  1.00 13.14 ? 408  GLY B O   1 
ATOM   5431  N  N   . SER B  1 323 ? 12.440  23.754   97.806  1.00 12.64 ? 409  SER B N   1 
ATOM   5432  C  CA  . SER B  1 323 ? 13.092  24.251   96.623  1.00 15.91 ? 409  SER B CA  1 
ATOM   5433  C  C   . SER B  1 323 ? 12.178  25.145   95.811  1.00 16.81 ? 409  SER B C   1 
ATOM   5434  O  O   . SER B  1 323 ? 10.965  24.977   95.812  1.00 16.86 ? 409  SER B O   1 
ATOM   5435  C  CB  . SER B  1 323 ? 13.526  23.091   95.728  1.00 15.53 ? 409  SER B CB  1 
ATOM   5436  O  OG  . SER B  1 323 ? 12.389  22.431   95.193  1.00 15.45 ? 409  SER B OG  1 
ATOM   5437  N  N   . PHE B  1 324 ? 12.775  26.126   95.152  1.00 17.38 ? 410  PHE B N   1 
ATOM   5438  C  CA  . PHE B  1 324 ? 12.034  26.958   94.237  1.00 18.02 ? 410  PHE B CA  1 
ATOM   5439  C  C   . PHE B  1 324 ? 12.967  27.151   93.060  1.00 19.60 ? 410  PHE B C   1 
ATOM   5440  O  O   . PHE B  1 324 ? 14.155  26.821   93.124  1.00 18.41 ? 410  PHE B O   1 
ATOM   5441  C  CB  . PHE B  1 324 ? 11.553  28.286   94.849  1.00 17.39 ? 410  PHE B CB  1 
ATOM   5442  C  CG  . PHE B  1 324 ? 12.633  29.282   95.158  1.00 16.54 ? 410  PHE B CG  1 
ATOM   5443  C  CD1 . PHE B  1 324 ? 13.306  29.249   96.376  1.00 15.97 ? 410  PHE B CD1 1 
ATOM   5444  C  CD2 . PHE B  1 324 ? 12.888  30.332   94.283  1.00 15.99 ? 410  PHE B CD2 1 
ATOM   5445  C  CE1 . PHE B  1 324 ? 14.209  30.251   96.718  1.00 14.85 ? 410  PHE B CE1 1 
ATOM   5446  C  CE2 . PHE B  1 324 ? 13.793  31.341   94.616  1.00 15.73 ? 410  PHE B CE2 1 
ATOM   5447  C  CZ  . PHE B  1 324 ? 14.447  31.303   95.832  1.00 15.15 ? 410  PHE B CZ  1 
ATOM   5448  N  N   . VAL B  1 325 ? 12.457  27.628   91.964  1.00 20.72 ? 411  VAL B N   1 
ATOM   5449  C  CA  . VAL B  1 325 ? 13.268  27.745   90.727  1.00 21.29 ? 411  VAL B CA  1 
ATOM   5450  C  C   . VAL B  1 325 ? 13.256  29.173   90.236  1.00 21.97 ? 411  VAL B C   1 
ATOM   5451  O  O   . VAL B  1 325 ? 12.436  29.886   90.722  1.00 25.28 ? 411  VAL B O   1 
ATOM   5452  C  CB  . VAL B  1 325 ? 12.640  26.872   89.584  1.00 20.76 ? 411  VAL B CB  1 
ATOM   5453  C  CG1 . VAL B  1 325 ? 12.866  27.031   88.392  1.00 22.47 ? 411  VAL B CG1 1 
ATOM   5454  C  CG2 . VAL B  1 325 ? 14.051  25.597   90.041  1.00 19.99 ? 411  VAL B CG2 1 
ATOM   5455  N  N   . GLN B  1 326 ? 14.103  29.453   89.253  1.00 24.82 ? 412  GLN B N   1 
ATOM   5456  C  CA  . GLN B  1 326 ? 14.270  30.694   88.514  1.00 23.73 ? 412  GLN B CA  1 
ATOM   5457  C  C   . GLN B  1 326 ? 14.309  30.179   87.033  1.00 23.19 ? 412  GLN B C   1 
ATOM   5458  O  O   . GLN B  1 326 ? 14.977  29.141   86.827  1.00 23.17 ? 412  GLN B O   1 
ATOM   5459  C  CB  . GLN B  1 326 ? 15.538  31.567   88.779  1.00 24.43 ? 412  GLN B CB  1 
ATOM   5460  C  CG  . GLN B  1 326 ? 15.128  32.276   90.253  1.00 24.26 ? 412  GLN B CG  1 
ATOM   5461  C  CD  . GLN B  1 326 ? 15.983  33.445   90.644  1.00 25.70 ? 412  GLN B CD  1 
ATOM   5462  O  OE1 . GLN B  1 326 ? 17.098  33.633   90.146  1.00 25.30 ? 412  GLN B OE1 1 
ATOM   5463  N  NE2 . GLN B  1 326 ? 15.478  34.231   91.577  1.00 26.64 ? 412  GLN B NE2 1 
ATOM   5464  N  N   . HIS B  1 327 A 13.480  30.614   86.299  1.00 23.08 ? 412  HIS B N   1 
ATOM   5465  C  CA  . HIS B  1 327 A 13.547  30.232   84.907  1.00 24.34 ? 412  HIS B CA  1 
ATOM   5466  C  C   . HIS B  1 327 A 14.373  31.210   84.080  1.00 24.38 ? 412  HIS B C   1 
ATOM   5467  O  O   . HIS B  1 327 A 14.610  32.347   84.467  1.00 25.31 ? 412  HIS B O   1 
ATOM   5468  C  CB  . HIS B  1 327 A 12.129  30.099   84.305  1.00 24.68 ? 412  HIS B CB  1 
ATOM   5469  C  CG  . HIS B  1 327 A 11.433  28.832   84.680  1.00 24.64 ? 412  HIS B CG  1 
ATOM   5470  N  ND1 . HIS B  1 327 A 11.255  27.788   83.783  1.00 23.45 ? 412  HIS B ND1 1 
ATOM   5471  C  CD2 . HIS B  1 327 A 10.918  28.406   85.852  1.00 24.62 ? 412  HIS B CD2 1 
ATOM   5472  C  CE1 . HIS B  1 327 A 10.667  26.789   84.401  1.00 27.44 ? 412  HIS B CE1 1 
ATOM   5473  N  NE2 . HIS B  1 327 A 10.447  27.130   85.663  1.00 26.91 ? 412  HIS B NE2 1 
ATOM   5474  N  N   . PRO B  1 328 B 14.841  30.749   82.927  1.00 23.73 ? 412  PRO B N   1 
ATOM   5475  C  CA  . PRO B  1 328 B 15.632  31.535   81.991  1.00 23.83 ? 412  PRO B CA  1 
ATOM   5476  C  C   . PRO B  1 328 B 14.787  32.708   81.533  1.00 23.47 ? 412  PRO B C   1 
ATOM   5477  O  O   . PRO B  1 328 B 15.317  33.752   81.260  1.00 22.94 ? 412  PRO B O   1 
ATOM   5478  C  CB  . PRO B  1 328 B 15.955  30.545   80.863  1.00 22.40 ? 412  PRO B CB  1 
ATOM   5479  C  CG  . PRO B  1 328 B 15.450  29.211   81.358  1.00 22.64 ? 412  PRO B CG  1 
ATOM   5480  C  CD  . PRO B  1 328 B 15.209  29.337   82.822  1.00 24.52 ? 412  PRO B CD  1 
ATOM   5481  N  N   . GLU B  1 329 C 13.465  32.582   81.483  1.00 24.32 ? 412  GLU B N   1 
ATOM   5482  C  CA  . GLU B  1 329 C 12.695  33.752   81.036  1.00 26.06 ? 412  GLU B CA  1 
ATOM   5483  C  C   . GLU B  1 329 C 12.715  34.887   82.059  1.00 24.65 ? 412  GLU B C   1 
ATOM   5484  O  O   . GLU B  1 329 C 12.208  35.972   81.812  1.00 24.99 ? 412  GLU B O   1 
ATOM   5485  C  CB  . GLU B  1 329 C 11.226  33.424   80.687  1.00 28.22 ? 412  GLU B CB  1 
ATOM   5486  C  CG  . GLU B  1 329 C 10.890  31.976   80.642  1.00 34.71 ? 412  GLU B CG  1 
ATOM   5487  C  CD  . GLU B  1 329 C 10.219  31.487   79.320  1.00 39.14 ? 412  GLU B CD  1 
ATOM   5488  O  OE1 . GLU B  1 329 C 9.140   31.994   78.910  1.00 44.20 ? 412  GLU B OE1 1 
ATOM   5489  O  OE2 . GLU B  1 329 C 10.788  30.584   78.661  1.00 37.81 ? 412  GLU B OE2 1 
ATOM   5490  N  N   . LEU B  1 330 D 13.304  34.636   83.216  1.00 23.99 ? 412  LEU B N   1 
ATOM   5491  C  CA  . LEU B  1 330 D 13.410  35.650   84.269  1.00 21.78 ? 412  LEU B CA  1 
ATOM   5492  C  C   . LEU B  1 330 D 14.870  36.027   84.452  1.00 21.88 ? 412  LEU B C   1 
ATOM   5493  O  O   . LEU B  1 330 D 15.209  37.169   84.739  1.00 22.92 ? 412  LEU B O   1 
ATOM   5494  C  CB  . LEU B  1 330 D 12.911  35.084   85.598  1.00 21.68 ? 412  LEU B CB  1 
ATOM   5495  C  CG  . LEU B  1 330 D 13.329  35.841   86.866  1.00 20.77 ? 412  LEU B CG  1 
ATOM   5496  C  CD1 . LEU B  1 330 D 12.476  37.082   86.997  1.00 18.33 ? 412  LEU B CD1 1 
ATOM   5497  C  CD2 . LEU B  1 330 D 13.142  34.950   88.091  1.00 20.22 ? 412  LEU B CD2 1 
ATOM   5498  N  N   . THR B  1 331 ? 15.735  35.050   84.240  1.00 21.30 ? 413  THR B N   1 
ATOM   5499  C  CA  . THR B  1 331 ? 17.153  35.224   84.458  1.00 20.78 ? 413  THR B CA  1 
ATOM   5500  C  C   . THR B  1 331 ? 18.017  35.605   83.270  1.00 21.88 ? 413  THR B C   1 
ATOM   5501  O  O   . THR B  1 331 ? 19.032  36.300   83.428  1.00 20.63 ? 413  THR B O   1 
ATOM   5502  C  CB  . THR B  1 331 ? 17.694  33.946   85.087  1.00 20.28 ? 413  THR B CB  1 
ATOM   5503  O  OG1 . THR B  1 331 ? 17.158  33.810   86.409  1.00 19.73 ? 413  THR B OG1 1 
ATOM   5504  C  CG2 . THR B  1 331 ? 19.192  33.971   85.144  1.00 24.54 ? 413  THR B CG2 1 
ATOM   5505  N  N   . GLY B  1 332 ? 17.615  35.155   82.089  1.00 21.49 ? 414  GLY B N   1 
ATOM   5506  C  CA  . GLY B  1 332 ? 18.396  35.433   80.907  1.00 22.13 ? 414  GLY B CA  1 
ATOM   5507  C  C   . GLY B  1 332 ? 19.400  34.311   80.754  1.00 23.68 ? 414  GLY B C   1 
ATOM   5508  O  O   . GLY B  1 332 ? 20.032  34.168   79.711  1.00 24.13 ? 414  GLY B O   1 
ATOM   5509  N  N   . LEU B  1 333 ? 19.550  33.519   81.812  1.00 25.54 ? 415  LEU B N   1 
ATOM   5510  C  CA  . LEU B  1 333 ? 20.448  32.373   81.808  1.00 26.86 ? 415  LEU B CA  1 
ATOM   5511  C  C   . LEU B  1 333 ? 19.917  31.369   80.786  1.00 28.24 ? 415  LEU B C   1 
ATOM   5512  O  O   . LEU B  1 333 ? 18.805  31.511   80.279  1.00 28.98 ? 415  LEU B O   1 
ATOM   5513  C  CB  . LEU B  1 333 ? 20.486  31.731   83.201  1.00 27.12 ? 415  LEU B CB  1 
ATOM   5514  C  CG  . LEU B  1 333 ? 21.722  31.967   84.080  1.00 27.27 ? 415  LEU B CG  1 
ATOM   5515  C  CD1 . LEU B  1 333 ? 22.303  33.350   83.821  1.00 24.95 ? 415  LEU B CD1 1 
ATOM   5516  C  CD2 . LEU B  1 333 ? 21.347  31.777   85.544  1.00 24.15 ? 415  LEU B CD2 1 
ATOM   5517  N  N   . ASP B  1 334 ? 20.708  30.350   80.488  1.00 30.18 ? 416  ASP B N   1 
ATOM   5518  C  CA  . ASP B  1 334 ? 20.306  29.338   79.517  1.00 32.67 ? 416  ASP B CA  1 
ATOM   5519  C  C   . ASP B  1 334 ? 19.968  28.031   80.227  1.00 32.67 ? 416  ASP B C   1 
ATOM   5520  O  O   . ASP B  1 334 ? 19.862  26.981   79.603  1.00 32.77 ? 416  ASP B O   1 
ATOM   5521  C  CB  . ASP B  1 334 ? 21.444  29.101   78.534  1.00 35.74 ? 416  ASP B CB  1 
ATOM   5522  C  CG  . ASP B  1 334 ? 22.688  28.573   79.218  1.00 40.40 ? 416  ASP B CG  1 
ATOM   5523  O  OD1 . ASP B  1 334 ? 23.165  29.220   80.185  1.00 43.49 ? 416  ASP B OD1 1 
ATOM   5524  O  OD2 . ASP B  1 334 ? 23.186  27.510   78.793  1.00 43.13 ? 416  ASP B OD2 1 
ATOM   5525  N  N   . CYS B  1 335 ? 19.800  28.109   81.541  1.00 32.69 ? 417  CYS B N   1 
ATOM   5526  C  CA  . CYS B  1 335 ? 19.486  26.947   82.353  1.00 31.67 ? 417  CYS B CA  1 
ATOM   5527  C  C   . CYS B  1 335 ? 18.548  27.346   83.488  1.00 29.89 ? 417  CYS B C   1 
ATOM   5528  O  O   . CYS B  1 335 ? 18.275  28.528   83.699  1.00 30.26 ? 417  CYS B O   1 
ATOM   5529  C  CB  . CYS B  1 335 ? 20.777  26.369   82.925  1.00 32.64 ? 417  CYS B CB  1 
ATOM   5530  S  SG  . CYS B  1 335 ? 21.823  27.670   83.651  1.00 40.46 ? 417  CYS B SG  1 
ATOM   5531  N  N   . ILE B  1 336 ? 18.047  26.350   84.209  1.00 28.01 ? 418  ILE B N   1 
ATOM   5532  C  CA  . ILE B  1 336 ? 17.150  26.591   85.326  1.00 24.85 ? 418  ILE B CA  1 
ATOM   5533  C  C   . ILE B  1 336 ? 17.967  26.747   86.598  1.00 24.17 ? 418  ILE B C   1 
ATOM   5534  O  O   . ILE B  1 336 ? 18.804  25.912   86.920  1.00 22.98 ? 418  ILE B O   1 
ATOM   5535  C  CB  . ILE B  1 336 ? 16.131  25.436   85.472  1.00 24.37 ? 418  ILE B CB  1 
ATOM   5536  C  CG1 . ILE B  1 336 ? 15.173  25.464   84.282  1.00 24.58 ? 418  ILE B CG1 1 
ATOM   5537  C  CG2 . ILE B  1 336 ? 15.349  25.558   86.777  1.00 22.25 ? 418  ILE B CG2 1 
ATOM   5538  C  CD1 . ILE B  1 336 ? 14.110  24.397   84.323  1.00 24.99 ? 418  ILE B CD1 1 
ATOM   5539  N  N   . ARG B  1 337 ? 17.709  27.834   87.314  1.00 24.48 ? 419  ARG B N   1 
ATOM   5540  C  CA  . ARG B  1 337 ? 18.407  28.159   88.550  1.00 23.89 ? 419  ARG B CA  1 
ATOM   5541  C  C   . ARG B  1 337 ? 17.754  27.518   89.758  1.00 23.01 ? 419  ARG B C   1 
ATOM   5542  O  O   . ARG B  1 337 ? 16.625  27.851   90.113  1.00 22.25 ? 419  ARG B O   1 
ATOM   5543  C  CB  . ARG B  1 337 ? 18.398  29.668   88.744  1.00 27.46 ? 419  ARG B CB  1 
ATOM   5544  C  CG  . ARG B  1 337 ? 19.748  30.308   88.806  1.00 30.38 ? 419  ARG B CG  1 
ATOM   5545  C  CD  . ARG B  1 337 ? 20.115  30.643   90.222  1.00 31.83 ? 419  ARG B CD  1 
ATOM   5546  N  NE  . ARG B  1 337 ? 21.394  31.334   90.241  1.00 36.18 ? 419  ARG B NE  1 
ATOM   5547  C  CZ  . ARG B  1 337 ? 21.585  32.565   89.783  1.00 35.35 ? 419  ARG B CZ  1 
ATOM   5548  N  NH1 . ARG B  1 337 ? 20.576  33.252   89.275  1.00 34.76 ? 419  ARG B NH1 1 
ATOM   5549  N  NH2 . ARG B  1 337 ? 22.796  33.098   89.818  1.00 38.16 ? 419  ARG B NH2 1 
ATOM   5550  N  N   . PRO B  1 338 ? 18.449  26.580   90.406  1.00 22.06 ? 420  PRO B N   1 
ATOM   5551  C  CA  . PRO B  1 338 ? 17.865  25.940   91.585  1.00 20.22 ? 420  PRO B CA  1 
ATOM   5552  C  C   . PRO B  1 338 ? 18.111  26.863   92.773  1.00 19.81 ? 420  PRO B C   1 
ATOM   5553  O  O   . PRO B  1 338 ? 19.177  27.463   92.882  1.00 20.54 ? 420  PRO B O   1 
ATOM   5554  C  CB  . PRO B  1 338 ? 18.655  24.647   91.693  1.00 19.94 ? 420  PRO B CB  1 
ATOM   5555  C  CG  . PRO B  1 338 ? 20.034  25.094   91.257  1.00 20.85 ? 420  PRO B CG  1 
ATOM   5556  C  CD  . PRO B  1 338 ? 19.735  25.957   90.043  1.00 21.42 ? 420  PRO B CD  1 
ATOM   5557  N  N   . CYS B  1 339 ? 17.124  26.997   93.645  1.00 17.79 ? 421  CYS B N   1 
ATOM   5558  C  CA  . CYS B  1 339 ? 17.264  27.841   94.820  1.00 17.64 ? 421  CYS B CA  1 
ATOM   5559  C  C   . CYS B  1 339 ? 16.468  27.149   95.901  1.00 16.34 ? 421  CYS B C   1 
ATOM   5560  O  O   . CYS B  1 339 ? 15.727  26.213   95.624  1.00 17.48 ? 421  CYS B O   1 
ATOM   5561  C  CB  . CYS B  1 339 ? 16.647  29.220   94.598  1.00 18.03 ? 421  CYS B CB  1 
ATOM   5562  S  SG  . CYS B  1 339 ? 17.221  30.184   93.170  1.00 22.98 ? 421  CYS B SG  1 
ATOM   5563  N  N   . PHE B  1 340 ? 16.613  27.599   97.134  1.00 14.73 ? 422  PHE B N   1 
ATOM   5564  C  CA  . PHE B  1 340 ? 15.832  27.009   98.195  1.00 14.60 ? 422  PHE B CA  1 
ATOM   5565  C  C   . PHE B  1 340 ? 15.573  28.024   99.288  1.00 14.63 ? 422  PHE B C   1 
ATOM   5566  O  O   . PHE B  1 340 ? 16.215  29.070   99.345  1.00 15.55 ? 422  PHE B O   1 
ATOM   5567  C  CB  . PHE B  1 340 ? 16.524  25.768   98.748  1.00 13.74 ? 422  PHE B CB  1 
ATOM   5568  C  CG  . PHE B  1 340 ? 17.785  26.048   99.485  1.00 12.47 ? 422  PHE B CG  1 
ATOM   5569  C  CD1 . PHE B  1 340 ? 17.762  26.268   100.855 1.00 11.74 ? 422  PHE B CD1 1 
ATOM   5570  C  CD2 . PHE B  1 340 ? 19.005  26.072   98.813  1.00 10.07 ? 422  PHE B CD2 1 
ATOM   5571  C  CE1 . PHE B  1 340 ? 18.945  26.511   101.555 1.00 12.11 ? 422  PHE B CE1 1 
ATOM   5572  C  CE2 . PHE B  1 340 ? 20.185  26.313   99.494  1.00 10.63 ? 422  PHE B CE2 1 
ATOM   5573  C  CZ  . PHE B  1 340 ? 20.161  26.534   100.874 1.00 10.47 ? 422  PHE B CZ  1 
ATOM   5574  N  N   . TRP B  1 341 ? 14.600  27.728   100.136 1.00 13.75 ? 423  TRP B N   1 
ATOM   5575  C  CA  . TRP B  1 341 ? 14.271  28.622   101.227 1.00 14.12 ? 423  TRP B CA  1 
ATOM   5576  C  C   . TRP B  1 341 ? 14.259  27.805   102.489 1.00 13.39 ? 423  TRP B C   1 
ATOM   5577  O  O   . TRP B  1 341 ? 14.016  26.610   102.445 1.00 15.57 ? 423  TRP B O   1 
ATOM   5578  C  CB  . TRP B  1 341 ? 12.891  29.247   101.012 1.00 12.64 ? 423  TRP B CB  1 
ATOM   5579  C  CG  . TRP B  1 341 ? 11.805  28.241   100.709 1.00 14.37 ? 423  TRP B CG  1 
ATOM   5580  C  CD1 . TRP B  1 341 ? 11.338  27.880   99.472  1.00 14.06 ? 423  TRP B CD1 1 
ATOM   5581  C  CD2 . TRP B  1 341 ? 11.040  27.488   101.658 1.00 12.38 ? 423  TRP B CD2 1 
ATOM   5582  N  NE1 . TRP B  1 341 ? 10.328  26.957   99.598  1.00 13.67 ? 423  TRP B NE1 1 
ATOM   5583  C  CE2 . TRP B  1 341 ? 10.121  26.701   100.933 1.00 12.51 ? 423  TRP B CE2 1 
ATOM   5584  C  CE3 . TRP B  1 341 ? 11.036  27.409   103.057 1.00 13.44 ? 423  TRP B CE3 1 
ATOM   5585  C  CZ2 . TRP B  1 341 ? 9.207   25.842   101.549 1.00 13.02 ? 423  TRP B CZ2 1 
ATOM   5586  C  CZ3 . TRP B  1 341 ? 10.125  26.553   103.678 1.00 15.15 ? 423  TRP B CZ3 1 
ATOM   5587  C  CH2 . TRP B  1 341 ? 9.221   25.783   102.919 1.00 14.29 ? 423  TRP B CH2 1 
ATOM   5588  N  N   . VAL B  1 342 ? 14.547  28.439   103.612 1.00 13.44 ? 424  VAL B N   1 
ATOM   5589  C  CA  . VAL B  1 342 ? 14.506  27.737   104.877 1.00 14.30 ? 424  VAL B CA  1 
ATOM   5590  C  C   . VAL B  1 342 ? 13.613  28.485   105.849 1.00 14.38 ? 424  VAL B C   1 
ATOM   5591  O  O   . VAL B  1 342 ? 13.674  29.710   105.949 1.00 16.53 ? 424  VAL B O   1 
ATOM   5592  C  CB  . VAL B  1 342 ? 15.893  27.585   105.521 1.00 12.60 ? 424  VAL B CB  1 
ATOM   5593  C  CG1 . VAL B  1 342 ? 15.739  26.867   106.847 1.00 10.36 ? 424  VAL B CG1 1 
ATOM   5594  C  CG2 . VAL B  1 342 ? 16.829  26.803   104.601 1.00 12.76 ? 424  VAL B CG2 1 
ATOM   5595  N  N   . GLU B  1 343 ? 12.777  27.733   106.551 1.00 14.47 ? 425  GLU B N   1 
ATOM   5596  C  CA  . GLU B  1 343 ? 11.872  28.289   107.539 1.00 15.87 ? 425  GLU B CA  1 
ATOM   5597  C  C   . GLU B  1 343 ? 12.556  28.214   108.908 1.00 16.05 ? 425  GLU B C   1 
ATOM   5598  O  O   . GLU B  1 343 ? 13.001  27.148   109.329 1.00 17.46 ? 425  GLU B O   1 
ATOM   5599  C  CB  . GLU B  1 343 ? 10.561  27.486   107.556 1.00 15.94 ? 425  GLU B CB  1 
ATOM   5600  C  CG  . GLU B  1 343 ? 9.586   27.924   108.653 1.00 16.61 ? 425  GLU B CG  1 
ATOM   5601  C  CD  . GLU B  1 343 ? 8.306   27.096   108.702 1.00 17.25 ? 425  GLU B CD  1 
ATOM   5602  O  OE1 . GLU B  1 343 ? 8.384   25.856   108.588 1.00 16.64 ? 425  GLU B OE1 1 
ATOM   5603  O  OE2 . GLU B  1 343 ? 7.216   27.688   108.874 1.00 18.65 ? 425  GLU B OE2 1 
ATOM   5604  N  N   . LEU B  1 344 ? 12.658  29.343   109.594 1.00 15.73 ? 426  LEU B N   1 
ATOM   5605  C  CA  . LEU B  1 344 ? 13.289  29.351   110.905 1.00 16.93 ? 426  LEU B CA  1 
ATOM   5606  C  C   . LEU B  1 344 ? 12.163  29.440   111.907 1.00 18.58 ? 426  LEU B C   1 
ATOM   5607  O  O   . LEU B  1 344 ? 11.666  30.528   112.207 1.00 19.94 ? 426  LEU B O   1 
ATOM   5608  C  CB  . LEU B  1 344 ? 14.224  30.551   111.044 1.00 16.73 ? 426  LEU B CB  1 
ATOM   5609  C  CG  . LEU B  1 344 ? 15.293  30.687   109.949 1.00 18.26 ? 426  LEU B CG  1 
ATOM   5610  C  CD1 . LEU B  1 344 ? 16.112  31.948   110.188 1.00 17.46 ? 426  LEU B CD1 1 
ATOM   5611  C  CD2 . LEU B  1 344 ? 16.196  29.451   109.942 1.00 17.60 ? 426  LEU B CD2 1 
ATOM   5612  N  N   . ILE B  1 345 ? 11.757  28.286   112.419 1.00 18.56 ? 427  ILE B N   1 
ATOM   5613  C  CA  . ILE B  1 345 ? 10.652  28.219   113.355 1.00 19.42 ? 427  ILE B CA  1 
ATOM   5614  C  C   . ILE B  1 345 ? 10.986  28.605   114.787 1.00 19.80 ? 427  ILE B C   1 
ATOM   5615  O  O   . ILE B  1 345 ? 11.918  28.066   115.386 1.00 19.79 ? 427  ILE B O   1 
ATOM   5616  C  CB  . ILE B  1 345 ? 10.036  26.808   113.363 1.00 19.93 ? 427  ILE B CB  1 
ATOM   5617  C  CG1 . ILE B  1 345 ? 9.592   26.428   111.948 1.00 20.88 ? 427  ILE B CG1 1 
ATOM   5618  C  CG2 . ILE B  1 345 ? 8.853   26.767   114.315 1.00 18.58 ? 427  ILE B CG2 1 
ATOM   5619  C  CD1 . ILE B  1 345 ? 9.249   24.953   111.787 1.00 21.89 ? 427  ILE B CD1 1 
ATOM   5620  N  N   . ARG B  1 346 ? 10.204  29.533   115.331 1.00 19.53 ? 428  ARG B N   1 
ATOM   5621  C  CA  . ARG B  1 346 ? 10.385  29.982   116.703 1.00 20.16 ? 428  ARG B CA  1 
ATOM   5622  C  C   . ARG B  1 346 ? 9.102   29.729   117.483 1.00 21.75 ? 428  ARG B C   1 
ATOM   5623  O  O   . ARG B  1 346 ? 8.012   29.656   116.900 1.00 23.31 ? 428  ARG B O   1 
ATOM   5624  C  CB  . ARG B  1 346 ? 10.723  31.473   116.749 1.00 17.96 ? 428  ARG B CB  1 
ATOM   5625  C  CG  . ARG B  1 346 ? 12.052  31.819   116.131 1.00 16.35 ? 428  ARG B CG  1 
ATOM   5626  C  CD  . ARG B  1 346 ? 13.179  30.996   116.729 1.00 15.43 ? 428  ARG B CD  1 
ATOM   5627  N  NE  . ARG B  1 346 ? 13.429  31.273   118.146 1.00 16.55 ? 428  ARG B NE  1 
ATOM   5628  C  CZ  . ARG B  1 346 ? 14.119  32.316   118.611 1.00 16.74 ? 428  ARG B CZ  1 
ATOM   5629  N  NH1 . ARG B  1 346 ? 14.291  32.468   119.914 1.00 16.35 ? 428  ARG B NH1 1 
ATOM   5630  N  NH2 . ARG B  1 346 ? 14.636  33.214   117.784 1.00 16.03 ? 428  ARG B NH2 1 
ATOM   5631  N  N   . GLY B  1 347 ? 9.234   29.597   118.799 1.00 21.97 ? 429  GLY B N   1 
ATOM   5632  C  CA  . GLY B  1 347 ? 8.075   29.359   119.635 1.00 22.84 ? 429  GLY B CA  1 
ATOM   5633  C  C   . GLY B  1 347 ? 7.857   27.887   119.929 1.00 24.29 ? 429  GLY B C   1 
ATOM   5634  O  O   . GLY B  1 347 ? 8.805   27.104   120.058 1.00 23.80 ? 429  GLY B O   1 
ATOM   5635  N  N   . ARG B  1 348 ? 6.594   27.503   120.033 1.00 25.93 ? 430  ARG B N   1 
ATOM   5636  C  CA  . ARG B  1 348 ? 6.253   26.121   120.322 1.00 27.32 ? 430  ARG B CA  1 
ATOM   5637  C  C   . ARG B  1 348 ? 6.595   25.196   119.157 1.00 27.32 ? 430  ARG B C   1 
ATOM   5638  O  O   . ARG B  1 348 ? 6.615   25.610   118.000 1.00 27.24 ? 430  ARG B O   1 
ATOM   5639  C  CB  . ARG B  1 348 ? 4.775   26.033   120.699 1.00 27.57 ? 430  ARG B CB  1 
ATOM   5640  C  CG  . ARG B  1 348 ? 4.505   26.691   122.037 1.00 31.60 ? 430  ARG B CG  1 
ATOM   5641  C  CD  . ARG B  1 348 ? 3.043   27.007   122.252 1.00 36.45 ? 430  ARG B CD  1 
ATOM   5642  N  NE  . ARG B  1 348 ? 2.205   25.816   122.195 1.00 41.29 ? 430  ARG B NE  1 
ATOM   5643  C  CZ  . ARG B  1 348 ? 0.908   25.798   122.496 1.00 43.37 ? 430  ARG B CZ  1 
ATOM   5644  N  NH1 . ARG B  1 348 ? 0.295   26.915   122.881 1.00 43.52 ? 430  ARG B NH1 1 
ATOM   5645  N  NH2 . ARG B  1 348 ? 0.224   24.661   122.414 1.00 43.70 ? 430  ARG B NH2 1 
ATOM   5646  N  N   . PRO B  1 349 ? 6.862   23.919   119.455 1.00 27.57 ? 431  PRO B N   1 
ATOM   5647  C  CA  . PRO B  1 349 ? 6.846   23.373   120.814 1.00 28.11 ? 431  PRO B CA  1 
ATOM   5648  C  C   . PRO B  1 349 ? 8.172   23.489   121.553 1.00 28.28 ? 431  PRO B C   1 
ATOM   5649  O  O   . PRO B  1 349 ? 8.245   23.190   122.734 1.00 29.39 ? 431  PRO B O   1 
ATOM   5650  C  CB  . PRO B  1 349 ? 6.480   21.924   120.574 1.00 27.50 ? 431  PRO B CB  1 
ATOM   5651  C  CG  . PRO B  1 349 ? 7.318   21.622   119.355 1.00 27.38 ? 431  PRO B CG  1 
ATOM   5652  C  CD  . PRO B  1 349 ? 7.063   22.844   118.466 1.00 27.14 ? 431  PRO B CD  1 
ATOM   5653  N  N   . LYS B  1 350 ? 9.219   23.925   120.869 1.00 28.24 ? 432  LYS B N   1 
ATOM   5654  C  CA  . LYS B  1 350 ? 10.528  24.018   121.500 1.00 28.77 ? 432  LYS B CA  1 
ATOM   5655  C  C   . LYS B  1 350 ? 10.780  25.127   122.510 1.00 28.55 ? 432  LYS B C   1 
ATOM   5656  O  O   . LYS B  1 350 ? 11.608  24.966   123.408 1.00 28.35 ? 432  LYS B O   1 
ATOM   5657  C  CB  . LYS B  1 350 ? 11.607  24.065   120.424 1.00 29.07 ? 432  LYS B CB  1 
ATOM   5658  C  CG  . LYS B  1 350 ? 11.760  22.745   119.708 1.00 31.70 ? 432  LYS B CG  1 
ATOM   5659  C  CD  . LYS B  1 350 ? 12.143  21.664   120.702 1.00 34.19 ? 432  LYS B CD  1 
ATOM   5660  C  CE  . LYS B  1 350 ? 12.238  20.308   120.045 1.00 36.25 ? 432  LYS B CE  1 
ATOM   5661  N  NZ  . LYS B  1 350 ? 12.686  19.284   121.031 1.00 38.59 ? 432  LYS B NZ  1 
ATOM   5662  N  N   . GLU B  1 351 ? 10.079  26.247   122.381 1.00 28.54 ? 433  GLU B N   1 
ATOM   5663  C  CA  . GLU B  1 351 ? 10.298  27.357   123.299 1.00 28.17 ? 433  GLU B CA  1 
ATOM   5664  C  C   . GLU B  1 351 ? 9.080   27.689   124.147 1.00 28.01 ? 433  GLU B C   1 
ATOM   5665  O  O   . GLU B  1 351 ? 7.949   27.440   123.748 1.00 27.22 ? 433  GLU B O   1 
ATOM   5666  C  CB  . GLU B  1 351 ? 10.773  28.573   122.502 1.00 28.19 ? 433  GLU B CB  1 
ATOM   5667  C  CG  . GLU B  1 351 ? 12.133  28.319   121.845 1.00 28.58 ? 433  GLU B CG  1 
ATOM   5668  C  CD  . GLU B  1 351 ? 12.500  29.329   120.770 1.00 29.16 ? 433  GLU B CD  1 
ATOM   5669  O  OE1 . GLU B  1 351 ? 11.941  29.255   119.651 1.00 26.38 ? 433  GLU B OE1 1 
ATOM   5670  O  OE2 . GLU B  1 351 ? 13.354  30.196   121.050 1.00 29.62 ? 433  GLU B OE2 1 
ATOM   5671  N  N   . SER B  1 352 ? 9.322   28.254   125.324 1.00 28.94 ? 435  SER B N   1 
ATOM   5672  C  CA  . SER B  1 352 ? 8.240   28.595   126.239 1.00 29.96 ? 435  SER B CA  1 
ATOM   5673  C  C   . SER B  1 352 ? 7.428   29.848   125.881 1.00 28.97 ? 435  SER B C   1 
ATOM   5674  O  O   . SER B  1 352 ? 7.521   30.883   126.549 1.00 31.03 ? 435  SER B O   1 
ATOM   5675  C  CB  . SER B  1 352 ? 8.795   28.713   127.667 1.00 30.74 ? 435  SER B CB  1 
ATOM   5676  O  OG  . SER B  1 352 ? 9.920   29.580   127.699 1.00 36.13 ? 435  SER B OG  1 
ATOM   5677  N  N   . THR B  1 353 ? 6.632   29.744   124.821 1.00 26.82 ? 436  THR B N   1 
ATOM   5678  C  CA  . THR B  1 353 ? 5.767   30.837   124.389 1.00 24.75 ? 436  THR B CA  1 
ATOM   5679  C  C   . THR B  1 353 ? 4.408   30.215   124.109 1.00 24.10 ? 436  THR B C   1 
ATOM   5680  O  O   . THR B  1 353 ? 4.242   29.000   124.222 1.00 23.86 ? 436  THR B O   1 
ATOM   5681  C  CB  . THR B  1 353 ? 6.246   31.504   123.083 1.00 24.06 ? 436  THR B CB  1 
ATOM   5682  O  OG1 . THR B  1 353 ? 6.091   30.587   121.993 1.00 22.26 ? 436  THR B OG1 1 
ATOM   5683  C  CG2 . THR B  1 353 ? 7.695   31.929   123.200 1.00 23.36 ? 436  THR B CG2 1 
ATOM   5684  N  N   . ILE B  1 354 ? 3.439   31.037   123.731 1.00 21.51 ? 437  ILE B N   1 
ATOM   5685  C  CA  . ILE B  1 354 ? 2.118   30.515   123.445 1.00 19.38 ? 437  ILE B CA  1 
ATOM   5686  C  C   . ILE B  1 354 ? 1.887   30.436   121.943 1.00 18.95 ? 437  ILE B C   1 
ATOM   5687  O  O   . ILE B  1 354 ? 0.832   30.003   121.496 1.00 19.93 ? 437  ILE B O   1 
ATOM   5688  C  CB  . ILE B  1 354 ? 1.020   31.410   124.046 1.00 19.66 ? 437  ILE B CB  1 
ATOM   5689  C  CG1 . ILE B  1 354 ? 1.012   32.767   123.340 1.00 21.27 ? 437  ILE B CG1 1 
ATOM   5690  C  CG2 . ILE B  1 354 ? 1.253   31.597   125.532 1.00 18.76 ? 437  ILE B CG2 1 
ATOM   5691  C  CD1 . ILE B  1 354 ? -0.121  33.695   123.782 1.00 22.06 ? 437  ILE B CD1 1 
ATOM   5692  N  N   . TRP B  1 355 ? 2.874   30.847   121.159 1.00 17.52 ? 438  TRP B N   1 
ATOM   5693  C  CA  . TRP B  1 355 ? 2.721   30.856   119.710 1.00 16.31 ? 438  TRP B CA  1 
ATOM   5694  C  C   . TRP B  1 355 ? 3.841   30.156   118.968 1.00 16.54 ? 438  TRP B C   1 
ATOM   5695  O  O   . TRP B  1 355 ? 4.820   29.701   119.555 1.00 17.19 ? 438  TRP B O   1 
ATOM   5696  C  CB  . TRP B  1 355 ? 2.657   32.292   119.221 1.00 17.00 ? 438  TRP B CB  1 
ATOM   5697  C  CG  . TRP B  1 355 ? 3.806   33.082   119.751 1.00 16.76 ? 438  TRP B CG  1 
ATOM   5698  C  CD1 . TRP B  1 355 ? 3.885   33.691   120.964 1.00 16.19 ? 438  TRP B CD1 1 
ATOM   5699  C  CD2 . TRP B  1 355 ? 5.075   33.273   119.120 1.00 16.30 ? 438  TRP B CD2 1 
ATOM   5700  N  NE1 . TRP B  1 355 ? 5.125   34.253   121.133 1.00 17.17 ? 438  TRP B NE1 1 
ATOM   5701  C  CE2 . TRP B  1 355 ? 5.879   34.013   120.016 1.00 16.58 ? 438  TRP B CE2 1 
ATOM   5702  C  CE3 . TRP B  1 355 ? 5.613   32.890   117.883 1.00 16.50 ? 438  TRP B CE3 1 
ATOM   5703  C  CZ2 . TRP B  1 355 ? 7.198   34.381   119.718 1.00 16.22 ? 438  TRP B CZ2 1 
ATOM   5704  C  CZ3 . TRP B  1 355 ? 6.933   33.257   117.581 1.00 18.32 ? 438  TRP B CZ3 1 
ATOM   5705  C  CH2 . TRP B  1 355 ? 7.707   33.997   118.500 1.00 18.12 ? 438  TRP B CH2 1 
ATOM   5706  N  N   . THR B  1 356 ? 3.685   30.101   117.655 1.00 15.32 ? 439  THR B N   1 
ATOM   5707  C  CA  . THR B  1 356 ? 4.653   29.467   116.786 1.00 16.63 ? 439  THR B CA  1 
ATOM   5708  C  C   . THR B  1 356 ? 4.604   30.231   115.485 1.00 17.65 ? 439  THR B C   1 
ATOM   5709  O  O   . THR B  1 356 ? 3.530   30.449   114.936 1.00 18.72 ? 439  THR B O   1 
ATOM   5710  C  CB  . THR B  1 356 ? 4.274   27.986   116.524 1.00 16.89 ? 439  THR B CB  1 
ATOM   5711  O  OG1 . THR B  1 356 ? 4.525   27.226   117.710 1.00 17.79 ? 439  THR B OG1 1 
ATOM   5712  C  CG2 . THR B  1 356 ? 5.073   27.403   115.354 1.00 13.12 ? 439  THR B CG2 1 
ATOM   5713  N  N   . SER B  1 357 ? 5.764   30.646   114.997 1.00 18.28 ? 440  SER B N   1 
ATOM   5714  C  CA  . SER B  1 357 ? 5.832   31.385   113.742 1.00 19.53 ? 440  SER B CA  1 
ATOM   5715  C  C   . SER B  1 357 ? 7.233   31.221   113.178 1.00 20.58 ? 440  SER B C   1 
ATOM   5716  O  O   . SER B  1 357 ? 8.165   30.887   113.916 1.00 20.59 ? 440  SER B O   1 
ATOM   5717  C  CB  . SER B  1 357 ? 5.522   32.868   113.984 1.00 17.36 ? 440  SER B CB  1 
ATOM   5718  O  OG  . SER B  1 357 ? 5.431   33.583   112.767 1.00 15.56 ? 440  SER B OG  1 
ATOM   5719  N  N   . GLY B  1 358 ? 7.393   31.456   111.880 1.00 21.09 ? 441  GLY B N   1 
ATOM   5720  C  CA  . GLY B  1 358 ? 8.714   31.309   111.302 1.00 21.98 ? 441  GLY B CA  1 
ATOM   5721  C  C   . GLY B  1 358 ? 9.203   32.424   110.396 1.00 21.58 ? 441  GLY B C   1 
ATOM   5722  O  O   . GLY B  1 358 ? 8.417   33.083   109.722 1.00 20.85 ? 441  GLY B O   1 
ATOM   5723  N  N   . SER B  1 359 ? 10.516  32.640   110.409 1.00 21.49 ? 442  SER B N   1 
ATOM   5724  C  CA  . SER B  1 359 ? 11.158  33.634   109.565 1.00 22.20 ? 442  SER B CA  1 
ATOM   5725  C  C   . SER B  1 359 ? 11.632  32.819   108.388 1.00 21.91 ? 442  SER B C   1 
ATOM   5726  O  O   . SER B  1 359 ? 11.569  31.592   108.419 1.00 22.74 ? 442  SER B O   1 
ATOM   5727  C  CB  . SER B  1 359 ? 12.383  34.245   110.239 1.00 24.33 ? 442  SER B CB  1 
ATOM   5728  O  OG  . SER B  1 359 ? 12.027  34.988   111.379 1.00 32.03 ? 442  SER B OG  1 
ATOM   5729  N  N   . SER B  1 360 ? 12.135  33.485   107.362 1.00 20.28 ? 443  SER B N   1 
ATOM   5730  C  CA  . SER B  1 360 ? 12.602  32.762   106.202 1.00 20.10 ? 443  SER B CA  1 
ATOM   5731  C  C   . SER B  1 360 ? 13.921  33.318   105.732 1.00 19.10 ? 443  SER B C   1 
ATOM   5732  O  O   . SER B  1 360 ? 14.244  34.473   105.991 1.00 18.67 ? 443  SER B O   1 
ATOM   5733  C  CB  . SER B  1 360 ? 11.586  32.875   105.066 1.00 22.10 ? 443  SER B CB  1 
ATOM   5734  O  OG  . SER B  1 360 ? 11.549  34.203   104.562 1.00 21.65 ? 443  SER B OG  1 
ATOM   5735  N  N   . ILE B  1 361 ? 14.677  32.470   105.050 1.00 18.07 ? 444  ILE B N   1 
ATOM   5736  C  CA  . ILE B  1 361 ? 15.959  32.837   104.468 1.00 18.19 ? 444  ILE B CA  1 
ATOM   5737  C  C   . ILE B  1 361 ? 15.981  32.059   103.164 1.00 17.79 ? 444  ILE B C   1 
ATOM   5738  O  O   . ILE B  1 361 ? 15.290  31.052   103.046 1.00 20.14 ? 444  ILE B O   1 
ATOM   5739  C  CB  . ILE B  1 361 ? 17.161  32.408   105.374 1.00 18.39 ? 444  ILE B CB  1 
ATOM   5740  C  CG1 . ILE B  1 361 ? 16.966  30.972   105.879 1.00 18.89 ? 444  ILE B CG1 1 
ATOM   5741  C  CG2 . ILE B  1 361 ? 17.311  33.377   106.540 1.00 15.70 ? 444  ILE B CG2 1 
ATOM   5742  C  CD1 . ILE B  1 361 ? 18.180  30.401   106.609 1.00 17.49 ? 444  ILE B CD1 1 
ATOM   5743  N  N   . SER B  1 362 ? 16.724  32.521   102.168 1.00 18.09 ? 445  SER B N   1 
ATOM   5744  C  CA  . SER B  1 362 ? 16.783  31.783   100.907 1.00 17.44 ? 445  SER B CA  1 
ATOM   5745  C  C   . SER B  1 362 ? 18.127  31.944   100.237 1.00 17.26 ? 445  SER B C   1 
ATOM   5746  O  O   . SER B  1 362 ? 18.816  32.936   100.448 1.00 17.32 ? 445  SER B O   1 
ATOM   5747  C  CB  . SER B  1 362 ? 15.677  32.233   99.955  1.00 18.57 ? 445  SER B CB  1 
ATOM   5748  O  OG  . SER B  1 362 ? 15.838  33.585   99.574  1.00 20.34 ? 445  SER B OG  1 
ATOM   5749  N  N   . PHE B  1 363 ? 18.495  30.945   99.443  1.00 17.85 ? 446  PHE B N   1 
ATOM   5750  C  CA  . PHE B  1 363 ? 19.764  30.928   98.727  1.00 17.94 ? 446  PHE B CA  1 
ATOM   5751  C  C   . PHE B  1 363 ? 19.556  30.417   97.308  1.00 19.37 ? 446  PHE B C   1 
ATOM   5752  O  O   . PHE B  1 363 ? 18.603  29.679   97.048  1.00 19.24 ? 446  PHE B O   1 
ATOM   5753  C  CB  . PHE B  1 363 ? 20.751  29.994   99.423  1.00 14.36 ? 446  PHE B CB  1 
ATOM   5754  C  CG  . PHE B  1 363 ? 20.957  30.294   100.865 1.00 12.78 ? 446  PHE B CG  1 
ATOM   5755  C  CD1 . PHE B  1 363 ? 19.956  30.035   101.796 1.00 14.38 ? 446  PHE B CD1 1 
ATOM   5756  C  CD2 . PHE B  1 363 ? 22.151  30.844   101.303 1.00 12.79 ? 446  PHE B CD2 1 
ATOM   5757  C  CE1 . PHE B  1 363 ? 20.145  30.322   103.153 1.00 12.81 ? 446  PHE B CE1 1 
ATOM   5758  C  CE2 . PHE B  1 363 ? 22.353  31.134   102.649 1.00 12.09 ? 446  PHE B CE2 1 
ATOM   5759  C  CZ  . PHE B  1 363 ? 21.345  30.874   103.577 1.00 11.79 ? 446  PHE B CZ  1 
ATOM   5760  N  N   . CYS B  1 364 ? 20.443  30.802   96.392  1.00 20.80 ? 447  CYS B N   1 
ATOM   5761  C  CA  . CYS B  1 364 ? 20.343  30.320   95.019  1.00 24.21 ? 447  CYS B CA  1 
ATOM   5762  C  C   . CYS B  1 364 ? 21.632  29.673   94.521  1.00 26.31 ? 447  CYS B C   1 
ATOM   5763  O  O   . CYS B  1 364 ? 22.712  29.926   95.058  1.00 26.21 ? 447  CYS B O   1 
ATOM   5764  C  CB  . CYS B  1 364 ? 19.947  31.442   94.067  1.00 23.69 ? 447  CYS B CB  1 
ATOM   5765  S  SG  . CYS B  1 364 ? 18.159  31.821   93.995  1.00 31.83 ? 447  CYS B SG  1 
ATOM   5766  N  N   . GLY B  1 365 ? 21.482  28.844   93.485  1.00 28.22 ? 448  GLY B N   1 
ATOM   5767  C  CA  . GLY B  1 365 ? 22.576  28.123   92.851  1.00 28.97 ? 448  GLY B CA  1 
ATOM   5768  C  C   . GLY B  1 365 ? 23.907  28.831   92.812  1.00 30.68 ? 448  GLY B C   1 
ATOM   5769  O  O   . GLY B  1 365 ? 24.569  28.928   93.833  1.00 33.37 ? 448  GLY B O   1 
ATOM   5770  N  N   . VAL B  1 366 ? 24.328  29.298   91.644  1.00 31.65 ? 449  VAL B N   1 
ATOM   5771  C  CA  . VAL B  1 366 ? 25.604  30.017   91.529  1.00 32.23 ? 449  VAL B CA  1 
ATOM   5772  C  C   . VAL B  1 366 ? 26.863  29.196   91.216  1.00 33.49 ? 449  VAL B C   1 
ATOM   5773  O  O   . VAL B  1 366 ? 27.150  28.169   91.838  1.00 31.51 ? 449  VAL B O   1 
ATOM   5774  C  CB  . VAL B  1 366 ? 25.864  30.876   92.797  1.00 30.56 ? 449  VAL B CB  1 
ATOM   5775  C  CG1 . VAL B  1 366 ? 27.315  31.291   92.879  1.00 31.09 ? 449  VAL B CG1 1 
ATOM   5776  C  CG2 . VAL B  1 366 ? 24.968  32.105   92.767  1.00 30.26 ? 449  VAL B CG2 1 
ATOM   5777  N  N   . ASN B  1 367 ? 27.612  29.701   90.238  1.00 35.86 ? 450  ASN B N   1 
ATOM   5778  C  CA  . ASN B  1 367 ? 28.856  29.105   89.759  1.00 37.60 ? 450  ASN B CA  1 
ATOM   5779  C  C   . ASN B  1 367 ? 30.039  29.622   90.575  1.00 36.62 ? 450  ASN B C   1 
ATOM   5780  O  O   . ASN B  1 367 ? 30.946  28.865   90.914  1.00 35.25 ? 450  ASN B O   1 
ATOM   5781  C  CB  . ASN B  1 367 ? 29.065  29.471   88.288  1.00 42.47 ? 450  ASN B CB  1 
ATOM   5782  C  CG  . ASN B  1 367 ? 27.955  28.951   87.385  1.00 47.61 ? 450  ASN B CG  1 
ATOM   5783  O  OD1 . ASN B  1 367 ? 26.771  28.969   87.748  1.00 51.99 ? 450  ASN B OD1 1 
ATOM   5784  N  ND2 . ASN B  1 367 ? 28.331  28.502   86.188  1.00 49.40 ? 450  ASN B ND2 1 
ATOM   5785  N  N   . SER B  1 368 ? 30.030  30.923   90.855  1.00 36.07 ? 451  SER B N   1 
ATOM   5786  C  CA  . SER B  1 368 ? 31.069  31.574   91.649  1.00 34.78 ? 451  SER B CA  1 
ATOM   5787  C  C   . SER B  1 368 ? 31.062  30.904   93.017  1.00 35.47 ? 451  SER B C   1 
ATOM   5788  O  O   . SER B  1 368 ? 30.260  29.998   93.239  1.00 36.64 ? 451  SER B O   1 
ATOM   5789  C  CB  . SER B  1 368 ? 30.742  33.054   91.772  1.00 34.98 ? 451  SER B CB  1 
ATOM   5790  O  OG  . SER B  1 368 ? 29.352  33.264   91.592  1.00 32.79 ? 451  SER B OG  1 
ATOM   5791  N  N   . ASP B  1 369 ? 31.920  31.305   93.950  1.00 35.18 ? 452  ASP B N   1 
ATOM   5792  C  CA  . ASP B  1 369 ? 31.859  30.595   95.225  1.00 36.14 ? 452  ASP B CA  1 
ATOM   5793  C  C   . ASP B  1 369 ? 31.151  31.352   96.317  1.00 33.32 ? 452  ASP B C   1 
ATOM   5794  O  O   . ASP B  1 369 ? 30.874  32.530   96.193  1.00 32.01 ? 452  ASP B O   1 
ATOM   5795  C  CB  . ASP B  1 369 ? 33.248  30.156   95.716  1.00 39.86 ? 452  ASP B CB  1 
ATOM   5796  C  CG  . ASP B  1 369 ? 33.198  28.869   96.550  1.00 42.50 ? 452  ASP B CG  1 
ATOM   5797  O  OD1 . ASP B  1 369 ? 32.827  27.811   95.984  1.00 44.21 ? 452  ASP B OD1 1 
ATOM   5798  O  OD2 . ASP B  1 369 ? 33.525  28.911   97.762  1.00 43.55 ? 452  ASP B OD2 1 
ATOM   5799  N  N   . THR B  1 370 ? 30.850  30.637   97.389  1.00 32.11 ? 453  THR B N   1 
ATOM   5800  C  CA  . THR B  1 370 ? 30.150  31.208   98.508  1.00 30.32 ? 453  THR B CA  1 
ATOM   5801  C  C   . THR B  1 370 ? 30.903  30.883   99.767  1.00 28.00 ? 453  THR B C   1 
ATOM   5802  O  O   . THR B  1 370 ? 32.085  30.562   99.733  1.00 27.70 ? 453  THR B O   1 
ATOM   5803  C  CB  . THR B  1 370 ? 28.741  30.615   98.624  1.00 33.05 ? 453  THR B CB  1 
ATOM   5804  O  OG1 . THR B  1 370 ? 28.244  30.323   97.310  1.00 30.81 ? 453  THR B OG1 1 
ATOM   5805  C  CG2 . THR B  1 370 ? 27.792  31.619   99.345  1.00 32.95 ? 453  THR B CG2 1 
ATOM   5806  N  N   . VAL B  1 371 ? 30.197  30.979   100.884 1.00 26.53 ? 454  VAL B N   1 
ATOM   5807  C  CA  . VAL B  1 371 ? 30.765  30.686   102.180 1.00 25.24 ? 454  VAL B CA  1 
ATOM   5808  C  C   . VAL B  1 371 ? 29.652  30.101   102.988 1.00 23.75 ? 454  VAL B C   1 
ATOM   5809  O  O   . VAL B  1 371 ? 28.482  30.389   102.743 1.00 24.51 ? 454  VAL B O   1 
ATOM   5810  C  CB  . VAL B  1 371 ? 31.193  31.939   102.935 1.00 25.07 ? 454  VAL B CB  1 
ATOM   5811  C  CG1 . VAL B  1 371 ? 32.336  31.600   103.873 1.00 23.19 ? 454  VAL B CG1 1 
ATOM   5812  C  CG2 . VAL B  1 371 ? 31.542  33.031   101.971 1.00 28.05 ? 454  VAL B CG2 1 
ATOM   5813  N  N   . GLY B  1 372 ? 30.023  29.279   103.955 1.00 22.88 ? 455  GLY B N   1 
ATOM   5814  C  CA  . GLY B  1 372 ? 29.038  28.708   104.837 1.00 22.03 ? 455  GLY B CA  1 
ATOM   5815  C  C   . GLY B  1 372 ? 29.014  29.683   105.991 1.00 21.83 ? 455  GLY B C   1 
ATOM   5816  O  O   . GLY B  1 372 ? 30.006  30.361   106.246 1.00 22.21 ? 455  GLY B O   1 
ATOM   5817  N  N   . TRP B  1 373 ? 27.888  29.779   106.677 1.00 22.20 ? 456  TRP B N   1 
ATOM   5818  C  CA  . TRP B  1 373 ? 27.778  30.676   107.814 1.00 22.98 ? 456  TRP B CA  1 
ATOM   5819  C  C   . TRP B  1 373 ? 26.468  30.328   108.497 1.00 23.47 ? 456  TRP B C   1 
ATOM   5820  O  O   . TRP B  1 373 ? 25.871  29.292   108.199 1.00 25.72 ? 456  TRP B O   1 
ATOM   5821  C  CB  . TRP B  1 373 ? 27.758  32.136   107.343 1.00 23.18 ? 456  TRP B CB  1 
ATOM   5822  C  CG  . TRP B  1 373 ? 28.205  33.120   108.405 1.00 22.10 ? 456  TRP B CG  1 
ATOM   5823  C  CD1 . TRP B  1 373 ? 29.175  32.919   109.347 1.00 21.59 ? 456  TRP B CD1 1 
ATOM   5824  C  CD2 . TRP B  1 373 ? 27.762  34.475   108.573 1.00 21.56 ? 456  TRP B CD2 1 
ATOM   5825  N  NE1 . TRP B  1 373 ? 29.368  34.060   110.087 1.00 21.05 ? 456  TRP B NE1 1 
ATOM   5826  C  CE2 . TRP B  1 373 ? 28.515  35.033   109.634 1.00 21.10 ? 456  TRP B CE2 1 
ATOM   5827  C  CE3 . TRP B  1 373 ? 26.805  35.277   107.928 1.00 20.01 ? 456  TRP B CE3 1 
ATOM   5828  C  CZ2 . TRP B  1 373 ? 28.343  36.350   110.067 1.00 19.70 ? 456  TRP B CZ2 1 
ATOM   5829  C  CZ3 . TRP B  1 373 ? 26.634  36.591   108.357 1.00 19.17 ? 456  TRP B CZ3 1 
ATOM   5830  C  CH2 . TRP B  1 373 ? 27.400  37.113   109.418 1.00 19.55 ? 456  TRP B CH2 1 
ATOM   5831  N  N   . SER B  1 374 ? 26.032  31.170   109.423 1.00 21.74 ? 457  SER B N   1 
ATOM   5832  C  CA  . SER B  1 374 ? 24.771  30.936   110.093 1.00 21.39 ? 457  SER B CA  1 
ATOM   5833  C  C   . SER B  1 374 ? 23.923  32.194   109.972 1.00 21.32 ? 457  SER B C   1 
ATOM   5834  O  O   . SER B  1 374 ? 24.360  33.285   110.328 1.00 22.02 ? 457  SER B O   1 
ATOM   5835  C  CB  . SER B  1 374 ? 24.987  30.603   111.564 1.00 20.31 ? 457  SER B CB  1 
ATOM   5836  O  OG  . SER B  1 374 ? 23.759  30.209   112.154 1.00 21.56 ? 457  SER B OG  1 
ATOM   5837  N  N   . TRP B  1 375 ? 22.715  32.037   109.451 1.00 20.97 ? 458  TRP B N   1 
ATOM   5838  C  CA  . TRP B  1 375 ? 21.794  33.150   109.295 1.00 20.77 ? 458  TRP B CA  1 
ATOM   5839  C  C   . TRP B  1 375 ? 20.526  32.776   110.036 1.00 20.02 ? 458  TRP B C   1 
ATOM   5840  O  O   . TRP B  1 375 ? 19.478  32.617   109.428 1.00 22.28 ? 458  TRP B O   1 
ATOM   5841  C  CB  . TRP B  1 375 ? 21.487  33.367   107.818 1.00 19.76 ? 458  TRP B CB  1 
ATOM   5842  C  CG  . TRP B  1 375 ? 22.594  34.031   107.059 1.00 21.69 ? 458  TRP B CG  1 
ATOM   5843  C  CD1 . TRP B  1 375 ? 22.857  35.377   106.992 1.00 21.34 ? 458  TRP B CD1 1 
ATOM   5844  C  CD2 . TRP B  1 375 ? 23.550  33.397   106.200 1.00 22.40 ? 458  TRP B CD2 1 
ATOM   5845  N  NE1 . TRP B  1 375 ? 23.905  35.617   106.135 1.00 20.57 ? 458  TRP B NE1 1 
ATOM   5846  C  CE2 . TRP B  1 375 ? 24.348  34.420   105.633 1.00 21.56 ? 458  TRP B CE2 1 
ATOM   5847  C  CE3 . TRP B  1 375 ? 23.808  32.065   105.847 1.00 22.79 ? 458  TRP B CE3 1 
ATOM   5848  C  CZ2 . TRP B  1 375 ? 25.383  34.150   104.735 1.00 21.60 ? 458  TRP B CZ2 1 
ATOM   5849  C  CZ3 . TRP B  1 375 ? 24.841  31.798   104.950 1.00 21.81 ? 458  TRP B CZ3 1 
ATOM   5850  C  CH2 . TRP B  1 375 ? 25.611  32.836   104.405 1.00 22.30 ? 458  TRP B CH2 1 
ATOM   5851  N  N   . PRO B  1 376 ? 20.607  32.639   111.369 1.00 19.82 ? 459  PRO B N   1 
ATOM   5852  C  CA  . PRO B  1 376 ? 19.467  32.273   112.205 1.00 19.01 ? 459  PRO B CA  1 
ATOM   5853  C  C   . PRO B  1 376 ? 18.410  33.350   112.248 1.00 19.98 ? 459  PRO B C   1 
ATOM   5854  O  O   . PRO B  1 376 ? 18.590  34.437   111.702 1.00 20.26 ? 459  PRO B O   1 
ATOM   5855  C  CB  . PRO B  1 376 ? 20.102  32.055   113.567 1.00 18.81 ? 459  PRO B CB  1 
ATOM   5856  C  CG  . PRO B  1 376 ? 21.125  33.117   113.607 1.00 18.54 ? 459  PRO B CG  1 
ATOM   5857  C  CD  . PRO B  1 376 ? 21.756  33.011   112.216 1.00 21.43 ? 459  PRO B CD  1 
ATOM   5858  N  N   . ASP B  1 377 ? 17.307  33.031   112.916 1.00 21.01 ? 460  ASP B N   1 
ATOM   5859  C  CA  . ASP B  1 377 ? 16.178  33.936   113.064 1.00 21.30 ? 460  ASP B CA  1 
ATOM   5860  C  C   . ASP B  1 377 ? 16.541  35.214   113.830 1.00 22.00 ? 460  ASP B C   1 
ATOM   5861  O  O   . ASP B  1 377 ? 16.210  36.321   113.393 1.00 21.66 ? 460  ASP B O   1 
ATOM   5862  C  CB  . ASP B  1 377 ? 15.042  33.193   113.751 1.00 21.42 ? 460  ASP B CB  1 
ATOM   5863  C  CG  . ASP B  1 377 ? 13.992  34.115   114.277 1.00 25.06 ? 460  ASP B CG  1 
ATOM   5864  O  OD1 . ASP B  1 377 ? 14.129  34.558   115.437 1.00 28.47 ? 460  ASP B OD1 1 
ATOM   5865  O  OD2 . ASP B  1 377 ? 13.036  34.412   113.530 1.00 25.43 ? 460  ASP B OD2 1 
ATOM   5866  N  N   . GLY B  1 378 ? 17.202  35.059   114.976 1.00 22.14 ? 461  GLY B N   1 
ATOM   5867  C  CA  . GLY B  1 378 ? 17.629  36.215   115.747 1.00 21.57 ? 461  GLY B CA  1 
ATOM   5868  C  C   . GLY B  1 378 ? 16.631  36.902   116.657 1.00 22.02 ? 461  GLY B C   1 
ATOM   5869  O  O   . GLY B  1 378 ? 16.902  38.002   117.132 1.00 23.28 ? 461  GLY B O   1 
ATOM   5870  N  N   . ALA B  1 379 ? 15.488  36.278   116.913 1.00 22.00 ? 462  ALA B N   1 
ATOM   5871  C  CA  . ALA B  1 379 ? 14.484  36.883   117.789 1.00 22.57 ? 462  ALA B CA  1 
ATOM   5872  C  C   . ALA B  1 379 ? 14.701  36.444   119.232 1.00 23.25 ? 462  ALA B C   1 
ATOM   5873  O  O   . ALA B  1 379 ? 15.035  35.290   119.487 1.00 22.58 ? 462  ALA B O   1 
ATOM   5874  C  CB  . ALA B  1 379 ? 13.084  36.500   117.332 1.00 19.96 ? 462  ALA B CB  1 
ATOM   5875  N  N   . GLU B  1 380 ? 14.513  37.372   120.166 1.00 24.93 ? 463  GLU B N   1 
ATOM   5876  C  CA  . GLU B  1 380 ? 14.688  37.094   121.590 1.00 27.38 ? 463  GLU B CA  1 
ATOM   5877  C  C   . GLU B  1 380 ? 13.356  36.691   122.207 1.00 26.72 ? 463  GLU B C   1 
ATOM   5878  O  O   . GLU B  1 380 ? 12.479  37.533   122.381 1.00 27.16 ? 463  GLU B O   1 
ATOM   5879  C  CB  . GLU B  1 380 ? 15.193  38.336   122.340 1.00 31.78 ? 463  GLU B CB  1 
ATOM   5880  C  CG  . GLU B  1 380 ? 16.595  38.843   121.982 1.00 38.96 ? 463  GLU B CG  1 
ATOM   5881  C  CD  . GLU B  1 380 ? 16.983  40.108   122.779 1.00 44.28 ? 463  GLU B CD  1 
ATOM   5882  O  OE1 . GLU B  1 380 ? 16.795  40.112   124.023 1.00 47.25 ? 463  GLU B OE1 1 
ATOM   5883  O  OE2 . GLU B  1 380 ? 17.478  41.091   122.169 1.00 44.74 ? 463  GLU B OE2 1 
ATOM   5884  N  N   . LEU B  1 381 ? 13.195  35.416   122.541 1.00 25.55 ? 464  LEU B N   1 
ATOM   5885  C  CA  . LEU B  1 381 ? 11.954  34.961   123.158 1.00 23.77 ? 464  LEU B CA  1 
ATOM   5886  C  C   . LEU B  1 381 ? 12.209  34.814   124.642 1.00 23.49 ? 464  LEU B C   1 
ATOM   5887  O  O   . LEU B  1 381 ? 13.350  34.653   125.061 1.00 24.22 ? 464  LEU B O   1 
ATOM   5888  C  CB  . LEU B  1 381 ? 11.499  33.635   122.577 1.00 23.42 ? 464  LEU B CB  1 
ATOM   5889  C  CG  . LEU B  1 381 ? 11.240  33.568   121.076 1.00 24.57 ? 464  LEU B CG  1 
ATOM   5890  C  CD1 . LEU B  1 381 ? 10.672  32.202   120.735 1.00 24.54 ? 464  LEU B CD1 1 
ATOM   5891  C  CD2 . LEU B  1 381 ? 10.281  34.656   120.663 1.00 26.09 ? 464  LEU B CD2 1 
ATOM   5892  N  N   . PRO B  1 382 ? 11.143  34.829   125.460 1.00 23.49 ? 465  PRO B N   1 
ATOM   5893  C  CA  . PRO B  1 382 ? 9.759   35.037   125.017 1.00 23.37 ? 465  PRO B CA  1 
ATOM   5894  C  C   . PRO B  1 382 ? 9.428   36.473   124.649 1.00 22.68 ? 465  PRO B C   1 
ATOM   5895  O  O   . PRO B  1 382 ? 10.182  37.398   124.960 1.00 22.06 ? 465  PRO B O   1 
ATOM   5896  C  CB  . PRO B  1 382 ? 8.948   34.542   126.212 1.00 23.02 ? 465  PRO B CB  1 
ATOM   5897  C  CG  . PRO B  1 382 ? 9.821   34.900   127.373 1.00 22.62 ? 465  PRO B CG  1 
ATOM   5898  C  CD  . PRO B  1 382 ? 11.197  34.505   126.895 1.00 22.56 ? 465  PRO B CD  1 
ATOM   5899  N  N   . PHE B  1 383 ? 8.303   36.654   123.969 1.00 22.47 ? 466  PHE B N   1 
ATOM   5900  C  CA  . PHE B  1 383 ? 7.851   37.984   123.579 1.00 21.01 ? 466  PHE B CA  1 
ATOM   5901  C  C   . PHE B  1 383 ? 6.991   38.513   124.694 1.00 20.78 ? 466  PHE B C   1 
ATOM   5902  O  O   . PHE B  1 383 ? 6.722   37.800   125.655 1.00 20.29 ? 466  PHE B O   1 
ATOM   5903  C  CB  . PHE B  1 383 ? 7.033   37.927   122.291 1.00 19.60 ? 466  PHE B CB  1 
ATOM   5904  C  CG  . PHE B  1 383 ? 7.852   38.102   121.053 1.00 17.75 ? 466  PHE B CG  1 
ATOM   5905  C  CD1 . PHE B  1 383 ? 9.227   37.898   121.081 1.00 15.75 ? 466  PHE B CD1 1 
ATOM   5906  C  CD2 . PHE B  1 383 ? 7.255   38.468   119.858 1.00 16.97 ? 466  PHE B CD2 1 
ATOM   5907  C  CE1 . PHE B  1 383 ? 9.991   38.053   119.939 1.00 15.05 ? 466  PHE B CE1 1 
ATOM   5908  C  CE2 . PHE B  1 383 ? 8.016   38.625   118.705 1.00 16.91 ? 466  PHE B CE2 1 
ATOM   5909  C  CZ  . PHE B  1 383 ? 9.387   38.418   118.748 1.00 16.51 ? 466  PHE B CZ  1 
ATOM   5910  N  N   . THR B  1 384 ? 6.557   39.762   124.573 1.00 22.80 ? 467  THR B N   1 
ATOM   5911  C  CA  . THR B  1 384 ? 5.707   40.354   125.593 1.00 23.78 ? 467  THR B CA  1 
ATOM   5912  C  C   . THR B  1 384 ? 4.526   39.405   125.765 1.00 24.98 ? 467  THR B C   1 
ATOM   5913  O  O   . THR B  1 384 ? 3.674   39.583   126.630 1.00 24.13 ? 467  THR B O   1 
ATOM   5914  C  CB  . THR B  1 384 ? 5.235   41.741   125.155 1.00 23.12 ? 467  THR B CB  1 
ATOM   5915  O  OG1 . THR B  1 384 ? 6.379   42.576   124.943 1.00 25.08 ? 467  THR B OG1 1 
ATOM   5916  C  CG2 . THR B  1 384 ? 4.362   42.370   126.219 1.00 23.53 ? 467  THR B CG2 1 
ATOM   5917  N  N   . ILE B  1 385 ? 4.539   38.366   124.935 1.00 27.89 ? 468  ILE B N   1 
ATOM   5918  C  CA  . ILE B  1 385 ? 3.536   37.313   124.900 1.00 27.95 ? 468  ILE B CA  1 
ATOM   5919  C  C   . ILE B  1 385 ? 2.288   37.898   124.294 1.00 29.90 ? 468  ILE B C   1 
ATOM   5920  O  O   . ILE B  1 385 ? 1.910   37.472   123.177 1.00 30.32 ? 468  ILE B O   1 
ATOM   5921  C  CB  . ILE B  1 385 ? 3.218   36.769   126.301 1.00 25.05 ? 468  ILE B CB  1 
ATOM   5922  C  CG1 . ILE B  1 385 ? 4.321   35.797   126.756 1.00 22.92 ? 468  ILE B CG1 1 
ATOM   5923  C  CG2 . ILE B  1 385 ? 1.847   36.127   126.289 1.00 25.57 ? 468  ILE B CG2 1 
ATOM   5924  C  CD1 . ILE B  1 385 ? 4.285   35.479   128.256 1.00 17.81 ? 468  ILE B CD1 1 
ATOM   5925  N  N   . VAL C  1 1   ? -13.115 48.839   77.255  1.00 34.94 ? 83   VAL C N   1 
ATOM   5926  C  CA  . VAL C  1 1   ? -14.314 48.221   76.608  1.00 37.34 ? 83   VAL C CA  1 
ATOM   5927  C  C   . VAL C  1 1   ? -15.408 47.832   77.614  1.00 37.38 ? 83   VAL C C   1 
ATOM   5928  O  O   . VAL C  1 1   ? -15.178 47.069   78.556  1.00 37.32 ? 83   VAL C O   1 
ATOM   5929  C  CB  . VAL C  1 1   ? -13.927 46.970   75.784  1.00 37.12 ? 83   VAL C CB  1 
ATOM   5930  C  CG1 . VAL C  1 1   ? -15.169 46.356   75.149  1.00 36.26 ? 83   VAL C CG1 1 
ATOM   5931  C  CG2 . VAL C  1 1   ? -12.928 47.353   74.707  1.00 37.58 ? 83   VAL C CG2 1 
ATOM   5932  N  N   . LYS C  1 2   ? -16.605 48.360   77.376  1.00 37.08 ? 84   LYS C N   1 
ATOM   5933  C  CA  . LYS C  1 2   ? -17.767 48.143   78.229  1.00 37.76 ? 84   LYS C CA  1 
ATOM   5934  C  C   . LYS C  1 2   ? -18.158 46.683   78.436  1.00 35.92 ? 84   LYS C C   1 
ATOM   5935  O  O   . LYS C  1 2   ? -18.227 45.884   77.500  1.00 36.21 ? 84   LYS C O   1 
ATOM   5936  C  CB  . LYS C  1 2   ? -18.951 48.929   77.661  1.00 40.76 ? 84   LYS C CB  1 
ATOM   5937  C  CG  . LYS C  1 2   ? -18.533 50.319   77.179  1.00 47.80 ? 84   LYS C CG  1 
ATOM   5938  C  CD  . LYS C  1 2   ? -19.563 50.979   76.261  1.00 52.24 ? 84   LYS C CD  1 
ATOM   5939  C  CE  . LYS C  1 2   ? -19.136 52.402   75.887  1.00 53.47 ? 84   LYS C CE  1 
ATOM   5940  N  NZ  . LYS C  1 2   ? -20.191 53.109   75.104  1.00 55.58 ? 84   LYS C NZ  1 
ATOM   5941  N  N   . LEU C  1 3   ? -18.411 46.356   79.695  1.00 33.97 ? 85   LEU C N   1 
ATOM   5942  C  CA  . LEU C  1 3   ? -18.810 45.023   80.117  1.00 32.14 ? 85   LEU C CA  1 
ATOM   5943  C  C   . LEU C  1 3   ? -20.141 44.669   79.453  1.00 31.74 ? 85   LEU C C   1 
ATOM   5944  O  O   . LEU C  1 3   ? -21.115 45.417   79.561  1.00 32.11 ? 85   LEU C O   1 
ATOM   5945  C  CB  . LEU C  1 3   ? -18.977 45.027   81.640  1.00 29.96 ? 85   LEU C CB  1 
ATOM   5946  C  CG  . LEU C  1 3   ? -18.407 43.951   82.562  1.00 29.14 ? 85   LEU C CG  1 
ATOM   5947  C  CD1 . LEU C  1 3   ? -16.906 43.785   82.367  1.00 25.22 ? 85   LEU C CD1 1 
ATOM   5948  C  CD2 . LEU C  1 3   ? -18.709 44.363   83.993  1.00 27.11 ? 85   LEU C CD2 1 
ATOM   5949  N  N   . ALA C  1 4   ? -20.177 43.548   78.744  1.00 31.46 ? 86   ALA C N   1 
ATOM   5950  C  CA  . ALA C  1 4   ? -21.411 43.102   78.103  1.00 31.35 ? 86   ALA C CA  1 
ATOM   5951  C  C   . ALA C  1 4   ? -22.040 42.160   79.110  1.00 31.75 ? 86   ALA C C   1 
ATOM   5952  O  O   . ALA C  1 4   ? -21.384 41.228   79.594  1.00 34.05 ? 86   ALA C O   1 
ATOM   5953  C  CB  . ALA C  1 4   ? -21.112 42.359   76.814  1.00 29.88 ? 86   ALA C CB  1 
ATOM   5954  N  N   . GLY C  1 5   ? -23.293 42.402   79.458  1.00 29.70 ? 87   GLY C N   1 
ATOM   5955  C  CA  . GLY C  1 5   ? -23.925 41.525   80.420  1.00 30.04 ? 87   GLY C CA  1 
ATOM   5956  C  C   . GLY C  1 5   ? -25.013 40.743   79.733  1.00 30.51 ? 87   GLY C C   1 
ATOM   5957  O  O   . GLY C  1 5   ? -26.114 40.605   80.267  1.00 31.68 ? 87   GLY C O   1 
ATOM   5958  N  N   . ASN C  1 6   ? -24.703 40.230   78.546  1.00 29.66 ? 88   ASN C N   1 
ATOM   5959  C  CA  . ASN C  1 6   ? -25.673 39.485   77.760  1.00 29.50 ? 88   ASN C CA  1 
ATOM   5960  C  C   . ASN C  1 6   ? -25.707 37.985   78.026  1.00 28.38 ? 88   ASN C C   1 
ATOM   5961  O  O   . ASN C  1 6   ? -26.691 37.332   77.711  1.00 30.07 ? 88   ASN C O   1 
ATOM   5962  C  CB  . ASN C  1 6   ? -25.447 39.732   76.264  1.00 31.26 ? 88   ASN C CB  1 
ATOM   5963  C  CG  . ASN C  1 6   ? -24.067 39.307   75.799  1.00 33.60 ? 88   ASN C CG  1 
ATOM   5964  O  OD1 . ASN C  1 6   ? -23.837 39.123   74.598  1.00 35.76 ? 88   ASN C OD1 1 
ATOM   5965  N  ND2 . ASN C  1 6   ? -23.135 39.153   76.744  1.00 32.34 ? 88   ASN C ND2 1 
ATOM   5966  N  N   . SER C  1 7   ? -24.642 37.431   78.590  1.00 26.94 ? 89   SER C N   1 
ATOM   5967  C  CA  . SER C  1 7   ? -24.619 36.001   78.880  1.00 25.21 ? 89   SER C CA  1 
ATOM   5968  C  C   . SER C  1 7   ? -25.461 35.725   80.125  1.00 24.86 ? 89   SER C C   1 
ATOM   5969  O  O   . SER C  1 7   ? -25.930 36.658   80.777  1.00 23.84 ? 89   SER C O   1 
ATOM   5970  C  CB  . SER C  1 7   ? -23.181 35.521   79.096  1.00 25.32 ? 89   SER C CB  1 
ATOM   5971  O  OG  . SER C  1 7   ? -22.572 36.192   80.187  1.00 28.75 ? 89   SER C OG  1 
ATOM   5972  N  N   . SER C  1 8   ? -25.649 34.450   80.454  1.00 24.97 ? 90   SER C N   1 
ATOM   5973  C  CA  . SER C  1 8   ? -26.450 34.067   81.615  1.00 26.41 ? 90   SER C CA  1 
ATOM   5974  C  C   . SER C  1 8   ? -25.610 33.527   82.767  1.00 25.45 ? 90   SER C C   1 
ATOM   5975  O  O   . SER C  1 8   ? -24.409 33.308   82.621  1.00 24.94 ? 90   SER C O   1 
ATOM   5976  C  CB  . SER C  1 8   ? -27.483 33.008   81.211  1.00 27.69 ? 90   SER C CB  1 
ATOM   5977  O  OG  . SER C  1 8   ? -28.463 33.565   80.349  1.00 31.38 ? 90   SER C OG  1 
ATOM   5978  N  N   . LEU C  1 9   ? -26.249 33.306   83.912  1.00 23.28 ? 91   LEU C N   1 
ATOM   5979  C  CA  . LEU C  1 9   ? -25.537 32.782   85.059  1.00 23.31 ? 91   LEU C CA  1 
ATOM   5980  C  C   . LEU C  1 9   ? -24.974 31.406   84.725  1.00 25.01 ? 91   LEU C C   1 
ATOM   5981  O  O   . LEU C  1 9   ? -25.622 30.616   84.046  1.00 25.71 ? 91   LEU C O   1 
ATOM   5982  C  CB  . LEU C  1 9   ? -26.467 32.676   86.269  1.00 21.65 ? 91   LEU C CB  1 
ATOM   5983  C  CG  . LEU C  1 9   ? -26.907 33.985   86.937  1.00 20.85 ? 91   LEU C CG  1 
ATOM   5984  C  CD1 . LEU C  1 9   ? -27.659 33.673   88.212  1.00 17.47 ? 91   LEU C CD1 1 
ATOM   5985  C  CD2 . LEU C  1 9   ? -25.690 34.847   87.253  1.00 19.69 ? 91   LEU C CD2 1 
ATOM   5986  N  N   . CYS C  1 10  ? -23.760 31.125   85.186  1.00 25.97 ? 92   CYS C N   1 
ATOM   5987  C  CA  . CYS C  1 10  ? -23.151 29.828   84.936  1.00 27.44 ? 92   CYS C CA  1 
ATOM   5988  C  C   . CYS C  1 10  ? -23.867 28.777   85.774  1.00 25.82 ? 92   CYS C C   1 
ATOM   5989  O  O   . CYS C  1 10  ? -24.304 29.058   86.887  1.00 25.56 ? 92   CYS C O   1 
ATOM   5990  C  CB  . CYS C  1 10  ? -21.679 29.803   85.358  1.00 29.93 ? 92   CYS C CB  1 
ATOM   5991  S  SG  . CYS C  1 10  ? -20.541 30.996   84.587  1.00 38.27 ? 92   CYS C SG  1 
ATOM   5992  N  N   . PRO C  1 11  ? -24.016 27.555   85.245  1.00 24.52 ? 93   PRO C N   1 
ATOM   5993  C  CA  . PRO C  1 11  ? -24.685 26.544   86.063  1.00 23.91 ? 93   PRO C CA  1 
ATOM   5994  C  C   . PRO C  1 11  ? -23.712 26.178   87.179  1.00 22.93 ? 93   PRO C C   1 
ATOM   5995  O  O   . PRO C  1 11  ? -22.505 26.238   86.981  1.00 23.68 ? 93   PRO C O   1 
ATOM   5996  C  CB  . PRO C  1 11  ? -24.921 25.404   85.074  1.00 22.61 ? 93   PRO C CB  1 
ATOM   5997  C  CG  . PRO C  1 11  ? -23.817 25.577   84.086  1.00 23.01 ? 93   PRO C CG  1 
ATOM   5998  C  CD  . PRO C  1 11  ? -23.801 27.059   83.877  1.00 22.69 ? 93   PRO C CD  1 
ATOM   5999  N  N   . ILE C  1 12  ? -24.217 25.814   88.351  1.00 22.64 ? 94   ILE C N   1 
ATOM   6000  C  CA  . ILE C  1 12  ? -23.319 25.480   89.449  1.00 22.75 ? 94   ILE C CA  1 
ATOM   6001  C  C   . ILE C  1 12  ? -23.860 24.365   90.343  1.00 24.19 ? 94   ILE C C   1 
ATOM   6002  O  O   . ILE C  1 12  ? -25.061 24.088   90.336  1.00 27.21 ? 94   ILE C O   1 
ATOM   6003  C  CB  . ILE C  1 12  ? -23.053 26.721   90.327  1.00 22.00 ? 94   ILE C CB  1 
ATOM   6004  C  CG1 . ILE C  1 12  ? -24.363 27.179   90.972  1.00 22.03 ? 94   ILE C CG1 1 
ATOM   6005  C  CG2 . ILE C  1 12  ? -22.459 27.845   89.484  1.00 19.85 ? 94   ILE C CG2 1 
ATOM   6006  C  CD1 . ILE C  1 12  ? -24.199 28.256   92.037  1.00 22.95 ? 94   ILE C CD1 1 
ATOM   6007  N  N   . ASN C  1 13  ? -22.976 23.729   91.113  1.00 23.42 ? 95   ASN C N   1 
ATOM   6008  C  CA  . ASN C  1 13  ? -23.385 22.659   92.016  1.00 22.86 ? 95   ASN C CA  1 
ATOM   6009  C  C   . ASN C  1 13  ? -23.137 23.011   93.478  1.00 21.61 ? 95   ASN C C   1 
ATOM   6010  O  O   . ASN C  1 13  ? -23.738 22.421   94.380  1.00 21.62 ? 95   ASN C O   1 
ATOM   6011  C  CB  . ASN C  1 13  ? -22.646 21.359   91.689  1.00 25.38 ? 95   ASN C CB  1 
ATOM   6012  C  CG  . ASN C  1 13  ? -23.130 20.719   90.401  1.00 27.74 ? 95   ASN C CG  1 
ATOM   6013  O  OD1 . ASN C  1 13  ? -24.321 20.431   90.240  1.00 27.36 ? 95   ASN C OD1 1 
ATOM   6014  N  ND2 . ASN C  1 13  ? -22.204 20.489   89.473  1.00 28.94 ? 95   ASN C ND2 1 
ATOM   6015  N  N   . GLY C  1 14  ? -22.250 23.969   93.714  1.00 19.31 ? 96   GLY C N   1 
ATOM   6016  C  CA  . GLY C  1 14  ? -21.944 24.355   95.076  1.00 16.61 ? 96   GLY C CA  1 
ATOM   6017  C  C   . GLY C  1 14  ? -21.120 25.616   95.104  1.00 16.33 ? 96   GLY C C   1 
ATOM   6018  O  O   . GLY C  1 14  ? -21.011 26.288   94.095  1.00 15.37 ? 96   GLY C O   1 
ATOM   6019  N  N   . TRP C  1 15  ? -20.520 25.935   96.245  1.00 15.58 ? 97   TRP C N   1 
ATOM   6020  C  CA  . TRP C  1 15  ? -19.745 27.158   96.348  1.00 14.66 ? 97   TRP C CA  1 
ATOM   6021  C  C   . TRP C  1 15  ? -18.355 26.913   96.900  1.00 14.87 ? 97   TRP C C   1 
ATOM   6022  O  O   . TRP C  1 15  ? -18.205 26.283   97.931  1.00 15.25 ? 97   TRP C O   1 
ATOM   6023  C  CB  . TRP C  1 15  ? -20.488 28.149   97.247  1.00 14.49 ? 97   TRP C CB  1 
ATOM   6024  C  CG  . TRP C  1 15  ? -21.919 28.287   96.881  1.00 14.51 ? 97   TRP C CG  1 
ATOM   6025  C  CD1 . TRP C  1 15  ? -22.941 27.441   97.220  1.00 14.76 ? 97   TRP C CD1 1 
ATOM   6026  C  CD2 . TRP C  1 15  ? -22.484 29.271   96.017  1.00 14.67 ? 97   TRP C CD2 1 
ATOM   6027  N  NE1 . TRP C  1 15  ? -24.105 27.834   96.609  1.00 14.78 ? 97   TRP C NE1 1 
ATOM   6028  C  CE2 . TRP C  1 15  ? -23.854 28.956   95.862  1.00 15.96 ? 97   TRP C CE2 1 
ATOM   6029  C  CE3 . TRP C  1 15  ? -21.967 30.392   95.351  1.00 14.11 ? 97   TRP C CE3 1 
ATOM   6030  C  CZ2 . TRP C  1 15  ? -24.716 29.723   95.071  1.00 15.14 ? 97   TRP C CZ2 1 
ATOM   6031  C  CZ3 . TRP C  1 15  ? -22.822 31.154   94.565  1.00 13.87 ? 97   TRP C CZ3 1 
ATOM   6032  C  CH2 . TRP C  1 15  ? -24.184 30.814   94.431  1.00 13.18 ? 97   TRP C CH2 1 
ATOM   6033  N  N   . ALA C  1 16  ? -17.335 27.426   96.225  1.00 15.42 ? 98   ALA C N   1 
ATOM   6034  C  CA  . ALA C  1 16  ? -15.967 27.233   96.700  1.00 15.78 ? 98   ALA C CA  1 
ATOM   6035  C  C   . ALA C  1 16  ? -15.488 28.476   97.436  1.00 15.37 ? 98   ALA C C   1 
ATOM   6036  O  O   . ALA C  1 16  ? -15.750 29.588   96.986  1.00 16.39 ? 98   ALA C O   1 
ATOM   6037  C  CB  . ALA C  1 16  ? -15.060 26.936   95.522  1.00 14.45 ? 98   ALA C CB  1 
ATOM   6038  N  N   . VAL C  1 17  ? -14.805 28.313   98.567  1.00 15.64 ? 99   VAL C N   1 
ATOM   6039  C  CA  . VAL C  1 17  ? -14.314 29.495   99.287  1.00 17.34 ? 99   VAL C CA  1 
ATOM   6040  C  C   . VAL C  1 17  ? -13.475 30.365   98.377  1.00 17.30 ? 99   VAL C C   1 
ATOM   6041  O  O   . VAL C  1 17  ? -12.665 29.874   97.599  1.00 17.46 ? 99   VAL C O   1 
ATOM   6042  C  CB  . VAL C  1 17  ? -13.423 29.156   100.481 1.00 18.87 ? 99   VAL C CB  1 
ATOM   6043  C  CG1 . VAL C  1 17  ? -14.251 29.069   101.732 1.00 20.87 ? 99   VAL C CG1 1 
ATOM   6044  C  CG2 . VAL C  1 17  ? -12.665 27.867   100.212 1.00 21.01 ? 99   VAL C CG2 1 
ATOM   6045  N  N   . TYR C  1 18  ? -13.665 31.666   98.493  1.00 17.89 ? 100  TYR C N   1 
ATOM   6046  C  CA  . TYR C  1 18  ? -12.929 32.601   97.670  1.00 19.35 ? 100  TYR C CA  1 
ATOM   6047  C  C   . TYR C  1 18  ? -12.006 33.472   98.512  1.00 18.22 ? 100  TYR C C   1 
ATOM   6048  O  O   . TYR C  1 18  ? -10.877 33.736   98.111  1.00 17.04 ? 100  TYR C O   1 
ATOM   6049  C  CB  . TYR C  1 18  ? -13.908 33.471   96.882  1.00 20.65 ? 100  TYR C CB  1 
ATOM   6050  C  CG  . TYR C  1 18  ? -13.252 34.340   95.839  1.00 21.97 ? 100  TYR C CG  1 
ATOM   6051  C  CD1 . TYR C  1 18  ? -12.461 33.780   94.833  1.00 21.22 ? 100  TYR C CD1 1 
ATOM   6052  C  CD2 . TYR C  1 18  ? -13.453 35.723   95.832  1.00 21.63 ? 100  TYR C CD2 1 
ATOM   6053  C  CE1 . TYR C  1 18  ? -11.891 34.579   93.842  1.00 22.00 ? 100  TYR C CE1 1 
ATOM   6054  C  CE2 . TYR C  1 18  ? -12.890 36.525   94.852  1.00 21.66 ? 100  TYR C CE2 1 
ATOM   6055  C  CZ  . TYR C  1 18  ? -12.113 35.950   93.861  1.00 21.99 ? 100  TYR C CZ  1 
ATOM   6056  O  OH  . TYR C  1 18  ? -11.561 36.755   92.892  1.00 24.81 ? 100  TYR C OH  1 
ATOM   6057  N  N   . SER C  1 19  ? -12.483 33.906   99.678  1.00 17.37 ? 101  SER C N   1 
ATOM   6058  C  CA  . SER C  1 19  ? -11.673 34.748   100.546 1.00 17.02 ? 101  SER C CA  1 
ATOM   6059  C  C   . SER C  1 19  ? -12.148 34.813   101.982 1.00 16.44 ? 101  SER C C   1 
ATOM   6060  O  O   . SER C  1 19  ? -13.252 34.391   102.306 1.00 16.66 ? 101  SER C O   1 
ATOM   6061  C  CB  . SER C  1 19  ? -11.611 36.172   99.999  1.00 17.28 ? 101  SER C CB  1 
ATOM   6062  O  OG  . SER C  1 19  ? -12.852 36.827   100.179 1.00 17.83 ? 101  SER C OG  1 
