data_2HU4
# 
_entry.id   2HU4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HU4         
RCSB  RCSB038763   
WWPDB D_1000038763 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HT5 . unspecified 
PDB 2HT7 . unspecified 
PDB 2HT8 . unspecified 
PDB 2HTU . unspecified 
PDB 2HTQ . unspecified 
PDB 2HTV . unspecified 
PDB 2HTW . unspecified 
PDB 2HTY . unspecified 
PDB 2HTR . unspecified 
PDB 2HU0 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HU4 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Russell, R.J.'   1 
'Haire, L.F.'     2 
'Stevens, D.J.'   3 
'Collins, P.J.'   4 
'Lin, Y.P.'       5 
'Blackburn, G.M.' 6 
'Hay, A.J.'       7 
'Gamblin, S.J.'   8 
'Skehel, J.J.'    9 
# 
_citation.id                        primary 
_citation.title                     
'The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            443 
_citation.page_first                45 
_citation.page_last                 49 
_citation.year                      2006 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16915235 
_citation.pdbx_database_id_DOI      10.1038/nature05114 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Russell, R.J.'   1 
primary 'Haire, L.F.'     2 
primary 'Stevens, D.J.'   3 
primary 'Collins, P.J.'   4 
primary 'Lin, Y.P.'       5 
primary 'Blackburn, G.M.' 6 
primary 'Hay, A.J.'       7 
primary 'Gamblin, S.J.'   8 
primary 'Skehel, J.J.'    9 
# 
_cell.entry_id           2HU4 
_cell.length_a           201.060 
_cell.length_b           201.240 
_cell.length_c           211.740 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              64 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HU4 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Neuraminidase                                                                           42429.180 8 ? H233Y ? ? 
2 non-polymer syn '(3R,4R,5S)-4-(acetylamino)-5-amino-3-(pentan-3-yloxy)cyclohex-1-ene-1-carboxylic acid' 284.351   8 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Neuraminidase NA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCP
VGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVM
TDGPSNGQASYKIFKMEKGKVVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVF
GDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGY
SGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCP
VGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVM
TDGPSNGQASYKIFKMEKGKVVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVF
GDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGY
SGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   LYS n 
1 3   LEU n 
1 4   ALA n 
1 5   GLY n 
1 6   ASN n 
1 7   SER n 
1 8   SER n 
1 9   LEU n 
1 10  CYS n 
1 11  PRO n 
1 12  ILE n 
1 13  ASN n 
1 14  GLY n 
1 15  TRP n 
1 16  ALA n 
1 17  VAL n 
1 18  TYR n 
1 19  SER n 
1 20  LYS n 
1 21  ASP n 
1 22  ASN n 
1 23  SER n 
1 24  ILE n 
1 25  ARG n 
1 26  ILE n 
1 27  GLY n 
1 28  SER n 
1 29  LYS n 
1 30  GLY n 
1 31  ASP n 
1 32  VAL n 
1 33  PHE n 
1 34  VAL n 
1 35  ILE n 
1 36  ARG n 
1 37  GLU n 
1 38  PRO n 
1 39  PHE n 
1 40  ILE n 
1 41  SER n 
1 42  CYS n 
1 43  SER n 
1 44  HIS n 
1 45  LEU n 
1 46  GLU n 
1 47  CYS n 
1 48  ARG n 
1 49  THR n 
1 50  PHE n 
1 51  PHE n 
1 52  LEU n 
1 53  THR n 
1 54  GLN n 
1 55  GLY n 
1 56  ALA n 
1 57  LEU n 
1 58  LEU n 
1 59  ASN n 
1 60  ASP n 
1 61  LYS n 
1 62  HIS n 
1 63  SER n 
1 64  ASN n 
1 65  GLY n 
1 66  THR n 
1 67  VAL n 
1 68  LYS n 
1 69  ASP n 
1 70  ARG n 
1 71  SER n 
1 72  PRO n 
1 73  HIS n 
1 74  ARG n 
1 75  THR n 
1 76  LEU n 
1 77  MET n 
1 78  SER n 
1 79  CYS n 
1 80  PRO n 
1 81  VAL n 
1 82  GLY n 
1 83  GLU n 
1 84  ALA n 
1 85  PRO n 
1 86  SER n 
1 87  PRO n 
1 88  TYR n 
1 89  ASN n 
1 90  SER n 
1 91  ARG n 
1 92  PHE n 
1 93  GLU n 
1 94  SER n 
1 95  VAL n 
1 96  ALA n 
1 97  TRP n 
1 98  SER n 
1 99  ALA n 
1 100 SER n 
1 101 ALA n 
1 102 CYS n 
1 103 HIS n 
1 104 ASP n 
1 105 GLY n 
1 106 THR n 
1 107 SER n 
1 108 TRP n 
1 109 LEU n 
1 110 THR n 
1 111 ILE n 
1 112 GLY n 
1 113 ILE n 
1 114 SER n 
1 115 GLY n 
1 116 PRO n 
1 117 ASP n 
1 118 ASN n 
1 119 GLY n 
1 120 ALA n 
1 121 VAL n 
1 122 ALA n 
1 123 VAL n 
1 124 LEU n 
1 125 LYS n 
1 126 TYR n 
1 127 ASN n 
1 128 GLY n 
1 129 ILE n 
1 130 ILE n 
1 131 THR n 
1 132 ASP n 
1 133 THR n 
1 134 ILE n 
1 135 LYS n 
1 136 SER n 
1 137 TRP n 
1 138 ARG n 
1 139 ASN n 
1 140 ASN n 
1 141 ILE n 
1 142 LEU n 
1 143 ARG n 
1 144 THR n 
1 145 GLN n 
1 146 GLU n 
1 147 SER n 
1 148 GLU n 
1 149 CYS n 
1 150 ALA n 
1 151 CYS n 
1 152 VAL n 
1 153 ASN n 
1 154 GLY n 
1 155 SER n 
1 156 CYS n 
1 157 PHE n 
1 158 THR n 
1 159 VAL n 
1 160 MET n 
1 161 THR n 
1 162 ASP n 
1 163 GLY n 
1 164 PRO n 
1 165 SER n 
1 166 ASN n 
1 167 GLY n 
1 168 GLN n 
1 169 ALA n 
1 170 SER n 
1 171 TYR n 
1 172 LYS n 
1 173 ILE n 
1 174 PHE n 
1 175 LYS n 
1 176 MET n 
1 177 GLU n 
1 178 LYS n 
1 179 GLY n 
1 180 LYS n 
1 181 VAL n 
1 182 VAL n 
1 183 LYS n 
1 184 SER n 
1 185 VAL n 
1 186 GLU n 
1 187 LEU n 
1 188 ASP n 
1 189 ALA n 
1 190 PRO n 
1 191 ASN n 
1 192 TYR n 
1 193 HIS n 
1 194 TYR n 
1 195 GLU n 
1 196 GLU n 
1 197 CYS n 
1 198 SER n 
1 199 CYS n 
1 200 TYR n 
1 201 PRO n 
1 202 ASN n 
1 203 ALA n 
1 204 GLY n 
1 205 GLU n 
1 206 ILE n 
1 207 THR n 
1 208 CYS n 
1 209 VAL n 
1 210 CYS n 
1 211 ARG n 
1 212 ASP n 
1 213 ASN n 
1 214 TRP n 
1 215 HIS n 
1 216 GLY n 
1 217 SER n 
1 218 ASN n 
1 219 ARG n 
1 220 PRO n 
1 221 TRP n 
1 222 VAL n 
1 223 SER n 
1 224 PHE n 
1 225 ASN n 
1 226 GLN n 
1 227 ASN n 
1 228 LEU n 
1 229 GLU n 
1 230 TYR n 
1 231 GLN n 
1 232 ILE n 
1 233 GLY n 
1 234 TYR n 
1 235 ILE n 
1 236 CYS n 
1 237 SER n 
1 238 GLY n 
1 239 VAL n 
1 240 PHE n 
1 241 GLY n 
1 242 ASP n 
1 243 ASN n 
1 244 PRO n 
1 245 ARG n 
1 246 PRO n 
1 247 ASN n 
1 248 ASP n 
1 249 GLY n 
1 250 THR n 
1 251 GLY n 
1 252 SER n 
1 253 CYS n 
1 254 GLY n 
1 255 PRO n 
1 256 VAL n 
1 257 SER n 
1 258 SER n 
1 259 ASN n 
1 260 GLY n 
1 261 ALA n 
1 262 TYR n 
1 263 GLY n 
1 264 VAL n 
1 265 LYS n 
1 266 GLY n 
1 267 PHE n 
1 268 SER n 
1 269 PHE n 
1 270 LYS n 
1 271 TYR n 
1 272 GLY n 
1 273 ASN n 
1 274 GLY n 
1 275 VAL n 
1 276 TRP n 
1 277 ILE n 
1 278 GLY n 
1 279 ARG n 
1 280 THR n 
1 281 LYS n 
1 282 SER n 
1 283 THR n 
1 284 ASN n 
1 285 SER n 
1 286 ARG n 
1 287 SER n 
1 288 GLY n 
1 289 PHE n 
1 290 GLU n 
1 291 MET n 
1 292 ILE n 
1 293 TRP n 
1 294 ASP n 
1 295 PRO n 
1 296 ASN n 
1 297 GLY n 
1 298 TRP n 
1 299 THR n 
1 300 GLU n 
1 301 THR n 
1 302 ASP n 
1 303 SER n 
1 304 SER n 
1 305 PHE n 
1 306 SER n 
1 307 VAL n 
1 308 LYS n 
1 309 GLN n 
1 310 ASP n 
1 311 ILE n 
1 312 VAL n 
1 313 ALA n 
1 314 ILE n 
1 315 THR n 
1 316 ASP n 
1 317 TRP n 
1 318 SER n 
1 319 GLY n 
1 320 TYR n 
1 321 SER n 
1 322 GLY n 
1 323 SER n 
1 324 PHE n 
1 325 VAL n 
1 326 GLN n 
1 327 HIS n 
1 328 PRO n 
1 329 GLU n 
1 330 LEU n 
1 331 THR n 
1 332 GLY n 
1 333 LEU n 
1 334 ASP n 
1 335 CYS n 
1 336 ILE n 
1 337 ARG n 
1 338 PRO n 
1 339 CYS n 
1 340 PHE n 
1 341 TRP n 
1 342 VAL n 
1 343 GLU n 
1 344 LEU n 
1 345 ILE n 
1 346 ARG n 
1 347 GLY n 
1 348 ARG n 
1 349 PRO n 
1 350 LYS n 
1 351 GLU n 
1 352 SER n 
1 353 THR n 
1 354 ILE n 
1 355 TRP n 
1 356 THR n 
1 357 SER n 
1 358 GLY n 
1 359 SER n 
1 360 SER n 
1 361 ILE n 
1 362 SER n 
1 363 PHE n 
1 364 CYS n 
1 365 GLY n 
1 366 VAL n 
1 367 ASN n 
1 368 SER n 
1 369 ASP n 
1 370 THR n 
1 371 VAL n 
1 372 GLY n 
1 373 TRP n 
1 374 SER n 
1 375 TRP n 
1 376 PRO n 
1 377 ASP n 
1 378 GLY n 
1 379 ALA n 
1 380 GLU n 
1 381 LEU n 
1 382 PRO n 
1 383 PHE n 
1 384 THR n 
1 385 ILE n 
1 386 ASP n 
1 387 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Influenza A virus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      11320 
_entity_src_nat.genus                      'Influenzavirus A' 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q6DPL2_9INFA 
_struct_ref.pdbx_db_accession          Q6DPL2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCP
VGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVM
TDGPSNGQASHKIFKMEKGKVVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVF
GDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGY
SGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
;
_struct_ref.pdbx_align_begin           63 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HU4 A 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
2 1 2HU4 B 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
3 1 2HU4 C 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
4 1 2HU4 D 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
5 1 2HU4 E 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
6 1 2HU4 F 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
7 1 2HU4 G 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
8 1 2HU4 H 1 ? 387 ? Q6DPL2 63 ? 449 ? 83 470 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HU4 TYR A 171 ? UNP Q6DPL2 HIS 233 'ENGINEERED MUTATION' 252 1 
2 2HU4 TYR B 171 ? UNP Q6DPL2 HIS 233 'ENGINEERED MUTATION' 252 2 
3 2HU4 TYR C 171 ? UNP Q6DPL2 HIS 233 'ENGINEERED MUTATION' 252 3 
4 2HU4 TYR D 171 ? UNP Q6DPL2 HIS 233 'ENGINEERED MUTATION' 252 4 
5 2HU4 TYR E 171 ? UNP Q6DPL2 HIS 233 'ENGINEERED MUTATION' 252 5 
6 2HU4 TYR F 171 ? UNP Q6DPL2 HIS 233 'ENGINEERED MUTATION' 252 6 
7 2HU4 TYR G 171 ? UNP Q6DPL2 HIS 233 'ENGINEERED MUTATION' 252 7 
8 2HU4 TYR H 171 ? UNP Q6DPL2 HIS 233 'ENGINEERED MUTATION' 252 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                 ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                              ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                         ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                ? 'C3 H7 N O2 S' 
121.158 
G39 non-polymer         . '(3R,4R,5S)-4-(acetylamino)-5-amino-3-(pentan-3-yloxy)cyclohex-1-ene-1-carboxylic acid' 
'Oseltamivir carboxylate' 'C14 H24 N2 O4'  284.351 
GLN 'L-peptide linking' y GLUTAMINE                                                                               ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                         ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                 ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                               ? 
'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                              ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                 ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                  ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                              ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                           ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                 ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                  ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                               ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                              ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                  ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          2HU4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.15 
_exptl_crystal.density_percent_sol   61.00 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'MES, PEG3350, pH 8.0, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2006-03-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     2HU4 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             30 
_reflns.number_all                   147469 
_reflns.number_obs                   136759 
_reflns.percent_possible_obs         93.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.085 
_reflns.pdbx_netI_over_sigmaI        11.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2HU4 
_refine.ls_d_res_high                            2.5 
_refine.ls_d_res_low                             30 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     147469 
_refine.ls_number_reflns_obs                     136759 
_refine.ls_number_reflns_R_free                  6805 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.237 
_refine.ls_R_factor_obs                          0.237 
_refine.ls_R_factor_R_work                       0.237 
_refine.ls_R_factor_R_free                       0.273 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        23696 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         160 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               23856 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        30 
# 
_struct.entry_id                  2HU4 
_struct.title                     'N1 neuraminidase in complex with oseltamivir 2' 
_struct.pdbx_descriptor           Neuraminidase 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HU4 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'N1, neuraminidase, oseltamivir, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 22  ? SER A 28  ? ASN A 104 SER A 110 1 ? 7 
HELX_P HELX_P2  2  ASP A 60  ? ASN A 64  ? ASP A 142 ASN A 146 5 ? 5 
HELX_P HELX_P3  3  HIS A 327 A GLY A 332 ? HIS A 412 GLY A 414 1 ? 6 
HELX_P HELX_P4  4  ASN B 22  ? GLY B 27  ? ASN B 104 GLY B 109 1 ? 6 
HELX_P HELX_P5  5  ASP B 60  ? ASN B 64  ? ASP B 142 ASN B 146 5 ? 5 
HELX_P HELX_P6  6  HIS B 327 A GLY B 332 ? HIS B 412 GLY B 414 1 ? 6 
HELX_P HELX_P7  7  ASN C 22  ? SER C 28  ? ASN C 104 SER C 110 1 ? 7 
HELX_P HELX_P8  8  ASP C 60  ? ASN C 64  ? ASP C 142 ASN C 146 5 ? 5 
HELX_P HELX_P9  9  HIS C 327 A GLY C 332 ? HIS C 412 GLY C 414 1 ? 6 
HELX_P HELX_P10 10 ASN D 22  ? SER D 28  ? ASN D 104 SER D 110 1 ? 7 
HELX_P HELX_P11 11 ASP D 60  ? ASN D 64  ? ASP D 142 ASN D 146 5 ? 5 
HELX_P HELX_P12 12 HIS D 327 A GLY D 332 ? HIS D 412 GLY D 414 1 ? 6 
HELX_P HELX_P13 13 ASN E 22  ? SER E 28  ? ASN E 104 SER E 110 1 ? 7 
HELX_P HELX_P14 14 ASP E 60  ? ASN E 64  ? ASP E 142 ASN E 146 5 ? 5 
HELX_P HELX_P15 15 HIS E 327 A GLY E 332 ? HIS E 412 GLY E 414 1 ? 6 
HELX_P HELX_P16 16 ASN F 22  ? SER F 28  ? ASN F 104 SER F 110 1 ? 7 
HELX_P HELX_P17 17 ASP F 60  ? ASN F 64  ? ASP F 142 ASN F 146 5 ? 5 
HELX_P HELX_P18 18 HIS F 327 A GLY F 332 ? HIS F 412 GLY F 414 1 ? 6 
HELX_P HELX_P19 19 ASN G 22  ? SER G 28  ? ASN G 104 SER G 110 1 ? 7 
HELX_P HELX_P20 20 ASP G 60  ? ASN G 64  ? ASP G 142 ASN G 146 5 ? 5 
HELX_P HELX_P21 21 HIS G 327 A GLY G 332 ? HIS G 412 GLY G 414 1 ? 6 
HELX_P HELX_P22 22 ASN H 22  ? SER H 28  ? ASN H 104 SER H 110 1 ? 7 
HELX_P HELX_P23 23 ASP H 60  ? ASN H 64  ? ASP H 142 ASN H 146 5 ? 5 
HELX_P HELX_P24 24 HIS H 327 A GLY H 332 ? HIS H 412 GLY H 414 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 10  SG ? ? ? 1_555 A CYS 335 SG ? ? A CYS 92  A CYS 417 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf2  disulf ? ? A CYS 42  SG ? ? ? 1_555 A CYS 47  SG ? ? A CYS 124 A CYS 129 1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf3  disulf ? ? A CYS 102 SG ? ? ? 1_555 A CYS 149 SG ? ? A CYS 183 A CYS 230 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4  disulf ? ? A CYS 151 SG ? ? ? 1_555 A CYS 156 SG ? ? A CYS 232 A CYS 237 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf5  disulf ? ? A CYS 197 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 278 A CYS 291 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf6  disulf ? ? A CYS 199 SG ? ? ? 1_555 A CYS 208 SG ? ? A CYS 280 A CYS 289 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf7  disulf ? ? A CYS 236 SG ? ? ? 1_555 A CYS 253 SG ? ? A CYS 318 A CYS 336 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf8  disulf ? ? A CYS 339 SG ? ? ? 1_555 A CYS 364 SG ? ? A CYS 421 A CYS 447 1_555 ? ? ? ? ? ? ? 2.058 ? 