ATOM   6063  N  N   . LYS C  1 20  ? -11.286 35.372   102.828 1.00 16.48 ? 102  LYS C N   1 
ATOM   6064  C  CA  . LYS C  1 20  ? -11.529 35.552   104.256 1.00 17.07 ? 102  LYS C CA  1 
ATOM   6065  C  C   . LYS C  1 20  ? -10.487 36.577   104.716 1.00 18.02 ? 102  LYS C C   1 
ATOM   6066  O  O   . LYS C  1 20  ? -9.291  36.326   104.605 1.00 18.66 ? 102  LYS C O   1 
ATOM   6067  C  CB  . LYS C  1 20  ? -11.319 34.230   104.998 1.00 16.05 ? 102  LYS C CB  1 
ATOM   6068  C  CG  . LYS C  1 20  ? -11.740 34.282   106.449 1.00 16.84 ? 102  LYS C CG  1 
ATOM   6069  C  CD  . LYS C  1 20  ? -11.547 32.964   107.171 1.00 17.15 ? 102  LYS C CD  1 
ATOM   6070  C  CE  . LYS C  1 20  ? -12.385 32.938   108.453 1.00 19.02 ? 102  LYS C CE  1 
ATOM   6071  N  NZ  . LYS C  1 20  ? -12.221 34.176   109.288 1.00 18.66 ? 102  LYS C NZ  1 
ATOM   6072  N  N   . ASP C  1 21  ? -10.914 37.727   105.228 1.00 18.21 ? 103  ASP C N   1 
ATOM   6073  C  CA  . ASP C  1 21  ? -9.929  38.729   105.632 1.00 18.53 ? 103  ASP C CA  1 
ATOM   6074  C  C   . ASP C  1 21  ? -9.404  38.662   107.065 1.00 16.07 ? 103  ASP C C   1 
ATOM   6075  O  O   . ASP C  1 21  ? -8.349  39.222   107.358 1.00 16.40 ? 103  ASP C O   1 
ATOM   6076  C  CB  . ASP C  1 21  ? -10.447 40.146   105.325 1.00 21.56 ? 103  ASP C CB  1 
ATOM   6077  C  CG  . ASP C  1 21  ? -11.769 40.461   106.011 1.00 25.51 ? 103  ASP C CG  1 
ATOM   6078  O  OD1 . ASP C  1 21  ? -12.345 41.536   105.715 1.00 27.80 ? 103  ASP C OD1 1 
ATOM   6079  O  OD2 . ASP C  1 21  ? -12.232 39.649   106.843 1.00 28.48 ? 103  ASP C OD2 1 
ATOM   6080  N  N   . ASN C  1 22  ? -10.113 37.965   107.944 1.00 13.81 ? 104  ASN C N   1 
ATOM   6081  C  CA  . ASN C  1 22  ? -9.701  37.846   109.341 1.00 14.28 ? 104  ASN C CA  1 
ATOM   6082  C  C   . ASN C  1 22  ? -9.492  39.213   109.983 1.00 15.40 ? 104  ASN C C   1 
ATOM   6083  O  O   . ASN C  1 22  ? -8.874  39.330   111.042 1.00 17.00 ? 104  ASN C O   1 
ATOM   6084  C  CB  . ASN C  1 22  ? -8.409  37.037   109.436 1.00 14.83 ? 104  ASN C CB  1 
ATOM   6085  C  CG  . ASN C  1 22  ? -8.624  35.564   109.151 1.00 17.05 ? 104  ASN C CG  1 
ATOM   6086  O  OD1 . ASN C  1 22  ? -7.824  34.929   108.463 1.00 17.31 ? 104  ASN C OD1 1 
ATOM   6087  N  ND2 . ASN C  1 22  ? -9.707  35.008   109.693 1.00 16.99 ? 104  ASN C ND2 1 
ATOM   6088  N  N   . SER C  1 23  ? -10.030 40.247   109.350 1.00 15.07 ? 105  SER C N   1 
ATOM   6089  C  CA  . SER C  1 23  ? -9.857  41.606   109.830 1.00 16.33 ? 105  SER C CA  1 
ATOM   6090  C  C   . SER C  1 23  ? -9.952  41.807   111.338 1.00 15.34 ? 105  SER C C   1 
ATOM   6091  O  O   . SER C  1 23  ? -9.078  42.424   111.932 1.00 13.66 ? 105  SER C O   1 
ATOM   6092  C  CB  . SER C  1 23  ? -10.839 42.542   109.110 1.00 17.81 ? 105  SER C CB  1 
ATOM   6093  O  OG  . SER C  1 23  ? -12.179 42.096   109.275 1.00 23.99 ? 105  SER C OG  1 
ATOM   6094  N  N   . ILE C  1 24  ? -10.993 41.280   111.968 1.00 15.38 ? 106  ILE C N   1 
ATOM   6095  C  CA  . ILE C  1 24  ? -11.146 41.491   113.398 1.00 14.59 ? 106  ILE C CA  1 
ATOM   6096  C  C   . ILE C  1 24  ? -10.031 40.847   114.190 1.00 16.84 ? 106  ILE C C   1 
ATOM   6097  O  O   . ILE C  1 24  ? -9.480  41.469   115.108 1.00 17.99 ? 106  ILE C O   1 
ATOM   6098  C  CB  . ILE C  1 24  ? -12.530 41.014   113.888 1.00 13.49 ? 106  ILE C CB  1 
ATOM   6099  C  CG1 . ILE C  1 24  ? -13.611 41.845   113.183 1.00 11.89 ? 106  ILE C CG1 1 
ATOM   6100  C  CG2 . ILE C  1 24  ? -12.656 41.200   115.391 1.00 9.22  ? 106  ILE C CG2 1 
ATOM   6101  C  CD1 . ILE C  1 24  ? -15.034 41.557   113.611 1.00 14.86 ? 106  ILE C CD1 1 
ATOM   6102  N  N   . ARG C  1 25  ? -9.686  39.611   113.835 1.00 16.60 ? 107  ARG C N   1 
ATOM   6103  C  CA  . ARG C  1 25  ? -8.600  38.917   114.516 1.00 16.37 ? 107  ARG C CA  1 
ATOM   6104  C  C   . ARG C  1 25  ? -7.329  39.751   114.340 1.00 15.11 ? 107  ARG C C   1 
ATOM   6105  O  O   . ARG C  1 25  ? -6.615  40.027   115.296 1.00 15.32 ? 107  ARG C O   1 
ATOM   6106  C  CB  . ARG C  1 25  ? -8.402  37.514   113.921 1.00 17.43 ? 107  ARG C CB  1 
ATOM   6107  C  CG  . ARG C  1 25  ? -9.401  36.466   114.412 1.00 18.20 ? 107  ARG C CG  1 
ATOM   6108  C  CD  . ARG C  1 25  ? -9.337  35.192   113.573 1.00 18.80 ? 107  ARG C CD  1 
ATOM   6109  N  NE  . ARG C  1 25  ? -8.000  34.601   113.538 1.00 20.91 ? 107  ARG C NE  1 
ATOM   6110  C  CZ  . ARG C  1 25  ? -7.489  33.836   114.498 1.00 21.55 ? 107  ARG C CZ  1 
ATOM   6111  N  NH1 . ARG C  1 25  ? -6.261  33.352   114.376 1.00 22.71 ? 107  ARG C NH1 1 
ATOM   6112  N  NH2 . ARG C  1 25  ? -8.204  33.544   115.575 1.00 21.03 ? 107  ARG C NH2 1 
ATOM   6113  N  N   . ILE C  1 26  ? -7.058  40.167   113.114 1.00 14.80 ? 108  ILE C N   1 
ATOM   6114  C  CA  . ILE C  1 26  ? -5.876  40.973   112.844 1.00 15.84 ? 108  ILE C CA  1 
ATOM   6115  C  C   . ILE C  1 26  ? -6.012  42.332   113.530 1.00 15.80 ? 108  ILE C C   1 
ATOM   6116  O  O   . ILE C  1 26  ? -5.032  42.910   114.001 1.00 13.69 ? 108  ILE C O   1 
ATOM   6117  C  CB  . ILE C  1 26  ? -5.694  41.174   111.318 1.00 16.97 ? 108  ILE C CB  1 
ATOM   6118  C  CG1 . ILE C  1 26  ? -5.625  39.798   110.637 1.00 16.77 ? 108  ILE C CG1 1 
ATOM   6119  C  CG2 . ILE C  1 26  ? -4.432  41.996   111.040 1.00 12.61 ? 108  ILE C CG2 1 
ATOM   6120  C  CD1 . ILE C  1 26  ? -5.577  39.838   109.130 1.00 18.63 ? 108  ILE C CD1 1 
ATOM   6121  N  N   . GLY C  1 27  ? -7.247  42.814   113.600 1.00 15.95 ? 109  GLY C N   1 
ATOM   6122  C  CA  . GLY C  1 27  ? -7.519  44.099   114.207 1.00 18.27 ? 109  GLY C CA  1 
ATOM   6123  C  C   . GLY C  1 27  ? -7.234  44.221   115.686 1.00 19.21 ? 109  GLY C C   1 
ATOM   6124  O  O   . GLY C  1 27  ? -7.303  45.318   116.233 1.00 20.22 ? 109  GLY C O   1 
ATOM   6125  N  N   . SER C  1 28  ? -6.918  43.112   116.343 1.00 20.32 ? 110  SER C N   1 
ATOM   6126  C  CA  . SER C  1 28  ? -6.632  43.148   117.771 1.00 20.85 ? 110  SER C CA  1 
ATOM   6127  C  C   . SER C  1 28  ? -5.345  43.949   118.028 1.00 21.29 ? 110  SER C C   1 
ATOM   6128  O  O   . SER C  1 28  ? -5.223  44.652   119.031 1.00 22.81 ? 110  SER C O   1 
ATOM   6129  C  CB  . SER C  1 28  ? -6.497  41.717   118.302 1.00 20.70 ? 110  SER C CB  1 
ATOM   6130  O  OG  . SER C  1 28  ? -6.387  41.682   119.711 1.00 21.50 ? 110  SER C OG  1 
ATOM   6131  N  N   . LYS C  1 29  ? -4.393  43.855   117.108 1.00 20.48 ? 111  LYS C N   1 
ATOM   6132  C  CA  . LYS C  1 29  ? -3.133  44.579   117.245 1.00 19.91 ? 111  LYS C CA  1 
ATOM   6133  C  C   . LYS C  1 29  ? -2.900  45.506   116.062 1.00 18.74 ? 111  LYS C C   1 
ATOM   6134  O  O   . LYS C  1 29  ? -2.450  46.636   116.229 1.00 19.12 ? 111  LYS C O   1 
ATOM   6135  C  CB  . LYS C  1 29  ? -1.971  43.598   117.340 1.00 20.27 ? 111  LYS C CB  1 
ATOM   6136  C  CG  . LYS C  1 29  ? -0.600  44.247   117.279 1.00 21.50 ? 111  LYS C CG  1 
ATOM   6137  C  CD  . LYS C  1 29  ? 0.480   43.179   117.293 1.00 24.20 ? 111  LYS C CD  1 
ATOM   6138  C  CE  . LYS C  1 29  ? 1.880   43.768   117.442 1.00 24.60 ? 111  LYS C CE  1 
ATOM   6139  N  NZ  . LYS C  1 29  ? 2.409   44.345   116.191 1.00 25.87 ? 111  LYS C NZ  1 
ATOM   6140  N  N   . GLY C  1 30  ? -3.204  45.017   114.867 1.00 16.93 ? 112  GLY C N   1 
ATOM   6141  C  CA  . GLY C  1 30  ? -3.001  45.817   113.679 1.00 17.29 ? 112  GLY C CA  1 
ATOM   6142  C  C   . GLY C  1 30  ? -3.970  46.977   113.538 1.00 17.23 ? 112  GLY C C   1 
ATOM   6143  O  O   . GLY C  1 30  ? -4.968  47.055   114.246 1.00 16.09 ? 112  GLY C O   1 
ATOM   6144  N  N   . ASP C  1 31  ? -3.673  47.885   112.615 1.00 16.83 ? 113  ASP C N   1 
ATOM   6145  C  CA  . ASP C  1 31  ? -4.526  49.041   112.401 1.00 18.12 ? 113  ASP C CA  1 
ATOM   6146  C  C   . ASP C  1 31  ? -5.615  48.751   111.389 1.00 18.73 ? 113  ASP C C   1 
ATOM   6147  O  O   . ASP C  1 31  ? -5.503  49.073   110.206 1.00 18.98 ? 113  ASP C O   1 
ATOM   6148  C  CB  . ASP C  1 31  ? -3.695  50.242   111.960 1.00 17.03 ? 113  ASP C CB  1 
ATOM   6149  C  CG  . ASP C  1 31  ? -2.669  50.616   112.984 1.00 18.50 ? 113  ASP C CG  1 
ATOM   6150  O  OD1 . ASP C  1 31  ? -3.019  50.558   114.184 1.00 18.86 ? 113  ASP C OD1 1 
ATOM   6151  O  OD2 . ASP C  1 31  ? -1.526  50.958   112.603 1.00 19.05 ? 113  ASP C OD2 1 
ATOM   6152  N  N   . VAL C  1 32  ? -6.687  48.155   111.886 1.00 17.89 ? 114  VAL C N   1 
ATOM   6153  C  CA  . VAL C  1 32  ? -7.801  47.803   111.045 1.00 18.17 ? 114  VAL C CA  1 
ATOM   6154  C  C   . VAL C  1 32  ? -9.065  48.595   111.328 1.00 18.06 ? 114  VAL C C   1 
ATOM   6155  O  O   . VAL C  1 32  ? -9.480  48.767   112.470 1.00 19.80 ? 114  VAL C O   1 
ATOM   6156  C  CB  . VAL C  1 32  ? -8.086  46.317   111.165 1.00 17.04 ? 114  VAL C CB  1 
ATOM   6157  C  CG1 . VAL C  1 32  ? -9.217  45.939   110.246 1.00 16.89 ? 114  VAL C CG1 1 
ATOM   6158  C  CG2 . VAL C  1 32  ? -6.824  45.545   110.812 1.00 16.60 ? 114  VAL C CG2 1 
ATOM   6159  N  N   . PHE C  1 33  ? -9.663  49.090   110.258 1.00 16.76 ? 115  PHE C N   1 
ATOM   6160  C  CA  . PHE C  1 33  ? -10.884 49.848   110.358 1.00 16.71 ? 115  PHE C CA  1 
ATOM   6161  C  C   . PHE C  1 33  ? -11.986 49.020   110.981 1.00 15.96 ? 115  PHE C C   1 
ATOM   6162  O  O   . PHE C  1 33  ? -12.081 47.816   110.769 1.00 13.92 ? 115  PHE C O   1 
ATOM   6163  C  CB  . PHE C  1 33  ? -11.351 50.276   108.969 1.00 18.01 ? 115  PHE C CB  1 
ATOM   6164  C  CG  . PHE C  1 33  ? -10.632 51.461   108.427 1.00 17.58 ? 115  PHE C CG  1 
ATOM   6165  C  CD1 . PHE C  1 33  ? -9.963  51.386   107.209 1.00 17.08 ? 115  PHE C CD1 1 
ATOM   6166  C  CD2 . PHE C  1 33  ? -10.641 52.666   109.124 1.00 17.63 ? 115  PHE C CD2 1 
ATOM   6167  C  CE1 . PHE C  1 33  ? -9.307  52.513   106.688 1.00 18.41 ? 115  PHE C CE1 1 
ATOM   6168  C  CE2 . PHE C  1 33  ? -9.989  53.800   108.614 1.00 17.46 ? 115  PHE C CE2 1 
ATOM   6169  C  CZ  . PHE C  1 33  ? -9.323  53.722   107.397 1.00 16.74 ? 115  PHE C CZ  1 
ATOM   6170  N  N   . VAL C  1 34  ? -12.809 49.677   111.776 1.00 17.30 ? 116  VAL C N   1 
ATOM   6171  C  CA  . VAL C  1 34  ? -13.949 49.017   112.361 1.00 20.32 ? 116  VAL C CA  1 
ATOM   6172  C  C   . VAL C  1 34  ? -14.885 49.250   111.188 1.00 20.05 ? 116  VAL C C   1 
ATOM   6173  O  O   . VAL C  1 34  ? -15.083 50.387   110.783 1.00 21.51 ? 116  VAL C O   1 
ATOM   6174  C  CB  . VAL C  1 34  ? -14.431 49.761   113.613 1.00 20.61 ? 116  VAL C CB  1 
ATOM   6175  C  CG1 . VAL C  1 34  ? -14.404 51.243   113.362 1.00 22.72 ? 116  VAL C CG1 1 
ATOM   6176  C  CG2 . VAL C  1 34  ? -15.843 49.318   113.970 1.00 22.37 ? 116  VAL C CG2 1 
ATOM   6177  N  N   . ILE C  1 35  ? -15.431 48.194   110.607 1.00 20.01 ? 117  ILE C N   1 
ATOM   6178  C  CA  . ILE C  1 35  ? -16.287 48.384   109.444 1.00 20.75 ? 117  ILE C CA  1 
ATOM   6179  C  C   . ILE C  1 35  ? -17.659 47.724   109.520 1.00 22.03 ? 117  ILE C C   1 
ATOM   6180  O  O   . ILE C  1 35  ? -18.034 47.118   110.523 1.00 23.61 ? 117  ILE C O   1 
ATOM   6181  C  CB  . ILE C  1 35  ? -15.592 47.844   108.167 1.00 20.67 ? 117  ILE C CB  1 
ATOM   6182  C  CG1 . ILE C  1 35  ? -15.615 46.320   108.175 1.00 21.32 ? 117  ILE C CG1 1 
ATOM   6183  C  CG2 . ILE C  1 35  ? -14.147 48.306   108.108 1.00 18.63 ? 117  ILE C CG2 1 
ATOM   6184  C  CD1 . ILE C  1 35  ? -15.031 45.702   106.934 1.00 25.67 ? 117  ILE C CD1 1 
ATOM   6185  N  N   . ARG C  1 36  ? -18.397 47.858   108.425 1.00 22.30 ? 118  ARG C N   1 
ATOM   6186  C  CA  . ARG C  1 36  ? -19.714 47.264   108.264 1.00 21.75 ? 118  ARG C CA  1 
ATOM   6187  C  C   . ARG C  1 36  ? -19.926 47.095   106.768 1.00 22.15 ? 118  ARG C C   1 
ATOM   6188  O  O   . ARG C  1 36  ? -19.344 47.823   105.962 1.00 19.88 ? 118  ARG C O   1 
ATOM   6189  C  CB  . ARG C  1 36  ? -20.824 48.149   108.844 1.00 21.82 ? 118  ARG C CB  1 
ATOM   6190  C  CG  . ARG C  1 36  ? -20.955 48.102   110.362 1.00 21.02 ? 118  ARG C CG  1 
ATOM   6191  C  CD  . ARG C  1 36  ? -21.025 46.671   110.875 1.00 22.14 ? 118  ARG C CD  1 
ATOM   6192  N  NE  . ARG C  1 36  ? -22.014 45.871   110.159 1.00 23.54 ? 118  ARG C NE  1 
ATOM   6193  C  CZ  . ARG C  1 36  ? -23.326 45.913   110.375 1.00 23.66 ? 118  ARG C CZ  1 
ATOM   6194  N  NH1 . ARG C  1 36  ? -24.135 45.143   109.661 1.00 23.00 ? 118  ARG C NH1 1 
ATOM   6195  N  NH2 . ARG C  1 36  ? -23.830 46.705   111.312 1.00 25.06 ? 118  ARG C NH2 1 
ATOM   6196  N  N   . GLU C  1 37  ? -20.751 46.115   106.415 1.00 23.38 ? 119  GLU C N   1 
ATOM   6197  C  CA  . GLU C  1 37  ? -21.082 45.801   105.032 1.00 25.55 ? 119  GLU C CA  1 
ATOM   6198  C  C   . GLU C  1 37  ? -19.929 45.838   104.046 1.00 24.66 ? 119  GLU C C   1 
ATOM   6199  O  O   . GLU C  1 37  ? -19.868 46.714   103.177 1.00 23.76 ? 119  GLU C O   1 
ATOM   6200  C  CB  . GLU C  1 37  ? -22.196 46.717   104.527 1.00 27.92 ? 119  GLU C CB  1 
ATOM   6201  C  CG  . GLU C  1 37  ? -21.925 48.187   104.688 1.00 32.37 ? 119  GLU C CG  1 
ATOM   6202  C  CD  . GLU C  1 37  ? -22.994 49.030   104.030 1.00 36.24 ? 119  GLU C CD  1 
ATOM   6203  O  OE1 . GLU C  1 37  ? -22.864 49.310   102.811 1.00 36.89 ? 119  GLU C OE1 1 
ATOM   6204  O  OE2 . GLU C  1 37  ? -23.968 49.393   104.734 1.00 35.78 ? 119  GLU C OE2 1 
ATOM   6205  N  N   . PRO C  1 38  ? -19.004 44.872   104.162 1.00 24.30 ? 120  PRO C N   1 
ATOM   6206  C  CA  . PRO C  1 38  ? -17.837 44.759   103.289 1.00 24.63 ? 120  PRO C CA  1 
ATOM   6207  C  C   . PRO C  1 38  ? -18.224 44.004   102.026 1.00 24.46 ? 120  PRO C C   1 
ATOM   6208  O  O   . PRO C  1 38  ? -17.816 42.851   101.831 1.00 27.74 ? 120  PRO C O   1 
ATOM   6209  C  CB  . PRO C  1 38  ? -16.855 43.970   104.138 1.00 24.64 ? 120  PRO C CB  1 
ATOM   6210  C  CG  . PRO C  1 38  ? -17.759 43.008   104.829 1.00 25.63 ? 120  PRO C CG  1 
ATOM   6211  C  CD  . PRO C  1 38  ? -18.912 43.905   105.272 1.00 25.16 ? 120  PRO C CD  1 
ATOM   6212  N  N   . PHE C  1 39  ? -19.010 44.642   101.168 1.00 20.82 ? 121  PHE C N   1 
ATOM   6213  C  CA  . PHE C  1 39  ? -19.430 43.979   99.950  1.00 17.96 ? 121  PHE C CA  1 
ATOM   6214  C  C   . PHE C  1 39  ? -18.314 43.972   98.921  1.00 16.35 ? 121  PHE C C   1 
ATOM   6215  O  O   . PHE C  1 39  ? -17.489 44.880   98.871  1.00 17.07 ? 121  PHE C O   1 
ATOM   6216  C  CB  . PHE C  1 39  ? -20.702 44.635   99.397  1.00 16.68 ? 121  PHE C CB  1 
ATOM   6217  C  CG  . PHE C  1 39  ? -20.504 46.023   98.868  1.00 14.41 ? 121  PHE C CG  1 
ATOM   6218  C  CD1 . PHE C  1 39  ? -19.979 46.226   97.600  1.00 13.83 ? 121  PHE C CD1 1 
ATOM   6219  C  CD2 . PHE C  1 39  ? -20.901 47.124   99.614  1.00 13.81 ? 121  PHE C CD2 1 
ATOM   6220  C  CE1 . PHE C  1 39  ? -19.856 47.502   97.074  1.00 14.71 ? 121  PHE C CE1 1 
ATOM   6221  C  CE2 . PHE C  1 39  ? -20.784 48.407   99.105  1.00 14.84 ? 121  PHE C CE2 1 
ATOM   6222  C  CZ  . PHE C  1 39  ? -20.261 48.600   97.827  1.00 16.35 ? 121  PHE C CZ  1 
ATOM   6223  N  N   . ILE C  1 40  ? -18.293 42.923   98.114  1.00 14.19 ? 122  ILE C N   1 
ATOM   6224  C  CA  . ILE C  1 40  ? -17.282 42.742   97.090  1.00 12.83 ? 122  ILE C CA  1 
ATOM   6225  C  C   . ILE C  1 40  ? -17.804 43.098   95.718  1.00 12.66 ? 122  ILE C C   1 
ATOM   6226  O  O   . ILE C  1 40  ? -18.971 42.897   95.423  1.00 12.30 ? 122  ILE C O   1 
ATOM   6227  C  CB  . ILE C  1 40  ? -16.811 41.274   97.063  1.00 13.00 ? 122  ILE C CB  1 
ATOM   6228  C  CG1 . ILE C  1 40  ? -16.067 40.956   98.359  1.00 13.37 ? 122  ILE C CG1 1 
ATOM   6229  C  CG2 . ILE C  1 40  ? -15.952 41.004   95.833  1.00 11.93 ? 122  ILE C CG2 1 
ATOM   6230  C  CD1 . ILE C  1 40  ? -15.412 39.601   98.360  1.00 14.19 ? 122  ILE C CD1 1 
ATOM   6231  N  N   . SER C  1 41  ? -16.936 43.643   94.881  1.00 13.29 ? 123  SER C N   1 
ATOM   6232  C  CA  . SER C  1 41  ? -17.324 43.978   93.525  1.00 15.67 ? 123  SER C CA  1 
ATOM   6233  C  C   . SER C  1 41  ? -16.092 43.829   92.672  1.00 16.99 ? 123  SER C C   1 
ATOM   6234  O  O   . SER C  1 41  ? -14.982 44.115   93.119  1.00 16.32 ? 123  SER C O   1 
ATOM   6235  C  CB  . SER C  1 41  ? -17.857 45.400   93.421  1.00 17.23 ? 123  SER C CB  1 
ATOM   6236  O  OG  . SER C  1 41  ? -18.306 45.645   92.097  1.00 18.76 ? 123  SER C OG  1 
ATOM   6237  N  N   . CYS C  1 42  ? -16.283 43.377   91.440  1.00 18.30 ? 124  CYS C N   1 
ATOM   6238  C  CA  . CYS C  1 42  ? -15.151 43.158   90.565  1.00 19.64 ? 124  CYS C CA  1 
ATOM   6239  C  C   . CYS C  1 42  ? -15.221 44.005   89.318  1.00 19.80 ? 124  CYS C C   1 
ATOM   6240  O  O   . CYS C  1 42  ? -16.290 44.468   88.916  1.00 20.03 ? 124  CYS C O   1 
ATOM   6241  C  CB  . CYS C  1 42  ? -15.083 41.682   90.157  1.00 22.11 ? 124  CYS C CB  1 
ATOM   6242  S  SG  . CYS C  1 42  ? -15.139 40.459   91.520  1.00 24.01 ? 124  CYS C SG  1 
ATOM   6243  N  N   . SER C  1 43  ? -14.061 44.218   88.713  1.00 19.82 ? 125  SER C N   1 
ATOM   6244  C  CA  . SER C  1 43  ? -13.999 44.965   87.476  1.00 18.83 ? 125  SER C CA  1 
ATOM   6245  C  C   . SER C  1 43  ? -13.668 43.911   86.424  1.00 20.96 ? 125  SER C C   1 
ATOM   6246  O  O   . SER C  1 43  ? -13.990 42.724   86.590  1.00 19.92 ? 125  SER C O   1 
ATOM   6247  C  CB  . SER C  1 43  ? -12.891 46.016   87.538  1.00 17.13 ? 125  SER C CB  1 
ATOM   6248  O  OG  . SER C  1 43  ? -11.614 45.426   87.433  1.00 13.23 ? 125  SER C OG  1 
ATOM   6249  N  N   . HIS C  1 44  ? -13.029 44.334   85.340  1.00 21.74 ? 126  HIS C N   1 
ATOM   6250  C  CA  . HIS C  1 44  ? -12.647 43.396   84.300  1.00 21.82 ? 126  HIS C CA  1 
ATOM   6251  C  C   . HIS C  1 44  ? -11.218 42.891   84.562  1.00 22.29 ? 126  HIS C C   1 
ATOM   6252  O  O   . HIS C  1 44  ? -10.674 42.090   83.808  1.00 21.06 ? 126  HIS C O   1 
ATOM   6253  C  CB  . HIS C  1 44  ? -12.744 44.065   82.923  1.00 23.42 ? 126  HIS C CB  1 
ATOM   6254  C  CG  . HIS C  1 44  ? -11.796 45.205   82.730  1.00 27.70 ? 126  HIS C CG  1 
ATOM   6255  N  ND1 . HIS C  1 44  ? -11.834 46.350   83.498  1.00 29.07 ? 126  HIS C ND1 1 
ATOM   6256  C  CD2 . HIS C  1 44  ? -10.772 45.372   81.858  1.00 28.32 ? 126  HIS C CD2 1 
ATOM   6257  C  CE1 . HIS C  1 44  ? -10.875 47.172   83.109  1.00 30.76 ? 126  HIS C CE1 1 
ATOM   6258  N  NE2 . HIS C  1 44  ? -10.216 46.601   82.115  1.00 30.54 ? 126  HIS C NE2 1 
ATOM   6259  N  N   . LEU C  1 45  ? -10.613 43.354   85.651  1.00 22.59 ? 127  LEU C N   1 
ATOM   6260  C  CA  . LEU C  1 45  ? -9.253  42.940   85.980  1.00 23.66 ? 127  LEU C CA  1 
ATOM   6261  C  C   . LEU C  1 45  ? -9.048  42.490   87.427  1.00 24.59 ? 127  LEU C C   1 
ATOM   6262  O  O   . LEU C  1 45  ? -8.274  41.573   87.681  1.00 27.07 ? 127  LEU C O   1 
ATOM   6263  C  CB  . LEU C  1 45  ? -8.274  44.071   85.663  1.00 22.64 ? 127  LEU C CB  1 
ATOM   6264  C  CG  . LEU C  1 45  ? -8.303  44.578   84.219  1.00 24.14 ? 127  LEU C CG  1 
ATOM   6265  C  CD1 . LEU C  1 45  ? -7.546  45.897   84.135  1.00 23.88 ? 127  LEU C CD1 1 
ATOM   6266  C  CD2 . LEU C  1 45  ? -7.705  43.537   83.274  1.00 21.74 ? 127  LEU C CD2 1 
ATOM   6267  N  N   . GLU C  1 46  ? -9.721  43.125   88.379  1.00 24.27 ? 128  GLU C N   1 
ATOM   6268  C  CA  . GLU C  1 46  ? -9.550  42.744   89.776  1.00 25.74 ? 128  GLU C CA  1 
ATOM   6269  C  C   . GLU C  1 46  ? -10.875 42.778   90.519  1.00 25.24 ? 128  GLU C C   1 
ATOM   6270  O  O   . GLU C  1 46  ? -11.868 43.318   90.026  1.00 23.48 ? 128  GLU C O   1 
ATOM   6271  C  CB  . GLU C  1 46  ? -8.578  43.706   90.489  1.00 27.65 ? 128  GLU C CB  1 
ATOM   6272  C  CG  . GLU C  1 46  ? -9.218  45.063   90.874  1.00 31.04 ? 128  GLU C CG  1 
ATOM   6273  C  CD  . GLU C  1 46  ? -8.317  45.966   91.735  1.00 34.27 ? 128  GLU C CD  1 
ATOM   6274  O  OE1 . GLU C  1 46  ? -7.673  45.459   92.684  1.00 35.47 ? 128  GLU C OE1 1 
ATOM   6275  O  OE2 . GLU C  1 46  ? -8.271  47.194   91.478  1.00 33.70 ? 128  GLU C OE2 1 
ATOM   6276  N  N   . CYS C  1 47  ? -10.875 42.185   91.708  1.00 24.36 ? 129  CYS C N   1 
ATOM   6277  C  CA  . CYS C  1 47  ? -12.042 42.191   92.569  1.00 23.99 ? 129  CYS C CA  1 
ATOM   6278  C  C   . CYS C  1 47  ? -11.610 42.997   93.786  1.00 22.19 ? 129  CYS C C   1 
ATOM   6279  O  O   . CYS C  1 47  ? -10.453 42.936   94.203  1.00 19.44 ? 129  CYS C O   1 
ATOM   6280  C  CB  . CYS C  1 47  ? -12.445 40.779   92.989  1.00 25.38 ? 129  CYS C CB  1 
ATOM   6281  S  SG  . CYS C  1 47  ? -13.219 39.767   91.682  1.00 31.18 ? 129  CYS C SG  1 
ATOM   6282  N  N   . ARG C  1 48  ? -12.535 43.765   94.343  1.00 20.39 ? 130  ARG C N   1 
ATOM   6283  C  CA  . ARG C  1 48  ? -12.217 44.590   95.492  1.00 19.31 ? 130  ARG C CA  1 
ATOM   6284  C  C   . ARG C  1 48  ? -13.283 44.463   96.551  1.00 19.10 ? 130  ARG C C   1 
ATOM   6285  O  O   . ARG C  1 48  ? -14.408 44.053   96.267  1.00 19.77 ? 130  ARG C O   1 
ATOM   6286  C  CB  . ARG C  1 48  ? -12.109 46.063   95.079  1.00 17.90 ? 130  ARG C CB  1 
ATOM   6287  C  CG  . ARG C  1 48  ? -11.022 46.380   94.069  1.00 18.33 ? 130  ARG C CG  1 
ATOM   6288  C  CD  . ARG C  1 48  ? -10.956 47.880   93.810  1.00 19.94 ? 130  ARG C CD  1 
ATOM   6289  N  NE  . ARG C  1 48  ? -10.566 48.619   95.009  1.00 20.48 ? 130  ARG C NE  1 
ATOM   6290  C  CZ  . ARG C  1 48  ? -9.320  48.708   95.465  1.00 19.30 ? 130  ARG C CZ  1 
ATOM   6291  N  NH1 . ARG C  1 48  ? -9.069  49.396   96.571  1.00 18.55 ? 130  ARG C NH1 1 
ATOM   6292  N  NH2 . ARG C  1 48  ? -8.326  48.127   94.806  1.00 18.25 ? 130  ARG C NH2 1 
ATOM   6293  N  N   . THR C  1 49  ? -12.917 44.815   97.778  1.00 18.45 ? 131  THR C N   1 
ATOM   6294  C  CA  . THR C  1 49  ? -13.856 44.792   98.890  1.00 17.82 ? 131  THR C CA  1 
ATOM   6295  C  C   . THR C  1 49  ? -14.190 46.230   99.262  1.00 17.01 ? 131  THR C C   1 
ATOM   6296  O  O   . THR C  1 49  ? -13.306 46.993   99.657  1.00 17.32 ? 131  THR C O   1 
ATOM   6297  C  CB  . THR C  1 49  ? -13.257 44.104   100.135 1.00 17.91 ? 131  THR C CB  1 
ATOM   6298  O  OG1 . THR C  1 49  ? -13.243 42.693   99.933  1.00 20.03 ? 131  THR C OG1 1 
ATOM   6299  C  CG2 . THR C  1 49  ? -14.080 44.413   101.376 1.00 18.33 ? 131  THR C CG2 1 
ATOM   6300  N  N   . PHE C  1 50  ? -15.456 46.610   99.117  1.00 15.41 ? 132  PHE C N   1 
ATOM   6301  C  CA  . PHE C  1 50  ? -15.879 47.953   99.496  1.00 12.74 ? 132  PHE C CA  1 
ATOM   6302  C  C   . PHE C  1 50  ? -16.464 47.797   100.880 1.00 13.40 ? 132  PHE C C   1 
ATOM   6303  O  O   . PHE C  1 50  ? -16.943 46.719   101.224 1.00 15.13 ? 132  PHE C O   1 
ATOM   6304  C  CB  . PHE C  1 50  ? -16.918 48.506   98.520  1.00 9.34  ? 132  PHE C CB  1 
ATOM   6305  C  CG  . PHE C  1 50  ? -16.356 48.821   97.164  1.00 10.29 ? 132  PHE C CG  1 
ATOM   6306  C  CD1 . PHE C  1 50  ? -16.117 47.806   96.238  1.00 9.39  ? 132  PHE C CD1 1 
ATOM   6307  C  CD2 . PHE C  1 50  ? -16.002 50.127   96.829  1.00 9.48  ? 132  PHE C CD2 1 
ATOM   6308  C  CE1 . PHE C  1 50  ? -15.532 48.086   95.008  1.00 8.74  ? 132  PHE C CE1 1 
ATOM   6309  C  CE2 . PHE C  1 50  ? -15.414 50.416   95.599  1.00 7.61  ? 132  PHE C CE2 1 
ATOM   6310  C  CZ  . PHE C  1 50  ? -15.179 49.394   94.688  1.00 8.44  ? 132  PHE C CZ  1 
ATOM   6311  N  N   . PHE C  1 51  ? -16.415 48.858   101.677 1.00 13.91 ? 133  PHE C N   1 
ATOM   6312  C  CA  . PHE C  1 51  ? -16.928 48.802   103.040 1.00 14.37 ? 133  PHE C CA  1 
ATOM   6313  C  C   . PHE C  1 51  ? -17.119 50.194   103.622 1.00 14.68 ? 133  PHE C C   1 
ATOM   6314  O  O   . PHE C  1 51  ? -16.538 51.162   103.143 1.00 14.07 ? 133  PHE C O   1 
ATOM   6315  C  CB  . PHE C  1 51  ? -15.949 48.034   103.906 1.00 14.67 ? 133  PHE C CB  1 
ATOM   6316  C  CG  . PHE C  1 51  ? -14.565 48.591   103.862 1.00 15.68 ? 133  PHE C CG  1 
ATOM   6317  C  CD1 . PHE C  1 51  ? -14.239 49.732   104.583 1.00 16.01 ? 133  PHE C CD1 1 
ATOM   6318  C  CD2 . PHE C  1 51  ? -13.595 48.001   103.064 1.00 16.84 ? 133  PHE C CD2 1 
ATOM   6319  C  CE1 . PHE C  1 51  ? -12.965 50.281   104.509 1.00 17.90 ? 133  PHE C CE1 1 
ATOM   6320  C  CE2 . PHE C  1 51  ? -12.312 48.543   102.979 1.00 18.41 ? 133  PHE C CE2 1 
ATOM   6321  C  CZ  . PHE C  1 51  ? -11.997 49.686   103.706 1.00 17.71 ? 133  PHE C CZ  1 
ATOM   6322  N  N   . LEU C  1 52  ? -17.946 50.292   104.656 1.00 17.23 ? 134  LEU C N   1 
ATOM   6323  C  CA  . LEU C  1 52  ? -18.193 51.572   105.306 1.00 19.22 ? 134  LEU C CA  1 
ATOM   6324  C  C   . LEU C  1 52  ? -17.478 51.569   106.639 1.00 20.63 ? 134  LEU C C   1 
ATOM   6325  O  O   . LEU C  1 52  ? -17.493 50.571   107.347 1.00 21.49 ? 134  LEU C O   1 
ATOM   6326  C  CB  . LEU C  1 52  ? -19.689 51.795   105.530 1.00 18.71 ? 134  LEU C CB  1 
ATOM   6327  C  CG  . LEU C  1 52  ? -20.570 51.964   104.290 1.00 20.95 ? 134  LEU C CG  1 
ATOM   6328  C  CD1 . LEU C  1 52  ? -22.011 52.224   104.727 1.00 23.29 ? 134  LEU C CD1 1 
ATOM   6329  C  CD2 . LEU C  1 52  ? -20.065 53.117   103.437 1.00 19.49 ? 134  LEU C CD2 1 
ATOM   6330  N  N   . THR C  1 53  ? -16.845 52.684   106.976 1.00 22.91 ? 135  THR C N   1 
ATOM   6331  C  CA  . THR C  1 53  ? -16.127 52.787   108.233 1.00 27.36 ? 135  THR C CA  1 
ATOM   6332  C  C   . THR C  1 53  ? -16.554 54.050   108.945 1.00 28.85 ? 135  THR C C   1 
ATOM   6333  O  O   . THR C  1 53  ? -16.930 55.026   108.299 1.00 31.71 ? 135  THR C O   1 
ATOM   6334  C  CB  . THR C  1 53  ? -14.618 52.892   108.002 1.00 29.46 ? 135  THR C CB  1 
ATOM   6335  O  OG1 . THR C  1 53  ? -14.327 54.136   107.353 1.00 30.43 ? 135  THR C OG1 1 
ATOM   6336  C  CG2 . THR C  1 53  ? -14.137 51.761   107.115 1.00 31.04 ? 135  THR C CG2 1 
ATOM   6337  N  N   . GLN C  1 54  ? -16.487 54.028   110.273 1.00 30.28 ? 136  GLN C N   1 
ATOM   6338  C  CA  . GLN C  1 54  ? -16.836 55.187   111.089 1.00 30.65 ? 136  GLN C CA  1 
ATOM   6339  C  C   . GLN C  1 54  ? -15.581 56.041   111.219 1.00 28.52 ? 136  GLN C C   1 
ATOM   6340  O  O   . GLN C  1 54  ? -15.534 56.990   111.997 1.00 29.21 ? 136  GLN C O   1 
ATOM   6341  C  CB  . GLN C  1 54  ? -17.294 54.731   112.480 1.00 35.13 ? 136  GLN C CB  1 
ATOM   6342  C  CG  . GLN C  1 54  ? -18.768 54.317   112.591 1.00 41.52 ? 136  GLN C CG  1 
ATOM   6343  C  CD  . GLN C  1 54  ? -19.717 55.515   112.615 1.00 46.03 ? 136  GLN C CD  1 
ATOM   6344  O  OE1 . GLN C  1 54  ? -19.441 56.536   113.265 1.00 49.01 ? 136  GLN C OE1 1 
ATOM   6345  N  NE2 . GLN C  1 54  ? -20.847 55.390   111.922 1.00 47.45 ? 136  GLN C NE2 1 
ATOM   6346  N  N   . GLY C  1 55  ? -14.561 55.696   110.444 1.00 26.29 ? 137  GLY C N   1 
ATOM   6347  C  CA  . GLY C  1 55  ? -13.310 56.424   110.518 1.00 24.08 ? 137  GLY C CA  1 
ATOM   6348  C  C   . GLY C  1 55  ? -12.662 56.158   111.865 1.00 22.48 ? 137  GLY C C   1 
ATOM   6349  O  O   . GLY C  1 55  ? -12.171 57.076   112.520 1.00 24.17 ? 137  GLY C O   1 
ATOM   6350  N  N   . ALA C  1 56  ? -12.670 54.896   112.278 1.00 19.31 ? 138  ALA C N   1 
ATOM   6351  C  CA  . ALA C  1 56  ? -12.100 54.497   113.555 1.00 18.75 ? 138  ALA C CA  1 
ATOM   6352  C  C   . ALA C  1 56  ? -11.385 53.154   113.413 1.00 17.63 ? 138  ALA C C   1 
ATOM   6353  O  O   . ALA C  1 56  ? -11.642 52.412   112.480 1.00 18.53 ? 138  ALA C O   1 
ATOM   6354  C  CB  . ALA C  1 56  ? -13.203 54.393   114.598 1.00 19.37 ? 138  ALA C CB  1 
ATOM   6355  N  N   . LEU C  1 57  ? -10.481 52.843   114.331 1.00 15.55 ? 139  LEU C N   1 
ATOM   6356  C  CA  . LEU C  1 57  ? -9.764  51.580   114.259 1.00 14.50 ? 139  LEU C CA  1 
ATOM   6357  C  C   . LEU C  1 57  ? -10.115 50.682   115.433 1.00 16.33 ? 139  LEU C C   1 
ATOM   6358  O  O   . LEU C  1 57  ? -10.387 51.154   116.543 1.00 17.29 ? 139  LEU C O   1 
ATOM   6359  C  CB  . LEU C  1 57  ? -8.251  51.810   114.254 1.00 12.64 ? 139  LEU C CB  1 
ATOM   6360  C  CG  . LEU C  1 57  ? -7.617  52.646   113.140 1.00 13.20 ? 139  LEU C CG  1 
ATOM   6361  C  CD1 . LEU C  1 57  ? -6.098  52.524   113.204 1.00 9.37  ? 139  LEU C CD1 1 
ATOM   6362  C  CD2 . LEU C  1 57  ? -8.118  52.172   111.787 1.00 15.07 ? 139  LEU C CD2 1 
ATOM   6363  N  N   . LEU C  1 58  ? -10.101 49.380   115.193 1.00 15.42 ? 140  LEU C N   1 
ATOM   6364  C  CA  . LEU C  1 58  ? -10.379 48.444   116.255 1.00 17.45 ? 140  LEU C CA  1 
ATOM   6365  C  C   . LEU C  1 58  ? -9.433  48.686   117.427 1.00 18.34 ? 140  LEU C C   1 
ATOM   6366  O  O   . LEU C  1 58  ? -8.271  49.041   117.247 1.00 17.13 ? 140  LEU C O   1 
ATOM   6367  C  CB  . LEU C  1 58  ? -10.217 47.016   115.747 1.00 19.12 ? 140  LEU C CB  1 
ATOM   6368  C  CG  . LEU C  1 58  ? -11.256 46.647   114.695 1.00 20.48 ? 140  LEU C CG  1 
ATOM   6369  C  CD1 . LEU C  1 58  ? -10.901 45.308   114.068 1.00 21.52 ? 140  LEU C CD1 1 
ATOM   6370  C  CD2 . LEU C  1 58  ? -12.636 46.608   115.351 1.00 20.22 ? 140  LEU C CD2 1 
ATOM   6371  N  N   . ASN C  1 59  ? -9.956  48.488   118.629 1.00 21.19 ? 141  ASN C N   1 
ATOM   6372  C  CA  . ASN C  1 59  ? -9.211  48.669   119.865 1.00 23.31 ? 141  ASN C CA  1 
ATOM   6373  C  C   . ASN C  1 59  ? -8.800  50.103   120.144 1.00 24.14 ? 141  ASN C C   1 
ATOM   6374  O  O   . ASN C  1 59  ? -7.806  50.354   120.823 1.00 23.72 ? 141  ASN C O   1 
ATOM   6375  C  CB  . ASN C  1 59  ? -7.974  47.767   119.902 1.00 25.04 ? 141  ASN C CB  1 
ATOM   6376  C  CG  . ASN C  1 59  ? -8.068  46.700   120.976 1.00 24.42 ? 141  ASN C CG  1 
ATOM   6377  O  OD1 . ASN C  1 59  ? -8.575  46.950   122.065 1.00 26.40 ? 141  ASN C OD1 1 
ATOM   6378  N  ND2 . ASN C  1 59  ? -7.563  45.509   120.679 1.00 26.86 ? 141  ASN C ND2 1 
ATOM   6379  N  N   . ASP C  1 60  ? -9.547  51.051   119.600 1.00 25.07 ? 142  ASP C N   1 
ATOM   6380  C  CA  . ASP C  1 60  ? -9.261  52.444   119.878 1.00 25.58 ? 142  ASP C CA  1 
ATOM   6381  C  C   . ASP C  1 60  ? -10.575 53.017   120.375 1.00 25.52 ? 142  ASP C C   1 
ATOM   6382  O  O   . ASP C  1 60  ? -11.643 52.556   119.977 1.00 26.34 ? 142  ASP C O   1 
ATOM   6383  C  CB  . ASP C  1 60  ? -8.800  53.198   118.637 1.00 26.90 ? 142  ASP C CB  1 
ATOM   6384  C  CG  . ASP C  1 60  ? -8.487  54.662   118.938 1.00 28.04 ? 142  ASP C CG  1 
ATOM   6385  O  OD1 . ASP C  1 60  ? -7.435  54.932   119.551 1.00 29.12 ? 142  ASP C OD1 1 
ATOM   6386  O  OD2 . ASP C  1 60  ? -9.302  55.540   118.580 1.00 26.82 ? 142  ASP C OD2 1 
ATOM   6387  N  N   . LYS C  1 61  ? -10.498 54.021   121.238 1.00 24.92 ? 143  LYS C N   1 
ATOM   6388  C  CA  . LYS C  1 61  ? -11.689 54.616   121.816 1.00 23.83 ? 143  LYS C CA  1 
ATOM   6389  C  C   . LYS C  1 61  ? -12.699 55.177   120.827 1.00 24.25 ? 143  LYS C C   1 
ATOM   6390  O  O   . LYS C  1 61  ? -13.883 55.285   121.145 1.00 25.06 ? 143  LYS C O   1 
ATOM   6391  C  CB  . LYS C  1 61  ? -11.288 55.703   122.804 1.00 22.77 ? 143  LYS C CB  1 
ATOM   6392  C  CG  . LYS C  1 61  ? -10.514 56.848   122.195 1.00 23.25 ? 143  LYS C CG  1 
ATOM   6393  C  CD  . LYS C  1 61  ? -10.253 57.892   123.253 1.00 24.06 ? 143  LYS C CD  1 
ATOM   6394  C  CE  . LYS C  1 61  ? -9.978  59.252   122.663 1.00 24.74 ? 143  LYS C CE  1 
ATOM   6395  N  NZ  . LYS C  1 61  ? -10.004 60.262   123.755 1.00 27.08 ? 143  LYS C NZ  1 
ATOM   6396  N  N   . HIS C  1 62  ? -12.254 55.539   119.631 1.00 24.64 ? 144  HIS C N   1 
ATOM   6397  C  CA  . HIS C  1 62  ? -13.185 56.100   118.659 1.00 24.44 ? 144  HIS C CA  1 
ATOM   6398  C  C   . HIS C  1 62  ? -14.080 55.043   118.051 1.00 24.74 ? 144  HIS C C   1 
ATOM   6399  O  O   . HIS C  1 62  ? -14.962 55.346   117.248 1.00 24.88 ? 144  HIS C O   1 
ATOM   6400  C  CB  . HIS C  1 62  ? -12.431 56.836   117.563 1.00 23.93 ? 144  HIS C CB  1 
ATOM   6401  C  CG  . HIS C  1 62  ? -11.708 58.044   118.057 1.00 22.62 ? 144  HIS C CG  1 
ATOM   6402  N  ND1 . HIS C  1 62  ? -12.369 59.168   118.502 1.00 23.75 ? 144  HIS C ND1 1 
ATOM   6403  C  CD2 . HIS C  1 62  ? -10.392 58.291   118.212 1.00 23.00 ? 144  HIS C CD2 1 
ATOM   6404  C  CE1 . HIS C  1 62  ? -11.483 60.058   118.908 1.00 23.05 ? 144  HIS C CE1 1 
ATOM   6405  N  NE2 . HIS C  1 62  ? -10.276 59.555   118.746 1.00 23.47 ? 144  HIS C NE2 1 
ATOM   6406  N  N   . SER C  1 63  ? -13.844 53.795   118.425 1.00 25.53 ? 145  SER C N   1 
ATOM   6407  C  CA  . SER C  1 63  ? -14.668 52.715   117.925 1.00 25.50 ? 145  SER C CA  1 
ATOM   6408  C  C   . SER C  1 63  ? -15.851 52.583   118.878 1.00 26.45 ? 145  SER C C   1 
ATOM   6409  O  O   . SER C  1 63  ? -16.632 51.651   118.763 1.00 26.14 ? 145  SER C O   1 
ATOM   6410  C  CB  . SER C  1 63  ? -13.870 51.415   117.891 1.00 24.12 ? 145  SER C CB  1 
ATOM   6411  O  OG  . SER C  1 63  ? -13.550 50.986   119.199 1.00 22.21 ? 145  SER C OG  1 
ATOM   6412  N  N   . ASN C  1 64  ? -15.976 53.537   119.803 1.00 30.24 ? 146  ASN C N   1 
ATOM   6413  C  CA  . ASN C  1 64  ? -17.043 53.556   120.807 1.00 33.91 ? 146  ASN C CA  1 
ATOM   6414  C  C   . ASN C  1 64  ? -18.406 53.156   120.257 1.00 36.85 ? 146  ASN C C   1 
ATOM   6415  O  O   . ASN C  1 64  ? -19.254 52.654   120.988 1.00 37.09 ? 146  ASN C O   1 
ATOM   6416  C  CB  . ASN C  1 64  ? -17.153 54.932   121.448 1.00 34.17 ? 146  ASN C CB  1 
ATOM   6417  C  CG  . ASN C  1 64  ? -17.756 54.871   122.838 1.00 35.66 ? 146  ASN C CG  1 
ATOM   6418  O  OD1 . ASN C  1 64  ? -18.763 54.200   123.067 1.00 34.19 ? 146  ASN C OD1 1 
ATOM   6419  N  ND2 . ASN C  1 64  ? -17.142 55.580   123.775 1.00 36.98 ? 146  ASN C ND2 1 
ATOM   6420  N  N   . GLY C  1 65  ? -18.625 53.413   118.977 1.00 39.52 ? 147  GLY C N   1 
ATOM   6421  C  CA  . GLY C  1 65  ? -19.864 53.006   118.339 1.00 44.18 ? 147  GLY C CA  1 
ATOM   6422  C  C   . GLY C  1 65  ? -21.229 53.387   118.883 1.00 47.33 ? 147  GLY C C   1 
ATOM   6423  O  O   . GLY C  1 65  ? -22.232 53.053   118.250 1.00 47.95 ? 147  GLY C O   1 
ATOM   6424  N  N   . THR C  1 66  ? -21.316 54.048   120.034 1.00 50.22 ? 148  THR C N   1 
ATOM   6425  C  CA  . THR C  1 66  ? -22.644 54.439   120.507 1.00 54.48 ? 148  THR C CA  1 
ATOM   6426  C  C   . THR C  1 66  ? -23.161 55.478   119.506 1.00 55.98 ? 148  THR C C   1 
ATOM   6427  O  O   . THR C  1 66  ? -24.325 55.876   119.536 1.00 57.20 ? 148  THR C O   1 
ATOM   6428  C  CB  . THR C  1 66  ? -22.620 55.053   121.939 1.00 55.42 ? 148  THR C CB  1 
ATOM   6429  O  OG1 . THR C  1 66  ? -21.530 55.980   122.051 1.00 58.35 ? 148  THR C OG1 1 
ATOM   6430  C  CG2 . THR C  1 66  ? -22.490 53.953   122.997 1.00 54.68 ? 148  THR C CG2 1 
ATOM   6431  N  N   . VAL C  1 67  ? -22.270 55.888   118.605 1.00 56.90 ? 149  VAL C N   1 
ATOM   6432  C  CA  . VAL C  1 67  ? -22.568 56.863   117.559 1.00 56.96 ? 149  VAL C CA  1 
ATOM   6433  C  C   . VAL C  1 67  ? -23.710 56.406   116.658 1.00 56.87 ? 149  VAL C C   1 
ATOM   6434  O  O   . VAL C  1 67  ? -23.891 55.212   116.426 1.00 57.68 ? 149  VAL C O   1 
ATOM   6435  C  CB  . VAL C  1 67  ? -21.333 57.092   116.650 1.00 56.63 ? 149  VAL C CB  1 
ATOM   6436  C  CG1 . VAL C  1 67  ? -21.606 58.220   115.662 1.00 55.94 ? 149  VAL C CG1 1 
ATOM   6437  C  CG2 . VAL C  1 67  ? -20.111 57.387   117.498 1.00 57.56 ? 149  VAL C CG2 1 
ATOM   6438  N  N   . LYS C  1 68  ? -24.470 57.366   116.144 1.00 56.56 ? 150  LYS C N   1 
ATOM   6439  C  CA  . LYS C  1 68  ? -25.575 57.075   115.232 1.00 55.57 ? 150  LYS C CA  1 
ATOM   6440  C  C   . LYS C  1 68  ? -25.033 56.295   114.023 1.00 53.52 ? 150  LYS C C   1 
ATOM   6441  O  O   . LYS C  1 68  ? -23.889 56.507   113.607 1.00 53.57 ? 150  LYS C O   1 
ATOM   6442  C  CB  . LYS C  1 68  ? -26.213 58.392   114.760 1.00 56.74 ? 150  LYS C CB  1 
ATOM   6443  C  CG  . LYS C  1 68  ? -25.187 59.514   114.566 1.00 59.92 ? 150  LYS C CG  1 
ATOM   6444  C  CD  . LYS C  1 68  ? -25.571 60.515   113.479 1.00 61.20 ? 150  LYS C CD  1 
ATOM   6445  C  CE  . LYS C  1 68  ? -26.815 61.316   113.820 1.00 62.40 ? 150  LYS C CE  1 
ATOM   6446  N  NZ  . LYS C  1 68  ? -27.132 62.272   112.715 1.00 62.83 ? 150  LYS C NZ  1 
ATOM   6447  N  N   . ASP C  1 69  ? -25.847 55.392   113.475 1.00 50.51 ? 151  ASP C N   1 
ATOM   6448  C  CA  . ASP C  1 69  ? -25.457 54.598   112.307 1.00 46.97 ? 151  ASP C CA  1 
ATOM   6449  C  C   . ASP C  1 69  ? -25.065 55.509   111.161 1.00 42.74 ? 151  ASP C C   1 
ATOM   6450  O  O   . ASP C  1 69  ? -24.154 55.211   110.395 1.00 41.71 ? 151  ASP C O   1 
ATOM   6451  C  CB  . ASP C  1 69  ? -26.619 53.724   111.835 1.00 50.54 ? 151  ASP C CB  1 
ATOM   6452  C  CG  . ASP C  1 69  ? -26.858 52.545   112.739 1.00 54.14 ? 151  ASP C CG  1 
ATOM   6453  O  OD1 . ASP C  1 69  ? -25.953 51.681   112.820 1.00 56.21 ? 151  ASP C OD1 1 
ATOM   6454  O  OD2 . ASP C  1 69  ? -27.944 52.486   113.366 1.00 54.03 ? 151  ASP C OD2 1 
ATOM   6455  N  N   . ARG C  1 70  ? -25.774 56.624   111.051 1.00 38.19 ? 152  ARG C N   1 
ATOM   6456  C  CA  . ARG C  1 70  ? -25.525 57.582   109.990 1.00 34.37 ? 152  ARG C CA  1 
ATOM   6457  C  C   . ARG C  1 70  ? -24.790 58.827   110.495 1.00 31.75 ? 152  ARG C C   1 
ATOM   6458  O  O   . ARG C  1 70  ? -25.407 59.871   110.736 1.00 32.39 ? 152  ARG C O   1 
ATOM   6459  C  CB  . ARG C  1 70  ? -26.857 57.970   109.343 1.00 32.05 ? 152  ARG C CB  1 
ATOM   6460  C  CG  . ARG C  1 70  ? -27.615 56.792   108.746 1.00 29.19 ? 152  ARG C CG  1 
ATOM   6461  C  CD  . ARG C  1 70  ? -28.961 57.229   108.206 1.00 27.38 ? 152  ARG C CD  1 
ATOM   6462  N  NE  . ARG C  1 70  ? -29.869 57.596   109.284 1.00 26.26 ? 152  ARG C NE  1 
ATOM   6463  C  CZ  . ARG C  1 70  ? -30.421 56.722   110.118 1.00 26.07 ? 152  ARG C CZ  1 
ATOM   6464  N  NH1 . ARG C  1 70  ? -31.239 57.138   111.078 1.00 24.03 ? 152  ARG C NH1 1 
ATOM   6465  N  NH2 . ARG C  1 70  ? -30.160 55.429   109.986 1.00 26.28 ? 152  ARG C NH2 1 
ATOM   6466  N  N   . SER C  1 71  ? -23.473 58.717   110.649 1.00 26.70 ? 153  SER C N   1 
ATOM   6467  C  CA  . SER C  1 71  ? -22.679 59.843   111.122 1.00 23.75 ? 153  SER C CA  1 
ATOM   6468  C  C   . SER C  1 71  ? -21.934 60.457   109.957 1.00 22.42 ? 153  SER C C   1 
ATOM   6469  O  O   . SER C  1 71  ? -21.722 59.805   108.941 1.00 23.10 ? 153  SER C O   1 
ATOM   6470  C  CB  . SER C  1 71  ? -21.654 59.397   112.152 1.00 21.66 ? 153  SER C CB  1 
ATOM   6471  O  OG  . SER C  1 71  ? -20.494 58.939   111.494 1.00 22.68 ? 153  SER C OG  1 
ATOM   6472  N  N   . PRO C  1 72  ? -21.524 61.727   110.091 1.00 21.88 ? 154  PRO C N   1 
ATOM   6473  C  CA  . PRO C  1 72  ? -20.791 62.433   109.036 1.00 19.99 ? 154  PRO C CA  1 
ATOM   6474  C  C   . PRO C  1 72  ? -19.363 61.913   108.851 1.00 19.55 ? 154  PRO C C   1 
ATOM   6475  O  O   . PRO C  1 72  ? -18.649 62.343   107.949 1.00 19.12 ? 154  PRO C O   1 
ATOM   6476  C  CB  . PRO C  1 72  ? -20.834 63.886   109.504 1.00 19.91 ? 154  PRO C CB  1 
ATOM   6477  C  CG  . PRO C  1 72  ? -20.865 63.756   110.988 1.00 19.35 ? 154  PRO C CG  1 
ATOM   6478  C  CD  . PRO C  1 72  ? -21.844 62.640   111.203 1.00 20.27 ? 154  PRO C CD  1 
ATOM   6479  N  N   . HIS C  1 73  ? -18.955 60.974   109.695 1.00 18.76 ? 155  HIS C N   1 
ATOM   6480  C  CA  . HIS C  1 73  ? -17.615 60.412   109.598 1.00 18.98 ? 155  HIS C CA  1 
ATOM   6481  C  C   . HIS C  1 73  ? -17.593 59.127   108.787 1.00 19.08 ? 155  HIS C C   1 
ATOM   6482  O  O   . HIS C  1 73  ? -16.538 58.679   108.363 1.00 18.78 ? 155  HIS C O   1 
ATOM   6483  C  CB  . HIS C  1 73  ? -17.074 60.136   110.989 1.00 20.34 ? 155  HIS C CB  1 
ATOM   6484  C  CG  . HIS C  1 73  ? -17.218 61.293   111.921 1.00 22.73 ? 155  HIS C CG  1 
ATOM   6485  N  ND1 . HIS C  1 73  ? -17.879 61.203   113.124 1.00 22.66 ? 155  HIS C ND1 1 
ATOM   6486  C  CD2 . HIS C  1 73  ? -16.838 62.590   111.797 1.00 23.63 ? 155  HIS C CD2 1 
ATOM   6487  C  CE1 . HIS C  1 73  ? -17.907 62.392   113.702 1.00 23.99 ? 155  HIS C CE1 1 
ATOM   6488  N  NE2 . HIS C  1 73  ? -17.282 63.250   112.915 1.00 23.56 ? 155  HIS C NE2 1 
ATOM   6489  N  N   . ARG C  1 74  ? -18.762 58.537   108.573 1.00 19.47 ? 156  ARG C N   1 
ATOM   6490  C  CA  . ARG C  1 74  ? -18.855 57.297   107.819 1.00 20.42 ? 156  ARG C CA  1 
ATOM   6491  C  C   . ARG C  1 74  ? -18.354 57.542   106.396 1.00 21.39 ? 156  ARG C C   1 
ATOM   6492  O  O   . ARG C  1 74  ? -18.782 58.489   105.732 1.00 22.47 ? 156  ARG C O   1 
ATOM   6493  C  CB  . ARG C  1 74  ? -20.311 56.820   107.783 1.00 21.89 ? 156  ARG C CB  1 
ATOM   6494  C  CG  . ARG C  1 74  ? -20.509 55.308   107.713 1.00 24.70 ? 156  ARG C CG  1 
ATOM   6495  C  CD  . ARG C  1 74  ? -20.800 54.722   109.090 1.00 25.79 ? 156  ARG C CD  1 
ATOM   6496  N  NE  . ARG C  1 74  ? -21.056 53.280   109.063 1.00 29.96 ? 156  ARG C NE  1 
ATOM   6497  C  CZ  . ARG C  1 74  ? -22.132 52.700   108.527 1.00 31.45 ? 156  ARG C CZ  1 
ATOM   6498  N  NH1 . ARG C  1 74  ? -22.261 51.378   108.562 1.00 31.93 ? 156  ARG C NH1 1 
ATOM   6499  N  NH2 . ARG C  1 74  ? -23.080 53.431   107.957 1.00 33.12 ? 156  ARG C NH2 1 
ATOM   6500  N  N   . THR C  1 75  ? -17.443 56.698   105.924 1.00 20.31 ? 157  THR C N   1 
ATOM   6501  C  CA  . THR C  1 75  ? -16.929 56.857   104.570 1.00 19.52 ? 157  THR C CA  1 
ATOM   6502  C  C   . THR C  1 75  ? -16.891 55.523   103.847 1.00 19.15 ? 157  THR C C   1 
ATOM   6503  O  O   . THR C  1 75  ? -16.675 54.477   104.456 1.00 21.30 ? 157  THR C O   1 
ATOM   6504  C  CB  . THR C  1 75  ? -15.491 57.429   104.552 1.00 20.59 ? 157  THR C CB  1 
ATOM   6505  O  OG1 . THR C  1 75  ? -14.603 56.505   105.191 1.00 22.06 ? 157  THR C OG1 1 
ATOM   6506  C  CG2 . THR C  1 75  ? -15.427 58.771   105.262 1.00 18.33 ? 157  THR C CG2 1 
ATOM   6507  N  N   . LEU C  1 76  ? -17.114 55.565   102.541 1.00 17.40 ? 158  LEU C N   1 
ATOM   6508  C  CA  . LEU C  1 76  ? -17.064 54.368   101.726 1.00 14.85 ? 158  LEU C CA  1 
ATOM   6509  C  C   . LEU C  1 76  ? -15.633 54.202   101.232 1.00 13.59 ? 158  LEU C C   1 
ATOM   6510  O  O   . LEU C  1 76  ? -15.082 55.107   100.607 1.00 13.75 ? 158  LEU C O   1 
ATOM   6511  C  CB  . LEU C  1 76  ? -17.990 54.493   100.518 1.00 12.80 ? 158  LEU C CB  1 
ATOM   6512  C  CG  . LEU C  1 76  ? -17.743 53.366   99.507  1.00 14.35 ? 158  LEU C CG  1 
ATOM   6513  C  CD1 . LEU C  1 76  ? -18.130 52.008   100.110 1.00 11.25 ? 158  LEU C CD1 1 
ATOM   6514  C  CD2 . LEU C  1 76  ? -18.522 53.643   98.248  1.00 15.02 ? 158  LEU C CD2 1 
ATOM   6515  N  N   . MET C  1 77  ? -15.032 53.052   101.509 1.00 13.17 ? 159  MET C N   1 
ATOM   6516  C  CA  . MET C  1 77  ? -13.668 52.791   101.058 1.00 14.82 ? 159  MET C CA  1 
ATOM   6517  C  C   . MET C  1 77  ? -13.534 51.385   100.475 1.00 14.70 ? 159  MET C C   1 
ATOM   6518  O  O   . MET C  1 77  ? -14.480 50.584   100.505 1.00 13.43 ? 159  MET C O   1 
ATOM   6519  C  CB  . MET C  1 77  ? -12.686 52.968   102.211 1.00 15.82 ? 159  MET C CB  1 
ATOM   6520  C  CG  . MET C  1 77  ? -12.735 54.347   102.819 1.00 21.50 ? 159  MET C CG  1 
ATOM   6521  S  SD  . MET C  1 77  ? -11.343 54.660   103.900 1.00 26.88 ? 159  MET C SD  1 
ATOM   6522  C  CE  . MET C  1 77  ? -11.952 53.895   105.397 1.00 28.76 ? 159  MET C CE  1 
ATOM   6523  N  N   . SER C  1 78  ? -12.362 51.079   99.937  1.00 12.83 ? 160  SER C N   1 
ATOM   6524  C  CA  . SER C  1 78  ? -12.173 49.766   99.372  1.00 14.12 ? 160  SER C CA  1 
ATOM   6525  C  C   . SER C  1 78  ? -10.718 49.334   99.377  1.00 15.41 ? 160  SER C C   1 
ATOM   6526  O  O   . SER C  1 78  ? -9.812  50.153   99.268  1.00 17.18 ? 160  SER C O   1 
ATOM   6527  C  CB  . SER C  1 78  ? -12.705 49.731   97.944  1.00 11.98 ? 160  SER C CB  1 
ATOM   6528  O  OG  . SER C  1 78  ? -11.808 50.363   97.058  1.00 11.91 ? 160  SER C OG  1 
ATOM   6529  N  N   . CYS C  1 79  ? -10.504 48.036   99.518  1.00 15.02 ? 161  CYS C N   1 
ATOM   6530  C  CA  . CYS C  1 79  ? -9.167  47.484   99.498  1.00 17.10 ? 161  CYS C CA  1 
ATOM   6531  C  C   . CYS C  1 79  ? -9.312  46.188   98.730  1.00 16.92 ? 161  CYS C C   1 
ATOM   6532  O  O   . CYS C  1 79  ? -10.426 45.775   98.409  1.00 15.63 ? 161  CYS C O   1 
ATOM   6533  C  CB  . CYS C  1 79  ? -8.664  47.214   100.922 1.00 17.06 ? 161  CYS C CB  1 
ATOM   6534  S  SG  . CYS C  1 79  ? -9.696  46.066   101.865 1.00 22.70 ? 161  CYS C SG  1 
ATOM   6535  N  N   . PRO C  1 80  ? -8.190  45.545   98.393  1.00 18.32 ? 162  PRO C N   1 
ATOM   6536  C  CA  . PRO C  1 80  ? -8.237  44.275   97.653  1.00 19.68 ? 162  PRO C CA  1 
ATOM   6537  C  C   . PRO C  1 80  ? -8.882  43.156   98.486  1.00 19.21 ? 162  PRO C C   1 
ATOM   6538  O  O   . PRO C  1 80  ? -8.779  43.140   99.714  1.00 19.32 ? 162  PRO C O   1 
ATOM   6539  C  CB  . PRO C  1 80  ? -6.769  44.013   97.312  1.00 18.90 ? 162  PRO C CB  1 
ATOM   6540  C  CG  . PRO C  1 80  ? -6.025  44.785   98.390  1.00 20.33 ? 162  PRO C CG  1 
ATOM   6541  C  CD  . PRO C  1 80  ? -6.811  46.038   98.541  1.00 18.79 ? 162  PRO C CD  1 
ATOM   6542  N  N   . VAL C  1 81  ? -9.567  42.241   97.807  1.00 18.29 ? 163  VAL C N   1 
ATOM   6543  C  CA  . VAL C  1 81  ? -10.251 41.126   98.460  1.00 17.76 ? 163  VAL C CA  1 
ATOM   6544  C  C   . VAL C  1 81  ? -9.350  40.247   99.320  1.00 17.92 ? 163  VAL C C   1 
ATOM   6545  O  O   . VAL C  1 81  ? -8.260  39.870   98.908  1.00 17.00 ? 163  VAL C O   1 
ATOM   6546  C  CB  . VAL C  1 81  ? -10.930 40.207   97.422  1.00 16.68 ? 163  VAL C CB  1 
ATOM   6547  C  CG1 . VAL C  1 81  ? -11.644 39.064   98.116  1.00 17.22 ? 163  VAL C CG1 1 
ATOM   6548  C  CG2 . VAL C  1 81  ? -11.906 40.993   96.605  1.00 18.55 ? 163  VAL C CG2 1 
ATOM   6549  N  N   . GLY C  1 82  ? -9.826  39.911   100.512 1.00 19.28 ? 164  GLY C N   1 
ATOM   6550  C  CA  . GLY C  1 82  ? -9.060  39.051   101.390 1.00 20.64 ? 164  GLY C CA  1 
ATOM   6551  C  C   . GLY C  1 82  ? -8.084  39.790   102.273 1.00 22.38 ? 164  GLY C C   1 
ATOM   6552  O  O   . GLY C  1 82  ? -7.475  39.202   103.166 1.00 24.00 ? 164  GLY C O   1 
ATOM   6553  N  N   . GLU C  1 83  ? -7.924  41.083   102.032 1.00 22.79 ? 165  GLU C N   1 
ATOM   6554  C  CA  . GLU C  1 83  ? -7.011  41.876   102.836 1.00 22.24 ? 165  GLU C CA  1 
ATOM   6555  C  C   . GLU C  1 83  ? -7.787  42.590   103.927 1.00 20.69 ? 165  GLU C C   1 
ATOM   6556  O  O   . GLU C  1 83  ? -8.921  43.008   103.715 1.00 22.98 ? 165  GLU C O   1 
ATOM   6557  C  CB  . GLU C  1 83  ? -6.271  42.871   101.942 1.00 24.34 ? 165  GLU C CB  1 
ATOM   6558  C  CG  . GLU C  1 83  ? -5.337  42.166   100.958 1.00 28.39 ? 165  GLU C CG  1 
ATOM   6559  C  CD  . GLU C  1 83  ? -4.496  43.117   100.117 1.00 30.87 ? 165  GLU C CD  1 
ATOM   6560  O  OE1 . GLU C  1 83  ? -4.208  44.240   100.581 1.00 31.66 ? 165  GLU C OE1 1 
ATOM   6561  O  OE2 . GLU C  1 83  ? -4.104  42.731   98.991  1.00 32.33 ? 165  GLU C OE2 1 
ATOM   6562  N  N   . ALA C  1 84  ? -7.198  42.696   105.109 1.00 17.80 ? 166  ALA C N   1 
ATOM   6563  C  CA  . ALA C  1 84  ? -7.864  43.382   106.202 1.00 16.21 ? 166  ALA C CA  1 
ATOM   6564  C  C   . ALA C  1 84  ? -7.917  44.869   105.856 1.00 15.00 ? 166  ALA C C   1 
ATOM   6565  O  O   . ALA C  1 84  ? -6.920  45.448   105.434 1.00 14.55 ? 166  ALA C O   1 
ATOM   6566  C  CB  . ALA C  1 84  ? -7.093  43.177   107.496 1.00 16.23 ? 166  ALA C CB  1 
ATOM   6567  N  N   . PRO C  1 85  ? -9.081  45.505   106.024 1.00 14.01 ? 167  PRO C N   1 
ATOM   6568  C  CA  . PRO C  1 85  ? -9.193  46.934   105.711 1.00 14.35 ? 167  PRO C CA  1 
ATOM   6569  C  C   . PRO C  1 85  ? -8.484  47.872   106.691 1.00 14.80 ? 167  PRO C C   1 
ATOM   6570  O  O   . PRO C  1 85  ? -8.947  48.081   107.812 1.00 15.86 ? 167  PRO C O   1 
ATOM   6571  C  CB  . PRO C  1 85  ? -10.708 47.161   105.676 1.00 14.39 ? 167  PRO C CB  1 
ATOM   6572  C  CG  . PRO C  1 85  ? -11.223 46.157   106.671 1.00 13.47 ? 167  PRO C CG  1 
ATOM   6573  C  CD  . PRO C  1 85  ? -10.402 44.927   106.335 1.00 14.49 ? 167  PRO C CD  1 
ATOM   6574  N  N   . SER C  1 86  ? -7.363  48.444   106.267 1.00 14.36 ? 168  SER C N   1 
ATOM   6575  C  CA  . SER C  1 86  ? -6.628  49.365   107.117 1.00 14.67 ? 168  SER C CA  1 
ATOM   6576  C  C   . SER C  1 86  ? -6.377  50.677   106.383 1.00 16.04 ? 168  SER C C   1 
ATOM   6577  O  O   . SER C  1 86  ? -6.462  50.751   105.154 1.00 16.03 ? 168  SER C O   1 
ATOM   6578  C  CB  . SER C  1 86  ? -5.289  48.763   107.522 1.00 16.21 ? 168  SER C CB  1 
ATOM   6579  O  OG  . SER C  1 86  ? -4.305  49.013   106.538 1.00 19.04 ? 168  SER C OG  1 
ATOM   6580  N  N   . PRO C  1 87  ? -6.054  51.739   107.130 1.00 16.59 ? 169  PRO C N   1 
ATOM   6581  C  CA  . PRO C  1 87  ? -5.805  53.006   106.447 1.00 16.31 ? 169  PRO C CA  1 
ATOM   6582  C  C   . PRO C  1 87  ? -4.525  52.974   105.615 1.00 17.77 ? 169  PRO C C   1 
ATOM   6583  O  O   . PRO C  1 87  ? -4.190  53.964   104.970 1.00 18.99 ? 169  PRO C O   1 
ATOM   6584  C  CB  . PRO C  1 87  ? -5.718  53.999   107.600 1.00 15.19 ? 169  PRO C CB  1 
ATOM   6585  C  CG  . PRO C  1 87  ? -5.133  53.177   108.709 1.00 15.59 ? 169  PRO C CG  1 
ATOM   6586  C  CD  . PRO C  1 87  ? -5.881  51.873   108.589 1.00 16.34 ? 169  PRO C CD  1 
ATOM   6587  N  N   . TYR C  1 88  A -3.810  51.847   105.624 1.00 16.44 ? 169  TYR C N   1 
ATOM   6588  C  CA  . TYR C  1 88  A -2.553  51.759   104.877 1.00 16.87 ? 169  TYR C CA  1 
ATOM   6589  C  C   . TYR C  1 88  A -2.709  51.019   103.558 1.00 17.25 ? 169  TYR C C   1 
ATOM   6590  O  O   . TYR C  1 88  A -1.838  51.088   102.698 1.00 15.68 ? 169  TYR C O   1 
ATOM   6591  C  CB  . TYR C  1 88  A -1.466  51.071   105.715 1.00 15.97 ? 169  TYR C CB  1 
ATOM   6592  C  CG  . TYR C  1 88  A -1.372  51.577   107.138 1.00 14.89 ? 169  TYR C CG  1 
ATOM   6593  C  CD1 . TYR C  1 88  A -1.166  50.696   108.190 1.00 11.67 ? 169  TYR C CD1 1 
ATOM   6594  C  CD2 . TYR C  1 88  A -1.513  52.933   107.432 1.00 13.96 ? 169  TYR C CD2 1 
ATOM   6595  C  CE1 . TYR C  1 88  A -1.112  51.142   109.497 1.00 13.00 ? 169  TYR C CE1 1 
ATOM   6596  C  CE2 . TYR C  1 88  A -1.457  53.393   108.743 1.00 12.98 ? 169  TYR C CE2 1 
ATOM   6597  C  CZ  . TYR C  1 88  A -1.257  52.490   109.774 1.00 13.55 ? 169  TYR C CZ  1 
ATOM   6598  O  OH  . TYR C  1 88  A -1.214  52.913   111.091 1.00 14.39 ? 169  TYR C OH  1 
ATOM   6599  N  N   . ASN C  1 89  ? -3.820  50.318   103.387 1.00 17.89 ? 170  ASN C N   1 
ATOM   6600  C  CA  . ASN C  1 89  ? -4.031  49.597   102.135 1.00 19.52 ? 170  ASN C CA  1 
ATOM   6601  C  C   . ASN C  1 89  ? -5.384  49.887   101.477 1.00 19.41 ? 170  ASN C C   1 
ATOM   6602  O  O   . ASN C  1 89  ? -5.680  49.334   100.419 1.00 21.64 ? 170  ASN C O   1 
ATOM   6603  C  CB  . ASN C  1 89  ? -3.913  48.097   102.380 1.00 20.50 ? 170  ASN C CB  1 
ATOM   6604  C  CG  . ASN C  1 89  ? -5.141  47.523   103.063 1.00 22.22 ? 170  ASN C CG  1 
ATOM   6605  O  OD1 . ASN C  1 89  ? -5.772  48.180   103.898 1.00 20.93 ? 170  ASN C OD1 1 
ATOM   6606  N  ND2 . ASN C  1 89  ? -5.483  46.288   102.715 1.00 23.16 ? 170  ASN C ND2 1 
ATOM   6607  N  N   . SER C  1 90  ? -6.197  50.747   102.089 1.00 17.67 ? 171  SER C N   1 
ATOM   6608  C  CA  . SER C  1 90  ? -7.521  51.051   101.548 1.00 17.18 ? 171  SER C CA  1 
ATOM   6609  C  C   . SER C  1 90  ? -7.569  52.343   100.760 1.00 18.31 ? 171  SER C C   1 
ATOM   6610  O  O   . SER C  1 90  ? -6.920  53.323   101.110 1.00 20.08 ? 171  SER C O   1 
ATOM   6611  C  CB  . SER C  1 90  ? -8.552  51.125   102.673 1.00 15.03 ? 171  SER C CB  1 
ATOM   6612  O  OG  . SER C  1 90  ? -8.441  49.993   103.509 1.00 14.01 ? 171  SER C OG  1 
ATOM   6613  N  N   . ARG C  1 91  ? -8.344  52.339   99.686  1.00 17.96 ? 172  ARG C N   1 
ATOM   6614  C  CA  . ARG C  1 91  ? -8.487  53.514   98.852  1.00 19.37 ? 172  ARG C CA  1 
ATOM   6615  C  C   . ARG C  1 91  ? -9.753  54.247   99.306  1.00 18.83 ? 172  ARG C C   1 
ATOM   6616  O  O   . ARG C  1 91  ? -10.742 53.612   99.683  1.00 18.80 ? 172  ARG C O   1 
ATOM   6617  C  CB  . ARG C  1 91  ? -8.598  53.082   97.386  1.00 22.40 ? 172  ARG C CB  1 
ATOM   6618  C  CG  . ARG C  1 91  ? -8.842  54.208   96.411  1.00 28.71 ? 172  ARG C CG  1 
ATOM   6619  C  CD  . ARG C  1 91  ? -9.642  53.708   95.217  1.00 34.68 ? 172  ARG C CD  1 
ATOM   6620  N  NE  . ARG C  1 91  ? -8.902  52.730   94.425  1.00 39.22 ? 172  ARG C NE  1 
ATOM   6621  C  CZ  . ARG C  1 91  ? -9.466  51.841   93.607  1.00 40.39 ? 172  ARG C CZ  1 
ATOM   6622  N  NH1 . ARG C  1 91  ? -8.702  50.996   92.926  1.00 40.67 ? 172  ARG C NH1 1 
ATOM   6623  N  NH2 . ARG C  1 91  ? -10.789 51.778   93.486  1.00 39.25 ? 172  ARG C NH2 1 
ATOM   6624  N  N   . PHE C  1 92  ? -9.722  55.575   99.302  1.00 18.47 ? 173  PHE C N   1 
ATOM   6625  C  CA  . PHE C  1 92  ? -10.899 56.339   99.705  1.00 18.94 ? 173  PHE C CA  1 
ATOM   6626  C  C   . PHE C  1 92  ? -11.844 56.398   98.512  1.00 18.45 ? 173  PHE C C   1 
ATOM   6627  O  O   . PHE C  1 92  ? -11.405 56.633   97.391  1.00 18.49 ? 173  PHE C O   1 
ATOM   6628  C  CB  . PHE C  1 92  ? -10.523 57.764   100.113 1.00 19.33 ? 173  PHE C CB  1 
ATOM   6629  C  CG  . PHE C  1 92  ? -11.707 58.616   100.442 1.00 18.21 ? 173  PHE C CG  1 
ATOM   6630  C  CD1 . PHE C  1 92  ? -12.315 58.536   101.687 1.00 19.35 ? 173  PHE C CD1 1 
ATOM   6631  C  CD2 . PHE C  1 92  ? -12.268 59.448   99.478  1.00 18.69 ? 173  PHE C CD2 1 
ATOM   6632  C  CE1 . PHE C  1 92  ? -13.470 59.276   101.968 1.00 17.84 ? 173  PHE C CE1 1 
ATOM   6633  C  CE2 . PHE C  1 92  ? -13.417 60.184   99.750  1.00 18.06 ? 173  PHE C CE2 1 
ATOM   6634  C  CZ  . PHE C  1 92  ? -14.018 60.093   100.998 1.00 17.15 ? 173  PHE C CZ  1 
ATOM   6635  N  N   . GLU C  1 93  ? -13.136 56.186   98.748  1.00 18.72 ? 174  GLU C N   1 
ATOM   6636  C  CA  . GLU C  1 93  ? -14.120 56.209   97.668  1.00 19.38 ? 174  GLU C CA  1 
ATOM   6637  C  C   . GLU C  1 93  ? -15.104 57.354   97.819  1.00 19.64 ? 174  GLU C C   1 
ATOM   6638  O  O   . GLU C  1 93  ? -15.369 58.079   96.860  1.00 21.96 ? 174  GLU C O   1 
ATOM   6639  C  CB  . GLU C  1 93  ? -14.905 54.898   97.618  1.00 20.22 ? 174  GLU C CB  1 
ATOM   6640  C  CG  . GLU C  1 93  ? -14.041 53.655   97.508  1.00 23.82 ? 174  GLU C CG  1 
ATOM   6641  C  CD  . GLU C  1 93  ? -13.352 53.548   96.169  1.00 25.50 ? 174  GLU C CD  1 
ATOM   6642  O  OE1 . GLU C  1 93  ? -12.493 52.648   95.998  1.00 27.47 ? 174  GLU C OE1 1 
ATOM   6643  O  OE2 . GLU C  1 93  ? -13.676 54.365   95.281  1.00 28.86 ? 174  GLU C OE2 1 
ATOM   6644  N  N   . SER C  1 94  ? -15.652 57.527   99.016  1.00 19.14 ? 175  SER C N   1 
ATOM   6645  C  CA  . SER C  1 94  ? -16.617 58.595   99.206  1.00 18.96 ? 175  SER C CA  1 
ATOM   6646  C  C   . SER C  1 94  ? -17.070 58.755   100.650 1.00 16.87 ? 175  SER C C   1 
ATOM   6647  O  O   . SER C  1 94  ? -16.892 57.859   101.465 1.00 16.47 ? 175  SER C O   1 
ATOM   6648  C  CB  . SER C  1 94  ? -17.835 58.330   98.316  1.00 19.69 ? 175  SER C CB  1 
ATOM   6649  O  OG  . SER C  1 94  ? -18.546 59.530   98.075  1.00 26.00 ? 175  SER C OG  1 
ATOM   6650  N  N   . VAL C  1 95  ? -17.643 59.912   100.964 1.00 15.28 ? 176  VAL C N   1 
ATOM   6651  C  CA  . VAL C  1 95  ? -18.149 60.163   102.306 1.00 13.97 ? 176  VAL C CA  1 
ATOM   6652  C  C   . VAL C  1 95  ? -19.530 59.543   102.235 1.00 14.00 ? 176  VAL C C   1 
ATOM   6653  O  O   . VAL C  1 95  ? -20.341 59.965   101.413 1.00 13.97 ? 176  VAL C O   1 
ATOM   6654  C  CB  . VAL C  1 95  ? -18.285 61.669   102.588 1.00 12.79 ? 176  VAL C CB  1 
ATOM   6655  C  CG1 . VAL C  1 95  ? -18.738 61.885   104.011 1.00 8.74  ? 176  VAL C CG1 1 
ATOM   6656  C  CG2 . VAL C  1 95  ? -16.966 62.374   102.311 1.00 10.04 ? 176  VAL C CG2 1 
ATOM   6657  N  N   . ALA C  1 96  ? -19.812 58.557   103.084 1.00 12.79 ? 177  ALA C N   1 
ATOM   6658  C  CA  . ALA C  1 96  ? -21.099 57.892   102.987 1.00 12.38 ? 177  ALA C CA  1 
ATOM   6659  C  C   . ALA C  1 96  ? -21.509 57.014   104.153 1.00 13.24 ? 177  ALA C C   1 
ATOM   6660  O  O   . ALA C  1 96  ? -20.666 56.374   104.778 1.00 12.62 ? 177  ALA C O   1 
ATOM   6661  C  CB  . ALA C  1 96  ? -21.109 57.052   101.718 1.00 9.68  ? 177  ALA C CB  1 
ATOM   6662  N  N   . TRP C  1 97  ? -22.809 56.989   104.453 1.00 13.85 ? 178  TRP C N   1 
ATOM   6663  C  CA  . TRP C  1 97  ? -23.300 56.100   105.501 1.00 15.48 ? 178  TRP C CA  1 
ATOM   6664  C  C   . TRP C  1 97  ? -24.197 55.036   104.868 1.00 15.98 ? 178  TRP C C   1 
ATOM   6665  O  O   . TRP C  1 97  ? -24.806 54.215   105.550 1.00 17.42 ? 178  TRP C O   1 
ATOM   6666  C  CB  . TRP C  1 97  ? -24.031 56.837   106.640 1.00 14.34 ? 178  TRP C CB  1 
ATOM   6667  C  CG  . TRP C  1 97  ? -24.952 57.961   106.284 1.00 14.54 ? 178  TRP C CG  1 
ATOM   6668  C  CD1 . TRP C  1 97  ? -24.753 59.276   106.558 1.00 14.47 ? 178  TRP C CD1 1 
ATOM   6669  C  CD2 . TRP C  1 97  ? -26.250 57.871   105.690 1.00 13.74 ? 178  TRP C CD2 1 
ATOM   6670  N  NE1 . TRP C  1 97  ? -25.845 60.010   106.195 1.00 14.55 ? 178  TRP C NE1 1 
ATOM   6671  C  CE2 . TRP C  1 97  ? -26.790 59.170   105.670 1.00 13.17 ? 178  TRP C CE2 1 
ATOM   6672  C  CE3 . TRP C  1 97  ? -27.030 56.812   105.209 1.00 14.58 ? 178  TRP C CE3 1 
ATOM   6673  C  CZ2 . TRP C  1 97  ? -28.045 59.457   105.145 1.00 14.16 ? 178  TRP C CZ2 1 
ATOM   6674  C  CZ3 . TRP C  1 97  ? -28.281 57.093   104.687 1.00 14.62 ? 178  TRP C CZ3 1 
ATOM   6675  C  CH2 . TRP C  1 97  ? -28.784 58.405   104.676 1.00 15.74 ? 178  TRP C CH2 1 
ATOM   6676  N  N   . SER C  1 98  ? -24.243 55.054   103.542 1.00 15.35 ? 179  SER C N   1 
ATOM   6677  C  CA  . SER C  1 98  ? -25.007 54.096   102.761 1.00 15.48 ? 179  SER C CA  1 
ATOM   6678  C  C   . SER C  1 98  ? -24.348 54.146   101.402 1.00 15.65 ? 179  SER C C   1 
ATOM   6679  O  O   . SER C  1 98  ? -24.031 55.230   100.923 1.00 16.73 ? 179  SER C O   1 
ATOM   6680  C  CB  . SER C  1 98  ? -26.463 54.525   102.654 1.00 16.52 ? 179  SER C CB  1 
ATOM   6681  O  OG  . SER C  1 98  ? -27.147 53.691   101.744 1.00 16.64 ? 179  SER C OG  1 
ATOM   6682  N  N   . ALA C  1 99  ? -24.140 53.002   100.765 1.00 14.81 ? 180  ALA C N   1 
ATOM   6683  C  CA  . ALA C  1 99  ? -23.463 53.032   99.480  1.00 15.28 ? 180  ALA C CA  1 
ATOM   6684  C  C   . ALA C  1 99  ? -23.617 51.800   98.624  1.00 16.40 ? 180  ALA C C   1 
ATOM   6685  O  O   . ALA C  1 99  ? -24.246 50.821   99.008  1.00 18.12 ? 180  ALA C O   1 
ATOM   6686  C  CB  . ALA C  1 99  ? -21.978 53.286   99.698  1.00 13.75 ? 180  ALA C CB  1 
ATOM   6687  N  N   . SER C  1 100 ? -23.018 51.878   97.442  1.00 17.51 ? 181  SER C N   1 
ATOM   6688  C  CA  . SER C  1 100 ? -22.999 50.780   96.492  1.00 17.83 ? 181  SER C CA  1 
ATOM   6689  C  C   . SER C  1 100 ? -21.944 51.152   95.444  1.00 16.12 ? 181  SER C C   1 
ATOM   6690  O  O   . SER C  1 100 ? -21.546 52.315   95.340  1.00 16.97 ? 181  SER C O   1 
ATOM   6691  C  CB  . SER C  1 100 ? -24.392 50.583   95.876  1.00 17.74 ? 181  SER C CB  1 
ATOM   6692  O  OG  . SER C  1 100 ? -24.491 51.141   94.583  1.00 23.59 ? 181  SER C OG  1 
ATOM   6693  N  N   . ALA C  1 101 ? -21.452 50.168   94.706  1.00 15.64 ? 182  ALA C N   1 
ATOM   6694  C  CA  . ALA C  1 101 ? -20.438 50.417   93.682  1.00 16.07 ? 182  ALA C CA  1 
ATOM   6695  C  C   . ALA C  1 101 ? -20.419 49.290   92.667  1.00 16.20 ? 182  ALA C C   1 
ATOM   6696  O  O   . ALA C  1 101 ? -20.864 48.180   92.945  1.00 16.38 ? 182  ALA C O   1 
ATOM   6697  C  CB  . ALA C  1 101 ? -19.049 50.561   94.324  1.00 13.90 ? 182  ALA C CB  1 
ATOM   6698  N  N   . CYS C  1 102 ? -19.919 49.589   91.480  1.00 17.45 ? 183  CYS C N   1 
ATOM   6699  C  CA  . CYS C  1 102 ? -19.809 48.591   90.427  1.00 20.72 ? 183  CYS C CA  1 
ATOM   6700  C  C   . CYS C  1 102 ? -19.020 49.185   89.273  1.00 20.92 ? 183  CYS C C   1 
ATOM   6701  O  O   . CYS C  1 102 ? -19.035 50.389   89.041  1.00 22.73 ? 183  CYS C O   1 
ATOM   6702  C  CB  . CYS C  1 102 ? -21.184 48.116   89.952  1.00 20.75 ? 183  CYS C CB  1 
ATOM   6703  S  SG  . CYS C  1 102 ? -22.284 49.438   89.384  1.00 24.43 ? 183  CYS C SG  1 
ATOM   6704  N  N   . HIS C  1 103 ? -18.320 48.319   88.565  1.00 20.96 ? 184  HIS C N   1 
ATOM   6705  C  CA  . HIS C  1 103 ? -17.476 48.713   87.460  1.00 20.48 ? 184  HIS C CA  1 
ATOM   6706  C  C   . HIS C  1 103 ? -18.185 48.338   86.167  1.00 20.51 ? 184  HIS C C   1 
ATOM   6707  O  O   . HIS C  1 103 ? -18.726 47.240   86.065  1.00 20.46 ? 184  HIS C O   1 
ATOM   6708  C  CB  . HIS C  1 103 ? -16.155 47.963   87.604  1.00 19.19 ? 184  HIS C CB  1 
ATOM   6709  C  CG  . HIS C  1 103 ? -15.096 48.394   86.646  1.00 18.80 ? 184  HIS C CG  1 
ATOM   6710  N  ND1 . HIS C  1 103 ? -14.056 49.215   87.013  1.00 19.61 ? 184  HIS C ND1 1 
ATOM   6711  C  CD2 . HIS C  1 103 ? -14.888 48.079   85.344  1.00 18.81 ? 184  HIS C CD2 1 
ATOM   6712  C  CE1 . HIS C  1 103 ? -13.246 49.388   85.980  1.00 20.62 ? 184  HIS C CE1 1 
ATOM   6713  N  NE2 . HIS C  1 103 ? -13.730 48.708   84.957  1.00 20.04 ? 184  HIS C NE2 1 
ATOM   6714  N  N   . ASP C  1 104 ? -18.188 49.235   85.181  1.00 20.89 ? 185  ASP C N   1 
ATOM   6715  C  CA  . ASP C  1 104 ? -18.860 48.938   83.912  1.00 21.03 ? 185  ASP C CA  1 
ATOM   6716  C  C   . ASP C  1 104 ? -17.941 48.393   82.818  1.00 20.62 ? 185  ASP C C   1 
ATOM   6717  O  O   . ASP C  1 104 ? -18.360 48.240   81.672  1.00 20.64 ? 185  ASP C O   1 
ATOM   6718  C  CB  . ASP C  1 104 ? -19.591 50.182   83.375  1.00 21.24 ? 185  ASP C CB  1 
ATOM   6719  C  CG  . ASP C  1 104 ? -18.652 51.340   83.063  1.00 21.89 ? 185  ASP C CG  1 
ATOM   6720  O  OD1 . ASP C  1 104 ? -17.424 51.132   82.940  1.00 23.15 ? 185  ASP C OD1 1 
ATOM   6721  O  OD2 . ASP C  1 104 ? -19.156 52.472   82.921  1.00 23.18 ? 185  ASP C OD2 1 
ATOM   6722  N  N   . GLY C  1 105 ? -16.691 48.102   83.166  1.00 20.84 ? 186  GLY C N   1 
ATOM   6723  C  CA  . GLY C  1 105 ? -15.757 47.594   82.174  1.00 20.22 ? 186  GLY C CA  1 
ATOM   6724  C  C   . GLY C  1 105 ? -14.701 48.638   81.859  1.00 19.89 ? 186  GLY C C   1 
ATOM   6725  O  O   . GLY C  1 105 ? -13.579 48.314   81.446  1.00 18.89 ? 186  GLY C O   1 
ATOM   6726  N  N   . THR C  1 106 ? -15.075 49.899   82.070  1.00 19.84 ? 187  THR C N   1 
ATOM   6727  C  CA  . THR C  1 106 ? -14.192 51.039   81.834  1.00 21.01 ? 187  THR C CA  1 
ATOM   6728  C  C   . THR C  1 106 ? -13.711 51.662   83.156  1.00 21.24 ? 187  THR C C   1 
ATOM   6729  O  O   . THR C  1 106 ? -12.512 51.702   83.423  1.00 22.76 ? 187  THR C O   1 
ATOM   6730  C  CB  . THR C  1 106 ? -14.905 52.130   80.978  1.00 20.44 ? 187  THR C CB  1 
ATOM   6731  O  OG1 . THR C  1 106 ? -15.240 51.591   79.690  1.00 21.21 ? 187  THR C OG1 1 
ATOM   6732  C  CG2 . THR C  1 106 ? -14.004 53.335   80.783  1.00 17.80 ? 187  THR C CG2 1 
ATOM   6733  N  N   . SER C  1 107 ? -14.641 52.140   83.981  1.00 20.95 ? 188  SER C N   1 
ATOM   6734  C  CA  . SER C  1 107 ? -14.283 52.758   85.262  1.00 19.08 ? 188  SER C CA  1 
ATOM   6735  C  C   . SER C  1 107 ? -15.212 52.366   86.403  1.00 17.42 ? 188  SER C C   1 
ATOM   6736  O  O   . SER C  1 107 ? -16.255 51.769   86.185  1.00 18.73 ? 188  SER C O   1 
ATOM   6737  C  CB  . SER C  1 107 ? -14.286 54.273   85.124  1.00 19.64 ? 188  SER C CB  1 
ATOM   6738  O  OG  . SER C  1 107 ? -13.337 54.680   84.159  1.00 22.26 ? 188  SER C OG  1 
ATOM   6739  N  N   . TRP C  1 108 ? -14.830 52.707   87.627  1.00 16.92 ? 189  TRP C N   1 
ATOM   6740  C  CA  . TRP C  1 108 ? -15.652 52.379   88.783  1.00 16.08 ? 189  TRP C CA  1 
ATOM   6741  C  C   . TRP C  1 108 ? -16.731 53.411   89.041  1.00 15.99 ? 189  TRP C C   1 
ATOM   6742  O  O   . TRP C  1 108 ? -16.511 54.616   88.920  1.00 14.96 ? 189  TRP C O   1 
ATOM   6743  C  CB  . TRP C  1 108 ? -14.810 52.267   90.053  1.00 14.45 ? 189  TRP C CB  1 
ATOM   6744  C  CG  . TRP C  1 108 ? -14.053 50.992   90.194  1.00 17.65 ? 189  TRP C CG  1 
ATOM   6745  C  CD1 . TRP C  1 108 ? -12.724 50.794   89.951  1.00 16.31 ? 189  TRP C CD1 1 
ATOM   6746  C  CD2 . TRP C  1 108 ? -14.577 49.727   90.631  1.00 17.18 ? 189  TRP C CD2 1 
ATOM   6747  N  NE1 . TRP C  1 108 ? -12.387 49.486   90.213  1.00 17.84 ? 189  TRP C NE1 1 
ATOM   6748  C  CE2 . TRP C  1 108 ? -13.504 48.809   90.630  1.00 16.89 ? 189  TRP C CE2 1 
ATOM   6749  C  CE3 . TRP C  1 108 ? -15.846 49.285   91.024  1.00 16.79 ? 189  TRP C CE3 1 
ATOM   6750  C  CZ2 . TRP C  1 108 ? -13.663 47.466   91.006  1.00 18.78 ? 189  TRP C CZ2 1 
ATOM   6751  C  CZ3 . TRP C  1 108 ? -16.007 47.951   91.400  1.00 18.15 ? 189  TRP C CZ3 1 
ATOM   6752  C  CH2 . TRP C  1 108 ? -14.920 47.057   91.389  1.00 18.29 ? 189  TRP C CH2 1 
ATOM   6753  N  N   . LEU C  1 109 ? -17.911 52.921   89.389  1.00 16.52 ? 190  LEU C N   1 
ATOM   6754  C  CA  . LEU C  1 109 ? -19.018 53.792   89.729  1.00 15.94 ? 190  LEU C CA  1 
ATOM   6755  C  C   . LEU C  1 109 ? -19.228 53.537   91.198  1.00 14.59 ? 190  LEU C C   1 
ATOM   6756  O  O   . LEU C  1 109 ? -19.319 52.392   91.616  1.00 14.20 ? 190  LEU C O   1 
ATOM   6757  C  CB  . LEU C  1 109 ? -20.293 53.418   88.978  1.00 16.54 ? 190  LEU C CB  1 
ATOM   6758  C  CG  . LEU C  1 109 ? -21.523 54.119   89.561  1.00 18.70 ? 190  LEU C CG  1 
ATOM   6759  C  CD1 . LEU C  1 109 ? -21.312 55.621   89.490  1.00 19.91 ? 190  LEU C CD1 1 
ATOM   6760  C  CD2 . LEU C  1 109 ? -22.781 53.723   88.802  1.00 18.77 ? 190  LEU C CD2 1 
ATOM   6761  N  N   . THR C  1 110 ? -19.253 54.598   91.986  1.00 14.72 ? 191  THR C N   1 
ATOM   6762  C  CA  . THR C  1 110 ? -19.487 54.461   93.409  1.00 15.45 ? 191  THR C CA  1 
ATOM   6763  C  C   . THR C  1 110 ? -20.621 55.412   93.723  1.00 17.06 ? 191  THR C C   1 
ATOM   6764  O  O   . THR C  1 110 ? -20.756 56.468   93.099  1.00 18.05 ? 191  THR C O   1 
ATOM   6765  C  CB  . THR C  1 110 ? -18.269 54.864   94.240  1.00 14.74 ? 191  THR C CB  1 
ATOM   6766  O  OG1 . THR C  1 110 ? -17.897 56.208   93.912  1.00 15.28 ? 191  THR C OG1 1 
ATOM   6767  C  CG2 . THR C  1 110 ? -17.103 53.916   93.968  1.00 13.99 ? 191  THR C CG2 1 
ATOM   6768  N  N   . ILE C  1 111 ? -21.447 55.023   94.677  1.00 16.37 ? 192  ILE C N   1 
ATOM   6769  C  CA  . ILE C  1 111 ? -22.567 55.840   95.082  1.00 17.20 ? 192  ILE C CA  1 
ATOM   6770  C  C   . ILE C  1 111 ? -22.492 55.922   96.585  1.00 17.00 ? 192  ILE C C   1 
ATOM   6771  O  O   . ILE C  1 111 ? -22.568 54.907   97.268  1.00 19.96 ? 192  ILE C O   1 
ATOM   6772  C  CB  . ILE C  1 111 ? -23.884 55.188   94.676  1.00 19.14 ? 192  ILE C CB  1 
ATOM   6773  C  CG1 . ILE C  1 111 ? -23.858 54.864   93.182  1.00 18.55 ? 192  ILE C CG1 1 
ATOM   6774  C  CG2 . ILE C  1 111 ? -25.040 56.112   95.009  1.00 18.07 ? 192  ILE C CG2 1 
ATOM   6775  C  CD1 . ILE C  1 111 ? -25.016 54.018   92.741  1.00 19.95 ? 192  ILE C CD1 1 
ATOM   6776  N  N   . GLY C  1 112 ? -22.311 57.126   97.099  1.00 15.68 ? 193  GLY C N   1 
ATOM   6777  C  CA  . GLY C  1 112 ? -22.221 57.300   98.530  1.00 14.97 ? 193  GLY C CA  1 
ATOM   6778  C  C   . GLY C  1 112 ? -23.246 58.315   98.968  1.00 14.98 ? 193  GLY C C   1 
ATOM   6779  O  O   . GLY C  1 112 ? -23.278 59.427   98.455  1.00 15.56 ? 193  GLY C O   1 
ATOM   6780  N  N   . ILE C  1 113 ? -24.093 57.925   99.910  1.00 14.72 ? 194  ILE C N   1 
ATOM   6781  C  CA  . ILE C  1 113 ? -25.129 58.806   100.413 1.00 14.23 ? 194  ILE C CA  1 
ATOM   6782  C  C   . ILE C  1 113 ? -24.683 59.369   101.755 1.00 14.65 ? 194  ILE C C   1 
ATOM   6783  O  O   . ILE C  1 113 ? -24.206 58.628   102.614 1.00 14.17 ? 194  ILE C O   1 
ATOM   6784  C  CB  . ILE C  1 113 ? -26.455 58.032   100.609 1.00 13.12 ? 194  ILE C CB  1 
ATOM   6785  C  CG1 . ILE C  1 113 ? -26.888 57.402   99.291  1.00 12.88 ? 194  ILE C CG1 1 
ATOM   6786  C  CG2 . ILE C  1 113 ? -27.547 58.956   101.120 1.00 13.75 ? 194  ILE C CG2 1 
ATOM   6787  C  CD1 . ILE C  1 113 ? -28.150 56.580   99.397  1.00 11.45 ? 194  ILE C CD1 1 
ATOM   6788  N  N   . SER C  1 114 ? -24.825 60.682   101.916 1.00 15.29 ? 195  SER C N   1 
ATOM   6789  C  CA  . SER C  1 114 ? -24.475 61.357   103.159 1.00 15.02 ? 195  SER C CA  1 
ATOM   6790  C  C   . SER C  1 114 ? -25.467 62.490   103.403 1.00 16.11 ? 195  SER C C   1 
ATOM   6791  O  O   . SER C  1 114 ? -26.346 62.738   102.572 1.00 17.40 ? 195  SER C O   1 
ATOM   6792  C  CB  . SER C  1 114 ? -23.065 61.921   103.091 1.00 15.93 ? 195  SER C CB  1 
ATOM   6793  O  OG  . SER C  1 114 ? -22.610 62.235   104.404 1.00 20.50 ? 195  SER C OG  1 
ATOM   6794  N  N   . GLY C  1 115 ? -25.325 63.179   104.534 1.00 15.74 ? 196  GLY C N   1 
ATOM   6795  C  CA  . GLY C  1 115 ? -26.229 64.268   104.858 1.00 14.07 ? 196  GLY C CA  1 
ATOM   6796  C  C   . GLY C  1 115 ? -27.201 63.878   105.955 1.00 14.36 ? 196  GLY C C   1 
ATOM   6797  O  O   . GLY C  1 115 ? -27.156 62.754   106.451 1.00 13.57 ? 196  GLY C O   1 
ATOM   6798  N  N   . PRO C  1 116 ? -28.108 64.784   106.348 1.00 14.65 ? 197  PRO C N   1 
ATOM   6799  C  CA  . PRO C  1 116 ? -29.105 64.539   107.399 1.00 14.40 ? 197  PRO C CA  1 
ATOM   6800  C  C   . PRO C  1 116 ? -30.161 63.537   106.949 1.00 14.97 ? 197  PRO C C   1 
ATOM   6801  O  O   . PRO C  1 116 ? -30.298 63.281   105.758 1.00 14.38 ? 197  PRO C O   1 
ATOM   6802  C  CB  . PRO C  1 116 ? -29.692 65.924   107.635 1.00 13.99 ? 197  PRO C CB  1 
ATOM   6803  C  CG  . PRO C  1 116 ? -29.717 66.482   106.241 1.00 13.84 ? 197  PRO C CG  1 
ATOM   6804  C  CD  . PRO C  1 116 ? -28.339 66.092   105.709 1.00 14.95 ? 197  PRO C CD  1 
ATOM   6805  N  N   . ASP C  1 117 ? -30.905 62.973   107.897 1.00 16.14 ? 198  ASP C N   1 
ATOM   6806  C  CA  . ASP C  1 117 ? -31.934 61.995   107.557 1.00 17.06 ? 198  ASP C CA  1 
ATOM   6807  C  C   . ASP C  1 117 ? -33.026 62.612   106.696 1.00 17.30 ? 198  ASP C C   1 
ATOM   6808  O  O   . ASP C  1 117 ? -33.516 61.976   105.774 1.00 18.10 ? 198  ASP C O   1 
ATOM   6809  C  CB  . ASP C  1 117 ? -32.572 61.401   108.820 1.00 18.74 ? 198  ASP C CB  1 
ATOM   6810  C  CG  . ASP C  1 117 ? -31.661 60.414   109.541 1.00 21.17 ? 198  ASP C CG  1 
ATOM   6811  O  OD1 . ASP C  1 117 ? -30.541 60.128   109.058 1.00 22.92 ? 198  ASP C OD1 1 
ATOM   6812  O  OD2 . ASP C  1 117 ? -32.072 59.916   110.605 1.00 22.47 ? 198  ASP C OD2 1 
ATOM   6813  N  N   . ASN C  1 118 ? -33.395 63.857   106.982 1.00 17.82 ? 199  ASN C N   1 
ATOM   6814  C  CA  . ASN C  1 118 ? -34.454 64.524   106.221 1.00 18.32 ? 199  ASN C CA  1 
ATOM   6815  C  C   . ASN C  1 118 ? -34.025 65.151   104.900 1.00 17.84 ? 199  ASN C C   1 
ATOM   6816  O  O   . ASN C  1 118 ? -34.768 65.947   104.320 1.00 18.06 ? 199  ASN C O   1 
ATOM   6817  C  CB  . ASN C  1 118 ? -35.136 65.602   107.077 1.00 20.01 ? 199  ASN C CB  1 
ATOM   6818  C  CG  . ASN C  1 118 ? -34.164 66.673   107.569 1.00 23.38 ? 199  ASN C CG  1 
ATOM   6819  O  OD1 . ASN C  1 118 ? -33.036 66.797   107.071 1.00 24.41 ? 199  ASN C OD1 1 
ATOM   6820  N  ND2 . ASN C  1 118 ? -34.605 67.458   108.548 1.00 23.49 ? 199  ASN C ND2 1 
ATOM   6821  N  N   . GLY C  1 119 ? -32.840 64.810   104.415 1.00 17.14 ? 200  GLY C N   1 
ATOM   6822  C  CA  . GLY C  1 119 ? -32.404 65.393   103.157 1.00 17.27 ? 200  GLY C CA  1 
ATOM   6823  C  C   . GLY C  1 119 ? -31.068 64.881   102.669 1.00 17.92 ? 200  GLY C C   1 
ATOM   6824  O  O   . GLY C  1 119 ? -30.258 65.648   102.133 1.00 17.64 ? 200  GLY C O   1 
ATOM   6825  N  N   . ALA C  1 120 ? -30.836 63.585   102.853 1.00 16.60 ? 201  ALA C N   1 
ATOM   6826  C  CA  . ALA C  1 120 ? -29.591 62.963   102.436 1.00 16.95 ? 201  ALA C CA  1 
ATOM   6827  C  C   . ALA C  1 120 ? -29.398 63.078   100.934 1.00 17.55 ? 201  ALA C C   1 
ATOM   6828  O  O   . ALA C  1 120 ? -30.367 63.143   100.178 1.00 19.35 ? 201  ALA C O   1 
ATOM   6829  C  CB  . ALA C  1 120 ? -29.584 61.494   102.846 1.00 16.98 ? 201  ALA C CB  1 
ATOM   6830  N  N   . VAL C  1 121 ? -28.149 63.102   100.494 1.00 17.79 ? 202  VAL C N   1 
ATOM   6831  C  CA  . VAL C  1 121 ? -27.885 63.184   99.064  1.00 17.39 ? 202  VAL C CA  1 
ATOM   6832  C  C   . VAL C  1 121 ? -26.866 62.135   98.631  1.00 16.07 ? 202  VAL C C   1 
ATOM   6833  O  O   . VAL C  1 121 ? -25.848 61.916   99.293  1.00 16.24 ? 202  VAL C O   1 
ATOM   6834  C  CB  . VAL C  1 121 ? -27.393 64.591   98.657  1.00 16.60 ? 202  VAL C CB  1 
ATOM   6835  C  CG1 . VAL C  1 121 ? -26.268 65.024   99.552  1.00 21.09 ? 202  VAL C CG1 1 
ATOM   6836  C  CG2 . VAL C  1 121 ? -26.923 64.570   97.218  1.00 17.67 ? 202  VAL C CG2 1 
ATOM   6837  N  N   . ALA C  1 122 ? -27.160 61.475   97.519  1.00 14.44 ? 203  ALA C N   1 
ATOM   6838  C  CA  . ALA C  1 122 ? -26.277 60.447   96.994  1.00 13.73 ? 203  ALA C CA  1 
ATOM   6839  C  C   . ALA C  1 122 ? -25.317 61.054   95.987  1.00 13.69 ? 203  ALA C C   1 
ATOM   6840  O  O   . ALA C  1 122 ? -25.735 61.635   94.993  1.00 15.96 ? 203  ALA C O   1 
ATOM   6841  C  CB  . ALA C  1 122 ? -27.092 59.346   96.336  1.00 9.17  ? 203  ALA C CB  1 
ATOM   6842  N  N   . VAL C  1 123 ? -24.027 60.935   96.258  1.00 14.14 ? 204  VAL C N   1 
ATOM   6843  C  CA  . VAL C  1 123 ? -23.011 61.449   95.351  1.00 14.59 ? 204  VAL C CA  1 
ATOM   6844  C  C   . VAL C  1 123 ? -22.513 60.290   94.487  1.00 13.86 ? 204  VAL C C   1 
ATOM   6845  O  O   . VAL C  1 123 ? -22.078 59.267   95.006  1.00 13.41 ? 204  VAL C O   1 
ATOM   6846  C  CB  . VAL C  1 123 ? -21.833 62.066   96.146  1.00 14.56 ? 204  VAL C CB  1 
ATOM   6847  C  CG1 . VAL C  1 123 ? -20.660 62.379   95.220  1.00 14.19 ? 204  VAL C CG1 1 
ATOM   6848  C  CG2 . VAL C  1 123 ? -22.303 63.339   96.836  1.00 12.64 ? 204  VAL C CG2 1 
ATOM   6849  N  N   . LEU C  1 124 ? -22.606 60.440   93.169  1.00 14.37 ? 205  LEU C N   1 
ATOM   6850  C  CA  . LEU C  1 124 ? -22.150 59.397   92.263  1.00 14.69 ? 205  LEU C CA  1 
ATOM   6851  C  C   . LEU C  1 124 ? -20.813 59.821   91.700  1.00 15.41 ? 205  LEU C C   1 
ATOM   6852  O  O   . LEU C  1 124 ? -20.637 60.964   91.274  1.00 15.36 ? 205  LEU C O   1 
ATOM   6853  C  CB  . LEU C  1 124 ? -23.133 59.186   91.112  1.00 15.29 ? 205  LEU C CB  1 
ATOM   6854  C  CG  . LEU C  1 124 ? -24.633 59.130   91.433  1.00 17.54 ? 205  LEU C CG  1 
ATOM   6855  C  CD1 . LEU C  1 124 ? -25.350 58.542   90.239  1.00 18.13 ? 205  LEU C CD1 1 
ATOM   6856  C  CD2 . LEU C  1 124 ? -24.905 58.289   92.659  1.00 18.49 ? 205  LEU C CD2 1 
ATOM   6857  N  N   . LYS C  1 125 ? -19.867 58.892   91.715  1.00 16.37 ? 206  LYS C N   1 
ATOM   6858  C  CA  . LYS C  1 125 ? -18.537 59.154   91.209  1.00 16.45 ? 206  LYS C CA  1 
ATOM   6859  C  C   . LYS C  1 125 ? -18.176 58.133   90.153  1.00 17.10 ? 206  LYS C C   1 
ATOM   6860  O  O   . LYS C  1 125 ? -18.340 56.923   90.348  1.00 16.99 ? 206  LYS C O   1 
ATOM   6861  C  CB  . LYS C  1 125 ? -17.500 59.098   92.334  1.00 17.02 ? 206  LYS C CB  1 
ATOM   6862  C  CG  . LYS C  1 125 ? -17.602 60.218   93.368  1.00 19.51 ? 206  LYS C CG  1 
ATOM   6863  C  CD  . LYS C  1 125 ? -16.397 60.217   94.293  1.00 18.47 ? 206  LYS C CD  1 
ATOM   6864  C  CE  . LYS C  1 125 ? -16.621 61.094   95.505  1.00 17.96 ? 206  LYS C CE  1 
ATOM   6865  N  NZ  . LYS C  1 125 ? -15.385 61.189   96.318  1.00 18.94 ? 206  LYS C NZ  1 
ATOM   6866  N  N   . TYR C  1 126 ? -17.710 58.637   89.019  1.00 17.85 ? 207  TYR C N   1 
ATOM   6867  C  CA  . TYR C  1 126 ? -17.272 57.788   87.931  1.00 19.21 ? 207  TYR C CA  1 
ATOM   6868  C  C   . TYR C  1 126 ? -15.787 58.073   87.833  1.00 19.98 ? 207  TYR C C   1 
ATOM   6869  O  O   . TYR C  1 126 ? -15.376 59.179   87.487  1.00 19.20 ? 207  TYR C O   1 
ATOM   6870  C  CB  . TYR C  1 126 ? -17.973 58.154   86.634  1.00 18.22 ? 207  TYR C CB  1 
ATOM   6871  C  CG  . TYR C  1 126 ? -17.760 57.127   85.548  1.00 19.53 ? 207  TYR C CG  1 
ATOM   6872  C  CD1 . TYR C  1 126 ? -16.915 57.384   84.465  1.00 18.95 ? 207  TYR C CD1 1 
ATOM   6873  C  CD2 . TYR C  1 126 ? -18.440 55.908   85.580  1.00 19.88 ? 207  TYR C CD2 1 
ATOM   6874  C  CE1 . TYR C  1 126 ? -16.761 56.461   83.440  1.00 18.94 ? 207  TYR C CE1 1 
ATOM   6875  C  CE2 . TYR C  1 126 ? -18.293 54.976   84.559  1.00 20.12 ? 207  TYR C CE2 1 
ATOM   6876  C  CZ  . TYR C  1 126 ? -17.457 55.262   83.490  1.00 21.79 ? 207  TYR C CZ  1 
ATOM   6877  O  OH  . TYR C  1 126 ? -17.352 54.363   82.453  1.00 24.57 ? 207  TYR C OH  1 
ATOM   6878  N  N   . ASN C  1 127 ? -14.995 57.063   88.168  1.00 21.37 ? 208  ASN C N   1 
ATOM   6879  C  CA  . ASN C  1 127 ? -13.543 57.149   88.181  1.00 22.06 ? 208  ASN C CA  1 
ATOM   6880  C  C   . ASN C  1 127 ? -13.081 58.137   89.241  1.00 21.29 ? 208  ASN C C   1 
ATOM   6881  O  O   . ASN C  1 127 ? -12.072 58.802   89.071  1.00 21.86 ? 208  ASN C O   1 
ATOM   6882  C  CB  . ASN C  1 127 ? -12.976 57.579   86.827  1.00 23.75 ? 208  ASN C CB  1 
ATOM   6883  C  CG  . ASN C  1 127 ? -11.557 57.043   86.598  1.00 28.85 ? 208  ASN C CG  1 
ATOM   6884  O  OD1 . ASN C  1 127 ? -10.759 56.931   87.531  1.00 29.31 ? 208  ASN C OD1 1 
ATOM   6885  N  ND2 . ASN C  1 127 ? -11.245 56.706   85.352  1.00 33.46 ? 208  ASN C ND2 1 
ATOM   6886  N  N   . GLY C  1 128 ? -13.829 58.250   90.328  1.00 20.08 ? 209  GLY C N   1 
ATOM   6887  C  CA  . GLY C  1 128 ? -13.421 59.152   91.384  1.00 20.18 ? 209  GLY C CA  1 
ATOM   6888  C  C   . GLY C  1 128 ? -13.866 60.597   91.251  1.00 21.05 ? 209  GLY C C   1 
ATOM   6889  O  O   . GLY C  1 128 ? -13.691 61.383   92.189  1.00 21.99 ? 209  GLY C O   1 
ATOM   6890  N  N   . ILE C  1 129 ? -14.419 60.986   90.109  1.00 18.83 ? 210  ILE C N   1 
ATOM   6891  C  CA  . ILE C  1 129 ? -14.858 62.362   90.015  1.00 18.88 ? 210  ILE C CA  1 
ATOM   6892  C  C   . ILE C  1 129 ? -16.373 62.385   90.015  1.00 18.17 ? 210  ILE C C   1 
ATOM   6893  O  O   . ILE C  1 129 ? -17.019 61.532   89.406  1.00 18.84 ? 210  ILE C O   1 
ATOM   6894  C  CB  . ILE C  1 129 ? -14.289 63.083   88.763  1.00 20.58 ? 210  ILE C CB  1 
ATOM   6895  C  CG1 . ILE C  1 129 ? -15.216 62.906   87.576  1.00 22.05 ? 210  ILE C CG1 1 
ATOM   6896  C  CG2 . ILE C  1 129 ? -12.898 62.550   88.435  1.00 17.61 ? 210  ILE C CG2 1 
ATOM   6897  C  CD1 . ILE C  1 129 ? -14.899 63.839   86.455  1.00 25.47 ? 210  ILE C CD1 1 
ATOM   6898  N  N   . ILE C  1 130 ? -16.947 63.343   90.729  1.00 17.84 ? 211  ILE C N   1 
ATOM   6899  C  CA  . ILE C  1 130 ? -18.395 63.441   90.816  1.00 16.58 ? 211  ILE C CA  1 
ATOM   6900  C  C   . ILE C  1 130 ? -19.030 63.665   89.442  1.00 18.42 ? 211  ILE C C   1 
ATOM   6901  O  O   . ILE C  1 130 ? -18.618 64.551   88.682  1.00 15.54 ? 211  ILE C O   1 
ATOM   6902  C  CB  . ILE C  1 130 ? -18.791 64.552   91.774  1.00 14.96 ? 211  ILE C CB  1 
ATOM   6903  C  CG1 . ILE C  1 130 ? -18.235 64.236   93.163  1.00 13.78 ? 211  ILE C CG1 1 
ATOM   6904  C  CG2 . ILE C  1 130 ? -20.290 64.671   91.826  1.00 16.15 ? 211  ILE C CG2 1 
ATOM   6905  C  CD1 . ILE C  1 130 ? -18.419 65.351   94.180  1.00 14.18 ? 211  ILE C CD1 1 
ATOM   6906  N  N   . THR C  1 131 ? -20.029 62.838   89.126  1.00 19.13 ? 212  THR C N   1 
ATOM   6907  C  CA  . THR C  1 131 ? -20.713 62.913   87.839  1.00 19.01 ? 212  THR C CA  1 
ATOM   6908  C  C   . THR C  1 131 ? -22.203 63.190   87.972  1.00 20.41 ? 212  THR C C   1 
ATOM   6909  O  O   . THR C  1 131 ? -22.863 63.579   87.005  1.00 21.64 ? 212  THR C O   1 
ATOM   6910  C  CB  . THR C  1 131 ? -20.521 61.624   87.062  1.00 18.16 ? 212  THR C CB  1 
ATOM   6911  O  OG1 . THR C  1 131 ? -20.887 60.515   87.898  1.00 16.71 ? 212  THR C OG1 1 
ATOM   6912  C  CG2 . THR C  1 131 ? -19.059 61.488   86.630  1.00 16.65 ? 212  THR C CG2 1 
ATOM   6913  N  N   . ASP C  1 132 ? -22.741 62.979   89.165  1.00 21.41 ? 213  ASP C N   1 
ATOM   6914  C  CA  . ASP C  1 132 ? -24.144 63.256   89.395  1.00 22.22 ? 213  ASP C CA  1 
ATOM   6915  C  C   . ASP C  1 132 ? -24.455 63.324   90.882  1.00 22.09 ? 213  ASP C C   1 
ATOM   6916  O  O   . ASP C  1 132 ? -23.593 63.112   91.734  1.00 20.23 ? 213  ASP C O   1 
ATOM   6917  C  CB  . ASP C  1 132 ? -25.036 62.205   88.732  1.00 25.50 ? 213  ASP C CB  1 
ATOM   6918  C  CG  . ASP C  1 132 ? -26.370 62.787   88.253  1.00 29.71 ? 213  ASP C CG  1 
ATOM   6919  O  OD1 . ASP C  1 132 ? -26.881 63.731   88.905  1.00 30.52 ? 213  ASP C OD1 1 
ATOM   6920  O  OD2 . ASP C  1 132 ? -26.911 62.295   87.230  1.00 31.92 ? 213  ASP C OD2 1 
ATOM   6921  N  N   . THR C  1 133 ? -25.718 63.609   91.166  1.00 22.11 ? 214  THR C N   1 
ATOM   6922  C  CA  . THR C  1 133 ? -26.219 63.747   92.512  1.00 21.89 ? 214  THR C CA  1 
ATOM   6923  C  C   . THR C  1 133 ? -27.711 63.389   92.526  1.00 22.82 ? 214  THR C C   1 
ATOM   6924  O  O   . THR C  1 133 ? -28.424 63.632   91.555  1.00 23.01 ? 214  THR C O   1 
ATOM   6925  C  CB  . THR C  1 133 ? -26.014 65.205   92.962  1.00 22.11 ? 214  THR C CB  1 
ATOM   6926  O  OG1 . THR C  1 133 ? -24.779 65.318   93.681  1.00 22.54 ? 214  THR C OG1 1 
ATOM   6927  C  CG2 . THR C  1 133 ? -27.163 65.680   93.798  1.00 23.75 ? 214  THR C CG2 1 
ATOM   6928  N  N   . ILE C  1 134 ? -28.175 62.800   93.624  1.00 22.82 ? 215  ILE C N   1 
ATOM   6929  C  CA  . ILE C  1 134 ? -29.588 62.437   93.777  1.00 21.60 ? 215  ILE C CA  1 
ATOM   6930  C  C   . ILE C  1 134 ? -30.024 62.791   95.197  1.00 21.07 ? 215  ILE C C   1 
ATOM   6931  O  O   . ILE C  1 134 ? -29.455 62.289   96.160  1.00 19.52 ? 215  ILE C O   1 
ATOM   6932  C  CB  . ILE C  1 134 ? -29.823 60.919   93.567  1.00 21.69 ? 215  ILE C CB  1 
ATOM   6933  C  CG1 . ILE C  1 134 ? -29.242 60.472   92.221  1.00 21.46 ? 215  ILE C CG1 1 
ATOM   6934  C  CG2 . ILE C  1 134 ? -31.313 60.619   93.617  1.00 20.61 ? 215  ILE C CG2 1 
ATOM   6935  C  CD1 . ILE C  1 134 ? -29.221 58.975   92.026  1.00 18.39 ? 215  ILE C CD1 1 
ATOM   6936  N  N   . LYS C  1 135 ? -31.022 63.660   95.317  1.00 22.11 ? 216  LYS C N   1 
ATOM   6937  C  CA  . LYS C  1 135 ? -31.550 64.085   96.615  1.00 23.26 ? 216  LYS C CA  1 
ATOM   6938  C  C   . LYS C  1 135 ? -32.684 63.203   97.111  1.00 22.24 ? 216  LYS C C   1 
ATOM   6939  O  O   . LYS C  1 135 ? -33.454 62.649   96.335  1.00 23.65 ? 216  LYS C O   1 
ATOM   6940  C  CB  . LYS C  1 135 ? -32.117 65.501   96.537  1.00 27.52 ? 216  LYS C CB  1 
ATOM   6941  C  CG  . LYS C  1 135 ? -31.131 66.627   96.680  1.00 34.41 ? 216  LYS C CG  1 
ATOM   6942  C  CD  . LYS C  1 135 ? -31.613 67.883   95.908  1.00 38.65 ? 216  LYS C CD  1 
ATOM   6943  C  CE  . LYS C  1 135 ? -31.554 67.677   94.379  1.00 39.56 ? 216  LYS C CE  1 
ATOM   6944  N  NZ  . LYS C  1 135 ? -31.756 68.924   93.579  1.00 38.94 ? 216  LYS C NZ  1 
ATOM   6945  N  N   . SER C  1 136 ? -32.799 63.108   98.422  1.00 21.33 ? 217  SER C N   1 
ATOM   6946  C  CA  . SER C  1 136 ? -33.873 62.356   99.031  1.00 21.00 ? 217  SER C CA  1 
ATOM   6947  C  C   . SER C  1 136 ? -35.166 62.958   98.469  1.00 21.09 ? 217  SER C C   1 
ATOM   6948  O  O   . SER C  1 136 ? -35.293 64.181   98.401  1.00 21.73 ? 217  SER C O   1 
ATOM   6949  C  CB  . SER C  1 136 ? -33.812 62.555   100.544 1.00 19.79 ? 217  SER C CB  1 
ATOM   6950  O  OG  . SER C  1 136 ? -34.915 61.956   101.187 1.00 22.23 ? 217  SER C OG  1 
ATOM   6951  N  N   . TRP C  1 137 ? -36.110 62.118   98.047  1.00 20.38 ? 218  TRP C N   1 
ATOM   6952  C  CA  . TRP C  1 137 ? -37.373 62.623   97.513  1.00 19.54 ? 218  TRP C CA  1 
ATOM   6953  C  C   . TRP C  1 137 ? -38.536 62.398   98.474  1.00 20.40 ? 218  TRP C C   1 
ATOM   6954  O  O   . TRP C  1 137 ? -39.682 62.720   98.165  1.00 19.22 ? 218  TRP C O   1 
ATOM   6955  C  CB  . TRP C  1 137 ? -37.678 61.989   96.154  1.00 19.25 ? 218  TRP C CB  1 
ATOM   6956  C  CG  . TRP C  1 137 ? -37.936 60.515   96.200  1.00 21.00 ? 218  TRP C CG  1 
ATOM   6957  C  CD1 . TRP C  1 137 ? -39.134 59.900   96.411  1.00 20.39 ? 218  TRP C CD1 1 
ATOM   6958  C  CD2 . TRP C  1 137 ? -36.975 59.468   96.012  1.00 21.25 ? 218  TRP C CD2 1 
ATOM   6959  N  NE1 . TRP C  1 137 ? -38.981 58.536   96.359  1.00 20.96 ? 218  TRP C NE1 1 
ATOM   6960  C  CE2 . TRP C  1 137 ? -37.664 58.242   96.120  1.00 21.06 ? 218  TRP C CE2 1 
ATOM   6961  C  CE3 . TRP C  1 137 ? -35.596 59.446   95.769  1.00 20.22 ? 218  TRP C CE3 1 
ATOM   6962  C  CZ2 . TRP C  1 137 ? -37.027 57.005   95.986  1.00 22.00 ? 218  TRP C CZ2 1 
ATOM   6963  C  CZ3 . TRP C  1 137 ? -34.960 58.220   95.636  1.00 20.52 ? 218  TRP C CZ3 1 
ATOM   6964  C  CH2 . TRP C  1 137 ? -35.675 57.014   95.747  1.00 21.73 ? 218  TRP C CH2 1 
ATOM   6965  N  N   . ARG C  1 138 ? -38.244 61.828   99.638  1.00 21.94 ? 219  ARG C N   1 
ATOM   6966  C  CA  . ARG C  1 138 ? -39.267 61.614   100.660 1.00 23.63 ? 219  ARG C CA  1 
ATOM   6967  C  C   . ARG C  1 138 ? -38.756 62.219   101.960 1.00 22.48 ? 219  ARG C C   1 
ATOM   6968  O  O   . ARG C  1 138 ? -39.483 62.323   102.943 1.00 21.89 ? 219  ARG C O   1 
ATOM   6969  C  CB  . ARG C  1 138 ? -39.550 60.124   100.866 1.00 26.87 ? 219  ARG C CB  1 
ATOM   6970  C  CG  . ARG C  1 138 ? -40.272 59.458   99.718  1.00 31.98 ? 219  ARG C CG  1 
ATOM   6971  C  CD  . ARG C  1 138 ? -41.661 60.039   99.519  1.00 36.91 ? 219  ARG C CD  1 
ATOM   6972  N  NE  . ARG C  1 138 ? -42.302 59.485   98.331  1.00 42.05 ? 219  ARG C NE  1 
ATOM   6973  C  CZ  . ARG C  1 138 ? -43.436 59.944   97.815  1.00 45.08 ? 219  ARG C CZ  1 
ATOM   6974  N  NH1 . ARG C  1 138 ? -44.059 60.967   98.391  1.00 46.97 ? 219  ARG C NH1 1 
ATOM   6975  N  NH2 . ARG C  1 138 ? -43.938 59.392   96.716  1.00 46.38 ? 219  ARG C NH2 1 
ATOM   6976  N  N   . ASN C  1 139 ? -37.493 62.623   101.948 1.00 22.03 ? 220  ASN C N   1 
ATOM   6977  C  CA  . ASN C  1 139 ? -36.868 63.215   103.119 1.00 23.00 ? 220  ASN C CA  1 
ATOM   6978  C  C   . ASN C  1 139 ? -36.924 62.269   104.310 1.00 22.05 ? 220  ASN C C   1 
ATOM   6979  O  O   . ASN C  1 139 ? -37.184 62.693   105.437 1.00 21.64 ? 220  ASN C O   1 
ATOM   6980  C  CB  . ASN C  1 139 ? -37.552 64.535   103.485 1.00 24.78 ? 220  ASN C CB  1 
ATOM   6981  C  CG  . ASN C  1 139 ? -37.561 65.521   102.339 1.00 25.01 ? 220  ASN C CG  1 
ATOM   6982  O  OD1 . ASN C  1 139 ? -36.555 65.715   101.669 1.00 27.82 ? 220  ASN C OD1 1 
ATOM   6983  N  ND2 . ASN C  1 139 ? -38.700 66.154   102.115 1.00 27.28 ? 220  ASN C ND2 1 
ATOM   6984  N  N   . ASN C  1 140 ? -36.684 60.987   104.059 1.00 21.02 ? 221  ASN C N   1 
ATOM   6985  C  CA  . ASN C  1 140 ? -36.705 60.005   105.130 1.00 19.99 ? 221  ASN C CA  1 
ATOM   6986  C  C   . ASN C  1 140 ? -35.687 58.907   104.886 1.00 18.35 ? 221  ASN C C   1 
ATOM   6987  O  O   . ASN C  1 140 ? -36.018 57.807   104.454 1.00 17.53 ? 221  ASN C O   1 
ATOM   6988  C  CB  . ASN C  1 140 ? -38.097 59.404   105.278 1.00 19.99 ? 221  ASN C CB  1 
ATOM   6989  C  CG  . ASN C  1 140 ? -38.247 58.597   106.552 1.00 20.95 ? 221  ASN C CG  1 
ATOM   6990  O  OD1 . ASN C  1 140 ? -37.280 58.389   107.296 1.00 18.71 ? 221  ASN C OD1 1 
ATOM   6991  N  ND2 . ASN C  1 140 ? -39.468 58.132   106.812 1.00 22.64 ? 221  ASN C ND2 1 
ATOM   6992  N  N   . ILE C  1 141 ? -34.439 59.248   105.167 1.00 17.78 ? 222  ILE C N   1 
ATOM   6993  C  CA  . ILE C  1 141 ? -33.296 58.366   105.028 1.00 17.89 ? 222  ILE C CA  1 
ATOM   6994  C  C   . ILE C  1 141 ? -33.124 57.695   103.672 1.00 18.42 ? 222  ILE C C   1 
ATOM   6995  O  O   . ILE C  1 141 ? -33.315 56.486   103.528 1.00 18.06 ? 222  ILE C O   1 
ATOM   6996  C  CB  . ILE C  1 141 ? -33.300 57.286   106.122 1.00 18.13 ? 222  ILE C CB  1 
ATOM   6997  C  CG1 . ILE C  1 141 ? -33.630 57.926   107.478 1.00 19.82 ? 222  ILE C CG1 1 
ATOM   6998  C  CG2 . ILE C  1 141 ? -31.927 56.642   106.207 1.00 18.10 ? 222  ILE C CG2 1 
ATOM   6999  C  CD1 . ILE C  1 141 ? -33.617 56.954   108.645 1.00 19.09 ? 222  ILE C CD1 1 
ATOM   7000  N  N   . LEU C  1 142 ? -32.762 58.491   102.672 1.00 17.99 ? 223  LEU C N   1 
ATOM   7001  C  CA  . LEU C  1 142 ? -32.502 57.960   101.344 1.00 17.06 ? 223  LEU C CA  1 
ATOM   7002  C  C   . LEU C  1 142 ? -31.394 56.925   101.542 1.00 17.13 ? 223  LEU C C   1 
ATOM   7003  O  O   . LEU C  1 142 ? -30.359 57.216   102.149 1.00 17.33 ? 223  LEU C O   1 
ATOM   7004  C  CB  . LEU C  1 142 ? -32.004 59.075   100.431 1.00 16.50 ? 223  LEU C CB  1 
ATOM   7005  C  CG  . LEU C  1 142 ? -31.558 58.641   99.036  1.00 16.69 ? 223  LEU C CG  1 
ATOM   7006  C  CD1 . LEU C  1 142 ? -32.727 58.038   98.279  1.00 13.51 ? 223  LEU C CD1 1 
ATOM   7007  C  CD2 . LEU C  1 142 ? -31.013 59.852   98.289  1.00 17.37 ? 223  LEU C CD2 1 
ATOM   7008  N  N   . ARG C  1 143 ? -31.596 55.716   101.045 1.00 15.94 ? 224  ARG C N   1 
ATOM   7009  C  CA  . ARG C  1 143 ? -30.583 54.682   101.231 1.00 15.87 ? 224  ARG C CA  1 
ATOM   7010  C  C   . ARG C  1 143 ? -30.503 53.764   100.032 1.00 15.30 ? 224  ARG C C   1 
ATOM   7011  O  O   . ARG C  1 143 ? -31.444 53.691   99.232  1.00 16.52 ? 224  ARG C O   1 
ATOM   7012  C  CB  . ARG C  1 143 ? -30.887 53.875   102.496 1.00 13.47 ? 224  ARG C CB  1 
ATOM   7013  C  CG  . ARG C  1 143 ? -32.352 53.501   102.619 1.00 14.61 ? 224  ARG C CG  1 
ATOM   7014  C  CD  . ARG C  1 143 ? -32.672 52.945   103.984 1.00 11.93 ? 224  ARG C CD  1 
ATOM   7015  N  NE  . ARG C  1 143 ? -34.064 52.531   104.079 1.00 15.02 ? 224  ARG C NE  1 
ATOM   7016  C  CZ  . ARG C  1 143 ? -35.095 53.363   104.205 1.00 15.75 ? 224  ARG C CZ  1 
ATOM   7017  N  NH1 . ARG C  1 143 ? -36.326 52.881   104.281 1.00 14.07 ? 224  ARG C NH1 1 
ATOM   7018  N  NH2 . ARG C  1 143 ? -34.899 54.672   104.263 1.00 16.32 ? 224  ARG C NH2 1 
ATOM   7019  N  N   . THR C  1 144 ? -29.381 53.059   99.916  1.00 14.67 ? 225  THR C N   1 
ATOM   7020  C  CA  . THR C  1 144 ? -29.167 52.176   98.791  1.00 15.18 ? 225  THR C CA  1 
ATOM   7021  C  C   . THR C  1 144 ? -28.726 50.768   99.169  1.00 14.28 ? 225  THR C C   1 
ATOM   7022  O  O   . THR C  1 144 ? -28.742 50.392   100.333 1.00 14.13 ? 225  THR C O   1 
ATOM   7023  C  CB  . THR C  1 144 ? -28.155 52.805   97.807  1.00 17.51 ? 225  THR C CB  1 
ATOM   7024  O  OG1 . THR C  1 144 ? -28.107 52.027   96.604  1.00 18.67 ? 225  THR C OG1 1 
ATOM   7025  C  CG2 . THR C  1 144 ? -26.770 52.875   98.439  1.00 15.98 ? 225  THR C CG2 1 
ATOM   7026  N  N   . GLN C  1 145 ? -28.320 50.004   98.160  1.00 14.80 ? 226  GLN C N   1 
ATOM   7027  C  CA  . GLN C  1 145 ? -27.920 48.598   98.295  1.00 14.01 ? 226  GLN C CA  1 
ATOM   7028  C  C   . GLN C  1 145 ? -26.997 48.082   99.391  1.00 13.67 ? 226  GLN C C   1 
ATOM   7029  O  O   . GLN C  1 145 ? -27.318 47.096   100.049 1.00 14.05 ? 226  GLN C O   1 
ATOM   7030  C  CB  . GLN C  1 145 ? -27.342 48.115   96.974  1.00 15.17 ? 226  GLN C CB  1 
ATOM   7031  C  CG  . GLN C  1 145 ? -28.240 48.299   95.784  1.00 15.34 ? 226  GLN C CG  1 
ATOM   7032  C  CD  . GLN C  1 145 ? -27.552 47.854   94.521  1.00 17.74 ? 226  GLN C CD  1 
ATOM   7033  O  OE1 . GLN C  1 145 ? -27.199 46.680   94.381  1.00 19.60 ? 226  GLN C OE1 1 
ATOM   7034  N  NE2 . GLN C  1 145 ? -27.340 48.786   93.597  1.00 16.23 ? 226  GLN C NE2 1 
ATOM   7035  N  N   . GLU C  1 146 ? -25.842 48.715   99.566  1.00 13.74 ? 227  GLU C N   1 
ATOM   7036  C  CA  . GLU C  1 146 ? -24.846 48.262   100.541 1.00 12.88 ? 227  GLU C CA  1 
ATOM   7037  C  C   . GLU C  1 146 ? -24.265 46.984   99.944  1.00 13.18 ? 227  GLU C C   1 
ATOM   7038  O  O   . GLU C  1 146 ? -23.939 46.037   100.644 1.00 15.54 ? 227  GLU C O   1 
ATOM   7039  C  CB  . GLU C  1 146 ? -25.447 47.952   101.922 1.00 13.58 ? 227  GLU C CB  1 
ATOM   7040  C  CG  . GLU C  1 146 ? -26.448 48.971   102.486 1.00 16.23 ? 227  GLU C CG  1 
ATOM   7041  C  CD  . GLU C  1 146 ? -25.960 50.424   102.468 1.00 18.25 ? 227  GLU C CD  1 
ATOM   7042  O  OE1 . GLU C  1 146 ? -24.761 50.682   102.194 1.00 18.48 ? 227  GLU C OE1 1 
ATOM   7043  O  OE2 . GLU C  1 146 ? -26.797 51.318   102.741 1.00 18.14 ? 227  GLU C OE2 1 
ATOM   7044  N  N   . SER C  1 147 ? -24.181 46.970   98.624  1.00 14.31 ? 228  SER C N   1 
ATOM   7045  C  CA  . SER C  1 147 ? -23.618 45.870   97.873  1.00 16.32 ? 228  SER C CA  1 
ATOM   7046  C  C   . SER C  1 147 ? -23.480 46.354   96.434  1.00 17.94 ? 228  SER C C   1 
ATOM   7047  O  O   . SER C  1 147 ? -23.941 47.435   96.088  1.00 18.77 ? 228  SER C O   1 
ATOM   7048  C  CB  . SER C  1 147 ? -24.500 44.615   97.961  1.00 18.48 ? 228  SER C CB  1 
ATOM   7049  O  OG  . SER C  1 147 ? -25.391 44.487   96.868  1.00 20.44 ? 228  SER C OG  1 
ATOM   7050  N  N   . GLU C  1 148 ? -22.834 45.547   95.608  1.00 19.46 ? 229  GLU C N   1 
ATOM   7051  C  CA  . GLU C  1 148 ? -22.562 45.837   94.200  1.00 21.04 ? 229  GLU C CA  1 
ATOM   7052  C  C   . GLU C  1 148 ? -23.769 46.195   93.326  1.00 21.62 ? 229  GLU C C   1 
ATOM   7053  O  O   . GLU C  1 148 ? -24.834 45.602   93.471  1.00 23.73 ? 229  GLU C O   1 
ATOM   7054  C  CB  . GLU C  1 148 ? -21.864 44.607   93.631  1.00 22.09 ? 229  GLU C CB  1 
ATOM   7055  C  CG  . GLU C  1 148 ? -21.467 44.641   92.190  1.00 27.72 ? 229  GLU C CG  1 
ATOM   7056  C  CD  . GLU C  1 148 ? -21.154 43.239   91.675  1.00 30.88 ? 229  GLU C CD  1 
ATOM   7057  O  OE1 . GLU C  1 148 ? -22.082 42.392   91.660  1.00 31.66 ? 229  GLU C OE1 1 
ATOM   7058  O  OE2 . GLU C  1 148 ? -19.987 42.979   91.295  1.00 33.08 ? 229  GLU C OE2 1 
ATOM   7059  N  N   . CYS C  1 149 ? -23.622 47.172   92.431  1.00 21.45 ? 230  CYS C N   1 
ATOM   7060  C  CA  . CYS C  1 149 ? -24.725 47.483   91.520  1.00 22.17 ? 230  CYS C CA  1 
ATOM   7061  C  C   . CYS C  1 149 ? -24.475 46.597   90.315  1.00 21.15 ? 230  CYS C C   1 
ATOM   7062  O  O   . CYS C  1 149 ? -23.468 45.899   90.274  1.00 21.97 ? 230  CYS C O   1 
ATOM   7063  C  CB  . CYS C  1 149 ? -24.795 48.966   91.096  1.00 22.20 ? 230  CYS C CB  1 
ATOM   7064  S  SG  . CYS C  1 149 ? -23.278 49.975   91.082  1.00 24.90 ? 230  CYS C SG  1 
ATOM   7065  N  N   . ALA C  1 150 ? -25.381 46.596   89.346  1.00 21.16 ? 231  ALA C N   1 
ATOM   7066  C  CA  . ALA C  1 150 ? -25.205 45.735   88.187  1.00 22.25 ? 231  ALA C CA  1 
ATOM   7067  C  C   . ALA C  1 150 ? -25.070 46.514   86.901  1.00 22.75 ? 231  ALA C C   1 
ATOM   7068  O  O   . ALA C  1 150 ? -25.896 47.366   86.598  1.00 22.85 ? 231  ALA C O   1 
ATOM   7069  C  CB  . ALA C  1 150 ? -26.373 44.776   88.076  1.00 23.18 ? 231  ALA C CB  1 
ATOM   7070  N  N   . CYS C  1 151 ? -24.023 46.229   86.143  1.00 23.13 ? 232  CYS C N   1 
ATOM   7071  C  CA  . CYS C  1 151 ? -23.848 46.917   84.884  1.00 25.22 ? 232  CYS C CA  1 
ATOM   7072  C  C   . CYS C  1 151 ? -24.108 45.960   83.724  1.00 27.05 ? 232  CYS C C   1 
ATOM   7073  O  O   . CYS C  1 151 ? -23.815 44.761   83.799  1.00 28.85 ? 232  CYS C O   1 
ATOM   7074  C  CB  . CYS C  1 151 ? -22.447 47.504   84.780  1.00 24.22 ? 232  CYS C CB  1 
ATOM   7075  S  SG  . CYS C  1 151 ? -21.959 48.563   86.185  1.00 27.21 ? 232  CYS C SG  1 
ATOM   7076  N  N   . VAL C  1 152 ? -24.683 46.503   82.659  1.00 27.53 ? 233  VAL C N   1 
ATOM   7077  C  CA  . VAL C  1 152 ? -24.996 45.742   81.460  1.00 27.76 ? 233  VAL C CA  1 
ATOM   7078  C  C   . VAL C  1 152 ? -24.893 46.695   80.280  1.00 27.29 ? 233  VAL C C   1 
ATOM   7079  O  O   . VAL C  1 152 ? -25.329 47.842   80.360  1.00 27.14 ? 233  VAL C O   1 
ATOM   7080  C  CB  . VAL C  1 152 ? -26.451 45.181   81.494  1.00 28.46 ? 233  VAL C CB  1 
ATOM   7081  C  CG1 . VAL C  1 152 ? -26.759 44.436   80.208  1.00 29.06 ? 233  VAL C CG1 1 
ATOM   7082  C  CG2 . VAL C  1 152 ? -26.628 44.258   82.674  1.00 27.51 ? 233  VAL C CG2 1 
ATOM   7083  N  N   . ASN C  1 153 ? -24.292 46.229   79.197  1.00 27.58 ? 234  ASN C N   1 
ATOM   7084  C  CA  . ASN C  1 153 ? -24.186 47.039   77.993  1.00 26.94 ? 234  ASN C CA  1 
ATOM   7085  C  C   . ASN C  1 153 ? -23.851 48.501   78.262  1.00 25.28 ? 234  ASN C C   1 
ATOM   7086  O  O   . ASN C  1 153 ? -24.485 49.395   77.709  1.00 25.25 ? 234  ASN C O   1 
ATOM   7087  C  CB  . ASN C  1 153 ? -25.508 46.946   77.221  1.00 28.48 ? 234  ASN C CB  1 
ATOM   7088  C  CG  . ASN C  1 153 ? -25.415 47.516   75.826  1.00 30.36 ? 234  ASN C CG  1 
ATOM   7089  O  OD1 . ASN C  1 153 ? -24.411 47.330   75.138  1.00 29.90 ? 234  ASN C OD1 1 
ATOM   7090  N  ND2 . ASN C  1 153 ? -26.473 48.198   75.386  1.00 31.51 ? 234  ASN C ND2 1 
ATOM   7091  N  N   . GLY C  1 154 ? -22.872 48.750   79.123  1.00 23.68 ? 235  GLY C N   1 
ATOM   7092  C  CA  . GLY C  1 154 ? -22.479 50.122   79.391  1.00 22.21 ? 235  GLY C CA  1 
ATOM   7093  C  C   . GLY C  1 154 ? -23.393 50.960   80.264  1.00 21.09 ? 235  GLY C C   1 
ATOM   7094  O  O   . GLY C  1 154 ? -23.266 52.184   80.320  1.00 19.59 ? 235  GLY C O   1 
ATOM   7095  N  N   . SER C  1 155 ? -24.326 50.316   80.943  1.00 20.56 ? 236  SER C N   1 
ATOM   7096  C  CA  . SER C  1 155 ? -25.220 51.040   81.831  1.00 20.99 ? 236  SER C CA  1 
ATOM   7097  C  C   . SER C  1 155 ? -25.239 50.289   83.150  1.00 20.47 ? 236  SER C C   1 
ATOM   7098  O  O   . SER C  1 155 ? -25.316 49.060   83.169  1.00 21.09 ? 236  SER C O   1 
ATOM   7099  C  CB  . SER C  1 155 ? -26.634 51.096   81.251  1.00 20.24 ? 236  SER C CB  1 
ATOM   7100  O  OG  . SER C  1 155 ? -26.612 51.533   79.905  1.00 22.81 ? 236  SER C OG  1 
ATOM   7101  N  N   . CYS C  1 156 ? -25.150 51.016   84.253  1.00 19.40 ? 237  CYS C N   1 
ATOM   7102  C  CA  . CYS C  1 156 ? -25.187 50.374   85.552  1.00 19.13 ? 237  CYS C CA  1 
ATOM   7103  C  C   . CYS C  1 156 ? -26.509 50.722   86.204  1.00 18.29 ? 237  CYS C C   1 
ATOM   7104  O  O   . CYS C  1 156 ? -27.086 51.770   85.916  1.00 20.13 ? 237  CYS C O   1 
ATOM   7105  C  CB  . CYS C  1 156 ? -24.020 50.850   86.401  1.00 20.69 ? 237  CYS C CB  1 
ATOM   7106  S  SG  . CYS C  1 156 ? -22.395 50.492   85.653  1.00 23.53 ? 237  CYS C SG  1 
ATOM   7107  N  N   . PHE C  1 157 ? -26.999 49.847   87.074  1.00 16.54 ? 238  PHE C N   1 
ATOM   7108  C  CA  . PHE C  1 157 ? -28.281 50.087   87.724  1.00 14.55 ? 238  PHE C CA  1 
ATOM   7109  C  C   . PHE C  1 157 ? -28.241 49.883   89.212  1.00 14.06 ? 238  PHE C C   1 
ATOM   7110  O  O   . PHE C  1 157 ? -27.533 49.023   89.712  1.00 14.77 ? 238  PHE C O   1 
ATOM   7111  C  CB  . PHE C  1 157 ? -29.347 49.161   87.147  1.00 14.78 ? 238  PHE C CB  1 
ATOM   7112  C  CG  . PHE C  1 157 ? -29.424 49.186   85.649  1.00 14.43 ? 238  PHE C CG  1 
ATOM   7113  C  CD1 . PHE C  1 157 ? -28.453 48.560   84.882  1.00 13.47 ? 238  PHE C CD1 1 
ATOM   7114  C  CD2 . PHE C  1 157 ? -30.464 49.844   85.007  1.00 14.30 ? 238  PHE C CD2 1 
ATOM   7115  C  CE1 . PHE C  1 157 ? -28.522 48.580   83.492  1.00 16.37 ? 238  PHE C CE1 1 
ATOM   7116  C  CE2 . PHE C  1 157 ? -30.544 49.872   83.613  1.00 16.39 ? 238  PHE C CE2 1 
ATOM   7117  C  CZ  . PHE C  1 157 ? -29.572 49.242   82.852  1.00 15.15 ? 238  PHE C CZ  1 
ATOM   7118  N  N   . THR C  1 158 ? -29.017 50.673   89.929  1.00 14.72 ? 239  THR C N   1 
ATOM   7119  C  CA  . THR C  1 158 ? -29.076 50.528   91.371  1.00 16.35 ? 239  THR C CA  1 
ATOM   7120  C  C   . THR C  1 158 ? -30.512 50.766   91.831  1.00 16.76 ? 239  THR C C   1 
ATOM   7121  O  O   . THR C  1 158 ? -31.350 51.253   91.067  1.00 17.45 ? 239  THR C O   1 
ATOM   7122  C  CB  . THR C  1 158 ? -28.115 51.521   92.071  1.00 17.85 ? 239  THR C CB  1 
ATOM   7123  O  OG1 . THR C  1 158 ? -28.029 51.194   93.462  1.00 17.57 ? 239  THR C OG1 1 
ATOM   7124  C  CG2 . THR C  1 158 ? -28.601 52.963   91.912  1.00 16.12 ? 239  THR C CG2 1 
ATOM   7125  N  N   . VAL C  1 159 ? -30.804 50.405   93.072  1.00 16.60 ? 240  VAL C N   1 
ATOM   7126  C  CA  . VAL C  1 159 ? -32.138 50.593   93.613  1.00 15.80 ? 240  VAL C CA  1 
ATOM   7127  C  C   . VAL C  1 159 ? -31.989 51.347   94.912  1.00 17.08 ? 240  VAL C C   1 
ATOM   7128  O  O   . VAL C  1 159 ? -31.193 50.958   95.763  1.00 17.85 ? 240  VAL C O   1 
ATOM   7129  C  CB  . VAL C  1 159 ? -32.819 49.257   93.923  1.00 15.73 ? 240  VAL C CB  1 
ATOM   7130  C  CG1 . VAL C  1 159 ? -34.212 49.514   94.449  1.00 15.51 ? 240  VAL C CG1 1 
ATOM   7131  C  CG2 . VAL C  1 159 ? -32.866 48.384   92.684  1.00 12.65 ? 240  VAL C CG2 1 
ATOM   7132  N  N   . MET C  1 160 ? -32.729 52.438   95.063  1.00 17.61 ? 241  MET C N   1 
ATOM   7133  C  CA  . MET C  1 160 ? -32.661 53.208   96.294  1.00 18.88 ? 241  MET C CA  1 
ATOM   7134  C  C   . MET C  1 160 ? -34.035 53.285   96.913  1.00 18.23 ? 241  MET C C   1 
ATOM   7135  O  O   . MET C  1 160 ? -35.046 53.104   96.238  1.00 17.81 ? 241  MET C O   1 
ATOM   7136  C  CB  . MET C  1 160 ? -32.147 54.626   96.045  1.00 20.73 ? 241  MET C CB  1 
ATOM   7137  C  CG  . MET C  1 160 ? -30.773 54.703   95.423  1.00 24.37 ? 241  MET C CG  1 
ATOM   7138  S  SD  . MET C  1 160 ? -30.078 56.376   95.501  1.00 26.03 ? 241  MET C SD  1 
ATOM   7139  C  CE  . MET C  1 160 ? -28.343 55.984   95.237  1.00 28.49 ? 241  MET C CE  1 
ATOM   7140  N  N   . THR C  1 161 ? -34.065 53.555   98.208  1.00 18.23 ? 242  THR C N   1 
ATOM   7141  C  CA  . THR C  1 161 ? -35.321 53.662   98.916  1.00 19.10 ? 242  THR C CA  1 
ATOM   7142  C  C   . THR C  1 161 ? -35.330 54.931   99.738  1.00 18.61 ? 242  THR C C   1 
ATOM   7143  O  O   . THR C  1 161 ? -34.294 55.374   100.229 1.00 20.90 ? 242  THR C O   1 
ATOM   7144  C  CB  . THR C  1 161 ? -35.527 52.471   99.859  1.00 18.69 ? 242  THR C CB  1 
ATOM   7145  O  OG1 . THR C  1 161 ? -35.498 51.259   99.102  1.00 21.19 ? 242  THR C OG1 1 
ATOM   7146  C  CG2 . THR C  1 161 ? -36.862 52.577   100.572 1.00 18.36 ? 242  THR C CG2 1 
ATOM   7147  N  N   . ASP C  1 162 ? -36.508 55.514   99.882  1.00 17.47 ? 243  ASP C N   1 
ATOM   7148  C  CA  . ASP C  1 162 ? -36.669 56.719   100.672 1.00 16.71 ? 243  ASP C CA  1 
ATOM   7149  C  C   . ASP C  1 162 ? -38.022 56.562   101.349 1.00 16.89 ? 243  ASP C C   1 
ATOM   7150  O  O   . ASP C  1 162 ? -39.004 56.178   100.714 1.00 16.32 ? 243  ASP C O   1 
ATOM   7151  C  CB  . ASP C  1 162 ? -36.642 57.958   99.771  1.00 16.87 ? 243  ASP C CB  1 
ATOM   7152  C  CG  . ASP C  1 162 ? -36.310 59.230   100.536 1.00 16.99 ? 243  ASP C CG  1 
ATOM   7153  O  OD1 . ASP C  1 162 ? -36.122 60.274   99.881  1.00 14.90 ? 243  ASP C OD1 1 
ATOM   7154  O  OD2 . ASP C  1 162 ? -36.239 59.186   101.788 1.00 17.59 ? 243  ASP C OD2 1 
ATOM   7155  N  N   . GLY C  1 163 ? -38.069 56.831   102.645 1.00 16.69 ? 244  GLY C N   1 
ATOM   7156  C  CA  . GLY C  1 163 ? -39.316 56.684   103.365 1.00 16.82 ? 244  GLY C CA  1 
ATOM   7157  C  C   . GLY C  1 163 ? -39.100 55.809   104.574 1.00 17.20 ? 244  GLY C C   1 
ATOM   7158  O  O   . GLY C  1 163 ? -37.985 55.374   104.823 1.00 17.41 ? 244  GLY C O   1 
ATOM   7159  N  N   . PRO C  1 164 ? -40.151 55.519   105.345 1.00 18.47 ? 245  PRO C N   1 
ATOM   7160  C  CA  . PRO C  1 164 ? -39.988 54.679   106.534 1.00 18.38 ? 245  PRO C CA  1 
ATOM   7161  C  C   . PRO C  1 164 ? -39.372 53.299   106.327 1.00 18.59 ? 245  PRO C C   1 
ATOM   7162  O  O   . PRO C  1 164 ? -39.305 52.787   105.212 1.00 17.94 ? 245  PRO C O   1 
ATOM   7163  C  CB  . PRO C  1 164 ? -41.403 54.615   107.109 1.00 16.54 ? 245  PRO C CB  1 
ATOM   7164  C  CG  . PRO C  1 164 ? -42.269 54.879   105.935 1.00 16.55 ? 245  PRO C CG  1 
ATOM   7165  C  CD  . PRO C  1 164 ? -41.550 55.951   105.197 1.00 16.41 ? 245  PRO C CD  1 
ATOM   7166  N  N   . SER C  1 165 ? -38.894 52.726   107.429 1.00 20.32 ? 246  SER C N   1 
ATOM   7167  C  CA  . SER C  1 165 ? -38.298 51.401   107.438 1.00 20.92 ? 246  SER C CA  1 
ATOM   7168  C  C   . SER C  1 165 ? -39.324 50.426   108.021 1.00 21.91 ? 246  SER C C   1 
ATOM   7169  O  O   . SER C  1 165 ? -39.026 49.254   108.229 1.00 22.01 ? 246  SER C O   1 
ATOM   7170  C  CB  . SER C  1 165 ? -37.019 51.400   108.269 1.00 21.79 ? 246  SER C CB  1 
ATOM   7171  O  OG  . SER C  1 165 ? -37.279 51.868   109.579 1.00 25.59 ? 246  SER C OG  1 
ATOM   7172  N  N   . ASN C  1 166 ? -40.524 50.944   108.297 1.00 23.85 ? 247  ASN C N   1 
ATOM   7173  C  CA  . ASN C  1 166 ? -41.662 50.156   108.774 1.00 25.13 ? 247  ASN C CA  1 
ATOM   7174  C  C   . ASN C  1 166 ? -42.576 50.126   107.568 1.00 27.20 ? 247  ASN C C   1 
ATOM   7175  O  O   . ASN C  1 166 ? -42.226 49.572   106.527 1.00 32.43 ? 247  ASN C O   1 
ATOM   7176  C  CB  . ASN C  1 166 ? -42.422 50.859   109.875 1.00 26.46 ? 247  ASN C CB  1 
ATOM   7177  C  CG  . ASN C  1 166 ? -41.532 51.388   110.928 1.00 25.87 ? 247  ASN C CG  1 
ATOM   7178  O  OD1 . ASN C  1 166 ? -40.604 50.708   111.358 1.00 28.96 ? 247  ASN C OD1 1 
ATOM   7179  N  ND2 . ASN C  1 166 ? -41.804 52.600   111.374 1.00 21.59 ? 247  ASN C ND2 1 
ATOM   7180  N  N   . GLY C  1 167 ? -43.733 50.765   107.691 1.00 25.98 ? 248  GLY C N   1 
ATOM   7181  C  CA  . GLY C  1 167 ? -44.688 50.808   106.589 1.00 24.83 ? 248  GLY C CA  1 
ATOM   7182  C  C   . GLY C  1 167 ? -44.166 51.141   105.194 1.00 22.73 ? 248  GLY C C   1 
ATOM   7183  O  O   . GLY C  1 167 ? -42.961 51.265   104.976 1.00 20.52 ? 248  GLY C O   1 
ATOM   7184  N  N   . GLN C  1 168 ? -45.098 51.284   104.249 1.00 21.79 ? 249  GLN C N   1 
ATOM   7185  C  CA  . GLN C  1 168 ? -44.789 51.598   102.858 1.00 20.33 ? 249  GLN C CA  1 
ATOM   7186  C  C   . GLN C  1 168 ? -43.695 52.624   102.711 1.00 18.30 ? 249  GLN C C   1 
ATOM   7187  O  O   . GLN C  1 168 ? -43.671 53.625   103.418 1.00 17.56 ? 249  GLN C O   1 
ATOM   7188  C  CB  . GLN C  1 168 ? -46.017 52.149   102.131 1.00 20.60 ? 249  GLN C CB  1 
ATOM   7189  C  CG  . GLN C  1 168 ? -46.784 51.141   101.292 1.00 24.70 ? 249  GLN C CG  1 
ATOM   7190  C  CD  . GLN C  1 168 ? -45.979 50.555   100.154 1.00 22.95 ? 249  GLN C CD  1 
ATOM   7191  O  OE1 . GLN C  1 168 ? -44.924 51.060   99.794  1.00 26.75 ? 249  GLN C OE1 1 
ATOM   7192  N  NE2 . GLN C  1 168 ? -46.487 49.491   99.574  1.00 24.96 ? 249  GLN C NE2 1 
ATOM   7193  N  N   . ALA C  1 169 ? -42.794 52.374   101.777 1.00 15.74 ? 250  ALA C N   1 
ATOM   7194  C  CA  . ALA C  1 169 ? -41.733 53.319   101.508 1.00 16.00 ? 250  ALA C CA  1 
ATOM   7195  C  C   . ALA C  1 169 ? -41.781 53.562   100.006 1.00 16.30 ? 250  ALA C C   1 
ATOM   7196  O  O   . ALA C  1 169 ? -42.701 53.117   99.323  1.00 17.09 ? 250  ALA C O   1 
ATOM   7197  C  CB  . ALA C  1 169 ? -40.398 52.756   101.918 1.00 15.89 ? 250  ALA C CB  1 
ATOM   7198  N  N   . SER C  1 170 ? -40.800 54.279   99.492  1.00 15.68 ? 251  SER C N   1 
ATOM   7199  C  CA  . SER C  1 170 ? -40.759 54.576   98.082  1.00 15.06 ? 251  SER C CA  1 
ATOM   7200  C  C   . SER C  1 170 ? -39.510 53.906   97.531  1.00 15.27 ? 251  SER C C   1 
ATOM   7201  O  O   . SER C  1 170 ? -38.439 53.964   98.148  1.00 15.96 ? 251  SER C O   1 
ATOM   7202  C  CB  . SER C  1 170 ? -40.714 56.088   97.900  1.00 16.00 ? 251  SER C CB  1 
ATOM   7203  O  OG  . SER C  1 170 ? -40.725 56.442   96.534  1.00 21.36 ? 251  SER C OG  1 
ATOM   7204  N  N   . TYR C  1 171 ? -39.648 53.259   96.378  1.00 14.87 ? 252  TYR C N   1 
ATOM   7205  C  CA  . TYR C  1 171 ? -38.535 52.544   95.770  1.00 15.13 ? 252  TYR C CA  1 
ATOM   7206  C  C   . TYR C  1 171 ? -38.313 52.990   94.329  1.00 16.91 ? 252  TYR C C   1 
ATOM   7207  O  O   . TYR C  1 171 ? -39.255 53.061   93.537  1.00 17.68 ? 252  TYR C O   1 
ATOM   7208  C  CB  . TYR C  1 171 ? -38.815 51.047   95.827  1.00 13.59 ? 252  TYR C CB  1 
ATOM   7209  C  CG  . TYR C  1 171 ? -39.581 50.666   97.070  1.00 15.70 ? 252  TYR C CG  1 
ATOM   7210  C  CD1 . TYR C  1 171 ? -40.930 50.302   97.002  1.00 15.39 ? 252  TYR C CD1 1 
ATOM   7211  C  CD2 . TYR C  1 171 ? -38.988 50.756   98.330  1.00 17.20 ? 252  TYR C CD2 1 
ATOM   7212  C  CE1 . TYR C  1 171 ? -41.670 50.046   98.155  1.00 14.68 ? 252  TYR C CE1 1 
ATOM   7213  C  CE2 . TYR C  1 171 ? -39.720 50.503   99.494  1.00 17.64 ? 252  TYR C CE2 1 
ATOM   7214  C  CZ  . TYR C  1 171 ? -41.061 50.151   99.396  1.00 17.93 ? 252  TYR C CZ  1 
ATOM   7215  O  OH  . TYR C  1 171 ? -41.790 49.924   100.542 1.00 18.01 ? 252  TYR C OH  1 
ATOM   7216  N  N   . LYS C  1 172 ? -37.059 53.280   93.997  1.00 16.94 ? 253  LYS C N   1 
ATOM   7217  C  CA  . LYS C  1 172 ? -36.707 53.745   92.666  1.00 17.49 ? 253  LYS C CA  1 
ATOM   7218  C  C   . LYS C  1 172 ? -35.538 53.001   92.053  1.00 18.66 ? 253  LYS C C   1 
ATOM   7219  O  O   . LYS C  1 172 ? -34.567 52.670   92.735  1.00 19.21 ? 253  LYS C O   1 
ATOM   7220  C  CB  . LYS C  1 172 ? -36.357 55.236   92.698  1.00 18.83 ? 253  LYS C CB  1 
ATOM   7221  C  CG  . LYS C  1 172 ? -37.542 56.179   92.859  1.00 19.46 ? 253  LYS C CG  1 
ATOM   7222  C  CD  . LYS C  1 172 ? -37.133 57.621   92.614  1.00 18.37 ? 253  LYS C CD  1 
ATOM   7223  C  CE  . LYS C  1 172 ? -38.299 58.563   92.848  1.00 18.47 ? 253  LYS C CE  1 
ATOM   7224  N  NZ  . LYS C  1 172 ? -37.927 59.973   92.568  1.00 19.72 ? 253  LYS C NZ  1 
ATOM   7225  N  N   . ILE C  1 173 ? -35.635 52.747   90.754  1.00 18.60 ? 254  ILE C N   1 
ATOM   7226  C  CA  . ILE C  1 173 ? -34.572 52.078   90.025  1.00 18.97 ? 254  ILE C CA  1 
ATOM   7227  C  C   . ILE C  1 173 ? -33.880 53.152   89.190  1.00 18.71 ? 254  ILE C C   1 
ATOM   7228  O  O   . ILE C  1 173 ? -34.532 53.876   88.449  1.00 19.57 ? 254  ILE C O   1 
ATOM   7229  C  CB  . ILE C  1 173 ? -35.127 51.032   89.077  1.00 19.44 ? 254  ILE C CB  1 
ATOM   7230  C  CG1 . ILE C  1 173 ? -35.872 49.957   89.864  1.00 20.66 ? 254  ILE C CG1 1 
ATOM   7231  C  CG2 . ILE C  1 173 ? -33.998 50.433   88.264  1.00 19.23 ? 254  ILE C CG2 1 
ATOM   7232  C  CD1 . ILE C  1 173 ? -36.601 48.968   88.959  1.00 22.62 ? 254  ILE C CD1 1 
ATOM   7233  N  N   . PHE C  1 174 ? -32.565 53.263   89.315  1.00 17.84 ? 255  PHE C N   1 
ATOM   7234  C  CA  . PHE C  1 174 ? -31.827 54.257   88.552  1.00 17.99 ? 255  PHE C CA  1 
ATOM   7235  C  C   . PHE C  1 174 ? -30.919 53.625   87.506  1.00 19.39 ? 255  PHE C C   1 
ATOM   7236  O  O   . PHE C  1 174 ? -30.155 52.701   87.800  1.00 21.11 ? 255  PHE C O   1 
ATOM   7237  C  CB  . PHE C  1 174 ? -30.955 55.118   89.464  1.00 15.75 ? 255  PHE C CB  1 
ATOM   7238  C  CG  . PHE C  1 174 ? -31.719 55.928   90.454  1.00 16.37 ? 255  PHE C CG  1 
ATOM   7239  C  CD1 . PHE C  1 174 ? -32.077 55.391   91.682  1.00 17.93 ? 255  PHE C CD1 1 
ATOM   7240  C  CD2 . PHE C  1 174 ? -32.067 57.240   90.170  1.00 17.17 ? 255  PHE C CD2 1 
ATOM   7241  C  CE1 . PHE C  1 174 ? -32.766 56.148   92.617  1.00 17.17 ? 255  PHE C CE1 1 
ATOM   7242  C  CE2 . PHE C  1 174 ? -32.752 58.003   91.092  1.00 18.48 ? 255  PHE C CE2 1 
ATOM   7243  C  CZ  . PHE C  1 174 ? -33.104 57.455   92.324  1.00 19.30 ? 255  PHE C CZ  1 
ATOM   7244  N  N   . LYS C  1 175 ? -31.011 54.122   86.282  1.00 19.48 ? 256  LYS C N   1 
ATOM   7245  C  CA  . LYS C  1 175 ? -30.157 53.651   85.209  1.00 20.68 ? 256  LYS C CA  1 
ATOM   7246  C  C   . LYS C  1 175 ? -29.151 54.777   85.004  1.00 21.58 ? 256  LYS C C   1 
ATOM   7247  O  O   . LYS C  1 175 ? -29.532 55.929   84.775  1.00 21.08 ? 256  LYS C O   1 
ATOM   7248  C  CB  . LYS C  1 175 ? -30.960 53.438   83.924  1.00 20.43 ? 256  LYS C CB  1 
ATOM   7249  C  CG  . LYS C  1 175 ? -30.104 53.151   82.703  1.00 18.05 ? 256  LYS C CG  1 
ATOM   7250  C  CD  . LYS C  1 175 ? -30.939 53.117   81.445  1.00 19.59 ? 256  LYS C CD  1 
ATOM   7251  C  CE  . LYS C  1 175 ? -30.089 52.733   80.250  1.00 19.94 ? 256  LYS C CE  1 
ATOM   7252  N  NZ  . LYS C  1 175 ? -30.907 52.459   79.030  1.00 20.10 ? 256  LYS C NZ  1 
ATOM   7253  N  N   . MET C  1 176 ? -27.868 54.467   85.104  1.00 22.31 ? 257  MET C N   1 
ATOM   7254  C  CA  . MET C  1 176 ? -26.884 55.514   84.910  1.00 24.59 ? 257  MET C CA  1 
ATOM   7255  C  C   . MET C  1 176 ? -25.756 55.096   83.996  1.00 25.30 ? 257  MET C C   1 
ATOM   7256  O  O   . MET C  1 176 ? -25.422 53.917   83.891  1.00 26.37 ? 257  MET C O   1 
ATOM   7257  C  CB  . MET C  1 176 ? -26.352 55.999   86.259  1.00 25.28 ? 257  MET C CB  1 
ATOM   7258  C  CG  . MET C  1 176 ? -25.945 54.909   87.204  1.00 27.32 ? 257  MET C CG  1 
ATOM   7259  S  SD  . MET C  1 176 ? -26.457 55.283   88.896  1.00 29.38 ? 257  MET C SD  1 
ATOM   7260  C  CE  . MET C  1 176 ? -26.760 53.626   89.462  1.00 30.32 ? 257  MET C CE  1 
ATOM   7261  N  N   . GLU C  1 177 ? -25.188 56.074   83.310  1.00 25.73 ? 258  GLU C N   1 
ATOM   7262  C  CA  . GLU C  1 177 ? -24.105 55.809   82.386  1.00 27.66 ? 258  GLU C CA  1 
ATOM   7263  C  C   . GLU C  1 177 ? -23.011 56.806   82.650  1.00 27.33 ? 258  GLU C C   1 
ATOM   7264  O  O   . GLU C  1 177 ? -23.269 58.004   82.737  1.00 27.28 ? 258  GLU C O   1 
ATOM   7265  C  CB  . GLU C  1 177 ? -24.620 55.927   80.959  1.00 29.92 ? 258  GLU C CB  1 
ATOM   7266  C  CG  . GLU C  1 177 ? -25.728 54.934   80.685  1.00 34.45 ? 258  GLU C CG  1 
ATOM   7267  C  CD  . GLU C  1 177 ? -26.420 55.167   79.363  1.00 37.00 ? 258  GLU C CD  1 
ATOM   7268  O  OE1 . GLU C  1 177 ? -27.256 54.317   78.984  1.00 37.23 ? 258  GLU C OE1 1 
ATOM   7269  O  OE2 . GLU C  1 177 ? -26.134 56.196   78.710  1.00 39.54 ? 258  GLU C OE2 1 
ATOM   7270  N  N   . LYS C  1 178 ? -21.787 56.314   82.770  1.00 28.04 ? 259  LYS C N   1 
ATOM   7271  C  CA  . LYS C  1 178 ? -20.674 57.189   83.073  1.00 28.76 ? 259  LYS C CA  1 
ATOM   7272  C  C   . LYS C  1 178 ? -21.084 57.958   84.323  1.00 27.49 ? 259  LYS C C   1 
ATOM   7273  O  O   . LYS C  1 178 ? -20.873 59.169   84.430  1.00 26.82 ? 259  LYS C O   1 
ATOM   7274  C  CB  . LYS C  1 178 ? -20.394 58.150   81.914  1.00 31.16 ? 259  LYS C CB  1 
ATOM   7275  C  CG  . LYS C  1 178 ? -19.863 57.451   80.669  1.00 37.69 ? 259  LYS C CG  1 
ATOM   7276  C  CD  . LYS C  1 178 ? -19.317 58.427   79.634  1.00 41.68 ? 259  LYS C CD  1 
ATOM   7277  C  CE  . LYS C  1 178 ? -18.812 57.669   78.403  1.00 45.06 ? 259  LYS C CE  1 
ATOM   7278  N  NZ  . LYS C  1 178 ? -18.153 58.563   77.395  1.00 46.80 ? 259  LYS C NZ  1 
ATOM   7279  N  N   . GLY C  1 179 ? -21.709 57.234   85.250  1.00 25.34 ? 260  GLY C N   1 
ATOM   7280  C  CA  . GLY C  1 179 ? -22.133 57.818   86.506  1.00 23.68 ? 260  GLY C CA  1 
ATOM   7281  C  C   . GLY C  1 179 ? -23.204 58.890   86.482  1.00 23.69 ? 260  GLY C C   1 
ATOM   7282  O  O   . GLY C  1 179 ? -23.433 59.544   87.500  1.00 24.21 ? 260  GLY C O   1 
ATOM   7283  N  N   . LYS C  1 180 ? -23.855 59.096   85.343  1.00 22.97 ? 261  LYS C N   1 
ATOM   7284  C  CA  . LYS C  1 180 ? -24.915 60.097   85.271  1.00 22.68 ? 261  LYS C CA  1 
ATOM   7285  C  C   . LYS C  1 180 ? -26.263 59.381   85.127  1.00 20.36 ? 261  LYS C C   1 
ATOM   7286  O  O   . LYS C  1 180 ? -26.403 58.473   84.313  1.00 19.18 ? 261  LYS C O   1 
ATOM   7287  C  CB  . LYS C  1 180 ? -24.679 61.048   84.087  1.00 24.44 ? 261  LYS C CB  1 
ATOM   7288  C  CG  . LYS C  1 180 ? -25.700 62.186   84.010  1.00 28.32 ? 261  LYS C CG  1 
ATOM   7289  C  CD  . LYS C  1 180 ? -25.421 63.169   82.875  1.00 30.73 ? 261  LYS C CD  1 
ATOM   7290  C  CE  . LYS C  1 180 ? -24.134 63.963   83.115  1.00 35.15 ? 261  LYS C CE  1 
ATOM   7291  N  NZ  . LYS C  1 180 ? -23.851 64.989   82.048  1.00 34.34 ? 261  LYS C NZ  1 
ATOM   7292  N  N   . VAL C  1 181 ? -27.246 59.772   85.932  1.00 19.70 ? 262  VAL C N   1 
ATOM   7293  C  CA  . VAL C  1 181 ? -28.573 59.142   85.878  1.00 18.44 ? 262  VAL C CA  1 
ATOM   7294  C  C   . VAL C  1 181 ? -29.275 59.498   84.585  1.00 17.55 ? 262  VAL C C   1 
ATOM   7295  O  O   . VAL C  1 181 ? -29.701 60.625   84.400  1.00 18.03 ? 262  VAL C O   1 
ATOM   7296  C  CB  . VAL C  1 181 ? -29.478 59.593   87.043  1.00 17.24 ? 262  VAL C CB  1 
ATOM   7297  C  CG1 . VAL C  1 181 ? -30.849 58.979   86.883  1.00 15.08 ? 262  VAL C CG1 1 
ATOM   7298  C  CG2 . VAL C  1 181 ? -28.870 59.179   88.375  1.00 15.79 ? 262  VAL C CG2 1 
ATOM   7299  N  N   . VAL C  1 182 ? -29.396 58.530   83.690  1.00 17.82 ? 263  VAL C N   1 
ATOM   7300  C  CA  . VAL C  1 182 ? -30.031 58.772   82.406  1.00 16.84 ? 263  VAL C CA  1 
ATOM   7301  C  C   . VAL C  1 182 ? -31.510 58.438   82.456  1.00 18.17 ? 263  VAL C C   1 
ATOM   7302  O  O   . VAL C  1 182 ? -32.267 58.800   81.557  1.00 18.56 ? 263  VAL C O   1 
ATOM   7303  C  CB  . VAL C  1 182 ? -29.363 57.945   81.298  1.00 16.57 ? 263  VAL C CB  1 
ATOM   7304  C  CG1 . VAL C  1 182 ? -27.937 58.441   81.076  1.00 16.94 ? 263  VAL C CG1 1 
ATOM   7305  C  CG2 . VAL C  1 182 ? -29.351 56.482   81.682  1.00 15.10 ? 263  VAL C CG2 1 
ATOM   7306  N  N   . LYS C  1 183 ? -31.926 57.750   83.513  1.00 18.83 ? 264  LYS C N   1 
ATOM   7307  C  CA  . LYS C  1 183 ? -33.322 57.392   83.661  1.00 20.15 ? 264  LYS C CA  1 
ATOM   7308  C  C   . LYS C  1 183 ? -33.565 56.791   85.023  1.00 21.99 ? 264  LYS C C   1 
ATOM   7309  O  O   . LYS C  1 183 ? -32.666 56.200   85.624  1.00 22.51 ? 264  LYS C O   1 
ATOM   7310  C  CB  . LYS C  1 183 ? -33.737 56.390   82.584  1.00 20.96 ? 264  LYS C CB  1 
ATOM   7311  C  CG  . LYS C  1 183 ? -35.242 56.147   82.508  1.00 22.89 ? 264  LYS C CG  1 
ATOM   7312  C  CD  . LYS C  1 183 ? -35.604 55.267   81.310  1.00 23.69 ? 264  LYS C CD  1 
ATOM   7313  C  CE  . LYS C  1 183 ? -37.112 55.080   81.202  1.00 24.27 ? 264  LYS C CE  1 
ATOM   7314  N  NZ  . LYS C  1 183 ? -37.508 54.364   79.947  1.00 24.68 ? 264  LYS C NZ  1 
ATOM   7315  N  N   . SER C  1 184 ? -34.788 56.949   85.510  1.00 21.93 ? 265  SER C N   1 
ATOM   7316  C  CA  . SER C  1 184 ? -35.157 56.399   86.797  1.00 22.06 ? 265  SER C CA  1 
ATOM   7317  C  C   . SER C  1 184 ? -36.635 56.090   86.758  1.00 22.93 ? 265  SER C C   1 
ATOM   7318  O  O   . SER C  1 184 ? -37.370 56.615   85.920  1.00 23.78 ? 265  SER C O   1 
ATOM   7319  C  CB  . SER C  1 184 ? -34.867 57.394   87.912  1.00 21.21 ? 265  SER C CB  1 
ATOM   7320  O  OG  . SER C  1 184 ? -35.559 58.601   87.679  1.00 24.32 ? 265  SER C OG  1 
ATOM   7321  N  N   . VAL C  1 185 ? -37.063 55.224   87.663  1.00 22.84 ? 266  VAL C N   1 
ATOM   7322  C  CA  . VAL C  1 185 ? -38.454 54.834   87.740  1.00 22.35 ? 266  VAL C CA  1 
ATOM   7323  C  C   . VAL C  1 185 ? -38.800 54.457   89.159  1.00 21.66 ? 266  VAL C C   1 
ATOM   7324  O  O   . VAL C  1 185 ? -38.066 53.724   89.819  1.00 21.83 ? 266  VAL C O   1 
ATOM   7325  C  CB  . VAL C  1 185 ? -38.754 53.622   86.833  1.00 23.11 ? 266  VAL C CB  1 
ATOM   7326  C  CG1 . VAL C  1 185 ? -40.173 53.137   87.058  1.00 23.07 ? 266  VAL C CG1 1 
ATOM   7327  C  CG2 . VAL C  1 185 ? -38.578 54.015   85.372  1.00 27.28 ? 266  VAL C CG2 1 