disulf9  disulf ? ? B CYS 10  SG ? ? ? 1_555 B CYS 335 SG ? ? B CYS 92  B CYS 417 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf10 disulf ? ? B CYS 42  SG ? ? ? 1_555 B CYS 47  SG ? ? B CYS 124 B CYS 129 1_555 ? ? ? ? ? ? ? 2.058 ? 
disulf11 disulf ? ? B CYS 102 SG ? ? ? 1_555 B CYS 149 SG ? ? B CYS 183 B CYS 230 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf12 disulf ? ? B CYS 151 SG ? ? ? 1_555 B CYS 156 SG ? ? B CYS 232 B CYS 237 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf13 disulf ? ? B CYS 197 SG ? ? ? 1_555 B CYS 210 SG ? ? B CYS 278 B CYS 291 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf14 disulf ? ? B CYS 199 SG ? ? ? 1_555 B CYS 208 SG ? ? B CYS 280 B CYS 289 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf15 disulf ? ? B CYS 236 SG ? ? ? 1_555 B CYS 253 SG ? ? B CYS 318 B CYS 336 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf16 disulf ? ? B CYS 339 SG ? ? ? 1_555 B CYS 364 SG ? ? B CYS 421 B CYS 447 1_555 ? ? ? ? ? ? ? 2.060 ? 
disulf17 disulf ? ? C CYS 10  SG ? ? ? 1_555 C CYS 335 SG ? ? C CYS 92  C CYS 417 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf18 disulf ? ? C CYS 42  SG ? ? ? 1_555 C CYS 47  SG ? ? C CYS 124 C CYS 129 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf19 disulf ? ? C CYS 102 SG ? ? ? 1_555 C CYS 149 SG ? ? C CYS 183 C CYS 230 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf20 disulf ? ? C CYS 151 SG ? ? ? 1_555 C CYS 156 SG ? ? C CYS 232 C CYS 237 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf21 disulf ? ? C CYS 197 SG ? ? ? 1_555 C CYS 210 SG ? ? C CYS 278 C CYS 291 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf22 disulf ? ? C CYS 199 SG ? ? ? 1_555 C CYS 208 SG ? ? C CYS 280 C CYS 289 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf23 disulf ? ? C CYS 236 SG ? ? ? 1_555 C CYS 253 SG ? ? C CYS 318 C CYS 336 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf24 disulf ? ? C CYS 339 SG ? ? ? 1_555 C CYS 364 SG ? ? C CYS 421 C CYS 447 1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf25 disulf ? ? D CYS 10  SG ? ? ? 1_555 D CYS 335 SG ? ? D CYS 92  D CYS 417 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf26 disulf ? ? D CYS 42  SG ? ? ? 1_555 D CYS 47  SG ? ? D CYS 124 D CYS 129 1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf27 disulf ? ? D CYS 102 SG ? ? ? 1_555 D CYS 149 SG ? ? D CYS 183 D CYS 230 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf28 disulf ? ? D CYS 151 SG ? ? ? 1_555 D CYS 156 SG ? ? D CYS 232 D CYS 237 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf29 disulf ? ? D CYS 197 SG ? ? ? 1_555 D CYS 210 SG ? ? D CYS 278 D CYS 291 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf30 disulf ? ? D CYS 199 SG ? ? ? 1_555 D CYS 208 SG ? ? D CYS 280 D CYS 289 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf31 disulf ? ? D CYS 236 SG ? ? ? 1_555 D CYS 253 SG ? ? D CYS 318 D CYS 336 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf32 disulf ? ? D CYS 339 SG ? ? ? 1_555 D CYS 364 SG ? ? D CYS 421 D CYS 447 1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf33 disulf ? ? E CYS 10  SG ? ? ? 1_555 E CYS 335 SG ? ? E CYS 92  E CYS 417 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf34 disulf ? ? E CYS 42  SG ? ? ? 1_555 E CYS 47  SG ? ? E CYS 124 E CYS 129 1_555 ? ? ? ? ? ? ? 2.058 ? 
disulf35 disulf ? ? E CYS 102 SG ? ? ? 1_555 E CYS 149 SG ? ? E CYS 183 E CYS 230 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf36 disulf ? ? E CYS 151 SG ? ? ? 1_555 E CYS 156 SG ? ? E CYS 232 E CYS 237 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf37 disulf ? ? E CYS 197 SG ? ? ? 1_555 E CYS 210 SG ? ? E CYS 278 E CYS 291 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf38 disulf ? ? E CYS 199 SG ? ? ? 1_555 E CYS 208 SG ? ? E CYS 280 E CYS 289 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf39 disulf ? ? E CYS 236 SG ? ? ? 1_555 E CYS 253 SG ? ? E CYS 318 E CYS 336 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf40 disulf ? ? E CYS 339 SG ? ? ? 1_555 E CYS 364 SG ? ? E CYS 421 E CYS 447 1_555 ? ? ? ? ? ? ? 2.069 ? 
disulf41 disulf ? ? F CYS 10  SG ? ? ? 1_555 F CYS 335 SG ? ? F CYS 92  F CYS 417 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf42 disulf ? ? F CYS 42  SG ? ? ? 1_555 F CYS 47  SG ? ? F CYS 124 F CYS 129 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf43 disulf ? ? F CYS 102 SG ? ? ? 1_555 F CYS 149 SG ? ? F CYS 183 F CYS 230 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf44 disulf ? ? F CYS 151 SG ? ? ? 1_555 F CYS 156 SG ? ? F CYS 232 F CYS 237 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf45 disulf ? ? F CYS 197 SG ? ? ? 1_555 F CYS 210 SG ? ? F CYS 278 F CYS 291 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf46 disulf ? ? F CYS 199 SG ? ? ? 1_555 F CYS 208 SG ? ? F CYS 280 F CYS 289 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf47 disulf ? ? F CYS 236 SG ? ? ? 1_555 F CYS 253 SG ? ? F CYS 318 F CYS 336 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf48 disulf ? ? F CYS 339 SG ? ? ? 1_555 F CYS 364 SG ? ? F CYS 421 F CYS 447 1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf49 disulf ? ? G CYS 10  SG ? ? ? 1_555 G CYS 335 SG ? ? G CYS 92  G CYS 417 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf50 disulf ? ? G CYS 42  SG ? ? ? 1_555 G CYS 47  SG ? ? G CYS 124 G CYS 129 1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf51 disulf ? ? G CYS 102 SG ? ? ? 1_555 G CYS 149 SG ? ? G CYS 183 G CYS 230 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf52 disulf ? ? G CYS 151 SG ? ? ? 1_555 G CYS 156 SG ? ? G CYS 232 G CYS 237 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf53 disulf ? ? G CYS 197 SG ? ? ? 1_555 G CYS 210 SG ? ? G CYS 278 G CYS 291 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf54 disulf ? ? G CYS 199 SG ? ? ? 1_555 G CYS 208 SG ? ? G CYS 280 G CYS 289 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf55 disulf ? ? G CYS 236 SG ? ? ? 1_555 G CYS 253 SG ? ? G CYS 318 G CYS 336 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf56 disulf ? ? G CYS 339 SG ? ? ? 1_555 G CYS 364 SG ? ? G CYS 421 G CYS 447 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf57 disulf ? ? H CYS 10  SG ? ? ? 1_555 H CYS 335 SG ? ? H CYS 92  H CYS 417 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf58 disulf ? ? H CYS 42  SG ? ? ? 1_555 H CYS 47  SG ? ? H CYS 124 H CYS 129 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf59 disulf ? ? H CYS 102 SG ? ? ? 1_555 H CYS 149 SG ? ? H CYS 183 H CYS 230 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf60 disulf ? ? H CYS 151 SG ? ? ? 1_555 H CYS 156 SG ? ? H CYS 232 H CYS 237 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf61 disulf ? ? H CYS 197 SG ? ? ? 1_555 H CYS 210 SG ? ? H CYS 278 H CYS 291 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf62 disulf ? ? H CYS 199 SG ? ? ? 1_555 H CYS 208 SG ? ? H CYS 280 H CYS 289 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf63 disulf ? ? H CYS 236 SG ? ? ? 1_555 H CYS 253 SG ? ? H CYS 318 H CYS 336 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf64 disulf ? ? H CYS 339 SG ? ? ? 1_555 H CYS 364 SG ? ? H CYS 421 H CYS 447 1_555 ? ? ? ? ? ? ? 2.056 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASN 243 A . ? ASN 325 A PRO 244 A ? PRO 326 A 1 -4.43 
2  ARG 348 A . ? ARG 430 A PRO 349 A ? PRO 431 A 1 0.24  
3  LEU 381 A . ? LEU 464 A PRO 382 A ? PRO 465 A 1 0.40  
4  ASN 243 B . ? ASN 325 B PRO 244 B ? PRO 326 B 1 1.56  
5  ARG 348 B . ? ARG 430 B PRO 349 B ? PRO 431 B 1 0.28  
6  LEU 381 B . ? LEU 464 B PRO 382 B ? PRO 465 B 1 -0.26 
7  ASN 243 C . ? ASN 325 C PRO 244 C ? PRO 326 C 1 0.55  
8  ARG 348 C . ? ARG 430 C PRO 349 C ? PRO 431 C 1 0.01  
9  LEU 381 C . ? LEU 464 C PRO 382 C ? PRO 465 C 1 1.96  
10 ASN 243 D . ? ASN 325 D PRO 244 D ? PRO 326 D 1 1.86  
11 ARG 348 D . ? ARG 430 D PRO 349 D ? PRO 431 D 1 0.37  
12 LEU 381 D . ? LEU 464 D PRO 382 D ? PRO 465 D 1 -0.25 
13 ASN 243 E . ? ASN 325 E PRO 244 E ? PRO 326 E 1 -1.41 
14 ARG 348 E . ? ARG 430 E PRO 349 E ? PRO 431 E 1 0.25  
15 LEU 381 E . ? LEU 464 E PRO 382 E ? PRO 465 E 1 1.68  
16 ASN 243 F . ? ASN 325 F PRO 244 F ? PRO 326 F 1 1.04  
17 ARG 348 F . ? ARG 430 F PRO 349 F ? PRO 431 F 1 0.36  
18 LEU 381 F . ? LEU 464 F PRO 382 F ? PRO 465 F 1 0.26  
19 ASN 243 G . ? ASN 325 G PRO 244 G ? PRO 326 G 1 4.90  
20 ARG 348 G . ? ARG 430 G PRO 349 G ? PRO 431 G 1 0.20  
21 LEU 381 G . ? LEU 464 G PRO 382 G ? PRO 465 G 1 0.00  
22 ASN 243 H . ? ASN 325 H PRO 244 H ? PRO 326 H 1 0.96  
23 ARG 348 H . ? ARG 430 H PRO 349 H ? PRO 431 H 1 0.36  
24 LEU 381 H . ? LEU 464 H PRO 382 H ? PRO 465 H 1 -0.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 4 ? 
D  ? 3 ? 
E  ? 4 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 4 ? 
I  ? 4 ? 
J  ? 4 ? 
K  ? 3 ? 
L  ? 4 ? 
M  ? 4 ? 
N  ? 4 ? 
O  ? 4 ? 
P  ? 4 ? 
Q  ? 4 ? 
R  ? 3 ? 
S  ? 4 ? 
T  ? 4 ? 
U  ? 4 ? 
V  ? 4 ? 
W  ? 4 ? 
X  ? 4 ? 
Y  ? 4 ? 
Z  ? 4 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 3 ? 
AF ? 4 ? 
AG ? 4 ? 
AH ? 4 ? 
AI ? 4 ? 
AJ ? 4 ? 
AK ? 4 ? 
AL ? 3 ? 
AM ? 4 ? 
AN ? 4 ? 
AO ? 4 ? 
AP ? 4 ? 
AQ ? 4 ? 
AR ? 4 ? 
AS ? 3 ? 
AT ? 4 ? 
AU ? 4 ? 
AV ? 4 ? 
AW ? 4 ? 
AX ? 4 ? 
AY ? 4 ? 
AZ ? 3 ? 
BA ? 4 ? 
BB ? 4 ? 
BC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AY 3 4 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ALA A 16  ? LYS A 20  ? ALA A 98  LYS A 102 
A  2 THR A 356 ? CYS A 364 ? THR A 439 CYS A 447 
A  3 ARG A 337 ? GLY A 347 ? ARG A 419 GLY A 429 
A  4 SER A 321 ? GLN A 326 ? SER A 407 GLN A 412 
B  1 PHE A 33  ? CYS A 42  ? PHE A 115 CYS A 124 
B  2 CYS A 47  ? LEU A 57  ? CYS A 129 LEU A 139 
B  3 THR A 75  ? PRO A 80  ? THR A 157 PRO A 162 
B  4 ARG A 91  ? VAL A 95  ? ARG A 172 VAL A 176 
C  1 SER A 98  ? HIS A 103 ? SER A 179 HIS A 184 
C  2 TRP A 108 ? SER A 114 ? TRP A 189 SER A 195 
C  3 VAL A 121 ? TYR A 126 ? VAL A 202 TYR A 207 
C  4 ILE A 129 ? LYS A 135 ? ILE A 210 LYS A 216 
D  1 ARG A 143 ? THR A 144 ? ARG A 224 THR A 225 
D  2 SER A 155 ? ASP A 162 ? SER A 236 ASP A 243 
D  3 ALA A 150 ? VAL A 152 ? ALA A 231 VAL A 233 
E  1 ARG A 143 ? THR A 144 ? ARG A 224 THR A 225 
E  2 SER A 155 ? ASP A 162 ? SER A 236 ASP A 243 
E  3 SER A 170 ? GLU A 177 ? SER A 251 GLU A 258 
E  4 LYS A 180 ? GLU A 186 ? LYS A 261 GLU A 267 
F  1 GLU A 195 ? ASN A 202 ? GLU A 276 ASN A 283 
F  2 GLU A 205 ? ARG A 211 ? GLU A 286 ARG A 292 
F  3 PRO A 220 ? PHE A 224 ? PRO A 301 PHE A 305 
F  4 TYR A 230 ? TYR A 234 ? TYR A 312 TYR A 316 
G  1 SER A 268 ? TYR A 271 ? SER A 353 TYR A 356 
G  2 GLY A 274 ? ARG A 279 ? GLY A 359 ARG A 364 
G  3 SER A 287 ? ASP A 294 ? SER A 372 ASP A 379 
G  4 VAL A 307 ? TRP A 317 ? VAL A 392 TRP A 403 
H  1 ALA B 16  ? LYS B 20  ? ALA B 98  LYS B 102 
H  2 THR B 356 ? CYS B 364 ? THR B 439 CYS B 447 
H  3 ARG B 337 ? GLY B 347 ? ARG B 419 GLY B 429 
H  4 SER B 321 ? GLN B 326 ? SER B 407 GLN B 412 
I  1 PHE B 33  ? CYS B 42  ? PHE B 115 CYS B 124 
I  2 CYS B 47  ? LEU B 57  ? CYS B 129 LEU B 139 
I  3 THR B 75  ? PRO B 80  ? THR B 157 PRO B 162 
I  4 ARG B 91  ? VAL B 95  ? ARG B 172 VAL B 176 
J  1 SER B 98  ? HIS B 103 ? SER B 179 HIS B 184 
J  2 TRP B 108 ? SER B 114 ? TRP B 189 SER B 195 
J  3 VAL B 121 ? TYR B 126 ? VAL B 202 TYR B 207 
J  4 ILE B 129 ? LYS B 135 ? ILE B 210 LYS B 216 
K  1 ARG B 143 ? THR B 144 ? ARG B 224 THR B 225 
K  2 SER B 155 ? ASP B 162 ? SER B 236 ASP B 243 
K  3 ALA B 150 ? VAL B 152 ? ALA B 231 VAL B 233 
L  1 ARG B 143 ? THR B 144 ? ARG B 224 THR B 225 
L  2 SER B 155 ? ASP B 162 ? SER B 236 ASP B 243 
L  3 SER B 170 ? GLU B 177 ? SER B 251 GLU B 258 
L  4 LYS B 180 ? GLU B 186 ? LYS B 261 GLU B 267 
M  1 SER B 198 ? ASN B 202 ? SER B 279 ASN B 283 
M  2 GLU B 205 ? VAL B 209 ? GLU B 286 VAL B 290 
M  3 PRO B 220 ? PHE B 224 ? PRO B 301 PHE B 305 
M  4 TYR B 230 ? TYR B 234 ? TYR B 312 TYR B 316 
N  1 SER B 268 ? TYR B 271 ? SER B 353 TYR B 356 
N  2 GLY B 274 ? ARG B 279 ? GLY B 359 ARG B 364 
N  3 SER B 287 ? ASP B 294 ? SER B 372 ASP B 379 
N  4 VAL B 307 ? TRP B 317 ? VAL B 392 TRP B 403 
O  1 ALA C 16  ? LYS C 20  ? ALA C 98  LYS C 102 
O  2 THR C 356 ? CYS C 364 ? THR C 439 CYS C 447 
O  3 ARG C 337 ? GLY C 347 ? ARG C 419 GLY C 429 
O  4 SER C 321 ? GLN C 326 ? SER C 407 GLN C 412 
P  1 PHE C 33  ? CYS C 42  ? PHE C 115 CYS C 124 
P  2 CYS C 47  ? LEU C 57  ? CYS C 129 LEU C 139 
P  3 THR C 75  ? PRO C 80  ? THR C 157 PRO C 162 
P  4 ARG C 91  ? VAL C 95  ? ARG C 172 VAL C 176 
Q  1 ALA C 99  ? HIS C 103 ? ALA C 180 HIS C 184 
Q  2 TRP C 108 ? SER C 114 ? TRP C 189 SER C 195 
Q  3 VAL C 121 ? TYR C 126 ? VAL C 202 TYR C 207 
Q  4 ILE C 129 ? LYS C 135 ? ILE C 210 LYS C 216 
R  1 ARG C 143 ? THR C 144 ? ARG C 224 THR C 225 
R  2 SER C 155 ? ASP C 162 ? SER C 236 ASP C 243 
R  3 ALA C 150 ? VAL C 152 ? ALA C 231 VAL C 233 
S  1 ARG C 143 ? THR C 144 ? ARG C 224 THR C 225 
S  2 SER C 155 ? ASP C 162 ? SER C 236 ASP C 243 
S  3 SER C 170 ? GLU C 177 ? SER C 251 GLU C 258 
S  4 LYS C 180 ? GLU C 186 ? LYS C 261 GLU C 267 
T  1 SER C 198 ? ASN C 202 ? SER C 279 ASN C 283 
T  2 GLU C 205 ? VAL C 209 ? GLU C 286 VAL C 290 
T  3 PRO C 220 ? PHE C 224 ? PRO C 301 PHE C 305 
T  4 TYR C 230 ? TYR C 234 ? TYR C 312 TYR C 316 
U  1 SER C 268 ? TYR C 271 ? SER C 353 TYR C 356 
U  2 GLY C 274 ? ARG C 279 ? GLY C 359 ARG C 364 
U  3 SER C 287 ? ASP C 294 ? SER C 372 ASP C 379 
U  4 VAL C 307 ? TRP C 317 ? VAL C 392 TRP C 403 
V  1 ALA D 16  ? LYS D 20  ? ALA D 98  LYS D 102 
V  2 THR D 356 ? CYS D 364 ? THR D 439 CYS D 447 
V  3 PRO D 338 ? GLY D 347 ? PRO D 420 GLY D 429 
V  4 SER D 321 ? VAL D 325 ? SER D 407 VAL D 411 
W  1 PHE D 33  ? CYS D 42  ? PHE D 115 CYS D 124 
W  2 CYS D 47  ? LEU D 57  ? CYS D 129 LEU D 139 
W  3 THR D 75  ? PRO D 80  ? THR D 157 PRO D 162 
W  4 ARG D 91  ? VAL D 95  ? ARG D 172 VAL D 176 
X  1 SER D 98  ? HIS D 103 ? SER D 179 HIS D 184 
X  2 TRP D 108 ? SER D 114 ? TRP D 189 SER D 195 
X  3 VAL D 121 ? TYR D 126 ? VAL D 202 TYR D 207 
X  4 ILE D 129 ? LYS D 135 ? ILE D 210 LYS D 216 
Y  1 ALA D 150 ? VAL D 152 ? ALA D 231 VAL D 233 
Y  2 SER D 155 ? ASP D 162 ? SER D 236 ASP D 243 
Y  3 SER D 170 ? GLU D 177 ? SER D 251 GLU D 258 
Y  4 LYS D 180 ? GLU D 186 ? LYS D 261 GLU D 267 
Z  1 SER D 198 ? ASN D 202 ? SER D 279 ASN D 283 
Z  2 GLU D 205 ? VAL D 209 ? GLU D 286 VAL D 290 
Z  3 PRO D 220 ? PHE D 224 ? PRO D 301 PHE D 305 
Z  4 TYR D 230 ? TYR D 234 ? TYR D 312 TYR D 316 
AA 1 SER D 268 ? TYR D 271 ? SER D 353 TYR D 356 
AA 2 GLY D 274 ? ARG D 279 ? GLY D 359 ARG D 364 
AA 3 SER D 287 ? ASP D 294 ? SER D 372 ASP D 379 
AA 4 VAL D 307 ? TRP D 317 ? VAL D 392 TRP D 403 
AB 1 ALA E 16  ? LYS E 20  ? ALA E 98  LYS E 102 
AB 2 THR E 356 ? CYS E 364 ? THR E 439 CYS E 447 
AB 3 ARG E 337 ? GLY E 347 ? ARG E 419 GLY E 429 
AB 4 SER E 321 ? GLN E 326 ? SER E 407 GLN E 412 
AC 1 PHE E 33  ? CYS E 42  ? PHE E 115 CYS E 124 
AC 2 CYS E 47  ? LEU E 57  ? CYS E 129 LEU E 139 
AC 3 THR E 75  ? PRO E 80  ? THR E 157 PRO E 162 
AC 4 ARG E 91  ? VAL E 95  ? ARG E 172 VAL E 176 
AD 1 SER E 98  ? HIS E 103 ? SER E 179 HIS E 184 
AD 2 TRP E 108 ? SER E 114 ? TRP E 189 SER E 195 
AD 3 VAL E 121 ? TYR E 126 ? VAL E 202 TYR E 207 
AD 4 ILE E 129 ? LYS E 135 ? ILE E 210 LYS E 216 
AE 1 ARG E 143 ? THR E 144 ? ARG E 224 THR E 225 
AE 2 SER E 155 ? ASP E 162 ? SER E 236 ASP E 243 
AE 3 ALA E 150 ? VAL E 152 ? ALA E 231 VAL E 233 
AF 1 ARG E 143 ? THR E 144 ? ARG E 224 THR E 225 
AF 2 SER E 155 ? ASP E 162 ? SER E 236 ASP E 243 
AF 3 SER E 170 ? GLU E 177 ? SER E 251 GLU E 258 
AF 4 LYS E 180 ? GLU E 186 ? LYS E 261 GLU E 267 
AG 1 GLU E 195 ? ASN E 202 ? GLU E 276 ASN E 283 
AG 2 GLU E 205 ? ARG E 211 ? GLU E 286 ARG E 292 
AG 3 PRO E 220 ? PHE E 224 ? PRO E 301 PHE E 305 
AG 4 TYR E 230 ? TYR E 234 ? TYR E 312 TYR E 316 
AH 1 SER E 268 ? TYR E 271 ? SER E 353 TYR E 356 
AH 2 GLY E 274 ? ARG E 279 ? GLY E 359 ARG E 364 
AH 3 SER E 287 ? ASP E 294 ? SER E 372 ASP E 379 
AH 4 VAL E 307 ? TRP E 317 ? VAL E 392 TRP E 403 
AI 1 ALA F 16  ? LYS F 20  ? ALA F 98  LYS F 102 
AI 2 THR F 356 ? CYS F 364 ? THR F 439 CYS F 447 
AI 3 ARG F 337 ? GLY F 347 ? ARG F 419 GLY F 429 
AI 4 SER F 321 ? GLN F 326 ? SER F 407 GLN F 412 
AJ 1 PHE F 33  ? CYS F 42  ? PHE F 115 CYS F 124 
AJ 2 CYS F 47  ? LEU F 57  ? CYS F 129 LEU F 139 
AJ 3 THR F 75  ? PRO F 80  ? THR F 157 PRO F 162 
AJ 4 ARG F 91  ? VAL F 95  ? ARG F 172 VAL F 176 
AK 1 SER F 98  ? HIS F 103 ? SER F 179 HIS F 184 
AK 2 TRP F 108 ? SER F 114 ? TRP F 189 SER F 195 
AK 3 VAL F 121 ? TYR F 126 ? VAL F 202 TYR F 207 
AK 4 ILE F 129 ? LYS F 135 ? ILE F 210 LYS F 216 
AL 1 ARG F 143 ? THR F 144 ? ARG F 224 THR F 225 
AL 2 SER F 155 ? ASP F 162 ? SER F 236 ASP F 243 
AL 3 ALA F 150 ? VAL F 152 ? ALA F 231 VAL F 233 
AM 1 ARG F 143 ? THR F 144 ? ARG F 224 THR F 225 
AM 2 SER F 155 ? ASP F 162 ? SER F 236 ASP F 243 
AM 3 SER F 170 ? GLU F 177 ? SER F 251 GLU F 258 
AM 4 LYS F 180 ? GLU F 186 ? LYS F 261 GLU F 267 
AN 1 SER F 198 ? ASN F 202 ? SER F 279 ASN F 283 
AN 2 GLU F 205 ? VAL F 209 ? GLU F 286 VAL F 290 
AN 3 PRO F 220 ? PHE F 224 ? PRO F 301 PHE F 305 
AN 4 TYR F 230 ? TYR F 234 ? TYR F 312 TYR F 316 
AO 1 SER F 268 ? TYR F 271 ? SER F 353 TYR F 356 
AO 2 GLY F 274 ? ARG F 279 ? GLY F 359 ARG F 364 
AO 3 SER F 287 ? ASP F 294 ? SER F 372 ASP F 379 
AO 4 VAL F 307 ? TRP F 317 ? VAL F 392 TRP F 403 
AP 1 ALA G 16  ? LYS G 20  ? ALA G 98  LYS G 102 
AP 2 THR G 356 ? CYS G 364 ? THR G 439 CYS G 447 
AP 3 ARG G 337 ? GLY G 347 ? ARG G 419 GLY G 429 
AP 4 SER G 321 ? GLN G 326 ? SER G 407 GLN G 412 
AQ 1 PHE G 33  ? CYS G 42  ? PHE G 115 CYS G 124 
AQ 2 CYS G 47  ? LEU G 57  ? CYS G 129 LEU G 139 
AQ 3 THR G 75  ? PRO G 80  ? THR G 157 PRO G 162 
AQ 4 ARG G 91  ? VAL G 95  ? ARG G 172 VAL G 176 
AR 1 ALA G 99  ? HIS G 103 ? ALA G 180 HIS G 184 
AR 2 TRP G 108 ? SER G 114 ? TRP G 189 SER G 195 
AR 3 VAL G 121 ? TYR G 126 ? VAL G 202 TYR G 207 
AR 4 ILE G 129 ? LYS G 135 ? ILE G 210 LYS G 216 
AS 1 ARG G 143 ? THR G 144 ? ARG G 224 THR G 225 
AS 2 SER G 155 ? ASP G 162 ? SER G 236 ASP G 243 
AS 3 ALA G 150 ? VAL G 152 ? ALA G 231 VAL G 233 
AT 1 ARG G 143 ? THR G 144 ? ARG G 224 THR G 225 
AT 2 SER G 155 ? ASP G 162 ? SER G 236 ASP G 243 
AT 3 SER G 170 ? GLU G 177 ? SER G 251 GLU G 258 
AT 4 LYS G 180 ? GLU G 186 ? LYS G 261 GLU G 267 
AU 1 GLU G 195 ? ASN G 202 ? GLU G 276 ASN G 283 
AU 2 GLU G 205 ? ARG G 211 ? GLU G 286 ARG G 292 
AU 3 PRO G 220 ? PHE G 224 ? PRO G 301 PHE G 305 
AU 4 TYR G 230 ? TYR G 234 ? TYR G 312 TYR G 316 
AV 1 PHE G 267 ? TYR G 271 ? PHE G 352 TYR G 356 
AV 2 GLY G 274 ? ARG G 279 ? GLY G 359 ARG G 364 
AV 3 SER G 287 ? ASP G 294 ? SER G 372 ASP G 379 
AV 4 VAL G 307 ? TRP G 317 ? VAL G 392 TRP G 403 
AW 1 ALA H 16  ? LYS H 20  ? ALA H 98  LYS H 102 
AW 2 THR H 356 ? CYS H 364 ? THR H 439 CYS H 447 
AW 3 ARG H 337 ? GLY H 347 ? ARG H 419 GLY H 429 
AW 4 SER H 321 ? GLN H 326 ? SER H 407 GLN H 412 
AX 1 PHE H 33  ? CYS H 42  ? PHE H 115 CYS H 124 
AX 2 CYS H 47  ? LEU H 57  ? CYS H 129 LEU H 139 
AX 3 THR H 75  ? PRO H 80  ? THR H 157 PRO H 162 
AX 4 ARG H 91  ? VAL H 95  ? ARG H 172 VAL H 176 
AY 1 ALA H 99  ? HIS H 103 ? ALA H 180 HIS H 184 
AY 2 TRP H 108 ? SER H 114 ? TRP H 189 SER H 195 
AY 3 VAL H 121 ? TYR H 126 ? VAL H 202 TYR H 207 
AY 4 ILE H 129 ? LYS H 135 ? ILE H 210 LYS H 216 
AZ 1 ARG H 143 ? THR H 144 ? ARG H 224 THR H 225 
AZ 2 SER H 155 ? ASP H 162 ? SER H 236 ASP H 243 
AZ 3 ALA H 150 ? VAL H 152 ? ALA H 231 VAL H 233 
BA 1 ARG H 143 ? THR H 144 ? ARG H 224 THR H 225 
BA 2 SER H 155 ? ASP H 162 ? SER H 236 ASP H 243 
BA 3 SER H 170 ? GLU H 177 ? SER H 251 GLU H 258 
BA 4 LYS H 180 ? GLU H 186 ? LYS H 261 GLU H 267 
BB 1 GLU H 195 ? ASN H 202 ? GLU H 276 ASN H 283 
BB 2 GLU H 205 ? ARG H 211 ? GLU H 286 ARG H 292 