ATOM   7328  N  N   . GLU C  1 186 ? -39.923 54.971   89.630  1.00 21.21 ? 267  GLU C N   1 
ATOM   7329  C  CA  . GLU C  1 186 ? -40.381 54.643   90.963  1.00 22.36 ? 267  GLU C CA  1 
ATOM   7330  C  C   . GLU C  1 186 ? -41.170 53.356   90.832  1.00 19.93 ? 267  GLU C C   1 
ATOM   7331  O  O   . GLU C  1 186 ? -42.052 53.259   89.992  1.00 20.27 ? 267  GLU C O   1 
ATOM   7332  C  CB  . GLU C  1 186 ? -41.280 55.747   91.505  1.00 24.61 ? 267  GLU C CB  1 
ATOM   7333  C  CG  . GLU C  1 186 ? -41.916 55.404   92.830  1.00 29.52 ? 267  GLU C CG  1 
ATOM   7334  C  CD  . GLU C  1 186 ? -42.502 56.619   93.523  1.00 32.97 ? 267  GLU C CD  1 
ATOM   7335  O  OE1 . GLU C  1 186 ? -43.394 57.285   92.943  1.00 35.49 ? 267  GLU C OE1 1 
ATOM   7336  O  OE2 . GLU C  1 186 ? -42.065 56.909   94.654  1.00 33.21 ? 267  GLU C OE2 1 
ATOM   7337  N  N   . LEU C  1 187 ? -40.849 52.357   91.636  1.00 18.61 ? 268  LEU C N   1 
ATOM   7338  C  CA  . LEU C  1 187 ? -41.592 51.112   91.550  1.00 19.00 ? 268  LEU C CA  1 
ATOM   7339  C  C   . LEU C  1 187 ? -42.995 51.303   92.083  1.00 20.04 ? 268  LEU C C   1 
ATOM   7340  O  O   . LEU C  1 187 ? -43.196 51.968   93.096  1.00 20.70 ? 268  LEU C O   1 
ATOM   7341  C  CB  . LEU C  1 187 ? -40.922 50.018   92.366  1.00 16.94 ? 268  LEU C CB  1 
ATOM   7342  C  CG  . LEU C  1 187 ? -39.519 49.669   91.904  1.00 16.66 ? 268  LEU C CG  1 
ATOM   7343  C  CD1 . LEU C  1 187 ? -38.949 48.558   92.772  1.00 13.77 ? 268  LEU C CD1 1 
ATOM   7344  C  CD2 . LEU C  1 187 ? -39.582 49.262   90.441  1.00 16.80 ? 268  LEU C CD2 1 
ATOM   7345  N  N   . ASP C  1 188 ? -43.971 50.746   91.383  1.00 21.36 ? 269  ASP C N   1 
ATOM   7346  C  CA  . ASP C  1 188 ? -45.337 50.816   91.854  1.00 22.42 ? 269  ASP C CA  1 
ATOM   7347  C  C   . ASP C  1 188 ? -45.500 49.503   92.615  1.00 21.53 ? 269  ASP C C   1 
ATOM   7348  O  O   . ASP C  1 188 ? -46.012 48.512   92.082  1.00 21.68 ? 269  ASP C O   1 
ATOM   7349  C  CB  . ASP C  1 188 ? -46.310 50.891   90.686  1.00 24.64 ? 269  ASP C CB  1 
ATOM   7350  C  CG  . ASP C  1 188 ? -47.748 50.822   91.139  1.00 28.21 ? 269  ASP C CG  1 
ATOM   7351  O  OD1 . ASP C  1 188 ? -48.061 51.464   92.163  1.00 30.60 ? 269  ASP C OD1 1 
ATOM   7352  O  OD2 . ASP C  1 188 ? -48.559 50.134   90.477  1.00 29.89 ? 269  ASP C OD2 1 
ATOM   7353  N  N   . ALA C  1 189 ? -45.043 49.500   93.864  1.00 20.07 ? 270  ALA C N   1 
ATOM   7354  C  CA  . ALA C  1 189 ? -45.086 48.294   94.675  1.00 18.91 ? 270  ALA C CA  1 
ATOM   7355  C  C   . ALA C  1 189 ? -45.862 48.392   95.976  1.00 18.73 ? 270  ALA C C   1 
ATOM   7356  O  O   . ALA C  1 189 ? -45.284 48.289   97.065  1.00 18.21 ? 270  ALA C O   1 
ATOM   7357  C  CB  . ALA C  1 189 ? -43.668 47.825   94.965  1.00 18.56 ? 270  ALA C CB  1 
ATOM   7358  N  N   . PRO C  1 190 ? -47.186 48.586   95.886  1.00 17.12 ? 271  PRO C N   1 
ATOM   7359  C  CA  . PRO C  1 190 ? -47.955 48.670   97.127  1.00 15.89 ? 271  PRO C CA  1 
ATOM   7360  C  C   . PRO C  1 190 ? -47.817 47.366   97.917  1.00 15.01 ? 271  PRO C C   1 
ATOM   7361  O  O   . PRO C  1 190 ? -47.890 46.278   97.352  1.00 13.65 ? 271  PRO C O   1 
ATOM   7362  C  CB  . PRO C  1 190 ? -49.379 48.902   96.636  1.00 14.98 ? 271  PRO C CB  1 
ATOM   7363  C  CG  . PRO C  1 190 ? -49.394 48.186   95.313  1.00 17.82 ? 271  PRO C CG  1 
ATOM   7364  C  CD  . PRO C  1 190 ? -48.072 48.618   94.710  1.00 17.25 ? 271  PRO C CD  1 
ATOM   7365  N  N   . ASN C  1 191 ? -47.619 47.503   99.222  1.00 15.27 ? 272  ASN C N   1 
ATOM   7366  C  CA  . ASN C  1 191 ? -47.465 46.390   100.155 1.00 16.81 ? 272  ASN C CA  1 
ATOM   7367  C  C   . ASN C  1 191 ? -46.089 45.743   100.105 1.00 18.05 ? 272  ASN C C   1 
ATOM   7368  O  O   . ASN C  1 191 ? -45.801 44.795   100.841 1.00 19.20 ? 272  ASN C O   1 
ATOM   7369  C  CB  . ASN C  1 191 ? -48.542 45.326   99.930  1.00 15.37 ? 272  ASN C CB  1 
ATOM   7370  C  CG  . ASN C  1 191 ? -48.752 44.468   101.159 1.00 17.01 ? 272  ASN C CG  1 
ATOM   7371  O  OD1 . ASN C  1 191 ? -48.819 44.990   102.284 1.00 16.87 ? 272  ASN C OD1 1 
ATOM   7372  N  ND2 . ASN C  1 191 ? -48.863 43.156   100.964 1.00 16.09 ? 272  ASN C ND2 1 
ATOM   7373  N  N   . TYR C  1 192 ? -45.238 46.253   99.227  1.00 18.49 ? 273  TYR C N   1 
ATOM   7374  C  CA  . TYR C  1 192 ? -43.891 45.736   99.111  1.00 17.28 ? 273  TYR C CA  1 
ATOM   7375  C  C   . TYR C  1 192 ? -42.988 46.605   99.962  1.00 17.87 ? 273  TYR C C   1 
ATOM   7376  O  O   . TYR C  1 192 ? -43.376 47.705   100.376 1.00 17.23 ? 273  TYR C O   1 
ATOM   7377  C  CB  . TYR C  1 192 ? -43.404 45.812   97.673  1.00 17.24 ? 273  TYR C CB  1 
ATOM   7378  C  CG  . TYR C  1 192 ? -43.899 44.713   96.788  1.00 16.47 ? 273  TYR C CG  1 
ATOM   7379  C  CD1 . TYR C  1 192 ? -45.227 44.653   96.385  1.00 17.56 ? 273  TYR C CD1 1 
ATOM   7380  C  CD2 . TYR C  1 192 ? -43.029 43.727   96.346  1.00 17.00 ? 273  TYR C CD2 1 
ATOM   7381  C  CE1 . TYR C  1 192 ? -45.672 43.626   95.553  1.00 18.00 ? 273  TYR C CE1 1 
ATOM   7382  C  CE2 . TYR C  1 192 ? -43.456 42.706   95.522  1.00 17.50 ? 273  TYR C CE2 1 
ATOM   7383  C  CZ  . TYR C  1 192 ? -44.774 42.661   95.128  1.00 18.02 ? 273  TYR C CZ  1 
ATOM   7384  O  OH  . TYR C  1 192 ? -45.175 41.648   94.300  1.00 20.00 ? 273  TYR C OH  1 
ATOM   7385  N  N   . HIS C  1 193 ? -41.789 46.101   100.227 1.00 16.46 ? 274  HIS C N   1 
ATOM   7386  C  CA  . HIS C  1 193 ? -40.801 46.848   100.982 1.00 17.16 ? 274  HIS C CA  1 
ATOM   7387  C  C   . HIS C  1 193 ? -39.400 46.456   100.525 1.00 15.77 ? 274  HIS C C   1 
ATOM   7388  O  O   . HIS C  1 193 ? -38.991 45.304   100.667 1.00 16.36 ? 274  HIS C O   1 
ATOM   7389  C  CB  . HIS C  1 193 ? -40.954 46.609   102.481 1.00 18.54 ? 274  HIS C CB  1 
ATOM   7390  C  CG  . HIS C  1 193 ? -40.222 47.614   103.311 1.00 21.27 ? 274  HIS C CG  1 
ATOM   7391  N  ND1 . HIS C  1 193 ? -38.872 47.528   103.570 1.00 22.94 ? 274  HIS C ND1 1 
ATOM   7392  C  CD2 . HIS C  1 193 ? -40.636 48.781   103.868 1.00 21.71 ? 274  HIS C CD2 1 
ATOM   7393  C  CE1 . HIS C  1 193 ? -38.483 48.594   104.248 1.00 22.76 ? 274  HIS C CE1 1 
ATOM   7394  N  NE2 . HIS C  1 193 ? -39.537 49.370   104.439 1.00 22.83 ? 274  HIS C NE2 1 
ATOM   7395  N  N   . TYR C  1 194 ? -38.675 47.420   99.968  1.00 13.58 ? 275  TYR C N   1 
ATOM   7396  C  CA  . TYR C  1 194 ? -37.331 47.171   99.469  1.00 13.63 ? 275  TYR C CA  1 
ATOM   7397  C  C   . TYR C  1 194 ? -36.219 47.929   100.163 1.00 14.41 ? 275  TYR C C   1 
ATOM   7398  O  O   . TYR C  1 194 ? -36.261 49.151   100.273 1.00 14.05 ? 275  TYR C O   1 
ATOM   7399  C  CB  . TYR C  1 194 ? -37.245 47.484   97.978  1.00 13.57 ? 275  TYR C CB  1 
ATOM   7400  C  CG  . TYR C  1 194 ? -38.093 46.585   97.109  1.00 12.98 ? 275  TYR C CG  1 
ATOM   7401  C  CD1 . TYR C  1 194 ? -39.452 46.827   96.937  1.00 11.47 ? 275  TYR C CD1 1 
ATOM   7402  C  CD2 . TYR C  1 194 ? -37.527 45.488   96.453  1.00 11.03 ? 275  TYR C CD2 1 
ATOM   7403  C  CE1 . TYR C  1 194 ? -40.227 45.999   96.120  1.00 10.65 ? 275  TYR C CE1 1 
ATOM   7404  C  CE2 . TYR C  1 194 ? -38.288 44.662   95.653  1.00 8.15  ? 275  TYR C CE2 1 
ATOM   7405  C  CZ  . TYR C  1 194 ? -39.631 44.925   95.484  1.00 9.45  ? 275  TYR C CZ  1 
ATOM   7406  O  OH  . TYR C  1 194 ? -40.362 44.135   94.644  1.00 9.76  ? 275  TYR C OH  1 
ATOM   7407  N  N   . GLU C  1 195 ? -35.219 47.177   100.615 1.00 15.31 ? 276  GLU C N   1 
ATOM   7408  C  CA  . GLU C  1 195 ? -34.041 47.721   101.276 1.00 16.28 ? 276  GLU C CA  1 
ATOM   7409  C  C   . GLU C  1 195 ? -32.845 46.811   101.029 1.00 16.53 ? 276  GLU C C   1 
ATOM   7410  O  O   . GLU C  1 195 ? -33.001 45.592   100.881 1.00 15.55 ? 276  GLU C O   1 
ATOM   7411  C  CB  . GLU C  1 195 ? -34.247 47.844   102.780 1.00 16.93 ? 276  GLU C CB  1 
ATOM   7412  C  CG  . GLU C  1 195 ? -35.010 49.055   103.215 1.00 20.17 ? 276  GLU C CG  1 
ATOM   7413  C  CD  . GLU C  1 195 ? -34.933 49.251   104.710 1.00 22.91 ? 276  GLU C CD  1 
ATOM   7414  O  OE1 . GLU C  1 195 ? -35.581 50.188   105.220 1.00 25.15 ? 276  GLU C OE1 1 
ATOM   7415  O  OE2 . GLU C  1 195 ? -34.218 48.466   105.376 1.00 25.63 ? 276  GLU C OE2 1 
ATOM   7416  N  N   . GLU C  1 196 ? -31.664 47.428   100.976 1.00 16.38 ? 277  GLU C N   1 
ATOM   7417  C  CA  . GLU C  1 196 ? -30.394 46.741   100.775 1.00 16.35 ? 277  GLU C CA  1 
ATOM   7418  C  C   . GLU C  1 196 ? -30.449 45.618   99.742  1.00 17.28 ? 277  GLU C C   1 
ATOM   7419  O  O   . GLU C  1 196 ? -30.188 44.457   100.049 1.00 18.17 ? 277  GLU C O   1 
ATOM   7420  C  CB  . GLU C  1 196 ? -29.897 46.214   102.124 1.00 16.49 ? 277  GLU C CB  1 
ATOM   7421  C  CG  . GLU C  1 196 ? -30.053 47.250   103.238 1.00 19.11 ? 277  GLU C CG  1 
ATOM   7422  C  CD  . GLU C  1 196 ? -29.475 46.826   104.580 1.00 22.82 ? 277  GLU C CD  1 
ATOM   7423  O  OE1 . GLU C  1 196 ? -29.794 45.716   105.069 1.00 25.37 ? 277  GLU C OE1 1 
ATOM   7424  O  OE2 . GLU C  1 196 ? -28.706 47.624   105.159 1.00 26.72 ? 277  GLU C OE2 1 
ATOM   7425  N  N   . CYS C  1 197 ? -30.767 45.977   98.505  1.00 18.16 ? 278  CYS C N   1 
ATOM   7426  C  CA  . CYS C  1 197 ? -30.868 45.007   97.432  1.00 20.50 ? 278  CYS C CA  1 
ATOM   7427  C  C   . CYS C  1 197 ? -29.546 44.425   96.970  1.00 21.51 ? 278  CYS C C   1 
ATOM   7428  O  O   . CYS C  1 197 ? -28.520 45.103   96.960  1.00 23.48 ? 278  CYS C O   1 
ATOM   7429  C  CB  . CYS C  1 197 ? -31.533 45.635   96.222  1.00 21.40 ? 278  CYS C CB  1 
ATOM   7430  S  SG  . CYS C  1 197 ? -33.285 46.054   96.416  1.00 27.66 ? 278  CYS C SG  1 
ATOM   7431  N  N   . SER C  1 198 ? -29.584 43.155   96.583  1.00 21.42 ? 279  SER C N   1 
ATOM   7432  C  CA  . SER C  1 198 ? -28.413 42.474   96.047  1.00 21.53 ? 279  SER C CA  1 
ATOM   7433  C  C   . SER C  1 198 ? -28.833 42.250   94.607  1.00 21.18 ? 279  SER C C   1 
ATOM   7434  O  O   . SER C  1 198 ? -29.636 41.366   94.309  1.00 22.85 ? 279  SER C O   1 
ATOM   7435  C  CB  . SER C  1 198 ? -28.179 41.133   96.742  1.00 20.04 ? 279  SER C CB  1 
ATOM   7436  O  OG  . SER C  1 198 ? -27.847 41.332   98.104  1.00 21.90 ? 279  SER C OG  1 
ATOM   7437  N  N   . CYS C  1 199 ? -28.326 43.079   93.716  1.00 19.96 ? 280  CYS C N   1 
ATOM   7438  C  CA  . CYS C  1 199 ? -28.699 42.965   92.323  1.00 20.25 ? 280  CYS C CA  1 
ATOM   7439  C  C   . CYS C  1 199 ? -27.589 42.297   91.519  1.00 20.18 ? 280  CYS C C   1 
ATOM   7440  O  O   . CYS C  1 199 ? -26.419 42.310   91.912  1.00 20.65 ? 280  CYS C O   1 
ATOM   7441  C  CB  . CYS C  1 199 ? -28.973 44.355   91.748  1.00 21.84 ? 280  CYS C CB  1 
ATOM   7442  S  SG  . CYS C  1 199 ? -30.254 45.390   92.558  1.00 26.43 ? 280  CYS C SG  1 
ATOM   7443  N  N   . TYR C  1 200 ? -27.963 41.702   90.394  1.00 18.46 ? 281  TYR C N   1 
ATOM   7444  C  CA  . TYR C  1 200 ? -26.987 41.068   89.532  1.00 18.23 ? 281  TYR C CA  1 
ATOM   7445  C  C   . TYR C  1 200 ? -27.517 40.979   88.111  1.00 18.41 ? 281  TYR C C   1 
ATOM   7446  O  O   . TYR C  1 200 ? -28.724 40.888   87.894  1.00 19.34 ? 281  TYR C O   1 
ATOM   7447  C  CB  . TYR C  1 200 ? -26.636 39.680   90.049  1.00 16.46 ? 281  TYR C CB  1 
ATOM   7448  C  CG  . TYR C  1 200 ? -27.763 38.691   89.997  1.00 15.18 ? 281  TYR C CG  1 
ATOM   7449  C  CD1 . TYR C  1 200 ? -28.636 38.538   91.071  1.00 15.80 ? 281  TYR C CD1 1 
ATOM   7450  C  CD2 . TYR C  1 200 ? -27.956 37.898   88.875  1.00 14.49 ? 281  TYR C CD2 1 
ATOM   7451  C  CE1 . TYR C  1 200 ? -29.681 37.603   91.022  1.00 15.54 ? 281  TYR C CE1 1 
ATOM   7452  C  CE2 . TYR C  1 200 ? -28.994 36.967   88.815  1.00 15.32 ? 281  TYR C CE2 1 
ATOM   7453  C  CZ  . TYR C  1 200 ? -29.850 36.823   89.887  1.00 14.27 ? 281  TYR C CZ  1 
ATOM   7454  O  OH  . TYR C  1 200 ? -30.859 35.892   89.819  1.00 15.07 ? 281  TYR C OH  1 
ATOM   7455  N  N   . PRO C  1 201 ? -26.619 41.026   87.119  1.00 17.52 ? 282  PRO C N   1 
ATOM   7456  C  CA  . PRO C  1 201 ? -27.023 40.947   85.715  1.00 17.26 ? 282  PRO C CA  1 
ATOM   7457  C  C   . PRO C  1 201 ? -27.177 39.503   85.258  1.00 18.38 ? 282  PRO C C   1 
ATOM   7458  O  O   . PRO C  1 201 ? -26.524 38.607   85.786  1.00 18.45 ? 282  PRO C O   1 
ATOM   7459  C  CB  . PRO C  1 201 ? -25.882 41.660   85.002  1.00 15.83 ? 282  PRO C CB  1 
ATOM   7460  C  CG  . PRO C  1 201 ? -24.700 41.208   85.775  1.00 16.60 ? 282  PRO C CG  1 
ATOM   7461  C  CD  . PRO C  1 201 ? -25.178 41.309   87.233  1.00 17.30 ? 282  PRO C CD  1 
ATOM   7462  N  N   . ASN C  1 202 ? -28.047 39.285   84.279  1.00 19.89 ? 283  ASN C N   1 
ATOM   7463  C  CA  . ASN C  1 202 ? -28.287 37.956   83.721  1.00 20.83 ? 283  ASN C CA  1 
ATOM   7464  C  C   . ASN C  1 202 ? -29.026 38.147   82.398  1.00 21.88 ? 283  ASN C C   1 
ATOM   7465  O  O   . ASN C  1 202 ? -30.103 38.749   82.356  1.00 23.54 ? 283  ASN C O   1 
ATOM   7466  C  CB  . ASN C  1 202 ? -29.144 37.103   84.671  1.00 21.71 ? 283  ASN C CB  1 
ATOM   7467  C  CG  . ASN C  1 202 ? -29.160 35.619   84.281  1.00 23.85 ? 283  ASN C CG  1 
ATOM   7468  O  OD1 . ASN C  1 202 ? -28.888 35.264   83.140  1.00 26.68 ? 283  ASN C OD1 1 
ATOM   7469  N  ND2 . ASN C  1 202 ? -29.491 34.756   85.232  1.00 25.50 ? 283  ASN C ND2 1 
ATOM   7470  N  N   . ALA C  1 203 ? -28.437 37.645   81.319  1.00 21.43 ? 284  ALA C N   1 
ATOM   7471  C  CA  . ALA C  1 203 ? -29.034 37.748   79.992  1.00 21.14 ? 284  ALA C CA  1 
ATOM   7472  C  C   . ALA C  1 203 ? -29.542 39.146   79.682  1.00 21.75 ? 284  ALA C C   1 
ATOM   7473  O  O   . ALA C  1 203 ? -30.695 39.328   79.291  1.00 22.19 ? 284  ALA C O   1 
ATOM   7474  C  CB  . ALA C  1 203 ? -30.169 36.745   79.849  1.00 21.60 ? 284  ALA C CB  1 
ATOM   7475  N  N   . GLY C  1 204 ? -28.684 40.135   79.875  1.00 20.99 ? 285  GLY C N   1 
ATOM   7476  C  CA  . GLY C  1 204 ? -29.057 41.501   79.575  1.00 21.31 ? 285  GLY C CA  1 
ATOM   7477  C  C   . GLY C  1 204 ? -30.041 42.171   80.505  1.00 22.50 ? 285  GLY C C   1 
ATOM   7478  O  O   . GLY C  1 204 ? -30.501 43.274   80.208  1.00 23.68 ? 285  GLY C O   1 
ATOM   7479  N  N   . GLU C  1 205 ? -30.379 41.534   81.620  1.00 22.57 ? 286  GLU C N   1 
ATOM   7480  C  CA  . GLU C  1 205 ? -31.318 42.156   82.543  1.00 24.10 ? 286  GLU C CA  1 
ATOM   7481  C  C   . GLU C  1 205 ? -30.818 42.051   83.962  1.00 23.10 ? 286  GLU C C   1 
ATOM   7482  O  O   . GLU C  1 205 ? -29.900 41.286   84.243  1.00 23.38 ? 286  GLU C O   1 
ATOM   7483  C  CB  . GLU C  1 205 ? -32.694 41.512   82.426  1.00 25.89 ? 286  GLU C CB  1 
ATOM   7484  C  CG  . GLU C  1 205 ? -33.115 41.297   80.993  1.00 31.44 ? 286  GLU C CG  1 
ATOM   7485  C  CD  . GLU C  1 205 ? -34.615 41.328   80.812  1.00 35.85 ? 286  GLU C CD  1 
ATOM   7486  O  OE1 . GLU C  1 205 ? -35.340 41.011   81.784  1.00 39.43 ? 286  GLU C OE1 1 
ATOM   7487  O  OE2 . GLU C  1 205 ? -35.065 41.664   79.693  1.00 38.34 ? 286  GLU C OE2 1 
ATOM   7488  N  N   . ILE C  1 206 ? -31.428 42.818   84.858  1.00 22.64 ? 287  ILE C N   1 
ATOM   7489  C  CA  . ILE C  1 206 ? -31.018 42.818   86.254  1.00 21.63 ? 287  ILE C CA  1 
ATOM   7490  C  C   . ILE C  1 206 ? -32.080 42.248   87.174  1.00 21.51 ? 287  ILE C C   1 
ATOM   7491  O  O   . ILE C  1 206 ? -33.268 42.509   87.004  1.00 21.53 ? 287  ILE C O   1 
ATOM   7492  C  CB  . ILE C  1 206 ? -30.681 44.253   86.740  1.00 20.95 ? 287  ILE C CB  1 
ATOM   7493  C  CG1 . ILE C  1 206 ? -29.533 44.831   85.914  1.00 21.17 ? 287  ILE C CG1 1 
ATOM   7494  C  CG2 . ILE C  1 206 ? -30.282 44.234   88.210  1.00 19.23 ? 287  ILE C CG2 1 
ATOM   7495  C  CD1 . ILE C  1 206 ? -29.918 45.179   84.510  1.00 24.52 ? 287  ILE C CD1 1 
ATOM   7496  N  N   . THR C  1 207 ? -31.639 41.457   88.146  1.00 21.68 ? 288  THR C N   1 
ATOM   7497  C  CA  . THR C  1 207 ? -32.537 40.882   89.139  1.00 21.41 ? 288  THR C CA  1 
ATOM   7498  C  C   . THR C  1 207 ? -31.967 41.273   90.498  1.00 20.71 ? 288  THR C C   1 
ATOM   7499  O  O   . THR C  1 207 ? -30.756 41.249   90.697  1.00 21.50 ? 288  THR C O   1 
ATOM   7500  C  CB  . THR C  1 207 ? -32.617 39.338   89.035  1.00 21.77 ? 288  THR C CB  1 
ATOM   7501  O  OG1 . THR C  1 207 ? -33.335 38.971   87.850  1.00 22.71 ? 288  THR C OG1 1 
ATOM   7502  C  CG2 . THR C  1 207 ? -33.342 38.762   90.242  1.00 20.48 ? 288  THR C CG2 1 
ATOM   7503  N  N   . CYS C  1 208 ? -32.838 41.657   91.421  1.00 19.78 ? 289  CYS C N   1 
ATOM   7504  C  CA  . CYS C  1 208 ? -32.411 42.056   92.755  1.00 18.84 ? 289  CYS C CA  1 
ATOM   7505  C  C   . CYS C  1 208 ? -33.232 41.347   93.801  1.00 17.05 ? 289  CYS C C   1 
ATOM   7506  O  O   . CYS C  1 208 ? -34.454 41.349   93.744  1.00 17.08 ? 289  CYS C O   1 
ATOM   7507  C  CB  . CYS C  1 208 ? -32.624 43.543   92.990  1.00 19.70 ? 289  CYS C CB  1 
ATOM   7508  S  SG  . CYS C  1 208 ? -31.993 44.706   91.755  1.00 22.65 ? 289  CYS C SG  1 
ATOM   7509  N  N   . VAL C  1 209 ? -32.551 40.755   94.764  1.00 15.95 ? 290  VAL C N   1 
ATOM   7510  C  CA  . VAL C  1 209 ? -33.213 40.078   95.859  1.00 14.65 ? 290  VAL C CA  1 
ATOM   7511  C  C   . VAL C  1 209 ? -32.880 40.978   97.033  1.00 14.68 ? 290  VAL C C   1 
ATOM   7512  O  O   . VAL C  1 209 ? -31.726 41.101   97.434  1.00 15.40 ? 290  VAL C O   1 
ATOM   7513  C  CB  . VAL C  1 209 ? -32.656 38.670   96.038  1.00 12.82 ? 290  VAL C CB  1 
ATOM   7514  C  CG1 . VAL C  1 209 ? -33.244 38.033   97.279  1.00 12.54 ? 290  VAL C CG1 1 
ATOM   7515  C  CG2 . VAL C  1 209 ? -33.002 37.838   94.801  1.00 12.67 ? 290  VAL C CG2 1 
ATOM   7516  N  N   . CYS C  1 210 ? -33.900 41.626   97.576  1.00 16.14 ? 291  CYS C N   1 
ATOM   7517  C  CA  . CYS C  1 210 ? -33.688 42.587   98.647  1.00 15.56 ? 291  CYS C CA  1 
ATOM   7518  C  C   . CYS C  1 210 ? -34.099 42.190   100.048 1.00 13.81 ? 291  CYS C C   1 
ATOM   7519  O  O   . CYS C  1 210 ? -34.162 41.016   100.384 1.00 13.91 ? 291  CYS C O   1 
ATOM   7520  C  CB  . CYS C  1 210 ? -34.381 43.877   98.254  1.00 15.50 ? 291  CYS C CB  1 
ATOM   7521  S  SG  . CYS C  1 210 ? -34.209 44.227   96.470  1.00 19.65 ? 291  CYS C SG  1 
ATOM   7522  N  N   . ARG C  1 211 ? -34.359 43.199   100.869 1.00 14.33 ? 292  ARG C N   1 
ATOM   7523  C  CA  . ARG C  1 211 ? -34.752 42.998   102.254 1.00 13.46 ? 292  ARG C CA  1 
ATOM   7524  C  C   . ARG C  1 211 ? -36.031 43.744   102.583 1.00 13.35 ? 292  ARG C C   1 
ATOM   7525  O  O   . ARG C  1 211 ? -36.122 44.950   102.351 1.00 12.45 ? 292  ARG C O   1 
ATOM   7526  C  CB  . ARG C  1 211 ? -33.638 43.491   103.177 1.00 15.05 ? 292  ARG C CB  1 
ATOM   7527  C  CG  . ARG C  1 211 ? -34.054 43.737   104.624 1.00 14.98 ? 292  ARG C CG  1 
ATOM   7528  C  CD  . ARG C  1 211 ? -32.849 44.153   105.465 1.00 14.34 ? 292  ARG C CD  1 
ATOM   7529  N  NE  . ARG C  1 211 ? -33.243 44.627   106.785 1.00 13.12 ? 292  ARG C NE  1 
ATOM   7530  C  CZ  . ARG C  1 211 ? -32.385 45.033   107.715 1.00 12.46 ? 292  ARG C CZ  1 
ATOM   7531  N  NH1 . ARG C  1 211 ? -32.817 45.454   108.894 1.00 7.92  ? 292  ARG C NH1 1 
ATOM   7532  N  NH2 . ARG C  1 211 ? -31.088 45.011   107.464 1.00 14.64 ? 292  ARG C NH2 1 
ATOM   7533  N  N   . ASP C  1 212 ? -37.014 43.018   103.113 1.00 12.67 ? 293  ASP C N   1 
ATOM   7534  C  CA  . ASP C  1 212 ? -38.287 43.602   103.523 1.00 11.54 ? 293  ASP C CA  1 
ATOM   7535  C  C   . ASP C  1 212 ? -38.148 43.736   105.039 1.00 11.30 ? 293  ASP C C   1 
ATOM   7536  O  O   . ASP C  1 212 ? -38.188 42.744   105.777 1.00 10.19 ? 293  ASP C O   1 
ATOM   7537  C  CB  . ASP C  1 212 ? -39.454 42.675   103.151 1.00 13.72 ? 293  ASP C CB  1 
ATOM   7538  C  CG  . ASP C  1 212 ? -40.805 43.164   103.686 1.00 18.03 ? 293  ASP C CG  1 
ATOM   7539  O  OD1 . ASP C  1 212 ? -41.837 42.865   103.039 1.00 17.72 ? 293  ASP C OD1 1 
ATOM   7540  O  OD2 . ASP C  1 212 ? -40.846 43.828   104.752 1.00 19.09 ? 293  ASP C OD2 1 
ATOM   7541  N  N   . ASN C  1 213 ? -37.972 44.976   105.486 1.00 10.17 ? 294  ASN C N   1 
ATOM   7542  C  CA  . ASN C  1 213 ? -37.781 45.284   106.896 1.00 10.35 ? 294  ASN C CA  1 
ATOM   7543  C  C   . ASN C  1 213 ? -39.093 45.620   107.585 1.00 10.61 ? 294  ASN C C   1 
ATOM   7544  O  O   . ASN C  1 213 ? -39.169 45.781   108.807 1.00 9.93  ? 294  ASN C O   1 
ATOM   7545  C  CB  . ASN C  1 213 ? -36.825 46.467   107.010 1.00 8.90  ? 294  ASN C CB  1 
ATOM   7546  C  CG  . ASN C  1 213 ? -36.190 46.566   108.362 1.00 10.36 ? 294  ASN C CG  1 
ATOM   7547  O  OD1 . ASN C  1 213 ? -35.418 45.692   108.757 1.00 11.77 ? 294  ASN C OD1 1 
ATOM   7548  N  ND2 . ASN C  1 213 ? -36.512 47.628   109.094 1.00 10.08 ? 294  ASN C ND2 1 
ATOM   7549  N  N   . TRP C  1 214 ? -40.138 45.705   106.783 1.00 12.06 ? 295  TRP C N   1 
ATOM   7550  C  CA  . TRP C  1 214 ? -41.456 46.070   107.276 1.00 12.21 ? 295  TRP C CA  1 
ATOM   7551  C  C   . TRP C  1 214 ? -42.285 44.889   107.757 1.00 12.24 ? 295  TRP C C   1 
ATOM   7552  O  O   . TRP C  1 214 ? -42.528 44.737   108.957 1.00 12.71 ? 295  TRP C O   1 
ATOM   7553  C  CB  . TRP C  1 214 ? -42.160 46.832   106.155 1.00 10.55 ? 295  TRP C CB  1 
ATOM   7554  C  CG  . TRP C  1 214 ? -43.578 47.183   106.350 1.00 10.84 ? 295  TRP C CG  1 
ATOM   7555  C  CD1 . TRP C  1 214 ? -44.238 47.355   107.528 1.00 10.09 ? 295  TRP C CD1 1 
ATOM   7556  C  CD2 . TRP C  1 214 ? -44.508 47.494   105.316 1.00 10.31 ? 295  TRP C CD2 1 
ATOM   7557  N  NE1 . TRP C  1 214 ? -45.529 47.758   107.292 1.00 9.61  ? 295  TRP C NE1 1 
ATOM   7558  C  CE2 . TRP C  1 214 ? -45.721 47.851   105.935 1.00 10.32 ? 295  TRP C CE2 1 
ATOM   7559  C  CE3 . TRP C  1 214 ? -44.434 47.506   103.914 1.00 11.18 ? 295  TRP C CE3 1 
ATOM   7560  C  CZ2 . TRP C  1 214 ? -46.858 48.219   105.206 1.00 11.48 ? 295  TRP C CZ2 1 
ATOM   7561  C  CZ3 . TRP C  1 214 ? -45.559 47.868   103.186 1.00 11.53 ? 295  TRP C CZ3 1 
ATOM   7562  C  CH2 . TRP C  1 214 ? -46.757 48.220   103.835 1.00 11.61 ? 295  TRP C CH2 1 
ATOM   7563  N  N   . HIS C  1 215 ? -42.680 44.025   106.830 1.00 12.67 ? 296  HIS C N   1 
ATOM   7564  C  CA  . HIS C  1 215 ? -43.524 42.904   107.188 1.00 12.79 ? 296  HIS C CA  1 
ATOM   7565  C  C   . HIS C  1 215 ? -43.287 41.618   106.402 1.00 13.25 ? 296  HIS C C   1 
ATOM   7566  O  O   . HIS C  1 215 ? -44.241 40.893   106.108 1.00 14.45 ? 296  HIS C O   1 
ATOM   7567  C  CB  . HIS C  1 215 ? -44.984 43.325   107.022 1.00 12.54 ? 296  HIS C CB  1 
ATOM   7568  C  CG  . HIS C  1 215 ? -45.285 43.906   105.677 1.00 11.61 ? 296  HIS C CG  1 
ATOM   7569  N  ND1 . HIS C  1 215 ? -44.485 43.679   104.576 1.00 12.76 ? 296  HIS C ND1 1 
ATOM   7570  C  CD2 . HIS C  1 215 ? -46.313 44.670   105.239 1.00 12.89 ? 296  HIS C CD2 1 
ATOM   7571  C  CE1 . HIS C  1 215 ? -45.009 44.275   103.521 1.00 11.94 ? 296  HIS C CE1 1 
ATOM   7572  N  NE2 . HIS C  1 215 ? -46.121 44.884   103.896 1.00 13.40 ? 296  HIS C NE2 1 
ATOM   7573  N  N   . GLY C  1 216 ? -42.040 41.319   106.059 1.00 12.11 ? 297  GLY C N   1 
ATOM   7574  C  CA  . GLY C  1 216 ? -41.791 40.089   105.329 1.00 12.65 ? 297  GLY C CA  1 
ATOM   7575  C  C   . GLY C  1 216 ? -40.620 39.266   105.821 1.00 12.78 ? 297  GLY C C   1 
ATOM   7576  O  O   . GLY C  1 216 ? -39.542 39.806   106.086 1.00 13.98 ? 297  GLY C O   1 
ATOM   7577  N  N   . SER C  1 217 ? -40.833 37.957   105.924 1.00 13.99 ? 298  SER C N   1 
ATOM   7578  C  CA  . SER C  1 217 ? -39.797 37.010   106.355 1.00 14.35 ? 298  SER C CA  1 
ATOM   7579  C  C   . SER C  1 217 ? -39.148 36.416   105.104 1.00 14.18 ? 298  SER C C   1 
ATOM   7580  O  O   . SER C  1 217 ? -38.044 35.886   105.158 1.00 17.08 ? 298  SER C O   1 
ATOM   7581  C  CB  . SER C  1 217 ? -40.411 35.899   107.225 1.00 14.87 ? 298  SER C CB  1 
ATOM   7582  O  OG  . SER C  1 217 ? -41.846 35.972   107.215 1.00 20.78 ? 298  SER C OG  1 
ATOM   7583  N  N   . ASN C  1 218 ? -39.842 36.509   103.975 1.00 14.11 ? 299  ASN C N   1 
ATOM   7584  C  CA  . ASN C  1 218 ? -39.305 36.046   102.697 1.00 13.82 ? 299  ASN C CA  1 
ATOM   7585  C  C   . ASN C  1 218 ? -38.766 37.314   102.041 1.00 15.12 ? 299  ASN C C   1 
ATOM   7586  O  O   . ASN C  1 218 ? -39.114 38.418   102.449 1.00 15.22 ? 299  ASN C O   1 
ATOM   7587  C  CB  . ASN C  1 218 ? -40.397 35.383   101.842 1.00 12.26 ? 299  ASN C CB  1 
ATOM   7588  C  CG  . ASN C  1 218 ? -41.703 36.170   101.826 1.00 15.39 ? 299  ASN C CG  1 
ATOM   7589  O  OD1 . ASN C  1 218 ? -41.953 37.015   102.689 1.00 17.53 ? 299  ASN C OD1 1 
ATOM   7590  N  ND2 . ASN C  1 218 ? -42.554 35.874   100.851 1.00 14.68 ? 299  ASN C ND2 1 
ATOM   7591  N  N   . ARG C  1 219 ? -37.912 37.161   101.041 1.00 15.98 ? 300  ARG C N   1 
ATOM   7592  C  CA  . ARG C  1 219 ? -37.315 38.312   100.393 1.00 16.61 ? 300  ARG C CA  1 
ATOM   7593  C  C   . ARG C  1 219 ? -38.022 38.772   99.126  1.00 17.33 ? 300  ARG C C   1 
ATOM   7594  O  O   . ARG C  1 219 ? -38.409 37.962   98.273  1.00 15.84 ? 300  ARG C O   1 
ATOM   7595  C  CB  . ARG C  1 219 ? -35.838 38.027   100.083 1.00 14.14 ? 300  ARG C CB  1 
ATOM   7596  C  CG  . ARG C  1 219 ? -34.997 37.810   101.319 1.00 14.48 ? 300  ARG C CG  1 
ATOM   7597  C  CD  . ARG C  1 219 ? -33.516 37.697   100.989 1.00 14.70 ? 300  ARG C CD  1 
ATOM   7598  N  NE  . ARG C  1 219 ? -32.728 37.556   102.210 1.00 18.34 ? 300  ARG C NE  1 
ATOM   7599  C  CZ  . ARG C  1 219 ? -32.435 38.559   103.036 1.00 19.76 ? 300  ARG C CZ  1 
ATOM   7600  N  NH1 . ARG C  1 219 ? -31.719 38.336   104.135 1.00 19.64 ? 300  ARG C NH1 1 
ATOM   7601  N  NH2 . ARG C  1 219 ? -32.832 39.791   102.749 1.00 20.08 ? 300  ARG C NH2 1 
ATOM   7602  N  N   . PRO C  1 220 ? -38.219 40.093   98.999  1.00 16.55 ? 301  PRO C N   1 
ATOM   7603  C  CA  . PRO C  1 220 ? -38.874 40.648   97.818  1.00 16.06 ? 301  PRO C CA  1 
ATOM   7604  C  C   . PRO C  1 220 ? -37.828 40.751   96.710  1.00 15.96 ? 301  PRO C C   1 
ATOM   7605  O  O   . PRO C  1 220 ? -36.620 40.805   96.990  1.00 14.91 ? 301  PRO C O   1 
ATOM   7606  C  CB  . PRO C  1 220 ? -39.337 42.018   98.300  1.00 17.08 ? 301  PRO C CB  1 
ATOM   7607  C  CG  . PRO C  1 220 ? -38.234 42.414   99.229  1.00 17.59 ? 301  PRO C CG  1 
ATOM   7608  C  CD  . PRO C  1 220 ? -38.023 41.131   100.025 1.00 16.70 ? 301  PRO C CD  1 
ATOM   7609  N  N   . TRP C  1 221 ? -38.287 40.758   95.461  1.00 14.37 ? 302  TRP C N   1 
ATOM   7610  C  CA  . TRP C  1 221 ? -37.381 40.875   94.340  1.00 14.86 ? 302  TRP C CA  1 
ATOM   7611  C  C   . TRP C  1 221 ? -37.904 41.838   93.294  1.00 16.40 ? 302  TRP C C   1 
ATOM   7612  O  O   . TRP C  1 221 ? -39.083 42.166   93.276  1.00 17.23 ? 302  TRP C O   1 
ATOM   7613  C  CB  . TRP C  1 221 ? -37.127 39.510   93.686  1.00 13.77 ? 302  TRP C CB  1 
ATOM   7614  C  CG  . TRP C  1 221 ? -38.359 38.767   93.205  1.00 13.46 ? 302  TRP C CG  1 
ATOM   7615  C  CD1 . TRP C  1 221 ? -39.057 37.805   93.886  1.00 13.43 ? 302  TRP C CD1 1 
ATOM   7616  C  CD2 . TRP C  1 221 ? -39.016 38.913   91.941  1.00 11.93 ? 302  TRP C CD2 1 
ATOM   7617  N  NE1 . TRP C  1 221 ? -40.102 37.343   93.126  1.00 11.11 ? 302  TRP C NE1 1 
ATOM   7618  C  CE2 . TRP C  1 221 ? -40.103 38.004   91.925  1.00 11.18 ? 302  TRP C CE2 1 
ATOM   7619  C  CE3 . TRP C  1 221 ? -38.793 39.721   90.815  1.00 11.24 ? 302  TRP C CE3 1 
ATOM   7620  C  CZ2 . TRP C  1 221 ? -40.965 37.879   90.832  1.00 10.29 ? 302  TRP C CZ2 1 
ATOM   7621  C  CZ3 . TRP C  1 221 ? -39.650 39.599   89.721  1.00 10.91 ? 302  TRP C CZ3 1 
ATOM   7622  C  CH2 . TRP C  1 221 ? -40.723 38.682   89.739  1.00 11.79 ? 302  TRP C CH2 1 
ATOM   7623  N  N   . VAL C  1 222 ? -37.000 42.292   92.434  1.00 17.45 ? 303  VAL C N   1 
ATOM   7624  C  CA  . VAL C  1 222 ? -37.330 43.185   91.335  1.00 19.56 ? 303  VAL C CA  1 
ATOM   7625  C  C   . VAL C  1 222 ? -36.412 42.816   90.191  1.00 19.77 ? 303  VAL C C   1 
ATOM   7626  O  O   . VAL C  1 222 ? -35.214 42.628   90.391  1.00 21.98 ? 303  VAL C O   1 
ATOM   7627  C  CB  . VAL C  1 222 ? -37.038 44.672   91.631  1.00 20.13 ? 303  VAL C CB  1 
ATOM   7628  C  CG1 . VAL C  1 222 ? -37.512 45.517   90.470  1.00 21.51 ? 303  VAL C CG1 1 
ATOM   7629  C  CG2 . VAL C  1 222 ? -37.727 45.114   92.864  1.00 23.24 ? 303  VAL C CG2 1 
ATOM   7630  N  N   . SER C  1 223 ? -36.958 42.698   88.995  1.00 19.92 ? 304  SER C N   1 
ATOM   7631  C  CA  . SER C  1 223 ? -36.118 42.408   87.850  1.00 21.87 ? 304  SER C CA  1 
ATOM   7632  C  C   . SER C  1 223 ? -36.559 43.384   86.782  1.00 22.04 ? 304  SER C C   1 
ATOM   7633  O  O   . SER C  1 223 ? -37.750 43.704   86.657  1.00 22.42 ? 304  SER C O   1 
ATOM   7634  C  CB  . SER C  1 223 ? -36.273 40.962   87.375  1.00 19.83 ? 304  SER C CB  1 
ATOM   7635  O  OG  . SER C  1 223 ? -37.580 40.707   86.911  1.00 25.66 ? 304  SER C OG  1 
ATOM   7636  N  N   . PHE C  1 224 ? -35.592 43.890   86.036  1.00 22.44 ? 305  PHE C N   1 
ATOM   7637  C  CA  . PHE C  1 224 ? -35.904 44.837   85.004  1.00 24.06 ? 305  PHE C CA  1 
ATOM   7638  C  C   . PHE C  1 224 ? -34.965 44.761   83.825  1.00 27.28 ? 305  PHE C C   1 
ATOM   7639  O  O   . PHE C  1 224 ? -33.885 44.171   83.889  1.00 28.18 ? 305  PHE C O   1 
ATOM   7640  C  CB  . PHE C  1 224 ? -35.924 46.251   85.591  1.00 23.57 ? 305  PHE C CB  1 
ATOM   7641  C  CG  . PHE C  1 224 ? -34.743 46.574   86.464  1.00 20.69 ? 305  PHE C CG  1 
ATOM   7642  C  CD1 . PHE C  1 224 ? -33.630 47.215   85.943  1.00 21.01 ? 305  PHE C CD1 1 
ATOM   7643  C  CD2 . PHE C  1 224 ? -34.756 46.255   87.816  1.00 21.60 ? 305  PHE C CD2 1 
ATOM   7644  C  CE1 . PHE C  1 224 ? -32.543 47.543   86.755  1.00 20.83 ? 305  PHE C CE1 1 
ATOM   7645  C  CE2 . PHE C  1 224 ? -33.678 46.576   88.639  1.00 21.81 ? 305  PHE C CE2 1 
ATOM   7646  C  CZ  . PHE C  1 224 ? -32.567 47.223   88.103  1.00 20.97 ? 305  PHE C CZ  1 
ATOM   7647  N  N   . ASN C  1 225 ? -35.418 45.360   82.737  1.00 29.48 ? 306  ASN C N   1 
ATOM   7648  C  CA  . ASN C  1 225 ? -34.685 45.421   81.496  1.00 31.17 ? 306  ASN C CA  1 
ATOM   7649  C  C   . ASN C  1 225 ? -33.887 46.729   81.508  1.00 30.03 ? 306  ASN C C   1 
ATOM   7650  O  O   . ASN C  1 225 ? -33.969 47.504   82.459  1.00 28.17 ? 306  ASN C O   1 
ATOM   7651  C  CB  . ASN C  1 225 ? -35.694 45.393   80.348  1.00 37.07 ? 306  ASN C CB  1 
ATOM   7652  C  CG  . ASN C  1 225 ? -35.052 45.611   79.007  1.00 45.90 ? 306  ASN C CG  1 
ATOM   7653  O  OD1 . ASN C  1 225 ? -34.091 44.917   78.633  1.00 49.94 ? 306  ASN C OD1 1 
ATOM   7654  N  ND2 . ASN C  1 225 ? -35.573 46.585   78.261  1.00 49.89 ? 306  ASN C ND2 1 
ATOM   7655  N  N   . GLN C  1 226 ? -33.123 46.975   80.452  1.00 29.58 ? 308  GLN C N   1 
ATOM   7656  C  CA  . GLN C  1 226 ? -32.316 48.184   80.360  1.00 30.19 ? 308  GLN C CA  1 
ATOM   7657  C  C   . GLN C  1 226 ? -33.156 49.449   80.150  1.00 30.67 ? 308  GLN C C   1 
ATOM   7658  O  O   . GLN C  1 226 ? -32.621 50.565   80.133  1.00 29.96 ? 308  GLN C O   1 
ATOM   7659  C  CB  . GLN C  1 226 ? -31.262 48.014   79.254  1.00 30.09 ? 308  GLN C CB  1 
ATOM   7660  C  CG  . GLN C  1 226 ? -30.206 46.967   79.631  1.00 31.13 ? 308  GLN C CG  1 
ATOM   7661  C  CD  . GLN C  1 226 ? -29.347 46.503   78.468  1.00 31.68 ? 308  GLN C CD  1 
ATOM   7662  O  OE1 . GLN C  1 226 ? -28.705 47.307   77.788  1.00 34.17 ? 308  GLN C OE1 1 
ATOM   7663  N  NE2 . GLN C  1 226 ? -29.320 45.195   78.244  1.00 29.60 ? 308  GLN C NE2 1 
ATOM   7664  N  N   . ASN C  1 227 ? -34.469 49.279   79.993  1.00 30.26 ? 309  ASN C N   1 
ATOM   7665  C  CA  . ASN C  1 227 ? -35.355 50.425   79.839  1.00 29.89 ? 309  ASN C CA  1 
ATOM   7666  C  C   . ASN C  1 227 ? -36.191 50.596   81.078  1.00 27.75 ? 309  ASN C C   1 
ATOM   7667  O  O   . ASN C  1 227 ? -37.213 51.280   81.067  1.00 26.86 ? 309  ASN C O   1 
ATOM   7668  C  CB  . ASN C  1 227 ? -36.250 50.276   78.623  1.00 34.25 ? 309  ASN C CB  1 
ATOM   7669  C  CG  . ASN C  1 227 ? -35.550 50.697   77.362  1.00 41.46 ? 309  ASN C CG  1 
ATOM   7670  O  OD1 . ASN C  1 227 ? -35.177 51.869   77.212  1.00 44.45 ? 309  ASN C OD1 1 
ATOM   7671  N  ND2 . ASN C  1 227 ? -35.338 49.747   76.447  1.00 44.47 ? 309  ASN C ND2 1 
ATOM   7672  N  N   . LEU C  1 228 ? -35.740 49.955   82.150  1.00 25.86 ? 310  LEU C N   1 
ATOM   7673  C  CA  . LEU C  1 228 ? -36.405 50.026   83.435  1.00 23.63 ? 310  LEU C CA  1 
ATOM   7674  C  C   . LEU C  1 228 ? -37.863 49.558   83.455  1.00 22.97 ? 310  LEU C C   1 
ATOM   7675  O  O   . LEU C  1 228 ? -38.661 50.048   84.245  1.00 23.04 ? 310  LEU C O   1 
ATOM   7676  C  CB  . LEU C  1 228 ? -36.271 51.449   83.981  1.00 23.11 ? 310  LEU C CB  1 
ATOM   7677  C  CG  . LEU C  1 228 ? -34.980 51.722   84.771  1.00 23.59 ? 310  LEU C CG  1 
ATOM   7678  C  CD1 . LEU C  1 228 ? -33.802 51.039   84.121  1.00 23.54 ? 310  LEU C CD1 1 
ATOM   7679  C  CD2 . LEU C  1 228 ? -34.744 53.217   84.881  1.00 24.66 ? 310  LEU C CD2 1 
ATOM   7680  N  N   . GLU C  1 229 ? -38.205 48.619   82.574  1.00 22.24 ? 311  GLU C N   1 
ATOM   7681  C  CA  . GLU C  1 229 ? -39.545 48.033   82.536  1.00 21.56 ? 311  GLU C CA  1 
ATOM   7682  C  C   . GLU C  1 229 ? -39.331 46.857   83.486  1.00 20.96 ? 311  GLU C C   1 
ATOM   7683  O  O   . GLU C  1 229 ? -38.543 45.961   83.207  1.00 22.37 ? 311  GLU C O   1 
ATOM   7684  C  CB  . GLU C  1 229 ? -39.875 47.581   81.115  1.00 21.88 ? 311  GLU C CB  1 
ATOM   7685  C  CG  . GLU C  1 229 ? -39.565 48.696   80.120  1.00 26.71 ? 311  GLU C CG  1 
ATOM   7686  C  CD  . GLU C  1 229 ? -39.736 48.315   78.662  1.00 27.82 ? 311  GLU C CD  1 
ATOM   7687  O  OE1 . GLU C  1 229 ? -39.286 47.221   78.261  1.00 28.18 ? 311  GLU C OE1 1 
ATOM   7688  O  OE2 . GLU C  1 229 ? -40.304 49.137   77.907  1.00 30.06 ? 311  GLU C OE2 1 
ATOM   7689  N  N   . TYR C  1 230 ? -40.023 46.867   84.615  1.00 19.02 ? 312  TYR C N   1 
ATOM   7690  C  CA  . TYR C  1 230 ? -39.807 45.854   85.640  1.00 19.24 ? 312  TYR C CA  1 
ATOM   7691  C  C   . TYR C  1 230 ? -40.972 44.955   86.044  1.00 20.40 ? 312  TYR C C   1 
ATOM   7692  O  O   . TYR C  1 230 ? -42.129 45.180   85.695  1.00 20.53 ? 312  TYR C O   1 
ATOM   7693  C  CB  . TYR C  1 230 ? -39.350 46.575   86.898  1.00 18.74 ? 312  TYR C CB  1 
ATOM   7694  C  CG  . TYR C  1 230 ? -40.478 47.414   87.454  1.00 16.29 ? 312  TYR C CG  1 
ATOM   7695  C  CD1 . TYR C  1 230 ? -41.446 46.847   88.281  1.00 14.31 ? 312  TYR C CD1 1 
ATOM   7696  C  CD2 . TYR C  1 230 ? -40.633 48.752   87.076  1.00 16.30 ? 312  TYR C CD2 1 
ATOM   7697  C  CE1 . TYR C  1 230 ? -42.541 47.582   88.718  1.00 15.11 ? 312  TYR C CE1 1 
ATOM   7698  C  CE2 . TYR C  1 230 ? -41.735 49.505   87.511  1.00 15.61 ? 312  TYR C CE2 1 
ATOM   7699  C  CZ  . TYR C  1 230 ? -42.683 48.906   88.334  1.00 15.98 ? 312  TYR C CZ  1 
ATOM   7700  O  OH  . TYR C  1 230 ? -43.760 49.627   88.792  1.00 16.30 ? 312  TYR C OH  1 
ATOM   7701  N  N   . GLN C  1 231 ? -40.631 43.941   86.827  1.00 21.17 ? 313  GLN C N   1 
ATOM   7702  C  CA  . GLN C  1 231 ? -41.602 43.012   87.385  1.00 22.60 ? 313  GLN C CA  1 
ATOM   7703  C  C   . GLN C  1 231 ? -41.193 42.901   88.851  1.00 22.03 ? 313  GLN C C   1 
ATOM   7704  O  O   . GLN C  1 231 ? -40.042 43.168   89.194  1.00 23.51 ? 313  GLN C O   1 
ATOM   7705  C  CB  . GLN C  1 231 ? -41.521 41.644   86.706  1.00 24.59 ? 313  GLN C CB  1 
ATOM   7706  C  CG  . GLN C  1 231 ? -41.926 41.644   85.234  1.00 29.91 ? 313  GLN C CG  1 
ATOM   7707  C  CD  . GLN C  1 231 ? -41.976 40.238   84.632  1.00 32.94 ? 313  GLN C CD  1 
ATOM   7708  O  OE1 . GLN C  1 231 ? -42.214 40.071   83.432  1.00 34.57 ? 313  GLN C OE1 1 
ATOM   7709  N  NE2 . GLN C  1 231 ? -41.757 39.224   85.468  1.00 32.94 ? 313  GLN C NE2 1 
ATOM   7710  N  N   . ILE C  1 232 ? -42.121 42.532   89.723  1.00 21.31 ? 314  ILE C N   1 
ATOM   7711  C  CA  . ILE C  1 232 ? -41.786 42.414   91.135  1.00 20.31 ? 314  ILE C CA  1 
ATOM   7712  C  C   . ILE C  1 232 ? -42.455 41.207   91.773  1.00 21.10 ? 314  ILE C C   1 
ATOM   7713  O  O   . ILE C  1 232 ? -43.296 40.551   91.159  1.00 21.41 ? 314  ILE C O   1 
ATOM   7714  C  CB  . ILE C  1 232 ? -42.203 43.672   91.918  1.00 18.73 ? 314  ILE C CB  1 
ATOM   7715  C  CG1 . ILE C  1 232 ? -43.696 43.929   91.719  1.00 18.94 ? 314  ILE C CG1 1 
ATOM   7716  C  CG2 . ILE C  1 232 ? -41.396 44.867   91.459  1.00 18.20 ? 314  ILE C CG2 1 
ATOM   7717  C  CD1 . ILE C  1 232 ? -44.232 45.108   92.499  1.00 18.10 ? 314  ILE C CD1 1 
ATOM   7718  N  N   . GLY C  1 233 ? -42.064 40.926   93.013  1.00 20.91 ? 315  GLY C N   1 
ATOM   7719  C  CA  . GLY C  1 233 ? -42.633 39.816   93.746  1.00 19.14 ? 315  GLY C CA  1 
ATOM   7720  C  C   . GLY C  1 233 ? -41.777 39.437   94.942  1.00 18.21 ? 315  GLY C C   1 
ATOM   7721  O  O   . GLY C  1 233 ? -40.862 40.163   95.316  1.00 17.76 ? 315  GLY C O   1 
ATOM   7722  N  N   . TYR C  1 234 ? -42.102 38.302   95.548  1.00 17.93 ? 316  TYR C N   1 
ATOM   7723  C  CA  . TYR C  1 234 ? -41.366 37.770   96.686  1.00 18.49 ? 316  TYR C CA  1 
ATOM   7724  C  C   . TYR C  1 234 ? -40.992 36.338   96.331  1.00 17.98 ? 316  TYR C C   1 
ATOM   7725  O  O   . TYR C  1 234 ? -41.667 35.711   95.518  1.00 18.92 ? 316  TYR C O   1 
ATOM   7726  C  CB  . TYR C  1 234 ? -42.230 37.761   97.948  1.00 17.70 ? 316  TYR C CB  1 
ATOM   7727  C  CG  . TYR C  1 234 ? -42.319 39.089   98.662  1.00 19.10 ? 316  TYR C CG  1 
ATOM   7728  C  CD1 . TYR C  1 234 ? -43.009 40.164   98.105  1.00 20.65 ? 316  TYR C CD1 1 
ATOM   7729  C  CD2 . TYR C  1 234 ? -41.708 39.271   99.899  1.00 19.78 ? 316  TYR C CD2 1 
ATOM   7730  C  CE1 . TYR C  1 234 ? -43.089 41.402   98.770  1.00 20.58 ? 316  TYR C CE1 1 
ATOM   7731  C  CE2 . TYR C  1 234 ? -41.779 40.497   100.570 1.00 22.41 ? 316  TYR C CE2 1 
ATOM   7732  C  CZ  . TYR C  1 234 ? -42.470 41.559   99.999  1.00 21.82 ? 316  TYR C CZ  1 
ATOM   7733  O  OH  . TYR C  1 234 ? -42.522 42.772   100.651 1.00 20.45 ? 316  TYR C OH  1 
ATOM   7734  N  N   . ILE C  1 235 ? -39.909 35.827   96.907  1.00 18.22 ? 317  ILE C N   1 
ATOM   7735  C  CA  . ILE C  1 235 ? -39.511 34.451   96.645  1.00 17.56 ? 317  ILE C CA  1 
ATOM   7736  C  C   . ILE C  1 235 ? -40.557 33.619   97.384  1.00 19.07 ? 317  ILE C C   1 
ATOM   7737  O  O   . ILE C  1 235 ? -40.759 33.795   98.584  1.00 19.13 ? 317  ILE C O   1 
ATOM   7738  C  CB  . ILE C  1 235 ? -38.106 34.178   97.183  1.00 17.27 ? 317  ILE C CB  1 
ATOM   7739  C  CG1 . ILE C  1 235 ? -37.097 35.029   96.409  1.00 16.71 ? 317  ILE C CG1 1 
ATOM   7740  C  CG2 . ILE C  1 235 ? -37.763 32.705   97.044  1.00 16.64 ? 317  ILE C CG2 1 
ATOM   7741  C  CD1 . ILE C  1 235 ? -35.695 34.993   96.990  1.00 18.20 ? 317  ILE C CD1 1 
ATOM   7742  N  N   . CYS C  1 236 ? -41.233 32.728   96.663  1.00 21.30 ? 318  CYS C N   1 
ATOM   7743  C  CA  . CYS C  1 236 ? -42.305 31.926   97.248  1.00 23.34 ? 318  CYS C CA  1 
ATOM   7744  C  C   . CYS C  1 236 ? -41.888 30.742   98.128  1.00 23.24 ? 318  CYS C C   1 
ATOM   7745  O  O   . CYS C  1 236 ? -42.690 30.261   98.932  1.00 22.51 ? 318  CYS C O   1 
ATOM   7746  C  CB  . CYS C  1 236 ? -43.245 31.403   96.149  1.00 26.81 ? 318  CYS C CB  1 
ATOM   7747  S  SG  . CYS C  1 236 ? -43.644 32.470   94.711  1.00 34.39 ? 318  CYS C SG  1 
ATOM   7748  N  N   . SER C  1 237 ? -40.653 30.267   97.986  1.00 22.54 ? 319  SER C N   1 
ATOM   7749  C  CA  . SER C  1 237 ? -40.193 29.126   98.776  1.00 21.68 ? 319  SER C CA  1 
ATOM   7750  C  C   . SER C  1 237 ? -40.483 29.232   100.270 1.00 21.37 ? 319  SER C C   1 
ATOM   7751  O  O   . SER C  1 237 ? -40.368 30.302   100.865 1.00 21.80 ? 319  SER C O   1 
ATOM   7752  C  CB  . SER C  1 237 ? -38.690 28.913   98.582  1.00 22.46 ? 319  SER C CB  1 
ATOM   7753  O  OG  . SER C  1 237 ? -38.214 27.871   99.423  1.00 23.54 ? 319  SER C OG  1 
ATOM   7754  N  N   . GLY C  1 238 ? -40.858 28.109   100.873 1.00 21.16 ? 320  GLY C N   1 
ATOM   7755  C  CA  . GLY C  1 238 ? -41.134 28.083   102.298 1.00 21.24 ? 320  GLY C CA  1 
ATOM   7756  C  C   . GLY C  1 238 ? -39.836 27.976   103.070 1.00 23.09 ? 320  GLY C C   1 
ATOM   7757  O  O   . GLY C  1 238 ? -39.829 27.701   104.271 1.00 22.99 ? 320  GLY C O   1 
ATOM   7758  N  N   . VAL C  1 239 ? -38.725 28.143   102.353 1.00 24.10 ? 321  VAL C N   1 
ATOM   7759  C  CA  . VAL C  1 239 ? -37.405 28.143   102.965 1.00 24.38 ? 321  VAL C CA  1 
ATOM   7760  C  C   . VAL C  1 239 ? -37.172 29.642   103.071 1.00 24.49 ? 321  VAL C C   1 
ATOM   7761  O  O   . VAL C  1 239 ? -36.512 30.245   102.224 1.00 25.20 ? 321  VAL C O   1 
ATOM   7762  C  CB  . VAL C  1 239 ? -36.319 27.510   102.049 1.00 25.10 ? 321  VAL C CB  1 
ATOM   7763  C  CG1 . VAL C  1 239 ? -34.947 27.622   102.709 1.00 23.41 ? 321  VAL C CG1 1 
ATOM   7764  C  CG2 . VAL C  1 239 ? -36.636 26.048   101.788 1.00 24.60 ? 321  VAL C CG2 1 
ATOM   7765  N  N   . PHE C  1 240 ? -37.772 30.243   104.094 1.00 23.12 ? 322  PHE C N   1 
ATOM   7766  C  CA  . PHE C  1 240 ? -37.673 31.678   104.314 1.00 23.09 ? 322  PHE C CA  1 
ATOM   7767  C  C   . PHE C  1 240 ? -36.229 32.150   104.433 1.00 22.23 ? 322  PHE C C   1 
ATOM   7768  O  O   . PHE C  1 240 ? -35.456 31.620   105.234 1.00 20.92 ? 322  PHE C O   1 
ATOM   7769  C  CB  . PHE C  1 240 ? -38.459 32.037   105.561 1.00 23.47 ? 322  PHE C CB  1 
ATOM   7770  C  CG  . PHE C  1 240 ? -39.845 31.498   105.552 1.00 23.67 ? 322  PHE C CG  1 
ATOM   7771  C  CD1 . PHE C  1 240 ? -40.277 30.650   106.562 1.00 25.45 ? 322  PHE C CD1 1 
ATOM   7772  C  CD2 . PHE C  1 240 ? -40.724 31.823   104.523 1.00 23.69 ? 322  PHE C CD2 1 
ATOM   7773  C  CE1 . PHE C  1 240 ? -41.573 30.129   106.550 1.00 25.41 ? 322  PHE C CE1 1 
ATOM   7774  C  CE2 . PHE C  1 240 ? -42.018 31.309   104.498 1.00 23.03 ? 322  PHE C CE2 1 
ATOM   7775  C  CZ  . PHE C  1 240 ? -42.444 30.462   105.512 1.00 23.99 ? 322  PHE C CZ  1 
ATOM   7776  N  N   . GLY C  1 241 ? -35.886 33.170   103.646 1.00 21.55 ? 323  GLY C N   1 
ATOM   7777  C  CA  . GLY C  1 241 ? -34.524 33.678   103.630 1.00 20.10 ? 323  GLY C CA  1 
ATOM   7778  C  C   . GLY C  1 241 ? -34.148 34.865   104.487 1.00 18.71 ? 323  GLY C C   1 
ATOM   7779  O  O   . GLY C  1 241 ? -32.958 35.136   104.667 1.00 18.82 ? 323  GLY C O   1 
ATOM   7780  N  N   . ASP C  1 242 ? -35.131 35.572   105.026 1.00 16.91 ? 324  ASP C N   1 
ATOM   7781  C  CA  . ASP C  1 242 ? -34.818 36.735   105.843 1.00 17.41 ? 324  ASP C CA  1 
ATOM   7782  C  C   . ASP C  1 242 ? -34.468 36.310   107.254 1.00 16.99 ? 324  ASP C C   1 
ATOM   7783  O  O   . ASP C  1 242 ? -34.532 35.129   107.604 1.00 16.72 ? 324  ASP C O   1 
ATOM   7784  C  CB  . ASP C  1 242 ? -36.007 37.709   105.890 1.00 17.23 ? 324  ASP C CB  1 
ATOM   7785  C  CG  . ASP C  1 242 ? -35.598 39.136   106.269 1.00 17.47 ? 324  ASP C CG  1 
ATOM   7786  O  OD1 . ASP C  1 242 ? -36.485 40.021   106.271 1.00 18.93 ? 324  ASP C OD1 1 
ATOM   7787  O  OD2 . ASP C  1 242 ? -34.405 39.382   106.553 1.00 15.02 ? 324  ASP C OD2 1 
ATOM   7788  N  N   . ASN C  1 243 ? -34.090 37.288   108.060 1.00 16.03 ? 325  ASN C N   1 
ATOM   7789  C  CA  . ASN C  1 243 ? -33.762 37.041   109.447 1.00 16.55 ? 325  ASN C CA  1 
ATOM   7790  C  C   . ASN C  1 243 ? -34.093 38.314   110.195 1.00 16.14 ? 325  ASN C C   1 
ATOM   7791  O  O   . ASN C  1 243 ? -33.615 39.382   109.833 1.00 18.69 ? 325  ASN C O   1 
ATOM   7792  C  CB  . ASN C  1 243 ? -32.287 36.698   109.597 1.00 17.04 ? 325  ASN C CB  1 
ATOM   7793  C  CG  . ASN C  1 243 ? -31.905 36.459   111.030 1.00 16.65 ? 325  ASN C CG  1 
ATOM   7794  O  OD1 . ASN C  1 243 ? -31.643 37.399   111.776 1.00 18.47 ? 325  ASN C OD1 1 
ATOM   7795  N  ND2 . ASN C  1 243 ? -31.897 35.197   111.437 1.00 16.53 ? 325  ASN C ND2 1 
ATOM   7796  N  N   . PRO C  1 244 ? -34.920 38.225   111.246 1.00 15.99 ? 326  PRO C N   1 
ATOM   7797  C  CA  . PRO C  1 244 ? -35.568 37.014   111.763 1.00 14.58 ? 326  PRO C CA  1 
ATOM   7798  C  C   . PRO C  1 244 ? -36.518 36.377   110.772 1.00 14.51 ? 326  PRO C C   1 
ATOM   7799  O  O   . PRO C  1 244 ? -36.687 36.862   109.659 1.00 14.09 ? 326  PRO C O   1 
ATOM   7800  C  CB  . PRO C  1 244 ? -36.293 37.516   113.000 1.00 12.37 ? 326  PRO C CB  1 
ATOM   7801  C  CG  . PRO C  1 244 ? -36.702 38.882   112.586 1.00 13.90 ? 326  PRO C CG  1 
ATOM   7802  C  CD  . PRO C  1 244 ? -35.425 39.414   111.957 1.00 15.10 ? 326  PRO C CD  1 
ATOM   7803  N  N   . ARG C  1 245 ? -37.141 35.283   111.195 1.00 16.32 ? 327  ARG C N   1 
ATOM   7804  C  CA  . ARG C  1 245 ? -38.081 34.547   110.361 1.00 15.39 ? 327  ARG C CA  1 
ATOM   7805  C  C   . ARG C  1 245 ? -38.624 33.395   111.194 1.00 17.60 ? 327  ARG C C   1 
ATOM   7806  O  O   . ARG C  1 245 ? -38.200 33.191   112.340 1.00 17.73 ? 327  ARG C O   1 
ATOM   7807  C  CB  . ARG C  1 245 ? -37.362 33.976   109.138 1.00 13.97 ? 327  ARG C CB  1 
ATOM   7808  C  CG  . ARG C  1 245 ? -36.311 32.907   109.477 1.00 13.08 ? 327  ARG C CG  1 
ATOM   7809  C  CD  . ARG C  1 245 ? -35.774 32.235   108.215 1.00 13.25 ? 327  ARG C CD  1 
ATOM   7810  N  NE  . ARG C  1 245 ? -34.833 31.146   108.485 1.00 12.96 ? 327  ARG C NE  1 
ATOM   7811  C  CZ  . ARG C  1 245 ? -33.502 31.261   108.508 1.00 14.07 ? 327  ARG C CZ  1 
ATOM   7812  N  NH1 . ARG C  1 245 ? -32.754 30.188   108.765 1.00 14.47 ? 327  ARG C NH1 1 
ATOM   7813  N  NH2 . ARG C  1 245 ? -32.914 32.431   108.274 1.00 8.66  ? 327  ARG C NH2 1 
ATOM   7814  N  N   . PRO C  1 246 ? -39.599 32.655   110.644 1.00 19.12 ? 328  PRO C N   1 
ATOM   7815  C  CA  . PRO C  1 246 ? -40.226 31.504   111.287 1.00 20.61 ? 328  PRO C CA  1 
ATOM   7816  C  C   . PRO C  1 246 ? -39.498 30.232   110.845 1.00 21.44 ? 328  PRO C C   1 
ATOM   7817  O  O   . PRO C  1 246 ? -38.560 30.276   110.032 1.00 21.97 ? 328  PRO C O   1 
ATOM   7818  C  CB  . PRO C  1 246 ? -41.653 31.570   110.751 1.00 20.18 ? 328  PRO C CB  1 
ATOM   7819  C  CG  . PRO C  1 246 ? -41.445 31.998   109.369 1.00 18.88 ? 328  PRO C CG  1 
ATOM   7820  C  CD  . PRO C  1 246 ? -40.465 33.135   109.550 1.00 19.34 ? 328  PRO C CD  1 
ATOM   7821  N  N   . ASN C  1 247 ? -39.909 29.110   111.420 1.00 22.48 ? 329  ASN C N   1 
ATOM   7822  C  CA  . ASN C  1 247 ? -39.349 27.829   111.051 1.00 24.04 ? 329  ASN C CA  1 
ATOM   7823  C  C   . ASN C  1 247 ? -39.891 27.652   109.650 1.00 25.64 ? 329  ASN C C   1 
ATOM   7824  O  O   . ASN C  1 247 ? -41.010 28.063   109.371 1.00 26.92 ? 329  ASN C O   1 
ATOM   7825  C  CB  . ASN C  1 247 ? -39.893 26.732   111.953 1.00 24.68 ? 329  ASN C CB  1 
ATOM   7826  C  CG  . ASN C  1 247 ? -39.425 26.869   113.378 1.00 25.00 ? 329  ASN C CG  1 
ATOM   7827  O  OD1 . ASN C  1 247 ? -38.246 27.090   113.632 1.00 27.04 ? 329  ASN C OD1 1 
ATOM   7828  N  ND2 . ASN C  1 247 ? -40.340 26.717   114.319 1.00 25.99 ? 329  ASN C ND2 1 
ATOM   7829  N  N   . ASP C  1 248 ? -39.105 27.060   108.766 1.00 28.44 ? 330  ASP C N   1 
ATOM   7830  C  CA  . ASP C  1 248 ? -39.551 26.871   107.398 1.00 30.51 ? 330  ASP C CA  1 
ATOM   7831  C  C   . ASP C  1 248 ? -40.874 26.129   107.318 1.00 30.47 ? 330  ASP C C   1 
ATOM   7832  O  O   . ASP C  1 248 ? -40.930 24.915   107.474 1.00 32.81 ? 330  ASP C O   1 
ATOM   7833  C  CB  . ASP C  1 248 ? -38.493 26.117   106.589 1.00 32.53 ? 330  ASP C CB  1 
ATOM   7834  C  CG  . ASP C  1 248 ? -37.193 26.890   106.465 1.00 34.63 ? 330  ASP C CG  1 
ATOM   7835  O  OD1 . ASP C  1 248 ? -37.239 28.144   106.430 1.00 34.28 ? 330  ASP C OD1 1 
ATOM   7836  O  OD2 . ASP C  1 248 ? -36.126 26.238   106.386 1.00 35.55 ? 330  ASP C OD2 1 
ATOM   7837  N  N   . GLY C  1 249 ? -41.940 26.872   107.077 1.00 31.30 ? 331  GLY C N   1 
ATOM   7838  C  CA  . GLY C  1 249 ? -43.248 26.267   106.956 1.00 30.16 ? 331  GLY C CA  1 
ATOM   7839  C  C   . GLY C  1 249 ? -43.705 26.385   105.517 1.00 29.03 ? 331  GLY C C   1 
ATOM   7840  O  O   . GLY C  1 249 ? -43.110 25.812   104.616 1.00 28.45 ? 331  GLY C O   1 
ATOM   7841  N  N   . THR C  1 250 ? -44.765 27.148   105.303 1.00 29.26 ? 332  THR C N   1 
ATOM   7842  C  CA  . THR C  1 250 ? -45.316 27.351   103.974 1.00 27.63 ? 332  THR C CA  1 
ATOM   7843  C  C   . THR C  1 250 ? -45.069 28.794   103.589 1.00 27.76 ? 332  THR C C   1 
ATOM   7844  O  O   . THR C  1 250 ? -45.405 29.711   104.337 1.00 27.90 ? 332  THR C O   1 
ATOM   7845  C  CB  . THR C  1 250 ? -46.826 27.081   103.973 1.00 28.36 ? 332  THR C CB  1 
ATOM   7846  O  OG1 . THR C  1 250 ? -47.066 25.736   104.409 1.00 28.78 ? 332  THR C OG1 1 
ATOM   7847  C  CG2 . THR C  1 250 ? -47.410 27.279   102.594 1.00 25.60 ? 332  THR C CG2 1 
ATOM   7848  N  N   . GLY C  1 251 ? -44.467 28.996   102.427 1.00 27.02 ? 333  GLY C N   1 
ATOM   7849  C  CA  . GLY C  1 251 ? -44.185 30.346   101.983 1.00 26.85 ? 333  GLY C CA  1 
ATOM   7850  C  C   . GLY C  1 251 ? -45.330 30.921   101.181 1.00 27.70 ? 333  GLY C C   1 
ATOM   7851  O  O   . GLY C  1 251 ? -46.396 30.315   101.087 1.00 28.81 ? 333  GLY C O   1 
ATOM   7852  N  N   . SER C  1 252 ? -45.130 32.107   100.625 1.00 26.62 ? 335  SER C N   1 
ATOM   7853  C  CA  . SER C  1 252 ? -46.152 32.720   99.802  1.00 27.70 ? 335  SER C CA  1 
ATOM   7854  C  C   . SER C  1 252 ? -45.420 33.686   98.913  1.00 27.49 ? 335  SER C C   1 
ATOM   7855  O  O   . SER C  1 252 ? -44.318 34.113   99.247  1.00 26.47 ? 335  SER C O   1 
ATOM   7856  C  CB  . SER C  1 252 ? -47.180 33.460   100.650 1.00 28.46 ? 335  SER C CB  1 
ATOM   7857  O  OG  . SER C  1 252 ? -46.736 34.759   100.930 1.00 30.60 ? 335  SER C OG  1 
ATOM   7858  N  N   . CYS C  1 253 ? -46.017 34.016   97.776  1.00 28.26 ? 336  CYS C N   1 
ATOM   7859  C  CA  . CYS C  1 253 ? -45.379 34.933   96.852  1.00 30.17 ? 336  CYS C CA  1 
ATOM   7860  C  C   . CYS C  1 253 ? -45.732 36.358   97.224  1.00 28.62 ? 336  CYS C C   1 
ATOM   7861  O  O   . CYS C  1 253 ? -45.673 37.261   96.401  1.00 29.70 ? 336  CYS C O   1 
ATOM   7862  C  CB  . CYS C  1 253 ? -45.811 34.655   95.424  1.00 32.27 ? 336  CYS C CB  1 
ATOM   7863  S  SG  . CYS C  1 253 ? -45.640 32.929   94.827  1.00 40.59 ? 336  CYS C SG  1 
ATOM   7864  N  N   . GLY C  1 254 ? -46.091 36.536   98.488  1.00 28.08 ? 339  GLY C N   1 
ATOM   7865  C  CA  . GLY C  1 254 ? -46.431 37.842   99.013  1.00 25.76 ? 339  GLY C CA  1 
ATOM   7866  C  C   . GLY C  1 254 ? -45.949 37.850   100.454 1.00 24.37 ? 339  GLY C C   1 
ATOM   7867  O  O   . GLY C  1 254 ? -46.097 36.852   101.153 1.00 27.61 ? 339  GLY C O   1 
ATOM   7868  N  N   . PRO C  1 255 ? -45.407 38.966   100.939 1.00 21.63 ? 340  PRO C N   1 
ATOM   7869  C  CA  . PRO C  1 255 ? -44.899 39.101   102.303 1.00 20.92 ? 340  PRO C CA  1 
ATOM   7870  C  C   . PRO C  1 255 ? -45.422 38.115   103.358 1.00 20.03 ? 340  PRO C C   1 
ATOM   7871  O  O   . PRO C  1 255 ? -46.620 38.063   103.641 1.00 20.99 ? 340  PRO C O   1 
ATOM   7872  C  CB  . PRO C  1 255 ? -45.234 40.555   102.645 1.00 19.51 ? 340  PRO C CB  1 
ATOM   7873  C  CG  . PRO C  1 255 ? -46.291 40.925   101.650 1.00 17.54 ? 340  PRO C CG  1 
ATOM   7874  C  CD  . PRO C  1 255 ? -45.775 40.286   100.422 1.00 19.97 ? 340  PRO C CD  1 
ATOM   7875  N  N   . VAL C  1 256 ? -44.514 37.322   103.923 1.00 18.37 ? 341  VAL C N   1 
ATOM   7876  C  CA  . VAL C  1 256 ? -44.869 36.392   104.992 1.00 17.40 ? 341  VAL C CA  1 
ATOM   7877  C  C   . VAL C  1 256 ? -44.740 37.243   106.246 1.00 18.10 ? 341  VAL C C   1 
ATOM   7878  O  O   . VAL C  1 256 ? -43.644 37.483   106.738 1.00 16.73 ? 341  VAL C O   1 
ATOM   7879  C  CB  . VAL C  1 256 ? -43.895 35.198   105.085 1.00 17.51 ? 341  VAL C CB  1 
ATOM   7880  C  CG1 . VAL C  1 256 ? -44.165 34.373   106.361 1.00 14.15 ? 341  VAL C CG1 1 
ATOM   7881  C  CG2 . VAL C  1 256 ? -44.070 34.329   103.860 1.00 18.07 ? 341  VAL C CG2 1 
ATOM   7882  N  N   . SER C  1 257 ? -45.860 37.707   106.775 1.00 18.73 ? 342  SER C N   1 
ATOM   7883  C  CA  . SER C  1 257 ? -45.810 38.588   107.936 1.00 21.20 ? 342  SER C CA  1 
ATOM   7884  C  C   . SER C  1 257 ? -45.169 37.995   109.153 1.00 21.96 ? 342  SER C C   1 
ATOM   7885  O  O   . SER C  1 257 ? -44.186 38.551   109.716 1.00 24.14 ? 342  SER C O   1 
ATOM   7886  C  CB  . SER C  1 257 ? -47.221 39.098   108.258 1.00 21.27 ? 342  SER C CB  1 
ATOM   7887  O  OG  . SER C  1 257 ? -48.028 38.064   108.781 1.00 17.32 ? 342  SER C OG  1 
ATOM   7888  N  N   . SER C  1 258 ? -45.729 36.875   109.561 1.00 24.14 ? 343  SER C N   1 
ATOM   7889  C  CA  . SER C  1 258 ? -45.191 36.213   110.717 1.00 27.36 ? 343  SER C CA  1 
ATOM   7890  C  C   . SER C  1 258 ? -43.693 36.334   110.912 1.00 27.97 ? 343  SER C C   1 
ATOM   7891  O  O   . SER C  1 258 ? -42.874 36.049   110.029 1.00 24.84 ? 343  SER C O   1 
ATOM   7892  C  CB  . SER C  1 258 ? -45.590 34.741   110.680 1.00 28.97 ? 343  SER C CB  1 
ATOM   7893  O  OG  . SER C  1 258 ? -45.337 34.216   109.317 1.00 32.61 ? 343  SER C OG  1 
ATOM   7894  N  N   . ASN C  1 259 ? -43.363 36.942   112.032 1.00 29.23 ? 344  ASN C N   1 
ATOM   7895  C  CA  . ASN C  1 259 ? -41.989 37.107   112.381 1.00 29.86 ? 344  ASN C CA  1 
ATOM   7896  C  C   . ASN C  1 259 ? -41.139 37.857   111.400 1.00 31.02 ? 344  ASN C C   1 
ATOM   7897  O  O   . ASN C  1 259 ? -39.976 38.122   111.656 1.00 30.55 ? 344  ASN C O   1 
ATOM   7898  C  CB  . ASN C  1 259 ? -41.356 35.747   112.653 1.00 30.12 ? 344  ASN C CB  1 
ATOM   7899  C  CG  . ASN C  1 259 ? -40.550 35.775   113.865 1.00 32.04 ? 344  ASN C CG  1 
ATOM   7900  O  OD1 . ASN C  1 259 ? -40.036 36.820   114.204 1.00 32.45 ? 344  ASN C OD1 1 
ATOM   7901  N  ND2 . ASN C  1 259 ? -40.418 34.641   114.547 1.00 32.47 ? 344  ASN C ND2 1 
ATOM   7902  N  N   . GLY C  1 260 ? -41.701 38.179   110.258 1.00 30.93 ? 345  GLY C N   1 
ATOM   7903  C  CA  . GLY C  1 260 ? -40.912 38.906   109.305 1.00 31.31 ? 345  GLY C CA  1 
ATOM   7904  C  C   . GLY C  1 260 ? -40.927 40.432   109.464 1.00 31.21 ? 345  GLY C C   1 
ATOM   7905  O  O   . GLY C  1 260 ? -40.769 41.146   108.475 1.00 29.88 ? 345  GLY C O   1 
ATOM   7906  N  N   . ALA C  1 261 ? -41.091 40.981   110.666 1.00 32.71 ? 346  ALA C N   1 
ATOM   7907  C  CA  . ALA C  1 261 ? -41.117 42.449   110.802 1.00 31.71 ? 346  ALA C CA  1 
ATOM   7908  C  C   . ALA C  1 261 ? -39.818 43.185   111.044 1.00 31.07 ? 346  ALA C C   1 
ATOM   7909  O  O   . ALA C  1 261 ? -39.840 44.231   111.685 1.00 33.61 ? 346  ALA C O   1 
ATOM   7910  C  CB  . ALA C  1 261 ? -42.132 42.858   111.877 1.00 33.79 ? 346  ALA C CB  1 
ATOM   7911  N  N   . TYR C  1 262 ? -38.704 42.663   110.543 1.00 28.10 ? 347  TYR C N   1 
ATOM   7912  C  CA  . TYR C  1 262 ? -37.403 43.339   110.688 1.00 24.92 ? 347  TYR C CA  1 
ATOM   7913  C  C   . TYR C  1 262 ? -36.557 42.789   109.528 1.00 22.81 ? 347  TYR C C   1 
ATOM   7914  O  O   . TYR C  1 262 ? -37.065 42.704   108.406 1.00 23.84 ? 347  TYR C O   1 
ATOM   7915  C  CB  . TYR C  1 262 ? -36.790 43.018   112.060 1.00 25.39 ? 347  TYR C CB  1 
ATOM   7916  C  CG  . TYR C  1 262 ? -35.366 43.488   112.300 1.00 23.87 ? 347  TYR C CG  1 
ATOM   7917  C  CD1 . TYR C  1 262 ? -34.969 44.789   112.005 1.00 24.59 ? 347  TYR C CD1 1 
ATOM   7918  C  CD2 . TYR C  1 262 ? -34.410 42.615   112.836 1.00 23.77 ? 347  TYR C CD2 1 
ATOM   7919  C  CE1 . TYR C  1 262 ? -33.633 45.216   112.238 1.00 23.41 ? 347  TYR C CE1 1 
ATOM   7920  C  CE2 . TYR C  1 262 ? -33.088 43.028   113.069 1.00 23.13 ? 347  TYR C CE2 1 
ATOM   7921  C  CZ  . TYR C  1 262 ? -32.707 44.326   112.768 1.00 24.33 ? 347  TYR C CZ  1 
ATOM   7922  O  OH  . TYR C  1 262 ? -31.399 44.711   112.995 1.00 24.92 ? 347  TYR C OH  1 
ATOM   7923  N  N   . GLY C  1 263 ? -35.295 42.425   109.748 1.00 20.06 ? 348  GLY C N   1 
ATOM   7924  C  CA  . GLY C  1 263 ? -34.532 41.864   108.639 1.00 18.22 ? 348  GLY C CA  1 
ATOM   7925  C  C   . GLY C  1 263 ? -33.014 41.933   108.634 1.00 17.14 ? 348  GLY C C   1 
ATOM   7926  O  O   . GLY C  1 263 ? -32.376 42.387   109.588 1.00 17.33 ? 348  GLY C O   1 
ATOM   7927  N  N   . VAL C  1 264 ? -32.441 41.466   107.529 1.00 15.34 ? 349  VAL C N   1 
ATOM   7928  C  CA  . VAL C  1 264 ? -30.996 41.457   107.320 1.00 13.27 ? 349  VAL C CA  1 
ATOM   7929  C  C   . VAL C  1 264 ? -30.692 41.467   105.818 1.00 13.96 ? 349  VAL C C   1 
ATOM   7930  O  O   . VAL C  1 264 ? -31.404 40.840   105.031 1.00 13.55 ? 349  VAL C O   1 
ATOM   7931  C  CB  . VAL C  1 264 ? -30.344 40.203   107.934 1.00 12.87 ? 349  VAL C CB  1 
ATOM   7932  C  CG1 . VAL C  1 264 ? -30.663 38.973   107.077 1.00 10.19 ? 349  VAL C CG1 1 
ATOM   7933  C  CG2 . VAL C  1 264 ? -28.842 40.412   108.068 1.00 11.26 ? 349  VAL C CG2 1 
ATOM   7934  N  N   . LYS C  1 265 ? -29.639 42.175   105.417 1.00 13.12 ? 350  LYS C N   1 
ATOM   7935  C  CA  . LYS C  1 265 ? -29.315 42.234   104.003 1.00 14.00 ? 350  LYS C CA  1 
ATOM   7936  C  C   . LYS C  1 265 ? -28.982 40.828   103.544 1.00 15.49 ? 350  LYS C C   1 
ATOM   7937  O  O   . LYS C  1 265 ? -28.210 40.125   104.202 1.00 16.55 ? 350  LYS C O   1 
ATOM   7938  C  CB  . LYS C  1 265 ? -28.132 43.169   103.729 1.00 12.12 ? 350  LYS C CB  1 
ATOM   7939  C  CG  . LYS C  1 265 ? -27.798 43.278   102.250 1.00 9.74  ? 350  LYS C CG  1 
ATOM   7940  C  CD  . LYS C  1 265 ? -26.586 44.144   101.990 1.00 11.46 ? 350  LYS C CD  1 
ATOM   7941  C  CE  . LYS C  1 265 ? -26.106 43.979   100.556 1.00 9.89  ? 350  LYS C CE  1 
ATOM   7942  N  NZ  . LYS C  1 265 ? -27.130 44.395   99.545  1.00 10.78 ? 350  LYS C NZ  1 
ATOM   7943  N  N   . GLY C  1 266 ? -29.579 40.424   102.422 1.00 14.70 ? 351  GLY C N   1 
ATOM   7944  C  CA  . GLY C  1 266 ? -29.352 39.091   101.894 1.00 15.41 ? 351  GLY C CA  1 
ATOM   7945  C  C   . GLY C  1 266 ? -29.398 39.023   100.380 1.00 16.22 ? 351  GLY C C   1 
ATOM   7946  O  O   . GLY C  1 266 ? -29.574 40.034   99.705  1.00 16.81 ? 351  GLY C O   1 
ATOM   7947  N  N   . PHE C  1 267 ? -29.253 37.822   99.839  1.00 15.32 ? 352  PHE C N   1 
ATOM   7948  C  CA  . PHE C  1 267 ? -29.253 37.647   98.393  1.00 15.14 ? 352  PHE C CA  1 
ATOM   7949  C  C   . PHE C  1 267 ? -29.843 36.296   97.998  1.00 14.95 ? 352  PHE C C   1 
ATOM   7950  O  O   . PHE C  1 267 ? -30.211 35.490   98.844  1.00 16.32 ? 352  PHE C O   1 
ATOM   7951  C  CB  . PHE C  1 267 ? -27.824 37.713   97.864  1.00 12.83 ? 352  PHE C CB  1 
ATOM   7952  C  CG  . PHE C  1 267 ? -27.018 36.513   98.213  1.00 15.08 ? 352  PHE C CG  1 
ATOM   7953  C  CD1 . PHE C  1 267 ? -26.525 36.344   99.502  1.00 16.52 ? 352  PHE C CD1 1 
ATOM   7954  C  CD2 . PHE C  1 267 ? -26.841 35.489   97.289  1.00 15.71 ? 352  PHE C CD2 1 
ATOM   7955  C  CE1 . PHE C  1 267 ? -25.867 35.167   99.871  1.00 16.89 ? 352  PHE C CE1 1 
ATOM   7956  C  CE2 . PHE C  1 267 ? -26.188 34.311   97.645  1.00 16.00 ? 352  PHE C CE2 1 
ATOM   7957  C  CZ  . PHE C  1 267 ? -25.701 34.146   98.942  1.00 15.47 ? 352  PHE C CZ  1 
ATOM   7958  N  N   . SER C  1 268 ? -29.886 36.055   96.696  1.00 14.64 ? 353  SER C N   1 
ATOM   7959  C  CA  . SER C  1 268 ? -30.404 34.822   96.136  1.00 16.14 ? 353  SER C CA  1 
ATOM   7960  C  C   . SER C  1 268 ? -30.154 34.836   94.640  1.00 16.79 ? 353  SER C C   1 