BB 3 PRO H 220 ? PHE H 224 ? PRO H 301 PHE H 305 
BB 4 TYR H 230 ? TYR H 234 ? TYR H 312 TYR H 316 
BC 1 SER H 268 ? TYR H 271 ? SER H 353 TYR H 356 
BC 2 GLY H 274 ? ARG H 279 ? GLY H 359 ARG H 364 
BC 3 SER H 287 ? ASP H 294 ? SER H 372 ASP H 379 
BC 4 VAL H 307 ? TRP H 317 ? VAL H 392 TRP H 403 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N TYR A 18  ? N TYR A 100 O SER A 362 ? O SER A 445 
A  2 3 O SER A 359 ? O SER A 442 N LEU A 344 ? N LEU A 426 
A  3 4 O TRP A 341 ? O TRP A 423 N GLY A 322 ? N GLY A 408 
B  1 2 N SER A 41  ? N SER A 123 O ARG A 48  ? O ARG A 130 
B  2 3 N THR A 53  ? N THR A 135 O THR A 75  ? O THR A 157 
B  3 4 N LEU A 76  ? N LEU A 158 O SER A 94  ? O SER A 175 
C  1 2 N SER A 98  ? N SER A 179 O ILE A 113 ? O ILE A 194 
C  2 3 N GLY A 112 ? N GLY A 193 O VAL A 123 ? O VAL A 204 
C  3 4 N ALA A 122 ? N ALA A 203 O ILE A 134 ? O ILE A 215 
D  1 2 N ARG A 143 ? N ARG A 224 O THR A 161 ? O THR A 242 
D  2 3 O SER A 155 ? O SER A 236 N VAL A 152 ? N VAL A 233 
E  1 2 N ARG A 143 ? N ARG A 224 O THR A 161 ? O THR A 242 
E  2 3 N ASP A 162 ? N ASP A 243 O SER A 170 ? O SER A 251 
E  3 4 N ILE A 173 ? N ILE A 254 O VAL A 185 ? O VAL A 266 
F  1 2 N GLU A 195 ? N GLU A 276 O ARG A 211 ? O ARG A 292 
F  2 3 N CYS A 208 ? N CYS A 289 O VAL A 222 ? O VAL A 303 
F  3 4 N TRP A 221 ? N TRP A 302 O GLY A 233 ? O GLY A 315 
G  1 2 N TYR A 271 ? N TYR A 356 O GLY A 274 ? O GLY A 359 
G  2 3 N ILE A 277 ? N ILE A 362 O ILE A 292 ? O ILE A 377 
G  3 4 N TRP A 293 ? N TRP A 378 O VAL A 307 ? O VAL A 392 
H  1 2 N TYR B 18  ? N TYR B 100 O SER B 362 ? O SER B 445 
H  2 3 O SER B 357 ? O SER B 440 N ARG B 346 ? N ARG B 428 
H  3 4 O TRP B 341 ? O TRP B 423 N GLY B 322 ? N GLY B 408 
I  1 2 N PHE B 39  ? N PHE B 121 O PHE B 50  ? O PHE B 132 
I  2 3 N THR B 49  ? N THR B 131 O CYS B 79  ? O CYS B 161 
I  3 4 N LEU B 76  ? N LEU B 158 O SER B 94  ? O SER B 175 
J  1 2 N CYS B 102 ? N CYS B 183 O LEU B 109 ? O LEU B 190 
J  2 3 N GLY B 112 ? N GLY B 193 O VAL B 123 ? O VAL B 204 
J  3 4 N ALA B 122 ? N ALA B 203 O ILE B 134 ? O ILE B 215 
K  1 2 N ARG B 143 ? N ARG B 224 O THR B 161 ? O THR B 242 
K  2 3 O PHE B 157 ? O PHE B 238 N ALA B 150 ? N ALA B 231 
L  1 2 N ARG B 143 ? N ARG B 224 O THR B 161 ? O THR B 242 
L  2 3 N ASP B 162 ? N ASP B 243 O SER B 170 ? O SER B 251 
L  3 4 N LYS B 175 ? N LYS B 256 O LYS B 183 ? O LYS B 264 
M  1 2 N ASN B 202 ? N ASN B 283 O GLU B 205 ? O GLU B 286 
M  2 3 N CYS B 208 ? N CYS B 289 O VAL B 222 ? O VAL B 303 
M  3 4 N TRP B 221 ? N TRP B 302 O GLY B 233 ? O GLY B 315 
N  1 2 N TYR B 271 ? N TYR B 356 O GLY B 274 ? O GLY B 359 
N  2 3 N ILE B 277 ? N ILE B 362 O ILE B 292 ? O ILE B 377 
N  3 4 N TRP B 293 ? N TRP B 378 O VAL B 307 ? O VAL B 392 
O  1 2 N TYR C 18  ? N TYR C 100 O SER C 362 ? O SER C 445 
O  2 3 O SER C 359 ? O SER C 442 N LEU C 344 ? N LEU C 426 
O  3 4 O ARG C 337 ? O ARG C 419 N GLN C 326 ? N GLN C 412 
P  1 2 N PHE C 39  ? N PHE C 121 O PHE C 50  ? O PHE C 132 
P  2 3 N THR C 49  ? N THR C 131 O CYS C 79  ? O CYS C 161 
P  3 4 N LEU C 76  ? N LEU C 158 O SER C 94  ? O SER C 175 
Q  1 2 N SER C 100 ? N SER C 181 O ILE C 111 ? O ILE C 192 
Q  2 3 N GLY C 112 ? N GLY C 193 O VAL C 123 ? O VAL C 204 
Q  3 4 N ALA C 122 ? N ALA C 203 O ILE C 134 ? O ILE C 215 
R  1 2 N ARG C 143 ? N ARG C 224 O THR C 161 ? O THR C 242 
R  2 3 O SER C 155 ? O SER C 236 N VAL C 152 ? N VAL C 233 
S  1 2 N ARG C 143 ? N ARG C 224 O THR C 161 ? O THR C 242 
S  2 3 N CYS C 156 ? N CYS C 237 O MET C 176 ? O MET C 257 
S  3 4 N LYS C 175 ? N LYS C 256 O LYS C 183 ? O LYS C 264 
T  1 2 N ASN C 202 ? N ASN C 283 O GLU C 205 ? O GLU C 286 
T  2 3 N CYS C 208 ? N CYS C 289 O VAL C 222 ? O VAL C 303 
T  3 4 N TRP C 221 ? N TRP C 302 O GLY C 233 ? O GLY C 315 
U  1 2 N TYR C 271 ? N TYR C 356 O GLY C 274 ? O GLY C 359 
U  2 3 N ILE C 277 ? N ILE C 362 O ILE C 292 ? O ILE C 377 
U  3 4 N MET C 291 ? N MET C 376 O GLN C 309 ? O GLN C 395 
V  1 2 N TYR D 18  ? N TYR D 100 O SER D 362 ? O SER D 445 
V  2 3 O SER D 359 ? O SER D 442 N LEU D 344 ? N LEU D 426 
V  3 4 O CYS D 339 ? O CYS D 421 N PHE D 324 ? N PHE D 410 
W  1 2 N PHE D 39  ? N PHE D 121 O PHE D 50  ? O PHE D 132 
W  2 3 N THR D 49  ? N THR D 131 O CYS D 79  ? O CYS D 161 
W  3 4 N LEU D 76  ? N LEU D 158 O SER D 94  ? O SER D 175 
X  1 2 N SER D 98  ? N SER D 179 O ILE D 113 ? O ILE D 194 
X  2 3 N THR D 110 ? N THR D 191 O LYS D 125 ? O LYS D 206 
X  3 4 N ALA D 122 ? N ALA D 203 O ILE D 134 ? O ILE D 215 
Y  1 2 N VAL D 152 ? N VAL D 233 O SER D 155 ? O SER D 236 
Y  2 3 N CYS D 156 ? N CYS D 237 O MET D 176 ? O MET D 257 
Y  3 4 N LYS D 175 ? N LYS D 256 O LYS D 183 ? O LYS D 264 
Z  1 2 N ASN D 202 ? N ASN D 283 O GLU D 205 ? O GLU D 286 
Z  2 3 N CYS D 208 ? N CYS D 289 O VAL D 222 ? O VAL D 303 
Z  3 4 N TRP D 221 ? N TRP D 302 O GLY D 233 ? O GLY D 315 
AA 1 2 N TYR D 271 ? N TYR D 356 O GLY D 274 ? O GLY D 359 
AA 2 3 N ILE D 277 ? N ILE D 362 O ILE D 292 ? O ILE D 377 
AA 3 4 N MET D 291 ? N MET D 376 O GLN D 309 ? O GLN D 395 
AB 1 2 N TYR E 18  ? N TYR E 100 O SER E 362 ? O SER E 445 
AB 2 3 O SER E 357 ? O SER E 440 N ARG E 346 ? N ARG E 428 
AB 3 4 O TRP E 341 ? O TRP E 423 N GLY E 322 ? N GLY E 408 
AC 1 2 N PHE E 39  ? N PHE E 121 O PHE E 50  ? O PHE E 132 
AC 2 3 N THR E 49  ? N THR E 131 O CYS E 79  ? O CYS E 161 
AC 3 4 N SER E 78  ? N SER E 160 O ARG E 91  ? O ARG E 172 
AD 1 2 N CYS E 102 ? N CYS E 183 O LEU E 109 ? O LEU E 190 
AD 2 3 N GLY E 112 ? N GLY E 193 O VAL E 123 ? O VAL E 204 
AD 3 4 N LEU E 124 ? N LEU E 205 O ASP E 132 ? O ASP E 213 
AE 1 2 N ARG E 143 ? N ARG E 224 O THR E 161 ? O THR E 242 
AE 2 3 O PHE E 157 ? O PHE E 238 N ALA E 150 ? N ALA E 231 
AF 1 2 N ARG E 143 ? N ARG E 224 O THR E 161 ? O THR E 242 
AF 2 3 N MET E 160 ? N MET E 241 O LYS E 172 ? O LYS E 253 
AF 3 4 N LYS E 175 ? N LYS E 256 O LYS E 183 ? O LYS E 264 
AG 1 2 N TYR E 200 ? N TYR E 281 O THR E 207 ? O THR E 288 
AG 2 3 N CYS E 208 ? N CYS E 289 O VAL E 222 ? O VAL E 303 
AG 3 4 N SER E 223 ? N SER E 304 O GLN E 231 ? O GLN E 313 
AH 1 2 N PHE E 269 ? N PHE E 354 O TRP E 276 ? O TRP E 361 
AH 2 3 N ILE E 277 ? N ILE E 362 O ILE E 292 ? O ILE E 377 
AH 3 4 N GLY E 288 ? N GLY E 373 O ASP E 316 ? O ASP E 402 
AI 1 2 N TYR F 18  ? N TYR F 100 O SER F 362 ? O SER F 445 
AI 2 3 O SER F 357 ? O SER F 440 N ARG F 346 ? N ARG F 428 
AI 3 4 O CYS F 339 ? O CYS F 421 N PHE F 324 ? N PHE F 410 
AJ 1 2 N PHE F 39  ? N PHE F 121 O PHE F 50  ? O PHE F 132 
AJ 2 3 N THR F 53  ? N THR F 135 O THR F 75  ? O THR F 157 
AJ 3 4 N SER F 78  ? N SER F 160 O ARG F 91  ? O ARG F 172 
AK 1 2 N SER F 100 ? N SER F 181 O ILE F 111 ? O ILE F 192 
AK 2 3 N GLY F 112 ? N GLY F 193 O VAL F 123 ? O VAL F 204 
AK 3 4 N ALA F 122 ? N ALA F 203 O ILE F 134 ? O ILE F 215 
AL 1 2 N ARG F 143 ? N ARG F 224 O THR F 161 ? O THR F 242 
AL 2 3 O PHE F 157 ? O PHE F 238 N ALA F 150 ? N ALA F 231 
AM 1 2 N ARG F 143 ? N ARG F 224 O THR F 161 ? O THR F 242 
AM 2 3 N THR F 158 ? N THR F 239 O PHE F 174 ? O PHE F 255 
AM 3 4 N LYS F 175 ? N LYS F 256 O LYS F 183 ? O LYS F 264 
AN 1 2 N SER F 198 ? N SER F 279 O VAL F 209 ? O VAL F 290 
AN 2 3 N CYS F 208 ? N CYS F 289 O VAL F 222 ? O VAL F 303 
AN 3 4 N TRP F 221 ? N TRP F 302 O GLY F 233 ? O GLY F 315 
AO 1 2 N PHE F 269 ? N PHE F 354 O TRP F 276 ? O TRP F 361 
AO 2 3 N ILE F 277 ? N ILE F 362 O ILE F 292 ? O ILE F 377 
AO 3 4 N GLY F 288 ? N GLY F 373 O ASP F 316 ? O ASP F 402 
AP 1 2 N TYR G 18  ? N TYR G 100 O SER G 362 ? O SER G 445 
AP 2 3 O SER G 359 ? O SER G 442 N LEU G 344 ? N LEU G 426 
AP 3 4 O TRP G 341 ? O TRP G 423 N GLY G 322 ? N GLY G 408 
AQ 1 2 N PHE G 39  ? N PHE G 121 O PHE G 50  ? O PHE G 132 
AQ 2 3 N THR G 49  ? N THR G 131 O CYS G 79  ? O CYS G 161 
AQ 3 4 N SER G 78  ? N SER G 160 O ARG G 91  ? O ARG G 172 
AR 1 2 N SER G 100 ? N SER G 181 O ILE G 111 ? O ILE G 192 
AR 2 3 N GLY G 112 ? N GLY G 193 O VAL G 123 ? O VAL G 204 
AR 3 4 N ALA G 122 ? N ALA G 203 O ILE G 134 ? O ILE G 215 
AS 1 2 N ARG G 143 ? N ARG G 224 O THR G 161 ? O THR G 242 
AS 2 3 O SER G 155 ? O SER G 236 N VAL G 152 ? N VAL G 233 
AT 1 2 N ARG G 143 ? N ARG G 224 O THR G 161 ? O THR G 242 
AT 2 3 N CYS G 156 ? N CYS G 237 O MET G 176 ? O MET G 257 
AT 3 4 N ILE G 173 ? N ILE G 254 O VAL G 185 ? O VAL G 266 
AU 1 2 N ASN G 202 ? N ASN G 283 O GLU G 205 ? O GLU G 286 
AU 2 3 N CYS G 208 ? N CYS G 289 O VAL G 222 ? O VAL G 303 
AU 3 4 N TRP G 221 ? N TRP G 302 O GLY G 233 ? O GLY G 315 
AV 1 2 N TYR G 271 ? N TYR G 356 O GLY G 274 ? O GLY G 359 
AV 2 3 N ILE G 277 ? N ILE G 362 O ILE G 292 ? O ILE G 377 
AV 3 4 N GLY G 288 ? N GLY G 373 O ASP G 316 ? O ASP G 402 
AW 1 2 N TYR H 18  ? N TYR H 100 O SER H 362 ? O SER H 445 
AW 2 3 O PHE H 363 ? O PHE H 446 N PHE H 340 ? N PHE H 422 
AW 3 4 O TRP H 341 ? O TRP H 423 N GLY H 322 ? N GLY H 408 
AX 1 2 N PHE H 39  ? N PHE H 121 O PHE H 50  ? O PHE H 132 
AX 2 3 N THR H 49  ? N THR H 131 O CYS H 79  ? O CYS H 161 
AX 3 4 N LEU H 76  ? N LEU H 158 O SER H 94  ? O SER H 175 
AY 1 2 N SER H 100 ? N SER H 181 O ILE H 111 ? O ILE H 192 
AY 2 3 N GLY H 112 ? N GLY H 193 O VAL H 123 ? O VAL H 204 
AY 3 4 N ALA H 122 ? N ALA H 203 O ILE H 134 ? O ILE H 215 
AZ 1 2 N ARG H 143 ? N ARG H 224 O THR H 161 ? O THR H 242 
AZ 2 3 O SER H 155 ? O SER H 236 N VAL H 152 ? N VAL H 233 
BA 1 2 N ARG H 143 ? N ARG H 224 O THR H 161 ? O THR H 242 
BA 2 3 N CYS H 156 ? N CYS H 237 O MET H 176 ? O MET H 257 
BA 3 4 N GLU H 177 ? N GLU H 258 O LYS H 180 ? O LYS H 261 
BB 1 2 N SER H 198 ? N SER H 279 O VAL H 209 ? O VAL H 290 
BB 2 3 N CYS H 210 ? N CYS H 291 O PRO H 220 ? O PRO H 301 
BB 3 4 N TRP H 221 ? N TRP H 302 O GLY H 233 ? O GLY H 315 
BC 1 2 N PHE H 269 ? N PHE H 354 O TRP H 276 ? O TRP H 361 
BC 2 3 N ILE H 277 ? N ILE H 362 O ILE H 292 ? O ILE H 377 
BC 3 4 N MET H 291 ? N MET H 376 O GLN H 309 ? O GLN H 395 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE G39 A 800' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE G39 B 801' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE G39 C 802' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE G39 D 803' 
AC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE G39 E 804' 
AC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE G39 F 805' 
AC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE G39 G 806' 
AC8 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE G39 H 807' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ARG A 36  ? ARG A 118 . ? 1_555 ? 