ATOM   7961  O  O   . SER C  1 268 ? -30.144 35.897   94.009  1.00 14.91 ? 353  SER C O   1 
ATOM   7962  C  CB  . SER C  1 268 ? -31.913 34.694   96.387  1.00 17.54 ? 353  SER C CB  1 
ATOM   7963  O  OG  . SER C  1 268 ? -32.196 34.171   97.675  1.00 19.87 ? 353  SER C OG  1 
ATOM   7964  N  N   . PHE C  1 269 ? -29.958 33.652   94.074  1.00 17.65 ? 354  PHE C N   1 
ATOM   7965  C  CA  . PHE C  1 269 ? -29.722 33.531   92.643  1.00 18.40 ? 354  PHE C CA  1 
ATOM   7966  C  C   . PHE C  1 269 ? -30.825 32.697   92.026  1.00 20.77 ? 354  PHE C C   1 
ATOM   7967  O  O   . PHE C  1 269 ? -31.098 31.579   92.463  1.00 22.21 ? 354  PHE C O   1 
ATOM   7968  C  CB  . PHE C  1 269 ? -28.358 32.892   92.381  1.00 17.22 ? 354  PHE C CB  1 
ATOM   7969  C  CG  . PHE C  1 269 ? -27.210 33.789   92.733  1.00 15.89 ? 354  PHE C CG  1 
ATOM   7970  C  CD1 . PHE C  1 269 ? -26.411 33.521   93.830  1.00 14.47 ? 354  PHE C CD1 1 
ATOM   7971  C  CD2 . PHE C  1 269 ? -26.963 34.933   91.990  1.00 15.76 ? 354  PHE C CD2 1 
ATOM   7972  C  CE1 . PHE C  1 269 ? -25.384 34.380   94.187  1.00 13.01 ? 354  PHE C CE1 1 
ATOM   7973  C  CE2 . PHE C  1 269 ? -25.941 35.796   92.341  1.00 15.62 ? 354  PHE C CE2 1 
ATOM   7974  C  CZ  . PHE C  1 269 ? -25.149 35.513   93.444  1.00 14.15 ? 354  PHE C CZ  1 
ATOM   7975  N  N   . LYS C  1 270 ? -31.468 33.255   91.010  1.00 22.32 ? 355  LYS C N   1 
ATOM   7976  C  CA  . LYS C  1 270 ? -32.555 32.575   90.330  1.00 21.61 ? 355  LYS C CA  1 
ATOM   7977  C  C   . LYS C  1 270 ? -32.041 31.833   89.117  1.00 22.01 ? 355  LYS C C   1 
ATOM   7978  O  O   . LYS C  1 270 ? -31.212 32.345   88.372  1.00 22.61 ? 355  LYS C O   1 
ATOM   7979  C  CB  . LYS C  1 270 ? -33.616 33.598   89.913  1.00 23.10 ? 355  LYS C CB  1 
ATOM   7980  C  CG  . LYS C  1 270 ? -34.624 33.128   88.871  1.00 20.74 ? 355  LYS C CG  1 
ATOM   7981  C  CD  . LYS C  1 270 ? -35.514 34.288   88.483  1.00 22.94 ? 355  LYS C CD  1 
ATOM   7982  C  CE  . LYS C  1 270 ? -36.292 34.020   87.205  1.00 24.32 ? 355  LYS C CE  1 
ATOM   7983  N  NZ  . LYS C  1 270 ? -37.309 32.958   87.374  1.00 23.91 ? 355  LYS C NZ  1 
ATOM   7984  N  N   . TYR C  1 271 ? -32.534 30.613   88.946  1.00 21.80 ? 356  TYR C N   1 
ATOM   7985  C  CA  . TYR C  1 271 ? -32.182 29.750   87.826  1.00 21.19 ? 356  TYR C CA  1 
ATOM   7986  C  C   . TYR C  1 271 ? -33.486 29.099   87.414  1.00 21.01 ? 356  TYR C C   1 
ATOM   7987  O  O   . TYR C  1 271 ? -33.933 28.152   88.056  1.00 21.11 ? 356  TYR C O   1 
ATOM   7988  C  CB  . TYR C  1 271 ? -31.192 28.662   88.258  1.00 21.76 ? 356  TYR C CB  1 
ATOM   7989  C  CG  . TYR C  1 271 ? -29.760 29.128   88.427  1.00 21.08 ? 356  TYR C CG  1 
ATOM   7990  C  CD1 . TYR C  1 271 ? -29.338 29.748   89.602  1.00 21.69 ? 356  TYR C CD1 1 
ATOM   7991  C  CD2 . TYR C  1 271 ? -28.822 28.923   87.418  1.00 19.84 ? 356  TYR C CD2 1 
ATOM   7992  C  CE1 . TYR C  1 271 ? -28.013 30.149   89.767  1.00 21.10 ? 356  TYR C CE1 1 
ATOM   7993  C  CE2 . TYR C  1 271 ? -27.499 29.317   87.572  1.00 19.68 ? 356  TYR C CE2 1 
ATOM   7994  C  CZ  . TYR C  1 271 ? -27.102 29.926   88.751  1.00 20.25 ? 356  TYR C CZ  1 
ATOM   7995  O  OH  . TYR C  1 271 ? -25.787 30.287   88.921  1.00 19.86 ? 356  TYR C OH  1 
ATOM   7996  N  N   . GLY C  1 272 ? -34.102 29.607   86.353  1.00 21.10 ? 357  GLY C N   1 
ATOM   7997  C  CA  . GLY C  1 272 ? -35.382 29.064   85.933  1.00 21.19 ? 357  GLY C CA  1 
ATOM   7998  C  C   . GLY C  1 272 ? -36.344 29.339   87.072  1.00 21.47 ? 357  GLY C C   1 
ATOM   7999  O  O   . GLY C  1 272 ? -36.479 30.483   87.498  1.00 22.45 ? 357  GLY C O   1 
ATOM   8000  N  N   . ASN C  1 273 ? -36.999 28.302   87.582  1.00 21.79 ? 358  ASN C N   1 
ATOM   8001  C  CA  . ASN C  1 273 ? -37.927 28.475   88.693  1.00 22.58 ? 358  ASN C CA  1 
ATOM   8002  C  C   . ASN C  1 273 ? -37.268 28.143   90.013  1.00 21.48 ? 358  ASN C C   1 
ATOM   8003  O  O   . ASN C  1 273 ? -37.911 28.174   91.051  1.00 20.21 ? 358  ASN C O   1 
ATOM   8004  C  CB  . ASN C  1 273 ? -39.151 27.580   88.531  1.00 25.37 ? 358  ASN C CB  1 
ATOM   8005  C  CG  . ASN C  1 273 ? -40.009 27.986   87.370  1.00 27.42 ? 358  ASN C CG  1 
ATOM   8006  O  OD1 . ASN C  1 273 ? -40.447 29.134   87.284  1.00 29.24 ? 358  ASN C OD1 1 
ATOM   8007  N  ND2 . ASN C  1 273 ? -40.261 27.048   86.463  1.00 28.68 ? 358  ASN C ND2 1 
ATOM   8008  N  N   . GLY C  1 274 ? -35.982 27.820   89.964  1.00 22.14 ? 359  GLY C N   1 
ATOM   8009  C  CA  . GLY C  1 274 ? -35.258 27.482   91.175  1.00 21.69 ? 359  GLY C CA  1 
ATOM   8010  C  C   . GLY C  1 274 ? -34.491 28.654   91.759  1.00 21.26 ? 359  GLY C C   1 
ATOM   8011  O  O   . GLY C  1 274 ? -34.282 29.663   91.083  1.00 18.32 ? 359  GLY C O   1 
ATOM   8012  N  N   . VAL C  1 275 ? -34.068 28.502   93.014  1.00 20.77 ? 360  VAL C N   1 
ATOM   8013  C  CA  . VAL C  1 275 ? -33.335 29.538   93.728  1.00 21.54 ? 360  VAL C CA  1 
ATOM   8014  C  C   . VAL C  1 275 ? -32.190 28.997   94.557  1.00 22.08 ? 360  VAL C C   1 
ATOM   8015  O  O   . VAL C  1 275 ? -32.294 27.931   95.169  1.00 22.64 ? 360  VAL C O   1 
ATOM   8016  C  CB  . VAL C  1 275 ? -34.195 30.265   94.777  1.00 22.18 ? 360  VAL C CB  1 
ATOM   8017  C  CG1 . VAL C  1 275 ? -33.883 31.738   94.768  1.00 22.37 ? 360  VAL C CG1 1 
ATOM   8018  C  CG2 . VAL C  1 275 ? -35.643 29.980   94.568  1.00 24.92 ? 360  VAL C CG2 1 
ATOM   8019  N  N   . TRP C  1 276 ? -31.101 29.747   94.586  1.00 20.28 ? 361  TRP C N   1 
ATOM   8020  C  CA  . TRP C  1 276 ? -29.996 29.397   95.442  1.00 19.87 ? 361  TRP C CA  1 
ATOM   8021  C  C   . TRP C  1 276 ? -30.187 30.440   96.544  1.00 21.43 ? 361  TRP C C   1 
ATOM   8022  O  O   . TRP C  1 276 ? -29.936 31.631   96.350  1.00 22.30 ? 361  TRP C O   1 
ATOM   8023  C  CB  . TRP C  1 276 ? -28.664 29.581   94.737  1.00 16.69 ? 361  TRP C CB  1 
ATOM   8024  C  CG  . TRP C  1 276 ? -28.106 28.303   94.231  1.00 16.26 ? 361  TRP C CG  1 
ATOM   8025  C  CD1 . TRP C  1 276 ? -27.991 27.920   92.927  1.00 16.45 ? 361  TRP C CD1 1 
ATOM   8026  C  CD2 . TRP C  1 276 ? -27.543 27.242   95.017  1.00 14.41 ? 361  TRP C CD2 1 
ATOM   8027  N  NE1 . TRP C  1 276 ? -27.384 26.688   92.850  1.00 17.20 ? 361  TRP C NE1 1 
ATOM   8028  C  CE2 . TRP C  1 276 ? -27.094 26.253   94.116  1.00 15.67 ? 361  TRP C CE2 1 
ATOM   8029  C  CE3 . TRP C  1 276 ? -27.367 27.040   96.390  1.00 13.27 ? 361  TRP C CE3 1 
ATOM   8030  C  CZ2 . TRP C  1 276 ? -26.473 25.068   94.551  1.00 14.93 ? 361  TRP C CZ2 1 
ATOM   8031  C  CZ3 . TRP C  1 276 ? -26.751 25.866   96.822  1.00 13.16 ? 361  TRP C CZ3 1 
ATOM   8032  C  CH2 . TRP C  1 276 ? -26.309 24.897   95.904  1.00 13.43 ? 361  TRP C CH2 1 
ATOM   8033  N  N   . ILE C  1 277 ? -30.690 29.987   97.684  1.00 21.70 ? 362  ILE C N   1 
ATOM   8034  C  CA  . ILE C  1 277 ? -30.940 30.863   98.812  1.00 20.77 ? 362  ILE C CA  1 
ATOM   8035  C  C   . ILE C  1 277 ? -29.809 30.813   99.826  1.00 21.27 ? 362  ILE C C   1 
ATOM   8036  O  O   . ILE C  1 277 ? -29.424 29.733   100.286 1.00 23.19 ? 362  ILE C O   1 
ATOM   8037  C  CB  . ILE C  1 277 ? -32.219 30.456   99.554  1.00 19.89 ? 362  ILE C CB  1 
ATOM   8038  C  CG1 . ILE C  1 277 ? -33.428 30.611   98.637  1.00 18.60 ? 362  ILE C CG1 1 
ATOM   8039  C  CG2 . ILE C  1 277 ? -32.378 31.293   100.817 1.00 19.52 ? 362  ILE C CG2 1 
ATOM   8040  C  CD1 . ILE C  1 277 ? -34.709 30.080   99.246  1.00 19.41 ? 362  ILE C CD1 1 
ATOM   8041  N  N   . GLY C  1 278 ? -29.271 31.982   100.152 1.00 18.60 ? 363  GLY C N   1 
ATOM   8042  C  CA  . GLY C  1 278 ? -28.242 32.069   101.162 1.00 15.64 ? 363  GLY C CA  1 
ATOM   8043  C  C   . GLY C  1 278 ? -29.006 32.637   102.344 1.00 16.44 ? 363  GLY C C   1 
ATOM   8044  O  O   . GLY C  1 278 ? -29.877 33.495   102.162 1.00 16.10 ? 363  GLY C O   1 
ATOM   8045  N  N   . ARG C  1 279 ? -28.730 32.161   103.549 1.00 15.98 ? 364  ARG C N   1 
ATOM   8046  C  CA  . ARG C  1 279 ? -29.440 32.680   104.709 1.00 16.08 ? 364  ARG C CA  1 
ATOM   8047  C  C   . ARG C  1 279 ? -28.731 32.266   105.977 1.00 18.14 ? 364  ARG C C   1 
ATOM   8048  O  O   . ARG C  1 279 ? -27.898 31.355   105.958 1.00 19.04 ? 364  ARG C O   1 
ATOM   8049  C  CB  . ARG C  1 279 ? -30.868 32.142   104.745 1.00 15.82 ? 364  ARG C CB  1 
ATOM   8050  C  CG  . ARG C  1 279 ? -30.948 30.669   105.113 1.00 15.05 ? 364  ARG C CG  1 
ATOM   8051  C  CD  . ARG C  1 279 ? -32.379 30.204   105.188 1.00 12.98 ? 364  ARG C CD  1 
ATOM   8052  N  NE  . ARG C  1 279 ? -32.481 28.822   105.638 1.00 11.90 ? 364  ARG C NE  1 
ATOM   8053  C  CZ  . ARG C  1 279 ? -33.632 28.185   105.822 1.00 10.41 ? 364  ARG C CZ  1 
ATOM   8054  N  NH1 . ARG C  1 279 ? -33.636 26.922   106.232 1.00 8.56  ? 364  ARG C NH1 1 
ATOM   8055  N  NH2 . ARG C  1 279 ? -34.776 28.815   105.591 1.00 7.57  ? 364  ARG C NH2 1 
ATOM   8056  N  N   . THR C  1 280 ? -29.050 32.940   107.078 1.00 18.67 ? 365  THR C N   1 
ATOM   8057  C  CA  . THR C  1 280 ? -28.453 32.605   108.364 1.00 20.09 ? 365  THR C CA  1 
ATOM   8058  C  C   . THR C  1 280 ? -29.046 31.260   108.750 1.00 20.44 ? 365  THR C C   1 
ATOM   8059  O  O   . THR C  1 280 ? -30.025 30.823   108.145 1.00 21.42 ? 365  THR C O   1 
ATOM   8060  C  CB  . THR C  1 280 ? -28.850 33.619   109.434 1.00 19.96 ? 365  THR C CB  1 
ATOM   8061  O  OG1 . THR C  1 280 ? -30.270 33.572   109.620 1.00 21.00 ? 365  THR C OG1 1 
ATOM   8062  C  CG2 . THR C  1 280 ? -28.444 35.016   109.011 1.00 19.30 ? 365  THR C CG2 1 
ATOM   8063  N  N   . LYS C  1 281 ? -28.472 30.595   109.744 1.00 20.71 ? 366  LYS C N   1 
ATOM   8064  C  CA  . LYS C  1 281 ? -29.018 29.309   110.162 1.00 21.66 ? 366  LYS C CA  1 
ATOM   8065  C  C   . LYS C  1 281 ? -30.056 29.522   111.260 1.00 21.31 ? 366  LYS C C   1 
ATOM   8066  O  O   . LYS C  1 281 ? -31.063 28.818   111.319 1.00 20.66 ? 366  LYS C O   1 
ATOM   8067  C  CB  . LYS C  1 281 ? -27.902 28.380   110.643 1.00 21.48 ? 366  LYS C CB  1 
ATOM   8068  C  CG  . LYS C  1 281 ? -26.903 28.037   109.555 1.00 23.52 ? 366  LYS C CG  1 
ATOM   8069  C  CD  . LYS C  1 281 ? -25.748 27.196   110.087 1.00 24.06 ? 366  LYS C CD  1 
ATOM   8070  C  CE  . LYS C  1 281 ? -25.894 25.732   109.712 1.00 23.58 ? 366  LYS C CE  1 
ATOM   8071  N  NZ  . LYS C  1 281 ? -25.771 25.523   108.249 1.00 21.61 ? 366  LYS C NZ  1 
ATOM   8072  N  N   . SER C  1 282 ? -29.809 30.503   112.123 1.00 22.32 ? 367  SER C N   1 
ATOM   8073  C  CA  . SER C  1 282 ? -30.737 30.824   113.207 1.00 23.29 ? 367  SER C CA  1 
ATOM   8074  C  C   . SER C  1 282 ? -31.940 31.566   112.623 1.00 23.14 ? 367  SER C C   1 
ATOM   8075  O  O   . SER C  1 282 ? -31.855 32.131   111.537 1.00 22.93 ? 367  SER C O   1 
ATOM   8076  C  CB  . SER C  1 282 ? -30.042 31.704   114.252 1.00 22.23 ? 367  SER C CB  1 
ATOM   8077  O  OG  . SER C  1 282 ? -30.920 32.030   115.311 1.00 22.86 ? 367  SER C OG  1 
ATOM   8078  N  N   . THR C  1 283 ? -33.060 31.555   113.335 1.00 23.58 ? 368  THR C N   1 
ATOM   8079  C  CA  . THR C  1 283 ? -34.256 32.242   112.861 1.00 25.08 ? 368  THR C CA  1 
ATOM   8080  C  C   . THR C  1 283 ? -34.519 33.496   113.683 1.00 26.79 ? 368  THR C C   1 
ATOM   8081  O  O   . THR C  1 283 ? -35.439 34.250   113.385 1.00 28.07 ? 368  THR C O   1 
ATOM   8082  C  CB  . THR C  1 283 ? -35.500 31.356   112.967 1.00 24.18 ? 368  THR C CB  1 
ATOM   8083  O  OG1 . THR C  1 283 ? -35.743 31.059   114.345 1.00 24.95 ? 368  THR C OG1 1 
ATOM   8084  C  CG2 . THR C  1 283 ? -35.313 30.065   112.197 1.00 21.99 ? 368  THR C CG2 1 
ATOM   8085  N  N   . ASN C  1 284 ? -33.713 33.712   114.720 1.00 29.27 ? 369  ASN C N   1 
ATOM   8086  C  CA  . ASN C  1 284 ? -33.870 34.879   115.580 1.00 31.18 ? 369  ASN C CA  1 
ATOM   8087  C  C   . ASN C  1 284 ? -32.637 35.764   115.616 1.00 31.06 ? 369  ASN C C   1 
ATOM   8088  O  O   . ASN C  1 284 ? -32.730 36.932   115.975 1.00 32.75 ? 369  ASN C O   1 
ATOM   8089  C  CB  . ASN C  1 284 ? -34.189 34.466   117.020 1.00 34.08 ? 369  ASN C CB  1 
ATOM   8090  C  CG  . ASN C  1 284 ? -35.481 33.680   117.135 1.00 39.54 ? 369  ASN C CG  1 
ATOM   8091  O  OD1 . ASN C  1 284 ? -36.554 34.145   116.730 1.00 42.88 ? 369  ASN C OD1 1 
ATOM   8092  N  ND2 . ASN C  1 284 ? -35.388 32.478   117.698 1.00 40.04 ? 369  ASN C ND2 1 
ATOM   8093  N  N   . SER C  1 285 ? -31.485 35.214   115.251 1.00 30.18 ? 370  SER C N   1 
ATOM   8094  C  CA  . SER C  1 285 ? -30.239 35.976   115.291 1.00 28.76 ? 370  SER C CA  1 
ATOM   8095  C  C   . SER C  1 285 ? -29.414 35.889   114.030 1.00 26.94 ? 370  SER C C   1 
ATOM   8096  O  O   . SER C  1 285 ? -29.610 35.025   113.186 1.00 26.84 ? 370  SER C O   1 
ATOM   8097  C  CB  . SER C  1 285 ? -29.357 35.494   116.440 1.00 29.40 ? 370  SER C CB  1 
ATOM   8098  O  OG  . SER C  1 285 ? -29.996 35.672   117.683 1.00 34.45 ? 370  SER C OG  1 
ATOM   8099  N  N   . ARG C  1 286 ? -28.460 36.793   113.922 1.00 25.07 ? 371  ARG C N   1 
ATOM   8100  C  CA  . ARG C  1 286 ? -27.588 36.792   112.779 1.00 23.67 ? 371  ARG C CA  1 
ATOM   8101  C  C   . ARG C  1 286 ? -26.422 35.878   113.129 1.00 23.11 ? 371  ARG C C   1 
ATOM   8102  O  O   . ARG C  1 286 ? -25.328 36.316   113.467 1.00 23.36 ? 371  ARG C O   1 
ATOM   8103  C  CB  . ARG C  1 286 ? -27.157 38.218   112.487 1.00 22.90 ? 371  ARG C CB  1 
ATOM   8104  C  CG  . ARG C  1 286 ? -28.348 39.077   112.131 1.00 21.68 ? 371  ARG C CG  1 
ATOM   8105  C  CD  . ARG C  1 286 ? -27.969 40.517   111.968 1.00 22.96 ? 371  ARG C CD  1 
ATOM   8106  N  NE  . ARG C  1 286 ? -29.077 41.295   111.436 1.00 24.03 ? 371  ARG C NE  1 
ATOM   8107  C  CZ  . ARG C  1 286 ? -28.998 42.590   111.153 1.00 24.98 ? 371  ARG C CZ  1 
ATOM   8108  N  NH1 . ARG C  1 286 ? -30.053 43.232   110.664 1.00 23.82 ? 371  ARG C NH1 1 
ATOM   8109  N  NH2 . ARG C  1 286 ? -27.856 43.240   111.361 1.00 24.95 ? 371  ARG C NH2 1 
ATOM   8110  N  N   . SER C  1 287 ? -26.693 34.583   113.077 1.00 22.23 ? 372  SER C N   1 
ATOM   8111  C  CA  . SER C  1 287 ? -25.686 33.591   113.389 1.00 21.64 ? 372  SER C CA  1 
ATOM   8112  C  C   . SER C  1 287 ? -25.792 32.396   112.438 1.00 20.31 ? 372  SER C C   1 
ATOM   8113  O  O   . SER C  1 287 ? -26.886 31.939   112.096 1.00 19.24 ? 372  SER C O   1 
ATOM   8114  C  CB  . SER C  1 287 ? -25.832 33.139   114.847 1.00 21.94 ? 372  SER C CB  1 
ATOM   8115  O  OG  . SER C  1 287 ? -27.029 32.413   115.042 1.00 23.76 ? 372  SER C OG  1 
ATOM   8116  N  N   . GLY C  1 288 ? -24.635 31.899   112.013 1.00 20.30 ? 373  GLY C N   1 
ATOM   8117  C  CA  . GLY C  1 288 ? -24.600 30.783   111.095 1.00 19.61 ? 373  GLY C CA  1 
ATOM   8118  C  C   . GLY C  1 288 ? -24.988 31.253   109.711 1.00 18.18 ? 373  GLY C C   1 
ATOM   8119  O  O   . GLY C  1 288 ? -25.580 32.318   109.554 1.00 19.30 ? 373  GLY C O   1 
ATOM   8120  N  N   . PHE C  1 289 ? -24.640 30.470   108.703 1.00 15.62 ? 374  PHE C N   1 
ATOM   8121  C  CA  . PHE C  1 289 ? -24.980 30.807   107.333 1.00 14.39 ? 374  PHE C CA  1 
ATOM   8122  C  C   . PHE C  1 289 ? -24.953 29.517   106.553 1.00 13.98 ? 374  PHE C C   1 
ATOM   8123  O  O   . PHE C  1 289 ? -24.197 28.612   106.876 1.00 15.32 ? 374  PHE C O   1 
ATOM   8124  C  CB  . PHE C  1 289 ? -23.979 31.788   106.718 1.00 11.22 ? 374  PHE C CB  1 
ATOM   8125  C  CG  . PHE C  1 289 ? -24.555 32.581   105.578 1.00 10.03 ? 374  PHE C CG  1 
ATOM   8126  C  CD1 . PHE C  1 289 ? -25.414 33.657   105.826 1.00 8.61  ? 374  PHE C CD1 1 
ATOM   8127  C  CD2 . PHE C  1 289 ? -24.331 32.194   104.261 1.00 9.71  ? 374  PHE C CD2 1 
ATOM   8128  C  CE1 . PHE C  1 289 ? -26.045 34.330   104.777 1.00 7.57  ? 374  PHE C CE1 1 
ATOM   8129  C  CE2 . PHE C  1 289 ? -24.956 32.857   103.205 1.00 9.82  ? 374  PHE C CE2 1 
ATOM   8130  C  CZ  . PHE C  1 289 ? -25.820 33.929   103.463 1.00 7.96  ? 374  PHE C CZ  1 
ATOM   8131  N  N   . GLU C  1 290 ? -25.772 29.435   105.518 1.00 14.76 ? 375  GLU C N   1 
ATOM   8132  C  CA  . GLU C  1 290 ? -25.843 28.231   104.710 1.00 15.55 ? 375  GLU C CA  1 
ATOM   8133  C  C   . GLU C  1 290 ? -26.412 28.581   103.361 1.00 15.88 ? 375  GLU C C   1 
ATOM   8134  O  O   . GLU C  1 290 ? -27.139 29.564   103.228 1.00 16.20 ? 375  GLU C O   1 
ATOM   8135  C  CB  . GLU C  1 290 ? -26.753 27.202   105.388 1.00 16.46 ? 375  GLU C CB  1 
ATOM   8136  C  CG  . GLU C  1 290 ? -28.187 27.695   105.595 1.00 18.90 ? 375  GLU C CG  1 
ATOM   8137  C  CD  . GLU C  1 290 ? -29.000 26.797   106.521 1.00 22.77 ? 375  GLU C CD  1 
ATOM   8138  O  OE1 . GLU C  1 290 ? -28.388 25.973   107.236 1.00 23.19 ? 375  GLU C OE1 1 
ATOM   8139  O  OE2 . GLU C  1 290 ? -30.249 26.928   106.551 1.00 23.33 ? 375  GLU C OE2 1 
ATOM   8140  N  N   . MET C  1 291 ? -26.066 27.784   102.359 1.00 17.12 ? 376  MET C N   1 
ATOM   8141  C  CA  . MET C  1 291 ? -26.582 27.982   101.014 1.00 17.98 ? 376  MET C CA  1 
ATOM   8142  C  C   . MET C  1 291 ? -27.516 26.819   100.766 1.00 19.93 ? 376  MET C C   1 
ATOM   8143  O  O   . MET C  1 291 ? -27.151 25.656   100.975 1.00 20.75 ? 376  MET C O   1 
ATOM   8144  C  CB  . MET C  1 291 ? -25.464 27.960   99.979  1.00 18.39 ? 376  MET C CB  1 
ATOM   8145  C  CG  . MET C  1 291 ? -24.583 29.188   99.993  1.00 19.53 ? 376  MET C CG  1 
ATOM   8146  S  SD  . MET C  1 291 ? -25.560 30.678   99.729  1.00 22.78 ? 376  MET C SD  1 
ATOM   8147  C  CE  . MET C  1 291 ? -26.200 30.361   98.082  1.00 20.65 ? 376  MET C CE  1 
ATOM   8148  N  N   . ILE C  1 292 ? -28.730 27.134   100.341 1.00 20.62 ? 377  ILE C N   1 
ATOM   8149  C  CA  . ILE C  1 292 ? -29.716 26.111   100.062 1.00 20.40 ? 377  ILE C CA  1 
ATOM   8150  C  C   . ILE C  1 292 ? -30.176 26.202   98.619  1.00 21.23 ? 377  ILE C C   1 
ATOM   8151  O  O   . ILE C  1 292 ? -30.392 27.289   98.086  1.00 22.15 ? 377  ILE C O   1 
ATOM   8152  C  CB  . ILE C  1 292 ? -30.925 26.246   101.000 1.00 20.11 ? 377  ILE C CB  1 
ATOM   8153  C  CG1 . ILE C  1 292 ? -30.490 25.913   102.428 1.00 19.88 ? 377  ILE C CG1 1 
ATOM   8154  C  CG2 . ILE C  1 292 ? -32.055 25.338   100.538 1.00 19.82 ? 377  ILE C CG2 1 
ATOM   8155  C  CD1 . ILE C  1 292 ? -31.512 26.248   103.479 1.00 21.13 ? 377  ILE C CD1 1 
ATOM   8156  N  N   . TRP C  1 293 ? -30.288 25.044   97.984  1.00 20.78 ? 378  TRP C N   1 
ATOM   8157  C  CA  . TRP C  1 293 ? -30.736 24.964   96.612  1.00 20.18 ? 378  TRP C CA  1 
ATOM   8158  C  C   . TRP C  1 293 ? -32.106 24.302   96.559  1.00 21.89 ? 378  TRP C C   1 
ATOM   8159  O  O   . TRP C  1 293 ? -32.229 23.084   96.699  1.00 19.74 ? 378  TRP C O   1 
ATOM   8160  C  CB  . TRP C  1 293 ? -29.758 24.157   95.771  1.00 18.90 ? 378  TRP C CB  1 
ATOM   8161  C  CG  . TRP C  1 293 ? -30.354 23.727   94.469  1.00 18.48 ? 378  TRP C CG  1 
ATOM   8162  C  CD1 . TRP C  1 293 ? -30.582 22.447   94.055  1.00 18.89 ? 378  TRP C CD1 1 
ATOM   8163  C  CD2 . TRP C  1 293 ? -30.834 24.579   93.422  1.00 19.29 ? 378  TRP C CD2 1 
ATOM   8164  N  NE1 . TRP C  1 293 ? -31.177 22.446   92.814  1.00 16.58 ? 378  TRP C NE1 1 
ATOM   8165  C  CE2 . TRP C  1 293 ? -31.341 23.739   92.402  1.00 17.39 ? 378  TRP C CE2 1 
ATOM   8166  C  CE3 . TRP C  1 293 ? -30.886 25.970   93.248  1.00 18.00 ? 378  TRP C CE3 1 
ATOM   8167  C  CZ2 . TRP C  1 293 ? -31.892 24.248   91.222  1.00 16.59 ? 378  TRP C CZ2 1 
ATOM   8168  C  CZ3 . TRP C  1 293 ? -31.436 26.475   92.082  1.00 16.95 ? 378  TRP C CZ3 1 
ATOM   8169  C  CH2 . TRP C  1 293 ? -31.933 25.614   91.081  1.00 18.06 ? 378  TRP C CH2 1 
ATOM   8170  N  N   . ASP C  1 294 ? -33.131 25.128   96.380  1.00 24.13 ? 379  ASP C N   1 
ATOM   8171  C  CA  . ASP C  1 294 ? -34.501 24.664   96.271  1.00 26.13 ? 379  ASP C CA  1 
ATOM   8172  C  C   . ASP C  1 294 ? -34.897 24.834   94.827  1.00 26.46 ? 379  ASP C C   1 
ATOM   8173  O  O   . ASP C  1 294 ? -35.222 25.932   94.394  1.00 26.77 ? 379  ASP C O   1 
ATOM   8174  C  CB  . ASP C  1 294 ? -35.440 25.482   97.165  1.00 26.54 ? 379  ASP C CB  1 
ATOM   8175  C  CG  . ASP C  1 294 ? -36.921 25.177   96.919  1.00 29.54 ? 379  ASP C CG  1 
ATOM   8176  O  OD1 . ASP C  1 294 ? -37.280 24.055   96.501  1.00 32.75 ? 379  ASP C OD1 1 
ATOM   8177  O  OD2 . ASP C  1 294 ? -37.749 26.071   97.168  1.00 32.70 ? 379  ASP C OD2 1 
ATOM   8178  N  N   . PRO C  1 295 ? -34.827 23.751   94.042  1.00 27.74 ? 380  PRO C N   1 
ATOM   8179  C  CA  . PRO C  1 295 ? -35.219 23.898   92.639  1.00 28.82 ? 380  PRO C CA  1 
ATOM   8180  C  C   . PRO C  1 295 ? -36.675 24.308   92.703  1.00 30.27 ? 380  PRO C C   1 
ATOM   8181  O  O   . PRO C  1 295 ? -37.241 24.352   93.793  1.00 32.61 ? 380  PRO C O   1 
ATOM   8182  C  CB  . PRO C  1 295 ? -35.026 22.488   92.080  1.00 27.78 ? 380  PRO C CB  1 
ATOM   8183  C  CG  . PRO C  1 295 ? -35.267 21.605   93.278  1.00 25.87 ? 380  PRO C CG  1 
ATOM   8184  C  CD  . PRO C  1 295 ? -34.548 22.343   94.377  1.00 27.37 ? 380  PRO C CD  1 
ATOM   8185  N  N   . ASN C  1 296 ? -37.286 24.622   91.573  1.00 31.10 ? 381  ASN C N   1 
ATOM   8186  C  CA  . ASN C  1 296 ? -38.701 24.998   91.594  1.00 34.47 ? 381  ASN C CA  1 
ATOM   8187  C  C   . ASN C  1 296 ? -39.128 25.482   92.998  1.00 33.21 ? 381  ASN C C   1 
ATOM   8188  O  O   . ASN C  1 296 ? -39.882 24.786   93.695  1.00 33.95 ? 381  ASN C O   1 
ATOM   8189  C  CB  . ASN C  1 296 ? -39.563 23.785   91.182  1.00 37.83 ? 381  ASN C CB  1 
ATOM   8190  C  CG  . ASN C  1 296 ? -39.060 23.098   89.892  1.00 40.35 ? 381  ASN C CG  1 
ATOM   8191  O  OD1 . ASN C  1 296 ? -39.085 23.681   88.799  1.00 36.67 ? 381  ASN C OD1 1 
ATOM   8192  N  ND2 . ASN C  1 296 ? -38.601 21.847   90.028  1.00 40.68 ? 381  ASN C ND2 1 
ATOM   8193  N  N   . GLY C  1 297 ? -38.619 26.652   93.399  1.00 31.49 ? 382  GLY C N   1 
ATOM   8194  C  CA  . GLY C  1 297 ? -38.908 27.236   94.705  1.00 29.32 ? 382  GLY C CA  1 
ATOM   8195  C  C   . GLY C  1 297 ? -38.972 28.765   94.715  1.00 28.72 ? 382  GLY C C   1 
ATOM   8196  O  O   . GLY C  1 297 ? -39.213 29.402   95.743  1.00 27.80 ? 382  GLY C O   1 
ATOM   8197  N  N   . TRP C  1 298 ? -38.744 29.359   93.551  1.00 27.19 ? 383  TRP C N   1 
ATOM   8198  C  CA  . TRP C  1 298 ? -38.798 30.802   93.371  1.00 25.41 ? 383  TRP C CA  1 
ATOM   8199  C  C   . TRP C  1 298 ? -40.257 31.128   93.087  1.00 27.12 ? 383  TRP C C   1 
ATOM   8200  O  O   . TRP C  1 298 ? -40.754 32.195   93.437  1.00 27.25 ? 383  TRP C O   1 
ATOM   8201  C  CB  . TRP C  1 298 ? -37.907 31.181   92.179  1.00 23.16 ? 383  TRP C CB  1 
ATOM   8202  C  CG  . TRP C  1 298 ? -38.016 32.583   91.672  1.00 20.93 ? 383  TRP C CG  1 
ATOM   8203  C  CD1 . TRP C  1 298 ? -38.975 33.083   90.842  1.00 21.39 ? 383  TRP C CD1 1 
ATOM   8204  C  CD2 . TRP C  1 298 ? -37.125 33.665   91.947  1.00 20.65 ? 383  TRP C CD2 1 
ATOM   8205  N  NE1 . TRP C  1 298 ? -38.739 34.411   90.582  1.00 18.67 ? 383  TRP C NE1 1 
ATOM   8206  C  CE2 . TRP C  1 298 ? -37.607 34.798   91.256  1.00 19.03 ? 383  TRP C CE2 1 
ATOM   8207  C  CE3 . TRP C  1 298 ? -35.963 33.796   92.721  1.00 21.38 ? 383  TRP C CE3 1 
ATOM   8208  C  CZ2 . TRP C  1 298 ? -36.975 36.037   91.305  1.00 19.08 ? 383  TRP C CZ2 1 
ATOM   8209  C  CZ3 . TRP C  1 298 ? -35.329 35.032   92.773  1.00 21.22 ? 383  TRP C CZ3 1 
ATOM   8210  C  CH2 . TRP C  1 298 ? -35.840 36.137   92.072  1.00 20.53 ? 383  TRP C CH2 1 
ATOM   8211  N  N   . THR C  1 299 ? -40.938 30.167   92.469  1.00 28.47 ? 384  THR C N   1 
ATOM   8212  C  CA  . THR C  1 299 ? -42.337 30.300   92.096  1.00 30.50 ? 384  THR C CA  1 
ATOM   8213  C  C   . THR C  1 299 ? -43.263 29.356   92.873  1.00 31.71 ? 384  THR C C   1 
ATOM   8214  O  O   . THR C  1 299 ? -44.486 29.422   92.737  1.00 32.36 ? 384  THR C O   1 
ATOM   8215  C  CB  . THR C  1 299 ? -42.520 30.022   90.590  1.00 30.89 ? 384  THR C CB  1 
ATOM   8216  O  OG1 . THR C  1 299 ? -42.192 28.654   90.309  1.00 32.92 ? 384  THR C OG1 1 
ATOM   8217  C  CG2 . THR C  1 299 ? -41.609 30.919   89.771  1.00 30.73 ? 384  THR C CG2 1 
ATOM   8218  N  N   . GLU C  1 300 ? -42.690 28.480   93.686  1.00 32.10 ? 385  GLU C N   1 
ATOM   8219  C  CA  . GLU C  1 300 ? -43.505 27.542   94.440  1.00 32.88 ? 385  GLU C CA  1 
ATOM   8220  C  C   . GLU C  1 300 ? -43.349 27.702   95.934  1.00 33.37 ? 385  GLU C C   1 
ATOM   8221  O  O   . GLU C  1 300 ? -42.424 28.344   96.421  1.00 33.48 ? 385  GLU C O   1 
ATOM   8222  C  CB  . GLU C  1 300 ? -43.154 26.099   94.066  1.00 35.50 ? 385  GLU C CB  1 
ATOM   8223  C  CG  . GLU C  1 300 ? -43.437 25.723   92.626  1.00 37.54 ? 385  GLU C CG  1 
ATOM   8224  C  CD  . GLU C  1 300 ? -44.896 25.858   92.268  1.00 40.11 ? 385  GLU C CD  1 
ATOM   8225  O  OE1 . GLU C  1 300 ? -45.741 25.248   92.961  1.00 42.42 ? 385  GLU C OE1 1 
ATOM   8226  O  OE2 . GLU C  1 300 ? -45.197 26.571   91.287  1.00 42.32 ? 385  GLU C OE2 1 
ATOM   8227  N  N   . THR C  1 301 ? -44.267 27.092   96.661  1.00 34.97 ? 386  THR C N   1 
ATOM   8228  C  CA  . THR C  1 301 ? -44.244 27.143   98.104  1.00 36.68 ? 386  THR C CA  1 
ATOM   8229  C  C   . THR C  1 301 ? -43.984 25.746   98.650  1.00 38.56 ? 386  THR C C   1 
ATOM   8230  O  O   . THR C  1 301 ? -44.799 24.846   98.486  1.00 40.67 ? 386  THR C O   1 
ATOM   8231  C  CB  . THR C  1 301 ? -45.576 27.627   98.648  1.00 36.24 ? 386  THR C CB  1 
ATOM   8232  O  OG1 . THR C  1 301 ? -45.916 28.884   98.050  1.00 33.70 ? 386  THR C OG1 1 
ATOM   8233  C  CG2 . THR C  1 301 ? -45.476 27.777   100.137 1.00 38.19 ? 386  THR C CG2 1 
ATOM   8234  N  N   . ASP C  1 302 ? -42.838 25.556   99.281  1.00 40.73 ? 387  ASP C N   1 
ATOM   8235  C  CA  . ASP C  1 302 ? -42.498 24.261   99.850  1.00 42.41 ? 387  ASP C CA  1 
ATOM   8236  C  C   . ASP C  1 302 ? -41.694 24.494   101.093 1.00 42.34 ? 387  ASP C C   1 
ATOM   8237  O  O   . ASP C  1 302 ? -41.585 25.608   101.575 1.00 45.30 ? 387  ASP C O   1 
ATOM   8238  C  CB  . ASP C  1 302 ? -41.639 23.418   98.903  1.00 44.48 ? 387  ASP C CB  1 
ATOM   8239  C  CG  . ASP C  1 302 ? -42.406 22.906   97.719  1.00 45.81 ? 387  ASP C CG  1 
ATOM   8240  O  OD1 . ASP C  1 302 ? -43.547 22.443   97.908  1.00 47.30 ? 387  ASP C OD1 1 
ATOM   8241  O  OD2 . ASP C  1 302 ? -41.861 22.954   96.600  1.00 49.27 ? 387  ASP C OD2 1 
ATOM   8242  N  N   . SER C  1 303 ? -41.125 23.421   101.608 1.00 41.49 ? 388  SER C N   1 
ATOM   8243  C  CA  . SER C  1 303 ? -40.289 23.494   102.785 1.00 40.40 ? 388  SER C CA  1 
ATOM   8244  C  C   . SER C  1 303 ? -39.150 22.614   102.348 1.00 38.47 ? 388  SER C C   1 
ATOM   8245  O  O   . SER C  1 303 ? -38.130 22.507   103.026 1.00 39.58 ? 388  SER C O   1 
ATOM   8246  C  CB  . SER C  1 303 ? -40.987 22.865   103.993 1.00 41.38 ? 388  SER C CB  1 
ATOM   8247  O  OG  . SER C  1 303 ? -42.327 23.315   104.110 1.00 44.07 ? 388  SER C OG  1 
ATOM   8248  N  N   . SER C  1 304 ? -39.342 21.989   101.189 1.00 35.28 ? 389  SER C N   1 
ATOM   8249  C  CA  . SER C  1 304 ? -38.352 21.076   100.654 1.00 33.92 ? 389  SER C CA  1 
ATOM   8250  C  C   . SER C  1 304 ? -37.486 21.673   99.563  1.00 32.22 ? 389  SER C C   1 
ATOM   8251  O  O   . SER C  1 304 ? -37.937 22.490   98.752  1.00 32.39 ? 389  SER C O   1 
ATOM   8252  C  CB  . SER C  1 304 ? -39.027 19.797   100.155 1.00 32.73 ? 389  SER C CB  1 
ATOM   8253  O  OG  . SER C  1 304 ? -39.902 20.073   99.080  1.00 34.14 ? 389  SER C OG  1 
ATOM   8254  N  N   . PHE C  1 305 ? -36.234 21.221   99.572  1.00 30.91 ? 390  PHE C N   1 
ATOM   8255  C  CA  . PHE C  1 305 ? -35.177 21.642   98.662  1.00 28.53 ? 390  PHE C CA  1 
ATOM   8256  C  C   . PHE C  1 305 ? -34.215 20.452   98.565  1.00 27.71 ? 390  PHE C C   1 
ATOM   8257  O  O   . PHE C  1 305 ? -34.253 19.566   99.413  1.00 25.11 ? 390  PHE C O   1 
ATOM   8258  C  CB  . PHE C  1 305 ? -34.457 22.826   99.285  1.00 27.15 ? 390  PHE C CB  1 
ATOM   8259  C  CG  . PHE C  1 305 ? -33.880 22.520   100.630 1.00 24.15 ? 390  PHE C CG  1 
ATOM   8260  C  CD1 . PHE C  1 305 ? -32.616 21.950   100.743 1.00 23.65 ? 390  PHE C CD1 1 
ATOM   8261  C  CD2 . PHE C  1 305 ? -34.625 22.735   101.784 1.00 23.19 ? 390  PHE C CD2 1 
ATOM   8262  C  CE1 . PHE C  1 305 ? -32.100 21.599   101.987 1.00 21.70 ? 390  PHE C CE1 1 
ATOM   8263  C  CE2 . PHE C  1 305 ? -34.118 22.388   103.031 1.00 22.62 ? 390  PHE C CE2 1 
ATOM   8264  C  CZ  . PHE C  1 305 ? -32.851 21.815   103.132 1.00 21.07 ? 390  PHE C CZ  1 
ATOM   8265  N  N   . SER C  1 306 ? -33.337 20.436   97.566  1.00 27.78 ? 391  SER C N   1 
ATOM   8266  C  CA  . SER C  1 306 ? -32.420 19.310   97.421  1.00 28.85 ? 391  SER C CA  1 
ATOM   8267  C  C   . SER C  1 306 ? -31.019 19.436   97.994  1.00 29.36 ? 391  SER C C   1 
ATOM   8268  O  O   . SER C  1 306 ? -30.414 18.419   98.325  1.00 29.93 ? 391  SER C O   1 
ATOM   8269  C  CB  . SER C  1 306 ? -32.313 18.897   95.953  1.00 29.35 ? 391  SER C CB  1 
ATOM   8270  O  OG  . SER C  1 306 ? -32.611 19.974   95.090  1.00 30.19 ? 391  SER C OG  1 
ATOM   8271  N  N   . VAL C  1 307 ? -30.491 20.655   98.117  1.00 29.06 ? 392  VAL C N   1 
ATOM   8272  C  CA  . VAL C  1 307 ? -29.134 20.818   98.642  1.00 25.91 ? 392  VAL C CA  1 
ATOM   8273  C  C   . VAL C  1 307 ? -28.970 21.923   99.664  1.00 24.84 ? 392  VAL C C   1 
ATOM   8274  O  O   . VAL C  1 307 ? -29.555 22.992   99.547  1.00 25.19 ? 392  VAL C O   1 
ATOM   8275  C  CB  . VAL C  1 307 ? -28.115 21.079   97.513  1.00 26.44 ? 392  VAL C CB  1 
ATOM   8276  C  CG1 . VAL C  1 307 ? -26.700 21.127   98.084  1.00 24.98 ? 392  VAL C CG1 1 
ATOM   8277  C  CG2 . VAL C  1 307 ? -28.228 20.005   96.451  1.00 26.11 ? 392  VAL C CG2 1 
ATOM   8278  N  N   . LYS C  1 308 ? -28.147 21.640   100.665 1.00 24.52 ? 394  LYS C N   1 
ATOM   8279  C  CA  . LYS C  1 308 ? -27.846 22.573   101.734 1.00 24.60 ? 394  LYS C CA  1 
ATOM   8280  C  C   . LYS C  1 308 ? -26.342 22.505   101.898 1.00 23.96 ? 394  LYS C C   1 
ATOM   8281  O  O   . LYS C  1 308 ? -25.782 21.424   102.041 1.00 24.87 ? 394  LYS C O   1 
ATOM   8282  C  CB  . LYS C  1 308 ? -28.506 22.119   103.028 1.00 25.51 ? 394  LYS C CB  1 
ATOM   8283  C  CG  . LYS C  1 308 ? -28.368 23.069   104.200 1.00 29.22 ? 394  LYS C CG  1 
ATOM   8284  C  CD  . LYS C  1 308 ? -28.670 22.317   105.492 1.00 34.27 ? 394  LYS C CD  1 
ATOM   8285  C  CE  . LYS C  1 308 ? -29.057 23.246   106.641 1.00 37.28 ? 394  LYS C CE  1 
ATOM   8286  N  NZ  . LYS C  1 308 ? -30.449 23.787   106.526 1.00 37.89 ? 394  LYS C NZ  1 
ATOM   8287  N  N   . GLN C  1 309 ? -25.686 23.651   101.858 1.00 22.57 ? 395  GLN C N   1 
ATOM   8288  C  CA  . GLN C  1 309 ? -24.249 23.689   102.024 1.00 20.99 ? 395  GLN C CA  1 
ATOM   8289  C  C   . GLN C  1 309 ? -23.950 24.646   103.154 1.00 22.03 ? 395  GLN C C   1 
ATOM   8290  O  O   . GLN C  1 309 ? -24.187 25.846   103.024 1.00 22.97 ? 395  GLN C O   1 
ATOM   8291  C  CB  . GLN C  1 309 ? -23.578 24.185   100.751 1.00 20.21 ? 395  GLN C CB  1 
ATOM   8292  C  CG  . GLN C  1 309 ? -22.091 24.424   100.916 1.00 17.68 ? 395  GLN C CG  1 
ATOM   8293  C  CD  . GLN C  1 309 ? -21.397 24.661   99.599  1.00 18.41 ? 395  GLN C CD  1 
ATOM   8294  O  OE1 . GLN C  1 309 ? -20.181 24.838   99.558  1.00 18.48 ? 395  GLN C OE1 1 
ATOM   8295  N  NE2 . GLN C  1 309 ? -22.162 24.658   98.508  1.00 17.58 ? 395  GLN C NE2 1 
ATOM   8296  N  N   . ASP C  1 310 ? -23.441 24.126   104.265 1.00 22.39 ? 396  ASP C N   1 
ATOM   8297  C  CA  . ASP C  1 310 ? -23.125 24.975   105.405 1.00 22.43 ? 396  ASP C CA  1 
ATOM   8298  C  C   . ASP C  1 310 ? -21.969 25.912   105.076 1.00 21.88 ? 396  ASP C C   1 
ATOM   8299  O  O   . ASP C  1 310 ? -21.092 25.578   104.275 1.00 20.54 ? 396  ASP C O   1 
ATOM   8300  C  CB  . ASP C  1 310 ? -22.744 24.133   106.620 1.00 24.73 ? 396  ASP C CB  1 
ATOM   8301  C  CG  . ASP C  1 310 ? -23.807 23.125   106.990 1.00 28.69 ? 396  ASP C CG  1 
ATOM   8302  O  OD1 . ASP C  1 310 ? -25.010 23.462   106.952 1.00 31.16 ? 396  ASP C OD1 1 
ATOM   8303  O  OD2 . ASP C  1 310 ? -23.435 21.987   107.337 1.00 32.56 ? 396  ASP C OD2 1 
ATOM   8304  N  N   . ILE C  1 311 ? -21.971 27.084   105.694 1.00 19.74 ? 397  ILE C N   1 
ATOM   8305  C  CA  . ILE C  1 311 ? -20.908 28.047   105.471 1.00 19.30 ? 397  ILE C CA  1 
ATOM   8306  C  C   . ILE C  1 311 ? -20.407 28.591   106.795 1.00 18.78 ? 397  ILE C C   1 
ATOM   8307  O  O   . ILE C  1 311 ? -19.209 28.760   107.000 1.00 19.16 ? 397  ILE C O   1 
ATOM   8308  C  CB  . ILE C  1 311 ? -21.399 29.147   104.540 1.00 19.16 ? 397  ILE C CB  1 
ATOM   8309  C  CG1 . ILE C  1 311 ? -21.466 28.564   103.126 1.00 20.59 ? 397  ILE C CG1 1 
ATOM   8310  C  CG2 . ILE C  1 311 ? -20.478 30.349   104.588 1.00 18.10 ? 397  ILE C CG2 1 
ATOM   8311  C  CD1 . ILE C  1 311 ? -22.369 29.297   102.211 1.00 26.34 ? 397  ILE C CD1 1 
ATOM   8312  N  N   . VAL C  1 312 ? -21.334 28.830   107.707 1.00 18.67 ? 398  VAL C N   1 
ATOM   8313  C  CA  . VAL C  1 312 ? -20.995 29.305   109.036 1.00 19.51 ? 398  VAL C CA  1 
ATOM   8314  C  C   . VAL C  1 312 ? -21.903 28.558   110.013 1.00 19.43 ? 398  VAL C C   1 
ATOM   8315  O  O   . VAL C  1 312 ? -23.116 28.526   109.831 1.00 18.75 ? 398  VAL C O   1 
ATOM   8316  C  CB  . VAL C  1 312 ? -21.208 30.832   109.140 1.00 20.03 ? 398  VAL C CB  1 
ATOM   8317  C  CG1 . VAL C  1 312 ? -21.052 31.300   110.588 1.00 17.77 ? 398  VAL C CG1 1 
ATOM   8318  C  CG2 . VAL C  1 312 ? -20.210 31.541   108.233 1.00 18.14 ? 398  VAL C CG2 1 
ATOM   8319  N  N   . ALA C  1 313 ? -21.306 27.941   111.029 1.00 20.72 ? 399  ALA C N   1 
ATOM   8320  C  CA  . ALA C  1 313 ? -22.056 27.183   112.036 1.00 23.19 ? 399  ALA C CA  1 
ATOM   8321  C  C   . ALA C  1 313 ? -23.013 28.068   112.834 1.00 24.89 ? 399  ALA C C   1 
ATOM   8322  O  O   . ALA C  1 313 ? -22.756 29.259   113.031 1.00 26.57 ? 399  ALA C O   1 
ATOM   8323  C  CB  . ALA C  1 313 ? -21.085 26.464   112.992 1.00 20.24 ? 399  ALA C CB  1 
ATOM   8324  N  N   . ILE C  1 314 ? -24.108 27.479   113.303 1.00 26.04 ? 400  ILE C N   1 
ATOM   8325  C  CA  . ILE C  1 314 ? -25.098 28.221   114.074 1.00 27.79 ? 400  ILE C CA  1 
ATOM   8326  C  C   . ILE C  1 314 ? -24.465 28.781   115.336 1.00 27.09 ? 400  ILE C C   1 
ATOM   8327  O  O   . ILE C  1 314 ? -25.011 29.692   115.951 1.00 27.87 ? 400  ILE C O   1 
ATOM   8328  C  CB  . ILE C  1 314 ? -26.296 27.320   114.506 1.00 31.11 ? 400  ILE C CB  1 
ATOM   8329  C  CG1 . ILE C  1 314 ? -26.621 26.316   113.402 1.00 33.53 ? 400  ILE C CG1 1 
ATOM   8330  C  CG2 . ILE C  1 314 ? -27.544 28.180   114.774 1.00 30.41 ? 400  ILE C CG2 1 
ATOM   8331  C  CD1 . ILE C  1 314 ? -27.817 25.431   113.714 1.00 37.92 ? 400  ILE C CD1 1 
ATOM   8332  N  N   . THR C  1 315 ? -23.318 28.239   115.732 1.00 25.69 ? 401  THR C N   1 
ATOM   8333  C  CA  . THR C  1 315 ? -22.662 28.711   116.948 1.00 24.67 ? 401  THR C CA  1 
ATOM   8334  C  C   . THR C  1 315 ? -21.792 29.930   116.713 1.00 22.84 ? 401  THR C C   1 
ATOM   8335  O  O   . THR C  1 315 ? -21.174 30.441   117.641 1.00 22.63 ? 401  THR C O   1 
ATOM   8336  C  CB  . THR C  1 315 ? -21.784 27.614   117.584 1.00 25.65 ? 401  THR C CB  1 
ATOM   8337  O  OG1 . THR C  1 315 ? -20.768 27.205   116.658 1.00 27.90 ? 401  THR C OG1 1 
ATOM   8338  C  CG2 . THR C  1 315 ? -22.628 26.418   117.957 1.00 24.78 ? 401  THR C CG2 1 
ATOM   8339  N  N   . ASP C  1 316 ? -21.735 30.398   115.475 1.00 21.61 ? 402  ASP C N   1 
ATOM   8340  C  CA  . ASP C  1 316 ? -20.917 31.564   115.166 1.00 21.50 ? 402  ASP C CA  1 
ATOM   8341  C  C   . ASP C  1 316 ? -21.707 32.676   114.494 1.00 20.26 ? 402  ASP C C   1 
ATOM   8342  O  O   . ASP C  1 316 ? -22.593 32.429   113.673 1.00 19.93 ? 402  ASP C O   1 
ATOM   8343  C  CB  . ASP C  1 316 ? -19.727 31.155   114.298 1.00 21.51 ? 402  ASP C CB  1 
ATOM   8344  C  CG  . ASP C  1 316 ? -18.661 30.422   115.089 1.00 24.32 ? 402  ASP C CG  1 
ATOM   8345  O  OD1 . ASP C  1 316 ? -17.992 31.076   115.924 1.00 25.84 ? 402  ASP C OD1 1 
ATOM   8346  O  OD2 . ASP C  1 316 ? -18.498 29.195   114.887 1.00 25.70 ? 402  ASP C OD2 1 
ATOM   8347  N  N   . TRP C  1 317 ? -21.373 33.907   114.851 1.00 18.17 ? 403  TRP C N   1 
ATOM   8348  C  CA  . TRP C  1 317 ? -22.056 35.065   114.306 1.00 16.96 ? 403  TRP C CA  1 
ATOM   8349  C  C   . TRP C  1 317 ? -21.837 35.302   112.814 1.00 16.62 ? 403  TRP C C   1 
ATOM   8350  O  O   . TRP C  1 317 ? -20.733 35.111   112.288 1.00 16.80 ? 403  TRP C O   1 
ATOM   8351  C  CB  . TRP C  1 317 ? -21.616 36.313   115.063 1.00 16.92 ? 403  TRP C CB  1 
ATOM   8352  C  CG  . TRP C  1 317 ? -21.845 36.237   116.543 1.00 17.91 ? 403  TRP C CG  1 
ATOM   8353  C  CD1 . TRP C  1 317 ? -20.891 36.245   117.525 1.00 17.69 ? 403  TRP C CD1 1 
ATOM   8354  C  CD2 . TRP C  1 317 ? -23.108 36.198   117.213 1.00 16.23 ? 403  TRP C CD2 1 
ATOM   8355  N  NE1 . TRP C  1 317 ? -21.488 36.221   118.764 1.00 19.00 ? 403  TRP C NE1 1 
ATOM   8356  C  CE2 . TRP C  1 317 ? -22.851 36.190   118.601 1.00 17.16 ? 403  TRP C CE2 1 
ATOM   8357  C  CE3 . TRP C  1 317 ? -24.439 36.171   116.777 1.00 15.76 ? 403  TRP C CE3 1 
ATOM   8358  C  CZ2 . TRP C  1 317 ? -23.872 36.157   119.557 1.00 17.13 ? 403  TRP C CZ2 1 
ATOM   8359  C  CZ3 . TRP C  1 317 ? -25.461 36.138   117.730 1.00 15.03 ? 403  TRP C CZ3 1 
ATOM   8360  C  CH2 . TRP C  1 317 ? -25.170 36.132   119.100 1.00 15.06 ? 403  TRP C CH2 1 
ATOM   8361  N  N   . SER C  1 318 ? -22.906 35.711   112.137 1.00 14.42 ? 404  SER C N   1 
ATOM   8362  C  CA  . SER C  1 318 ? -22.834 36.050   110.722 1.00 14.23 ? 404  SER C CA  1 
ATOM   8363  C  C   . SER C  1 318 ? -23.347 37.492   110.618 1.00 13.91 ? 404  SER C C   1 
ATOM   8364  O  O   . SER C  1 318 ? -23.087 38.305   111.503 1.00 15.12 ? 404  SER C O   1 
ATOM   8365  C  CB  . SER C  1 318 ? -23.688 35.094   109.871 1.00 13.62 ? 404  SER C CB  1 
ATOM   8366  O  OG  . SER C  1 318 ? -25.068 35.224   110.169 1.00 14.97 ? 404  SER C OG  1 
ATOM   8367  N  N   . GLY C  1 319 ? -24.077 37.812   109.558 1.00 13.19 ? 405  GLY C N   1 
ATOM   8368  C  CA  . GLY C  1 319 ? -24.588 39.159   109.408 1.00 11.39 ? 405  GLY C CA  1 
ATOM   8369  C  C   . GLY C  1 319 ? -25.093 39.379   107.999 1.00 12.51 ? 405  GLY C C   1 
ATOM   8370  O  O   . GLY C  1 319 ? -25.744 38.508   107.413 1.00 13.06 ? 405  GLY C O   1 
ATOM   8371  N  N   . TYR C  1 320 ? -24.802 40.554   107.454 1.00 13.21 ? 406  TYR C N   1 
ATOM   8372  C  CA  . TYR C  1 320 ? -25.211 40.898   106.100 1.00 13.40 ? 406  TYR C CA  1 
ATOM   8373  C  C   . TYR C  1 320 ? -24.525 39.948   105.138 1.00 12.66 ? 406  TYR C C   1 
ATOM   8374  O  O   . TYR C  1 320 ? -23.461 39.419   105.427 1.00 13.56 ? 406  TYR C O   1 
ATOM   8375  C  CB  . TYR C  1 320 ? -24.763 42.323   105.765 1.00 15.80 ? 406  TYR C CB  1 
ATOM   8376  C  CG  . TYR C  1 320 ? -25.699 43.425   106.201 1.00 18.67 ? 406  TYR C CG  1 
ATOM   8377  C  CD1 . TYR C  1 320 ? -26.531 43.270   107.311 1.00 19.29 ? 406  TYR C CD1 1 
ATOM   8378  C  CD2 . TYR C  1 320 ? -25.744 44.639   105.505 1.00 19.36 ? 406  TYR C CD2 1 
ATOM   8379  C  CE1 . TYR C  1 320 ? -27.389 44.296   107.714 1.00 20.62 ? 406  TYR C CE1 1 
ATOM   8380  C  CE2 . TYR C  1 320 ? -26.593 45.671   105.902 1.00 18.45 ? 406  TYR C CE2 1 
ATOM   8381  C  CZ  . TYR C  1 320 ? -27.414 45.490   107.007 1.00 19.74 ? 406  TYR C CZ  1 
ATOM   8382  O  OH  . TYR C  1 320 ? -28.278 46.485   107.404 1.00 20.63 ? 406  TYR C OH  1 
ATOM   8383  N  N   . SER C  1 321 ? -25.142 39.722   103.994 1.00 12.08 ? 407  SER C N   1 
ATOM   8384  C  CA  . SER C  1 321 ? -24.547 38.877   102.973 1.00 12.52 ? 407  SER C CA  1 
ATOM   8385  C  C   . SER C  1 321 ? -25.085 39.495   101.701 1.00 13.40 ? 407  SER C C   1 
ATOM   8386  O  O   . SER C  1 321 ? -26.142 40.122   101.724 1.00 14.06 ? 407  SER C O   1 
ATOM   8387  C  CB  . SER C  1 321 ? -24.992 37.406   103.114 1.00 12.85 ? 407  SER C CB  1 
ATOM   8388  O  OG  . SER C  1 321 ? -26.311 37.175   102.661 1.00 9.64  ? 407  SER C OG  1 
ATOM   8389  N  N   . GLY C  1 322 ? -24.357 39.360   100.602 1.00 12.44 ? 408  GLY C N   1 
ATOM   8390  C  CA  . GLY C  1 322 ? -24.830 39.949   99.368  1.00 11.59 ? 408  GLY C CA  1 
ATOM   8391  C  C   . GLY C  1 322 ? -24.241 39.247   98.177  1.00 12.73 ? 408  GLY C C   1 
ATOM   8392  O  O   . GLY C  1 322 ? -23.331 38.434   98.309  1.00 14.09 ? 408  GLY C O   1 
ATOM   8393  N  N   . SER C  1 323 ? -24.752 39.549   96.998  1.00 13.16 ? 409  SER C N   1 
ATOM   8394  C  CA  . SER C  1 323 ? -24.224 38.908   95.815  1.00 14.50 ? 409  SER C CA  1 
ATOM   8395  C  C   . SER C  1 323 ? -23.304 39.816   95.025  1.00 15.64 ? 409  SER C C   1 
ATOM   8396  O  O   . SER C  1 323 ? -23.475 41.033   95.000  1.00 14.85 ? 409  SER C O   1 
ATOM   8397  C  CB  . SER C  1 323 ? -25.359 38.474   94.896  1.00 14.20 ? 409  SER C CB  1 
ATOM   8398  O  OG  . SER C  1 323 ? -26.061 39.600   94.405  1.00 16.96 ? 409  SER C OG  1 
ATOM   8399  N  N   . PHE C  1 324 ? -22.301 39.209   94.406  1.00 16.72 ? 410  PHE C N   1 
ATOM   8400  C  CA  . PHE C  1 324 ? -21.425 39.938   93.517  1.00 18.23 ? 410  PHE C CA  1 
ATOM   8401  C  C   . PHE C  1 324 ? -21.162 39.021   92.333  1.00 19.98 ? 410  PHE C C   1 
ATOM   8402  O  O   . PHE C  1 324 ? -21.218 37.796   92.437  1.00 20.59 ? 410  PHE C O   1 
ATOM   8403  C  CB  . PHE C  1 324 ? -20.125 40.427   94.192  1.00 16.47 ? 410  PHE C CB  1 
ATOM   8404  C  CG  . PHE C  1 324 ? -19.124 39.353   94.514  1.00 16.24 ? 410  PHE C CG  1 
ATOM   8405  C  CD1 . PHE C  1 324 ? -19.210 38.627   95.703  1.00 16.36 ? 410  PHE C CD1 1 
ATOM   8406  C  CD2 . PHE C  1 324 ? -18.032 39.138   93.672  1.00 13.55 ? 410  PHE C CD2 1 
ATOM   8407  C  CE1 . PHE C  1 324 ? -18.214 37.707   96.049  1.00 16.53 ? 410  PHE C CE1 1 
ATOM   8408  C  CE2 . PHE C  1 324 ? -17.035 38.228   94.002  1.00 12.15 ? 410  PHE C CE2 1 
ATOM   8409  C  CZ  . PHE C  1 324 ? -17.120 37.512   95.193  1.00 15.54 ? 410  PHE C CZ  1 
ATOM   8410  N  N   . VAL C  1 325 ? -20.711 39.569   91.231  1.00 22.47 ? 411  VAL C N   1 
ATOM   8411  C  CA  . VAL C  1 325 ? -20.725 38.922   89.889  1.00 23.18 ? 411  VAL C CA  1 
ATOM   8412  C  C   . VAL C  1 325 ? -19.266 38.961   89.345  1.00 24.64 ? 411  VAL C C   1 
ATOM   8413  O  O   . VAL C  1 325 ? -18.394 39.757   89.769  1.00 28.87 ? 411  VAL C O   1 
ATOM   8414  C  CB  . VAL C  1 325 ? -21.677 39.761   89.014  1.00 24.13 ? 411  VAL C CB  1 
ATOM   8415  C  CG1 . VAL C  1 325 ? -21.232 39.263   87.530  1.00 24.54 ? 411  VAL C CG1 1 
ATOM   8416  C  CG2 . VAL C  1 325 ? -22.956 38.281   89.086  1.00 20.73 ? 411  VAL C CG2 1 
ATOM   8417  N  N   . GLN C  1 326 ? -18.968 38.035   88.427  1.00 20.22 ? 412  GLN C N   1 
ATOM   8418  C  CA  . GLN C  1 326 ? -17.633 37.818   87.897  1.00 20.90 ? 412  GLN C CA  1 
ATOM   8419  C  C   . GLN C  1 326 ? -17.442 38.350   86.504  1.00 20.79 ? 412  GLN C C   1 
ATOM   8420  O  O   . GLN C  1 326 ? -16.330 38.676   86.112  1.00 22.02 ? 412  GLN C O   1 
ATOM   8421  C  CB  . GLN C  1 326 ? -17.294 36.326   87.892  1.00 20.24 ? 412  GLN C CB  1 
ATOM   8422  C  CG  . GLN C  1 326 ? -17.324 35.678   89.267  1.00 21.98 ? 412  GLN C CG  1 
ATOM   8423  C  CD  . GLN C  1 326 ? -16.339 36.310   90.230  1.00 21.88 ? 412  GLN C CD  1 
ATOM   8424  O  OE1 . GLN C  1 326 ? -15.620 37.245   89.875  1.00 24.49 ? 412  GLN C OE1 1 
ATOM   8425  N  NE2 . GLN C  1 326 ? -16.317 35.814   91.462  1.00 21.35 ? 412  GLN C NE2 1 
ATOM   8426  N  N   . HIS C  1 327 A -17.887 38.805   85.702  1.00 21.00 ? 412  HIS C N   1 
ATOM   8427  C  CA  . HIS C  1 327 A -18.250 38.818   84.288  1.00 21.69 ? 412  HIS C CA  1 
ATOM   8428  C  C   . HIS C  1 327 A -17.299 38.063   83.387  1.00 21.89 ? 412  HIS C C   1 
ATOM   8429  O  O   . HIS C  1 327 A -16.127 37.879   83.697  1.00 21.94 ? 412  HIS C O   1 
ATOM   8430  C  CB  . HIS C  1 327 A -18.347 40.204   83.747  1.00 20.28 ? 412  HIS C CB  1 
ATOM   8431  C  CG  . HIS C  1 327 A -19.600 40.915   84.132  1.00 21.73 ? 412  HIS C CG  1 
ATOM   8432  N  ND1 . HIS C  1 327 A -20.636 41.145   83.238  1.00 20.95 ? 412  HIS C ND1 1 
ATOM   8433  C  CD2 . HIS C  1 327 A -20.002 41.462   85.299  1.00 22.13 ? 412  HIS C CD2 1 
ATOM   8434  C  CE1 . HIS C  1 327 A -21.602 41.794   83.843  1.00 22.34 ? 412  HIS C CE1 1 
ATOM   8435  N  NE2 . HIS C  1 327 A -21.249 42.006   85.103  1.00 23.21 ? 412  HIS C NE2 1 
ATOM   8436  N  N   . PRO C  1 328 B -17.819 37.557   82.266  1.00 22.98 ? 412  PRO C N   1 
ATOM   8437  C  CA  . PRO C  1 328 B -17.034 36.796   81.282  1.00 24.73 ? 412  PRO C CA  1 
ATOM   8438  C  C   . PRO C  1 328 B -15.845 37.611   80.766  1.00 26.37 ? 412  PRO C C   1 
ATOM   8439  O  O   . PRO C  1 328 B -14.973 37.114   80.051  1.00 28.99 ? 412  PRO C O   1 
ATOM   8440  C  CB  . PRO C  1 328 B -18.040 36.485   80.163  1.00 23.84 ? 412  PRO C CB  1 
ATOM   8441  C  CG  . PRO C  1 328 B -19.210 37.400   80.431  1.00 23.93 ? 412  PRO C CG  1 
ATOM   8442  C  CD  . PRO C  1 328 B -19.250 37.544   81.939  1.00 22.45 ? 412  PRO C CD  1 
ATOM   8443  N  N   . GLU C  1 329 C -15.805 38.887   81.089  1.00 26.70 ? 412  GLU C N   1 
ATOM   8444  C  CA  . GLU C  1 329 C -14.681 39.628   80.588  1.00 27.23 ? 412  GLU C CA  1 
ATOM   8445  C  C   . GLU C  1 329 C -13.526 39.489   81.549  1.00 27.32 ? 412  GLU C C   1 
ATOM   8446  O  O   . GLU C  1 329 C -12.398 39.594   81.108  1.00 28.07 ? 412  GLU C O   1 
ATOM   8447  C  CB  . GLU C  1 329 C -15.072 41.079   80.318  1.00 28.03 ? 412  GLU C CB  1 
ATOM   8448  C  CG  . GLU C  1 329 C -16.575 41.171   80.219  1.00 30.77 ? 412  GLU C CG  1 
ATOM   8449  C  CD  . GLU C  1 329 C -17.017 41.861   78.990  1.00 32.52 ? 412  GLU C CD  1 
ATOM   8450  O  OE1 . GLU C  1 329 C -16.278 42.770   78.555  1.00 36.08 ? 412  GLU C OE1 1 
ATOM   8451  O  OE2 . GLU C  1 329 C -18.097 41.506   78.477  1.00 31.83 ? 412  GLU C OE2 1 
ATOM   8452  N  N   . LEU C  1 330 D -13.765 39.180   82.822  1.00 25.90 ? 412  LEU C N   1 
ATOM   8453  C  CA  . LEU C  1 330 D -12.655 39.052   83.752  1.00 23.95 ? 412  LEU C CA  1 
ATOM   8454  C  C   . LEU C  1 330 D -12.183 37.623   83.888  1.00 24.39 ? 412  LEU C C   1 
ATOM   8455  O  O   . LEU C  1 330 D -11.021 37.358   84.118  1.00 24.69 ? 412  LEU C O   1 
ATOM   8456  C  CB  . LEU C  1 330 D -13.111 39.545   85.095  1.00 23.19 ? 412  LEU C CB  1 
ATOM   8457  C  CG  . LEU C  1 330 D -12.419 38.998   86.317  1.00 23.03 ? 412  LEU C CG  1 
ATOM   8458  C  CD1 . LEU C  1 330 D -11.047 39.632   86.529  1.00 21.99 ? 412  LEU C CD1 1 
ATOM   8459  C  CD2 . LEU C  1 330 D -13.342 39.257   87.468  1.00 20.59 ? 412  LEU C CD2 1 
ATOM   8460  N  N   . THR C  1 331 ? -13.134 36.717   83.717  1.00 24.87 ? 413  THR C N   1 
ATOM   8461  C  CA  . THR C  1 331 ? -12.977 35.267   83.851  1.00 24.28 ? 413  THR C CA  1 
ATOM   8462  C  C   . THR C  1 331 ? -12.576 34.482   82.596  1.00 24.31 ? 413  THR C C   1 
ATOM   8463  O  O   . THR C  1 331 ? -11.766 33.556   82.656  1.00 24.85 ? 413  THR C O   1 
ATOM   8464  C  CB  . THR C  1 331 ? -14.292 34.645   84.311  1.00 23.24 ? 413  THR C CB  1 
ATOM   8465  O  OG1 . THR C  1 331 ? -14.560 35.020   85.665  1.00 25.96 ? 413  THR C OG1 1 
ATOM   8466  C  CG2 . THR C  1 331 ? -14.257 33.173   84.133  1.00 26.10 ? 413  THR C CG2 1 
ATOM   8467  N  N   . GLY C  1 332 ? -13.161 34.832   81.462  1.00 23.49 ? 414  GLY C N   1 
ATOM   8468  C  CA  . GLY C  1 332 ? -12.885 34.123   80.235  1.00 22.57 ? 414  GLY C CA  1 
ATOM   8469  C  C   . GLY C  1 332 ? -13.977 33.097   80.011  1.00 24.56 ? 414  GLY C C   1 
ATOM   8470  O  O   . GLY C  1 332 ? -14.015 32.467   78.961  1.00 25.11 ? 414  GLY C O   1 
ATOM   8471  N  N   . LEU C  1 333 ? -14.847 32.917   81.005  1.00 26.29 ? 415  LEU C N   1 
ATOM   8472  C  CA  . LEU C  1 333 ? -15.969 31.991   80.917  1.00 26.54 ? 415  LEU C CA  1 
ATOM   8473  C  C   . LEU C  1 333 ? -16.945 32.572   79.889  1.00 27.66 ? 415  LEU C C   1 
ATOM   8474  O  O   . LEU C  1 333 ? -16.829 33.727   79.481  1.00 26.10 ? 415  LEU C O   1 
ATOM   8475  C  CB  . LEU C  1 333 ? -16.644 31.884   82.292  1.00 26.33 ? 415  LEU C CB  1 
ATOM   8476  C  CG  . LEU C  1 333 ? -16.489 30.645   83.193  1.00 27.89 ? 415  LEU C CG  1 
ATOM   8477  C  CD1 . LEU C  1 333 ? -15.141 29.967   83.001  1.00 27.14 ? 415  LEU C CD1 1 
ATOM   8478  C  CD2 . LEU C  1 333 ? -16.675 31.065   84.648  1.00 26.58 ? 415  LEU C CD2 1 
ATOM   8479  N  N   . ASP C  1 334 ? -17.910 31.770   79.470  1.00 29.95 ? 416  ASP C N   1 
ATOM   8480  C  CA  . ASP C  1 334 ? -18.907 32.211   78.494  1.00 30.98 ? 416  ASP C CA  1 
ATOM   8481  C  C   . ASP C  1 334 ? -20.194 32.601   79.217  1.00 30.81 ? 416  ASP C C   1 
ATOM   8482  O  O   . ASP C  1 334 ? -21.233 32.823   78.596  1.00 31.30 ? 416  ASP C O   1 
ATOM   8483  C  CB  . ASP C  1 334 ? -19.199 31.070   77.541  1.00 31.69 ? 416  ASP C CB  1 
ATOM   8484  C  CG  . ASP C  1 334 ? -19.528 29.800   78.281  1.00 34.75 ? 416  ASP C CG  1 
ATOM   8485  O  OD1 . ASP C  1 334 ? -18.699 29.385   79.124  1.00 35.91 ? 416  ASP C OD1 1 
ATOM   8486  O  OD2 . ASP C  1 334 ? -20.606 29.221   78.040  1.00 36.91 ? 416  ASP C OD2 1 
ATOM   8487  N  N   . CYS C  1 335 ? -20.113 32.671   80.539  1.00 30.60 ? 417  CYS C N   1 
ATOM   8488  C  CA  . CYS C  1 335 ? -21.256 33.010   81.363  1.00 30.11 ? 417  CYS C CA  1 
ATOM   8489  C  C   . CYS C  1 335 ? -20.840 33.921   82.504  1.00 28.14 ? 417  CYS C C   1 
ATOM   8490  O  O   . CYS C  1 335 ? -19.660 34.242   82.666  1.00 29.03 ? 417  CYS C O   1 
ATOM   8491  C  CB  . CYS C  1 335 ? -21.874 31.732   81.925  1.00 33.35 ? 417  CYS C CB  1 
ATOM   8492  S  SG  . CYS C  1 335 ? -20.614 30.591   82.591  1.00 41.47 ? 417  CYS C SG  1 
ATOM   8493  N  N   . ILE C  1 336 ? -21.824 34.336   83.289  1.00 25.78 ? 418  ILE C N   1 
ATOM   8494  C  CA  . ILE C  1 336 ? -21.599 35.209   84.429  1.00 23.10 ? 418  ILE C CA  1 
ATOM   8495  C  C   . ILE C  1 336 ? -21.456 34.345   85.672  1.00 21.54 ? 418  ILE C C   1 
ATOM   8496  O  O   . ILE C  1 336 ? -22.299 33.504   85.959  1.00 21.03 ? 418  ILE C O   1 
ATOM   8497  C  CB  . ILE C  1 336 ? -22.774 36.198   84.579  1.00 22.97 ? 418  ILE C CB  1 
ATOM   8498  C  CG1 . ILE C  1 336 ? -22.786 37.132   83.370  1.00 22.98 ? 418  ILE C CG1 1 
ATOM   8499  C  CG2 . ILE C  1 336 ? -22.660 36.976   85.873  1.00 20.02 ? 418  ILE C CG2 1 
ATOM   8500  C  CD1 . ILE C  1 336 ? -23.984 38.029   83.298  1.00 26.79 ? 418  ILE C CD1 1 
ATOM   8501  N  N   . ARG C  1 337 ? -20.372 34.561   86.402  1.00 21.50 ? 419  ARG C N   1 
ATOM   8502  C  CA  . ARG C  1 337 ? -20.072 33.796   87.601  1.00 21.87 ? 419  ARG C CA  1 
ATOM   8503  C  C   . ARG C  1 337 ? -20.761 34.356   88.821  1.00 21.16 ? 419  ARG C C   1 
ATOM   8504  O  O   . ARG C  1 337 ? -20.463 35.462   89.247  1.00 23.12 ? 419  ARG C O   1 
ATOM   8505  C  CB  . ARG C  1 337 ? -18.570 33.816   87.853  1.00 24.98 ? 419  ARG C CB  1 
ATOM   8506  C  CG  . ARG C  1 337 ? -17.902 32.481   87.819  1.00 27.57 ? 419  ARG C CG  1 
ATOM   8507  C  CD  . ARG C  1 337 ? -17.739 31.893   89.194  1.00 28.92 ? 419  ARG C CD  1 
ATOM   8508  N  NE  . ARG C  1 337 ? -16.956 30.668   89.082  1.00 32.29 ? 419  ARG C NE  1 
ATOM   8509  C  CZ  . ARG C  1 337 ? -15.666 30.635   88.759  1.00 31.35 ? 419  ARG C CZ  1 
ATOM   8510  N  NH1 . ARG C  1 337 ? -15.010 31.761   88.532  1.00 31.74 ? 419  ARG C NH1 1 
ATOM   8511  N  NH2 . ARG C  1 337 ? -15.042 29.474   88.622  1.00 32.06 ? 419  ARG C NH2 1 
ATOM   8512  N  N   . PRO C  1 338 ? -21.703 33.607   89.399  1.00 19.92 ? 420  PRO C N   1 
ATOM   8513  C  CA  . PRO C  1 338 ? -22.363 34.143   90.587  1.00 18.30 ? 420  PRO C CA  1 
ATOM   8514  C  C   . PRO C  1 338 ? -21.489 33.854   91.793  1.00 17.09 ? 420  PRO C C   1 
ATOM   8515  O  O   . PRO C  1 338 ? -20.972 32.750   91.926  1.00 15.39 ? 420  PRO C O   1 
ATOM   8516  C  CB  . PRO C  1 338 ? -23.664 33.352   90.637  1.00 18.15 ? 420  PRO C CB  1 
ATOM   8517  C  CG  . PRO C  1 338 ? -23.220 32.004   90.135  1.00 18.45 ? 420  PRO C CG  1 
ATOM   8518  C  CD  . PRO C  1 338 ? -22.381 32.386   88.928  1.00 18.26 ? 420  PRO C CD  1 
ATOM   8519  N  N   . CYS C  1 339 ? -21.313 34.848   92.655  1.00 17.81 ? 421  CYS C N   1 
ATOM   8520  C  CA  . CYS C  1 339 ? -20.531 34.692   93.884  1.00 18.76 ? 421  CYS C CA  1 
ATOM   8521  C  C   . CYS C  1 339 ? -21.304 35.404   94.982  1.00 16.52 ? 421  CYS C C   1 
ATOM   8522  O  O   . CYS C  1 339 ? -22.313 36.060   94.710  1.00 16.52 ? 421  CYS C O   1 
ATOM   8523  C  CB  . CYS C  1 339 ? -19.158 35.368   93.785  1.00 20.73 ? 421  CYS C CB  1 
ATOM   8524  S  SG  . CYS C  1 339 ? -18.055 34.867   92.432  1.00 26.66 ? 421  CYS C SG  1 
ATOM   8525  N  N   . PHE C  1 340 ? -20.837 35.276   96.219  1.00 13.81 ? 422  PHE C N   1 
ATOM   8526  C  CA  . PHE C  1 340 ? -21.476 35.970   97.320  1.00 13.31 ? 422  PHE C CA  1 
ATOM   8527  C  C   . PHE C  1 340 ? -20.484 36.204   98.434  1.00 13.15 ? 422  PHE C C   1 
ATOM   8528  O  O   . PHE C  1 340 ? -19.407 35.610   98.465  1.00 14.26 ? 422  PHE C O   1 
ATOM   8529  C  CB  . PHE C  1 340 ? -22.707 35.202   97.826  1.00 14.23 ? 422  PHE C CB  1 
ATOM   8530  C  CG  . PHE C  1 340 ? -22.393 33.969   98.623  1.00 14.55 ? 422  PHE C CG  1 
ATOM   8531  C  CD1 . PHE C  1 340 ? -22.208 34.040   100.002 1.00 15.12 ? 422  PHE C CD1 1 
ATOM   8532  C  CD2 . PHE C  1 340 ? -22.310 32.730   98.002  1.00 14.42 ? 422  PHE C CD2 1 
ATOM   8533  C  CE1 . PHE C  1 340 ? -21.951 32.883   100.760 1.00 15.28 ? 422  PHE C CE1 1 
ATOM   8534  C  CE2 . PHE C  1 340 ? -22.057 31.576   98.744  1.00 15.96 ? 422  PHE C CE2 1 
ATOM   8535  C  CZ  . PHE C  1 340 ? -21.875 31.656   100.129 1.00 13.83 ? 422  PHE C CZ  1 
ATOM   8536  N  N   . TRP C  1 341 ? -20.842 37.105   99.335  1.00 12.86 ? 423  TRP C N   1 
ATOM   8537  C  CA  . TRP C  1 341 ? -19.993 37.433   100.467 1.00 12.87 ? 423  TRP C CA  1 
ATOM   8538  C  C   . TRP C  1 341 ? -20.855 37.446   101.699 1.00 12.05 ? 423  TRP C C   1 
ATOM   8539  O  O   . TRP C  1 341 ? -22.023 37.820   101.635 1.00 13.93 ? 423  TRP C O   1 
ATOM   8540  C  CB  . TRP C  1 341 ? -19.346 38.816   100.292 1.00 12.19 ? 423  TRP C CB  1 
ATOM   8541  C  CG  . TRP C  1 341 ? -20.314 39.927   100.013 1.00 12.01 ? 423  TRP C CG  1 
ATOM   8542  C  CD1 . TRP C  1 341 ? -20.623 40.458   98.790  1.00 11.95 ? 423  TRP C CD1 1 
ATOM   8543  C  CD2 . TRP C  1 341 ? -21.108 40.643   100.971 1.00 13.89 ? 423  TRP C CD2 1 
ATOM   8544  N  NE1 . TRP C  1 341 ? -21.557 41.457   98.927  1.00 13.07 ? 423  TRP C NE1 1 
ATOM   8545  C  CE2 . TRP C  1 341 ? -21.874 41.592   100.256 1.00 13.65 ? 423  TRP C CE2 1 
ATOM   8546  C  CE3 . TRP C  1 341 ? -21.248 40.575   102.366 1.00 13.64 ? 423  TRP C CE3 1 
ATOM   8547  C  CZ2 . TRP C  1 341 ? -22.767 42.464   100.887 1.00 14.24 ? 423  TRP C CZ2 1 
ATOM   8548  C  CZ3 . TRP C  1 341 ? -22.136 41.440   102.990 1.00 13.41 ? 423  TRP C CZ3 1 
ATOM   8549  C  CH2 . TRP C  1 341 ? -22.884 42.372   102.251 1.00 14.42 ? 423  TRP C CH2 1 
ATOM   8550  N  N   . VAL C  1 342 ? -20.285 37.034   102.819 1.00 12.16 ? 424  VAL C N   1 
ATOM   8551  C  CA  . VAL C  1 342 ? -21.018 37.028   104.071 1.00 12.90 ? 424  VAL C CA  1 
ATOM   8552  C  C   . VAL C  1 342 ? -20.287 37.909   105.070 1.00 13.56 ? 424  VAL C C   1 
ATOM   8553  O  O   . VAL C  1 342 ? -19.067 37.816   105.226 1.00 15.52 ? 424  VAL C O   1 
ATOM   8554  C  CB  . VAL C  1 342 ? -21.140 35.601   104.654 1.00 12.88 ? 424  VAL C CB  1 
ATOM   8555  C  CG1 . VAL C  1 342 ? -21.920 35.649   105.959 1.00 12.11 ? 424  VAL C CG1 1 
ATOM   8556  C  CG2 . VAL C  1 342 ? -21.851 34.674   103.656 1.00 11.55 ? 424  VAL C CG2 1 
ATOM   8557  N  N   . GLU C  1 343 ? -21.027 38.780   105.737 1.00 14.19 ? 425  GLU C N   1 
ATOM   8558  C  CA  . GLU C  1 343 ? -20.436 39.656   106.735 1.00 14.79 ? 425  GLU C CA  1 
ATOM   8559  C  C   . GLU C  1 343 ? -20.516 38.961   108.108 1.00 14.16 ? 425  GLU C C   1 
ATOM   8560  O  O   . GLU C  1 343 ? -21.576 38.497   108.527 1.00 14.04 ? 425  GLU C O   1 
ATOM   8561  C  CB  . GLU C  1 343 ? -21.192 40.991   106.762 1.00 16.76 ? 425  GLU C CB  1 
ATOM   8562  C  CG  . GLU C  1 343 ? -20.754 41.931   107.876 1.00 18.52 ? 425  GLU C CG  1 
ATOM   8563  C  CD  . GLU C  1 343 ? -21.744 43.059   108.110 1.00 20.58 ? 425  GLU C CD  1 
ATOM   8564  O  OE1 . GLU C  1 343 ? -22.961 42.780   108.243 1.00 21.67 ? 425  GLU C OE1 1 
ATOM   8565  O  OE2 . GLU C  1 343 ? -21.303 44.225   108.174 1.00 22.19 ? 425  GLU C OE2 1 
ATOM   8566  N  N   . LEU C  1 344 ? -19.394 38.865   108.804 1.00 13.62 ? 426  LEU C N   1 
ATOM   8567  C  CA  . LEU C  1 344 ? -19.407 38.226   110.111 1.00 13.82 ? 426  LEU C CA  1 
ATOM   8568  C  C   . LEU C  1 344 ? -19.358 39.345   111.128 1.00 14.12 ? 426  LEU C C   1 
ATOM   8569  O  O   . LEU C  1 344 ? -18.323 39.961   111.320 1.00 14.42 ? 426  LEU C O   1 
ATOM   8570  C  CB  . LEU C  1 344 ? -18.198 37.300   110.255 1.00 12.39 ? 426  LEU C CB  1 
ATOM   8571  C  CG  . LEU C  1 344 ? -18.025 36.358   109.060 1.00 11.52 ? 426  LEU C CG  1 
ATOM   8572  C  CD1 . LEU C  1 344 ? -16.799 35.498   109.268 1.00 13.03 ? 426  LEU C CD1 1 
ATOM   8573  C  CD2 . LEU C  1 344 ? -19.270 35.491   108.880 1.00 8.88  ? 426  LEU C CD2 1 
ATOM   8574  N  N   . ILE C  1 345 ? -20.492 39.620   111.762 1.00 14.41 ? 427  ILE C N   1 
ATOM   8575  C  CA  . ILE C  1 345 ? -20.577 40.705   112.729 1.00 15.52 ? 427  ILE C CA  1 
ATOM   8576  C  C   . ILE C  1 345 ? -20.202 40.321   114.145 1.00 17.00 ? 427  ILE C C   1 
ATOM   8577  O  O   . ILE C  1 345 ? -20.733 39.360   114.697 1.00 19.32 ? 427  ILE C O   1 
ATOM   8578  C  CB  . ILE C  1 345 ? -21.992 41.281   112.778 1.00 15.59 ? 427  ILE C CB  1 
ATOM   8579  C  CG1 . ILE C  1 345 ? -22.348 41.893   111.421 1.00 14.97 ? 427  ILE C CG1 1 
ATOM   8580  C  CG2 . ILE C  1 345 ? -22.099 42.289   113.913 1.00 12.98 ? 427  ILE C CG2 1 
ATOM   8581  C  CD1 . ILE C  1 345 ? -23.826 42.161   111.262 1.00 13.64 ? 427  ILE C CD1 1 
ATOM   8582  N  N   . ARG C  1 346 ? -19.294 41.085   114.737 1.00 17.88 ? 428  ARG C N   1 
ATOM   8583  C  CA  . ARG C  1 346 ? -18.878 40.836   116.110 1.00 18.75 ? 428  ARG C CA  1 
ATOM   8584  C  C   . ARG C  1 346 ? -19.073 42.099   116.933 1.00 19.82 ? 428  ARG C C   1 
ATOM   8585  O  O   . ARG C  1 346 ? -18.936 43.212   116.421 1.00 20.38 ? 428  ARG C O   1 
ATOM   8586  C  CB  . ARG C  1 346 ? -17.410 40.405   116.160 1.00 18.13 ? 428  ARG C CB  1 
ATOM   8587  C  CG  . ARG C  1 346 ? -17.122 39.102   115.416 1.00 17.54 ? 428  ARG C CG  1 
ATOM   8588  C  CD  . ARG C  1 346 ? -17.967 37.949   115.945 1.00 15.34 ? 428  ARG C CD  1 
ATOM   8589  N  NE  . ARG C  1 346 ? -17.697 37.662   117.355 1.00 15.53 ? 428  ARG C NE  1 
ATOM   8590  C  CZ  . ARG C  1 346 ? -16.569 37.125   117.820 1.00 15.07 ? 428  ARG C CZ  1 
ATOM   8591  N  NH1 . ARG C  1 346 ? -16.421 36.901   119.121 1.00 15.48 ? 428  ARG C NH1 1 
ATOM   8592  N  NH2 . ARG C  1 346 ? -15.590 36.802   116.993 1.00 13.08 ? 428  ARG C NH2 1 