2  AC1 13 GLU A 37  ? GLU A 119 . ? 1_555 ? 
3  AC1 13 ASP A 69  ? ASP A 151 . ? 1_555 ? 
4  AC1 13 ARG A 70  ? ARG A 152 . ? 1_555 ? 
5  AC1 13 TRP A 97  ? TRP A 178 . ? 1_555 ? 
6  AC1 13 SER A 165 ? SER A 246 . ? 1_555 ? 
7  AC1 13 GLU A 195 ? GLU A 276 . ? 1_555 ? 
8  AC1 13 GLU A 196 ? GLU A 277 . ? 1_555 ? 
9  AC1 13 ARG A 211 ? ARG A 292 . ? 1_555 ? 
10 AC1 13 ASN A 213 ? ASN A 294 . ? 1_555 ? 
11 AC1 13 TYR A 262 ? TYR A 347 . ? 1_555 ? 
12 AC1 13 ARG A 286 ? ARG A 371 . ? 1_555 ? 
13 AC1 13 TYR A 320 ? TYR A 406 . ? 1_555 ? 
14 AC2 12 ARG B 36  ? ARG B 118 . ? 1_555 ? 
15 AC2 12 GLU B 37  ? GLU B 119 . ? 1_555 ? 
16 AC2 12 ASP B 69  ? ASP B 151 . ? 1_555 ? 
17 AC2 12 ARG B 70  ? ARG B 152 . ? 1_555 ? 
18 AC2 12 SER B 165 ? SER B 246 . ? 1_555 ? 
19 AC2 12 GLU B 195 ? GLU B 276 . ? 1_555 ? 
20 AC2 12 GLU B 196 ? GLU B 277 . ? 1_555 ? 
21 AC2 12 ARG B 211 ? ARG B 292 . ? 1_555 ? 
22 AC2 12 ASN B 213 ? ASN B 294 . ? 1_555 ? 
23 AC2 12 TYR B 262 ? TYR B 347 . ? 1_555 ? 
24 AC2 12 ARG B 286 ? ARG B 371 . ? 1_555 ? 
25 AC2 12 TYR B 320 ? TYR B 406 . ? 1_555 ? 
26 AC3 13 ARG C 36  ? ARG C 118 . ? 1_555 ? 
27 AC3 13 GLU C 37  ? GLU C 119 . ? 1_555 ? 
28 AC3 13 ASP C 69  ? ASP C 151 . ? 1_555 ? 
29 AC3 13 ARG C 70  ? ARG C 152 . ? 1_555 ? 
30 AC3 13 TRP C 97  ? TRP C 178 . ? 1_555 ? 
31 AC3 13 SER C 165 ? SER C 246 . ? 1_555 ? 
32 AC3 13 GLU C 195 ? GLU C 276 . ? 1_555 ? 
33 AC3 13 GLU C 196 ? GLU C 277 . ? 1_555 ? 
34 AC3 13 ARG C 211 ? ARG C 292 . ? 1_555 ? 
35 AC3 13 ASN C 213 ? ASN C 294 . ? 1_555 ? 
36 AC3 13 TYR C 262 ? TYR C 347 . ? 1_555 ? 
37 AC3 13 ARG C 286 ? ARG C 371 . ? 1_555 ? 
38 AC3 13 TYR C 320 ? TYR C 406 . ? 1_555 ? 
39 AC4 11 ARG D 36  ? ARG D 118 . ? 1_555 ? 
40 AC4 11 GLU D 37  ? GLU D 119 . ? 1_555 ? 
41 AC4 11 ASP D 69  ? ASP D 151 . ? 1_555 ? 
42 AC4 11 ARG D 70  ? ARG D 152 . ? 1_555 ? 
43 AC4 11 ARG D 143 ? ARG D 224 . ? 1_555 ? 
44 AC4 11 SER D 165 ? SER D 246 . ? 1_555 ? 
45 AC4 11 GLU D 195 ? GLU D 276 . ? 1_555 ? 
46 AC4 11 ARG D 211 ? ARG D 292 . ? 1_555 ? 
47 AC4 11 TYR D 262 ? TYR D 347 . ? 1_555 ? 
48 AC4 11 ARG D 286 ? ARG D 371 . ? 1_555 ? 
49 AC4 11 TYR D 320 ? TYR D 406 . ? 1_555 ? 
50 AC5 11 ARG E 36  ? ARG E 118 . ? 1_555 ? 
51 AC5 11 GLU E 37  ? GLU E 119 . ? 1_555 ? 
52 AC5 11 ASP E 69  ? ASP E 151 . ? 1_555 ? 
53 AC5 11 ARG E 70  ? ARG E 152 . ? 1_555 ? 
54 AC5 11 ARG E 143 ? ARG E 224 . ? 1_555 ? 
55 AC5 11 GLU E 195 ? GLU E 276 . ? 1_555 ? 
56 AC5 11 ARG E 211 ? ARG E 292 . ? 1_555 ? 
57 AC5 11 ASN E 213 ? ASN E 294 . ? 1_555 ? 
58 AC5 11 TYR E 262 ? TYR E 347 . ? 1_555 ? 
59 AC5 11 ARG E 286 ? ARG E 371 . ? 1_555 ? 
60 AC5 11 TYR E 320 ? TYR E 406 . ? 1_555 ? 
61 AC6 12 ARG F 36  ? ARG F 118 . ? 1_555 ? 
62 AC6 12 GLU F 37  ? GLU F 119 . ? 1_555 ? 
63 AC6 12 ASP F 69  ? ASP F 151 . ? 1_555 ? 
64 AC6 12 ARG F 70  ? ARG F 152 . ? 1_555 ? 
65 AC6 12 SER F 165 ? SER F 246 . ? 1_555 ? 
66 AC6 12 GLU F 195 ? GLU F 276 . ? 1_555 ? 
67 AC6 12 GLU F 196 ? GLU F 277 . ? 1_555 ? 
68 AC6 12 ARG F 211 ? ARG F 292 . ? 1_555 ? 
69 AC6 12 ASN F 213 ? ASN F 294 . ? 1_555 ? 
70 AC6 12 TYR F 262 ? TYR F 347 . ? 1_555 ? 
71 AC6 12 ARG F 286 ? ARG F 371 . ? 1_555 ? 
72 AC6 12 TYR F 320 ? TYR F 406 . ? 1_555 ? 
73 AC7 11 ARG G 36  ? ARG G 118 . ? 1_555 ? 
74 AC7 11 GLU G 37  ? GLU G 119 . ? 1_555 ? 
75 AC7 11 ASP G 69  ? ASP G 151 . ? 1_555 ? 
76 AC7 11 ARG G 70  ? ARG G 152 . ? 1_555 ? 
77 AC7 11 ARG G 143 ? ARG G 224 . ? 1_555 ? 
78 AC7 11 GLU G 195 ? GLU G 276 . ? 1_555 ? 
79 AC7 11 GLU G 196 ? GLU G 277 . ? 1_555 ? 
80 AC7 11 ARG G 211 ? ARG G 292 . ? 1_555 ? 
81 AC7 11 TYR G 262 ? TYR G 347 . ? 1_555 ? 
82 AC7 11 ARG G 286 ? ARG G 371 . ? 1_555 ? 
83 AC7 11 TYR G 320 ? TYR G 406 . ? 1_555 ? 
84 AC8 10 GLU H 37  ? GLU H 119 . ? 1_555 ? 
85 AC8 10 ASP H 69  ? ASP H 151 . ? 1_555 ? 
86 AC8 10 ARG H 70  ? ARG H 152 . ? 1_555 ? 
87 AC8 10 ARG H 143 ? ARG H 224 . ? 1_555 ? 
88 AC8 10 GLU H 195 ? GLU H 276 . ? 1_555 ? 
89 AC8 10 GLU H 196 ? GLU H 277 . ? 1_555 ? 
90 AC8 10 ARG H 211 ? ARG H 292 . ? 1_555 ? 
91 AC8 10 TYR H 262 ? TYR H 347 . ? 1_555 ? 
92 AC8 10 ARG H 286 ? ARG H 371 . ? 1_555 ? 
93 AC8 10 TYR H 320 ? TYR H 406 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2HU4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HU4 
_atom_sites.fract_transf_matrix[1][1]   0.004974 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004969 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004723 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . VAL A 1 1   ? -0.603  65.642   77.183  1.00 23.27 ? 83  VAL A N   1 
ATOM   2     C CA  . VAL A 1 1   ? -0.883  67.005   76.630  1.00 24.70 ? 83  VAL A CA  1 
ATOM   3     C C   . VAL A 1 1   ? -1.221  68.015   77.732  1.00 24.24 ? 83  VAL A C   1 
ATOM   4     O O   . VAL A 1 1   ? -1.851  67.665   78.731  1.00 23.78 ? 83  VAL A O   1 
ATOM   5     C CB  . VAL A 1 1   ? -2.050  66.965   75.617  1.00 25.58 ? 83  VAL A CB  1 
ATOM   6     C CG1 . VAL A 1 1   ? -2.332  68.365   75.094  1.00 27.08 ? 83  VAL A CG1 1 
ATOM   7     C CG2 . VAL A 1 1   ? -1.694  66.047   74.443  1.00 26.86 ? 83  VAL A CG2 1 
ATOM   8     N N   . LYS A 1 2   ? -0.803  69.266   77.541  1.00 23.15 ? 84  LYS A N   1 
ATOM   9     C CA  . LYS A 1 2   ? -1.047  70.312   78.526  1.00 23.28 ? 84  LYS A CA  1 
ATOM   10    C C   . LYS A 1 2   ? -2.520  70.643   78.728  1.00 22.34 ? 84  LYS A C   1 
ATOM   11    O O   . LYS A 1 2   ? -3.329  70.575   77.803  1.00 21.41 ? 84  LYS A O   1 
ATOM   12    C CB  . LYS A 1 2   ? -0.293  71.609   78.170  1.00 25.35 ? 84  LYS A CB  1 
ATOM   13    C CG  . LYS A 1 2   ? 1.234   71.495   78.128  1.00 27.98 ? 84  LYS A CG  1 
ATOM   14    C CD  . LYS A 1 2   ? 1.687   70.672   76.908  1.00 32.17 ? 84  LYS A CD  1 
ATOM   15    C CE  . LYS A 1 2   ? 3.218   70.699   76.721  1.00 35.02 ? 84  LYS A CE  1 
ATOM   16    N NZ  . LYS A 1 2   ? 3.669   69.985   75.468  1.00 32.46 ? 84  LYS A NZ  1 
ATOM   17    N N   . LEU A 1 3   ? -2.836  70.998   79.971  1.00 21.36 ? 85  LEU A N   1 
ATOM   18    C CA  . LEU A 1 3   ? -4.174  71.377   80.412  1.00 21.17 ? 85  LEU A CA  1 
ATOM   19    C C   . LEU A 1 3   ? -4.571  72.749   79.852  1.00 21.63 ? 85  LEU A C   1 
ATOM   20    O O   . LEU A 1 3   ? -4.184  73.775   80.412  1.00 21.68 ? 85  LEU A O   1 
ATOM   21    C CB  . LEU A 1 3   ? -4.180  71.472   81.940  1.00 19.23 ? 85  LEU A CB  1 
ATOM   22    C CG  . LEU A 1 3   ? -4.907  70.504   82.871  1.00 18.81 ? 85  LEU A CG  1 
ATOM   23    C CD1 . LEU A 1 3   ? -4.718  69.052   82.431  1.00 17.36 ? 85  LEU A CD1 1 
ATOM   24    C CD2 . LEU A 1 3   ? -4.375  70.727   84.283  1.00 15.43 ? 85  LEU A CD2 1 
ATOM   25    N N   . ALA A 1 4   ? -5.324  72.783   78.758  1.00 22.41 ? 86  ALA A N   1 
ATOM   26    C CA  . ALA A 1 4   ? -5.764  74.068   78.209  1.00 23.07 ? 86  ALA A CA  1 
ATOM   27    C C   . ALA A 1 4   ? -6.644  74.681   79.283  1.00 24.49 ? 86  ALA A C   1 
ATOM   28    O O   . ALA A 1 4   ? -7.432  73.968   79.940  1.00 26.72 ? 86  ALA A O   1 
ATOM   29    C CB  . ALA A 1 4   ? -6.582  73.860   76.947  1.00 21.36 ? 86  ALA A CB  1 
ATOM   30    N N   . GLY A 1 5   ? -6.521  75.983   79.490  1.00 23.88 ? 87  GLY A N   1 
ATOM   31    C CA  . GLY A 1 5   ? -7.356  76.603   80.502  1.00 23.40 ? 87  GLY A CA  1 
ATOM   32    C C   . GLY A 1 5   ? -8.233  77.644   79.853  1.00 23.10 ? 87  GLY A C   1 
ATOM   33    O O   . GLY A 1 5   ? -8.455  78.701   80.430  1.00 24.54 ? 87  GLY A O   1 
ATOM   34    N N   . ASN A 1 6   ? -8.734  77.345   78.658  1.00 22.81 ? 88  ASN A N   1 
ATOM   35    C CA  . ASN A 1 6   ? -9.557  78.291   77.901  1.00 23.45 ? 88  ASN A CA  1 
ATOM   36    C C   . ASN A 1 6   ? -11.049 78.272   78.232  1.00 22.82 ? 88  ASN A C   1 
ATOM   37    O O   . ASN A 1 6   ? -11.773 79.227   77.934  1.00 22.04 ? 88  ASN A O   1 
ATOM   38    C CB  . ASN A 1 6   ? -9.371  78.065   76.388  1.00 23.46 ? 88  ASN A CB  1 
ATOM   39    C CG  . ASN A 1 6   ? -9.739  76.650   75.945  1.00 25.27 ? 88  ASN A CG  1 
ATOM   40    O OD1 . ASN A 1 6   ? -9.875  76.376   74.744  1.00 26.52 ? 88  ASN A OD1 1 
ATOM   41    N ND2 . ASN A 1 6   ? -9.889  75.744   76.907  1.00 24.57 ? 88  ASN A ND2 1 
ATOM   42    N N   . SER A 1 7   ? -11.496 77.184   78.850  1.00 22.01 ? 89  SER A N   1 
ATOM   43    C CA  . SER A 1 7   ? -12.890 77.003   79.222  1.00 20.48 ? 89  SER A CA  1 
ATOM   44    C C   . SER A 1 7   ? -13.275 77.864   80.437  1.00 20.16 ? 89  SER A C   1 
ATOM   45    O O   . SER A 1 7   ? -12.389 78.389   81.123  1.00 18.19 ? 89  SER A O   1 
ATOM   46    C CB  . SER A 1 7   ? -13.118 75.525   79.503  1.00 20.37 ? 89  SER A CB  1 
ATOM   47    O OG  . SER A 1 7   ? -14.284 75.325   80.256  1.00 24.18 ? 89  SER A OG  1 
ATOM   48    N N   . SER A 1 8   ? -14.584 78.019   80.683  1.00 18.16 ? 90  SER A N   1 
ATOM   49    C CA  . SER A 1 8   ? -15.089 78.818   81.809  1.00 18.71 ? 90  SER A CA  1 
ATOM   50    C C   . SER A 1 8   ? -15.584 77.952   82.951  1.00 18.51 ? 90  SER A C   1 
ATOM   51    O O   . SER A 1 8   ? -15.737 76.750   82.795  1.00 17.89 ? 90  SER A O   1 
ATOM   52    C CB  . SER A 1 8   ? -16.253 79.718   81.376  1.00 18.61 ? 90  SER A CB  1 
ATOM   53    O OG  . SER A 1 8   ? -15.818 80.825   80.605  1.00 21.87 ? 90  SER A OG  1 
ATOM   54    N N   . LEU A 1 9   ? -15.839 78.573   84.099  1.00 18.93 ? 91  LEU A N   1 
ATOM   55    C CA  . LEU A 1 9   ? -16.343 77.836   85.246  1.00 20.24 ? 91  LEU A CA  1 
ATOM   56    C C   . LEU A 1 9   ? -17.727 77.294   84.928  1.00 21.74 ? 91  LEU A C   1 
ATOM   57    O O   . LEU A 1 9   ? -18.540 77.973   84.281  1.00 22.26 ? 91  LEU A O   1 
ATOM   58    C CB  . LEU A 1 9   ? -16.443 78.728   86.482  1.00 19.23 ? 91  LEU A CB  1 
ATOM   59    C CG  . LEU A 1 9   ? -15.139 79.157   87.148  1.00 20.38 ? 91  LEU A CG  1 
ATOM   60    C CD1 . LEU A 1 9   ? -15.461 79.926   88.422  1.00 19.78 ? 91  LEU A CD1 1 
ATOM   61    C CD2 . LEU A 1 9   ? -14.286 77.934   87.469  1.00 21.05 ? 91  LEU A CD2 1 
ATOM   62    N N   . CYS A 1 10  ? -17.988 76.072   85.388  1.00 22.34 ? 92  CYS A N   1 
ATOM   63    C CA  . CYS A 1 10  ? -19.276 75.421   85.167  1.00 23.87 ? 92  CYS A CA  1 
ATOM   64    C C   . CYS A 1 10  ? -20.379 76.025   86.033  1.00 22.62 ? 92  CYS A C   1 
ATOM   65    O O   . CYS A 1 10  ? -20.200 76.259   87.231  1.00 22.68 ? 92  CYS A O   1 
ATOM   66    C CB  . CYS A 1 10  ? -19.208 73.924   85.499  1.00 24.29 ? 92  CYS A CB  1 
ATOM   67    S SG  . CYS A 1 10  ? -17.950 72.903   84.654  1.00 28.63 ? 92  CYS A SG  1 
ATOM   68    N N   . PRO A 1 11  ? -21.543 76.283   85.432  1.00 22.29 ? 93  PRO A N   1 
ATOM   69    C CA  . PRO A 1 11  ? -22.665 76.848   86.192  1.00 21.47 ? 93  PRO A CA  1 
ATOM   70    C C   . PRO A 1 11  ? -23.051 75.833   87.276  1.00 20.56 ? 93  PRO A C   1 
ATOM   71    O O   . PRO A 1 11  ? -23.027 74.633   87.025  1.00 20.96 ? 93  PRO A O   1 
ATOM   72    C CB  . PRO A 1 11  ? -23.747 77.016   85.124  1.00 21.42 ? 93  PRO A CB  1 
ATOM   73    C CG  . PRO A 1 11  ? -23.387 75.953   84.102  1.00 21.53 ? 93  PRO A CG  1 
ATOM   74    C CD  . PRO A 1 11  ? -21.897 76.087   84.016  1.00 21.41 ? 93  PRO A CD  1 
ATOM   75    N N   . ILE A 1 12  ? -23.410 76.306   88.467  1.00 19.54 ? 94  ILE A N   1 
ATOM   76    C CA  . ILE A 1 12  ? -23.755 75.413   89.576  1.00 18.82 ? 94  ILE A CA  1 
ATOM   77    C C   . ILE A 1 12  ? -24.907 75.922   90.443  1.00 18.69 ? 94  ILE A C   1 
ATOM   78    O O   . ILE A 1 12  ? -25.173 77.126   90.499  1.00 19.16 ? 94  ILE A O   1 
ATOM   79    C CB  . ILE A 1 12  ? -22.543 75.231   90.521  1.00 18.77 ? 94  ILE A CB  1 
ATOM   80    C CG1 . ILE A 1 12  ? -22.121 76.607   91.064  1.00 18.20 ? 94  ILE A CG1 1 
ATOM   81    C CG2 . ILE A 1 12  ? -21.393 74.553   89.789  1.00 16.48 ? 94  ILE A CG2 1 
ATOM   82    C CD1 . ILE A 1 12  ? -20.922 76.594   92.003  1.00 19.30 ? 94  ILE A CD1 1 
ATOM   83    N N   . ASN A 1 13  ? -25.561 75.007   91.151  1.00 17.85 ? 95  ASN A N   1 
ATOM   84    C CA  . ASN A 1 13  ? -26.661 75.382   92.034  1.00 17.80 ? 95  ASN A CA  1 
ATOM   85    C C   . ASN A 1 13  ? -26.351 75.192   93.516  1.00 16.85 ? 95  ASN A C   1 
ATOM   86    O O   . ASN A 1 13  ? -26.893 75.894   94.356  1.00 18.58 ? 95  ASN A O   1 
ATOM   87    C CB  . ASN A 1 13  ? -27.918 74.600   91.657  1.00 18.29 ? 95  ASN A CB  1 
ATOM   88    C CG  . ASN A 1 13  ? -28.406 74.950   90.270  1.00 18.81 ? 95  ASN A CG  1 
ATOM   89    O OD1 . ASN A 1 13  ? -28.697 76.115   89.985  1.00 20.87 ? 95  ASN A OD1 1 
ATOM   90    N ND2 . ASN A 1 13  ? -28.481 73.958   89.395  1.00 16.41 ? 95  ASN A ND2 1 
ATOM   91    N N   . GLY A 1 14  ? -25.468 74.252   93.831  1.00 16.59 ? 96  GLY A N   1 
ATOM   92    C CA  . GLY A 1 14  ? -25.111 73.989   95.216  1.00 15.59 ? 96  GLY A CA  1 
ATOM   93    C C   . GLY A 1 14  ? -23.809 73.213   95.304  1.00 16.10 ? 96  GLY A C   1 
ATOM   94    O O   . GLY A 1 14  ? -23.030 73.221   94.355  1.00 15.13 ? 96  GLY A O   1 
ATOM   95    N N   . TRP A 1 15  ? -23.565 72.533   96.421  1.00 14.71 ? 97  TRP A N   1 
ATOM   96    C CA  . TRP A 1 15  ? -22.320 71.792   96.572  1.00 13.24 ? 97  TRP A CA  1 
ATOM   97    C C   . TRP A 1 15  ? -22.503 70.374   97.104  1.00 12.70 ? 97  TRP A C   1 
ATOM   98    O O   . TRP A 1 15  ? -23.161 70.160   98.114  1.00 13.47 ? 97  TRP A O   1 
ATOM   99    C CB  . TRP A 1 15  ? -21.382 72.573   97.488  1.00 13.31 ? 97  TRP A CB  1 
ATOM   100   C CG  . TRP A 1 15  ? -21.232 73.988   97.069  1.00 12.85 ? 97  TRP A CG  1 
ATOM   101   C CD1 . TRP A 1 15  ? -22.087 75.026   97.338  1.00 12.77 ? 97  TRP A CD1 1 
ATOM   102   C CD2 . TRP A 1 15  ? -20.202 74.523   96.237  1.00 13.15 ? 97  TRP A CD2 1 
ATOM   103   N NE1 . TRP A 1 15  ? -21.650 76.173   96.721  1.00 12.28 ? 97  TRP A NE1 1 
ATOM   104   C CE2 . TRP A 1 15  ? -20.494 75.891   96.036  1.00 14.86 ? 97  TRP A CE2 1 
ATOM   105   C CE3 . TRP A 1 15  ? -19.058 73.978   95.633  1.00 12.71 ? 97  TRP A CE3 1 
ATOM   106   C CZ2 . TRP A 1 15  ? -19.679 76.723   95.253  1.00 15.46 ? 97  TRP A CZ2 1 
ATOM   107   C CZ3 . TRP A 1 15  ? -18.250 74.805   94.856  1.00 13.67 ? 97  TRP A CZ3 1 
ATOM   108   C CH2 . TRP A 1 15  ? -18.566 76.162   94.673  1.00 12.77 ? 97  TRP A CH2 1 
ATOM   109   N N   . ALA A 1 16  ? -21.910 69.408   96.415  1.00 12.12 ? 98  ALA A N   1 
ATOM   110   C CA  . ALA A 1 16  ? -22.016 68.013   96.813  1.00 11.95 ? 98  ALA A CA  1 
ATOM   111   C C   . ALA A 1 16  ? -20.751 67.550   97.524  1.00 12.20 ? 98  ALA A C   1 
ATOM   112   O O   . ALA A 1 16  ? -19.644 67.910   97.136  1.00 12.01 ? 98  ALA A O   1 
ATOM   113   C CB  . ALA A 1 16  ? -22.275 67.153   95.595  1.00 11.01 ? 98  ALA A CB  1 
ATOM   114   N N   . VAL A 1 17  ? -20.922 66.743   98.564  1.00 12.65 ? 99  VAL A N   1 
ATOM   115   C CA  . VAL A 1 17  ? -19.781 66.243   99.322  1.00 14.64 ? 99  VAL A CA  1 
ATOM   116   C C   . VAL A 1 17  ? -18.885 65.404   98.439  1.00 13.18 ? 99  VAL A C   1 
ATOM   117   O O   . VAL A 1 17  ? -19.359 64.549   97.708  1.00 12.64 ? 99  VAL A O   1 
ATOM   118   C CB  . VAL A 1 17  ? -20.202 65.356   100.485 1.00 15.97 ? 99  VAL A CB  1 
ATOM   119   C CG1 . VAL A 1 17  ? -19.354 65.693   101.700 1.00 15.79 ? 99  VAL A CG1 1 
ATOM   120   C CG2 . VAL A 1 17  ? -21.686 65.519   100.760 1.00 19.35 ? 99  VAL A CG2 1 
ATOM   121   N N   . TYR A 1 18  ? -17.585 65.637   98.533  1.00 13.63 ? 100 TYR A N   1 
ATOM   122   C CA  . TYR A 1 18  ? -16.639 64.906   97.718  1.00 14.52 ? 100 TYR A CA  1 
ATOM   123   C C   . TYR A 1 18  ? -15.803 63.930   98.553  1.00 15.51 ? 100 TYR A C   1 
ATOM   124   O O   . TYR A 1 18  ? -15.587 62.787   98.130  1.00 15.83 ? 100 TYR A O   1 
ATOM   125   C CB  . TYR A 1 18  ? -15.742 65.898   96.968  1.00 13.53 ? 100 TYR A CB  1 
ATOM   126   C CG  . TYR A 1 18  ? -14.919 65.285   95.858  1.00 14.01 ? 100 TYR A CG  1 
ATOM   127   C CD1 . TYR A 1 18  ? -15.522 64.571   94.824  1.00 13.99 ? 100 TYR A CD1 1 
ATOM   128   C CD2 . TYR A 1 18  ? -13.539 65.423   95.838  1.00 14.32 ? 100 TYR A CD2 1 
ATOM   129   C CE1 . TYR A 1 18  ? -14.767 64.009   93.802  1.00 11.98 ? 100 TYR A CE1 1 
ATOM   130   C CE2 . TYR A 1 18  ? -12.774 64.867   94.817  1.00 13.82 ? 100 TYR A CE2 1 
ATOM   131   C CZ  . TYR A 1 18  ? -13.391 64.160   93.805  1.00 14.31 ? 100 TYR A CZ  1 
ATOM   132   O OH  . TYR A 1 18  ? -12.618 63.581   92.812  1.00 15.72 ? 100 TYR A OH  1 
ATOM   133   N N   . SER A 1 19  ? -15.357 64.365   99.735  1.00 13.51 ? 101 SER A N   1 
ATOM   134   C CA  . SER A 1 19  ? -14.539 63.503   100.590 1.00 12.62 ? 101 SER A CA  1 
ATOM   135   C C   . SER A 1 19  ? -14.416 63.900   102.068 1.00 13.97 ? 101 SER A C   1 
ATOM   136   O O   . SER A 1 19  ? -14.744 65.019   102.476 1.00 14.57 ? 101 SER A O   1 
ATOM   137   C CB  . SER A 1 19  ? -13.128 63.407   100.015 1.00 11.77 ? 101 SER A CB  1 
ATOM   138   O OG  . SER A 1 19  ? -12.451 64.647   100.141 1.00 11.08 ? 101 SER A OG  1 
ATOM   139   N N   . LYS A 1 20  ? -13.918 62.962   102.861 1.00 13.04 ? 102 LYS A N   1 
ATOM   140   C CA  . LYS A 1 20  ? -13.698 63.181   104.283 1.00 14.72 ? 102 LYS A CA  1 
ATOM   141   C C   . LYS A 1 20  ? -12.652 62.157   104.725 1.00 14.61 ? 102 LYS A C   1 
ATOM   142   O O   . LYS A 1 20  ? -12.870 60.955   104.596 1.00 16.89 ? 102 LYS A O   1 
ATOM   143   C CB  . LYS A 1 20  ? -15.000 62.996   105.070 1.00 13.78 ? 102 LYS A CB  1 
ATOM   144   C CG  . LYS A 1 20  ? -14.871 63.366   106.540 1.00 14.11 ? 102 LYS A CG  1 
ATOM   145   C CD  . LYS A 1 20  ? -16.194 63.259   107.267 1.00 12.86 ? 102 LYS A CD  1 
ATOM   146   C CE  . LYS A 1 20  ? -16.174 64.042   108.565 1.00 12.67 ? 102 LYS A CE  1 
ATOM   147   N NZ  . LYS A 1 20  ? -15.160 63.556   109.541 1.00 11.15 ? 102 LYS A NZ  1 
ATOM   148   N N   . ASP A 1 21  ? -11.525 62.621   105.249 1.00 13.72 ? 103 ASP A N   1 
ATOM   149   C CA  . ASP A 1 21  ? -10.469 61.700   105.643 1.00 15.37 ? 103 ASP A CA  1 
ATOM   150   C C   . ASP A 1 21  ? -10.456 61.196   107.081 1.00 15.71 ? 103 ASP A C   1 
ATOM   151   O O   . ASP A 1 21  ? -9.741  60.245   107.380 1.00 17.23 ? 103 ASP A O   1 
ATOM   152   C CB  . ASP A 1 21  ? -9.093  62.287   105.270 1.00 17.90 ? 103 ASP A CB  1 
ATOM   153   C CG  . ASP A 1 21  ? -8.857  63.683   105.838 1.00 20.44 ? 103 ASP A CG  1 
ATOM   154   O OD1 . ASP A 1 21  ? -8.066  64.443   105.226 1.00 22.27 ? 103 ASP A OD1 1 
ATOM   155   O OD2 . ASP A 1 21  ? -9.440  64.022   106.892 1.00 22.08 ? 103 ASP A OD2 1 
ATOM   156   N N   . ASN A 1 22  ? -11.242 61.815   107.961 1.00 14.75 ? 104 ASN A N   1 
ATOM   157   C CA  . ASN A 1 22  ? -11.313 61.404   109.361 1.00 14.37 ? 104 ASN A CA  1 
ATOM   158   C C   . ASN A 1 22  ? -9.945  61.165   109.986 1.00 15.66 ? 104 ASN A C   1 
ATOM   159   O O   . ASN A 1 22  ? -9.837  60.437   110.967 1.00 15.47 ? 104 ASN A O   1 
ATOM   160   C CB  . ASN A 1 22  ? -12.127 60.118   109.486 1.00 13.83 ? 104 ASN A CB  1 
ATOM   161   C CG  . ASN A 1 22  ? -13.608 60.354   109.346 1.00 13.58 ? 104 ASN A CG  1 
ATOM   162   O OD1 . ASN A 1 22  ? -14.266 59.777   108.485 1.00 15.86 ? 104 ASN A OD1 1 
ATOM   163   N ND2 . ASN A 1 22  ? -14.142 61.204   110.196 1.00 9.58  ? 104 ASN A ND2 1 
ATOM   164   N N   . SER A 1 23  ? -8.914  61.798   109.441 1.00 15.35 ? 105 SER A N   1 
ATOM   165   C CA  . SER A 1 23  ? -7.551  61.594   109.916 1.00 17.55 ? 105 SER A CA  1 
ATOM   166   C C   . SER A 1 23  ? -7.300  61.629   111.429 1.00 17.96 ? 105 SER A C   1 
ATOM   167   O O   . SER A 1 23  ? -6.501  60.841   111.936 1.00 18.51 ? 105 SER A O   1 
ATOM   168   C CB  . SER A 1 23  ? -6.605  62.581   109.233 1.00 17.63 ? 105 SER A CB  1 
ATOM   169   O OG  . SER A 1 23  ? -6.594  63.816   109.924 1.00 23.37 ? 105 SER A OG  1 
ATOM   170   N N   . ILE A 1 24  ? -7.963  62.522   112.155 1.00 18.17 ? 106 ILE A N   1 
ATOM   171   C CA  . ILE A 1 24  ? -7.737  62.603   113.598 1.00 18.14 ? 106 ILE A CA  1 
ATOM   172   C C   . ILE A 1 24  ? -8.428  61.497   114.398 1.00 18.35 ? 106 ILE A C   1 
ATOM   173   O O   . ILE A 1 24  ? -7.839  60.940   115.335 1.00 18.93 ? 106 ILE A O   1 
ATOM   174   C CB  . ILE A 1 24  ? -8.127  63.997   114.134 1.00 17.39 ? 106 ILE A CB  1 
ATOM   175   C CG1 . ILE A 1 24  ? -7.303  65.057   113.382 1.00 16.56 ? 106 ILE A CG1 1 
ATOM   176   C CG2 . ILE A 1 24  ? -7.862  64.079   115.637 1.00 15.87 ? 106 ILE A CG2 1 
ATOM   177   C CD1 . ILE A 1 24  ? -7.657  66.483   113.685 1.00 16.68 ? 106 ILE A CD1 1 
ATOM   178   N N   . ARG A 1 25  ? -9.665  61.169   114.031 1.00 17.47 ? 107 ARG A N   1 
ATOM   179   C CA  . ARG A 1 25  ? -10.393 60.093   114.711 1.00 16.32 ? 107 ARG A CA  1 
ATOM   180   C C   . ARG A 1 25  ? -9.552  58.829   114.574 1.00 15.83 ? 107 ARG A C   1 
ATOM   181   O O   . ARG A 1 25  ? -9.335  58.098   115.540 1.00 17.65 ? 107 ARG A O   1 
ATOM   182   C CB  . ARG A 1 25  ? -11.762 59.865   114.056 1.00 15.15 ? 107 ARG A CB  1 
ATOM   183   C CG  . ARG A 1 25  ? -12.830 60.880   114.442 1.00 13.35 ? 107 ARG A CG  1 
ATOM   184   C CD  . ARG A 1 25  ? -14.025 60.798   113.502 1.00 13.94 ? 107 ARG A CD  1 
ATOM   185   N NE  . ARG A 1 25  ? -14.687 59.494   113.511 1.00 13.22 ? 107 ARG A NE  1 
ATOM   186   C CZ  . ARG A 1 25  ? -15.594 59.117   114.409 1.00 13.77 ? 107 ARG A CZ  1 
ATOM   187   N NH1 . ARG A 1 25  ? -16.141 57.912   114.334 1.00 11.16 ? 107 ARG A NH1 1 
ATOM   188   N NH2 . ARG A 1 25  ? -15.959 59.946   115.382 1.00 11.90 ? 107 ARG A NH2 1 
ATOM   189   N N   . ILE A 1 26  ? -9.072  58.601   113.358 1.00 14.27 ? 108 ILE A N   1 
ATOM   190   C CA  . ILE A 1 26  ? -8.256  57.451   113.029 1.00 13.04 ? 108 ILE A CA  1 
ATOM   191   C C   . ILE A 1 26  ? -6.905  57.517   113.730 1.00 13.67 ? 108 ILE A C   1 
ATOM   192   O O   . ILE A 1 26  ? -6.420  56.519   114.255 1.00 11.98 ? 108 ILE A O   1 
ATOM   193   C CB  . ILE A 1 26  ? -8.052  57.377   111.502 1.00 13.65 ? 108 ILE A CB  1 
ATOM   194   C CG1 . ILE A 1 26  ? -9.407  57.168   110.819 1.00 13.81 ? 108 ILE A CG1 1 
ATOM   195   C CG2 . ILE A 1 26  ? -7.096  56.256   111.146 1.00 13.28 ? 108 ILE A CG2 1 
ATOM   196   C CD1 . ILE A 1 26  ? -9.343  57.167   109.300 1.00 13.22 ? 108 ILE A CD1 1 
ATOM   197   N N   . GLY A 1 27  ? -6.308  58.706   113.739 1.00 14.21 ? 109 GLY A N   1 
ATOM   198   C CA  . GLY A 1 27  ? -5.014  58.896   114.371 1.00 15.84 ? 109 GLY A CA  1 
ATOM   199   C C   . GLY A 1 27  ? -4.987  58.579   115.860 1.00 16.48 ? 109 GLY A C   1 
ATOM   200   O O   . GLY A 1 27  ? -3.915  58.444   116.450 1.00 16.67 ? 109 GLY A O   1 
ATOM   201   N N   . SER A 1 28  ? -6.162  58.480   116.473 1.00 16.06 ? 110 SER A N   1 
ATOM   202   C CA  . SER A 1 28  ? -6.251  58.155   117.884 1.00 16.27 ? 110 SER A CA  1 
ATOM   203   C C   . SER A 1 28  ? -5.436  56.890   118.108 1.00 15.55 ? 110 SER A C   1 
ATOM   204   O O   . SER A 1 28  ? -4.780  56.734   119.137 1.00 14.14 ? 110 SER A O   1 
ATOM   205   C CB  . SER A 1 28  ? -7.706  57.909   118.276 1.00 15.85 ? 110 SER A CB  1 
ATOM   206   O OG  . SER A 1 28  ? -7.838  57.664   119.669 1.00 18.13 ? 110 SER A OG  1 
ATOM   207   N N   . LYS A 1 29  ? -5.477  55.998   117.121 1.00 15.81 ? 111 LYS A N   1 
ATOM   208   C CA  . LYS A 1 29  ? -4.741  54.745   117.185 1.00 15.80 ? 111 LYS A CA  1 
ATOM   209   C C   . LYS A 1 29  ? -3.734  54.559   116.047 1.00 16.01 ? 111 LYS A C   1 
ATOM   210   O O   . LYS A 1 29  ? -2.581  54.200   116.289 1.00 15.66 ? 111 LYS A O   1 
ATOM   211   C CB  . LYS A 1 29  ? -5.709  53.558   117.187 1.00 15.08 ? 111 LYS A CB  1 
ATOM   212   C CG  . LYS A 1 29  ? -4.982  52.226   117.118 1.00 14.89 ? 111 LYS A CG  1 
ATOM   213   C CD  . LYS A 1 29  ? -5.910  51.032   117.078 1.00 15.11 ? 111 LYS A CD  1 
ATOM   214   C CE  . LYS A 1 29  ? -5.080  49.763   116.936 1.00 15.83 ? 111 LYS A CE  1 
ATOM   215   N NZ  . LYS A 1 29  ? -5.884  48.611   116.462 1.00 18.51 ? 111 LYS A NZ  1 
ATOM   216   N N   . GLY A 1 30  ? -4.179  54.801   114.815 1.00 15.96 ? 112 GLY A N   1 
ATOM   217   C CA  . GLY A 1 30  ? -3.331  54.630   113.648 1.00 15.85 ? 112 GLY A CA  1 