ATOM   8593  N  N   . GLY C  1 347 ? -19.402 41.923   118.208 1.00 21.79 ? 429  GLY C N   1 
ATOM   8594  C  CA  . GLY C  1 347 ? -19.599 43.064   119.086 1.00 23.11 ? 429  GLY C CA  1 
ATOM   8595  C  C   . GLY C  1 347 ? -21.053 43.286   119.442 1.00 24.44 ? 429  GLY C C   1 
ATOM   8596  O  O   . GLY C  1 347 ? -21.824 42.339   119.632 1.00 24.82 ? 429  GLY C O   1 
ATOM   8597  N  N   . ARG C  1 348 ? -21.434 44.550   119.538 1.00 25.67 ? 430  ARG C N   1 
ATOM   8598  C  CA  . ARG C  1 348 ? -22.804 44.895   119.869 1.00 26.75 ? 430  ARG C CA  1 
ATOM   8599  C  C   . ARG C  1 348 ? -23.687 44.630   118.662 1.00 25.13 ? 430  ARG C C   1 
ATOM   8600  O  O   . ARG C  1 348 ? -23.221 44.660   117.526 1.00 25.73 ? 430  ARG C O   1 
ATOM   8601  C  CB  . ARG C  1 348 ? -22.878 46.365   120.281 1.00 29.12 ? 430  ARG C CB  1 
ATOM   8602  C  CG  . ARG C  1 348 ? -22.219 46.632   121.623 1.00 33.70 ? 430  ARG C CG  1 
ATOM   8603  C  CD  . ARG C  1 348 ? -21.869 48.103   121.792 1.00 39.01 ? 430  ARG C CD  1 
ATOM   8604  N  NE  . ARG C  1 348 ? -23.027 48.982   121.622 1.00 43.84 ? 430  ARG C NE  1 
ATOM   8605  C  CZ  . ARG C  1 348 ? -23.007 50.297   121.840 1.00 45.02 ? 430  ARG C CZ  1 
ATOM   8606  N  NH1 . ARG C  1 348 ? -21.884 50.885   122.236 1.00 45.52 ? 430  ARG C NH1 1 
ATOM   8607  N  NH2 . ARG C  1 348 ? -24.110 51.023   121.677 1.00 44.00 ? 430  ARG C NH2 1 
ATOM   8608  N  N   . PRO C  1 349 ? -24.975 44.356   118.893 1.00 24.28 ? 431  PRO C N   1 
ATOM   8609  C  CA  . PRO C  1 349 ? -25.610 44.302   120.212 1.00 23.92 ? 431  PRO C CA  1 
ATOM   8610  C  C   . PRO C  1 349 ? -25.506 42.940   120.904 1.00 23.31 ? 431  PRO C C   1 
ATOM   8611  O  O   . PRO C  1 349 ? -25.859 42.799   122.064 1.00 24.23 ? 431  PRO C O   1 
ATOM   8612  C  CB  . PRO C  1 349 ? -27.053 44.660   119.893 1.00 21.77 ? 431  PRO C CB  1 
ATOM   8613  C  CG  . PRO C  1 349 ? -27.253 43.916   118.596 1.00 23.99 ? 431  PRO C CG  1 
ATOM   8614  C  CD  . PRO C  1 349 ? -25.985 44.232   117.821 1.00 22.94 ? 431  PRO C CD  1 
ATOM   8615  N  N   . LYS C  1 350 ? -25.016 41.936   120.195 1.00 24.60 ? 432  LYS C N   1 
ATOM   8616  C  CA  . LYS C  1 350 ? -24.926 40.597   120.759 1.00 23.89 ? 432  LYS C CA  1 
ATOM   8617  C  C   . LYS C  1 350 ? -23.797 40.306   121.726 1.00 23.73 ? 432  LYS C C   1 
ATOM   8618  O  O   . LYS C  1 350 ? -23.899 39.379   122.522 1.00 23.38 ? 432  LYS C O   1 
ATOM   8619  C  CB  . LYS C  1 350 ? -24.898 39.575   119.625 1.00 25.16 ? 432  LYS C CB  1 
ATOM   8620  C  CG  . LYS C  1 350 ? -26.240 39.453   118.915 1.00 27.99 ? 432  LYS C CG  1 
ATOM   8621  C  CD  . LYS C  1 350 ? -27.321 39.079   119.922 1.00 28.70 ? 432  LYS C CD  1 
ATOM   8622  C  CE  . LYS C  1 350 ? -28.697 39.043   119.305 1.00 31.92 ? 432  LYS C CE  1 
ATOM   8623  N  NZ  . LYS C  1 350 ? -29.735 38.751   120.351 1.00 33.66 ? 432  LYS C NZ  1 
ATOM   8624  N  N   . GLU C  1 351 ? -22.727 41.093   121.674 1.00 23.29 ? 433  GLU C N   1 
ATOM   8625  C  CA  . GLU C  1 351 ? -21.590 40.855   122.552 1.00 23.51 ? 433  GLU C CA  1 
ATOM   8626  C  C   . GLU C  1 351 ? -21.235 42.019   123.469 1.00 24.49 ? 433  GLU C C   1 
ATOM   8627  O  O   . GLU C  1 351 ? -21.408 43.185   123.120 1.00 26.15 ? 433  GLU C O   1 
ATOM   8628  C  CB  . GLU C  1 351 ? -20.389 40.443   121.703 1.00 22.32 ? 433  GLU C CB  1 
ATOM   8629  C  CG  . GLU C  1 351 ? -20.638 39.146   120.955 1.00 22.01 ? 433  GLU C CG  1 
ATOM   8630  C  CD  . GLU C  1 351 ? -19.463 38.717   120.111 1.00 22.95 ? 433  GLU C CD  1 
ATOM   8631  O  OE1 . GLU C  1 351 ? -19.343 39.185   118.958 1.00 21.97 ? 433  GLU C OE1 1 
ATOM   8632  O  OE2 . GLU C  1 351 ? -18.650 37.914   120.615 1.00 23.18 ? 433  GLU C OE2 1 
ATOM   8633  N  N   . SER C  1 352 ? -20.729 41.686   124.648 1.00 24.66 ? 435  SER C N   1 
ATOM   8634  C  CA  . SER C  1 352 ? -20.371 42.687   125.641 1.00 25.77 ? 435  SER C CA  1 
ATOM   8635  C  C   . SER C  1 352 ? -19.124 43.506   125.305 1.00 25.03 ? 435  SER C C   1 
ATOM   8636  O  O   . SER C  1 352 ? -18.086 43.374   125.958 1.00 25.78 ? 435  SER C O   1 
ATOM   8637  C  CB  . SER C  1 352 ? -20.208 42.006   127.005 1.00 27.71 ? 435  SER C CB  1 
ATOM   8638  O  OG  . SER C  1 352 ? -19.395 40.843   126.895 1.00 33.83 ? 435  SER C OG  1 
ATOM   8639  N  N   . THR C  1 353 ? -19.236 44.359   124.290 1.00 23.73 ? 436  THR C N   1 
ATOM   8640  C  CA  . THR C  1 353 ? -18.124 45.212   123.866 1.00 21.96 ? 436  THR C CA  1 
ATOM   8641  C  C   . THR C  1 353 ? -18.654 46.627   123.667 1.00 21.69 ? 436  THR C C   1 
ATOM   8642  O  O   . THR C  1 353 ? -19.849 46.873   123.824 1.00 23.04 ? 436  THR C O   1 
ATOM   8643  C  CB  . THR C  1 353 ? -17.522 44.741   122.523 1.00 21.53 ? 436  THR C CB  1 
ATOM   8644  O  OG1 . THR C  1 353 ? -18.448 45.013   121.463 1.00 19.98 ? 436  THR C OG1 1 
ATOM   8645  C  CG2 . THR C  1 353 ? -17.229 43.257   122.559 1.00 18.35 ? 436  THR C CG2 1 
ATOM   8646  N  N   . ILE C  1 354 ? -17.780 47.562   123.320 1.00 20.27 ? 437  ILE C N   1 
ATOM   8647  C  CA  . ILE C  1 354 ? -18.239 48.928   123.100 1.00 19.07 ? 437  ILE C CA  1 
ATOM   8648  C  C   . ILE C  1 354 ? -18.403 49.224   121.607 1.00 18.94 ? 437  ILE C C   1 
ATOM   8649  O  O   . ILE C  1 354 ? -19.029 50.210   121.223 1.00 19.88 ? 437  ILE C O   1 
ATOM   8650  C  CB  . ILE C  1 354 ? -17.259 49.979   123.700 1.00 19.26 ? 437  ILE C CB  1 
ATOM   8651  C  CG1 . ILE C  1 354 ? -16.008 50.101   122.830 1.00 18.20 ? 437  ILE C CG1 1 
ATOM   8652  C  CG2 . ILE C  1 354 ? -16.870 49.589   125.114 1.00 18.25 ? 437  ILE C CG2 1 
ATOM   8653  C  CD1 . ILE C  1 354 ? -15.044 51.172   123.321 1.00 19.07 ? 437  ILE C CD1 1 
ATOM   8654  N  N   . TRP C  1 355 ? -17.855 48.355   120.769 1.00 16.84 ? 438  TRP C N   1 
ATOM   8655  C  CA  . TRP C  1 355 ? -17.906 48.546   119.325 1.00 14.94 ? 438  TRP C CA  1 
ATOM   8656  C  C   . TRP C  1 355 ? -18.659 47.440   118.603 1.00 14.73 ? 438  TRP C C   1 
ATOM   8657  O  O   . TRP C  1 355 ? -19.141 46.489   119.212 1.00 14.87 ? 438  TRP C O   1 
ATOM   8658  C  CB  . TRP C  1 355 ? -16.482 48.581   118.779 1.00 13.73 ? 438  TRP C CB  1 
ATOM   8659  C  CG  . TRP C  1 355 ? -15.702 47.440   119.329 1.00 12.36 ? 438  TRP C CG  1 
ATOM   8660  C  CD1 . TRP C  1 355 ? -15.151 47.358   120.580 1.00 13.54 ? 438  TRP C CD1 1 
ATOM   8661  C  CD2 . TRP C  1 355 ? -15.485 46.184   118.714 1.00 10.80 ? 438  TRP C CD2 1 
ATOM   8662  N  NE1 . TRP C  1 355 ? -14.623 46.117   120.789 1.00 13.06 ? 438  TRP C NE1 1 
ATOM   8663  C  CE2 . TRP C  1 355 ? -14.831 45.356   119.663 1.00 11.79 ? 438  TRP C CE2 1 
ATOM   8664  C  CE3 . TRP C  1 355 ? -15.825 45.628   117.478 1.00 11.64 ? 438  TRP C CE3 1 
ATOM   8665  C  CZ2 . TRP C  1 355 ? -14.453 44.045   119.389 1.00 12.40 ? 438  TRP C CZ2 1 
ATOM   8666  C  CZ3 . TRP C  1 355 ? -15.459 44.322   117.203 1.00 13.12 ? 438  TRP C CZ3 1 
ATOM   8667  C  CH2 . TRP C  1 355 ? -14.801 43.537   118.163 1.00 13.72 ? 438  TRP C CH2 1 
ATOM   8668  N  N   . THR C  1 356 ? -18.737 47.590   117.287 1.00 14.49 ? 439  THR C N   1 
ATOM   8669  C  CA  . THR C  1 356 ? -19.363 46.627   116.393 1.00 15.57 ? 439  THR C CA  1 
ATOM   8670  C  C   . THR C  1 356 ? -18.582 46.720   115.092 1.00 16.73 ? 439  THR C C   1 
ATOM   8671  O  O   . THR C  1 356 ? -18.367 47.812   114.576 1.00 18.33 ? 439  THR C O   1 
ATOM   8672  C  CB  . THR C  1 356 ? -20.830 46.978   116.059 1.00 15.18 ? 439  THR C CB  1 
ATOM   8673  O  OG1 . THR C  1 356 ? -21.638 46.847   117.227 1.00 17.42 ? 439  THR C OG1 1 
ATOM   8674  C  CG2 . THR C  1 356 ? -21.364 46.056   114.967 1.00 13.83 ? 439  THR C CG2 1 
ATOM   8675  N  N   . SER C  1 357 ? -18.153 45.583   114.566 1.00 17.66 ? 440  SER C N   1 
ATOM   8676  C  CA  . SER C  1 357 ? -17.424 45.558   113.306 1.00 18.15 ? 440  SER C CA  1 
ATOM   8677  C  C   . SER C  1 357 ? -17.667 44.183   112.711 1.00 19.98 ? 440  SER C C   1 
ATOM   8678  O  O   . SER C  1 357 ? -18.191 43.294   113.393 1.00 21.43 ? 440  SER C O   1 
ATOM   8679  C  CB  . SER C  1 357 ? -15.928 45.772   113.544 1.00 17.41 ? 440  SER C CB  1 
ATOM   8680  O  OG  . SER C  1 357 ? -15.247 46.011   112.321 1.00 14.75 ? 440  SER C OG  1 
ATOM   8681  N  N   . GLY C  1 358 ? -17.298 43.997   111.449 1.00 21.11 ? 441  GLY C N   1 
ATOM   8682  C  CA  . GLY C  1 358 ? -17.492 42.699   110.831 1.00 21.25 ? 441  GLY C CA  1 
ATOM   8683  C  C   . GLY C  1 358 ? -16.330 42.270   109.956 1.00 22.08 ? 441  GLY C C   1 
ATOM   8684  O  O   . GLY C  1 358 ? -15.622 43.125   109.424 1.00 22.72 ? 441  GLY C O   1 
ATOM   8685  N  N   . SER C  1 359 ? -16.114 40.957   109.832 1.00 22.17 ? 442  SER C N   1 
ATOM   8686  C  CA  . SER C  1 359 ? -15.064 40.415   108.972 1.00 21.65 ? 442  SER C CA  1 
ATOM   8687  C  C   . SER C  1 359 ? -15.803 39.967   107.731 1.00 20.14 ? 442  SER C C   1 
ATOM   8688  O  O   . SER C  1 359 ? -17.024 40.084   107.658 1.00 19.56 ? 442  SER C O   1 
ATOM   8689  C  CB  . SER C  1 359 ? -14.390 39.180   109.583 1.00 24.91 ? 442  SER C CB  1 
ATOM   8690  O  OG  . SER C  1 359 ? -13.757 39.475   110.808 1.00 31.65 ? 442  SER C OG  1 
ATOM   8691  N  N   . SER C  1 360 ? -15.079 39.422   106.765 1.00 18.95 ? 443  SER C N   1 
ATOM   8692  C  CA  . SER C  1 360 ? -15.734 38.969   105.557 1.00 18.87 ? 443  SER C CA  1 
ATOM   8693  C  C   . SER C  1 360 ? -15.181 37.656   105.048 1.00 18.39 ? 443  SER C C   1 
ATOM   8694  O  O   . SER C  1 360 ? -14.022 37.322   105.273 1.00 19.38 ? 443  SER C O   1 
ATOM   8695  C  CB  . SER C  1 360 ? -15.603 40.020   104.457 1.00 18.14 ? 443  SER C CB  1 
ATOM   8696  O  OG  . SER C  1 360 ? -14.249 40.158   104.071 1.00 17.74 ? 443  SER C OG  1 
ATOM   8697  N  N   . ILE C  1 361 ? -16.044 36.905   104.380 1.00 17.36 ? 444  ILE C N   1 
ATOM   8698  C  CA  . ILE C  1 361 ? -15.678 35.644   103.766 1.00 16.38 ? 444  ILE C CA  1 
ATOM   8699  C  C   . ILE C  1 361 ? -16.465 35.689   102.466 1.00 15.29 ? 444  ILE C C   1 
ATOM   8700  O  O   . ILE C  1 361 ? -17.508 36.340   102.405 1.00 14.38 ? 444  ILE C O   1 
ATOM   8701  C  CB  . ILE C  1 361 ? -16.126 34.426   104.614 1.00 17.02 ? 444  ILE C CB  1 
ATOM   8702  C  CG1 . ILE C  1 361 ? -17.631 34.484   104.863 1.00 17.17 ? 444  ILE C CG1 1 
ATOM   8703  C  CG2 . ILE C  1 361 ? -15.372 34.394   105.940 1.00 15.65 ? 444  ILE C CG2 1 
ATOM   8704  C  CD1 . ILE C  1 361 ? -18.162 33.244   105.564 1.00 18.36 ? 444  ILE C CD1 1 
ATOM   8705  N  N   . SER C  1 362 ? -15.971 35.039   101.422 1.00 14.02 ? 445  SER C N   1 
ATOM   8706  C  CA  . SER C  1 362 ? -16.692 35.044   100.156 1.00 14.91 ? 445  SER C CA  1 
ATOM   8707  C  C   . SER C  1 362 ? -16.551 33.711   99.457  1.00 15.36 ? 445  SER C C   1 
ATOM   8708  O  O   . SER C  1 362 ? -15.585 32.987   99.687  1.00 14.97 ? 445  SER C O   1 
ATOM   8709  C  CB  . SER C  1 362 ? -16.182 36.168   99.251  1.00 15.71 ? 445  SER C CB  1 
ATOM   8710  O  OG  . SER C  1 362 ? -14.829 35.973   98.877  1.00 18.77 ? 445  SER C OG  1 
ATOM   8711  N  N   . PHE C  1 363 ? -17.528 33.386   98.611  1.00 16.48 ? 446  PHE C N   1 
ATOM   8712  C  CA  . PHE C  1 363 ? -17.538 32.123   97.867  1.00 16.81 ? 446  PHE C CA  1 
ATOM   8713  C  C   . PHE C  1 363 ? -18.028 32.371   96.436  1.00 18.79 ? 446  PHE C C   1 
ATOM   8714  O  O   . PHE C  1 363 ? -18.730 33.351   96.178  1.00 19.24 ? 446  PHE C O   1 
ATOM   8715  C  CB  . PHE C  1 363 ? -18.468 31.108   98.558  1.00 14.49 ? 446  PHE C CB  1 
ATOM   8716  C  CG  . PHE C  1 363 ? -18.178 30.903   100.029 1.00 14.21 ? 446  PHE C CG  1 
ATOM   8717  C  CD1 . PHE C  1 363 ? -18.388 31.933   100.955 1.00 14.85 ? 446  PHE C CD1 1 
ATOM   8718  C  CD2 . PHE C  1 363 ? -17.691 29.680   100.494 1.00 13.95 ? 446  PHE C CD2 1 
ATOM   8719  C  CE1 . PHE C  1 363 ? -18.117 31.750   102.325 1.00 13.94 ? 446  PHE C CE1 1 
ATOM   8720  C  CE2 . PHE C  1 363 ? -17.413 29.479   101.863 1.00 12.80 ? 446  PHE C CE2 1 
ATOM   8721  C  CZ  . PHE C  1 363 ? -17.627 30.516   102.779 1.00 13.67 ? 446  PHE C CZ  1 
ATOM   8722  N  N   . CYS C  1 364 ? -17.655 31.498   95.503  1.00 21.21 ? 447  CYS C N   1 
ATOM   8723  C  CA  . CYS C  1 364 ? -18.104 31.650   94.123  1.00 24.61 ? 447  CYS C CA  1 
ATOM   8724  C  C   . CYS C  1 364 ? -18.763 30.392   93.562  1.00 25.17 ? 447  CYS C C   1 
ATOM   8725  O  O   . CYS C  1 364 ? -18.543 29.295   94.062  1.00 24.87 ? 447  CYS C O   1 
ATOM   8726  C  CB  . CYS C  1 364 ? -16.947 32.073   93.218  1.00 26.36 ? 447  CYS C CB  1 
ATOM   8727  S  SG  . CYS C  1 364 ? -16.504 33.845   93.313  1.00 33.09 ? 447  CYS C SG  1 
ATOM   8728  N  N   . GLY C  1 365 ? -19.569 30.589   92.516  1.00 27.47 ? 448  GLY C N   1 
ATOM   8729  C  CA  . GLY C  1 365 ? -20.307 29.530   91.833  1.00 29.56 ? 448  GLY C CA  1 
ATOM   8730  C  C   . GLY C  1 365 ? -19.662 28.171   91.683  1.00 30.72 ? 448  GLY C C   1 
ATOM   8731  O  O   . GLY C  1 365 ? -19.866 27.316   92.527  1.00 33.66 ? 448  GLY C O   1 
ATOM   8732  N  N   . VAL C  1 366 ? -18.935 27.932   90.600  1.00 31.71 ? 449  VAL C N   1 
ATOM   8733  C  CA  . VAL C  1 366 ? -18.250 26.641   90.428  1.00 33.18 ? 449  VAL C CA  1 
ATOM   8734  C  C   . VAL C  1 366 ? -19.067 25.380   90.078  1.00 34.60 ? 449  VAL C C   1 
ATOM   8735  O  O   . VAL C  1 366 ? -20.037 25.030   90.758  1.00 34.31 ? 449  VAL C O   1 
ATOM   8736  C  CB  . VAL C  1 366 ? -17.387 26.344   91.686  1.00 31.74 ? 449  VAL C CB  1 
ATOM   8737  C  CG1 . VAL C  1 366 ? -17.027 24.873   91.769  1.00 30.68 ? 449  VAL C CG1 1 
ATOM   8738  C  CG2 . VAL C  1 366 ? -16.137 27.194   91.644  1.00 31.36 ? 449  VAL C CG2 1 
ATOM   8739  N  N   . ASN C  1 367 ? -18.618 24.691   89.026  1.00 37.27 ? 450  ASN C N   1 
ATOM   8740  C  CA  . ASN C  1 367 ? -19.225 23.454   88.513  1.00 39.23 ? 450  ASN C CA  1 
ATOM   8741  C  C   . ASN C  1 367 ? -18.759 22.222   89.290  1.00 38.49 ? 450  ASN C C   1 
ATOM   8742  O  O   . ASN C  1 367 ? -19.525 21.280   89.481  1.00 39.37 ? 450  ASN C O   1 
ATOM   8743  C  CB  . ASN C  1 367 ? -18.836 23.239   87.046  1.00 44.03 ? 450  ASN C CB  1 
ATOM   8744  C  CG  . ASN C  1 367 ? -19.528 24.195   86.095  1.00 48.73 ? 450  ASN C CG  1 
ATOM   8745  O  OD1 . ASN C  1 367 ? -19.669 25.390   86.375  1.00 53.90 ? 450  ASN C OD1 1 
ATOM   8746  N  ND2 . ASN C  1 367 ? -19.943 23.674   84.942  1.00 51.17 ? 450  ASN C ND2 1 
ATOM   8747  N  N   . SER C  1 368 ? -17.488 22.217   89.688  1.00 37.79 ? 451  SER C N   1 
ATOM   8748  C  CA  . SER C  1 368 ? -16.901 21.106   90.439  1.00 37.07 ? 451  SER C CA  1 
ATOM   8749  C  C   . SER C  1 368 ? -17.563 21.010   91.807  1.00 37.09 ? 451  SER C C   1 
ATOM   8750  O  O   . SER C  1 368 ? -18.351 21.881   92.165  1.00 38.07 ? 451  SER C O   1 
ATOM   8751  C  CB  . SER C  1 368 ? -15.392 21.317   90.584  1.00 35.87 ? 451  SER C CB  1 
ATOM   8752  O  OG  . SER C  1 368 ? -15.099 22.661   90.903  1.00 30.96 ? 451  SER C OG  1 
ATOM   8753  N  N   . ASP C  1 369 ? -17.274 19.974   92.589  1.00 37.36 ? 452  ASP C N   1 
ATOM   8754  C  CA  . ASP C  1 369 ? -17.952 19.918   93.875  1.00 37.38 ? 452  ASP C CA  1 
ATOM   8755  C  C   . ASP C  1 369 ? -17.159 20.508   95.019  1.00 33.86 ? 452  ASP C C   1 
ATOM   8756  O  O   . ASP C  1 369 ? -15.940 20.506   95.008  1.00 33.82 ? 452  ASP C O   1 
ATOM   8757  C  CB  . ASP C  1 369 ? -18.409 18.499   94.223  1.00 41.69 ? 452  ASP C CB  1 
ATOM   8758  C  CG  . ASP C  1 369 ? -19.632 18.501   95.136  1.00 44.76 ? 452  ASP C CG  1 
ATOM   8759  O  OD1 . ASP C  1 369 ? -20.702 18.985   94.686  1.00 47.27 ? 452  ASP C OD1 1 
ATOM   8760  O  OD2 . ASP C  1 369 ? -19.525 18.038   96.296  1.00 45.57 ? 452  ASP C OD2 1 
ATOM   8761  N  N   . THR C  1 370 ? -17.888 21.020   96.002  1.00 30.59 ? 453  THR C N   1 
ATOM   8762  C  CA  . THR C  1 370 ? -17.301 21.664   97.150  1.00 27.16 ? 453  THR C CA  1 
ATOM   8763  C  C   . THR C  1 370 ? -17.568 20.897   98.426  1.00 24.28 ? 453  THR C C   1 
ATOM   8764  O  O   . THR C  1 370 ? -17.862 19.705   98.402  1.00 23.59 ? 453  THR C O   1 
ATOM   8765  C  CB  . THR C  1 370 ? -17.879 23.074   97.317  1.00 30.94 ? 453  THR C CB  1 
ATOM   8766  O  OG1 . THR C  1 370 ? -18.173 23.625   96.021  1.00 27.94 ? 453  THR C OG1 1 
ATOM   8767  C  CG2 . THR C  1 370 ? -16.866 23.978   98.075  1.00 31.87 ? 453  THR C CG2 1 
ATOM   8768  N  N   . VAL C  1 371 ? -17.463 21.606   99.542  1.00 22.87 ? 454  VAL C N   1 
ATOM   8769  C  CA  . VAL C  1 371 ? -17.681 21.030   100.853 1.00 22.12 ? 454  VAL C CA  1 
ATOM   8770  C  C   . VAL C  1 371 ? -18.286 22.093   101.732 1.00 20.70 ? 454  VAL C C   1 
ATOM   8771  O  O   . VAL C  1 371 ? -17.886 23.248   101.678 1.00 20.07 ? 454  VAL C O   1 
ATOM   8772  C  CB  . VAL C  1 371 ? -16.365 20.620   101.555 1.00 23.08 ? 454  VAL C CB  1 
ATOM   8773  C  CG1 . VAL C  1 371 ? -16.647 19.501   102.530 1.00 21.81 ? 454  VAL C CG1 1 
ATOM   8774  C  CG2 . VAL C  1 371 ? -15.308 20.224   100.542 1.00 26.38 ? 454  VAL C CG2 1 
ATOM   8775  N  N   . GLY C  1 372 ? -19.251 21.697   102.544 1.00 20.16 ? 455  GLY C N   1 
ATOM   8776  C  CA  . GLY C  1 372 ? -19.843 22.636   103.463 1.00 19.63 ? 455  GLY C CA  1 
ATOM   8777  C  C   . GLY C  1 372 ? -18.943 22.595   104.679 1.00 19.63 ? 455  GLY C C   1 
ATOM   8778  O  O   . GLY C  1 372 ? -18.358 21.558   104.995 1.00 21.00 ? 455  GLY C O   1 
ATOM   8779  N  N   . TRP C  1 373 ? -18.797 23.721   105.354 1.00 19.13 ? 456  TRP C N   1 
ATOM   8780  C  CA  . TRP C  1 373 ? -17.969 23.765   106.540 1.00 18.15 ? 456  TRP C CA  1 
ATOM   8781  C  C   . TRP C  1 373 ? -18.389 25.007   107.309 1.00 19.97 ? 456  TRP C C   1 
ATOM   8782  O  O   . TRP C  1 373 ? -19.509 25.502   107.130 1.00 20.21 ? 456  TRP C O   1 
ATOM   8783  C  CB  . TRP C  1 373 ? -16.484 23.817   106.150 1.00 15.76 ? 456  TRP C CB  1 
ATOM   8784  C  CG  . TRP C  1 373 ? -15.546 23.333   107.248 1.00 15.71 ? 456  TRP C CG  1 
ATOM   8785  C  CD1 . TRP C  1 373 ? -15.809 22.365   108.181 1.00 16.27 ? 456  TRP C CD1 1 
ATOM   8786  C  CD2 . TRP C  1 373 ? -14.198 23.770   107.499 1.00 14.87 ? 456  TRP C CD2 1 
ATOM   8787  N  NE1 . TRP C  1 373 ? -14.715 22.171   108.993 1.00 15.22 ? 456  TRP C NE1 1 
ATOM   8788  C  CE2 . TRP C  1 373 ? -13.713 23.016   108.598 1.00 14.67 ? 456  TRP C CE2 1 
ATOM   8789  C  CE3 . TRP C  1 373 ? -13.353 24.720   106.901 1.00 14.16 ? 456  TRP C CE3 1 
ATOM   8790  C  CZ2 . TRP C  1 373 ? -12.422 23.186   109.112 1.00 12.45 ? 456  TRP C CZ2 1 
ATOM   8791  C  CZ3 . TRP C  1 373 ? -12.066 24.885   107.415 1.00 12.80 ? 456  TRP C CZ3 1 
ATOM   8792  C  CH2 . TRP C  1 373 ? -11.617 24.118   108.509 1.00 12.81 ? 456  TRP C CH2 1 
ATOM   8793  N  N   . SER C  1 374 ? -17.503 25.501   108.167 1.00 19.58 ? 457  SER C N   1 
ATOM   8794  C  CA  . SER C  1 374 ? -17.778 26.689   108.955 1.00 18.93 ? 457  SER C CA  1 
ATOM   8795  C  C   . SER C  1 374 ? -16.536 27.562   108.952 1.00 19.96 ? 457  SER C C   1 
ATOM   8796  O  O   . SER C  1 374 ? -15.489 27.174   109.461 1.00 21.51 ? 457  SER C O   1 
ATOM   8797  C  CB  . SER C  1 374 ? -18.143 26.304   110.388 1.00 16.43 ? 457  SER C CB  1 
ATOM   8798  O  OG  . SER C  1 374 ? -18.255 27.446   111.207 1.00 14.68 ? 457  SER C OG  1 
ATOM   8799  N  N   . TRP C  1 375 ? -16.662 28.741   108.363 1.00 20.93 ? 458  TRP C N   1 
ATOM   8800  C  CA  . TRP C  1 375 ? -15.564 29.690   108.284 1.00 20.55 ? 458  TRP C CA  1 
ATOM   8801  C  C   . TRP C  1 375 ? -15.994 30.918   109.074 1.00 19.53 ? 458  TRP C C   1 
ATOM   8802  O  O   . TRP C  1 375 ? -16.283 31.961   108.506 1.00 21.65 ? 458  TRP C O   1 
ATOM   8803  C  CB  . TRP C  1 375 ? -15.310 30.056   106.821 1.00 19.72 ? 458  TRP C CB  1 
ATOM   8804  C  CG  . TRP C  1 375 ? -14.610 28.980   106.025 1.00 19.23 ? 458  TRP C CG  1 
ATOM   8805  C  CD1 . TRP C  1 375 ? -13.266 28.752   105.964 1.00 19.74 ? 458  TRP C CD1 1 
ATOM   8806  C  CD2 . TRP C  1 375 ? -15.217 28.009   105.162 1.00 17.65 ? 458  TRP C CD2 1 
ATOM   8807  N  NE1 . TRP C  1 375 ? -12.996 27.709   105.109 1.00 18.81 ? 458  TRP C NE1 1 
ATOM   8808  C  CE2 . TRP C  1 375 ? -14.180 27.236   104.599 1.00 17.30 ? 458  TRP C CE2 1 
ATOM   8809  C  CE3 . TRP C  1 375 ? -16.541 27.724   104.797 1.00 18.26 ? 458  TRP C CE3 1 
ATOM   8810  C  CZ2 . TRP C  1 375 ? -14.414 26.196   103.708 1.00 17.60 ? 458  TRP C CZ2 1 
ATOM   8811  C  CZ3 . TRP C  1 375 ? -16.779 26.687   103.907 1.00 18.47 ? 458  TRP C CZ3 1 
ATOM   8812  C  CH2 . TRP C  1 375 ? -15.717 25.940   103.367 1.00 19.26 ? 458  TRP C CH2 1 
ATOM   8813  N  N   . PRO C  1 376 ? -16.048 30.801   110.404 1.00 18.95 ? 459  PRO C N   1 
ATOM   8814  C  CA  . PRO C  1 376 ? -16.452 31.904   111.275 1.00 19.18 ? 459  PRO C CA  1 
ATOM   8815  C  C   . PRO C  1 376 ? -15.398 32.994   111.369 1.00 20.38 ? 459  PRO C C   1 
ATOM   8816  O  O   . PRO C  1 376 ? -14.288 32.848   110.868 1.00 20.41 ? 459  PRO C O   1 
ATOM   8817  C  CB  . PRO C  1 376 ? -16.654 31.212   112.610 1.00 19.40 ? 459  PRO C CB  1 
ATOM   8818  C  CG  . PRO C  1 376 ? -15.520 30.231   112.608 1.00 18.97 ? 459  PRO C CG  1 
ATOM   8819  C  CD  . PRO C  1 376 ? -15.624 29.640   111.207 1.00 18.95 ? 459  PRO C CD  1 
ATOM   8820  N  N   . ASP C  1 377 ? -15.760 34.081   112.038 1.00 21.81 ? 460  ASP C N   1 
ATOM   8821  C  CA  . ASP C  1 377 ? -14.875 35.219   112.234 1.00 22.17 ? 460  ASP C CA  1 
ATOM   8822  C  C   . ASP C  1 377 ? -13.603 34.833   112.994 1.00 23.14 ? 460  ASP C C   1 
ATOM   8823  O  O   . ASP C  1 377 ? -12.496 35.172   112.581 1.00 22.86 ? 460  ASP C O   1 
ATOM   8824  C  CB  . ASP C  1 377 ? -15.631 36.314   112.977 1.00 23.37 ? 460  ASP C CB  1 
ATOM   8825  C  CG  . ASP C  1 377 ? -14.715 37.345   113.565 1.00 27.20 ? 460  ASP C CG  1 
ATOM   8826  O  OD1 . ASP C  1 377 ? -14.393 37.227   114.764 1.00 30.75 ? 460  ASP C OD1 1 
ATOM   8827  O  OD2 . ASP C  1 377 ? -14.299 38.264   112.830 1.00 27.26 ? 460  ASP C OD2 1 
ATOM   8828  N  N   . GLY C  1 378 ? -13.764 34.148   114.119 1.00 23.38 ? 461  GLY C N   1 
ATOM   8829  C  CA  . GLY C  1 378 ? -12.605 33.707   114.883 1.00 24.07 ? 461  GLY C CA  1 
ATOM   8830  C  C   . GLY C  1 378 ? -11.909 34.634   115.868 1.00 23.72 ? 461  GLY C C   1 
ATOM   8831  O  O   . GLY C  1 378 ? -10.835 34.308   116.362 1.00 24.29 ? 461  GLY C O   1 
ATOM   8832  N  N   . ALA C  1 379 ? -12.492 35.782   116.167 1.00 23.96 ? 462  ALA C N   1 
ATOM   8833  C  CA  . ALA C  1 379 ? -11.857 36.690   117.112 1.00 25.22 ? 462  ALA C CA  1 
ATOM   8834  C  C   . ALA C  1 379 ? -12.249 36.325   118.541 1.00 26.34 ? 462  ALA C C   1 
ATOM   8835  O  O   . ALA C  1 379 ? -13.326 35.783   118.775 1.00 26.65 ? 462  ALA C O   1 
ATOM   8836  C  CB  . ALA C  1 379 ? -12.267 38.120   116.812 1.00 24.45 ? 462  ALA C CB  1 
ATOM   8837  N  N   . GLU C  1 380 ? -11.371 36.616   119.492 1.00 27.39 ? 463  GLU C N   1 
ATOM   8838  C  CA  . GLU C  1 380 ? -11.654 36.344   120.897 1.00 29.67 ? 463  GLU C CA  1 
ATOM   8839  C  C   . GLU C  1 380 ? -12.107 37.638   121.563 1.00 27.86 ? 463  GLU C C   1 
ATOM   8840  O  O   . GLU C  1 380 ? -11.287 38.517   121.809 1.00 28.02 ? 463  GLU C O   1 
ATOM   8841  C  CB  . GLU C  1 380 ? -10.402 35.849   121.629 1.00 34.62 ? 463  GLU C CB  1 
ATOM   8842  C  CG  . GLU C  1 380 ? -9.975  34.414   121.341 1.00 43.01 ? 463  GLU C CG  1 
ATOM   8843  C  CD  . GLU C  1 380 ? -8.798  33.983   122.223 1.00 48.81 ? 463  GLU C CD  1 
ATOM   8844  O  OE1 . GLU C  1 380 ? -8.890  34.183   123.464 1.00 51.52 ? 463  GLU C OE1 1 
ATOM   8845  O  OE2 . GLU C  1 380 ? -7.793  33.447   121.684 1.00 49.60 ? 463  GLU C OE2 1 
ATOM   8846  N  N   . LEU C  1 381 ? -13.398 37.771   121.847 1.00 25.64 ? 464  LEU C N   1 
ATOM   8847  C  CA  . LEU C  1 381 ? -13.875 38.976   122.512 1.00 24.49 ? 464  LEU C CA  1 
ATOM   8848  C  C   . LEU C  1 381 ? -14.029 38.727   124.020 1.00 25.07 ? 464  LEU C C   1 
ATOM   8849  O  O   . LEU C  1 381 ? -14.149 37.586   124.474 1.00 26.16 ? 464  LEU C O   1 
ATOM   8850  C  CB  . LEU C  1 381 ? -15.204 39.432   121.912 1.00 23.43 ? 464  LEU C CB  1 
ATOM   8851  C  CG  . LEU C  1 381 ? -15.261 39.731   120.407 1.00 22.78 ? 464  LEU C CG  1 
ATOM   8852  C  CD1 . LEU C  1 381 ? -16.616 40.301   120.066 1.00 24.00 ? 464  LEU C CD1 1 
ATOM   8853  C  CD2 . LEU C  1 381 ? -14.194 40.714   120.008 1.00 22.47 ? 464  LEU C CD2 1 
ATOM   8854  N  N   . PRO C  1 382 ? -14.020 39.795   124.821 1.00 24.92 ? 465  PRO C N   1 
ATOM   8855  C  CA  . PRO C  1 382 ? -13.873 41.184   124.395 1.00 24.40 ? 465  PRO C CA  1 
ATOM   8856  C  C   . PRO C  1 382 ? -12.413 41.558   124.152 1.00 24.10 ? 465  PRO C C   1 
ATOM   8857  O  O   . PRO C  1 382 ? -11.505 40.800   124.494 1.00 24.86 ? 465  PRO C O   1 
ATOM   8858  C  CB  . PRO C  1 382 ? -14.488 41.948   125.553 1.00 24.88 ? 465  PRO C CB  1 
ATOM   8859  C  CG  . PRO C  1 382 ? -14.030 41.139   126.732 1.00 24.42 ? 465  PRO C CG  1 
ATOM   8860  C  CD  . PRO C  1 382 ? -14.284 39.716   126.269 1.00 25.53 ? 465  PRO C CD  1 
ATOM   8861  N  N   . PHE C  1 383 ? -12.207 42.731   123.556 1.00 23.33 ? 466  PHE C N   1 
ATOM   8862  C  CA  . PHE C  1 383 ? -10.878 43.244   123.241 1.00 21.14 ? 466  PHE C CA  1 
ATOM   8863  C  C   . PHE C  1 383 ? -10.362 44.096   124.383 1.00 20.69 ? 466  PHE C C   1 
ATOM   8864  O  O   . PHE C  1 383 ? -11.049 44.286   125.378 1.00 21.72 ? 466  PHE C O   1 
ATOM   8865  C  CB  . PHE C  1 383 ? -10.932 44.100   121.969 1.00 19.21 ? 466  PHE C CB  1 
ATOM   8866  C  CG  . PHE C  1 383 ? -10.832 43.312   120.689 1.00 17.21 ? 466  PHE C CG  1 
ATOM   8867  C  CD1 . PHE C  1 383 ? -10.942 41.923   120.688 1.00 15.94 ? 466  PHE C CD1 1 
ATOM   8868  C  CD2 . PHE C  1 383 ? -10.614 43.970   119.474 1.00 17.16 ? 466  PHE C CD2 1 
ATOM   8869  C  CE1 . PHE C  1 383 ? -10.833 41.197   119.493 1.00 16.32 ? 466  PHE C CE1 1 
ATOM   8870  C  CE2 . PHE C  1 383 ? -10.505 43.258   118.272 1.00 15.34 ? 466  PHE C CE2 1 
ATOM   8871  C  CZ  . PHE C  1 383 ? -10.614 41.868   118.283 1.00 16.20 ? 466  PHE C CZ  1 
ATOM   8872  N  N   . THR C  1 384 ? -9.155  44.626   124.235 1.00 21.65 ? 467  THR C N   1 
ATOM   8873  C  CA  . THR C  1 384 ? -8.582  45.473   125.270 1.00 24.28 ? 467  THR C CA  1 
ATOM   8874  C  C   . THR C  1 384 ? -9.527  46.656   125.490 1.00 26.30 ? 467  THR C C   1 
ATOM   8875  O  O   . THR C  1 384 ? -9.343  47.475   126.391 1.00 27.40 ? 467  THR C O   1 
ATOM   8876  C  CB  . THR C  1 384 ? -7.188  45.960   124.852 1.00 23.45 ? 467  THR C CB  1 
ATOM   8877  O  OG1 . THR C  1 384 ? -6.394  44.827   124.484 1.00 26.11 ? 467  THR C OG1 1 
ATOM   8878  C  CG2 . THR C  1 384 ? -6.500  46.668   125.994 1.00 22.09 ? 467  THR C CG2 1 
ATOM   8879  N  N   . ILE C  1 385 ? -10.564 46.705   124.664 1.00 28.47 ? 468  ILE C N   1 
ATOM   8880  C  CA  . ILE C  1 385 ? -11.584 47.739   124.717 1.00 28.65 ? 468  ILE C CA  1 
ATOM   8881  C  C   . ILE C  1 385 ? -11.049 49.039   124.134 1.00 30.07 ? 468  ILE C C   1 
ATOM   8882  O  O   . ILE C  1 385 ? -11.534 49.466   123.065 1.00 30.21 ? 468  ILE C O   1 
ATOM   8883  C  CB  . ILE C  1 385 ? -12.062 47.952   126.162 1.00 26.45 ? 468  ILE C CB  1 
ATOM   8884  C  CG1 . ILE C  1 385 ? -13.028 46.822   126.563 1.00 24.59 ? 468  ILE C CG1 1 
ATOM   8885  C  CG2 . ILE C  1 385 ? -12.677 49.329   126.301 1.00 25.33 ? 468  ILE C CG2 1 
ATOM   8886  C  CD1 . ILE C  1 385 ? -13.230 46.675   128.095 1.00 20.53 ? 468  ILE C CD1 1 
ATOM   8887  N  N   . VAL D  1 1   ? 17.233  51.901   78.148  1.00 34.41 ? 83   VAL D N   1 
ATOM   8888  C  CA  . VAL D  1 1   ? 18.420  52.550   77.506  1.00 35.16 ? 83   VAL D CA  1 
ATOM   8889  C  C   . VAL D  1 1   ? 19.500  52.888   78.524  1.00 33.78 ? 83   VAL D C   1 
ATOM   8890  O  O   . VAL D  1 1   ? 19.246  53.593   79.494  1.00 34.02 ? 83   VAL D O   1 
ATOM   8891  C  CB  . VAL D  1 1   ? 18.040  53.860   76.797  1.00 37.14 ? 83   VAL D CB  1 
ATOM   8892  C  CG1 . VAL D  1 1   ? 19.278  54.462   76.126  1.00 37.04 ? 83   VAL D CG1 1 
ATOM   8893  C  CG2 . VAL D  1 1   ? 16.930  53.603   75.784  1.00 39.02 ? 83   VAL D CG2 1 
ATOM   8894  N  N   . LYS D  1 2   ? 20.710  52.405   78.273  1.00 33.31 ? 84   LYS D N   1 
ATOM   8895  C  CA  . LYS D  1 2   ? 21.843  52.618   79.164  1.00 33.40 ? 84   LYS D CA  1 
ATOM   8896  C  C   . LYS D  1 2   ? 22.184  54.085   79.435  1.00 31.98 ? 84   LYS D C   1 
ATOM   8897  O  O   . LYS D  1 2   ? 22.128  54.948   78.560  1.00 32.14 ? 84   LYS D O   1 
ATOM   8898  C  CB  . LYS D  1 2   ? 23.076  51.880   78.623  1.00 36.39 ? 84   LYS D CB  1 
ATOM   8899  C  CG  . LYS D  1 2   ? 22.874  50.370   78.470  1.00 41.27 ? 84   LYS D CG  1 
ATOM   8900  C  CD  . LYS D  1 2   ? 23.953  49.717   77.588  1.00 46.53 ? 84   LYS D CD  1 
ATOM   8901  C  CE  . LYS D  1 2   ? 23.635  48.245   77.254  1.00 46.95 ? 84   LYS D CE  1 
ATOM   8902  N  NZ  . LYS D  1 2   ? 24.659  47.635   76.346  1.00 47.10 ? 84   LYS D NZ  1 
ATOM   8903  N  N   . LEU D  1 3   ? 22.548  54.334   80.682  1.00 29.69 ? 85   LEU D N   1 
ATOM   8904  C  CA  . LEU D  1 3   ? 22.906  55.649   81.182  1.00 27.19 ? 85   LEU D CA  1 
ATOM   8905  C  C   . LEU D  1 3   ? 24.260  56.092   80.630  1.00 26.27 ? 85   LEU D C   1 
ATOM   8906  O  O   . LEU D  1 3   ? 25.284  55.507   80.956  1.00 26.32 ? 85   LEU D O   1 
ATOM   8907  C  CB  . LEU D  1 3   ? 22.970  55.568   82.710  1.00 24.54 ? 85   LEU D CB  1 
ATOM   8908  C  CG  . LEU D  1 3   ? 22.254  56.559   83.616  1.00 24.01 ? 85   LEU D CG  1 
ATOM   8909  C  CD1 . LEU D  1 3   ? 20.849  56.806   83.137  1.00 22.25 ? 85   LEU D CD1 1 
ATOM   8910  C  CD2 . LEU D  1 3   ? 22.257  56.000   85.029  1.00 23.29 ? 85   LEU D CD2 1 
ATOM   8911  N  N   . ALA D  1 4   ? 24.275  57.112   79.785  1.00 25.73 ? 86   ALA D N   1 
ATOM   8912  C  CA  . ALA D  1 4   ? 25.545  57.602   79.256  1.00 24.72 ? 86   ALA D CA  1 
ATOM   8913  C  C   . ALA D  1 4   ? 26.144  58.421   80.383  1.00 25.06 ? 86   ALA D C   1 
ATOM   8914  O  O   . ALA D  1 4   ? 25.427  59.132   81.086  1.00 26.56 ? 86   ALA D O   1 
ATOM   8915  C  CB  . ALA D  1 4   ? 25.315  58.489   78.040  1.00 22.22 ? 86   ALA D CB  1 
ATOM   8916  N  N   . GLY D  1 5   ? 27.444  58.324   80.585  1.00 23.02 ? 87   GLY D N   1 
ATOM   8917  C  CA  . GLY D  1 5   ? 28.026  59.112   81.651  1.00 22.74 ? 87   GLY D CA  1 
ATOM   8918  C  C   . GLY D  1 5   ? 29.027  60.074   81.062  1.00 22.64 ? 87   GLY D C   1 
ATOM   8919  O  O   . GLY D  1 5   ? 29.992  60.445   81.715  1.00 24.36 ? 87   GLY D O   1 
ATOM   8920  N  N   . ASN D  1 6   ? 28.786  60.500   79.828  1.00 22.71 ? 88   ASN D N   1 
ATOM   8921  C  CA  . ASN D  1 6   ? 29.732  61.373   79.152  1.00 23.38 ? 88   ASN D CA  1 
ATOM   8922  C  C   . ASN D  1 6   ? 29.731  62.855   79.501  1.00 21.62 ? 88   ASN D C   1 
ATOM   8923  O  O   . ASN D  1 6   ? 30.735  63.526   79.295  1.00 22.44 ? 88   ASN D O   1 
ATOM   8924  C  CB  . ASN D  1 6   ? 29.618  61.191   77.626  1.00 23.16 ? 88   ASN D CB  1 
ATOM   8925  C  CG  . ASN D  1 6   ? 28.221  61.436   77.103  1.00 25.57 ? 88   ASN D CG  1 
ATOM   8926  O  OD1 . ASN D  1 6   ? 27.981  61.360   75.892  1.00 26.44 ? 88   ASN D OD1 1 
ATOM   8927  N  ND2 . ASN D  1 6   ? 27.286  61.732   78.005  1.00 24.94 ? 88   ASN D ND2 1 
ATOM   8928  N  N   . SER D  1 7   ? 28.631  63.377   80.030  1.00 21.35 ? 89   SER D N   1 
ATOM   8929  C  CA  . SER D  1 7   ? 28.595  64.794   80.375  1.00 19.63 ? 89   SER D CA  1 
ATOM   8930  C  C   . SER D  1 7   ? 29.393  65.071   81.654  1.00 20.02 ? 89   SER D C   1 
ATOM   8931  O  O   . SER D  1 7   ? 29.918  64.151   82.285  1.00 18.81 ? 89   SER D O   1 
ATOM   8932  C  CB  . SER D  1 7   ? 27.160  65.267   80.551  1.00 17.21 ? 89   SER D CB  1 
ATOM   8933  O  OG  . SER D  1 7   ? 26.674  64.882   81.812  1.00 21.55 ? 89   SER D OG  1 
ATOM   8934  N  N   . SER D  1 8   ? 29.476  66.344   82.028  1.00 20.41 ? 90   SER D N   1 
ATOM   8935  C  CA  . SER D  1 8   ? 30.224  66.763   83.207  1.00 22.01 ? 90   SER D CA  1 
ATOM   8936  C  C   . SER D  1 8   ? 29.370  67.246   84.359  1.00 21.44 ? 90   SER D C   1 
ATOM   8937  O  O   . SER D  1 8   ? 28.191  67.523   84.185  1.00 23.37 ? 90   SER D O   1 
ATOM   8938  C  CB  . SER D  1 8   ? 31.174  67.879   82.824  1.00 21.99 ? 90   SER D CB  1 
ATOM   8939  O  OG  . SER D  1 8   ? 32.290  67.322   82.162  1.00 31.89 ? 90   SER D OG  1 
ATOM   8940  N  N   . LEU D  1 9   ? 29.973  67.357   85.538  1.00 20.47 ? 91   LEU D N   1 
ATOM   8941  C  CA  . LEU D  1 9   ? 29.251  67.850   86.704  1.00 21.01 ? 91   LEU D CA  1 
ATOM   8942  C  C   . LEU D  1 9   ? 28.727  69.253   86.417  1.00 21.41 ? 91   LEU D C   1 
ATOM   8943  O  O   . LEU D  1 9   ? 29.454  70.105   85.917  1.00 22.93 ? 91   LEU D O   1 
ATOM   8944  C  CB  . LEU D  1 9   ? 30.165  67.896   87.931  1.00 19.56 ? 91   LEU D CB  1 
ATOM   8945  C  CG  . LEU D  1 9   ? 30.525  66.564   88.591  1.00 20.19 ? 91   LEU D CG  1 
ATOM   8946  C  CD1 . LEU D  1 9   ? 31.422  66.810   89.782  1.00 17.73 ? 91   LEU D CD1 1 
ATOM   8947  C  CD2 . LEU D  1 9   ? 29.252  65.847   89.032  1.00 20.43 ? 91   LEU D CD2 1 
ATOM   8948  N  N   . CYS D  1 10  ? 27.463  69.496   86.726  1.00 21.33 ? 92   CYS D N   1 
ATOM   8949  C  CA  . CYS D  1 10  ? 26.893  70.812   86.495  1.00 22.53 ? 92   CYS D CA  1 
ATOM   8950  C  C   . CYS D  1 10  ? 27.614  71.823   87.358  1.00 21.60 ? 92   CYS D C   1 
ATOM   8951  O  O   . CYS D  1 10  ? 28.076  71.496   88.448  1.00 23.17 ? 92   CYS D O   1 
ATOM   8952  C  CB  . CYS D  1 10  ? 25.422  70.843   86.888  1.00 24.75 ? 92   CYS D CB  1 
ATOM   8953  S  SG  . CYS D  1 10  ? 24.409  69.503   86.199  1.00 32.65 ? 92   CYS D SG  1 
ATOM   8954  N  N   . PRO D  1 11  ? 27.752  73.061   86.870  1.00 20.38 ? 93   PRO D N   1 
ATOM   8955  C  CA  . PRO D  1 11  ? 28.422  74.101   87.659  1.00 19.39 ? 93   PRO D CA  1 
ATOM   8956  C  C   . PRO D  1 11  ? 27.415  74.553   88.727  1.00 18.60 ? 93   PRO D C   1 
ATOM   8957  O  O   . PRO D  1 11  ? 26.241  74.754   88.435  1.00 18.38 ? 93   PRO D O   1 
ATOM   8958  C  CB  . PRO D  1 11  ? 28.731  75.177   86.618  1.00 18.88 ? 93   PRO D CB  1 
ATOM   8959  C  CG  . PRO D  1 11  ? 27.652  74.980   85.591  1.00 18.46 ? 93   PRO D CG  1 
ATOM   8960  C  CD  . PRO D  1 11  ? 27.561  73.493   85.476  1.00 18.27 ? 93   PRO D CD  1 
ATOM   8961  N  N   . ILE D  1 12  ? 27.859  74.688   89.967  1.00 17.48 ? 94   ILE D N   1 
ATOM   8962  C  CA  . ILE D  1 12  ? 26.941  75.073   91.023  1.00 15.40 ? 94   ILE D CA  1 
ATOM   8963  C  C   . ILE D  1 12  ? 27.468  76.222   91.862  1.00 15.38 ? 94   ILE D C   1 
ATOM   8964  O  O   . ILE D  1 12  ? 28.602  76.656   91.688  1.00 14.19 ? 94   ILE D O   1 
ATOM   8965  C  CB  . ILE D  1 12  ? 26.648  73.875   91.959  1.00 15.42 ? 94   ILE D CB  1 
ATOM   8966  C  CG1 . ILE D  1 12  ? 27.945  73.419   92.635  1.00 15.88 ? 94   ILE D CG1 1 
ATOM   8967  C  CG2 . ILE D  1 12  ? 26.027  72.730   91.166  1.00 13.43 ? 94   ILE D CG2 1 
ATOM   8968  C  CD1 . ILE D  1 12  ? 27.801  72.227   93.572  1.00 13.84 ? 94   ILE D CD1 1 
ATOM   8969  N  N   . ASN D  1 13  ? 26.622  76.715   92.762  1.00 13.31 ? 95   ASN D N   1 
ATOM   8970  C  CA  . ASN D  1 13  ? 26.985  77.798   93.661  1.00 13.04 ? 95   ASN D CA  1 
ATOM   8971  C  C   . ASN D  1 13  ? 26.563  77.447   95.072  1.00 12.48 ? 95   ASN D C   1 
ATOM   8972  O  O   . ASN D  1 13  ? 27.016  78.071   96.026  1.00 13.00 ? 95   ASN D O   1 
ATOM   8973  C  CB  . ASN D  1 13  ? 26.290  79.100   93.274  1.00 15.87 ? 95   ASN D CB  1 
ATOM   8974  C  CG  . ASN D  1 13  ? 26.847  79.706   92.023  1.00 17.70 ? 95   ASN D CG  1 
ATOM   8975  O  OD1 . ASN D  1 13  ? 28.050  79.979   91.927  1.00 19.90 ? 95   ASN D OD1 1 
ATOM   8976  N  ND2 . ASN D  1 13  ? 25.979  79.929   91.046  1.00 18.32 ? 95   ASN D ND2 1 
ATOM   8977  N  N   . GLY D  1 14  ? 25.688  76.453   95.205  1.00 12.01 ? 96   GLY D N   1 
ATOM   8978  C  CA  . GLY D  1 14  ? 25.228  76.072   96.524  1.00 12.54 ? 96   GLY D CA  1 
ATOM   8979  C  C   . GLY D  1 14  ? 24.472  74.769   96.538  1.00 13.64 ? 96   GLY D C   1 
ATOM   8980  O  O   . GLY D  1 14  ? 24.446  74.058   95.550  1.00 14.85 ? 96   GLY D O   1 
ATOM   8981  N  N   . TRP D  1 15  ? 23.851  74.451   97.665  1.00 14.50 ? 97   TRP D N   1 
ATOM   8982  C  CA  . TRP D  1 15  ? 23.117  73.201   97.786  1.00 13.63 ? 97   TRP D CA  1 
ATOM   8983  C  C   . TRP D  1 15  ? 21.727  73.450   98.350  1.00 12.99 ? 97   TRP D C   1 
ATOM   8984  O  O   . TRP D  1 15  ? 21.582  74.073   99.387  1.00 12.82 ? 97   TRP D O   1 
ATOM   8985  C  CB  . TRP D  1 15  ? 23.886  72.246   98.696  1.00 12.14 ? 97   TRP D CB  1 
ATOM   8986  C  CG  . TRP D  1 15  ? 25.310  72.125   98.318  1.00 13.20 ? 97   TRP D CG  1 
ATOM   8987  C  CD1 . TRP D  1 15  ? 26.330  72.950   98.693  1.00 16.08 ? 97   TRP D CD1 1 
ATOM   8988  C  CD2 . TRP D  1 15  ? 25.886  71.141   97.455  1.00 15.09 ? 97   TRP D CD2 1 
ATOM   8989  N  NE1 . TRP D  1 15  ? 27.511  72.542   98.118  1.00 15.43 ? 97   TRP D NE1 1 
ATOM   8990  C  CE2 . TRP D  1 15  ? 27.264  71.435   97.347  1.00 15.41 ? 97   TRP D CE2 1 
ATOM   8991  C  CE3 . TRP D  1 15  ? 25.370  70.042   96.748  1.00 15.67 ? 97   TRP D CE3 1 
ATOM   8992  C  CZ2 . TRP D  1 15  ? 28.135  70.663   96.577  1.00 15.05 ? 97   TRP D CZ2 1 
ATOM   8993  C  CZ3 . TRP D  1 15  ? 26.235  69.278   95.983  1.00 14.81 ? 97   TRP D CZ3 1 
ATOM   8994  C  CH2 . TRP D  1 15  ? 27.603  69.596   95.899  1.00 15.55 ? 97   TRP D CH2 1 
ATOM   8995  N  N   . ALA D  1 16  ? 20.713  72.937   97.669  1.00 11.96 ? 98   ALA D N   1 
ATOM   8996  C  CA  . ALA D  1 16  ? 19.338  73.115   98.088  1.00 12.48 ? 98   ALA D CA  1 
ATOM   8997  C  C   . ALA D  1 16  ? 18.813  71.865   98.774  1.00 13.24 ? 98   ALA D C   1 
ATOM   8998  O  O   . ALA D  1 16  ? 19.155  70.749   98.366  1.00 14.01 ? 98   ALA D O   1 
ATOM   8999  C  CB  . ALA D  1 16  ? 18.492  73.435   96.872  1.00 13.51 ? 98   ALA D CB  1 
ATOM   9000  N  N   . VAL D  1 17  ? 17.990  72.028   99.813  1.00 13.61 ? 99   VAL D N   1 
ATOM   9001  C  CA  . VAL D  1 17  ? 17.434  70.844   100.487 1.00 14.76 ? 99   VAL D CA  1 
ATOM   9002  C  C   . VAL D  1 17  ? 16.607  69.999   99.533  1.00 13.77 ? 99   VAL D C   1 
ATOM   9003  O  O   . VAL D  1 17  ? 15.739  70.491   98.817  1.00 11.45 ? 99   VAL D O   1 
ATOM   9004  C  CB  . VAL D  1 17  ? 16.525  71.173   101.683 1.00 15.71 ? 99   VAL D CB  1 
ATOM   9005  C  CG1 . VAL D  1 17  ? 17.318  71.099   102.958 1.00 16.16 ? 99   VAL D CG1 1 
ATOM   9006  C  CG2 . VAL D  1 17  ? 15.883  72.536   101.508 1.00 17.59 ? 99   VAL D CG2 1 
ATOM   9007  N  N   . TYR D  1 18  ? 16.885  68.709   99.542  1.00 14.35 ? 100  TYR D N   1 
ATOM   9008  C  CA  . TYR D  1 18  ? 16.191  67.796   98.666  1.00 15.74 ? 100  TYR D CA  1 
ATOM   9009  C  C   . TYR D  1 18  ? 15.257  66.877   99.443  1.00 15.00 ? 100  TYR D C   1 
ATOM   9010  O  O   . TYR D  1 18  ? 14.144  66.614   99.001  1.00 12.56 ? 100  TYR D O   1 
ATOM   9011  C  CB  . TYR D  1 18  ? 17.215  66.978   97.869  1.00 15.50 ? 100  TYR D CB  1 
ATOM   9012  C  CG  . TYR D  1 18  ? 16.619  66.151   96.754  1.00 17.79 ? 100  TYR D CG  1 
ATOM   9013  C  CD1 . TYR D  1 18  ? 15.881  66.751   95.737  1.00 17.59 ? 100  TYR D CD1 1 
ATOM   9014  C  CD2 . TYR D  1 18  ? 16.822  64.768   96.697  1.00 18.78 ? 100  TYR D CD2 1 
ATOM   9015  C  CE1 . TYR D  1 18  ? 15.360  66.002   94.690  1.00 21.20 ? 100  TYR D CE1 1 
ATOM   9016  C  CE2 . TYR D  1 18  ? 16.308  64.004   95.648  1.00 20.11 ? 100  TYR D CE2 1 
ATOM   9017  C  CZ  . TYR D  1 18  ? 15.578  64.628   94.647  1.00 21.85 ? 100  TYR D CZ  1 
ATOM   9018  O  OH  . TYR D  1 18  ? 15.073  63.896   93.592  1.00 23.54 ? 100  TYR D OH  1 
ATOM   9019  N  N   . SER D  1 19  ? 15.695  66.407   100.608 1.00 15.33 ? 101  SER D N   1 
ATOM   9020  C  CA  . SER D  1 19  ? 14.856  65.508   101.392 1.00 15.89 ? 101  SER D CA  1 
ATOM   9021  C  C   . SER D  1 19  ? 15.246  65.386   102.855 1.00 16.59 ? 101  SER D C   1 
ATOM   9022  O  O   . SER D  1 19  ? 16.396  65.615   103.225 1.00 16.61 ? 101  SER D O   1 
ATOM   9023  C  CB  . SER D  1 19  ? 14.899  64.117   100.778 1.00 15.68 ? 101  SER D CB  1 
ATOM   9024  O  OG  . SER D  1 19  ? 16.158  63.517   101.038 1.00 14.88 ? 101  SER D OG  1 
ATOM   9025  N  N   . LYS D  1 20  ? 14.275  65.006   103.677 1.00 16.73 ? 102  LYS D N   1 
ATOM   9026  C  CA  . LYS D  1 20  ? 14.486  64.796   105.107 1.00 17.28 ? 102  LYS D CA  1 
ATOM   9027  C  C   . LYS D  1 20  ? 13.462  63.734   105.489 1.00 18.50 ? 102  LYS D C   1 
ATOM   9028  O  O   . LYS D  1 20  ? 12.264  63.948   105.323 1.00 19.96 ? 102  LYS D O   1 
ATOM   9029  C  CB  . LYS D  1 20  ? 14.227  66.083   105.895 1.00 15.45 ? 102  LYS D CB  1 
ATOM   9030  C  CG  . LYS D  1 20  ? 14.688  66.001   107.350 1.00 15.55 ? 102  LYS D CG  1 
ATOM   9031  C  CD  . LYS D  1 20  ? 14.449  67.306   108.091 1.00 15.64 ? 102  LYS D CD  1 
ATOM   9032  C  CE  . LYS D  1 20  ? 15.239  67.374   109.385 1.00 15.87 ? 102  LYS D CE  1 
ATOM   9033  N  NZ  . LYS D  1 20  ? 14.869  66.295   110.339 1.00 19.15 ? 102  LYS D NZ  1 
ATOM   9034  N  N   . ASP D  1 21  ? 13.909  62.591   106.000 1.00 19.79 ? 103  ASP D N   1 
ATOM   9035  C  CA  . ASP D  1 21  ? 12.954  61.538   106.332 1.00 20.65 ? 103  ASP D CA  1 
ATOM   9036  C  C   . ASP D  1 21  ? 12.332  61.565   107.730 1.00 19.36 ? 103  ASP D C   1 
ATOM   9037  O  O   . ASP D  1 21  ? 11.269  60.967   107.930 1.00 19.23 ? 103  ASP D O   1 
ATOM   9038  C  CB  . ASP D  1 21  ? 13.560  60.151   106.047 1.00 24.36 ? 103  ASP D CB  1 
ATOM   9039  C  CG  . ASP D  1 21  ? 14.852  59.897   106.806 1.00 29.24 ? 103  ASP D CG  1 
ATOM   9040  O  OD1 . ASP D  1 21  ? 15.458  58.818   106.593 1.00 31.88 ? 103  ASP D OD1 1 
ATOM   9041  O  OD2 . ASP D  1 21  ? 15.265  60.763   107.612 1.00 32.15 ? 103  ASP D OD2 1 
ATOM   9042  N  N   . ASN D  1 22  ? 12.960  62.273   108.674 1.00 17.22 ? 104  ASN D N   1 
ATOM   9043  C  CA  . ASN D  1 22  ? 12.456  62.361   110.053 1.00 16.37 ? 104  ASN D CA  1 
ATOM   9044  C  C   . ASN D  1 22  ? 12.167  60.961   110.571 1.00 17.08 ? 104  ASN D C   1 
ATOM   9045  O  O   . ASN D  1 22  ? 11.242  60.765   111.364 1.00 17.26 ? 104  ASN D O   1 
ATOM   9046  C  CB  . ASN D  1 22  ? 11.154  63.177   110.115 1.00 14.31 ? 104  ASN D CB  1 
ATOM   9047  C  CG  . ASN D  1 22  ? 11.379  64.664   109.940 1.00 14.01 ? 104  ASN D CG  1 
ATOM   9048  O  OD1 . ASN D  1 22  ? 10.552  65.359   109.348 1.00 12.22 ? 104  ASN D OD1 1 
ATOM   9049  N  ND2 . ASN D  1 22  ? 12.489  65.166   110.468 1.00 12.13 ? 104  ASN D ND2 1 
ATOM   9050  N  N   . SER D  1 23  ? 12.951  59.987   110.121 1.00 16.35 ? 105  SER D N   1 
ATOM   9051  C  CA  . SER D  1 23  ? 12.724  58.611   110.525 1.00 16.01 ? 105  SER D CA  1 
ATOM   9052  C  C   . SER D  1 23  ? 12.721  58.381   112.039 1.00 14.80 ? 105  SER D C   1 
ATOM   9053  O  O   . SER D  1 23  ? 11.806  57.754   112.572 1.00 13.47 ? 105  SER D O   1 
ATOM   9054  C  CB  . SER D  1 23  ? 13.740  57.684   109.838 1.00 17.47 ? 105  SER D CB  1 
ATOM   9055  O  OG  . SER D  1 23  ? 15.083  58.012   110.162 1.00 23.70 ? 105  SER D OG  1 
ATOM   9056  N  N   . ILE D  1 24  ? 13.718  58.901   112.740 1.00 13.57 ? 106  ILE D N   1 
ATOM   9057  C  CA  . ILE D  1 24  ? 13.782  58.695   114.183 1.00 14.17 ? 106  ILE D CA  1 
ATOM   9058  C  C   . ILE D  1 24  ? 12.629  59.354   114.942 1.00 14.21 ? 106  ILE D C   1 
ATOM   9059  O  O   . ILE D  1 24  ? 12.052  58.750   115.853 1.00 14.68 ? 106  ILE D O   1 
ATOM   9060  C  CB  . ILE D  1 24  ? 15.136  59.165   114.732 1.00 13.92 ? 106  ILE D CB  1 
ATOM   9061  C  CG1 . ILE D  1 24  ? 16.252  58.495   113.918 1.00 13.91 ? 106  ILE D CG1 1 
ATOM   9062  C  CG2 . ILE D  1 24  ? 15.265  58.783   116.195 1.00 10.53 ? 106  ILE D CG2 1 
ATOM   9063  C  CD1 . ILE D  1 24  ? 17.651  58.833   114.369 1.00 18.02 ? 106  ILE D CD1 1 
ATOM   9064  N  N   . ARG D  1 25  ? 12.288  60.585   114.572 1.00 15.20 ? 107  ARG D N   1 
ATOM   9065  C  CA  . ARG D  1 25  ? 11.174  61.277   115.212 1.00 13.58 ? 107  ARG D CA  1 
ATOM   9066  C  C   . ARG D  1 25  ? 9.928   60.448   114.938 1.00 11.79 ? 107  ARG D C   1 
ATOM   9067  O  O   . ARG D  1 25  ? 9.145   60.165   115.833 1.00 11.75 ? 107  ARG D O   1 
ATOM   9068  C  CB  . ARG D  1 25  ? 11.006  62.685   114.632 1.00 14.73 ? 107  ARG D CB  1 
ATOM   9069  C  CG  . ARG D  1 25  ? 12.022  63.710   115.142 1.00 15.81 ? 107  ARG D CG  1 
ATOM   9070  C  CD  . ARG D  1 25  ? 11.933  65.010   114.351 1.00 14.35 ? 107  ARG D CD  1 
ATOM   9071  N  NE  . ARG D  1 25  ? 10.584  65.560   114.330 1.00 15.44 ? 107  ARG D NE  1 
ATOM   9072  C  CZ  . ARG D  1 25  ? 10.086  66.356   115.269 1.00 15.67 ? 107  ARG D CZ  1 
ATOM   9073  N  NH1 . ARG D  1 25  ? 8.841   66.809   115.170 1.00 14.07 ? 107  ARG D NH1 1 
ATOM   9074  N  NH2 . ARG D  1 25  ? 10.835  66.710   116.297 1.00 12.86 ? 107  ARG D NH2 1 
ATOM   9075  N  N   . ILE D  1 26  ? 9.760   60.037   113.693 1.00 10.41 ? 108  ILE D N   1 
ATOM   9076  C  CA  . ILE D  1 26  ? 8.605   59.231   113.327 1.00 10.63 ? 108  ILE D CA  1 
ATOM   9077  C  C   . ILE D  1 26  ? 8.627   57.864   114.010 1.00 12.94 ? 108  ILE D C   1 
ATOM   9078  O  O   . ILE D  1 26  ? 7.590   57.365   114.440 1.00 14.27 ? 108  ILE D O   1 
ATOM   9079  C  CB  . ILE D  1 26  ? 8.536   59.036   111.790 1.00 7.99  ? 108  ILE D CB  1 
ATOM   9080  C  CG1 . ILE D  1 26  ? 8.285   60.391   111.116 1.00 6.47  ? 108  ILE D CG1 1 
ATOM   9081  C  CG2 . ILE D  1 26  ? 7.445   58.039   111.430 1.00 6.58  ? 108  ILE D CG2 1 
ATOM   9082  C  CD1 . ILE D  1 26  ? 8.276   60.353   109.615 1.00 5.35  ? 108  ILE D CD1 1 
ATOM   9083  N  N   . GLY D  1 27  ? 9.814   57.274   114.115 1.00 14.24 ? 109  GLY D N   1 
ATOM   9084  C  CA  . GLY D  1 27  ? 9.962   55.960   114.716 1.00 15.67 ? 109  GLY D CA  1 
ATOM   9085  C  C   . GLY D  1 27  ? 9.600   55.830   116.182 1.00 16.96 ? 109  GLY D C   1 
ATOM   9086  O  O   . GLY D  1 27  ? 9.449   54.722   116.687 1.00 17.33 ? 109  GLY D O   1 
ATOM   9087  N  N   . SER D  1 28  ? 9.485   56.951   116.878 1.00 18.08 ? 110  SER D N   1 
ATOM   9088  C  CA  . SER D  1 28  ? 9.118   56.936   118.291 1.00 18.66 ? 110  SER D CA  1 
ATOM   9089  C  C   . SER D  1 28  ? 7.820   56.136   118.461 1.00 18.83 ? 110  SER D C   1 
ATOM   9090  O  O   . SER D  1 28  ? 7.658   55.362   119.413 1.00 19.10 ? 110  SER D O   1 
ATOM   9091  C  CB  . SER D  1 28  ? 8.909   58.375   118.778 1.00 18.16 ? 110  SER D CB  1 
ATOM   9092  O  OG  . SER D  1 28  ? 8.444   58.419   120.112 1.00 19.74 ? 110  SER D OG  1 
ATOM   9093  N  N   . LYS D  1 29  ? 6.896   56.335   117.529 1.00 17.48 ? 111  LYS D N   1 
ATOM   9094  C  CA  . LYS D  1 29  ? 5.623   55.641   117.571 1.00 18.75 ? 111  LYS D CA  1 
ATOM   9095  C  C   . LYS D  1 29  ? 5.438   54.726   116.374 1.00 19.10 ? 111  LYS D C   1 
ATOM   9096  O  O   . LYS D  1 29  ? 4.920   53.617   116.510 1.00 20.60 ? 111  LYS D O   1 
ATOM   9097  C  CB  . LYS D  1 29  ? 4.478   56.652   117.612 1.00 19.19 ? 111  LYS D CB  1 
ATOM   9098  C  CG  . LYS D  1 29  ? 3.098   56.030   117.446 1.00 20.49 ? 111  LYS D CG  1 
ATOM   9099  C  CD  . LYS D  1 29  ? 2.011   57.066   117.696 1.00 21.90 ? 111  LYS D CD  1 
ATOM   9100  C  CE  . LYS D  1 29  ? 0.605   56.456   117.747 1.00 20.56 ? 111  LYS D CE  1 
ATOM   9101  N  NZ  . LYS D  1 29  ? 0.148   55.970   116.421 1.00 23.07 ? 111  LYS D NZ  1 
ATOM   9102  N  N   . GLY D  1 30  ? 5.861   55.199   115.206 1.00 17.76 ? 112  GLY D N   1 
ATOM   9103  C  CA  . GLY D  1 30  ? 5.712   54.428   113.985 1.00 17.62 ? 112  GLY D CA  1 
ATOM   9104  C  C   . GLY D  1 30  ? 6.592   53.199   113.879 1.00 18.05 ? 112  GLY D C   1 
ATOM   9105  O  O   . GLY D  1 30  ? 7.510   52.999   114.676 1.00 18.28 ? 112  GLY D O   1 
ATOM   9106  N  N   . ASP D  1 31  ? 6.306   52.363   112.889 1.00 17.22 ? 113  ASP D N   1 
ATOM   9107  C  CA  . ASP D  1 31  ? 7.086   51.159   112.701 1.00 18.11 ? 113  ASP D CA  1 
ATOM   9108  C  C   . ASP D  1 31  ? 8.213   51.441   111.729 1.00 17.97 ? 113  ASP D C   1 
ATOM   9109  O  O   . ASP D  1 31  ? 8.154   51.096   110.551 1.00 18.75 ? 113  ASP D O   1 
ATOM   9110  C  CB  . ASP D  1 31  ? 6.191   50.019   112.222 1.00 17.15 ? 113  ASP D CB  1 
ATOM   9111  C  CG  . ASP D  1 31  ? 5.218   49.571   113.300 1.00 20.74 ? 113  ASP D CG  1 
ATOM   9112  O  OD1 . ASP D  1 31  ? 5.502   49.836   114.491 1.00 21.30 ? 113  ASP D OD1 1 
ATOM   9113  O  OD2 . ASP D  1 31  ? 4.180   48.949   112.972 1.00 21.83 ? 113  ASP D OD2 1 
ATOM   9114  N  N   . VAL D  1 32  ? 9.249   52.074   112.261 1.00 17.35 ? 114  VAL D N   1 
ATOM   9115  C  CA  . VAL D  1 32  ? 10.420  52.468   111.500 1.00 16.91 ? 114  VAL D CA  1 
ATOM   9116  C  C   . VAL D  1 32  ? 11.622  51.600   111.825 1.00 17.87 ? 114  VAL D C   1 
ATOM   9117  O  O   . VAL D  1 32  ? 11.911  51.326   112.995 1.00 20.35 ? 114  VAL D O   1 
ATOM   9118  C  CB  . VAL D  1 32  ? 10.773  53.932   111.807 1.00 15.38 ? 114  VAL D CB  1 
ATOM   9119  C  CG1 . VAL D  1 32  ? 12.054  54.314   111.134 1.00 14.78 ? 114  VAL D CG1 1 
ATOM   9120  C  CG2 . VAL D  1 32  ? 9.643   54.838   111.340 1.00 16.65 ? 114  VAL D CG2 1 
ATOM   9121  N  N   . PHE D  1 33  ? 12.326  51.168   110.787 1.00 17.21 ? 115  PHE D N   1 
ATOM   9122  C  CA  . PHE D  1 33  ? 13.515  50.344   110.963 1.00 17.28 ? 115  PHE D CA  1 
ATOM   9123  C  C   . PHE D  1 33  ? 14.619  51.137   111.661 1.00 18.45 ? 115  PHE D C   1 
ATOM   9124  O  O   . PHE D  1 33  ? 14.726  52.351   111.475 1.00 18.12 ? 115  PHE D O   1 
ATOM   9125  C  CB  . PHE D  1 33  ? 14.062  49.907   109.600 1.00 15.53 ? 115  PHE D CB  1 
ATOM   9126  C  CG  . PHE D  1 33  ? 13.346  48.738   108.982 1.00 12.90 ? 115  PHE D CG  1 
ATOM   9127  C  CD1 . PHE D  1 33  ? 12.778  48.849   107.719 1.00 12.97 ? 115  PHE D CD1 1 
ATOM   9128  C  CD2 . PHE D  1 33  ? 13.310  47.507   109.622 1.00 11.61 ? 115  PHE D CD2 1 
ATOM   9129  C  CE1 . PHE D  1 33  ? 12.185  47.741   107.092 1.00 13.00 ? 115  PHE D CE1 1 
ATOM   9130  C  CE2 . PHE D  1 33  ? 12.721  46.397   109.008 1.00 12.79 ? 115  PHE D CE2 1 
ATOM   9131  C  CZ  . PHE D  1 33  ? 12.158  46.516   107.740 1.00 11.47 ? 115  PHE D CZ  1 
ATOM   9132  N  N   . VAL D  1 34  ? 15.425  50.464   112.475 1.00 19.44 ? 116  VAL D N   1 
ATOM   9133  C  CA  . VAL D  1 34  ? 16.562  51.134   113.091 1.00 21.64 ? 116  VAL D CA  1 
ATOM   9134  C  C   . VAL D  1 34  ? 17.565  50.946   111.959 1.00 21.98 ? 116  VAL D C   1 
ATOM   9135  O  O   . VAL D  1 34  ? 17.819  49.820   111.534 1.00 21.32 ? 116  VAL D O   1 
ATOM   9136  C  CB  . VAL D  1 34  ? 17.045  50.431   114.394 1.00 22.89 ? 116  VAL D CB  1 
ATOM   9137  C  CG1 . VAL D  1 34  ? 17.013  48.934   114.234 1.00 26.66 ? 116  VAL D CG1 1 
ATOM   9138  C  CG2 . VAL D  1 34  ? 18.463  50.872   114.722 1.00 22.86 ? 116  VAL D CG2 1 
ATOM   9139  N  N   . ILE D  1 35  ? 18.107  52.039   111.436 1.00 22.75 ? 117  ILE D N   1 
ATOM   9140  C  CA  . ILE D  1 35  ? 19.018  51.925   110.307 1.00 22.55 ? 117  ILE D CA  1 
ATOM   9141  C  C   . ILE D  1 35  ? 20.349  52.641   110.432 1.00 21.64 ? 117  ILE D C   1 
ATOM   9142  O  O   . ILE D  1 35  ? 20.579  53.413   111.360 1.00 22.47 ? 117  ILE D O   1 
ATOM   9143  C  CB  . ILE D  1 35  ? 18.360  52.460   109.022 1.00 24.29 ? 117  ILE D CB  1 
ATOM   9144  C  CG1 . ILE D  1 35  ? 18.495  53.981   108.964 1.00 25.60 ? 117  ILE D CG1 1 
ATOM   9145  C  CG2 . ILE D  1 35  ? 16.894  52.105   109.005 1.00 24.94 ? 117  ILE D CG2 1 
ATOM   9146  C  CD1 . ILE D  1 35  ? 18.075  54.571   107.645 1.00 27.75 ? 117  ILE D CD1 1 
ATOM   9147  N  N   . ARG D  1 36  ? 21.209  52.368   109.455 1.00 20.43 ? 118  ARG D N   1 
ATOM   9148  C  CA  . ARG D  1 36  ? 22.530  52.972   109.339 1.00 19.56 ? 118  ARG D CA  1 
ATOM   9149  C  C   . ARG D  1 36  ? 22.816  53.202   107.859 1.00 19.85 ? 118  ARG D C   1 
ATOM   9150  O  O   . ARG D  1 36  ? 22.241  52.537   106.988 1.00 18.34 ? 118  ARG D O   1 
ATOM   9151  C  CB  . ARG D  1 36  ? 23.625  52.070   109.924 1.00 17.37 ? 118  ARG D CB  1 
ATOM   9152  C  CG  . ARG D  1 36  ? 23.766  52.133   111.437 1.00 17.69 ? 118  ARG D CG  1 
ATOM   9153  C  CD  . ARG D  1 36  ? 23.842  53.571   111.938 1.00 15.75 ? 118  ARG D CD  1 
ATOM   9154  N  NE  . ARG D  1 36  ? 24.914  54.313   111.291 1.00 15.58 ? 118  ARG D NE  1 
ATOM   9155  C  CZ  . ARG D  1 36  ? 26.195  54.231   111.631 1.00 17.14 ? 118  ARG D CZ  1 
ATOM   9156  N  NH1 . ARG D  1 36  ? 27.099  54.941   110.971 1.00 15.84 ? 118  ARG D NH1 1 
ATOM   9157  N  NH2 . ARG D  1 36  ? 26.572  53.458   112.644 1.00 17.17 ? 118  ARG D NH2 1 
ATOM   9158  N  N   . GLU D  1 37  ? 23.703  54.154   107.591 1.00 20.59 ? 119  GLU D N   1 
ATOM   9159  C  CA  . GLU D  1 37  ? 24.115  54.502   106.237 1.00 21.96 ? 119  GLU D CA  1 
ATOM   9160  C  C   . GLU D  1 37  ? 22.993  54.520   105.213 1.00 20.67 ? 119  GLU D C   1 
ATOM   9161  O  O   . GLU D  1 37  ? 22.923  53.658   104.331 1.00 21.50 ? 119  GLU D O   1 
ATOM   9162  C  CB  . GLU D  1 37  ? 25.205  53.553   105.756 1.00 23.65 ? 119  GLU D CB  1 
ATOM   9163  C  CG  . GLU D  1 37  ? 24.787  52.106   105.715 1.00 28.68 ? 119  GLU D CG  1 
ATOM   9164  C  CD  . GLU D  1 37  ? 25.867  51.232   105.125 1.00 32.97 ? 119  GLU D CD  1 
ATOM   9165  O  OE1 . GLU D  1 37  ? 25.721  50.820   103.946 1.00 33.26 ? 119  GLU D OE1 1 
ATOM   9166  O  OE2 . GLU D  1 37  ? 26.868  50.977   105.839 1.00 34.66 ? 119  GLU D OE2 1 
ATOM   9167  N  N   . PRO D  1 38  ? 22.094  55.506   105.317 1.00 18.41 ? 120  PRO D N   1 
ATOM   9168  C  CA  . PRO D  1 38  ? 20.970  55.647   104.396 1.00 18.02 ? 120  PRO D CA  1 
ATOM   9169  C  C   . PRO D  1 38  ? 21.408  56.409   103.146 1.00 19.20 ? 120  PRO D C   1 
ATOM   9170  O  O   . PRO D  1 38  ? 21.158  57.612   103.025 1.00 21.88 ? 120  PRO D O   1 
ATOM   9171  C  CB  . PRO D  1 38  ? 19.966  56.431   105.220 1.00 16.66 ? 120  PRO D CB  1 
ATOM   9172  C  CG  . PRO D  1 38  ? 20.852  57.353   105.985 1.00 16.99 ? 120  PRO D CG  1 
ATOM   9173  C  CD  . PRO D  1 38  ? 21.968  56.450   106.441 1.00 16.94 ? 120  PRO D CD  1 
ATOM   9174  N  N   . PHE D  1 39  ? 22.065  55.719   102.220 1.00 16.86 ? 121  PHE D N   1 
ATOM   9175  C  CA  . PHE D  1 39  ? 22.518  56.372   101.005 1.00 15.37 ? 121  PHE D CA  1 
ATOM   9176  C  C   . PHE D  1 39  ? 21.474  56.385   99.898  1.00 15.30 ? 121  PHE D C   1 
ATOM   9177  O  O   . PHE D  1 39  ? 20.659  55.472   99.777  1.00 14.43 ? 121  PHE D O   1 
ATOM   9178  C  CB  . PHE D  1 39  ? 23.805  55.720   100.510 1.00 14.38 ? 121  PHE D CB  1 
ATOM   9179  C  CG  . PHE D  1 39  ? 23.625  54.340   99.953  1.00 11.83 ? 121  PHE D CG  1 
ATOM   9180  C  CD1 . PHE D  1 39  ? 23.327  54.153   98.606  1.00 13.08 ? 121  PHE D CD1 1 
ATOM   9181  C  CD2 . PHE D  1 39  ? 23.859  53.227   100.745 1.00 11.14 ? 121  PHE D CD2 1 
ATOM   9182  C  CE1 . PHE D  1 39  ? 23.271  52.871   98.054  1.00 11.45 ? 121  PHE D CE1 1 
ATOM   9183  C  CE2 . PHE D  1 39  ? 23.805  51.946   100.207 1.00 12.19 ? 121  PHE D CE2 1 
ATOM   9184  C  CZ  . PHE D  1 39  ? 23.516  51.767   98.855  1.00 11.72 ? 121  PHE D CZ  1 
ATOM   9185  N  N   . ILE D  1 40  ? 21.520  57.429   99.080  1.00 14.58 ? 122  ILE D N   1 
ATOM   9186  C  CA  . ILE D  1 40  ? 20.579  57.593   97.990  1.00 13.67 ? 122  ILE D CA  1 
ATOM   9187  C  C   . ILE D  1 40  ? 21.195  57.252   96.648  1.00 14.49 ? 122  ILE D C   1 
ATOM   9188  O  O   . ILE D  1 40  ? 22.369  57.508   96.412  1.00 16.53 ? 122  ILE D O   1 
ATOM   9189  C  CB  . ILE D  1 40  ? 20.069  59.038   97.961  1.00 13.25 ? 122  ILE D CB  1 
ATOM   9190  C  CG1 . ILE D  1 40  ? 19.342  59.335   99.273  1.00 12.25 ? 122  ILE D CG1 1 
ATOM   9191  C  CG2 . ILE D  1 40  ? 19.171  59.266   96.748  1.00 13.35 ? 122  ILE D CG2 1 
ATOM   9192  C  CD1 . ILE D  1 40  ? 19.036  60.791   99.490  1.00 13.04 ? 122  ILE D CD1 1 
ATOM   9193  N  N   . SER D  1 41  ? 20.396  56.664   95.768  1.00 15.64 ? 123  SER D N   1 
ATOM   9194  C  CA  . SER D  1 41  ? 20.853  56.311   94.436  1.00 16.10 ? 123  SER D CA  1 
ATOM   9195  C  C   . SER D  1 41  ? 19.663  56.485   93.520  1.00 17.74 ? 123  SER D C   1 
ATOM   9196  O  O   . SER D  1 41  ? 18.542  56.159   93.896  1.00 18.18 ? 123  SER D O   1 
ATOM   9197  C  CB  . SER D  1 41  ? 21.326  54.868   94.392  1.00 15.66 ? 123  SER D CB  1 
ATOM   9198  O  OG  . SER D  1 41  ? 22.034  54.633   93.190  1.00 16.84 ? 123  SER D OG  1 
ATOM   9199  N  N   . CYS D  1 42  ? 19.891  56.991   92.316  1.00 19.40 ? 124  CYS D N   1 
ATOM   9200  C  CA  . CYS D  1 42  ? 18.773  57.214   91.415  1.00 21.05 ? 124  CYS D CA  1 
ATOM   9201  C  C   . CYS D  1 42  ? 18.851  56.402   90.134  1.00 21.60 ? 124  CYS D C   1 
ATOM   9202  O  O   . CYS D  1 42  ? 19.914  55.923   89.751  1.00 23.64 ? 124  CYS D O   1 
ATOM   9203  C  CB  . CYS D  1 42  ? 18.675  58.701   91.069  1.00 22.29 ? 124  CYS D CB  1 
ATOM   9204  S  SG  . CYS D  1 42  ? 18.665  59.854   92.493  1.00 25.92 ? 124  CYS D SG  1 
ATOM   9205  N  N   . SER D  1 43  ? 17.702  56.230   89.489  1.00 21.94 ? 125  SER D N   1 
ATOM   9206  C  CA  . SER D  1 43  ? 17.620  55.509   88.229  1.00 21.26 ? 125  SER D CA  1 
ATOM   9207  C  C   . SER D  1 43  ? 17.343  56.588   87.200  1.00 21.25 ? 125  SER D C   1 
ATOM   9208  O  O   . SER D  1 43  ? 17.603  57.765   87.443  1.00 20.07 ? 125  SER D O   1 
ATOM   9209  C  CB  . SER D  1 43  ? 16.450  54.526   88.236  1.00 21.08 ? 125  SER D CB  1 
ATOM   9210  O  OG  . SER D  1 43  ? 15.214  55.218   88.115  1.00 21.65 ? 125  SER D OG  1 
ATOM   9211  N  N   . HIS D  1 44  ? 16.795  56.190   86.061  1.00 22.11 ? 126  HIS D N   1 
ATOM   9212  C  CA  . HIS D  1 44  ? 16.475  57.151   85.014  1.00 22.87 ? 126  HIS D CA  1 
ATOM   9213  C  C   . HIS D  1 44  ? 15.060  57.686   85.253  1.00 22.52 ? 126  HIS D C   1 
ATOM   9214  O  O   . HIS D  1 44  ? 14.579  58.554   84.519  1.00 23.97 ? 126  HIS D O   1 
ATOM   9215  C  CB  . HIS D  1 44  ? 16.552  56.474   83.648  1.00 22.06 ? 126  HIS D CB  1 
ATOM   9216  C  CG  . HIS D  1 44  ? 15.562  55.363   83.476  1.00 25.46 ? 126  HIS D CG  1 
ATOM   9217  N  ND1 . HIS D  1 44  ? 15.408  54.358   84.410  1.00 24.96 ? 126  HIS D ND1 1 
ATOM   9218  C  CD2 . HIS D  1 44  ? 14.677  55.101   82.488  1.00 25.14 ? 126  HIS D CD2 1 
ATOM   9219  C  CE1 . HIS D  1 44  ? 14.468  53.526   83.999  1.00 26.81 ? 126  HIS D CE1 1 
ATOM   9220  N  NE2 . HIS D  1 44  ? 14.007  53.950   82.836  1.00 25.87 ? 126  HIS D NE2 1 
ATOM   9221  N  N   . LEU D  1 45  ? 14.408  57.176   86.294  1.00 21.17 ? 127  LEU D N   1 
ATOM   9222  C  CA  . LEU D  1 45  ? 13.042  57.574   86.599  1.00 21.34 ? 127  LEU D CA  1 
ATOM   9223  C  C   . LEU D  1 45  ? 12.758  57.987   88.033  1.00 22.25 ? 127  LEU D C   1 
ATOM   9224  O  O   . LEU D  1 45  ? 11.864  58.797   88.268  1.00 23.23 ? 127  LEU D O   1 
ATOM   9225  C  CB  . LEU D  1 45  ? 12.074  56.443   86.251  1.00 21.56 ? 127  LEU D CB  1 