ATOM   218   C C   . GLY A 1 30  ? -2.126  55.547   113.553 1.00 17.80 ? 112 GLY A C   1 
ATOM   219   O O   . GLY A 1 30  ? -2.011  56.530   114.297 1.00 18.94 ? 112 GLY A O   1 
ATOM   220   N N   . ASP A 1 31  ? -1.217  55.223   112.638 1.00 16.57 ? 113 ASP A N   1 
ATOM   221   C CA  . ASP A 1 31  ? -0.023  56.025   112.446 1.00 16.98 ? 113 ASP A CA  1 
ATOM   222   C C   . ASP A 1 31  ? -0.298  57.147   111.432 1.00 17.49 ? 113 ASP A C   1 
ATOM   223   O O   . ASP A 1 31  ? 0.174   57.106   110.293 1.00 18.73 ? 113 ASP A O   1 
ATOM   224   C CB  . ASP A 1 31  ? 1.129   55.141   111.960 1.00 17.33 ? 113 ASP A CB  1 
ATOM   225   C CG  . ASP A 1 31  ? 1.374   53.946   112.867 1.00 17.36 ? 113 ASP A CG  1 
ATOM   226   O OD1 . ASP A 1 31  ? 1.422   54.126   114.102 1.00 18.85 ? 113 ASP A OD1 1 
ATOM   227   O OD2 . ASP A 1 31  ? 1.527   52.821   112.342 1.00 18.65 ? 113 ASP A OD2 1 
ATOM   228   N N   . VAL A 1 32  ? -1.064  58.144   111.868 1.00 16.14 ? 114 VAL A N   1 
ATOM   229   C CA  . VAL A 1 32  ? -1.443  59.295   111.046 1.00 15.92 ? 114 VAL A CA  1 
ATOM   230   C C   . VAL A 1 32  ? -0.568  60.516   111.355 1.00 16.10 ? 114 VAL A C   1 
ATOM   231   O O   . VAL A 1 32  ? -0.405  60.875   112.520 1.00 17.40 ? 114 VAL A O   1 
ATOM   232   C CB  . VAL A 1 32  ? -2.909  59.696   111.320 1.00 15.02 ? 114 VAL A CB  1 
ATOM   233   C CG1 . VAL A 1 32  ? -3.301  60.874   110.451 1.00 16.47 ? 114 VAL A CG1 1 
ATOM   234   C CG2 . VAL A 1 32  ? -3.822  58.525   111.075 1.00 13.66 ? 114 VAL A CG2 1 
ATOM   235   N N   . PHE A 1 33  ? -0.005  61.153   110.330 1.00 14.08 ? 115 PHE A N   1 
ATOM   236   C CA  . PHE A 1 33  ? 0.820   62.338   110.565 1.00 13.37 ? 115 PHE A CA  1 
ATOM   237   C C   . PHE A 1 33  ? -0.011  63.412   111.255 1.00 14.32 ? 115 PHE A C   1 
ATOM   238   O O   . PHE A 1 33  ? -1.235  63.375   111.227 1.00 13.85 ? 115 PHE A O   1 
ATOM   239   C CB  . PHE A 1 33  ? 1.310   62.960   109.257 1.00 11.30 ? 115 PHE A CB  1 
ATOM   240   C CG  . PHE A 1 33  ? 2.461   62.253   108.624 1.00 12.01 ? 115 PHE A CG  1 
ATOM   241   C CD1 . PHE A 1 33  ? 2.318   61.652   107.377 1.00 11.21 ? 115 PHE A CD1 1 
ATOM   242   C CD2 . PHE A 1 33  ? 3.709   62.238   109.240 1.00 11.72 ? 115 PHE A CD2 1 
ATOM   243   C CE1 . PHE A 1 33  ? 3.401   61.046   106.744 1.00 12.34 ? 115 PHE A CE1 1 
ATOM   244   C CE2 . PHE A 1 33  ? 4.804   61.634   108.617 1.00 11.24 ? 115 PHE A CE2 1 
ATOM   245   C CZ  . PHE A 1 33  ? 4.649   61.038   107.365 1.00 11.63 ? 115 PHE A CZ  1 
ATOM   246   N N   . VAL A 1 34  ? 0.671   64.355   111.893 1.00 14.38 ? 116 VAL A N   1 
ATOM   247   C CA  . VAL A 1 34  ? 0.008   65.495   112.492 1.00 15.12 ? 116 VAL A CA  1 
ATOM   248   C C   . VAL A 1 34  ? 0.246   66.523   111.389 1.00 15.22 ? 116 VAL A C   1 
ATOM   249   O O   . VAL A 1 34  ? 1.335   66.563   110.805 1.00 15.50 ? 116 VAL A O   1 
ATOM   250   C CB  . VAL A 1 34  ? 0.692   65.952   113.794 1.00 16.30 ? 116 VAL A CB  1 
ATOM   251   C CG1 . VAL A 1 34  ? 2.197   65.888   113.635 1.00 20.03 ? 116 VAL A CG1 1 
ATOM   252   C CG2 . VAL A 1 34  ? 0.261   67.380   114.129 1.00 13.51 ? 116 VAL A CG2 1 
ATOM   253   N N   . ILE A 1 35  ? -0.750  67.344   111.083 1.00 15.31 ? 117 ILE A N   1 
ATOM   254   C CA  . ILE A 1 35  ? -0.589  68.310   110.000 1.00 14.57 ? 117 ILE A CA  1 
ATOM   255   C C   . ILE A 1 35  ? -1.445  69.564   110.118 1.00 13.57 ? 117 ILE A C   1 
ATOM   256   O O   . ILE A 1 35  ? -2.301  69.671   110.981 1.00 15.45 ? 117 ILE A O   1 
ATOM   257   C CB  . ILE A 1 35  ? -0.980  67.679   108.651 1.00 14.88 ? 117 ILE A CB  1 
ATOM   258   C CG1 . ILE A 1 35  ? -2.486  67.423   108.643 1.00 13.93 ? 117 ILE A CG1 1 
ATOM   259   C CG2 . ILE A 1 35  ? -0.264  66.374   108.442 1.00 14.75 ? 117 ILE A CG2 1 
ATOM   260   C CD1 . ILE A 1 35  ? -3.037  67.067   107.303 1.00 14.94 ? 117 ILE A CD1 1 
ATOM   261   N N   . ARG A 1 36  ? -1.201  70.490   109.200 1.00 11.73 ? 118 ARG A N   1 
ATOM   262   C CA  . ARG A 1 36  ? -1.945  71.736   109.070 1.00 12.45 ? 118 ARG A CA  1 
ATOM   263   C C   . ARG A 1 36  ? -1.812  72.131   107.601 1.00 12.34 ? 118 ARG A C   1 
ATOM   264   O O   . ARG A 1 36  ? -1.036  71.528   106.856 1.00 12.14 ? 118 ARG A O   1 
ATOM   265   C CB  . ARG A 1 36  ? -1.358  72.856   109.932 1.00 13.80 ? 118 ARG A CB  1 
ATOM   266   C CG  . ARG A 1 36  ? -1.832  72.927   111.373 1.00 16.79 ? 118 ARG A CG  1 
ATOM   267   C CD  . ARG A 1 36  ? -3.322  73.221   111.525 1.00 18.17 ? 118 ARG A CD  1 
ATOM   268   N NE  . ARG A 1 36  ? -3.815  74.351   110.729 1.00 22.44 ? 118 ARG A NE  1 
ATOM   269   C CZ  . ARG A 1 36  ? -3.545  75.640   110.938 1.00 21.46 ? 118 ARG A CZ  1 
ATOM   270   N NH1 . ARG A 1 36  ? -4.072  76.550   110.127 1.00 20.63 ? 118 ARG A NH1 1 
ATOM   271   N NH2 . ARG A 1 36  ? -2.759  76.027   111.939 1.00 21.26 ? 118 ARG A NH2 1 
ATOM   272   N N   . GLU A 1 37  ? -2.567  73.142   107.191 1.00 10.70 ? 119 GLU A N   1 
ATOM   273   C CA  . GLU A 1 37  ? -2.518  73.632   105.829 1.00 10.49 ? 119 GLU A CA  1 
ATOM   274   C C   . GLU A 1 37  ? -2.672  72.541   104.756 1.00 10.17 ? 119 GLU A C   1 
ATOM   275   O O   . GLU A 1 37  ? -1.805  72.360   103.907 1.00 9.01  ? 119 GLU A O   1 
ATOM   276   C CB  . GLU A 1 37  ? -1.207  74.404   105.608 1.00 11.76 ? 119 GLU A CB  1 
ATOM   277   C CG  . GLU A 1 37  ? -0.942  75.589   106.564 1.00 13.65 ? 119 GLU A CG  1 
ATOM   278   C CD  . GLU A 1 37  ? -0.349  75.185   107.924 1.00 15.97 ? 119 GLU A CD  1 
ATOM   279   O OE1 . GLU A 1 37  ? 0.522   74.281   107.973 1.00 16.55 ? 119 GLU A OE1 1 
ATOM   280   O OE2 . GLU A 1 37  ? -0.737  75.788   108.944 1.00 15.78 ? 119 GLU A OE2 1 
ATOM   281   N N   . PRO A 1 38  ? -3.782  71.791   104.787 1.00 10.69 ? 120 PRO A N   1 
ATOM   282   C CA  . PRO A 1 38  ? -3.985  70.747   103.783 1.00 11.04 ? 120 PRO A CA  1 
ATOM   283   C C   . PRO A 1 38  ? -4.705  71.355   102.592 1.00 11.60 ? 120 PRO A C   1 
ATOM   284   O O   . PRO A 1 38  ? -5.366  72.386   102.719 1.00 13.09 ? 120 PRO A O   1 
ATOM   285   C CB  . PRO A 1 38  ? -4.882  69.763   104.507 1.00 10.05 ? 120 PRO A CB  1 
ATOM   286   C CG  . PRO A 1 38  ? -5.804  70.688   105.220 1.00 9.70  ? 120 PRO A CG  1 
ATOM   287   C CD  . PRO A 1 38  ? -4.823  71.702   105.826 1.00 11.40 ? 120 PRO A CD  1 
ATOM   288   N N   . PHE A 1 39  ? -4.581  70.729   101.434 1.00 12.64 ? 121 PHE A N   1 
ATOM   289   C CA  . PHE A 1 39  ? -5.282  71.231   100.259 1.00 14.08 ? 121 PHE A CA  1 
ATOM   290   C C   . PHE A 1 39  ? -5.328  70.173   99.177  1.00 14.60 ? 121 PHE A C   1 
ATOM   291   O O   . PHE A 1 39  ? -4.473  69.290   99.130  1.00 16.45 ? 121 PHE A O   1 
ATOM   292   C CB  . PHE A 1 39  ? -4.643  72.531   99.747  1.00 13.80 ? 121 PHE A CB  1 
ATOM   293   C CG  . PHE A 1 39  ? -3.262  72.371   99.158  1.00 14.38 ? 121 PHE A CG  1 
ATOM   294   C CD1 . PHE A 1 39  ? -3.095  71.990   97.824  1.00 15.23 ? 121 PHE A CD1 1 
ATOM   295   C CD2 . PHE A 1 39  ? -2.130  72.681   99.909  1.00 13.66 ? 121 PHE A CD2 1 
ATOM   296   C CE1 . PHE A 1 39  ? -1.817  71.930   97.243  1.00 13.13 ? 121 PHE A CE1 1 
ATOM   297   C CE2 . PHE A 1 39  ? -0.849  72.624   99.340  1.00 14.59 ? 121 PHE A CE2 1 
ATOM   298   C CZ  . PHE A 1 39  ? -0.695  72.248   98.002  1.00 13.42 ? 121 PHE A CZ  1 
ATOM   299   N N   . ILE A 1 40  ? -6.344  70.248   98.325  1.00 15.20 ? 122 ILE A N   1 
ATOM   300   C CA  . ILE A 1 40  ? -6.505  69.282   97.253  1.00 14.78 ? 122 ILE A CA  1 
ATOM   301   C C   . ILE A 1 40  ? -6.142  69.885   95.915  1.00 14.81 ? 122 ILE A C   1 
ATOM   302   O O   . ILE A 1 40  ? -6.286  71.073   95.717  1.00 16.89 ? 122 ILE A O   1 
ATOM   303   C CB  . ILE A 1 40  ? -7.960  68.771   97.202  1.00 14.83 ? 122 ILE A CB  1 
ATOM   304   C CG1 . ILE A 1 40  ? -8.286  68.044   98.513  1.00 13.97 ? 122 ILE A CG1 1 
ATOM   305   C CG2 . ILE A 1 40  ? -8.159  67.866   95.996  1.00 11.24 ? 122 ILE A CG2 1 
ATOM   306   C CD1 . ILE A 1 40  ? -9.748  67.692   98.691  1.00 14.88 ? 122 ILE A CD1 1 
ATOM   307   N N   . SER A 1 41  ? -5.649  69.052   95.009  1.00 15.53 ? 123 SER A N   1 
ATOM   308   C CA  . SER A 1 41  ? -5.282  69.483   93.668  1.00 14.96 ? 123 SER A CA  1 
ATOM   309   C C   . SER A 1 41  ? -5.404  68.267   92.763  1.00 14.76 ? 123 SER A C   1 
ATOM   310   O O   . SER A 1 41  ? -5.152  67.151   93.205  1.00 14.69 ? 123 SER A O   1 
ATOM   311   C CB  . SER A 1 41  ? -3.857  70.022   93.646  1.00 15.30 ? 123 SER A CB  1 
ATOM   312   O OG  . SER A 1 41  ? -3.563  70.560   92.373  1.00 18.23 ? 123 SER A OG  1 
ATOM   313   N N   . CYS A 1 42  ? -5.784  68.475   91.505  1.00 15.16 ? 124 CYS A N   1 
ATOM   314   C CA  . CYS A 1 42  ? -5.977  67.354   90.581  1.00 16.84 ? 124 CYS A CA  1 
ATOM   315   C C   . CYS A 1 42  ? -5.188  67.445   89.274  1.00 16.83 ? 124 CYS A C   1 
ATOM   316   O O   . CYS A 1 42  ? -4.939  68.531   88.749  1.00 18.06 ? 124 CYS A O   1 
ATOM   317   C CB  . CYS A 1 42  ? -7.471  67.208   90.232  1.00 16.96 ? 124 CYS A CB  1 
ATOM   318   S SG  . CYS A 1 42  ? -8.655  67.276   91.627  1.00 22.73 ? 124 CYS A SG  1 
ATOM   319   N N   . SER A 1 43  ? -4.805  66.290   88.750  1.00 16.73 ? 125 SER A N   1 
ATOM   320   C CA  . SER A 1 43  ? -4.076  66.215   87.488  1.00 17.78 ? 125 SER A CA  1 
ATOM   321   C C   . SER A 1 43  ? -5.138  65.903   86.446  1.00 19.79 ? 125 SER A C   1 
ATOM   322   O O   . SER A 1 43  ? -6.319  66.178   86.658  1.00 20.56 ? 125 SER A O   1 
ATOM   323   C CB  . SER A 1 43  ? -3.083  65.060   87.524  1.00 16.89 ? 125 SER A CB  1 
ATOM   324   O OG  . SER A 1 43  ? -3.779  63.823   87.611  1.00 16.11 ? 125 SER A OG  1 
ATOM   325   N N   . HIS A 1 44  ? -4.731  65.318   85.326  1.00 21.17 ? 126 HIS A N   1 
ATOM   326   C CA  . HIS A 1 44  ? -5.708  64.948   84.322  1.00 20.84 ? 126 HIS A CA  1 
ATOM   327   C C   . HIS A 1 44  ? -6.220  63.547   84.638  1.00 21.27 ? 126 HIS A C   1 
ATOM   328   O O   . HIS A 1 44  ? -7.238  63.117   84.102  1.00 23.14 ? 126 HIS A O   1 
ATOM   329   C CB  . HIS A 1 44  ? -5.102  65.009   82.916  1.00 21.16 ? 126 HIS A CB  1 
ATOM   330   C CG  . HIS A 1 44  ? -3.923  64.113   82.710  1.00 22.16 ? 126 HIS A CG  1 
ATOM   331   N ND1 . HIS A 1 44  ? -2.787  64.180   83.492  1.00 22.75 ? 126 HIS A ND1 1 
ATOM   332   C CD2 . HIS A 1 44  ? -3.680  63.163   81.777  1.00 20.67 ? 126 HIS A CD2 1 
ATOM   333   C CE1 . HIS A 1 44  ? -1.898  63.311   83.045  1.00 23.10 ? 126 HIS A CE1 1 
ATOM   334   N NE2 . HIS A 1 44  ? -2.416  62.681   82.003  1.00 21.79 ? 126 HIS A NE2 1 
ATOM   335   N N   . LEU A 1 45  ? -5.544  62.847   85.545  1.00 20.68 ? 127 LEU A N   1 
ATOM   336   C CA  . LEU A 1 45  ? -5.957  61.491   85.897  1.00 20.77 ? 127 LEU A CA  1 
ATOM   337   C C   . LEU A 1 45  ? -6.519  61.292   87.301  1.00 21.72 ? 127 LEU A C   1 
ATOM   338   O O   . LEU A 1 45  ? -7.474  60.529   87.476  1.00 22.12 ? 127 LEU A O   1 
ATOM   339   C CB  . LEU A 1 45  ? -4.791  60.528   85.713  1.00 19.06 ? 127 LEU A CB  1 
ATOM   340   C CG  . LEU A 1 45  ? -4.171  60.495   84.317  1.00 20.69 ? 127 LEU A CG  1 
ATOM   341   C CD1 . LEU A 1 45  ? -2.973  59.561   84.353  1.00 21.10 ? 127 LEU A CD1 1 
ATOM   342   C CD2 . LEU A 1 45  ? -5.192  60.034   83.270  1.00 15.04 ? 127 LEU A CD2 1 
ATOM   343   N N   . GLU A 1 46  ? -5.937  61.965   88.296  1.00 21.47 ? 128 GLU A N   1 
ATOM   344   C CA  . GLU A 1 46  ? -6.380  61.798   89.683  1.00 22.46 ? 128 GLU A CA  1 
ATOM   345   C C   . GLU A 1 46  ? -6.322  63.080   90.521  1.00 21.54 ? 128 GLU A C   1 
ATOM   346   O O   . GLU A 1 46  ? -5.742  64.076   90.106  1.00 20.95 ? 128 GLU A O   1 
ATOM   347   C CB  . GLU A 1 46  ? -5.507  60.745   90.379  1.00 23.16 ? 128 GLU A CB  1 
ATOM   348   C CG  . GLU A 1 46  ? -4.214  61.330   90.963  1.00 27.75 ? 128 GLU A CG  1 
ATOM   349   C CD  . GLU A 1 46  ? -3.334  60.310   91.696  1.00 31.85 ? 128 GLU A CD  1 
ATOM   350   O OE1 . GLU A 1 46  ? -3.862  59.506   92.512  1.00 34.15 ? 128 GLU A OE1 1 