ATOM   9226  C  CG  . LEU D  1 45  ? 11.985  55.932   84.814  1.00 20.80 ? 127  LEU D CG  1 
ATOM   9227  C  CD1 . LEU D  1 45  ? 11.073  54.719   84.793  1.00 19.43 ? 127  LEU D CD1 1 
ATOM   9228  C  CD2 . LEU D  1 45  ? 11.462  57.019   83.894  1.00 18.85 ? 127  LEU D CD2 1 
ATOM   9229  N  N   . GLU D  1 46  ? 13.478  57.428   88.998  1.00 22.07 ? 128  GLU D N   1 
ATOM   9230  C  CA  . GLU D  1 46  ? 13.205  57.777   90.385  1.00 23.42 ? 128  GLU D CA  1 
ATOM   9231  C  C   . GLU D  1 46  ? 14.438  57.673   91.261  1.00 23.47 ? 128  GLU D C   1 
ATOM   9232  O  O   . GLU D  1 46  ? 15.465  57.146   90.841  1.00 23.99 ? 128  GLU D O   1 
ATOM   9233  C  CB  . GLU D  1 46  ? 12.129  56.849   90.957  1.00 24.54 ? 128  GLU D CB  1 
ATOM   9234  C  CG  . GLU D  1 46  ? 12.679  55.490   91.389  1.00 27.76 ? 128  GLU D CG  1 
ATOM   9235  C  CD  . GLU D  1 46  ? 11.691  54.657   92.209  1.00 29.69 ? 128  GLU D CD  1 
ATOM   9236  O  OE1 . GLU D  1 46  ? 10.825  55.247   92.899  1.00 31.27 ? 128  GLU D OE1 1 
ATOM   9237  O  OE2 . GLU D  1 46  ? 11.799  53.411   92.179  1.00 27.56 ? 128  GLU D OE2 1 
ATOM   9238  N  N   . CYS D  1 47  ? 14.334  58.178   92.482  1.00 21.99 ? 129  CYS D N   1 
ATOM   9239  C  CA  . CYS D  1 47  ? 15.445  58.092   93.411  1.00 23.26 ? 129  CYS D CA  1 
ATOM   9240  C  C   . CYS D  1 47  ? 14.981  57.292   94.608  1.00 21.33 ? 129  CYS D C   1 
ATOM   9241  O  O   . CYS D  1 47  ? 13.827  57.386   95.028  1.00 21.15 ? 129  CYS D O   1 
ATOM   9242  C  CB  . CYS D  1 47  ? 15.911  59.472   93.878  1.00 24.85 ? 129  CYS D CB  1 
ATOM   9243  S  SG  . CYS D  1 47  ? 16.734  60.528   92.633  1.00 30.83 ? 129  CYS D SG  1 
ATOM   9244  N  N   . ARG D  1 48  ? 15.886  56.500   95.159  1.00 19.07 ? 130  ARG D N   1 
ATOM   9245  C  CA  . ARG D  1 48  ? 15.553  55.682   96.303  1.00 17.80 ? 130  ARG D CA  1 
ATOM   9246  C  C   . ARG D  1 48  ? 16.608  55.877   97.361  1.00 17.65 ? 130  ARG D C   1 
ATOM   9247  O  O   . ARG D  1 48  ? 17.724  56.311   97.068  1.00 16.57 ? 130  ARG D O   1 
ATOM   9248  C  CB  . ARG D  1 48  ? 15.508  54.203   95.909  1.00 16.51 ? 130  ARG D CB  1 
ATOM   9249  C  CG  . ARG D  1 48  ? 14.542  53.882   94.788  1.00 18.47 ? 130  ARG D CG  1 
ATOM   9250  C  CD  . ARG D  1 48  ? 14.538  52.387   94.478  1.00 21.52 ? 130  ARG D CD  1 
ATOM   9251  N  NE  . ARG D  1 48  ? 14.043  51.603   95.607  1.00 20.49 ? 130  ARG D NE  1 
ATOM   9252  C  CZ  . ARG D  1 48  ? 12.786  51.622   96.026  1.00 17.85 ? 130  ARG D CZ  1 
ATOM   9253  N  NH1 . ARG D  1 48  ? 12.423  50.884   97.066  1.00 16.34 ? 130  ARG D NH1 1 
ATOM   9254  N  NH2 . ARG D  1 48  ? 11.897  52.371   95.392  1.00 16.30 ? 130  ARG D NH2 1 
ATOM   9255  N  N   . THR D  1 49  ? 16.236  55.577   98.599  1.00 17.36 ? 131  THR D N   1 
ATOM   9256  C  CA  . THR D  1 49  ? 17.156  55.654   99.713  1.00 16.03 ? 131  THR D CA  1 
ATOM   9257  C  C   . THR D  1 49  ? 17.415  54.207   100.070 1.00 15.17 ? 131  THR D C   1 
ATOM   9258  O  O   . THR D  1 49  ? 16.483  53.465   100.358 1.00 16.59 ? 131  THR D O   1 
ATOM   9259  C  CB  . THR D  1 49  ? 16.531  56.342   100.938 1.00 16.66 ? 131  THR D CB  1 
ATOM   9260  O  OG1 . THR D  1 49  ? 16.545  57.759   100.746 1.00 19.10 ? 131  THR D OG1 1 
ATOM   9261  C  CG2 . THR D  1 49  ? 17.309  56.003   102.208 1.00 16.35 ? 131  THR D CG2 1 
ATOM   9262  N  N   . PHE D  1 50  ? 18.669  53.792   100.010 1.00 13.91 ? 132  PHE D N   1 
ATOM   9263  C  CA  . PHE D  1 50  ? 19.025  52.436   100.398 1.00 12.99 ? 132  PHE D CA  1 
ATOM   9264  C  C   . PHE D  1 50  ? 19.517  52.570   101.827 1.00 13.51 ? 132  PHE D C   1 
ATOM   9265  O  O   . PHE D  1 50  ? 19.850  53.670   102.267 1.00 14.74 ? 132  PHE D O   1 
ATOM   9266  C  CB  . PHE D  1 50  ? 20.140  51.883   99.506  1.00 10.33 ? 132  PHE D CB  1 
ATOM   9267  C  CG  . PHE D  1 50  ? 19.708  51.647   98.095  1.00 9.36  ? 132  PHE D CG  1 
ATOM   9268  C  CD1 . PHE D  1 50  ? 19.513  52.710   97.228  1.00 8.84  ? 132  PHE D CD1 1 
ATOM   9269  C  CD2 . PHE D  1 50  ? 19.432  50.358   97.650  1.00 10.27 ? 132  PHE D CD2 1 
ATOM   9270  C  CE1 . PHE D  1 50  ? 19.044  52.492   95.933  1.00 10.55 ? 132  PHE D CE1 1 
ATOM   9271  C  CE2 . PHE D  1 50  ? 18.963  50.125   96.362  1.00 9.96  ? 132  PHE D CE2 1 
ATOM   9272  C  CZ  . PHE D  1 50  ? 18.768  51.195   95.502  1.00 11.22 ? 132  PHE D CZ  1 
ATOM   9273  N  N   . PHE D  1 51  ? 19.542  51.467   102.561 1.00 13.69 ? 133  PHE D N   1 
ATOM   9274  C  CA  . PHE D  1 51  ? 20.015  51.504   103.932 1.00 14.51 ? 133  PHE D CA  1 
ATOM   9275  C  C   . PHE D  1 51  ? 20.191  50.080   104.410 1.00 16.05 ? 133  PHE D C   1 
ATOM   9276  O  O   . PHE D  1 51  ? 19.732  49.149   103.747 1.00 16.56 ? 133  PHE D O   1 
ATOM   9277  C  CB  . PHE D  1 51  ? 19.010  52.246   104.801 1.00 13.33 ? 133  PHE D CB  1 
ATOM   9278  C  CG  . PHE D  1 51  ? 17.620  51.703   104.710 1.00 14.63 ? 133  PHE D CG  1 
ATOM   9279  C  CD1 . PHE D  1 51  ? 17.209  50.664   105.537 1.00 15.03 ? 133  PHE D CD1 1 
ATOM   9280  C  CD2 . PHE D  1 51  ? 16.719  52.220   103.788 1.00 14.88 ? 133  PHE D CD2 1 
ATOM   9281  C  CE1 . PHE D  1 51  ? 15.914  50.144   105.451 1.00 14.54 ? 133  PHE D CE1 1 
ATOM   9282  C  CE2 . PHE D  1 51  ? 15.424  51.709   103.692 1.00 15.61 ? 133  PHE D CE2 1 
ATOM   9283  C  CZ  . PHE D  1 51  ? 15.023  50.664   104.529 1.00 15.37 ? 133  PHE D CZ  1 
ATOM   9284  N  N   . LEU D  1 52  ? 20.880  49.913   105.537 1.00 16.68 ? 134  LEU D N   1 
ATOM   9285  C  CA  . LEU D  1 52  ? 21.111  48.597   106.122 1.00 17.59 ? 134  LEU D CA  1 
ATOM   9286  C  C   . LEU D  1 52  ? 20.385  48.550   107.447 1.00 20.56 ? 134  LEU D C   1 
ATOM   9287  O  O   . LEU D  1 52  ? 20.449  49.509   108.221 1.00 21.76 ? 134  LEU D O   1 
ATOM   9288  C  CB  . LEU D  1 52  ? 22.597  48.360   106.380 1.00 16.40 ? 134  LEU D CB  1 
ATOM   9289  C  CG  . LEU D  1 52  ? 23.564  48.311   105.195 1.00 16.17 ? 134  LEU D CG  1 
ATOM   9290  C  CD1 . LEU D  1 52  ? 24.958  47.982   105.731 1.00 14.99 ? 134  LEU D CD1 1 
ATOM   9291  C  CD2 . LEU D  1 52  ? 23.123  47.271   104.179 1.00 13.15 ? 134  LEU D CD2 1 
ATOM   9292  N  N   . THR D  1 53  ? 19.717  47.434   107.724 1.00 21.93 ? 135  THR D N   1 
ATOM   9293  C  CA  . THR D  1 53  ? 18.983  47.297   108.966 1.00 24.55 ? 135  THR D CA  1 
ATOM   9294  C  C   . THR D  1 53  ? 19.286  45.995   109.675 1.00 26.36 ? 135  THR D C   1 
ATOM   9295  O  O   . THR D  1 53  ? 19.451  44.956   109.043 1.00 27.35 ? 135  THR D O   1 
ATOM   9296  C  CB  . THR D  1 53  ? 17.456  47.356   108.727 1.00 24.82 ? 135  THR D CB  1 
ATOM   9297  O  OG1 . THR D  1 53  ? 17.048  46.275   107.875 1.00 24.45 ? 135  THR D OG1 1 
ATOM   9298  C  CG2 . THR D  1 53  ? 17.083  48.654   108.071 1.00 27.28 ? 135  THR D CG2 1 
ATOM   9299  N  N   . GLN D  1 54  ? 19.347  46.065   110.999 1.00 28.82 ? 136  GLN D N   1 
ATOM   9300  C  CA  . GLN D  1 54  ? 19.590  44.895   111.823 1.00 31.06 ? 136  GLN D CA  1 
ATOM   9301  C  C   . GLN D  1 54  ? 18.284  44.114   111.879 1.00 30.51 ? 136  GLN D C   1 
ATOM   9302  O  O   . GLN D  1 54  ? 18.152  43.149   112.630 1.00 32.40 ? 136  GLN D O   1 
ATOM   9303  C  CB  . GLN D  1 54  ? 19.982  45.321   113.239 1.00 35.41 ? 136  GLN D CB  1 
ATOM   9304  C  CG  . GLN D  1 54  ? 21.468  45.589   113.457 1.00 41.42 ? 136  GLN D CG  1 
ATOM   9305  C  CD  . GLN D  1 54  ? 22.304  44.309   113.489 1.00 45.17 ? 136  GLN D CD  1 
ATOM   9306  O  OE1 . GLN D  1 54  ? 21.952  43.327   114.159 1.00 46.64 ? 136  GLN D OE1 1 
ATOM   9307  N  NE2 . GLN D  1 54  ? 23.426  44.324   112.777 1.00 47.08 ? 136  GLN D NE2 1 
ATOM   9308  N  N   . GLY D  1 55  ? 17.312  44.542   111.086 1.00 27.86 ? 137  GLY D N   1 
ATOM   9309  C  CA  . GLY D  1 55  ? 16.028  43.869   111.082 1.00 26.02 ? 137  GLY D CA  1 
ATOM   9310  C  C   . GLY D  1 55  ? 15.252  44.128   112.361 1.00 24.64 ? 137  GLY D C   1 
ATOM   9311  O  O   . GLY D  1 55  ? 14.534  43.257   112.851 1.00 26.64 ? 137  GLY D O   1 
ATOM   9312  N  N   . ALA D  1 56  ? 15.387  45.329   112.905 1.00 21.85 ? 138  ALA D N   1 
ATOM   9313  C  CA  . ALA D  1 56  ? 14.696  45.686   114.135 1.00 19.43 ? 138  ALA D CA  1 
ATOM   9314  C  C   . ALA D  1 56  ? 14.052  47.065   114.005 1.00 18.61 ? 138  ALA D C   1 
ATOM   9315  O  O   . ALA D  1 56  ? 14.547  47.922   113.272 1.00 20.53 ? 138  ALA D O   1 
ATOM   9316  C  CB  . ALA D  1 56  ? 15.685  45.678   115.293 1.00 17.41 ? 138  ALA D CB  1 
ATOM   9317  N  N   . LEU D  1 57  ? 12.944  47.282   114.700 1.00 15.62 ? 139  LEU D N   1 
ATOM   9318  C  CA  . LEU D  1 57  ? 12.289  48.581   114.645 1.00 15.47 ? 139  LEU D CA  1 
ATOM   9319  C  C   . LEU D  1 57  ? 12.661  49.406   115.871 1.00 16.73 ? 139  LEU D C   1 
ATOM   9320  O  O   . LEU D  1 57  ? 13.018  48.861   116.927 1.00 15.46 ? 139  LEU D O   1 
ATOM   9321  C  CB  . LEU D  1 57  ? 10.768  48.424   114.591 1.00 14.81 ? 139  LEU D CB  1 
ATOM   9322  C  CG  . LEU D  1 57  ? 10.247  47.496   113.493 1.00 13.96 ? 139  LEU D CG  1 
ATOM   9323  C  CD1 . LEU D  1 57  ? 8.735   47.482   113.512 1.00 12.85 ? 139  LEU D CD1 1 
ATOM   9324  C  CD2 . LEU D  1 57  ? 10.783  47.948   112.141 1.00 11.40 ? 139  LEU D CD2 1 
ATOM   9325  N  N   . LEU D  1 58  ? 12.591  50.725   115.720 1.00 16.19 ? 140  LEU D N   1 
ATOM   9326  C  CA  . LEU D  1 58  ? 12.891  51.625   116.820 1.00 16.91 ? 140  LEU D CA  1 
ATOM   9327  C  C   . LEU D  1 58  ? 11.909  51.359   117.954 1.00 17.97 ? 140  LEU D C   1 
ATOM   9328  O  O   . LEU D  1 58  ? 10.768  50.965   117.724 1.00 17.01 ? 140  LEU D O   1 
ATOM   9329  C  CB  . LEU D  1 58  ? 12.755  53.075   116.364 1.00 15.65 ? 140  LEU D CB  1 
ATOM   9330  C  CG  . LEU D  1 58  ? 13.860  53.572   115.446 1.00 14.45 ? 140  LEU D CG  1 
ATOM   9331  C  CD1 . LEU D  1 58  ? 13.365  54.762   114.645 1.00 15.97 ? 140  LEU D CD1 1 
ATOM   9332  C  CD2 . LEU D  1 58  ? 15.074  53.937   116.293 1.00 15.83 ? 140  LEU D CD2 1 
ATOM   9333  N  N   . ASN D  1 59  ? 12.366  51.593   119.176 1.00 19.90 ? 141  ASN D N   1 
ATOM   9334  C  CA  . ASN D  1 59  ? 11.573  51.397   120.377 1.00 20.83 ? 141  ASN D CA  1 
ATOM   9335  C  C   . ASN D  1 59  ? 11.176  49.980   120.688 1.00 21.59 ? 141  ASN D C   1 
ATOM   9336  O  O   . ASN D  1 59  ? 10.282  49.746   121.496 1.00 22.35 ? 141  ASN D O   1 
ATOM   9337  C  CB  . ASN D  1 59  ? 10.330  52.269   120.367 1.00 21.99 ? 141  ASN D CB  1 
ATOM   9338  C  CG  . ASN D  1 59  ? 10.371  53.302   121.457 1.00 23.90 ? 141  ASN D CG  1 
ATOM   9339  O  OD1 . ASN D  1 59  ? 11.067  53.115   122.459 1.00 23.94 ? 141  ASN D OD1 1 
ATOM   9340  N  ND2 . ASN D  1 59  ? 9.628   54.395   121.287 1.00 25.70 ? 141  ASN D ND2 1 
ATOM   9341  N  N   . ASP D  1 60  ? 11.829  49.030   120.040 1.00 22.04 ? 142  ASP D N   1 
ATOM   9342  C  CA  . ASP D  1 60  ? 11.564  47.637   120.323 1.00 23.68 ? 142  ASP D CA  1 
ATOM   9343  C  C   . ASP D  1 60  ? 12.853  47.083   120.911 1.00 24.75 ? 142  ASP D C   1 
ATOM   9344  O  O   . ASP D  1 60  ? 13.942  47.525   120.547 1.00 24.89 ? 142  ASP D O   1 
ATOM   9345  C  CB  . ASP D  1 60  ? 11.213  46.864   119.064 1.00 24.78 ? 142  ASP D CB  1 
ATOM   9346  C  CG  . ASP D  1 60  ? 11.002  45.397   119.346 1.00 25.74 ? 142  ASP D CG  1 
ATOM   9347  O  OD1 . ASP D  1 60  ? 10.019  45.070   120.052 1.00 28.05 ? 142  ASP D OD1 1 
ATOM   9348  O  OD2 . ASP D  1 60  ? 11.828  44.579   118.885 1.00 25.76 ? 142  ASP D OD2 1 
ATOM   9349  N  N   . LYS D  1 61  ? 12.728  46.116   121.814 1.00 25.25 ? 143  LYS D N   1 
ATOM   9350  C  CA  . LYS D  1 61  ? 13.885  45.526   122.473 1.00 24.32 ? 143  LYS D CA  1 
ATOM   9351  C  C   . LYS D  1 61  ? 14.924  45.029   121.490 1.00 24.75 ? 143  LYS D C   1 
ATOM   9352  O  O   . LYS D  1 61  ? 16.119  45.086   121.770 1.00 24.93 ? 143  LYS D O   1 
ATOM   9353  C  CB  . LYS D  1 61  ? 13.452  44.369   123.377 1.00 23.75 ? 143  LYS D CB  1 
ATOM   9354  C  CG  . LYS D  1 61  ? 12.959  43.129   122.631 1.00 23.82 ? 143  LYS D CG  1 
ATOM   9355  C  CD  . LYS D  1 61  ? 12.521  42.054   123.606 1.00 23.01 ? 143  LYS D CD  1 
ATOM   9356  C  CE  . LYS D  1 61  ? 12.076  40.796   122.899 1.00 22.78 ? 143  LYS D CE  1 
ATOM   9357  N  NZ  . LYS D  1 61  ? 11.608  39.786   123.883 1.00 23.71 ? 143  LYS D NZ  1 
ATOM   9358  N  N   . HIS D  1 62  ? 14.476  44.551   120.334 1.00 25.31 ? 144  HIS D N   1 
ATOM   9359  C  CA  . HIS D  1 62  ? 15.406  44.028   119.337 1.00 26.18 ? 144  HIS D CA  1 
ATOM   9360  C  C   . HIS D  1 62  ? 16.360  45.054   118.772 1.00 26.13 ? 144  HIS D C   1 
ATOM   9361  O  O   . HIS D  1 62  ? 17.215  44.714   117.958 1.00 26.34 ? 144  HIS D O   1 
ATOM   9362  C  CB  . HIS D  1 62  ? 14.648  43.360   118.194 1.00 25.61 ? 144  HIS D CB  1 
ATOM   9363  C  CG  . HIS D  1 62  ? 13.965  42.096   118.595 1.00 26.95 ? 144  HIS D CG  1 
ATOM   9364  N  ND1 . HIS D  1 62  ? 14.650  40.941   118.902 1.00 28.83 ? 144  HIS D ND1 1 
ATOM   9365  C  CD2 . HIS D  1 62  ? 12.653  41.811   118.776 1.00 27.84 ? 144  HIS D CD2 1 
ATOM   9366  C  CE1 . HIS D  1 62  ? 13.794  39.999   119.253 1.00 28.15 ? 144  HIS D CE1 1 
ATOM   9367  N  NE2 . HIS D  1 62  ? 12.574  40.505   119.184 1.00 29.59 ? 144  HIS D NE2 1 
ATOM   9368  N  N   . SER D  1 63  ? 16.215  46.305   119.191 1.00 27.36 ? 145  SER D N   1 
ATOM   9369  C  CA  . SER D  1 63  ? 17.103  47.356   118.712 1.00 28.91 ? 145  SER D CA  1 
ATOM   9370  C  C   . SER D  1 63  ? 18.288  47.465   119.663 1.00 31.62 ? 145  SER D C   1 
ATOM   9371  O  O   . SER D  1 63  ? 19.111  48.364   119.525 1.00 31.84 ? 145  SER D O   1 
ATOM   9372  C  CB  . SER D  1 63  ? 16.371  48.701   118.631 1.00 27.59 ? 145  SER D CB  1 
ATOM   9373  O  OG  . SER D  1 63  ? 16.135  49.259   119.913 1.00 25.01 ? 145  SER D OG  1 
ATOM   9374  N  N   . ASN D  1 64  ? 18.368  46.523   120.606 1.00 35.47 ? 146  ASN D N   1 
ATOM   9375  C  CA  . ASN D  1 64  ? 19.420  46.457   121.624 1.00 39.14 ? 146  ASN D CA  1 
ATOM   9376  C  C   . ASN D  1 64  ? 20.799  46.924   121.167 1.00 41.78 ? 146  ASN D C   1 
ATOM   9377  O  O   . ASN D  1 64  ? 21.600  47.372   121.975 1.00 43.61 ? 146  ASN D O   1 
ATOM   9378  C  CB  . ASN D  1 64  ? 19.516  45.036   122.171 1.00 41.05 ? 146  ASN D CB  1 
ATOM   9379  C  CG  . ASN D  1 64  ? 20.190  44.974   123.529 1.00 43.42 ? 146  ASN D CG  1 
ATOM   9380  O  OD1 . ASN D  1 64  ? 21.358  45.320   123.677 1.00 43.94 ? 146  ASN D OD1 1 
ATOM   9381  N  ND2 . ASN D  1 64  ? 19.448  44.524   124.530 1.00 45.31 ? 146  ASN D ND2 1 
ATOM   9382  N  N   . GLY D  1 65  ? 21.093  46.793   119.882 1.00 44.11 ? 147  GLY D N   1 
ATOM   9383  C  CA  . GLY D  1 65  ? 22.366  47.273   119.367 1.00 47.24 ? 147  GLY D CA  1 
ATOM   9384  C  C   . GLY D  1 65  ? 23.702  46.866   119.975 1.00 49.56 ? 147  GLY D C   1 
ATOM   9385  O  O   . GLY D  1 65  ? 24.737  47.350   119.517 1.00 49.94 ? 147  GLY D O   1 
ATOM   9386  N  N   . THR D  1 66  ? 23.729  46.018   120.998 1.00 51.83 ? 148  THR D N   1 
ATOM   9387  C  CA  . THR D  1 66  ? 25.033  45.611   121.525 1.00 54.53 ? 148  THR D CA  1 
ATOM   9388  C  C   . THR D  1 66  ? 25.612  44.616   120.516 1.00 55.39 ? 148  THR D C   1 
ATOM   9389  O  O   . THR D  1 66  ? 26.812  44.339   120.507 1.00 57.61 ? 148  THR D O   1 
ATOM   9390  C  CB  . THR D  1 66  ? 24.952  44.936   122.926 1.00 54.61 ? 148  THR D CB  1 
ATOM   9391  O  OG1 . THR D  1 66  ? 23.998  43.867   122.898 1.00 56.60 ? 148  THR D OG1 1 
ATOM   9392  C  CG2 . THR D  1 66  ? 24.575  45.956   123.997 1.00 54.72 ? 148  THR D CG2 1 
ATOM   9393  N  N   . VAL D  1 67  ? 24.740  44.098   119.656 1.00 55.18 ? 149  VAL D N   1 
ATOM   9394  C  CA  . VAL D  1 67  ? 25.126  43.154   118.611 1.00 54.53 ? 149  VAL D CA  1 
ATOM   9395  C  C   . VAL D  1 67  ? 26.364  43.641   117.837 1.00 53.62 ? 149  VAL D C   1 
ATOM   9396  O  O   . VAL D  1 67  ? 26.662  44.839   117.793 1.00 52.76 ? 149  VAL D O   1 
ATOM   9397  C  CB  . VAL D  1 67  ? 23.964  42.963   117.583 1.00 54.72 ? 149  VAL D CB  1 
ATOM   9398  C  CG1 . VAL D  1 67  ? 24.296  41.847   116.604 1.00 54.75 ? 149  VAL D CG1 1 
ATOM   9399  C  CG2 . VAL D  1 67  ? 22.664  42.658   118.309 1.00 55.70 ? 149  VAL D CG2 1 
ATOM   9400  N  N   . LYS D  1 68  ? 27.080  42.694   117.240 1.00 52.25 ? 150  LYS D N   1 
ATOM   9401  C  CA  . LYS D  1 68  ? 28.254  42.982   116.425 1.00 50.27 ? 150  LYS D CA  1 
ATOM   9402  C  C   . LYS D  1 68  ? 27.754  43.746   115.193 1.00 48.58 ? 150  LYS D C   1 
ATOM   9403  O  O   . LYS D  1 68  ? 26.637  43.514   114.735 1.00 48.30 ? 150  LYS D O   1 
ATOM   9404  C  CB  . LYS D  1 68  ? 28.895  41.663   115.986 1.00 51.20 ? 150  LYS D CB  1 
ATOM   9405  C  CG  . LYS D  1 68  ? 27.850  40.599   115.627 1.00 53.73 ? 150  LYS D CG  1 
ATOM   9406  C  CD  . LYS D  1 68  ? 28.323  39.589   114.574 1.00 55.96 ? 150  LYS D CD  1 
ATOM   9407  C  CE  . LYS D  1 68  ? 29.426  38.659   115.077 1.00 56.95 ? 150  LYS D CE  1 
ATOM   9408  N  NZ  . LYS D  1 68  ? 29.869  37.713   114.000 1.00 56.95 ? 150  LYS D NZ  1 
ATOM   9409  N  N   . ASP D  1 69  ? 28.569  44.650   114.657 1.00 46.47 ? 151  ASP D N   1 
ATOM   9410  C  CA  . ASP D  1 69  ? 28.171  45.415   113.477 1.00 44.00 ? 151  ASP D CA  1 
ATOM   9411  C  C   . ASP D  1 69  ? 27.802  44.505   112.312 1.00 40.50 ? 151  ASP D C   1 
ATOM   9412  O  O   . ASP D  1 69  ? 26.791  44.710   111.634 1.00 40.23 ? 151  ASP D O   1 
ATOM   9413  C  CB  . ASP D  1 69  ? 29.304  46.347   113.038 1.00 48.64 ? 151  ASP D CB  1 
ATOM   9414  C  CG  . ASP D  1 69  ? 29.423  47.575   113.920 1.00 53.23 ? 151  ASP D CG  1 
ATOM   9415  O  OD1 . ASP D  1 69  ? 28.470  48.391   113.921 1.00 55.36 ? 151  ASP D OD1 1 
ATOM   9416  O  OD2 . ASP D  1 69  ? 30.462  47.723   114.609 1.00 54.37 ? 151  ASP D OD2 1 
ATOM   9417  N  N   . ARG D  1 70  ? 28.629  43.494   112.087 1.00 35.23 ? 152  ARG D N   1 
ATOM   9418  C  CA  . ARG D  1 70  ? 28.414  42.566   110.996 1.00 30.60 ? 152  ARG D CA  1 
ATOM   9419  C  C   . ARG D  1 70  ? 27.611  41.336   111.402 1.00 28.81 ? 152  ARG D C   1 
ATOM   9420  O  O   . ARG D  1 70  ? 28.157  40.239   111.515 1.00 28.33 ? 152  ARG D O   1 
ATOM   9421  C  CB  . ARG D  1 70  ? 29.769  42.138   110.423 1.00 28.94 ? 152  ARG D CB  1 
ATOM   9422  C  CG  . ARG D  1 70  ? 30.571  43.273   109.803 1.00 25.54 ? 152  ARG D CG  1 
ATOM   9423  C  CD  . ARG D  1 70  ? 31.924  42.783   109.326 1.00 22.94 ? 152  ARG D CD  1 
ATOM   9424  N  NE  . ARG D  1 70  ? 32.764  42.388   110.448 1.00 22.42 ? 152  ARG D NE  1 
ATOM   9425  C  CZ  . ARG D  1 70  ? 33.313  43.245   111.301 1.00 22.75 ? 152  ARG D CZ  1 
ATOM   9426  N  NH1 . ARG D  1 70  ? 34.062  42.803   112.300 1.00 20.64 ? 152  ARG D NH1 1 
ATOM   9427  N  NH2 . ARG D  1 70  ? 33.122  44.548   111.143 1.00 22.85 ? 152  ARG D NH2 1 
ATOM   9428  N  N   . SER D  1 71  ? 26.310  41.502   111.611 1.00 26.25 ? 153  SER D N   1 
ATOM   9429  C  CA  . SER D  1 71  ? 25.497  40.356   111.997 1.00 23.73 ? 153  SER D CA  1 
ATOM   9430  C  C   . SER D  1 71  ? 24.794  39.739   110.796 1.00 20.75 ? 153  SER D C   1 
ATOM   9431  O  O   . SER D  1 71  ? 24.588  40.394   109.782 1.00 19.68 ? 153  SER D O   1 
ATOM   9432  C  CB  . SER D  1 71  ? 24.458  40.754   113.039 1.00 24.71 ? 153  SER D CB  1 
ATOM   9433  O  OG  . SER D  1 71  ? 23.346  41.372   112.421 1.00 30.57 ? 153  SER D OG  1 
ATOM   9434  N  N   . PRO D  1 72  ? 24.423  38.453   110.895 1.00 19.76 ? 154  PRO D N   1 
ATOM   9435  C  CA  . PRO D  1 72  ? 23.736  37.780   109.790 1.00 17.51 ? 154  PRO D CA  1 
ATOM   9436  C  C   . PRO D  1 72  ? 22.326  38.324   109.594 1.00 16.59 ? 154  PRO D C   1 
ATOM   9437  O  O   . PRO D  1 72  ? 21.647  37.948   108.650 1.00 16.77 ? 154  PRO D O   1 
ATOM   9438  C  CB  . PRO D  1 72  ? 23.730  36.321   110.228 1.00 17.46 ? 154  PRO D CB  1 
ATOM   9439  C  CG  . PRO D  1 72  ? 23.627  36.436   111.733 1.00 17.56 ? 154  PRO D CG  1 
ATOM   9440  C  CD  . PRO D  1 72  ? 24.628  37.528   112.028 1.00 18.56 ? 154  PRO D CD  1 
ATOM   9441  N  N   . HIS D  1 73  ? 21.900  39.220   110.481 1.00 15.62 ? 155  HIS D N   1 
ATOM   9442  C  CA  . HIS D  1 73  ? 20.569  39.818   110.407 1.00 15.90 ? 155  HIS D CA  1 
ATOM   9443  C  C   . HIS D  1 73  ? 20.551  41.130   109.638 1.00 17.31 ? 155  HIS D C   1 
ATOM   9444  O  O   . HIS D  1 73  ? 19.492  41.694   109.386 1.00 19.38 ? 155  HIS D O   1 
ATOM   9445  C  CB  . HIS D  1 73  ? 20.046  40.067   111.814 1.00 16.80 ? 155  HIS D CB  1 
ATOM   9446  C  CG  . HIS D  1 73  ? 20.083  38.856   112.685 1.00 17.31 ? 155  HIS D CG  1 
ATOM   9447  N  ND1 . HIS D  1 73  ? 20.579  38.881   113.970 1.00 17.68 ? 155  HIS D ND1 1 
ATOM   9448  C  CD2 . HIS D  1 73  ? 19.720  37.573   112.442 1.00 17.30 ? 155  HIS D CD2 1 
ATOM   9449  C  CE1 . HIS D  1 73  ? 20.524  37.662   114.481 1.00 20.71 ? 155  HIS D CE1 1 
ATOM   9450  N  NE2 . HIS D  1 73  ? 20.007  36.850   113.574 1.00 18.58 ? 155  HIS D NE2 1 
ATOM   9451  N  N   . ARG D  1 74  ? 21.723  41.624   109.271 1.00 16.99 ? 156  ARG D N   1 
ATOM   9452  C  CA  . ARG D  1 74  ? 21.804  42.875   108.547 1.00 17.38 ? 156  ARG D CA  1 
ATOM   9453  C  C   . ARG D  1 74  ? 21.334  42.647   107.109 1.00 18.14 ? 156  ARG D C   1 
ATOM   9454  O  O   . ARG D  1 74  ? 21.756  41.693   106.443 1.00 17.78 ? 156  ARG D O   1 
ATOM   9455  C  CB  . ARG D  1 74  ? 23.248  43.388   108.559 1.00 18.57 ? 156  ARG D CB  1 
ATOM   9456  C  CG  . ARG D  1 74  ? 23.407  44.900   108.619 1.00 19.79 ? 156  ARG D CG  1 
ATOM   9457  C  CD  . ARG D  1 74  ? 23.743  45.350   110.036 1.00 22.13 ? 156  ARG D CD  1 
ATOM   9458  N  NE  . ARG D  1 74  ? 24.036  46.781   110.147 1.00 24.25 ? 156  ARG D NE  1 
ATOM   9459  C  CZ  . ARG D  1 74  ? 25.110  47.382   109.636 1.00 23.85 ? 156  ARG D CZ  1 
ATOM   9460  N  NH1 . ARG D  1 74  ? 25.280  48.688   109.798 1.00 21.34 ? 156  ARG D NH1 1 
ATOM   9461  N  NH2 . ARG D  1 74  ? 26.016  46.683   108.966 1.00 23.60 ? 156  ARG D NH2 1 
ATOM   9462  N  N   . THR D  1 75  ? 20.449  43.518   106.638 1.00 16.95 ? 157  THR D N   1 
ATOM   9463  C  CA  . THR D  1 75  ? 19.942  43.417   105.282 1.00 17.84 ? 157  THR D CA  1 
ATOM   9464  C  C   . THR D  1 75  ? 19.960  44.766   104.589 1.00 16.89 ? 157  THR D C   1 
ATOM   9465  O  O   . THR D  1 75  ? 19.769  45.803   105.219 1.00 17.16 ? 157  THR D O   1 
ATOM   9466  C  CB  . THR D  1 75  ? 18.479  42.918   105.244 1.00 20.04 ? 157  THR D CB  1 
ATOM   9467  O  OG1 . THR D  1 75  ? 17.677  43.737   106.109 1.00 21.00 ? 157  THR D OG1 1 
ATOM   9468  C  CG2 . THR D  1 75  ? 18.389  41.440   105.652 1.00 18.97 ? 157  THR D CG2 1 
ATOM   9469  N  N   . LEU D  1 76  ? 20.204  44.745   103.285 1.00 16.10 ? 158  LEU D N   1 
ATOM   9470  C  CA  . LEU D  1 76  ? 20.179  45.963   102.495 1.00 13.43 ? 158  LEU D CA  1 
ATOM   9471  C  C   . LEU D  1 76  ? 18.749  46.068   102.002 1.00 13.23 ? 158  LEU D C   1 
ATOM   9472  O  O   . LEU D  1 76  ? 18.182  45.081   101.530 1.00 13.64 ? 158  LEU D O   1 
ATOM   9473  C  CB  . LEU D  1 76  ? 21.108  45.877   101.284 1.00 11.04 ? 158  LEU D CB  1 
ATOM   9474  C  CG  . LEU D  1 76  ? 20.971  47.109   100.371 1.00 12.45 ? 158  LEU D CG  1 
ATOM   9475  C  CD1 . LEU D  1 76  ? 21.297  48.392   101.175 1.00 11.29 ? 158  LEU D CD1 1 
ATOM   9476  C  CD2 . LEU D  1 76  ? 21.888  46.980   99.168  1.00 8.50  ? 158  LEU D CD2 1 
ATOM   9477  N  N   . MET D  1 77  ? 18.160  47.251   102.137 1.00 13.34 ? 159  MET D N   1 
ATOM   9478  C  CA  . MET D  1 77  ? 16.797  47.494   101.678 1.00 13.79 ? 159  MET D CA  1 
ATOM   9479  C  C   . MET D  1 77  ? 16.711  48.922   101.149 1.00 13.61 ? 159  MET D C   1 
ATOM   9480  O  O   . MET D  1 77  ? 17.653  49.700   101.303 1.00 13.17 ? 159  MET D O   1 
ATOM   9481  C  CB  . MET D  1 77  ? 15.801  47.296   102.814 1.00 13.89 ? 159  MET D CB  1 
ATOM   9482  C  CG  . MET D  1 77  ? 15.750  45.878   103.337 1.00 17.94 ? 159  MET D CG  1 
ATOM   9483  S  SD  . MET D  1 77  ? 14.293  45.611   104.367 1.00 23.77 ? 159  MET D SD  1 
ATOM   9484  C  CE  . MET D  1 77  ? 14.921  46.149   105.944 1.00 23.77 ? 159  MET D CE  1 
ATOM   9485  N  N   . SER D  1 78  ? 15.595  49.260   100.512 1.00 14.18 ? 160  SER D N   1 
ATOM   9486  C  CA  . SER D  1 78  ? 15.422  50.602   99.973  1.00 15.15 ? 160  SER D CA  1 
ATOM   9487  C  C   . SER D  1 78  ? 13.969  51.035   99.947  1.00 17.03 ? 160  SER D C   1 
ATOM   9488  O  O   . SER D  1 78  ? 13.050  50.204   99.891  1.00 16.19 ? 160  SER D O   1 
ATOM   9489  C  CB  . SER D  1 78  ? 15.967  50.692   98.548  1.00 13.74 ? 160  SER D CB  1 
ATOM   9490  O  OG  . SER D  1 78  ? 15.000  50.242   97.616  1.00 11.36 ? 160  SER D OG  1 
ATOM   9491  N  N   . CYS D  1 79  ? 13.779  52.350   99.973  1.00 17.06 ? 161  CYS D N   1 
ATOM   9492  C  CA  . CYS D  1 79  ? 12.456  52.940   99.930  1.00 19.61 ? 161  CYS D CA  1 
ATOM   9493  C  C   . CYS D  1 79  ? 12.546  54.284   99.208  1.00 19.71 ? 161  CYS D C   1 
ATOM   9494  O  O   . CYS D  1 79  ? 13.641  54.772   98.916  1.00 19.18 ? 161  CYS D O   1 
ATOM   9495  C  CB  . CYS D  1 79  ? 11.919  53.140   101.347 1.00 19.45 ? 161  CYS D CB  1 
ATOM   9496  S  SG  . CYS D  1 79  ? 12.887  54.277   102.352 1.00 24.60 ? 161  CYS D SG  1 
ATOM   9497  N  N   . PRO D  1 80  ? 11.396  54.887   98.882  1.00 19.88 ? 162  PRO D N   1 
ATOM   9498  C  CA  . PRO D  1 80  ? 11.479  56.178   98.195  1.00 19.86 ? 162  PRO D CA  1 
ATOM   9499  C  C   . PRO D  1 80  ? 12.064  57.282   99.072  1.00 19.77 ? 162  PRO D C   1 
ATOM   9500  O  O   . PRO D  1 80  ? 11.782  57.368   100.269 1.00 20.35 ? 162  PRO D O   1 
ATOM   9501  C  CB  . PRO D  1 80  ? 10.037  56.450   97.761  1.00 19.11 ? 162  PRO D CB  1 
ATOM   9502  C  CG  . PRO D  1 80  ? 9.198   55.497   98.583  1.00 20.80 ? 162  PRO D CG  1 
ATOM   9503  C  CD  . PRO D  1 80  ? 10.054  54.292   98.758  1.00 19.65 ? 162  PRO D CD  1 
ATOM   9504  N  N   . VAL D  1 81  ? 12.889  58.122   98.459  1.00 18.57 ? 163  VAL D N   1 
ATOM   9505  C  CA  . VAL D  1 81  ? 13.541  59.219   99.156  1.00 18.26 ? 163  VAL D CA  1 
ATOM   9506  C  C   . VAL D  1 81  ? 12.588  60.053   99.993  1.00 17.43 ? 163  VAL D C   1 
ATOM   9507  O  O   . VAL D  1 81  ? 11.473  60.354   99.571  1.00 15.93 ? 163  VAL D O   1 
ATOM   9508  C  CB  . VAL D  1 81  ? 14.242  60.171   98.166  1.00 19.20 ? 163  VAL D CB  1 
ATOM   9509  C  CG1 . VAL D  1 81  ? 15.219  61.066   98.911  1.00 19.17 ? 163  VAL D CG1 1 
ATOM   9510  C  CG2 . VAL D  1 81  ? 14.957  59.371   97.098  1.00 21.21 ? 163  VAL D CG2 1 
ATOM   9511  N  N   . GLY D  1 82  ? 13.048  60.432   101.182 1.00 17.78 ? 164  GLY D N   1 
ATOM   9512  C  CA  . GLY D  1 82  ? 12.246  61.255   102.069 1.00 18.25 ? 164  GLY D CA  1 
ATOM   9513  C  C   . GLY D  1 82  ? 11.236  60.495   102.900 1.00 18.47 ? 164  GLY D C   1 
ATOM   9514  O  O   . GLY D  1 82  ? 10.588  61.076   103.770 1.00 19.76 ? 164  GLY D O   1 
ATOM   9515  N  N   . GLU D  1 83  ? 11.085  59.203   102.631 1.00 18.48 ? 165  GLU D N   1 
ATOM   9516  C  CA  . GLU D  1 83  ? 10.140  58.381   103.383 1.00 18.74 ? 165  GLU D CA  1 
ATOM   9517  C  C   . GLU D  1 83  ? 10.825  57.636   104.522 1.00 16.87 ? 165  GLU D C   1 
ATOM   9518  O  O   . GLU D  1 83  ? 11.948  57.160   104.376 1.00 19.55 ? 165  GLU D O   1 
ATOM   9519  C  CB  . GLU D  1 83  ? 9.434   57.391   102.440 1.00 19.45 ? 165  GLU D CB  1 
ATOM   9520  C  CG  . GLU D  1 83  ? 8.373   58.062   101.564 1.00 21.61 ? 165  GLU D CG  1 
ATOM   9521  C  CD  . GLU D  1 83  ? 7.629   57.098   100.653 1.00 22.72 ? 165  GLU D CD  1 
ATOM   9522  O  OE1 . GLU D  1 83  ? 7.350   55.962   101.083 1.00 23.98 ? 165  GLU D OE1 1 
ATOM   9523  O  OE2 . GLU D  1 83  ? 7.306   57.486   99.509  1.00 23.16 ? 165  GLU D OE2 1 
ATOM   9524  N  N   . ALA D  1 84  ? 10.158  57.553   105.665 1.00 15.99 ? 166  ALA D N   1 
ATOM   9525  C  CA  . ALA D  1 84  ? 10.711  56.849   106.816 1.00 15.15 ? 166  ALA D CA  1 
ATOM   9526  C  C   . ALA D  1 84  ? 10.784  55.362   106.478 1.00 15.62 ? 166  ALA D C   1 
ATOM   9527  O  O   . ALA D  1 84  ? 9.767   54.743   106.188 1.00 16.37 ? 166  ALA D O   1 
ATOM   9528  C  CB  . ALA D  1 84  ? 9.834   57.068   108.021 1.00 13.58 ? 166  ALA D CB  1 
ATOM   9529  N  N   . PRO D  1 85  ? 11.988  54.768   106.517 1.00 15.39 ? 167  PRO D N   1 
ATOM   9530  C  CA  . PRO D  1 85  ? 12.133  53.346   106.195 1.00 15.83 ? 167  PRO D CA  1 
ATOM   9531  C  C   . PRO D  1 85  ? 11.409  52.442   107.177 1.00 16.69 ? 167  PRO D C   1 
ATOM   9532  O  O   . PRO D  1 85  ? 11.812  52.316   108.339 1.00 18.76 ? 167  PRO D O   1 
ATOM   9533  C  CB  . PRO D  1 85  ? 13.644  53.141   106.216 1.00 15.88 ? 167  PRO D CB  1 
ATOM   9534  C  CG  . PRO D  1 85  ? 14.077  54.069   107.307 1.00 17.07 ? 167  PRO D CG  1 
ATOM   9535  C  CD  . PRO D  1 85  ? 13.260  55.325   107.015 1.00 16.72 ? 167  PRO D CD  1 
ATOM   9536  N  N   . SER D  1 86  ? 10.333  51.823   106.704 1.00 15.27 ? 168  SER D N   1 
ATOM   9537  C  CA  . SER D  1 86  ? 9.544   50.923   107.524 1.00 15.36 ? 168  SER D CA  1 
ATOM   9538  C  C   . SER D  1 86  ? 9.376   49.601   106.784 1.00 16.00 ? 168  SER D C   1 
ATOM   9539  O  O   . SER D  1 86  ? 9.670   49.501   105.590 1.00 14.84 ? 168  SER D O   1 
ATOM   9540  C  CB  . SER D  1 86  ? 8.163   51.525   107.801 1.00 15.99 ? 168  SER D CB  1 
ATOM   9541  O  OG  . SER D  1 86  ? 7.224   51.135   106.806 1.00 19.81 ? 168  SER D OG  1 
ATOM   9542  N  N   . PRO D  1 87  ? 8.911   48.559   107.489 1.00 16.87 ? 169  PRO D N   1 
ATOM   9543  C  CA  . PRO D  1 87  ? 8.729   47.271   106.810 1.00 16.64 ? 169  PRO D CA  1 
ATOM   9544  C  C   . PRO D  1 87  ? 7.575   47.323   105.812 1.00 16.14 ? 169  PRO D C   1 
ATOM   9545  O  O   . PRO D  1 87  ? 7.435   46.437   104.959 1.00 18.02 ? 169  PRO D O   1 
ATOM   9546  C  CB  . PRO D  1 87  ? 8.483   46.305   107.970 1.00 16.56 ? 169  PRO D CB  1 
ATOM   9547  C  CG  . PRO D  1 87  ? 7.847   47.199   109.025 1.00 16.76 ? 169  PRO D CG  1 
ATOM   9548  C  CD  . PRO D  1 87  ? 8.692   48.436   108.942 1.00 16.20 ? 169  PRO D CD  1 
ATOM   9549  N  N   . TYR D  1 88  A 6.771   48.381   105.933 1.00 15.19 ? 169  TYR D N   1 
ATOM   9550  C  CA  . TYR D  1 88  A 5.602   48.628   105.080 1.00 15.27 ? 169  TYR D CA  1 
ATOM   9551  C  C   . TYR D  1 88  A 5.860   49.417   103.779 1.00 15.90 ? 169  TYR D C   1 
ATOM   9552  O  O   . TYR D  1 88  A 4.999   49.451   102.889 1.00 16.39 ? 169  TYR D O   1 
ATOM   9553  C  CB  . TYR D  1 88  A 4.506   49.338   105.907 1.00 13.25 ? 169  TYR D CB  1 
ATOM   9554  C  CG  . TYR D  1 88  A 4.287   48.721   107.290 1.00 11.46 ? 169  TYR D CG  1 
ATOM   9555  C  CD1 . TYR D  1 88  A 4.066   49.516   108.396 1.00 10.60 ? 169  TYR D CD1 1 
ATOM   9556  C  CD2 . TYR D  1 88  A 4.413   47.346   107.508 1.00 10.73 ? 169  TYR D CD2 1 
ATOM   9557  C  CE1 . TYR D  1 88  A 3.976   48.982   109.661 1.00 11.14 ? 169  TYR D CE1 1 
ATOM   9558  C  CE2 . TYR D  1 88  A 4.323   46.807   108.806 1.00 8.66  ? 169  TYR D CE2 1 
ATOM   9559  C  CZ  . TYR D  1 88  A 4.113   47.653   109.870 1.00 10.80 ? 169  TYR D CZ  1 
ATOM   9560  O  OH  . TYR D  1 88  A 4.040   47.222   111.169 1.00 12.30 ? 169  TYR D OH  1 
ATOM   9561  N  N   . ASN D  1 89  ? 7.021   50.056   103.667 1.00 17.48 ? 170  ASN D N   1 
ATOM   9562  C  CA  . ASN D  1 89  ? 7.337   50.815   102.456 1.00 19.82 ? 170  ASN D CA  1 
ATOM   9563  C  C   . ASN D  1 89  ? 8.725   50.527   101.882 1.00 20.48 ? 170  ASN D C   1 
ATOM   9564  O  O   . ASN D  1 89  ? 9.159   51.192   100.941 1.00 22.35 ? 170  ASN D O   1 
ATOM   9565  C  CB  . ASN D  1 89  ? 7.222   52.315   102.738 1.00 21.09 ? 170  ASN D CB  1 
ATOM   9566  C  CG  . ASN D  1 89  ? 8.410   52.860   103.543 1.00 23.03 ? 170  ASN D CG  1 
ATOM   9567  O  OD1 . ASN D  1 89  ? 8.907   52.205   104.454 1.00 24.02 ? 170  ASN D OD1 1 
ATOM   9568  N  ND2 . ASN D  1 89  ? 8.857   54.067   103.206 1.00 24.65 ? 170  ASN D ND2 1 
ATOM   9569  N  N   . SER D  1 90  ? 9.422   49.555   102.460 1.00 19.66 ? 171  SER D N   1 
ATOM   9570  C  CA  . SER D  1 90  ? 10.753  49.210   102.003 1.00 19.56 ? 171  SER D CA  1 
ATOM   9571  C  C   . SER D  1 90  ? 10.790  47.914   101.220 1.00 19.63 ? 171  SER D C   1 
ATOM   9572  O  O   . SER D  1 90  ? 10.125  46.935   101.570 1.00 19.71 ? 171  SER D O   1 
ATOM   9573  C  CB  . SER D  1 90  ? 11.703  49.100   103.189 1.00 19.30 ? 171  SER D CB  1 
ATOM   9574  O  OG  . SER D  1 90  ? 11.828  50.344   103.846 1.00 23.01 ? 171  SER D OG  1 
ATOM   9575  N  N   . ARG D  1 91  ? 11.581  47.923   100.154 1.00 19.11 ? 172  ARG D N   1 
ATOM   9576  C  CA  . ARG D  1 91  ? 11.761  46.761   99.303  1.00 18.87 ? 172  ARG D CA  1 
ATOM   9577  C  C   . ARG D  1 91  ? 13.027  46.038   99.748  1.00 17.43 ? 172  ARG D C   1 
ATOM   9578  O  O   . ARG D  1 91  ? 14.023  46.673   100.073 1.00 17.13 ? 172  ARG D O   1 
ATOM   9579  C  CB  . ARG D  1 91  ? 11.925  47.200   97.859  1.00 21.51 ? 172  ARG D CB  1 
ATOM   9580  C  CG  . ARG D  1 91  ? 12.402  46.093   96.957  1.00 26.70 ? 172  ARG D CG  1 
ATOM   9581  C  CD  . ARG D  1 91  ? 13.150  46.666   95.774  1.00 30.10 ? 172  ARG D CD  1 
ATOM   9582  N  NE  . ARG D  1 91  ? 12.363  47.661   95.057  1.00 30.90 ? 172  ARG D NE  1 
ATOM   9583  C  CZ  . ARG D  1 91  ? 12.842  48.400   94.061  1.00 32.90 ? 172  ARG D CZ  1 
ATOM   9584  N  NH1 . ARG D  1 91  ? 12.057  49.285   93.458  1.00 34.16 ? 172  ARG D NH1 1 
ATOM   9585  N  NH2 . ARG D  1 91  ? 14.107  48.262   93.676  1.00 30.23 ? 172  ARG D NH2 1 
ATOM   9586  N  N   . PHE D  1 92  ? 12.995  44.713   99.770  1.00 16.72 ? 173  PHE D N   1 
ATOM   9587  C  CA  . PHE D  1 92  ? 14.175  43.955   100.177 1.00 15.55 ? 173  PHE D CA  1 
ATOM   9588  C  C   . PHE D  1 92  ? 15.184  43.967   99.052  1.00 15.91 ? 173  PHE D C   1 
ATOM   9589  O  O   . PHE D  1 92  ? 14.840  43.717   97.896  1.00 17.69 ? 173  PHE D O   1 
ATOM   9590  C  CB  . PHE D  1 92  ? 13.826  42.505   100.490 1.00 12.57 ? 173  PHE D CB  1 
ATOM   9591  C  CG  . PHE D  1 92  ? 15.019  41.665   100.779 1.00 11.35 ? 173  PHE D CG  1 
ATOM   9592  C  CD1 . PHE D  1 92  ? 15.648  41.733   102.019 1.00 11.80 ? 173  PHE D CD1 1 
ATOM   9593  C  CD2 . PHE D  1 92  ? 15.566  40.854   99.796  1.00 11.02 ? 173  PHE D CD2 1 
ATOM   9594  C  CE1 . PHE D  1 92  ? 16.812  41.010   102.276 1.00 9.57  ? 173  PHE D CE1 1 
ATOM   9595  C  CE2 . PHE D  1 92  ? 16.735  40.123   100.044 1.00 11.68 ? 173  PHE D CE2 1 
ATOM   9596  C  CZ  . PHE D  1 92  ? 17.356  40.206   101.288 1.00 10.91 ? 173  PHE D CZ  1 
ATOM   9597  N  N   . GLU D  1 93  ? 16.435  44.251   99.377  1.00 15.89 ? 174  GLU D N   1 
ATOM   9598  C  CA  . GLU D  1 93  ? 17.458  44.275   98.347  1.00 16.87 ? 174  GLU D CA  1 
ATOM   9599  C  C   . GLU D  1 93  ? 18.429  43.104   98.457  1.00 17.35 ? 174  GLU D C   1 
ATOM   9600  O  O   . GLU D  1 93  ? 18.598  42.329   97.516  1.00 18.19 ? 174  GLU D O   1 
ATOM   9601  C  CB  . GLU D  1 93  ? 18.221  45.596   98.401  1.00 16.94 ? 174  GLU D CB  1 
ATOM   9602  C  CG  . GLU D  1 93  ? 17.339  46.818   98.134  1.00 19.76 ? 174  GLU D CG  1 
ATOM   9603  C  CD  . GLU D  1 93  ? 16.846  46.887   96.698  1.00 20.29 ? 174  GLU D CD  1 
ATOM   9604  O  OE1 . GLU D  1 93  ? 16.041  47.785   96.374  1.00 22.43 ? 174  GLU D OE1 1 
ATOM   9605  O  OE2 . GLU D  1 93  ? 17.273  46.043   95.888  1.00 22.58 ? 174  GLU D OE2 1 
ATOM   9606  N  N   . SER D  1 94  ? 19.055  42.947   99.613  1.00 17.97 ? 175  SER D N   1 
ATOM   9607  C  CA  . SER D  1 94  ? 20.017  41.872   99.751  1.00 18.47 ? 175  SER D CA  1 
ATOM   9608  C  C   . SER D  1 94  ? 20.352  41.657   101.217 1.00 16.75 ? 175  SER D C   1 
ATOM   9609  O  O   . SER D  1 94  ? 20.058  42.504   102.056 1.00 16.82 ? 175  SER D O   1 
ATOM   9610  C  CB  . SER D  1 94  ? 21.271  42.259   98.963  1.00 20.27 ? 175  SER D CB  1 
ATOM   9611  O  OG  . SER D  1 94  ? 22.135  41.164   98.757  1.00 26.54 ? 175  SER D OG  1 
ATOM   9612  N  N   . VAL D  1 95  ? 20.935  40.511   101.540 1.00 15.02 ? 176  VAL D N   1 
ATOM   9613  C  CA  . VAL D  1 95  ? 21.331  40.266   102.919 1.00 15.43 ? 176  VAL D CA  1 
ATOM   9614  C  C   . VAL D  1 95  ? 22.765  40.777   102.964 1.00 14.97 ? 176  VAL D C   1 
ATOM   9615  O  O   . VAL D  1 95  ? 23.591  40.326   102.186 1.00 15.18 ? 176  VAL D O   1 
ATOM   9616  C  CB  . VAL D  1 95  ? 21.304  38.766   103.269 1.00 13.64 ? 176  VAL D CB  1 
ATOM   9617  C  CG1 . VAL D  1 95  ? 21.782  38.572   104.685 1.00 12.94 ? 176  VAL D CG1 1 
ATOM   9618  C  CG2 . VAL D  1 95  ? 19.886  38.210   103.104 1.00 12.63 ? 176  VAL D CG2 1 
ATOM   9619  N  N   . ALA D  1 96  ? 23.066  41.722   103.852 1.00 15.35 ? 177  ALA D N   1 
ATOM   9620  C  CA  . ALA D  1 96  ? 24.422  42.262   103.896 1.00 15.09 ? 177  ALA D CA  1 
ATOM   9621  C  C   . ALA D  1 96  ? 24.704  43.140   105.101 1.00 15.05 ? 177  ALA D C   1 
ATOM   9622  O  O   . ALA D  1 96  ? 23.783  43.678   105.713 1.00 16.32 ? 177  ALA D O   1 
ATOM   9623  C  CB  . ALA D  1 96  ? 24.676  43.061   102.636 1.00 14.66 ? 177  ALA D CB  1 
ATOM   9624  N  N   . TRP D  1 97  ? 25.979  43.274   105.451 1.00 13.42 ? 178  TRP D N   1 
ATOM   9625  C  CA  . TRP D  1 97  ? 26.348  44.155   106.544 1.00 14.15 ? 178  TRP D CA  1 
ATOM   9626  C  C   . TRP D  1 97  ? 27.216  45.288   105.993 1.00 14.31 ? 178  TRP D C   1 
ATOM   9627  O  O   . TRP D  1 97  ? 27.676  46.154   106.731 1.00 14.78 ? 178  TRP D O   1 
ATOM   9628  C  CB  . TRP D  1 97  ? 27.054  43.415   107.695 1.00 15.13 ? 178  TRP D CB  1 
ATOM   9629  C  CG  . TRP D  1 97  ? 27.927  42.261   107.331 1.00 17.16 ? 178  TRP D CG  1 
ATOM   9630  C  CD1 . TRP D  1 97  ? 27.647  40.943   107.521 1.00 16.50 ? 178  TRP D CD1 1 
ATOM   9631  C  CD2 . TRP D  1 97  ? 29.254  42.317   106.779 1.00 17.38 ? 178  TRP D CD2 1 
ATOM   9632  N  NE1 . TRP D  1 97  ? 28.714  40.171   107.129 1.00 18.71 ? 178  TRP D NE1 1 
ATOM   9633  C  CE2 . TRP D  1 97  ? 29.715  40.989   106.669 1.00 16.24 ? 178  TRP D CE2 1 
ATOM   9634  C  CE3 . TRP D  1 97  ? 30.095  43.363   106.365 1.00 16.85 ? 178  TRP D CE3 1 
ATOM   9635  C  CZ2 . TRP D  1 97  ? 30.982  40.670   106.169 1.00 16.54 ? 178  TRP D CZ2 1 
ATOM   9636  C  CZ3 . TRP D  1 97  ? 31.361  43.045   105.863 1.00 17.49 ? 178  TRP D CZ3 1 
ATOM   9637  C  CH2 . TRP D  1 97  ? 31.788  41.705   105.769 1.00 16.76 ? 178  TRP D CH2 1 
ATOM   9638  N  N   . SER D  1 98  ? 27.409  45.265   104.675 1.00 14.16 ? 179  SER D N   1 
ATOM   9639  C  CA  . SER D  1 98  ? 28.143  46.288   103.923 1.00 13.61 ? 179  SER D CA  1 
ATOM   9640  C  C   . SER D  1 98  ? 27.594  46.237   102.494 1.00 13.58 ? 179  SER D C   1 
ATOM   9641  O  O   . SER D  1 98  ? 27.371  45.154   101.954 1.00 14.32 ? 179  SER D O   1 
ATOM   9642  C  CB  . SER D  1 98  ? 29.641  46.003   103.908 1.00 13.07 ? 179  SER D CB  1 
ATOM   9643  O  OG  . SER D  1 98  ? 30.239  46.583   102.761 1.00 9.52  ? 179  SER D OG  1 
ATOM   9644  N  N   . ALA D  1 99  ? 27.373  47.384   101.867 1.00 12.75 ? 180  ALA D N   1 
ATOM   9645  C  CA  . ALA D  1 99  ? 26.821  47.329   100.525 1.00 13.87 ? 180  ALA D CA  1 
ATOM   9646  C  C   . ALA D  1 99  ? 26.865  48.617   99.733  1.00 14.64 ? 180  ALA D C   1 
ATOM   9647  O  O   . ALA D  1 99  ? 27.242  49.672   100.238 1.00 16.30 ? 180  ALA D O   1 
ATOM   9648  C  CB  . ALA D  1 99  ? 25.386  46.855   100.603 1.00 14.59 ? 180  ALA D CB  1 
ATOM   9649  N  N   . SER D  1 100 ? 26.471  48.510   98.473  1.00 14.88 ? 181  SER D N   1 
ATOM   9650  C  CA  . SER D  1 100 ? 26.385  49.664   97.596  1.00 17.60 ? 181  SER D CA  1 
ATOM   9651  C  C   . SER D  1 100 ? 25.330  49.337   96.541  1.00 17.22 ? 181  SER D C   1 
ATOM   9652  O  O   . SER D  1 100 ? 24.876  48.191   96.432  1.00 16.45 ? 181  SER D O   1 
ATOM   9653  C  CB  . SER D  1 100 ? 27.732  49.964   96.926  1.00 20.05 ? 181  SER D CB  1 
ATOM   9654  O  OG  . SER D  1 100 ? 28.005  49.061   95.867  1.00 27.38 ? 181  SER D OG  1 
ATOM   9655  N  N   . ALA D  1 101 ? 24.922  50.339   95.776  1.00 16.77 ? 182  ALA D N   1 
ATOM   9656  C  CA  . ALA D  1 101 ? 23.925  50.109   94.748  1.00 16.83 ? 182  ALA D CA  1 
ATOM   9657  C  C   . ALA D  1 101 ? 23.960  51.241   93.766  1.00 18.21 ? 182  ALA D C   1 
ATOM   9658  O  O   . ALA D  1 101 ? 24.435  52.326   94.082  1.00 18.84 ? 182  ALA D O   1 
ATOM   9659  C  CB  . ALA D  1 101 ? 22.535  49.996   95.361  1.00 15.33 ? 182  ALA D CB  1 
ATOM   9660  N  N   . CYS D  1 102 ? 23.488  50.960   92.558  1.00 20.27 ? 183  CYS D N   1 
ATOM   9661  C  CA  . CYS D  1 102 ? 23.406  51.951   91.495  1.00 22.24 ? 183  CYS D CA  1 
ATOM   9662  C  C   . CYS D  1 102 ? 22.601  51.361   90.361  1.00 21.76 ? 183  CYS D C   1 
ATOM   9663  O  O   . CYS D  1 102 ? 22.403  50.153   90.299  1.00 22.88 ? 183  CYS D O   1 
ATOM   9664  C  CB  . CYS D  1 102 ? 24.787  52.378   91.004  1.00 22.33 ? 183  CYS D CB  1 
ATOM   9665  S  SG  . CYS D  1 102 ? 25.863  51.015   90.497  1.00 28.08 ? 183  CYS D SG  1 
ATOM   9666  N  N   . HIS D  1 103 ? 22.136  52.232   89.475  1.00 20.79 ? 184  HIS D N   1 
ATOM   9667  C  CA  . HIS D  1 103 ? 21.303  51.854   88.344  1.00 20.11 ? 184  HIS D CA  1 
ATOM   9668  C  C   . HIS D  1 103 ? 22.055  52.187   87.054  1.00 20.77 ? 184  HIS D C   1 
ATOM   9669  O  O   . HIS D  1 103 ? 22.613  53.272   86.921  1.00 22.01 ? 184  HIS D O   1 
ATOM   9670  C  CB  . HIS D  1 103 ? 19.996  52.653   88.421  1.00 18.50 ? 184  HIS D CB  1 
ATOM   9671  C  CG  . HIS D  1 103 ? 18.929  52.171   87.490  1.00 16.76 ? 184  HIS D CG  1 
ATOM   9672  N  ND1 . HIS D  1 103 ? 17.936  51.303   87.883  1.00 16.74 ? 184  HIS D ND1 1 
ATOM   9673  C  CD2 . HIS D  1 103 ? 18.710  52.428   86.179  1.00 14.08 ? 184  HIS D CD2 1 
ATOM   9674  C  CE1 . HIS D  1 103 ? 17.146  51.044   86.854  1.00 15.99 ? 184  HIS D CE1 1 
ATOM   9675  N  NE2 . HIS D  1 103 ? 17.597  51.715   85.809  1.00 16.31 ? 184  HIS D NE2 1 
ATOM   9676  N  N   . ASP D  1 104 ? 22.076  51.274   86.094  1.00 19.95 ? 185  ASP D N   1 
ATOM   9677  C  CA  . ASP D  1 104 ? 22.799  51.573   84.865  1.00 20.83 ? 185  ASP D CA  1 
ATOM   9678  C  C   . ASP D  1 104 ? 21.928  52.221   83.796  1.00 19.49 ? 185  ASP D C   1 
ATOM   9679  O  O   . ASP D  1 104 ? 22.387  52.478   82.691  1.00 17.05 ? 185  ASP D O   1 
ATOM   9680  C  CB  . ASP D  1 104 ? 23.443  50.306   84.295  1.00 22.25 ? 185  ASP D CB  1 
ATOM   9681  C  CG  . ASP D  1 104 ? 22.431  49.219   83.975  1.00 22.08 ? 185  ASP D CG  1 
ATOM   9682  O  OD1 . ASP D  1 104 ? 21.214  49.497   83.909  1.00 22.64 ? 185  ASP D OD1 1 
ATOM   9683  O  OD2 . ASP D  1 104 ? 22.869  48.072   83.775  1.00 23.23 ? 185  ASP D OD2 1 
ATOM   9684  N  N   . GLY D  1 105 ? 20.675  52.493   84.139  1.00 20.17 ? 186  GLY D N   1 
ATOM   9685  C  CA  . GLY D  1 105 ? 19.757  53.083   83.183  1.00 19.86 ? 186  GLY D CA  1 
ATOM   9686  C  C   . GLY D  1 105 ? 18.751  52.021   82.772  1.00 20.40 ? 186  GLY D C   1 
ATOM   9687  O  O   . GLY D  1 105 ? 17.669  52.328   82.253  1.00 20.02 ? 186  GLY D O   1 
ATOM   9688  N  N   . THR D  1 106 ? 19.116  50.763   83.018  1.00 19.88 ? 187  THR D N   1 
ATOM   9689  C  CA  . THR D  1 106 ? 18.264  49.631   82.680  1.00 19.92 ? 187  THR D CA  1 
ATOM   9690  C  C   . THR D  1 106 ? 17.741  48.916   83.925  1.00 19.37 ? 187  THR D C   1 
ATOM   9691  O  O   . THR D  1 106 ? 16.534  48.767   84.083  1.00 20.55 ? 187  THR D O   1 
ATOM   9692  C  CB  . THR D  1 106 ? 19.008  48.606   81.789  1.00 21.25 ? 187  THR D CB  1 
ATOM   9693  O  OG1 . THR D  1 106 ? 19.465  49.247   80.586  1.00 20.40 ? 187  THR D OG1 1 
ATOM   9694  C  CG2 . THR D  1 106 ? 18.075  47.448   81.423  1.00 19.40 ? 187  THR D CG2 1 
ATOM   9695  N  N   . SER D  1 107 ? 18.632  48.469   84.807  1.00 18.17 ? 188  SER D N   1 
ATOM   9696  C  CA  . SER D  1 107 ? 18.198  47.782   86.027  1.00 16.94 ? 188  SER D CA  1 
ATOM   9697  C  C   . SER D  1 107 ? 19.040  48.151   87.244  1.00 16.82 ? 188  SER D C   1 
ATOM   9698  O  O   . SER D  1 107 ? 20.119  48.733   87.129  1.00 17.72 ? 188  SER D O   1 
ATOM   9699  C  CB  . SER D  1 107 ? 18.250  46.259   85.841  1.00 17.41 ? 188  SER D CB  1 
ATOM   9700  O  OG  . SER D  1 107 ? 17.258  45.794   84.939  1.00 19.05 ? 188  SER D OG  1 
ATOM   9701  N  N   . TRP D  1 108 ? 18.541  47.815   88.423  1.00 14.75 ? 189  TRP D N   1 
ATOM   9702  C  CA  . TRP D  1 108 ? 19.293  48.087   89.626  1.00 13.43 ? 189  TRP D CA  1 
ATOM   9703  C  C   . TRP D  1 108 ? 20.354  47.026   89.841  1.00 14.26 ? 189  TRP D C   1 
ATOM   9704  O  O   . TRP D  1 108 ? 20.112  45.843   89.630  1.00 14.62 ? 189  TRP D O   1 
ATOM   9705  C  CB  . TRP D  1 108 ? 18.392  48.101   90.853  1.00 11.88 ? 189  TRP D CB  1 
ATOM   9706  C  CG  . TRP D  1 108 ? 17.655  49.381   91.053  1.00 12.89 ? 189  TRP D CG  1 
ATOM   9707  C  CD1 . TRP D  1 108 ? 16.326  49.600   90.853  1.00 8.65  ? 189  TRP D CD1 1 
ATOM   9708  C  CD2 . TRP D  1 108 ? 18.207  50.626   91.497  1.00 13.45 ? 189  TRP D CD2 1 
ATOM   9709  N  NE1 . TRP D  1 108 ? 16.014  50.897   91.145  1.00 11.81 ? 189  TRP D NE1 1 
ATOM   9710  C  CE2 . TRP D  1 108 ? 17.146  51.556   91.544  1.00 12.38 ? 189  TRP D CE2 1 
ATOM   9711  C  CE3 . TRP D  1 108 ? 19.497  51.048   91.856  1.00 14.56 ? 189  TRP D CE3 1 
ATOM   9712  C  CZ2 . TRP D  1 108 ? 17.326  52.891   91.940  1.00 13.34 ? 189  TRP D CZ2 1 
ATOM   9713  C  CZ3 . TRP D  1 108 ? 19.680  52.388   92.252  1.00 15.09 ? 189  TRP D CZ3 1 
ATOM   9714  C  CH2 . TRP D  1 108 ? 18.597  53.287   92.289  1.00 12.90 ? 189  TRP D CH2 1 
ATOM   9715  N  N   . LEU D  1 109 ? 21.536  47.466   90.245  1.00 14.30 ? 190  LEU D N   1 
ATOM   9716  C  CA  . LEU D  1 109 ? 22.621  46.566   90.570  1.00 14.32 ? 190  LEU D CA  1 
ATOM   9717  C  C   . LEU D  1 109 ? 22.823  46.798   92.057  1.00 16.33 ? 190  LEU D C   1 
ATOM   9718  O  O   . LEU D  1 109 ? 23.015  47.941   92.484  1.00 17.78 ? 190  LEU D O   1 
ATOM   9719  C  CB  . LEU D  1 109 ? 23.908  46.939   89.840  1.00 13.42 ? 190  LEU D CB  1 
ATOM   9720  C  CG  . LEU D  1 109 ? 25.151  46.345   90.526  1.00 14.52 ? 190  LEU D CG  1 
ATOM   9721  C  CD1 . LEU D  1 109 ? 25.111  44.831   90.456  1.00 14.08 ? 190  LEU D CD1 1 
ATOM   9722  C  CD2 . LEU D  1 109 ? 26.419  46.856   89.877  1.00 15.30 ? 190  LEU D CD2 1 
ATOM   9723  N  N   . THR D  1 110 ? 22.753  45.734   92.849  1.00 16.11 ? 191  THR D N   1 
ATOM   9724  C  CA  . THR D  1 110 ? 22.966  45.859   94.280  1.00 15.49 ? 191  THR D CA  1 
ATOM   9725  C  C   . THR D  1 110 ? 24.134  44.972   94.649  1.00 15.25 ? 191  THR D C   1 
ATOM   9726  O  O   . THR D  1 110 ? 24.381  43.954   94.008  1.00 16.15 ? 191  THR D O   1 
ATOM   9727  C  CB  . THR D  1 110 ? 21.737  45.416   95.096  1.00 16.20 ? 191  THR D CB  1 
ATOM   9728  O  OG1 . THR D  1 110 ? 21.406  44.059   94.765  1.00 18.73 ? 191  THR D OG1 1 
ATOM   9729  C  CG2 . THR D  1 110 ? 20.551  46.331   94.814  1.00 13.77 ? 191  THR D CG2 1 
ATOM   9730  N  N   . ILE D  1 111 ? 24.860  45.366   95.679  1.00 15.46 ? 192  ILE D N   1 
ATOM   9731  C  CA  . ILE D  1 111 ? 26.008  44.601   96.116  1.00 16.59 ? 192  ILE D CA  1 
ATOM   9732  C  C   . ILE D  1 111 ? 25.926  44.457   97.612  1.00 17.15 ? 192  ILE D C   1 
ATOM   9733  O  O   . ILE D  1 111 ? 26.154  45.415   98.344  1.00 17.96 ? 192  ILE D O   1 
ATOM   9734  C  CB  . ILE D  1 111 ? 27.321  45.312   95.795  1.00 16.45 ? 192  ILE D CB  1 
ATOM   9735  C  CG1 . ILE D  1 111 ? 27.432  45.572   94.296  1.00 15.53 ? 192  ILE D CG1 1 
ATOM   9736  C  CG2 . ILE D  1 111 ? 28.477  44.469   96.286  1.00 16.84 ? 192  ILE D CG2 1 
ATOM   9737  C  CD1 . ILE D  1 111 ? 28.541  46.544   93.940  1.00 17.53 ? 192  ILE D CD1 1 
ATOM   9738  N  N   . GLY D  1 112 ? 25.586  43.255   98.058  1.00 16.56 ? 193  GLY D N   1 
ATOM   9739  C  CA  . GLY D  1 112 ? 25.486  42.999   99.478  1.00 15.24 ? 193  GLY D CA  1 
ATOM   9740  C  C   . GLY D  1 112 ? 26.581  42.040   99.873  1.00 15.02 ? 193  GLY D C   1 
ATOM   9741  O  O   . GLY D  1 112 ? 26.763  40.994   99.256  1.00 14.33 ? 193  GLY D O   1 
ATOM   9742  N  N   . ILE D  1 113 ? 27.333  42.421   100.890 1.00 14.53 ? 194  ILE D N   1 
ATOM   9743  C  CA  . ILE D  1 113 ? 28.411  41.598   101.379 1.00 14.37 ? 194  ILE D CA  1 
ATOM   9744  C  C   . ILE D  1 113 ? 27.938  41.022   102.695 1.00 15.14 ? 194  ILE D C   1 
ATOM   9745  O  O   . ILE D  1 113 ? 27.426  41.757   103.543 1.00 16.44 ? 194  ILE D O   1 
ATOM   9746  C  CB  . ILE D  1 113 ? 29.680  42.436   101.615 1.00 14.59 ? 194  ILE D CB  1 
ATOM   9747  C  CG1 . ILE D  1 113 ? 30.245  42.899   100.269 1.00 14.29 ? 194  ILE D CG1 1 
ATOM   9748  C  CG2 . ILE D  1 113 ? 30.709  41.631   102.403 1.00 12.98 ? 194  ILE D CG2 1 
ATOM   9749  C  CD1 . ILE D  1 113 ? 31.434  43.843   100.395 1.00 13.50 ? 194  ILE D CD1 1 
ATOM   9750  N  N   . SER D  1 114 ? 28.087  39.708   102.850 1.00 15.01 ? 195  SER D N   1 
ATOM   9751  C  CA  . SER D  1 114 ? 27.695  39.021   104.075 1.00 14.16 ? 195  SER D CA  1 
ATOM   9752  C  C   . SER D  1 114 ? 28.581  37.807   104.275 1.00 14.26 ? 195  SER D C   1 
ATOM   9753  O  O   . SER D  1 114 ? 29.384  37.464   103.398 1.00 13.75 ? 195  SER D O   1 
ATOM   9754  C  CB  . SER D  1 114 ? 26.235  38.579   104.004 1.00 13.83 ? 195  SER D CB  1 
ATOM   9755  O  OG  . SER D  1 114 ? 25.873  37.871   105.175 1.00 15.81 ? 195  SER D OG  1 
ATOM   9756  N  N   . GLY D  1 115 ? 28.426  37.153   105.422 1.00 13.76 ? 196  GLY D N   1 
ATOM   9757  C  CA  . GLY D  1 115 ? 29.233  35.987   105.722 1.00 13.77 ? 196  GLY D CA  1 
ATOM   9758  C  C   . GLY D  1 115 ? 30.187  36.270   106.868 1.00 14.28 ? 196  GLY D C   1 
ATOM   9759  O  O   . GLY D  1 115 ? 30.071  37.294   107.527 1.00 13.67 ? 196  GLY D O   1 
ATOM   9760  N  N   . PRO D  1 116 ? 31.155  35.386   107.126 1.00 14.70 ? 197  PRO D N   1 
ATOM   9761  C  CA  . PRO D  1 116 ? 32.091  35.621   108.228 1.00 15.98 ? 197  PRO D CA  1 
ATOM   9762  C  C   . PRO D  1 116 ? 33.192  36.624   107.873 1.00 16.63 ? 197  PRO D C   1 
ATOM   9763  O  O   . PRO D  1 116 ? 33.483  36.849   106.698 1.00 15.47 ? 197  PRO D O   1 
ATOM   9764  C  CB  . PRO D  1 116 ? 32.632  34.224   108.503 1.00 14.85 ? 197  PRO D CB  1 
ATOM   9765  C  CG  . PRO D  1 116 ? 32.718  33.655   107.120 1.00 14.98 ? 197  PRO D CG  1 
ATOM   9766  C  CD  . PRO D  1 116 ? 31.418  34.091   106.473 1.00 14.92 ? 197  PRO D CD  1 
ATOM   9767  N  N   . ASP D  1 117 ? 33.808  37.220   108.890 1.00 17.12 ? 198  ASP D N   1 
ATOM   9768  C  CA  . ASP D  1 117 ? 34.872  38.188   108.651 1.00 17.36 ? 198  ASP D CA  1 
ATOM   9769  C  C   . ASP D  1 117 ? 36.047  37.595   107.904 1.00 17.85 ? 198  ASP D C   1 
ATOM   9770  O  O   . ASP D  1 117 ? 36.726  38.299   107.159 1.00 19.38 ? 198  ASP D O   1 
ATOM   9771  C  CB  . ASP D  1 117 ? 35.366  38.793   109.964 1.00 16.96 ? 198  ASP D CB  1 
ATOM   9772  C  CG  . ASP D  1 117 ? 34.319  39.681   110.620 1.00 18.65 ? 198  ASP D CG  1 
ATOM   9773  O  OD1 . ASP D  1 117 ? 33.277  39.953   109.976 1.00 15.76 ? 198  ASP D OD1 1 
ATOM   9774  O  OD2 . ASP D  1 117 ? 34.540  40.113   111.769 1.00 16.63 ? 198  ASP D OD2 1 
ATOM   9775  N  N   . ASN D  1 118 ? 36.288  36.301   108.072 1.00 18.37 ? 199  ASN D N   1 
ATOM   9776  C  CA  . ASN D  1 118 ? 37.418  35.701   107.385 1.00 19.38 ? 199  ASN D CA  1 
ATOM   9777  C  C   . ASN D  1 118 ? 37.061  35.096   106.044 1.00 20.25 ? 199  ASN D C   1 
ATOM   9778  O  O   . ASN D  1 118 ? 37.869  34.396   105.446 1.00 21.57 ? 199  ASN D O   1 
ATOM   9779  C  CB  . ASN D  1 118 ? 38.069  34.627   108.250 1.00 20.41 ? 199  ASN D CB  1 
ATOM   9780  C  CG  . ASN D  1 118 ? 37.178  33.417   108.456 1.00 23.20 ? 199  ASN D CG  1 
ATOM   9781  O  OD1 . ASN D  1 118 ? 36.215  33.199   107.717 1.00 26.06 ? 199  ASN D OD1 1 
ATOM   9782  N  ND2 . ASN D  1 118 ? 37.508  32.610   109.458 1.00 23.36 ? 199  ASN D ND2 1 
ATOM   9783  N  N   . GLY D  1 119 ? 35.860  35.353   105.555 1.00 20.45 ? 200  GLY D N   1 
ATOM   9784  C  CA  . GLY D  1 119 ? 35.500  34.767   104.281 1.00 19.85 ? 200  GLY D CA  1 
ATOM   9785  C  C   . GLY D  1 119 ? 34.239  35.349   103.708 1.00 20.74 ? 200  GLY D C   1 
ATOM   9786  O  O   . GLY D  1 119 ? 33.539  34.679   102.957 1.00 20.87 ? 200  GLY D O   1 
ATOM   9787  N  N   . ALA D  1 120 ? 33.957  36.598   104.062 1.00 20.03 ? 201  ALA D N   1 
ATOM   9788  C  CA  . ALA D  1 120 ? 32.770  37.289   103.583 1.00 19.27 ? 201  ALA D CA  1 
ATOM   9789  C  C   . ALA D  1 120 ? 32.692  37.245   102.068 1.00 18.80 ? 201  ALA D C   1 
ATOM   9790  O  O   . ALA D  1 120 ? 33.704  37.212   101.382 1.00 18.55 ? 201  ALA D O   1 
ATOM   9791  C  CB  . ALA D  1 120 ? 32.791  38.733   104.056 1.00 19.90 ? 201  ALA D CB  1 
ATOM   9792  N  N   . VAL D  1 121 ? 31.481  37.248   101.540 1.00 19.06 ? 202  VAL D N   1 
ATOM   9793  C  CA  . VAL D  1 121 ? 31.315  37.214   100.102 1.00 19.55 ? 202  VAL D CA  1 
ATOM   9794  C  C   . VAL D  1 121 ? 30.303  38.262   99.659  1.00 19.41 ? 202  VAL D C   1 
ATOM   9795  O  O   . VAL D  1 121 ? 29.261  38.447   100.294 1.00 21.25 ? 202  VAL D O   1 
ATOM   9796  C  CB  . VAL D  1 121 ? 30.865  35.805   99.625  1.00 20.01 ? 202  VAL D CB  1 
ATOM   9797  C  CG1 . VAL D  1 121 ? 29.788  35.273   100.528 1.00 20.33 ? 202  VAL D CG1 1 
ATOM   9798  C  CG2 . VAL D  1 121 ? 30.344  35.880   98.196  1.00 23.13 ? 202  VAL D CG2 1 
ATOM   9799  N  N   . ALA D  1 122 ? 30.629  38.953   98.571  1.00 18.18 ? 203  ALA D N   1 
ATOM   9800  C  CA  . ALA D  1 122 ? 29.759  39.979   98.014  1.00 18.74 ? 203  ALA D CA  1 
ATOM   9801  C  C   . ALA D  1 122 ? 28.842  39.361   96.960  1.00 19.12 ? 203  ALA D C   1 
ATOM   9802  O  O   . ALA D  1 122 ? 29.321  38.785   95.977  1.00 21.73 ? 203  ALA D O   1 
ATOM   9803  C  CB  . ALA D  1 122 ? 30.592  41.082   97.381  1.00 17.24 ? 203  ALA D CB  1 
ATOM   9804  N  N   . VAL D  1 123 ? 27.530  39.465   97.170  1.00 17.65 ? 204  VAL D N   1 
ATOM   9805  C  CA  . VAL D  1 123 ? 26.565  38.944   96.208  1.00 16.74 ? 204  VAL D CA  1 
ATOM   9806  C  C   . VAL D  1 123 ? 26.089  40.114   95.366  1.00 16.34 ? 204  VAL D C   1 
ATOM   9807  O  O   . VAL D  1 123 ? 25.614  41.108   95.906  1.00 17.90 ? 204  VAL D O   1 
ATOM   9808  C  CB  . VAL D  1 123 ? 25.331  38.320   96.902  1.00 16.49 ? 204  VAL D CB  1 
ATOM   9809  C  CG1 . VAL D  1 123 ? 24.276  37.947   95.853  1.00 17.58 ? 204  VAL D CG1 1 
ATOM   9810  C  CG2 . VAL D  1 123 ? 25.733  37.093   97.680  1.00 14.90 ? 204  VAL D CG2 1 
ATOM   9811  N  N   . LEU D  1 124 ? 26.228  40.013   94.049  1.00 16.64 ? 205  LEU D N   1 
ATOM   9812  C  CA  . LEU D  1 124 ? 25.784  41.083   93.165  1.00 16.96 ? 205  LEU D CA  1 
ATOM   9813  C  C   . LEU D  1 124 ? 24.447  40.703   92.558  1.00 18.09 ? 205  LEU D C   1 
ATOM   9814  O  O   . LEU D  1 124 ? 24.268  39.589   92.067  1.00 18.23 ? 205  LEU D O   1 
ATOM   9815  C  CB  . LEU D  1 124 ? 26.781  41.330   92.036  1.00 16.45 ? 205  LEU D CB  1 
ATOM   9816  C  CG  . LEU D  1 124 ? 28.266  41.500   92.355  1.00 18.40 ? 205  LEU D CG  1 
ATOM   9817  C  CD1 . LEU D  1 124 ? 28.919  42.226   91.198  1.00 17.28 ? 205  LEU D CD1 1 
ATOM   9818  C  CD2 . LEU D  1 124 ? 28.465  42.269   93.629  1.00 18.28 ? 205  LEU D CD2 1 
ATOM   9819  N  N   . LYS D  1 125 ? 23.501  41.632   92.589  1.00 19.79 ? 206  LYS D N   1 
ATOM   9820  C  CA  . LYS D  1 125 ? 22.181  41.369   92.040  1.00 19.07 ? 206  LYS D CA  1 
ATOM   9821  C  C   . LYS D  1 125 ? 21.777  42.426   91.025  1.00 19.95 ? 206  LYS D C   1 
ATOM   9822  O  O   . LYS D  1 125 ? 21.757  43.624   91.327  1.00 18.92 ? 206  LYS D O   1 
ATOM   9823  C  CB  . LYS D  1 125 ? 21.119  41.345   93.143  1.00 18.25 ? 206  LYS D CB  1 
ATOM   9824  C  CG  . LYS D  1 125 ? 21.153  40.186   94.133  1.00 18.18 ? 206  LYS D CG  1 
ATOM   9825  C  CD  . LYS D  1 125 ? 19.920  40.313   95.015  1.00 18.86 ? 206  LYS D CD  1 
ATOM   9826  C  CE  . LYS D  1 125 ? 19.865  39.333   96.168  1.00 18.93 ? 206  LYS D CE  1 
ATOM   9827  N  NZ  . LYS D  1 125 ? 18.612  39.561   96.973  1.00 18.19 ? 206  LYS D NZ  1 
ATOM   9828  N  N   . TYR D  1 126 ? 21.461  41.959   89.821  1.00 19.33 ? 207  TYR D N   1 
ATOM   9829  C  CA  . TYR D  1 126 ? 20.996  42.806   88.737  1.00 18.61 ? 207  TYR D CA  1 
ATOM   9830  C  C   . TYR D  1 126 ? 19.509  42.477   88.727  1.00 19.55 ? 207  TYR D C   1 
ATOM   9831  O  O   . TYR D  1 126 ? 19.134  41.301   88.770  1.00 19.41 ? 207  TYR D O   1 
ATOM   9832  C  CB  . TYR D  1 126 ? 21.639  42.386   87.420  1.00 17.88 ? 207  TYR D CB  1 
ATOM   9833  C  CG  . TYR D  1 126 ? 21.569  43.416   86.322  1.00 15.56 ? 207  TYR D CG  1 
ATOM   9834  C  CD1 . TYR D  1 126 ? 20.886  43.154   85.142  1.00 16.22 ? 207  TYR D CD1 1 
ATOM   9835  C  CD2 . TYR D  1 126 ? 22.224  44.637   86.447  1.00 15.03 ? 207  TYR D CD2 1 
ATOM   9836  C  CE1 . TYR D  1 126 ? 20.855  44.084   84.105  1.00 17.31 ? 207  TYR D CE1 1 
ATOM   9837  C  CE2 . TYR D  1 126 ? 22.204  45.573   85.419  1.00 16.38 ? 207  TYR D CE2 1 
ATOM   9838  C  CZ  . TYR D  1 126 ? 21.521  45.291   84.252  1.00 17.54 ? 207  TYR D CZ  1 
ATOM   9839  O  OH  . TYR D  1 126 ? 21.502  46.203   83.226  1.00 19.29 ? 207  TYR D OH  1 
ATOM   9840  N  N   . ASN D  1 127 ? 18.672  43.511   88.698  1.00 20.93 ? 208  ASN D N   1 
ATOM   9841  C  CA  . ASN D  1 127 ? 17.222  43.343   88.721  1.00 22.26 ? 208  ASN D CA  1 
ATOM   9842  C  C   . ASN D  1 127 ? 16.766  42.330   89.774  1.00 22.37 ? 208  ASN D C   1 
ATOM   9843  O  O   . ASN D  1 127 ? 15.869  41.541   89.521  1.00 22.40 ? 208  ASN D O   1 
ATOM   9844  C  CB  . ASN D  1 127 ? 16.699  42.888   87.364  1.00 24.50 ? 208  ASN D CB  1 
ATOM   9845  C  CG  . ASN D  1 127 ? 15.299  43.401   87.090  1.00 28.99 ? 208  ASN D CG  1 
ATOM   9846  O  OD1 . ASN D  1 127 ? 14.416  43.354   87.952  1.00 28.80 ? 208  ASN D OD1 1 
ATOM   9847  N  ND2 . ASN D  1 127 ? 15.090  43.904   85.882  1.00 33.36 ? 208  ASN D ND2 1 
ATOM   9848  N  N   . GLY D  1 128 ? 17.395  42.337   90.944  1.00 22.45 ? 209  GLY D N   1 
ATOM   9849  C  CA  . GLY D  1 128 ? 16.991  41.419   91.995  1.00 23.47 ? 209  GLY D CA  1 
ATOM   9850  C  C   . GLY D  1 128 ? 17.440  39.970   91.868  1.00 24.90 ? 209  GLY D C   1 
ATOM   9851  O  O   . GLY D  1 128 ? 17.198  39.169   92.786  1.00 25.02 ? 209  GLY D O   1 
ATOM   9852  N  N   . ILE D  1 129 ? 18.082  39.613   90.755  1.00 22.88 ? 210  ILE D N   1 
ATOM   9853  C  CA  . ILE D  1 129 ? 18.542  38.240   90.593  1.00 22.41 ? 210  ILE D CA  1 
ATOM   9854  C  C   . ILE D  1 129 ? 20.068  38.163   90.649  1.00 20.87 ? 210  ILE D C   1 
ATOM   9855  O  O   . ILE D  1 129 ? 20.761  38.881   89.921  1.00 21.34 ? 210  ILE D O   1 
ATOM   9856  C  CB  . ILE D  1 129 ? 18.053  37.607   89.253  1.00 23.74 ? 210  ILE D CB  1 
ATOM   9857  C  CG1 . ILE D  1 129 ? 18.845  38.185   88.084  1.00 26.39 ? 210  ILE D CG1 1 
ATOM   9858  C  CG2 . ILE D  1 129 ? 16.543  37.878   89.050  1.00 21.30 ? 210  ILE D CG2 1 
ATOM   9859  C  CD1 . ILE D  1 129 ? 18.815  37.323   86.828  1.00 30.83 ? 210  ILE D CD1 1 
ATOM   9860  N  N   . ILE D  1 130 ? 20.582  37.301   91.525  1.00 17.87 ? 211  ILE D N   1 
ATOM   9861  C  CA  . ILE D  1 130 ? 22.017  37.111   91.672  1.00 15.90 ? 211  ILE D CA  1 
ATOM   9862  C  C   . ILE D  1 130 ? 22.631  36.940   90.299  1.00 16.12 ? 211  ILE D C   1 
ATOM   9863  O  O   . ILE D  1 130 ? 22.199  36.087   89.533  1.00 15.52 ? 211  ILE D O   1 
ATOM   9864  C  CB  . ILE D  1 130 ? 22.325  35.861   92.500  1.00 15.30 ? 211  ILE D CB  1 
ATOM   9865  C  CG1 . ILE D  1 130 ? 21.650  35.978   93.859  1.00 14.42 ? 211  ILE D CG1 1 
ATOM   9866  C  CG2 . ILE D  1 130 ? 23.824  35.699   92.664  1.00 12.86 ? 211  ILE D CG2 1 
ATOM   9867  C  CD1 . ILE D  1 130 ? 21.845  34.768   94.737  1.00 18.39 ? 211  ILE D CD1 1 
ATOM   9868  N  N   . THR D  1 131 ? 23.636  37.757   89.996  1.00 16.48 ? 212  THR D N   1 
ATOM   9869  C  CA  . THR D  1 131 ? 24.300  37.714   88.701  1.00 17.92 ? 212  THR D CA  1 
ATOM   9870  C  C   . THR D  1 131 ? 25.783  37.378   88.781  1.00 19.40 ? 212  THR D C   1 
ATOM   9871  O  O   . THR D  1 131 ? 26.396  37.029   87.773  1.00 19.76 ? 212  THR D O   1 
ATOM   9872  C  CB  . THR D  1 131 ? 24.163  39.045   87.972  1.00 18.45 ? 212  THR D CB  1 
ATOM   9873  O  OG1 . THR D  1 131 ? 24.387  40.108   88.902  1.00 18.25 ? 212  THR D OG1 1 
ATOM   9874  C  CG2 . THR D  1 131 ? 22.788  39.173   87.340  1.00 17.98 ? 212  THR D CG2 1 
ATOM   9875  N  N   . ASP D  1 132 ? 26.359  37.498   89.972  1.00 19.29 ? 213  ASP D N   1 
ATOM   9876  C  CA  . ASP D  1 132 ? 27.767  37.187   90.171  1.00 19.99 ? 213  ASP D CA  1 
ATOM   9877  C  C   . ASP D  1 132 ? 28.058  37.190   91.671  1.00 19.67 ? 213  ASP D C   1 
ATOM   9878  O  O   . ASP D  1 132 ? 27.227  37.607   92.470  1.00 17.91 ? 213  ASP D O   1 
ATOM   9879  C  CB  . ASP D  1 132 ? 28.652  38.215   89.446  1.00 21.74 ? 213  ASP D CB  1 
ATOM   9880  C  CG  . ASP D  1 132 ? 30.099  37.735   89.268  1.00 23.86 ? 213  ASP D CG  1 
ATOM   9881  O  OD1 . ASP D  1 132 ? 30.437  36.637   89.768  1.00 23.04 ? 213  ASP D OD1 1 
ATOM   9882  O  OD2 . ASP D  1 132 ? 30.900  38.457   88.623  1.00 24.89 ? 213  ASP D OD2 1 
ATOM   9883  N  N   . THR D  1 133 ? 29.243  36.720   92.043  1.00 20.30 ? 214  THR D N   1 
ATOM   9884  C  CA  . THR D  1 133 ? 29.659  36.655   93.441  1.00 20.56 ? 214  THR D CA  1 
ATOM   9885  C  C   . THR D  1 133 ? 31.152  37.021   93.565  1.00 20.31 ? 214  THR D C   1 
ATOM   9886  O  O   . THR D  1 133 ? 31.942  36.696   92.682  1.00 21.62 ? 214  THR D O   1 
ATOM   9887  C  CB  . THR D  1 133 ? 29.416  35.216   93.973  1.00 21.29 ? 214  THR D CB  1 
ATOM   9888  O  OG1 . THR D  1 133 ? 28.227  35.190   94.771  1.00 23.49 ? 214  THR D OG1 1 
ATOM   9889  C  CG2 . THR D  1 133 ? 30.587  34.726   94.776  1.00 21.05 ? 214  THR D CG2 1 
ATOM   9890  N  N   . ILE D  1 134 ? 31.538  37.705   94.641  1.00 18.94 ? 215  ILE D N   1 
ATOM   9891  C  CA  . ILE D  1 134 ? 32.948  38.058   94.855  1.00 18.18 ? 215  ILE D CA  1 
ATOM   9892  C  C   . ILE D  1 134 ? 33.348  37.613   96.254  1.00 18.60 ? 215  ILE D C   1 
ATOM   9893  O  O   . ILE D  1 134 ? 32.655  37.915   97.218  1.00 17.15 ? 215  ILE D O   1 
ATOM   9894  C  CB  . ILE D  1 134 ? 33.196  39.583   94.754  1.00 19.27 ? 215  ILE D CB  1 
ATOM   9895  C  CG1 . ILE D  1 134 ? 32.854  40.087   93.353  1.00 18.84 ? 215  ILE D CG1 1 
ATOM   9896  C  CG2 . ILE D  1 134 ? 34.656  39.902   95.067  1.00 17.12 ? 215  ILE D CG2 1 
ATOM   9897  C  CD1 . ILE D  1 134 ? 32.886  41.596   93.236  1.00 20.50 ? 215  ILE D CD1 1 
ATOM   9898  N  N   . LYS D  1 135 ? 34.460  36.890   96.359  1.00 20.36 ? 216  LYS D N   1 
ATOM   9899  C  CA  . LYS D  1 135 ? 34.957  36.400   97.645  1.00 21.40 ? 216  LYS D CA  1 
ATOM   9900  C  C   . LYS D  1 135 ? 36.088  37.247   98.198  1.00 20.25 ? 216  LYS D C   1 
ATOM   9901  O  O   . LYS D  1 135 ? 36.878  37.820   97.456  1.00 18.78 ? 216  LYS D O   1 
ATOM   9902  C  CB  . LYS D  1 135 ? 35.469  34.964   97.521  1.00 24.30 ? 216  LYS D CB  1 
ATOM   9903  C  CG  . LYS D  1 135 ? 34.442  33.890   97.775  1.00 31.09 ? 216  LYS D CG  1 
ATOM   9904  C  CD  . LYS D  1 135 ? 34.710  32.655   96.894  1.00 35.27 ? 216  LYS D CD  1 
ATOM   9905  C  CE  . LYS D  1 135 ? 34.436  32.949   95.397  1.00 34.80 ? 216  LYS D CE  1 
ATOM   9906  N  NZ  . LYS D  1 135 ? 34.925  31.882   94.467  1.00 31.13 ? 216  LYS D NZ  1 
ATOM   9907  N  N   . SER D  1 136 ? 36.159  37.289   99.519  1.00 21.15 ? 217  SER D N   1 
ATOM   9908  C  CA  . SER D  1 136 ? 37.184  38.018   100.231 1.00 21.99 ? 217  SER D CA  1 
ATOM   9909  C  C   . SER D  1 136 ? 38.523  37.448   99.747  1.00 23.53 ? 217  SER D C   1 
ATOM   9910  O  O   . SER D  1 136 ? 38.718  36.230   99.781  1.00 25.18 ? 217  SER D O   1 
ATOM   9911  C  CB  . SER D  1 136 ? 36.990  37.772   101.729 1.00 21.07 ? 217  SER D CB  1 
ATOM   9912  O  OG  . SER D  1 136 ? 37.913  38.493   102.519 1.00 22.68 ? 217  SER D OG  1 
ATOM   9913  N  N   . TRP D  1 137 ? 39.429  38.304   99.270  1.00 22.23 ? 218  TRP D N   1 
ATOM   9914  C  CA  . TRP D  1 137 ? 40.727  37.821   98.800  1.00 23.03 ? 218  TRP D CA  1 
ATOM   9915  C  C   . TRP D  1 137 ? 41.823  37.951   99.856  1.00 24.02 ? 218  TRP D C   1 
ATOM   9916  O  O   . TRP D  1 137 ? 42.956  37.516   99.628  1.00 22.97 ? 218  TRP D O   1 
ATOM   9917  C  CB  . TRP D  1 137 ? 41.154  38.540   97.511  1.00 23.04 ? 218  TRP D CB  1 
ATOM   9918  C  CG  . TRP D  1 137 ? 41.371  40.023   97.645  1.00 24.21 ? 218  TRP D CG  1 
ATOM   9919  C  CD1 . TRP D  1 137 ? 42.556  40.666   97.865  1.00 23.15 ? 218  TRP D CD1 1 
ATOM   9920  C  CD2 . TRP D  1 137 ? 40.362  41.046   97.592  1.00 24.68 ? 218  TRP D CD2 1 
ATOM   9921  N  NE1 . TRP D  1 137 ? 42.348  42.030   97.952  1.00 23.75 ? 218  TRP D NE1 1 
ATOM   9922  C  CE2 . TRP D  1 137 ? 41.014  42.288   97.789  1.00 23.52 ? 218  TRP D CE2 1 
ATOM   9923  C  CE3 . TRP D  1 137 ? 38.972  41.032   97.396  1.00 24.97 ? 218  TRP D CE3 1 
ATOM   9924  C  CZ2 . TRP D  1 137 ? 40.322  43.501   97.800  1.00 23.39 ? 218  TRP D CZ2 1 
ATOM   9925  C  CZ3 . TRP D  1 137 ? 38.284  42.238   97.406  1.00 23.85 ? 218  TRP D CZ3 1 
ATOM   9926  C  CH2 . TRP D  1 137 ? 38.962  43.458   97.607  1.00 24.45 ? 218  TRP D CH2 1 
ATOM   9927  N  N   . ARG D  1 138 ? 41.476  38.533   101.007 1.00 24.46 ? 219  ARG D N   1 
ATOM   9928  C  CA  . ARG D  1 138 ? 42.414  38.717   102.116 1.00 26.70 ? 219  ARG D CA  1 
ATOM   9929  C  C   . ARG D  1 138 ? 41.914  38.048   103.390 1.00 26.16 ? 219  ARG D C   1 
ATOM   9930  O  O   . ARG D  1 138 ? 42.654  37.921   104.372 1.00 25.51 ? 219  ARG D O   1 
ATOM   9931  C  CB  . ARG D  1 138 ? 42.632  40.206   102.407 1.00 29.18 ? 219  ARG D CB  1 
ATOM   9932  C  CG  . ARG D  1 138 ? 43.384  40.952   101.339 1.00 32.28 ? 219  ARG D CG  1 
ATOM   9933  C  CD  . ARG D  1 138 ? 44.795  40.419   101.176 1.00 36.70 ? 219  ARG D CD  1 
ATOM   9934  N  NE  . ARG D  1 138 ? 45.415  41.018   100.000 1.00 41.89 ? 219  ARG D NE  1 
ATOM   9935  C  CZ  . ARG D  1 138 ? 46.596  40.675   99.505  1.00 43.90 ? 219  ARG D CZ  1 
ATOM   9936  N  NH1 . ARG D  1 138 ? 47.319  39.723   100.084 1.00 46.60 ? 219  ARG D NH1 1 
ATOM   9937  N  NH2 . ARG D  1 138 ? 47.045  41.279   98.412  1.00 46.02 ? 219  ARG D NH2 1 
ATOM   9938  N  N   . ASN D  1 139 ? 40.649  37.640   103.373 1.00 25.24 ? 220  ASN D N   1 
ATOM   9939  C  CA  . ASN D  1 139 ? 40.025  36.989   104.518 1.00 24.23 ? 220  ASN D CA  1 
ATOM   9940  C  C   . ASN D  1 139 ? 39.994  37.886   105.758 1.00 22.92 ? 220  ASN D C   1 
ATOM   9941  O  O   . ASN D  1 139 ? 40.057  37.409   106.892 1.00 23.60 ? 220  ASN D O   1 
ATOM   9942  C  CB  . ASN D  1 139 ? 40.730  35.658   104.838 1.00 24.64 ? 220  ASN D CB  1 
ATOM   9943  C  CG  . ASN D  1 139 ? 40.622  34.647   103.700 1.00 26.62 ? 220  ASN D CG  1 
ATOM   9944  O  OD1 . ASN D  1 139 ? 39.557  34.475   103.099 1.00 27.50 ? 220  ASN D OD1 1 
ATOM   9945  N  ND2 . ASN D  1 139 ? 41.722  33.967   103.409 1.00 28.67 ? 220  ASN D ND2 1 
ATOM   9946  N  N   . ASN D  1 140 ? 39.876  39.189   105.541 1.00 21.46 ? 221  ASN D N   1 
ATOM   9947  C  CA  . ASN D  1 140 ? 39.832  40.116   106.656 1.00 20.49 ? 221  ASN D CA  1 
ATOM   9948  C  C   . ASN D  1 140 ? 38.855  41.243   106.384 1.00 19.46 ? 221  ASN D C   1 
ATOM   9949  O  O   . ASN D  1 140 ? 39.244  42.375   106.078 1.00 20.71 ? 221  ASN D O   1 
ATOM   9950  C  CB  . ASN D  1 140 ? 41.231  40.673   106.950 1.00 20.29 ? 221  ASN D CB  1 
ATOM   9951  C  CG  . ASN D  1 140 ? 41.261  41.540   108.194 1.00 21.48 ? 221  ASN D CG  1 
ATOM   9952  O  OD1 . ASN D  1 140 ? 40.339  41.503   109.016 1.00 19.65 ? 221  ASN D OD1 1 
ATOM   9953  N  ND2 . ASN D  1 140 ? 42.334  42.318   108.348 1.00 21.58 ? 221  ASN D ND2 1 
ATOM   9954  N  N   . ILE D  1 141 ? 37.576  40.890   106.480 1.00 17.41 ? 222  ILE D N   1 
ATOM   9955  C  CA  . ILE D  1 141 ? 36.438  41.784   106.296 1.00 12.71 ? 222  ILE D CA  1 
ATOM   9956  C  C   . ILE D  1 141 ? 36.257  42.493   104.952 1.00 11.11 ? 222  ILE D C   1 
ATOM   9957  O  O   . ILE D  1 141 ? 36.387  43.712   104.847 1.00 9.78  ? 222  ILE D O   1 
ATOM   9958  C  CB  . ILE D  1 141 ? 36.399  42.829   107.410 1.00 11.69 ? 222  ILE D CB  1 
ATOM   9959  C  CG1 . ILE D  1 141 ? 36.644  42.144   108.760 1.00 12.37 ? 222  ILE D CG1 1 
ATOM   9960  C  CG2 . ILE D  1 141 ? 35.047  43.532   107.406 1.00 12.49 ? 222  ILE D CG2 1 
ATOM   9961  C  CD1 . ILE D  1 141 ? 36.614  43.081   109.956 1.00 11.98 ? 222  ILE D CD1 1 
ATOM   9962  N  N   . LEU D  1 142 ? 35.946  41.722   103.920 1.00 10.63 ? 223  LEU D N   1 
ATOM   9963  C  CA  . LEU D  1 142 ? 35.681  42.298   102.614 1.00 12.01 ? 223  LEU D CA  1 
ATOM   9964  C  C   . LEU D  1 142 ? 34.600  43.355   102.850 1.00 12.82 ? 223  LEU D C   1 
ATOM   9965  O  O   . LEU D  1 142 ? 33.598  43.087   103.507 1.00 13.91 ? 223  LEU D O   1 
ATOM   9966  C  CB  . LEU D  1 142 ? 35.145  41.224   101.674 1.00 11.06 ? 223  LEU D CB  1 
ATOM   9967  C  CG  . LEU D  1 142 ? 34.678  41.706   100.298 1.00 11.77 ? 223  LEU D CG  1 
ATOM   9968  C  CD1 . LEU D  1 142 ? 35.806  42.443   99.590  1.00 9.74  ? 223  LEU D CD1 1 
ATOM   9969  C  CD2 . LEU D  1 142 ? 34.199  40.506   99.471  1.00 9.43  ? 223  LEU D CD2 1 
ATOM   9970  N  N   . ARG D  1 143 ? 34.799  44.559   102.336 1.00 13.03 ? 224  ARG D N   1 
ATOM   9971  C  CA  . ARG D  1 143 ? 33.812  45.617   102.540 1.00 13.71 ? 224  ARG D CA  1 
ATOM   9972  C  C   . ARG D  1 143 ? 33.756  46.584   101.368 1.00 14.51 ? 224  ARG D C   1 
ATOM   9973  O  O   . ARG D  1 143 ? 34.707  46.690   100.582 1.00 16.00 ? 224  ARG D O   1 
ATOM   9974  C  CB  . ARG D  1 143 ? 34.106  46.363   103.842 1.00 13.96 ? 224  ARG D CB  1 
ATOM   9975  C  CG  . ARG D  1 143 ? 35.560  46.814   104.010 1.00 12.84 ? 224  ARG D CG  1 
ATOM   9976  C  CD  . ARG D  1 143 ? 35.783  47.312   105.414 1.00 12.30 ? 224  ARG D CD  1 
ATOM   9977  N  NE  . ARG D  1 143 ? 37.156  47.729   105.655 1.00 15.43 ? 224  ARG D NE  1 
ATOM   9978  C  CZ  . ARG D  1 143 ? 38.187  46.898   105.785 1.00 16.54 ? 224  ARG D CZ  1 
ATOM   9979  N  NH1 . ARG D  1 143 ? 39.401  47.388   106.005 1.00 16.03 ? 224  ARG D NH1 1 
ATOM   9980  N  NH2 . ARG D  1 143 ? 38.011  45.582   105.700 1.00 16.01 ? 224  ARG D NH2 1 
ATOM   9981  N  N   . THR D  1 144 ? 32.641  47.296   101.251 1.00 14.95 ? 225  THR D N   1 
ATOM   9982  C  CA  . THR D  1 144 ? 32.470  48.205   100.134 1.00 14.63 ? 225  THR D CA  1 
ATOM   9983  C  C   . THR D  1 144 ? 32.049  49.633   100.499 1.00 14.68 ? 225  THR D C   1 
ATOM   9984  O  O   . THR D  1 144 ? 32.215  50.073   101.642 1.00 14.98 ? 225  THR D O   1 
ATOM   9985  C  CB  . THR D  1 144 ? 31.504  47.566   99.092  1.00 15.31 ? 225  THR D CB  1 
ATOM   9986  O  OG1 . THR D  1 144 ? 31.457  48.375   97.914  1.00 18.02 ? 225  THR D OG1 1 
ATOM   9987  C  CG2 . THR D  1 144 ? 30.120  47.398   99.669  1.00 12.65 ? 225  THR D CG2 1 
ATOM   9988  N  N   . GLN D  1 145 ? 31.506  50.345   99.516  1.00 15.36 ? 226  GLN D N   1 
ATOM   9989  C  CA  . GLN D  1 145 ? 31.120  51.755   99.638  1.00 15.48 ? 226  GLN D CA  1 
ATOM   9990  C  C   . GLN D  1 145 ? 30.181  52.288   100.717 1.00 15.32 ? 226  GLN D C   1 
ATOM   9991  O  O   . GLN D  1 145 ? 30.468  53.313   101.333 1.00 15.61 ? 226  GLN D O   1 
ATOM   9992  C  CB  . GLN D  1 145 ? 30.600  52.242   98.285  1.00 16.00 ? 226  GLN D CB  1 
ATOM   9993  C  CG  . GLN D  1 145 ? 31.606  52.118   97.145  1.00 19.10 ? 226  GLN D CG  1 
ATOM   9994  C  CD  . GLN D  1 145 ? 31.058  52.658   95.832  1.00 22.94 ? 226  GLN D CD  1 
ATOM   9995  O  OE1 . GLN D  1 145 ? 30.823  53.865   95.688  1.00 25.89 ? 226  GLN D OE1 1 
ATOM   9996  N  NE2 . GLN D  1 145 ? 30.843  51.765   94.869  1.00 23.52 ? 226  GLN D NE2 1 
ATOM   9997  N  N   . GLU D  1 146 ? 29.063  51.615   100.944 1.00 15.49 ? 227  GLU D N   1 
ATOM   9998  C  CA  . GLU D  1 146 ? 28.074  52.094   101.899 1.00 15.37 ? 227  GLU D CA  1 
ATOM   9999  C  C   . GLU D  1 146 ? 27.473  53.330   101.246 1.00 15.43 ? 227  GLU D C   1 
ATOM   10000 O  O   . GLU D  1 146 ? 27.106  54.285   101.912 1.00 16.86 ? 227  GLU D O   1 
ATOM   10001 C  CB  . GLU D  1 146 ? 28.687  52.489   103.250 1.00 18.01 ? 227  GLU D CB  1 
ATOM   10002 C  CG  . GLU D  1 146 ? 29.637  51.470   103.894 1.00 21.18 ? 227  GLU D CG  1 
ATOM   10003 C  CD  . GLU D  1 146 ? 29.138  50.038   103.839 1.00 22.81 ? 227  GLU D CD  1 
ATOM   10004 O  OE1 . GLU D  1 146 ? 27.914  49.813   103.702 1.00 24.75 ? 227  GLU D OE1 1 
ATOM   10005 O  OE2 . GLU D  1 146 ? 29.984  49.126   103.948 1.00 24.05 ? 227  GLU D OE2 1 
ATOM   10006 N  N   . SER D  1 147 ? 27.415  53.304   99.922  1.00 16.12 ? 228  SER D N   1 
ATOM   10007 C  CA  . SER D  1 147 ? 26.832  54.373   99.133  1.00 17.95 ? 228  SER D CA  1 
ATOM   10008 C  C   . SER D  1 147 ? 26.835  53.962   97.673  1.00 19.57 ? 228  SER D C   1 
ATOM   10009 O  O   . SER D  1 147 ? 27.514  53.022   97.275  1.00 21.47 ? 228  SER D O   1 
ATOM   10010 C  CB  . SER D  1 147 ? 27.587  55.700   99.303  1.00 20.33 ? 228  SER D CB  1 
ATOM   10011 O  OG  . SER D  1 147 ? 28.810  55.732   98.587  1.00 20.98 ? 228  SER D OG  1 
ATOM   10012 N  N   . GLU D  1 148 ? 26.055  54.686   96.889  1.00 20.66 ? 229  GLU D N   1 
ATOM   10013 C  CA  . GLU D  1 148 ? 25.881  54.473   95.462  1.00 21.81 ? 229  GLU D CA  1 
ATOM   10014 C  C   . GLU D  1 148 ? 27.145  54.137   94.654  1.00 22.29 ? 229  GLU D C   1 
ATOM   10015 O  O   . GLU D  1 148 ? 28.205  54.721   94.886  1.00 21.16 ? 229  GLU D O   1 
ATOM   10016 C  CB  . GLU D  1 148 ? 25.237  55.739   94.914  1.00 24.03 ? 229  GLU D CB  1 
ATOM   10017 C  CG  . GLU D  1 148 ? 24.993  55.784   93.449  1.00 28.99 ? 229  GLU D CG  1 
ATOM   10018 C  CD  . GLU D  1 148 ? 24.696  57.198   92.995  1.00 31.41 ? 229  GLU D CD  1 
ATOM   10019 O  OE1 . GLU D  1 148 ? 25.600  58.059   93.113  1.00 31.21 ? 229  GLU D OE1 1 
ATOM   10020 O  OE2 . GLU D  1 148 ? 23.560  57.447   92.531  1.00 33.90 ? 229  GLU D OE2 1 
ATOM   10021 N  N   . CYS D  1 149 ? 27.044  53.174   93.734  1.00 21.71 ? 230  CYS D N   1 
ATOM   10022 C  CA  . CYS D  1 149 ? 28.177  52.856   92.865  1.00 21.77 ? 230  CYS D CA  1 
ATOM   10023 C  C   . CYS D  1 149 ? 27.940  53.739   91.654  1.00 20.76 ? 230  CYS D C   1 
ATOM   10024 O  O   . CYS D  1 149 ? 26.878  54.333   91.539  1.00 20.46 ? 230  CYS D O   1 
ATOM   10025 C  CB  . CYS D  1 149 ? 28.246  51.370   92.449  1.00 23.45 ? 230  CYS D CB  1 
ATOM   10026 S  SG  . CYS D  1 149 ? 26.709  50.402   92.251  1.00 27.66 ? 230  CYS D SG  1 
ATOM   10027 N  N   . ALA D  1 150 ? 28.911  53.846   90.757  1.00 21.23 ? 231  ALA D N   1 
ATOM   10028 C  CA  . ALA D  1 150 ? 28.753  54.727   89.601  1.00 21.43 ? 231  ALA D CA  1 
ATOM   10029 C  C   . ALA D  1 150 ? 28.714  53.989   88.283  1.00 21.95 ? 231  ALA D C   1 
ATOM   10030 O  O   . ALA D  1 150 ? 29.536  53.116   88.041  1.00 21.86 ? 231  ALA D O   1 
ATOM   10031 C  CB  . ALA D  1 150 ? 29.876  55.752   89.580  1.00 21.37 ? 231  ALA D CB  1 
ATOM   10032 N  N   . CYS D  1 151 ? 27.755  54.338   87.431  1.00 23.60 ? 232  CYS D N   1 
ATOM   10033 C  CA  . CYS D  1 151 ? 27.640  53.691   86.132  1.00 25.73 ? 232  CYS D CA  1 
ATOM   10034 C  C   . CYS D  1 151 ? 27.995  54.662   85.004  1.00 26.30 ? 232  CYS D C   1 
ATOM   10035 O  O   . CYS D  1 151 ? 27.857  55.881   85.135  1.00 26.81 ? 232  CYS D O   1 
ATOM   10036 C  CB  . CYS D  1 151 ? 26.226  53.134   85.916  1.00 26.07 ? 232  CYS D CB  1 
ATOM   10037 S  SG  . CYS D  1 151 ? 25.601  51.967   87.189  1.00 31.27 ? 232  CYS D SG  1 
ATOM   10038 N  N   . VAL D  1 152 ? 28.460  54.103   83.895  1.00 26.54 ? 233  VAL D N   1 
ATOM   10039 C  CA  . VAL D  1 152 ? 28.852  54.883   82.733  1.00 25.96 ? 233  VAL D CA  1 
ATOM   10040 C  C   . VAL D  1 152 ? 28.820  53.981   81.498  1.00 25.57 ? 233  VAL D C   1 
ATOM   10041 O  O   . VAL D  1 152 ? 29.293  52.846   81.548  1.00 25.37 ? 233  VAL D O   1 
ATOM   10042 C  CB  . VAL D  1 152 ? 30.304  55.435   82.895  1.00 26.85 ? 233  VAL D CB  1 
ATOM   10043 C  CG1 . VAL D  1 152 ? 30.659  56.337   81.730  1.00 27.02 ? 233  VAL D CG1 1 
ATOM   10044 C  CG2 . VAL D  1 152 ? 30.438  56.207   84.194  1.00 26.97 ? 233  VAL D CG2 1 
ATOM   10045 N  N   . ASN D  1 153 ? 28.248  54.484   80.406  1.00 24.81 ? 234  ASN D N   1 
ATOM   10046 C  CA  . ASN D  1 153 ? 28.193  53.762   79.139  1.00 25.08 ? 234  ASN D CA  1 
ATOM   10047 C  C   . ASN D  1 153 ? 27.886  52.272   79.303  1.00 26.32 ? 234  ASN D C   1 
ATOM   10048 O  O   . ASN D  1 153 ? 28.529  51.421   78.687  1.00 27.26 ? 234  ASN D O   1 
ATOM   10049 C  CB  . ASN D  1 153 ? 29.529  53.977   78.398  1.00 25.32 ? 234  ASN D CB  1 
ATOM   10050 C  CG  . ASN D  1 153 ? 29.582  53.295   77.031  1.00 26.37 ? 234  ASN D CG  1 
ATOM   10051 O  OD1 . ASN D  1 153 ? 28.605  53.292   76.279  1.00 25.05 ? 234  ASN D OD1 1 
ATOM   10052 N  ND2 . ASN D  1 153 ? 30.744  52.729   76.699  1.00 26.43 ? 234  ASN D ND2 1 
ATOM   10053 N  N   . GLY D  1 154 ? 26.914  51.958   80.151  1.00 26.34 ? 235  GLY D N   1 
ATOM   10054 C  CA  . GLY D  1 154 ? 26.529  50.570   80.350  1.00 25.88 ? 235  GLY D CA  1 
ATOM   10055 C  C   . GLY D  1 154 ? 27.401  49.737   81.267  1.00 26.46 ? 235  GLY D C   1 
ATOM   10056 O  O   . GLY D  1 154 ? 27.324  48.507   81.252  1.00 26.77 ? 235  GLY D O   1 
ATOM   10057 N  N   . SER D  1 155 ? 28.230  50.390   82.071  1.00 26.32 ? 236  SER D N   1 
ATOM   10058 C  CA  . SER D  1 155 ? 29.102  49.667   82.987  1.00 26.10 ? 236  SER D CA  1 
ATOM   10059 C  C   . SER D  1 155 ? 29.098  50.379   84.324  1.00 26.87 ? 236  SER D C   1 
ATOM   10060 O  O   . SER D  1 155 ? 29.206  51.600   84.386  1.00 27.84 ? 236  SER D O   1 
ATOM   10061 C  CB  . SER D  1 155 ? 30.534  49.623   82.448  1.00 26.66 ? 236  SER D CB  1 
ATOM   10062 O  OG  . SER D  1 155 ? 30.573  49.251   81.076  1.00 27.74 ? 236  SER D OG  1 
ATOM   10063 N  N   . CYS D  1 156 ? 28.969  49.620   85.400  1.00 26.72 ? 237  CYS D N   1 
ATOM   10064 C  CA  . CYS D  1 156 ? 28.967  50.220   86.719  1.00 25.42 ? 237  CYS D CA  1 
ATOM   10065 C  C   . CYS D  1 156 ? 30.273  49.842   87.426  1.00 23.76 ? 237  CYS D C   1 
ATOM   10066 O  O   . CYS D  1 156 ? 30.858  48.791   87.154  1.00 25.43 ? 237  CYS D O   1 
ATOM   10067 C  CB  . CYS D  1 156 ? 27.727  49.752   87.486  1.00 26.88 ? 237  CYS D CB  1 
ATOM   10068 S  SG  . CYS D  1 156 ? 26.148  50.082   86.613  1.00 28.04 ? 237  CYS D SG  1 
ATOM   10069 N  N   . PHE D  1 157 ? 30.743  50.708   88.313  1.00 20.31 ? 238  PHE D N   1 
ATOM   10070 C  CA  . PHE D  1 157 ? 31.997  50.465   89.005  1.00 17.54 ? 238  PHE D CA  1 
ATOM   10071 C  C   . PHE D  1 157 ? 31.875  50.667   90.497  1.00 17.49 ? 238  PHE D C   1 
ATOM   10072 O  O   . PHE D  1 157 ? 31.098  51.503   90.958  1.00 18.19 ? 238  PHE D O   1 
ATOM   10073 C  CB  . PHE D  1 157 ? 33.074  51.411   88.470  1.00 15.76 ? 238  PHE D CB  1 
ATOM   10074 C  CG  . PHE D  1 157 ? 33.178  51.420   86.981  1.00 14.85 ? 238  PHE D CG  1 
ATOM   10075 C  CD1 . PHE D  1 157 ? 32.214  52.070   86.205  1.00 13.11 ? 238  PHE D CD1 1 
ATOM   10076 C  CD2 . PHE D  1 157 ? 34.209  50.740   86.343  1.00 12.16 ? 238  PHE D CD2 1 
ATOM   10077 C  CE1 . PHE D  1 157 ? 32.279  52.041   84.821  1.00 12.90 ? 238  PHE D CE1 1 
ATOM   10078 C  CE2 . PHE D  1 157 ? 34.282  50.706   84.957  1.00 11.52 ? 238  PHE D CE2 1 
ATOM   10079 C  CZ  . PHE D  1 157 ? 33.316  51.354   84.193  1.00 11.97 ? 238  PHE D CZ  1 
ATOM   10080 N  N   . THR D  1 158 ? 32.652  49.899   91.250  1.00 16.25 ? 239  THR D N   1 
ATOM   10081 C  CA  . THR D  1 158 ? 32.651  50.014   92.697  1.00 16.29 ? 239  THR D CA  1 
ATOM   10082 C  C   . THR D  1 158 ? 34.063  49.821   93.215  1.00 16.29 ? 239  THR D C   1 
ATOM   10083 O  O   . THR D  1 158 ? 34.959  49.453   92.456  1.00 17.96 ? 239  THR D O   1 
ATOM   10084 C  CB  . THR D  1 158 ? 31.753  48.966   93.365  1.00 16.29 ? 239  THR D CB  1 
ATOM   10085 O  OG1 . THR D  1 158 ? 31.743  49.205   94.778  1.00 18.75 ? 239  THR D OG1 1 
ATOM   10086 C  CG2 . THR D  1 158 ? 32.278  47.549   93.111  1.00 14.49 ? 239  THR D CG2 1 
ATOM   10087 N  N   . VAL D  1 159 ? 34.256  50.076   94.504  1.00 15.32 ? 240  VAL D N   1 
ATOM   10088 C  CA  . VAL D  1 159 ? 35.554  49.920   95.143  1.00 15.12 ? 240  VAL D CA  1 
ATOM   10089 C  C   . VAL D  1 159 ? 35.351  49.053   96.368  1.00 16.48 ? 240  VAL D C   1 
ATOM   10090 O  O   . VAL D  1 159 ? 34.437  49.294   97.162  1.00 18.38 ? 240  VAL D O   1 
ATOM   10091 C  CB  . VAL D  1 159 ? 36.130  51.273   95.606  1.00 14.40 ? 240  VAL D CB  1 
ATOM   10092 C  CG1 . VAL D  1 159 ? 37.469  51.062   96.293  1.00 12.74 ? 240  VAL D CG1 1 
ATOM   10093 C  CG2 . VAL D  1 159 ? 36.286  52.204   94.423  1.00 16.27 ? 240  VAL D CG2 1 
ATOM   10094 N  N   . MET D  1 160 ? 36.189  48.036   96.518  1.00 16.99 ? 241  MET D N   1 
ATOM   10095 C  CA  . MET D  1 160 ? 36.083  47.147   97.662  1.00 16.56 ? 241  MET D CA  1 
ATOM   10096 C  C   . MET D  1 160 ? 37.410  47.093   98.383  1.00 16.75 ? 241  MET D C   1 
ATOM   10097 O  O   . MET D  1 160 ? 38.472  47.228   97.772  1.00 16.28 ? 241  MET D O   1 
ATOM   10098 C  CB  . MET D  1 160 ? 35.678  45.742   97.224  1.00 17.81 ? 241  MET D CB  1 
ATOM   10099 C  CG  . MET D  1 160 ? 34.333  45.679   96.528  1.00 19.89 ? 241  MET D CG  1 
ATOM   10100 S  SD  . MET D  1 160 ? 33.546  44.056   96.678  1.00 23.75 ? 241  MET D SD  1 
ATOM   10101 C  CE  . MET D  1 160 ? 31.854  44.466   96.155  1.00 23.24 ? 241  MET D CE  1 
ATOM   10102 N  N   . THR D  1 161 ? 37.337  46.896   99.690  1.00 15.48 ? 242  THR D N   1 
ATOM   10103 C  CA  . THR D  1 161 ? 38.522  46.837   100.514 1.00 16.08 ? 242  THR D CA  1 
ATOM   10104 C  C   . THR D  1 161 ? 38.526  45.550   101.316 1.00 17.29 ? 242  THR D C   1 
ATOM   10105 O  O   . THR D  1 161 ? 37.481  45.059   101.745 1.00 18.26 ? 242  THR D O   1 
ATOM   10106 C  CB  . THR D  1 161 ? 38.568  48.019   101.498 1.00 15.09 ? 242  THR D CB  1 
ATOM   10107 O  OG1 . THR D  1 161 ? 38.548  49.244   100.765 1.00 18.33 ? 242  THR D OG1 1 
ATOM   10108 C  CG2 . THR D  1 161 ? 39.822  47.973   102.345 1.00 15.34 ? 242  THR D CG2 1 
ATOM   10109 N  N   . ASP D  1 162 ? 39.711  44.993   101.505 1.00 17.01 ? 243  ASP D N   1 
ATOM   10110 C  CA  . ASP D  1 162 ? 39.835  43.787   102.284 1.00 16.97 ? 243  ASP D CA  1 
ATOM   10111 C  C   . ASP D  1 162 ? 41.116  43.986   103.046 1.00 16.66 ? 243  ASP D C   1 
ATOM   10112 O  O   . ASP D  1 162 ? 42.095  44.459   102.489 1.00 17.50 ? 243  ASP D O   1 
ATOM   10113 C  CB  . ASP D  1 162 ? 39.921  42.564   101.375 1.00 15.64 ? 243  ASP D CB  1 
ATOM   10114 C  CG  . ASP D  1 162 ? 39.535  41.273   102.092 1.00 17.11 ? 243  ASP D CG  1 
ATOM   10115 O  OD1 . ASP D  1 162 ? 39.289  40.274   101.384 1.00 16.66 ? 243  ASP D OD1 1 
ATOM   10116 O  OD2 . ASP D  1 162 ? 39.483  41.252   103.352 1.00 15.36 ? 243  ASP D OD2 1 
ATOM   10117 N  N   . GLY D  1 163 ? 41.106  43.662   104.327 1.00 17.25 ? 244  GLY D N   1 
ATOM   10118 C  CA  . GLY D  1 163 ? 42.312  43.828   105.112 1.00 18.41 ? 244  GLY D CA  1 
ATOM   10119 C  C   . GLY D  1 163 ? 42.104  44.659   106.358 1.00 19.04 ? 244  GLY D C   1 
ATOM   10120 O  O   . GLY D  1 163 ? 40.977  45.045   106.677 1.00 20.07 ? 244  GLY D O   1 
ATOM   10121 N  N   . PRO D  1 164 ? 43.183  44.963   107.089 1.00 19.30 ? 245  PRO D N   1 
ATOM   10122 C  CA  . PRO D  1 164 ? 43.036  45.762   108.308 1.00 19.39 ? 245  PRO D CA  1 
ATOM   10123 C  C   . PRO D  1 164 ? 42.418  47.144   108.128 1.00 19.81 ? 245  PRO D C   1 
ATOM   10124 O  O   . PRO D  1 164 ? 42.518  47.756   107.064 1.00 19.98 ? 245  PRO D O   1 
ATOM   10125 C  CB  . PRO D  1 164 ? 44.467  45.827   108.855 1.00 18.33 ? 245  PRO D CB  1 
ATOM   10126 C  CG  . PRO D  1 164 ? 45.315  45.602   107.651 1.00 17.79 ? 245  PRO D CG  1 
ATOM   10127 C  CD  . PRO D  1 164 ? 44.583  44.554   106.885 1.00 16.33 ? 245  PRO D CD  1 
ATOM   10128 N  N   . SER D  1 165 ? 41.747  47.622   109.171 1.00 21.33 ? 246  SER D N   1 
ATOM   10129 C  CA  . SER D  1 165 ? 41.171  48.955   109.127 1.00 22.43 ? 246  SER D CA  1 
ATOM   10130 C  C   . SER D  1 165 ? 42.196  49.884   109.778 1.00 23.49 ? 246  SER D C   1 
ATOM   10131 O  O   . SER D  1 165 ? 41.940  51.064   109.992 1.00 23.83 ? 246  SER D O   1 
ATOM   10132 C  CB  . SER D  1 165 ? 39.808  49.007   109.827 1.00 20.78 ? 246  SER D CB  1 
ATOM   10133 O  OG  . SER D  1 165 ? 39.869  48.529   111.146 1.00 23.11 ? 246  SER D OG  1 
ATOM   10134 N  N   . ASN D  1 166 ? 43.360  49.304   110.090 1.00 26.79 ? 247  ASN D N   1 
ATOM   10135 C  CA  . ASN D  1 166 ? 44.529  50.014   110.626 1.00 27.54 ? 247  ASN D CA  1 
ATOM   10136 C  C   . ASN D  1 166 ? 45.426  50.084   109.399 1.00 27.18 ? 247  ASN D C   1 
ATOM   10137 O  O   . ASN D  1 166 ? 44.984  50.435   108.309 1.00 31.78 ? 247  ASN D O   1 
ATOM   10138 C  CB  . ASN D  1 166 ? 45.288  49.199   111.667 1.00 29.14 ? 247  ASN D CB  1 
ATOM   10139 C  CG  . ASN D  1 166 ? 44.427  48.769   112.806 1.00 30.70 ? 247  ASN D CG  1 
ATOM   10140 O  OD1 . ASN D  1 166 ? 43.557  49.520   113.251 1.00 33.45 ? 247  ASN D OD1 1 
ATOM   10141 N  ND2 . ASN D  1 166 ? 44.671  47.568   113.310 1.00 27.49 ? 247  ASN D ND2 1 
ATOM   10142 N  N   . GLY D  1 167 ? 46.677  49.697   109.566 1.00 25.18 ? 248  GLY D N   1 
ATOM   10143 C  CA  . GLY D  1 167 ? 47.615  49.724   108.455 1.00 22.33 ? 248  GLY D CA  1 
ATOM   10144 C  C   . GLY D  1 167 ? 47.151  49.324   107.064 1.00 19.54 ? 248  GLY D C   1 
ATOM   10145 O  O   . GLY D  1 167 ? 45.973  49.095   106.815 1.00 16.49 ? 248  GLY D O   1 
ATOM   10146 N  N   . GLN D  1 168 ? 48.113  49.264   106.147 1.00 19.32 ? 249  GLN D N   1 
ATOM   10147 C  CA  . GLN D  1 168 ? 47.866  48.879   104.761 1.00 19.03 ? 249  GLN D CA  1 
ATOM   10148 C  C   . GLN D  1 168 ? 46.785  47.822   104.630 1.00 17.86 ? 249  GLN D C   1 
ATOM   10149 O  O   . GLN D  1 168 ? 46.755  46.852   105.381 1.00 17.36 ? 249  GLN D O   1 
ATOM   10150 C  CB  . GLN D  1 168 ? 49.128  48.276   104.137 1.00 18.96 ? 249  GLN D CB  1 
ATOM   10151 C  CG  . GLN D  1 168 ? 49.925  49.177   103.254 1.00 20.98 ? 249  GLN D CG  1 
ATOM   10152 C  CD  . GLN D  1 168 ? 49.090  49.817   102.193 1.00 21.05 ? 249  GLN D CD  1 
ATOM   10153 O  OE1 . GLN D  1 168 ? 48.213  49.194   101.601 1.00 22.63 ? 249  GLN D OE1 1 
ATOM   10154 N  NE2 . GLN D  1 168 ? 49.361  51.074   101.937 1.00 25.52 ? 249  GLN D NE2 1 
ATOM   10155 N  N   . ALA D  1 169 ? 45.910  48.002   103.659 1.00 16.35 ? 250  ALA D N   1 
ATOM   10156 C  CA  . ALA D  1 169 ? 44.889  47.010   103.393 1.00 16.09 ? 250  ALA D CA  1 
ATOM   10157 C  C   . ALA D  1 169 ? 44.994  46.889   101.889 1.00 15.96 ? 250  ALA D C   1 
ATOM   10158 O  O   . ALA D  1 169 ? 45.863  47.516   101.278 1.00 14.51 ? 250  ALA D O   1 
ATOM   10159 C  CB  . ALA D  1 169 ? 43.525  47.502   103.794 1.00 16.64 ? 250  ALA D CB  1 
ATOM   10160 N  N   . SER D  1 170 ? 44.129  46.077   101.298 1.00 15.99 ? 251  SER D N   1 
ATOM   10161 C  CA  . SER D  1 170 ? 44.127  45.881   99.862  1.00 15.63 ? 251  SER D CA  1 
ATOM   10162 C  C   . SER D  1 170 ? 42.895  46.567   99.299  1.00 16.93 ? 251  SER D C   1 
ATOM   10163 O  O   . SER D  1 170 ? 41.841  46.612   99.951  1.00 18.05 ? 251  SER D O   1 
ATOM   10164 C  CB  . SER D  1 170 ? 44.101  44.391   99.547  1.00 16.32 ? 251  SER D CB  1 
ATOM   10165 O  OG  . SER D  1 170 ? 44.131  44.163   98.150  1.00 19.77 ? 251  SER D OG  1 
ATOM   10166 N  N   . TYR D  1 171 ? 43.024  47.111   98.095  1.00 17.18 ? 252  TYR D N   1 
ATOM   10167 C  CA  . TYR D  1 171 ? 41.911  47.807   97.468  1.00 17.31 ? 252  TYR D CA  1 
ATOM   10168 C  C   . TYR D  1 171 ? 41.797  47.394   96.023  1.00 17.95 ? 252  TYR D C   1 
ATOM   10169 O  O   . TYR D  1 171 ? 42.795  47.352   95.304  1.00 18.79 ? 252  TYR D O   1 
ATOM   10170 C  CB  . TYR D  1 171 ? 42.118  49.321   97.559  1.00 16.83 ? 252  TYR D CB  1 
ATOM   10171 C  CG  . TYR D  1 171 ? 42.798  49.729   98.840  1.00 18.33 ? 252  TYR D CG  1 
ATOM   10172 C  CD1 . TYR D  1 171 ? 44.136  50.114   98.846  1.00 18.95 ? 252  TYR D CD1 1 
ATOM   10173 C  CD2 . TYR D  1 171 ? 42.134  49.644   100.061 1.00 19.43 ? 252  TYR D CD2 1 
ATOM   10174 C  CE1 . TYR D  1 171 ? 44.799  50.396   100.037 1.00 19.08 ? 252  TYR D CE1 1 
ATOM   10175 C  CE2 . TYR D  1 171 ? 42.792  49.920   101.259 1.00 18.83 ? 252  TYR D CE2 1 
ATOM   10176 C  CZ  . TYR D  1 171 ? 44.122  50.296   101.234 1.00 17.96 ? 252  TYR D CZ  1 
ATOM   10177 O  OH  . TYR D  1 171 ? 44.779  50.558   102.408 1.00 19.41 ? 252  TYR D OH  1 
ATOM   10178 N  N   . LYS D  1 172 ? 40.575  47.083   95.605  1.00 18.05 ? 253  LYS D N   1 
ATOM   10179 C  CA  . LYS D  1 172 ? 40.312  46.678   94.236  1.00 19.91 ? 253  LYS D CA  1 
ATOM   10180 C  C   . LYS D  1 172 ? 39.135  47.459   93.666  1.00 21.38 ? 253  LYS D C   1 
ATOM   10181 O  O   . LYS D  1 172 ? 38.146  47.699   94.359  1.00 23.79 ? 253  LYS D O   1 
ATOM   10182 C  CB  . LYS D  1 172 ? 39.972  45.189   94.172  1.00 19.48 ? 253  LYS D CB  1 
ATOM   10183 C  CG  . LYS D  1 172 ? 41.101  44.258   94.520  1.00 19.68 ? 253  LYS D CG  1 
ATOM   10184 C  CD  . LYS D  1 172 ? 40.718  42.820   94.231  1.00 20.80 ? 253  LYS D CD  1 
ATOM   10185 C  CE  . LYS D  1 172 ? 41.930  41.912   94.348  1.00 23.41 ? 253  LYS D CE  1 
ATOM   10186 N  NZ  . LYS D  1 172 ? 41.657  40.499   93.946  1.00 26.92 ? 253  LYS D NZ  1 
ATOM   10187 N  N   . ILE D  1 173 ? 39.248  47.859   92.405  1.00 20.64 ? 254  ILE D N   1 
ATOM   10188 C  CA  . ILE D  1 173 ? 38.174  48.564   91.729  1.00 19.54 ? 254  ILE D CA  1 
ATOM   10189 C  C   . ILE D  1 173 ? 37.547  47.502   90.845  1.00 18.85 ? 254  ILE D C   1 
ATOM   10190 O  O   . ILE D  1 173 ? 38.269  46.741   90.203  1.00 19.27 ? 254  ILE D O   1 
ATOM   10191 C  CB  . ILE D  1 173 ? 38.699  49.636   90.801  1.00 21.49 ? 254  ILE D CB  1 
ATOM   10192 C  CG1 . ILE D  1 173 ? 39.472  50.689   91.580  1.00 23.46 ? 254  ILE D CG1 1 
ATOM   10193 C  CG2 . ILE D  1 173 ? 37.549  50.254   90.047  1.00 24.88 ? 254  ILE D CG2 1 
ATOM   10194 C  CD1 . ILE D  1 173 ? 40.286  51.579   90.658  1.00 26.82 ? 254  ILE D CD1 1 
ATOM   10195 N  N   . PHE D  1 174 ? 36.222  47.439   90.799  1.00 17.62 ? 255  PHE D N   1 
ATOM   10196 C  CA  . PHE D  1 174 ? 35.563  46.443   89.965  1.00 17.29 ? 255  PHE D CA  1 
ATOM   10197 C  C   . PHE D  1 174 ? 34.719  47.060   88.856  1.00 17.60 ? 255  PHE D C   1 
ATOM   10198 O  O   . PHE D  1 174 ? 34.080  48.095   89.055  1.00 18.07 ? 255  PHE D O   1 
ATOM   10199 C  CB  . PHE D  1 174 ? 34.680  45.524   90.812  1.00 15.76 ? 255  PHE D CB  1 
ATOM   10200 C  CG  . PHE D  1 174 ? 35.432  44.726   91.839  1.00 17.18 ? 255  PHE D CG  1 
ATOM   10201 C  CD1 . PHE D  1 174 ? 35.659  45.235   93.111  1.00 17.77 ? 255  PHE D CD1 1 
ATOM   10202 C  CD2 . PHE D  1 174 ? 35.909  43.455   91.535  1.00 18.42 ? 255  PHE D CD2 1 
ATOM   10203 C  CE1 . PHE D  1 174 ? 36.345  44.485   94.072  1.00 19.20 ? 255  PHE D CE1 1 
ATOM   10204 C  CE2 . PHE D  1 174 ? 36.596  42.696   92.486  1.00 18.57 ? 255  PHE D CE2 1 
ATOM   10205 C  CZ  . PHE D  1 174 ? 36.817  43.210   93.756  1.00 18.97 ? 255  PHE D CZ  1 
ATOM   10206 N  N   . LYS D  1 175 ? 34.725  46.416   87.690  1.00 17.39 ? 256  LYS D N   1 
ATOM   10207 C  CA  . LYS D  1 175 ? 33.948  46.865   86.544  1.00 18.39 ? 256  LYS D CA  1 
ATOM   10208 C  C   . LYS D  1 175 ? 32.952  45.774   86.232  1.00 20.93 ? 256  LYS D C   1 
ATOM   10209 O  O   . LYS D  1 175 ? 33.335  44.642   85.930  1.00 22.20 ? 256  LYS D O   1 
ATOM   10210 C  CB  . LYS D  1 175 ? 34.837  47.086   85.320  1.00 18.55 ? 256  LYS D CB  1 
ATOM   10211 C  CG  . LYS D  1 175 ? 34.069  47.445   84.051  1.00 17.01 ? 256  LYS D CG  1 
ATOM   10212 C  CD  . LYS D  1 175 ? 34.985  47.594   82.840  1.00 17.74 ? 256  LYS D CD  1 
ATOM   10213 C  CE  . LYS D  1 175 ? 34.204  48.110   81.642  1.00 17.01 ? 256  LYS D CE  1 
ATOM   10214 N  NZ  . LYS D  1 175 ? 35.070  48.358   80.463  1.00 18.77 ? 256  LYS D NZ  1 
ATOM   10215 N  N   . MET D  1 176 ? 31.670  46.101   86.306  1.00 22.85 ? 257  MET D N   1 
ATOM   10216 C  CA  . MET D  1 176 ? 30.661  45.103   86.028  1.00 25.58 ? 257  MET D CA  1 
ATOM   10217 C  C   . MET D  1 176 ? 29.599  45.551   85.049  1.00 25.95 ? 257  MET D C   1 
ATOM   10218 O  O   . MET D  1 176 ? 29.239  46.725   84.984  1.00 25.68 ? 257  MET D O   1 
ATOM   10219 C  CB  . MET D  1 176 ? 30.014  44.634   87.331  1.00 27.88 ? 257  MET D CB  1 
ATOM   10220 C  CG  . MET D  1 176 ? 29.710  45.745   88.301  1.00 31.82 ? 257  MET D CG  1 
ATOM   10221 S  SD  . MET D  1 176 ? 30.374  45.391   89.945  1.00 35.62 ? 257  MET D SD  1 
ATOM   10222 C  CE  . MET D  1 176 ? 30.048  46.961   90.766  1.00 34.53 ? 257  MET D CE  1 
ATOM   10223 N  N   . GLU D  1 177 ? 29.118  44.586   84.277  1.00 27.00 ? 258  GLU D N   1 
ATOM   10224 C  CA  . GLU D  1 177 ? 28.091  44.811   83.287  1.00 28.43 ? 258  GLU D CA  1 
ATOM   10225 C  C   . GLU D  1 177 ? 27.018  43.784   83.577  1.00 29.15 ? 258  GLU D C   1 
ATOM   10226 O  O   . GLU D  1 177 ? 27.314  42.606   83.760  1.00 28.68 ? 258  GLU D O   1 
ATOM   10227 C  CB  . GLU D  1 177 ? 28.677  44.629   81.893  1.00 30.46 ? 258  GLU D CB  1 
ATOM   10228 C  CG  . GLU D  1 177 ? 29.641  45.749   81.515  1.00 34.64 ? 258  GLU D CG  1 
ATOM   10229 C  CD  . GLU D  1 177 ? 30.559  45.380   80.368  1.00 37.29 ? 258  GLU D CD  1 
ATOM   10230 O  OE1 . GLU D  1 177 ? 31.378  46.236   79.957  1.00 37.69 ? 258  GLU D OE1 1 
ATOM   10231 O  OE2 . GLU D  1 177 ? 30.466  44.231   79.882  1.00 39.33 ? 258  GLU D OE2 1 
ATOM   10232 N  N   . LYS D  1 178 ? 25.770  44.241   83.629  1.00 30.30 ? 259  LYS D N   1 
ATOM   10233 C  CA  . LYS D  1 178 ? 24.647  43.371   83.944  1.00 29.91 ? 259  LYS D CA  1 
ATOM   10234 C  C   . LYS D  1 178 ? 24.986  42.588   85.194  1.00 28.51 ? 259  LYS D C   1 
ATOM   10235 O  O   . LYS D  1 178 ? 24.824  41.370   85.241  1.00 28.73 ? 259  LYS D O   1 
ATOM   10236 C  CB  . LYS D  1 178 ? 24.345  42.417   82.790  1.00 31.96 ? 259  LYS D CB  1 
ATOM   10237 C  CG  . LYS D  1 178 ? 23.774  43.126   81.588  1.00 36.06 ? 259  LYS D CG  1 
ATOM   10238 C  CD  . LYS D  1 178 ? 23.391  42.164   80.481  1.00 38.66 ? 259  LYS D CD  1 
ATOM   10239 C  CE  . LYS D  1 178 ? 22.886  42.937   79.270  1.00 41.51 ? 259  LYS D CE  1 
ATOM   10240 N  NZ  . LYS D  1 178 ? 22.679  42.060   78.086  1.00 43.59 ? 259  LYS D NZ  1 
ATOM   10241 N  N   . GLY D  1 179 ? 25.486  43.309   86.194  1.00 27.74 ? 260  GLY D N   1 
ATOM   10242 C  CA  . GLY D  1 179 ? 25.837  42.710   87.470  1.00 26.41 ? 260  GLY D CA  1 
ATOM   10243 C  C   . GLY D  1 179 ? 26.902  41.636   87.453  1.00 25.87 ? 260  GLY D C   1 
ATOM   10244 O  O   . GLY D  1 179 ? 27.030  40.879   88.414  1.00 26.01 ? 260  GLY D O   1 
ATOM   10245 N  N   . LYS D  1 180 ? 27.662  41.547   86.368  1.00 25.88 ? 261  LYS D N   1 
ATOM   10246 C  CA  . LYS D  1 180 ? 28.722  40.553   86.290  1.00 26.44 ? 261  LYS D CA  1 
ATOM   10247 C  C   . LYS D  1 180 ? 30.078  41.256   86.231  1.00 25.65 ? 261  LYS D C   1 
ATOM   10248 O  O   . LYS D  1 180 ? 30.262  42.209   85.471  1.00 23.65 ? 261  LYS D O   1 
ATOM   10249 C  CB  . LYS D  1 180 ? 28.538  39.657   85.057  1.00 28.79 ? 261  LYS D CB  1 
ATOM   10250 C  CG  . LYS D  1 180 ? 29.571  38.518   84.975  1.00 35.82 ? 261  LYS D CG  1 
ATOM   10251 C  CD  . LYS D  1 180 ? 29.342  37.562   83.796  1.00 38.99 ? 261  LYS D CD  1 
ATOM   10252 C  CE  . LYS D  1 180 ? 28.097  36.704   83.997  1.00 42.66 ? 261  LYS D CE  1 
ATOM   10253 N  NZ  . LYS D  1 180 ? 27.869  35.717   82.889  1.00 43.10 ? 261  LYS D NZ  1 
ATOM   10254 N  N   . VAL D  1 181 ? 31.023  40.801   87.046  1.00 23.94 ? 262  VAL D N   1 
ATOM   10255 C  CA  . VAL D  1 181 ? 32.353  41.398   87.051  1.00 23.88 ? 262  VAL D CA  1 
ATOM   10256 C  C   . VAL D  1 181 ? 33.098  40.986   85.789  1.00 23.59 ? 262  VAL D C   1 
ATOM   10257 O  O   . VAL D  1 181 ? 33.413  39.818   85.609  1.00 25.32 ? 262  VAL D O   1 
ATOM   10258 C  CB  . VAL D  1 181 ? 33.168  40.931   88.272  1.00 23.39 ? 262  VAL D CB  1 
ATOM   10259 C  CG1 . VAL D  1 181 ? 34.562  41.527   88.221  1.00 22.00 ? 262  VAL D CG1 1 
ATOM   10260 C  CG2 . VAL D  1 181 ? 32.459  41.329   89.557  1.00 21.98 ? 262  VAL D CG2 1 
ATOM   10261 N  N   . VAL D  1 182 ? 33.374  41.938   84.909  1.00 23.56 ? 263  VAL D N   1 
ATOM   10262 C  CA  . VAL D  1 182 ? 34.097  41.623   83.683  1.00 23.50 ? 263  VAL D CA  1 
ATOM   10263 C  C   . VAL D  1 182 ? 35.574  41.993   83.812  1.00 24.95 ? 263  VAL D C   1 
ATOM   10264 O  O   . VAL D  1 182 ? 36.406  41.586   83.003  1.00 26.42 ? 263  VAL D O   1 
ATOM   10265 C  CB  . VAL D  1 182 ? 33.499  42.358   82.475  1.00 22.61 ? 263  VAL D CB  1 
ATOM   10266 C  CG1 . VAL D  1 182 ? 32.065  41.909   82.275  1.00 22.65 ? 263  VAL D CG1 1 
ATOM   10267 C  CG2 . VAL D  1 182 ? 33.576  43.866   82.678  1.00 22.41 ? 263  VAL D CG2 1 
ATOM   10268 N  N   . LYS D  1 183 ? 35.902  42.768   84.836  1.00 25.12 ? 264  LYS D N   1 
ATOM   10269 C  CA  . LYS D  1 183 ? 37.282  43.165   85.046  1.00 25.19 ? 264  LYS D CA  1 
ATOM   10270 C  C   . LYS D  1 183 ? 37.476  43.776   86.423  1.00 25.33 ? 264  LYS D C   1 
ATOM   10271 O  O   . LYS D  1 183 ? 36.577  44.429   86.961  1.00 25.46 ? 264  LYS D O   1 
ATOM   10272 C  CB  . LYS D  1 183 ? 37.713  44.164   83.968  1.00 24.75 ? 264  LYS D CB  1 
ATOM   10273 C  CG  . LYS D  1 183 ? 39.160  44.589   84.094  1.00 25.11 ? 264  LYS D CG  1 
ATOM   10274 C  CD  . LYS D  1 183 ? 39.598  45.490   82.954  1.00 26.25 ? 264  LYS D CD  1 
ATOM   10275 C  CE  . LYS D  1 183 ? 41.062  45.867   83.126  1.00 27.28 ? 264  LYS D CE  1 
ATOM   10276 N  NZ  . LYS D  1 183 ? 41.609  46.593   81.956  1.00 28.94 ? 264  LYS D NZ  1 
ATOM   10277 N  N   . SER D  1 184 ? 38.652  43.555   86.996  1.00 24.55 ? 265  SER D N   1 
ATOM   10278 C  CA  . SER D  1 184 ? 38.956  44.106   88.305  1.00 24.11 ? 265  SER D CA  1 
ATOM   10279 C  C   . SER D  1 184 ? 40.443  44.389   88.418  1.00 24.25 ? 265  SER D C   1 
ATOM   10280 O  O   . SER D  1 184 ? 41.267  43.638   87.906  1.00 24.62 ? 265  SER D O   1 
ATOM   10281 C  CB  . SER D  1 184 ? 38.525  43.140   89.404  1.00 22.63 ? 265  SER D CB  1 
ATOM   10282 O  OG  . SER D  1 184 ? 39.214  41.916   89.287  1.00 23.41 ? 265  SER D OG  1 
ATOM   10283 N  N   . VAL D  1 185 ? 40.769  45.478   89.102  1.00 23.82 ? 266  VAL D N   1 
ATOM   10284 C  CA  . VAL D  1 185 ? 42.147  45.886   89.295  1.00 23.15 ? 266  VAL D CA  1 
ATOM   10285 C  C   . VAL D  1 185 ? 42.418  46.193   90.757  1.00 23.72 ? 266  VAL D C   1 
ATOM   10286 O  O   . VAL D  1 185 ? 41.590  46.812   91.427  1.00 23.17 ? 266  VAL D O   1 
ATOM   10287 C  CB  . VAL D  1 185 ? 42.453  47.154   88.486  1.00 22.85 ? 266  VAL D CB  1 
ATOM   10288 C  CG1 . VAL D  1 185 ? 43.807  47.708   88.876  1.00 23.57 ? 266  VAL D CG1 1 
ATOM   10289 C  CG2 . VAL D  1 185 ? 42.406  46.842   87.015  1.00 22.14 ? 266  VAL D CG2 1 
ATOM   10290 N  N   . GLU D  1 186 ? 43.576  45.756   91.244  1.00 23.49 ? 267  GLU D N   1 
ATOM   10291 C  CA  . GLU D  1 186 ? 43.961  46.021   92.619  1.00 25.43 ? 267  GLU D CA  1 
ATOM   10292 C  C   . GLU D  1 186 ? 44.847  47.252   92.600  1.00 24.40 ? 267  GLU D C   1 
ATOM   10293 O  O   . GLU D  1 186 ? 45.865  47.281   91.921  1.00 24.78 ? 267  GLU D O   1 
ATOM   10294 C  CB  . GLU D  1 186 ? 44.734  44.847   93.233  1.00 26.76 ? 267  GLU D CB  1 
ATOM   10295 C  CG  . GLU D  1 186 ? 45.319  45.196   94.597  1.00 32.62 ? 267  GLU D CG  1 
ATOM   10296 C  CD  . GLU D  1 186 ? 46.038  44.040   95.285  1.00 38.07 ? 267  GLU D CD  1 
ATOM   10297 O  OE1 . GLU D  1 186 ? 46.653  43.200   94.589  1.00 43.34 ? 267  GLU D OE1 1 
ATOM   10298 O  OE2 . GLU D  1 186 ? 46.010  43.982   96.536  1.00 40.36 ? 267  GLU D OE2 1 
ATOM   10299 N  N   . LEU D  1 187 ? 44.456  48.277   93.341  1.00 23.79 ? 268  LEU D N   1 
ATOM   10300 C  CA  . LEU D  1 187 ? 45.237  49.507   93.386  1.00 23.83 ? 268  LEU D CA  1 
ATOM   10301 C  C   . LEU D  1 187 ? 46.590  49.316   94.055  1.00 23.91 ? 268  LEU D C   1 
ATOM   10302 O  O   . LEU D  1 187 ? 46.676  48.721   95.136  1.00 25.30 ? 268  LEU D O   1 
ATOM   10303 C  CB  . LEU D  1 187 ? 44.485  50.587   94.161  1.00 22.34 ? 268  LEU D CB  1 
ATOM   10304 C  CG  . LEU D  1 187 ? 43.041  50.842   93.769  1.00 22.25 ? 268  LEU D CG  1 
ATOM   10305 C  CD1 . LEU D  1 187 ? 42.505  51.957   94.638  1.00 21.17 ? 268  LEU D CD1 1 
ATOM   10306 C  CD2 . LEU D  1 187 ? 42.949  51.192   92.294  1.00 21.75 ? 268  LEU D CD2 1 
ATOM   10307 N  N   . ASP D  1 188 ? 47.642  49.818   93.415  1.00 22.92 ? 269  ASP D N   1 
ATOM   10308 C  CA  . ASP D  1 188 ? 48.977  49.757   93.992  1.00 22.55 ? 269  ASP D CA  1 
ATOM   10309 C  C   . ASP D  1 188 ? 49.036  51.067   94.766  1.00 22.88 ? 269  ASP D C   1 
ATOM   10310 O  O   . ASP D  1 188 ? 49.569  52.071   94.287  1.00 23.52 ? 269  ASP D O   1 
ATOM   10311 C  CB  . ASP D  1 188 ? 50.044  49.717   92.895  1.00 24.37 ? 269  ASP D CB  1 
ATOM   10312 C  CG  . ASP D  1 188 ? 51.460  49.877   93.444  1.00 28.56 ? 269  ASP D CG  1 
ATOM   10313 O  OD1 . ASP D  1 188 ? 51.740  49.380   94.559  1.00 30.24 ? 269  ASP D OD1 1 
ATOM   10314 O  OD2 . ASP D  1 188 ? 52.303  50.493   92.753  1.00 30.76 ? 269  ASP D OD2 1 
ATOM   10315 N  N   . ALA D  1 189 ? 48.461  51.051   95.964  1.00 21.02 ? 270  ALA D N   1 
ATOM   10316 C  CA  . ALA D  1 189 ? 48.395  52.247   96.786  1.00 19.25 ? 270  ALA D CA  1 
ATOM   10317 C  C   . ALA D  1 189 ? 49.109  52.158   98.138  1.00 17.65 ? 270  ALA D C   1 
ATOM   10318 O  O   . ALA D  1 189 ? 48.506  52.390   99.192  1.00 14.04 ? 270  ALA D O   1 
ATOM   10319 C  CB  . ALA D  1 189 ? 46.921  52.635   96.989  1.00 18.79 ? 270  ALA D CB  1 
ATOM   10320 N  N   . PRO D  1 190 ? 50.411  51.838   98.124  1.00 17.47 ? 271  PRO D N   1 
ATOM   10321 C  CA  . PRO D  1 190 ? 51.129  51.750   99.399  1.00 16.01 ? 271  PRO D CA  1 
ATOM   10322 C  C   . PRO D  1 190 ? 51.027  53.078   100.153 1.00 14.42 ? 271  PRO D C   1 
ATOM   10323 O  O   . PRO D  1 190 ? 51.169  54.144   99.559  1.00 14.77 ? 271  PRO D O   1 
ATOM   10324 C  CB  . PRO D  1 190 ? 52.557  51.427   98.969  1.00 15.88 ? 271  PRO D CB  1 
ATOM   10325 C  CG  . PRO D  1 190 ? 52.667  52.135   97.639  1.00 16.88 ? 271  PRO D CG  1 
ATOM   10326 C  CD  . PRO D  1 190 ? 51.345  51.769   96.984  1.00 17.50 ? 271  PRO D CD  1 
ATOM   10327 N  N   . ASN D  1 191 ? 50.779  52.981   101.456 1.00 12.69 ? 272  ASN D N   1 
ATOM   10328 C  CA  . ASN D  1 191 ? 50.625  54.106   102.367 1.00 12.64 ? 272  ASN D CA  1 
ATOM   10329 C  C   . ASN D  1 191 ? 49.249  54.759   102.292 1.00 13.79 ? 272  ASN D C   1 
ATOM   10330 O  O   . ASN D  1 191 ? 48.965  55.725   102.999 1.00 14.33 ? 272  ASN D O   1 
ATOM   10331 C  CB  . ASN D  1 191 ? 51.708  55.155   102.144 1.00 12.94 ? 272  ASN D CB  1 
ATOM   10332 C  CG  . ASN D  1 191 ? 51.891  56.044   103.353 1.00 14.66 ? 272  ASN D CG  1 
ATOM   10333 O  OD1 . ASN D  1 191 ? 51.984  55.549   104.473 1.00 13.32 ? 272  ASN D OD1 1 
ATOM   10334 N  ND2 . ASN D  1 191 ? 51.945  57.358   103.139 1.00 15.87 ? 272  ASN D ND2 1 
ATOM   10335 N  N   . TYR D  1 192 ? 48.396  54.225   101.430 1.00 14.66 ? 273  TYR D N   1 
ATOM   10336 C  CA  . TYR D  1 192 ? 47.038  54.727   101.287 1.00 16.19 ? 273  TYR D CA  1 
ATOM   10337 C  C   . TYR D  1 192 ? 46.137  53.794   102.071 1.00 17.03 ? 273  TYR D C   1 
ATOM   10338 O  O   . TYR D  1 192 ? 46.539  52.687   102.427 1.00 16.83 ? 273  TYR D O   1 
ATOM   10339 C  CB  . TYR D  1 192 ? 46.576  54.689   99.827  1.00 16.59 ? 273  TYR D CB  1 
ATOM   10340 C  CG  . TYR D  1 192 ? 47.116  55.785   98.950  1.00 17.20 ? 273  TYR D CG  1 
ATOM   10341 C  CD1 . TYR D  1 192 ? 48.461  55.815   98.582  1.00 17.04 ? 273  TYR D CD1 1 
ATOM   10342 C  CD2 . TYR D  1 192 ? 46.279  56.797   98.485  1.00 16.27 ? 273  TYR D CD2 1 
ATOM   10343 C  CE1 . TYR D  1 192 ? 48.955  56.831   97.767  1.00 17.86 ? 273  TYR D CE1 1 
ATOM   10344 C  CE2 . TYR D  1 192 ? 46.764  57.815   97.674  1.00 17.23 ? 273  TYR D CE2 1 
ATOM   10345 C  CZ  . TYR D  1 192 ? 48.100  57.827   97.321  1.00 18.30 ? 273  TYR D CZ  1 
ATOM   10346 O  OH  . TYR D  1 192 ? 48.585  58.839   96.529  1.00 20.55 ? 273  TYR D OH  1 
ATOM   10347 N  N   . HIS D  1 193 ? 44.922  54.254   102.343 1.00 17.00 ? 274  HIS D N   1 
ATOM   10348 C  CA  . HIS D  1 193 ? 43.926  53.441   103.027 1.00 17.96 ? 274  HIS D CA  1 
ATOM   10349 C  C   . HIS D  1 193 ? 42.585  53.909   102.496 1.00 17.53 ? 274  HIS D C   1 
ATOM   10350 O  O   . HIS D  1 193 ? 42.248  55.089   102.600 1.00 18.96 ? 274  HIS D O   1 
ATOM   10351 C  CB  . HIS D  1 193 ? 43.985  53.627   104.541 1.00 18.24 ? 274  HIS D CB  1 
ATOM   10352 C  CG  . HIS D  1 193 ? 43.176  52.614   105.298 1.00 18.07 ? 274  HIS D CG  1 
ATOM   10353 N  ND1 . HIS D  1 193 ? 41.952  52.907   105.863 1.00 17.74 ? 274  HIS D ND1 1 
ATOM   10354 C  CD2 . HIS D  1 193 ? 43.407  51.306   105.558 1.00 18.24 ? 274  HIS D CD2 1 
ATOM   10355 C  CE1 . HIS D  1 193 ? 41.468  51.821   106.438 1.00 17.61 ? 274  HIS D CE1 1 
ATOM   10356 N  NE2 . HIS D  1 193 ? 42.328  50.835   106.269 1.00 18.32 ? 274  HIS D NE2 1 
ATOM   10357 N  N   . TYR D  1 194 ? 41.837  52.992   101.898 1.00 16.21 ? 275  TYR D N   1 
ATOM   10358 C  CA  . TYR D  1 194 ? 40.541  53.327   101.334 1.00 16.45 ? 275  TYR D CA  1 
ATOM   10359 C  C   . TYR D  1 194 ? 39.417  52.572   102.002 1.00 16.97 ? 275  TYR D C   1 
ATOM   10360 O  O   . TYR D  1 194 ? 39.517  51.377   102.241 1.00 17.56 ? 275  TYR D O   1 
ATOM   10361 C  CB  . TYR D  1 194 ? 40.496  53.020   99.832  1.00 15.74 ? 275  TYR D CB  1 
ATOM   10362 C  CG  . TYR D  1 194 ? 41.360  53.915   98.976  1.00 15.42 ? 275  TYR D CG  1 
ATOM   10363 C  CD1 . TYR D  1 194 ? 42.690  53.588   98.710  1.00 14.62 ? 275  TYR D CD1 1 
ATOM   10364 C  CD2 . TYR D  1 194 ? 40.846  55.093   98.429  1.00 14.34 ? 275  TYR D CD2 1 
ATOM   10365 C  CE1 . TYR D  1 194 ? 43.486  54.403   97.914  1.00 14.35 ? 275  TYR D CE1 1 
ATOM   10366 C  CE2 . TYR D  1 194 ? 41.630  55.919   97.644  1.00 13.83 ? 275  TYR D CE2 1 
ATOM   10367 C  CZ  . TYR D  1 194 ? 42.953  55.563   97.377  1.00 16.26 ? 275  TYR D CZ  1 
ATOM   10368 O  OH  . TYR D  1 194 ? 43.721  56.325   96.521  1.00 14.83 ? 275  TYR D OH  1 
ATOM   10369 N  N   . GLU D  1 195 ? 38.343  53.289   102.296 1.00 18.22 ? 276  GLU D N   1 
ATOM   10370 C  CA  . GLU D  1 195 ? 37.164  52.702   102.902 1.00 19.19 ? 276  GLU D CA  1 
ATOM   10371 C  C   . GLU D  1 195 ? 35.953  53.558   102.597 1.00 19.45 ? 276  GLU D C   1 
ATOM   10372 O  O   . GLU D  1 195 ? 36.070  54.772   102.444 1.00 19.62 ? 276  GLU D O   1 
ATOM   10373 C  CB  . GLU D  1 195 ? 37.326  52.568   104.417 1.00 19.48 ? 276  GLU D CB  1 
ATOM   10374 C  CG  . GLU D  1 195 ? 38.111  51.343   104.824 1.00 23.02 ? 276  GLU D CG  1 
ATOM   10375 C  CD  . GLU D  1 195 ? 38.022  51.055   106.307 1.00 25.31 ? 276  GLU D CD  1 
ATOM   10376 O  OE1 . GLU D  1 195 ? 38.504  49.987   106.734 1.00 26.72 ? 276  GLU D OE1 1 
ATOM   10377 O  OE2 . GLU D  1 195 ? 37.476  51.894   107.049 1.00 28.04 ? 276  GLU D OE2 1 
ATOM   10378 N  N   . GLU D  1 196 ? 34.802  52.897   102.488 1.00 19.50 ? 277  GLU D N   1 
ATOM   10379 C  CA  . GLU D  1 196 ? 33.522  53.536   102.235 1.00 18.83 ? 277  GLU D CA  1 
ATOM   10380 C  C   . GLU D  1 196 ? 33.647  54.670   101.229 1.00 19.28 ? 277  GLU D C   1 
ATOM   10381 O  O   . GLU D  1 196 ? 33.370  55.828   101.537 1.00 20.22 ? 277  GLU D O   1 
ATOM   10382 C  CB  . GLU D  1 196 ? 32.956  54.051   103.562 1.00 18.59 ? 277  GLU D CB  1 
ATOM   10383 C  CG  . GLU D  1 196 ? 33.144  53.065   104.704 1.00 19.19 ? 277  GLU D CG  1 
ATOM   10384 C  CD  . GLU D  1 196 ? 32.663  53.576   106.053 1.00 23.30 ? 277  GLU D CD  1 
ATOM   10385 O  OE1 . GLU D  1 196 ? 32.951  54.749   106.406 1.00 22.35 ? 277  GLU D OE1 1 
ATOM   10386 O  OE2 . GLU D  1 196 ? 32.013  52.781   106.774 1.00 25.06 ? 277  GLU D OE2 1 
ATOM   10387 N  N   . CYS D  1 197 ? 34.064  54.333   100.018 1.00 19.85 ? 278  CYS D N   1 
ATOM   10388 C  CA  . CYS D  1 197 ? 34.228  55.332   98.973  1.00 19.78 ? 278  CYS D CA  1 
ATOM   10389 C  C   . CYS D  1 197 ? 32.916  55.914   98.446  1.00 19.45 ? 278  CYS D C   1 
ATOM   10390 O  O   . CYS D  1 197 ? 31.914  55.210   98.302  1.00 19.10 ? 278  CYS D O   1 
ATOM   10391 C  CB  . CYS D  1 197 ? 35.001  54.738   97.805  1.00 18.76 ? 278  CYS D CB  1 
ATOM   10392 S  SG  . CYS D  1 197 ? 36.761  54.408   98.150  1.00 26.16 ? 278  CYS D SG  1 
ATOM   10393 N  N   . SER D  1 198 ? 32.929  57.213   98.172  1.00 17.59 ? 279  SER D N   1 
ATOM   10394 C  CA  . SER D  1 198 ? 31.767  57.881   97.610  1.00 17.05 ? 279  SER D CA  1 
ATOM   10395 C  C   . SER D  1 198 ? 32.229  58.230   96.208  1.00 17.70 ? 279  SER D C   1 
ATOM   10396 O  O   . SER D  1 198 ? 33.039  59.145   96.005  1.00 16.50 ? 279  SER D O   1 
ATOM   10397 C  CB  . SER D  1 198 ? 31.413  59.140   98.402  1.00 16.27 ? 279  SER D CB  1 
ATOM   10398 O  OG  . SER D  1 198 ? 30.998  58.797   99.712  1.00 15.51 ? 279  SER D OG  1 
ATOM   10399 N  N   . CYS D  1 199 ? 31.727  57.465   95.246  1.00 18.03 ? 280  CYS D N   1 
ATOM   10400 C  CA  . CYS D  1 199 ? 32.106  57.627   93.855  1.00 18.96 ? 280  CYS D CA  1 
ATOM   10401 C  C   . CYS D  1 199 ? 31.042  58.260   92.980  1.00 19.35 ? 280  CYS D C   1 
ATOM   10402 O  O   . CYS D  1 199 ? 29.848  58.170   93.259  1.00 20.98 ? 280  CYS D O   1 
ATOM   10403 C  CB  . CYS D  1 199 ? 32.439  56.272   93.260  1.00 20.14 ? 280  CYS D CB  1 
ATOM   10404 S  SG  . CYS D  1 199 ? 33.595  55.226   94.193  1.00 23.56 ? 280  CYS D SG  1 
ATOM   10405 N  N   . TYR D  1 200 ? 31.483  58.882   91.897  1.00 18.69 ? 281  TYR D N   1 
ATOM   10406 C  CA  . TYR D  1 200 ? 30.560  59.494   90.968  1.00 17.28 ? 281  TYR D CA  1 
ATOM   10407 C  C   . TYR D  1 200 ? 31.155  59.551   89.576  1.00 16.79 ? 281  TYR D C   1 
ATOM   10408 O  O   . TYR D  1 200 ? 32.377  59.557   89.408  1.00 15.18 ? 281  TYR D O   1 
ATOM   10409 C  CB  . TYR D  1 200 ? 30.175  60.898   91.427  1.00 18.54 ? 281  TYR D CB  1 
ATOM   10410 C  CG  . TYR D  1 200 ? 31.313  61.886   91.513  1.00 19.20 ? 281  TYR D CG  1 
ATOM   10411 C  CD1 . TYR D  1 200 ? 32.047  62.035   92.689  1.00 18.96 ? 281  TYR D CD1 1 
ATOM   10412 C  CD2 . TYR D  1 200 ? 31.641  62.695   90.419  1.00 19.82 ? 281  TYR D CD2 1 
ATOM   10413 C  CE1 . TYR D  1 200 ? 33.075  62.969   92.777  1.00 21.17 ? 281  TYR D CE1 1 
ATOM   10414 C  CE2 . TYR D  1 200 ? 32.668  63.631   90.496  1.00 19.35 ? 281  TYR D CE2 1 
ATOM   10415 C  CZ  . TYR D  1 200 ? 33.379  63.764   91.675  1.00 21.26 ? 281  TYR D CZ  1 
ATOM   10416 O  OH  . TYR D  1 200 ? 34.393  64.694   91.754  1.00 23.62 ? 281  TYR D OH  1 
ATOM   10417 N  N   . PRO D  1 201 ? 30.290  59.547   88.551  1.00 17.89 ? 282  PRO D N   1 
ATOM   10418 C  CA  . PRO D  1 201 ? 30.745  59.606   87.160  1.00 17.78 ? 282  PRO D CA  1 
ATOM   10419 C  C   . PRO D  1 201 ? 30.958  61.070   86.771  1.00 19.19 ? 282  PRO D C   1 
ATOM   10420 O  O   . PRO D  1 201 ? 30.341  61.961   87.350  1.00 19.55 ? 282  PRO D O   1 
ATOM   10421 C  CB  . PRO D  1 201 ? 29.592  58.954   86.404  1.00 16.91 ? 282  PRO D CB  1 
ATOM   10422 C  CG  . PRO D  1 201 ? 28.405  59.402   87.184  1.00 14.85 ? 282  PRO D CG  1 
ATOM   10423 C  CD  . PRO D  1 201 ? 28.854  59.215   88.618  1.00 15.26 ? 282  PRO D CD  1 
ATOM   10424 N  N   . ASN D  1 202 ? 31.841  61.321   85.811  1.00 19.77 ? 283  ASN D N   1 
ATOM   10425 C  CA  . ASN D  1 202 ? 32.112  62.687   85.369  1.00 20.69 ? 283  ASN D CA  1 
ATOM   10426 C  C   . ASN D  1 202 ? 32.891  62.587   84.065  1.00 20.56 ? 283  ASN D C   1 
ATOM   10427 O  O   . ASN D  1 202 ? 34.026  62.128   84.054  1.00 21.12 ? 283  ASN D O   1 
ATOM   10428 C  CB  . ASN D  1 202 ? 32.948  63.432   86.424  1.00 22.40 ? 283  ASN D CB  1 
ATOM   10429 C  CG  . ASN D  1 202 ? 33.020  64.944   86.178  1.00 26.51 ? 283  ASN D CG  1 
ATOM   10430 O  OD1 . ASN D  1 202 ? 32.542  65.457   85.161  1.00 30.36 ? 283  ASN D OD1 1 
ATOM   10431 N  ND2 . ASN D  1 202 ? 33.627  65.663   87.121  1.00 27.17 ? 283  ASN D ND2 1 
ATOM   10432 N  N   . ALA D  1 203 ? 32.272  62.999   82.966  1.00 19.60 ? 284  ALA D N   1 
ATOM   10433 C  CA  . ALA D  1 203 ? 32.922  62.958   81.668  1.00 20.07 ? 284  ALA D CA  1 
ATOM   10434 C  C   . ALA D  1 203 ? 33.534  61.597   81.355  1.00 20.05 ? 284  ALA D C   1 
ATOM   10435 O  O   . ALA D  1 203 ? 34.713  61.497   81.008  1.00 20.38 ? 284  ALA D O   1 
ATOM   10436 C  CB  . ALA D  1 203 ? 33.997  64.047   81.584  1.00 20.79 ? 284  ALA D CB  1 
ATOM   10437 N  N   . GLY D  1 204 ? 32.733  60.550   81.497  1.00 19.10 ? 285  GLY D N   1 
ATOM   10438 C  CA  . GLY D  1 204 ? 33.200  59.219   81.176  1.00 18.88 ? 285  GLY D CA  1 
ATOM   10439 C  C   . GLY D  1 204 ? 34.184  58.560   82.109  1.00 20.24 ? 285  GLY D C   1 
ATOM   10440 O  O   . GLY D  1 204 ? 34.701  57.484   81.806  1.00 21.38 ? 285  GLY D O   1 
ATOM   10441 N  N   . GLU D  1 205 ? 34.464  59.188   83.238  1.00 21.67 ? 286  GLU D N   1 
ATOM   10442 C  CA  . GLU D  1 205 ? 35.387  58.590   84.194  1.00 23.44 ? 286  GLU D CA  1 
ATOM   10443 C  C   . GLU D  1 205 ? 34.755  58.625   85.577  1.00 22.41 ? 286  GLU D C   1 
ATOM   10444 O  O   . GLU D  1 205 ? 33.725  59.272   85.771  1.00 23.17 ? 286  GLU D O   1 
ATOM   10445 C  CB  . GLU D  1 205 ? 36.722  59.334   84.189  1.00 25.93 ? 286  GLU D CB  1 
ATOM   10446 C  CG  . GLU D  1 205 ? 37.286  59.524   82.791  1.00 30.66 ? 286  GLU D CG  1 
ATOM   10447 C  CD  . GLU D  1 205 ? 38.801  59.635   82.771  1.00 35.62 ? 286  GLU D CD  1 
ATOM   10448 O  OE1 . GLU D  1 205 ? 39.379  60.247   83.701  1.00 38.61 ? 286  GLU D OE1 1 
ATOM   10449 O  OE2 . GLU D  1 205 ? 39.418  59.117   81.811  1.00 38.22 ? 286  GLU D OE2 1 
ATOM   10450 N  N   . ILE D  1 206 ? 35.361  57.921   86.529  1.00 21.87 ? 287  ILE D N   1 
ATOM   10451 C  CA  . ILE D  1 206 ? 34.835  57.861   87.889  1.00 20.72 ? 287  ILE D CA  1 
ATOM   10452 C  C   . ILE D  1 206 ? 35.796  58.444   88.908  1.00 20.05 ? 287  ILE D C   1 
ATOM   10453 O  O   . ILE D  1 206 ? 37.006  58.256   88.817  1.00 21.16 ? 287  ILE D O   1 
ATOM   10454 C  CB  . ILE D  1 206 ? 34.529  56.403   88.314  1.00 21.44 ? 287  ILE D CB  1 
ATOM   10455 C  CG1 . ILE D  1 206 ? 33.441  55.812   87.423  1.00 23.34 ? 287  ILE D CG1 1 
ATOM   10456 C  CG2 . ILE D  1 206 ? 34.078  56.359   89.767  1.00 22.39 ? 287  ILE D CG2 1 
ATOM   10457 C  CD1 . ILE D  1 206 ? 33.935  55.400   86.057  1.00 26.28 ? 287  ILE D CD1 1 
ATOM   10458 N  N   . THR D  1 207 ? 35.252  59.150   89.886  1.00 18.76 ? 288  THR D N   1 
ATOM   10459 C  CA  . THR D  1 207 ? 36.070  59.723   90.934  1.00 18.05 ? 288  THR D CA  1 
ATOM   10460 C  C   . THR D  1 207 ? 35.489  59.315   92.291  1.00 18.27 ? 288  THR D C   1 
ATOM   10461 O  O   . THR D  1 207 ? 34.274  59.361   92.492  1.00 18.76 ? 288  THR D O   1 
ATOM   10462 C  CB  . THR D  1 207 ? 36.116  61.253   90.801  1.00 18.60 ? 288  THR D CB  1 
ATOM   10463 O  OG1 . THR D  1 207 ? 36.691  61.588   89.529  1.00 20.21 ? 288  THR D OG1 1 
ATOM   10464 C  CG2 . THR D  1 207 ? 36.958  61.872   91.915  1.00 15.41 ? 288  THR D CG2 1 
ATOM   10465 N  N   . CYS D  1 208 ? 36.350  58.888   93.209  1.00 17.05 ? 289  CYS D N   1 
ATOM   10466 C  CA  . CYS D  1 208 ? 35.890  58.490   94.535  1.00 17.85 ? 289  CYS D CA  1 
ATOM   10467 C  C   . CYS D  1 208 ? 36.697  59.176   95.629  1.00 16.45 ? 289  CYS D C   1 
ATOM   10468 O  O   . CYS D  1 208 ? 37.921  59.133   95.626  1.00 14.72 ? 289  CYS D O   1 
ATOM   10469 C  CB  . CYS D  1 208 ? 36.031  56.982   94.768  1.00 18.37 ? 289  CYS D CB  1 
ATOM   10470 S  SG  . CYS D  1 208 ? 35.426  55.806   93.518  1.00 22.18 ? 289  CYS D SG  1 
ATOM   10471 N  N   . VAL D  1 209 ? 36.001  59.817   96.555  1.00 15.35 ? 290  VAL D N   1 
ATOM   10472 C  CA  . VAL D  1 209 ? 36.654  60.445   97.684  1.00 15.28 ? 290  VAL D CA  1 
ATOM   10473 C  C   . VAL D  1 209 ? 36.249  59.477   98.783  1.00 16.64 ? 290  VAL D C   1 
ATOM   10474 O  O   . VAL D  1 209 ? 35.056  59.208   98.972  1.00 16.41 ? 290  VAL D O   1 
ATOM   10475 C  CB  . VAL D  1 209 ? 36.101  61.841   97.950  1.00 14.85 ? 290  VAL D CB  1 
ATOM   10476 C  CG1 . VAL D  1 209 ? 36.755  62.431   99.182  1.00 14.15 ? 290  VAL D CG1 1 
ATOM   10477 C  CG2 . VAL D  1 209 ? 36.368  62.724   96.746  1.00 15.13 ? 290  VAL D CG2 1 
ATOM   10478 N  N   . CYS D  1 210 ? 37.235  58.936   99.493  1.00 15.60 ? 291  CYS D N   1 
ATOM   10479 C  CA  . CYS D  1 210 ? 36.941  57.943   100.501 1.00 16.45 ? 291  CYS D CA  1 
ATOM   10480 C  C   . CYS D  1 210 ? 37.316  58.294   101.930 1.00 16.48 ? 291  CYS D C   1 
ATOM   10481 O  O   . CYS D  1 210 ? 37.531  59.452   102.278 1.00 17.78 ? 291  CYS D O   1 
ATOM   10482 C  CB  . CYS D  1 210 ? 37.616  56.634   100.104 1.00 16.83 ? 291  CYS D CB  1 
ATOM   10483 S  SG  . CYS D  1 210 ? 37.601  56.281   98.308  1.00 20.61 ? 291  CYS D SG  1 
ATOM   10484 N  N   . ARG D  1 211 ? 37.378  57.261   102.758 1.00 16.76 ? 292  ARG D N   1 
ATOM   10485 C  CA  . ARG D  1 211 ? 37.716  57.404   104.161 1.00 16.94 ? 292  ARG D CA  1 
ATOM   10486 C  C   . ARG D  1 211 ? 39.019  56.688   104.480 1.00 16.38 ? 292  ARG D C   1 
ATOM   10487 O  O   . ARG D  1 211 ? 39.198  55.516   104.144 1.00 17.62 ? 292  ARG D O   1 
ATOM   10488 C  CB  . ARG D  1 211 ? 36.596  56.825   105.015 1.00 15.27 ? 292  ARG D CB  1 
ATOM   10489 C  CG  . ARG D  1 211 ? 36.978  56.502   106.441 1.00 16.17 ? 292  ARG D CG  1 
ATOM   10490 C  CD  . ARG D  1 211 ? 35.793  55.871   107.149 1.00 16.45 ? 292  AR