ATOM   351   O OE2 . GLU A 1 46  ? -2.101  60.329   91.468  1.00 32.16 ? 128 GLU A OE2 1 
ATOM   352   N N   . CYS A 1 47  ? -6.915  63.028   91.713  1.00 20.84 ? 129 CYS A N   1 
ATOM   353   C CA  . CYS A 1 47  ? -6.901  64.151   92.649  1.00 21.08 ? 129 CYS A CA  1 
ATOM   354   C C   . CYS A 1 47  ? -6.124  63.744   93.887  1.00 19.35 ? 129 CYS A C   1 
ATOM   355   O O   . CYS A 1 47  ? -6.320  62.651   94.413  1.00 19.42 ? 129 CYS A O   1 
ATOM   356   C CB  . CYS A 1 47  ? -8.309  64.547   93.094  1.00 22.09 ? 129 CYS A CB  1 
ATOM   357   S SG  . CYS A 1 47  ? -9.358  65.356   91.843  1.00 28.57 ? 129 CYS A SG  1 
ATOM   358   N N   . ARG A 1 48  ? -5.256  64.628   94.361  1.00 18.34 ? 130 ARG A N   1 
ATOM   359   C CA  . ARG A 1 48  ? -4.462  64.332   95.539  1.00 16.33 ? 130 ARG A CA  1 
ATOM   360   C C   . ARG A 1 48  ? -4.642  65.369   96.630  1.00 16.35 ? 130 ARG A C   1 
ATOM   361   O O   . ARG A 1 48  ? -5.147  66.463   96.395  1.00 17.66 ? 130 ARG A O   1 
ATOM   362   C CB  . ARG A 1 48  ? -2.979  64.262   95.179  1.00 16.02 ? 130 ARG A CB  1 
ATOM   363   C CG  . ARG A 1 48  ? -2.605  63.203   94.173  1.00 13.77 ? 130 ARG A CG  1 
ATOM   364   C CD  . ARG A 1 48  ? -1.089  63.174   93.979  1.00 16.39 ? 130 ARG A CD  1 
ATOM   365   N NE  . ARG A 1 48  ? -0.368  62.730   95.175  1.00 15.64 ? 130 ARG A NE  1 
ATOM   366   C CZ  . ARG A 1 48  ? -0.365  61.478   95.622  1.00 16.75 ? 130 ARG A CZ  1 
ATOM   367   N NH1 . ARG A 1 48  ? 0.317   61.164   96.717  1.00 15.36 ? 130 ARG A NH1 1 
ATOM   368   N NH2 . ARG A 1 48  ? -1.040  60.537   94.971  1.00 14.93 ? 130 ARG A NH2 1 
ATOM   369   N N   . THR A 1 49  ? -4.213  65.008   97.831  1.00 16.46 ? 131 THR A N   1 
ATOM   370   C CA  . THR A 1 49  ? -4.277  65.896   98.980  1.00 15.45 ? 131 THR A CA  1 
ATOM   371   C C   . THR A 1 49  ? -2.852  66.156   99.436  1.00 14.12 ? 131 THR A C   1 
ATOM   372   O O   . THR A 1 49  ? -2.120  65.224   99.759  1.00 14.28 ? 131 THR A O   1 
ATOM   373   C CB  . THR A 1 49  ? -5.056  65.264   100.157 1.00 16.85 ? 131 THR A CB  1 
ATOM   374   O OG1 . THR A 1 49  ? -6.395  64.974   99.741  1.00 19.90 ? 131 THR A OG1 1 
ATOM   375   C CG2 . THR A 1 49  ? -5.109  66.216   101.348 1.00 13.61 ? 131 THR A CG2 1 
ATOM   376   N N   . PHE A 1 50  ? -2.452  67.423   99.432  1.00 11.60 ? 132 PHE A N   1 
ATOM   377   C CA  . PHE A 1 50  ? -1.121  67.796   99.882  1.00 11.10 ? 132 PHE A CA  1 
ATOM   378   C C   . PHE A 1 50  ? -1.286  68.330   101.293 1.00 12.34 ? 132 PHE A C   1 
ATOM   379   O O   . PHE A 1 50  ? -2.378  68.759   101.675 1.00 13.64 ? 132 PHE A O   1 
ATOM   380   C CB  . PHE A 1 50  ? -0.523  68.888   98.998  1.00 9.73  ? 132 PHE A CB  1 
ATOM   381   C CG  . PHE A 1 50  ? -0.243  68.445   97.605  1.00 9.05  ? 132 PHE A CG  1 
ATOM   382   C CD1 . PHE A 1 50  ? -1.281  68.210   96.716  1.00 9.95  ? 132 PHE A CD1 1 
ATOM   383   C CD2 . PHE A 1 50  ? 1.063   68.219   97.190  1.00 10.02 ? 132 PHE A CD2 1 
ATOM   384   C CE1 . PHE A 1 50  ? -1.024  67.751   95.433  1.00 11.72 ? 132 PHE A CE1 1 
ATOM   385   C CE2 . PHE A 1 50  ? 1.338   67.760   95.910  1.00 9.99  ? 132 PHE A CE2 1 
ATOM   386   C CZ  . PHE A 1 50  ? 0.295   67.523   95.026  1.00 10.49 ? 132 PHE A CZ  1 
ATOM   387   N N   . PHE A 1 51  ? -0.212  68.309   102.068 1.00 11.56 ? 133 PHE A N   1 
ATOM   388   C CA  . PHE A 1 51  ? -0.275  68.811   103.434 1.00 12.76 ? 133 PHE A CA  1 
ATOM   389   C C   . PHE A 1 51  ? 1.109   69.042   103.991 1.00 12.54 ? 133 PHE A C   1 
ATOM   390   O O   . PHE A 1 51  ? 2.084   68.514   103.475 1.00 14.92 ? 133 PHE A O   1 
ATOM   391   C CB  . PHE A 1 51  ? -1.036  67.818   104.316 1.00 13.40 ? 133 PHE A CB  1 
ATOM   392   C CG  . PHE A 1 51  ? -0.623  66.396   104.107 1.00 12.74 ? 133 PHE A CG  1 
ATOM   393   C CD1 . PHE A 1 51  ? 0.481   65.875   104.768 1.00 11.65 ? 133 PHE A CD1 1 
ATOM   394   C CD2 . PHE A 1 51  ? -1.312  65.591   103.203 1.00 11.19 ? 133 PHE A CD2 1 
ATOM   395   C CE1 . PHE A 1 51  ? 0.896   64.574   104.532 1.00 11.99 ? 133 PHE A CE1 1 
ATOM   396   C CE2 . PHE A 1 51  ? -0.906  64.284   102.959 1.00 9.08  ? 133 PHE A CE2 1 
ATOM   397   C CZ  . PHE A 1 51  ? 0.197   63.775   103.621 1.00 10.66 ? 133 PHE A CZ  1 
ATOM   398   N N   . LEU A 1 52  ? 1.194   69.853   105.034 1.00 12.98 ? 134 LEU A N   1 
ATOM   399   C CA  . LEU A 1 52  ? 2.471   70.122   105.663 1.00 13.35 ? 134 LEU A CA  1 
ATOM   400   C C   . LEU A 1 52  ? 2.458   69.391   106.987 1.00 13.58 ? 134 LEU A C   1 
ATOM   401   O O   . LEU A 1 52  ? 1.697   69.736   107.885 1.00 13.79 ? 134 LEU A O   1 
ATOM   402   C CB  . LEU A 1 52  ? 2.664   71.623   105.878 1.00 14.01 ? 134 LEU A CB  1 
ATOM   403   C CG  . LEU A 1 52  ? 2.787   72.479   104.607 1.00 14.92 ? 134 LEU A CG  1 
ATOM   404   C CD1 . LEU A 1 52  ? 2.923   73.941   104.989 1.00 16.45 ? 134 LEU A CD1 1 
ATOM   405   C CD2 . LEU A 1 52  ? 3.984   72.040   103.789 1.00 13.82 ? 134 LEU A CD2 1 
ATOM   406   N N   . THR A 1 53  ? 3.287   68.365   107.099 1.00 13.16 ? 135 THR A N   1 
ATOM   407   C CA  . THR A 1 53  ? 3.346   67.591   108.325 1.00 14.13 ? 135 THR A CA  1 
ATOM   408   C C   . THR A 1 53  ? 4.173   68.325   109.358 1.00 14.75 ? 135 THR A C   1 
ATOM   409   O O   . THR A 1 53  ? 4.788   69.348   109.070 1.00 15.08 ? 135 THR A O   1 
ATOM   410   C CB  . THR A 1 53  ? 4.041   66.242   108.125 1.00 14.70 ? 135 THR A CB  1 
ATOM   411   O OG1 . THR A 1 53  ? 5.457   66.461   108.073 1.00 13.58 ? 135 THR A OG1 1 
ATOM   412   C CG2 . THR A 1 53  ? 3.575   65.567   106.838 1.00 14.11 ? 135 THR A CG2 1 
ATOM   413   N N   . GLN A 1 54  ? 4.189   67.773   110.564 1.00 15.42 ? 136 GLN A N   1 
ATOM   414   C CA  . GLN A 1 54  ? 4.975   68.321   111.658 1.00 14.86 ? 136 GLN A CA  1 
ATOM   415   C C   . GLN A 1 54  ? 6.053   67.300   112.025 1.00 14.30 ? 136 GLN A C   1 
ATOM   416   O O   . GLN A 1 54  ? 6.588   67.324   113.129 1.00 15.22 ? 136 GLN A O   1 
ATOM   417   C CB  . GLN A 1 54  ? 4.084   68.610   112.867 1.00 15.30 ? 136 GLN A CB  1 
ATOM   418   C CG  . GLN A 1 54  ? 3.244   69.860   112.731 1.00 14.49 ? 136 GLN A CG  1 
ATOM   419   C CD  . GLN A 1 54  ? 4.069   71.114   112.869 1.00 14.17 ? 136 GLN A CD  1 
ATOM   420   O OE1 . GLN A 1 54  ? 5.292   71.052   113.021 1.00 13.75 ? 136 GLN A OE1 1 
ATOM   421   N NE2 . GLN A 1 54  ? 3.409   72.266   112.817 1.00 13.78 ? 136 GLN A NE2 1 
ATOM   422   N N   . GLY A 1 55  ? 6.352   66.397   111.093 1.00 12.52 ? 137 GLY A N   1 
ATOM   423   C CA  . GLY A 1 55  ? 7.374   65.389   111.322 1.00 12.32 ? 137 GLY A CA  1 
ATOM   424   C C   . GLY A 1 55  ? 7.116   64.478   112.505 1.00 12.26 ? 137 GLY A C   1 
ATOM   425   O O   . GLY A 1 55  ? 8.052   63.999   113.139 1.00 11.95 ? 137 GLY A O   1 
ATOM   426   N N   . ALA A 1 56  ? 5.844   64.241   112.804 1.00 11.64 ? 138 ALA A N   1 
ATOM   427   C CA  . ALA A 1 56  ? 5.469   63.384   113.917 1.00 12.14 ? 138 ALA A CA  1 
ATOM   428   C C   . ALA A 1 56  ? 4.072   62.821   113.715 1.00 12.16 ? 138 ALA A C   1 
ATOM   429   O O   . ALA A 1 56  ? 3.336   63.234   112.816 1.00 13.25 ? 138 ALA A O   1 
ATOM   430   C CB  . ALA A 1 56  ? 5.526   64.166   115.224 1.00 13.75 ? 138 ALA A CB  1 
ATOM   431   N N   . LEU A 1 57  ? 3.705   61.876   114.566 1.00 11.29 ? 139 LEU A N   1 
ATOM   432   C CA  . LEU A 1 57  ? 2.401   61.252   114.472 1.00 10.17 ? 139 LEU A CA  1 
ATOM   433   C C   . LEU A 1 57  ? 1.505   61.676   115.624 1.00 10.47 ? 139 LEU A C   1 
ATOM   434   O O   . LEU A 1 57  ? 1.989   62.142   116.659 1.00 10.95 ? 139 LEU A O   1 
ATOM   435   C CB  . LEU A 1 57  ? 2.563   59.734   114.479 1.00 9.31  ? 139 LEU A CB  1 
ATOM   436   C CG  . LEU A 1 57  ? 3.488   59.151   113.411 1.00 9.14  ? 139 LEU A CG  1 
ATOM   437   C CD1 . LEU A 1 57  ? 3.443   57.630   113.492 1.00 6.78  ? 139 LEU A CD1 1 
ATOM   438   C CD2 . LEU A 1 57  ? 3.056   59.631   112.027 1.00 9.30  ? 139 LEU A CD2 1 
ATOM   439   N N   . LEU A 1 58  ? 0.197   61.518   115.438 1.00 9.18  ? 140 LEU A N   1 
ATOM   440   C CA  . LEU A 1 58  ? -0.757  61.856   116.477 1.00 10.38 ? 140 LEU A CA  1 
ATOM   441   C C   . LEU A 1 58  ? -0.622  60.885   117.660 1.00 12.16 ? 140 LEU A C   1 
ATOM   442   O O   . LEU A 1 58  ? -0.257  59.728   117.478 1.00 10.42 ? 140 LEU A O   1 
ATOM   443   C CB  . LEU A 1 58  ? -2.180  61.798   115.920 1.00 8.34  ? 140 LEU A CB  1 
ATOM   444   C CG  . LEU A 1 58  ? -2.610  62.960   115.023 1.00 6.62  ? 140 LEU A CG  1 
ATOM   445   C CD1 . LEU A 1 58  ? -3.965  62.667   114.402 1.00 5.72  ? 140 LEU A CD1 1 
ATOM   446   C CD2 . LEU A 1 58  ? -2.661  64.229   115.837 1.00 6.32  ? 140 LEU A CD2 1 
ATOM   447   N N   . ASN A 1 59  ? -0.906  61.378   118.866 1.00 13.73 ? 141 ASN A N   1 
ATOM   448   C CA  . ASN A 1 59  ? -0.845  60.589   120.101 1.00 15.45 ? 141 ASN A CA  1 
ATOM   449   C C   . ASN A 1 59  ? 0.545   60.065   120.464 1.00 16.09 ? 141 ASN A C   1 
ATOM   450   O O   . ASN A 1 59  ? 0.679   59.061   121.168 1.00 14.85 ? 141 ASN A O   1 
ATOM   451   C CB  . ASN A 1 59  ? -1.839  59.424   120.050 1.00 16.37 ? 141 ASN A CB  1 
ATOM   452   C CG  . ASN A 1 59  ? -2.930  59.547   121.102 1.00 18.52 ? 141 ASN A CG  1 
ATOM   453   O OD1 . ASN A 1 59  ? -2.819  60.350   122.028 1.00 19.32 ? 141 ASN A OD1 1 
ATOM   454   N ND2 . ASN A 1 59  ? -3.986  58.740   120.972 1.00 19.01 ? 141 ASN A ND2 1 
ATOM   455   N N   . ASP A 1 60  ? 1.568   60.766   119.982 1.00 17.35 ? 142 ASP A N   1 
ATOM   456   C CA  . ASP A 1 60  ? 2.967   60.443   120.260 1.00 16.99 ? 142 ASP A CA  1 
ATOM   457   C C   . ASP A 1 60  ? 3.572   61.678   120.916 1.00 17.21 ? 142 ASP A C   1 
ATOM   458   O O   . ASP A 1 60  ? 3.108   62.789   120.679 1.00 16.10 ? 142 ASP A O   1 
ATOM   459   C CB  . ASP A 1 60  ? 3.725   60.131   118.968 1.00 16.59 ? 142 ASP A CB  1 
ATOM   460   C CG  . ASP A 1 60  ? 5.212   59.950   119.202 1.00 19.46 ? 142 ASP A CG  1 
ATOM   461   O OD1 . ASP A 1 60  ? 5.592   59.008   119.939 1.00 18.72 ? 142 ASP A OD1 1 
ATOM   462   O OD2 . ASP A 1 60  ? 5.999   60.757   118.658 1.00 19.65 ? 142 ASP A OD2 1 
ATOM   463   N N   . LYS A 1 61  ? 4.599   61.501   121.742 1.00 17.87 ? 143 LYS A N   1 
ATOM   464   C CA  . LYS A 1 61  ? 5.200   62.659   122.403 1.00 18.78 ? 143 LYS A CA  1 
ATOM   465   C C   . LYS A 1 61  ? 5.726   63.715   121.435 1.00 20.49 ? 143 LYS A C   1 
ATOM   466   O O   . LYS A 1 61  ? 5.691   64.902   121.725 1.00 20.51 ? 143 LYS A O   1 
ATOM   467   C CB  . LYS A 1 61  ? 6.327   62.234   123.346 1.00 18.10 ? 143 LYS A CB  1 
ATOM   468   C CG  . LYS A 1 61  ? 7.564   61.691   122.670 1.00 16.91 ? 143 LYS A CG  1 
ATOM   469   C CD  . LYS A 1 61  ? 8.563   61.357   123.750 1.00 17.38 ? 143 LYS A CD  1 
ATOM   470   C CE  . LYS A 1 61  ? 9.909   61.068   123.142 1.00 17.64 ? 143 LYS A CE  1 
ATOM   471   N NZ  . LYS A 1 61  ? 10.956  60.927   124.173 1.00 16.33 ? 143 LYS A NZ  1 
ATOM   472   N N   . HIS A 1 62  ? 6.212   63.300   120.277 1.00 20.84 ? 144 HIS A N   1 
ATOM   473   C CA  . HIS A 1 62  ? 6.745   64.284   119.342 1.00 21.75 ? 144 HIS A CA  1 
ATOM   474   C C   . HIS A 1 62  ? 5.720   65.188   118.708 1.00 22.31 ? 144 HIS A C   1 
ATOM   475   O O   . HIS A 1 62  ? 6.039   66.040   117.883 1.00 21.29 ? 144 HIS A O   1 
ATOM   476   C CB  . HIS A 1 62  ? 7.522   63.582   118.264 1.00 19.38 ? 144 HIS A CB  1 
ATOM   477   C CG  . HIS A 1 62  ? 8.702   62.849   118.796 1.00 19.76 ? 144 HIS A CG  1 
ATOM   478   N ND1 . HIS A 1 62  ? 9.850   63.490   119.190 1.00 18.78 ? 144 HIS A ND1 1 
ATOM   479   C CD2 . HIS A 1 62  ? 8.887   61.536   119.060 1.00 19.56 ? 144 HIS A CD2 1 
ATOM   480   C CE1 . HIS A 1 62  ? 10.702  62.603   119.674 1.00 20.12 ? 144 HIS A CE1 1 
ATOM   481   N NE2 . HIS A 1 62  ? 10.140  61.412   119.606 1.00 20.06 ? 144 HIS A NE2 1 
ATOM   482   N N   . SER A 1 63  ? 4.482   65.005   119.117 1.00 22.78 ? 145 SER A N   1 
ATOM   483   C CA  . SER A 1 63  ? 3.393   65.781   118.587 1.00 24.35 ? 145 SER A CA  1 
ATOM   484   C C   . SER A 1 63  ? 3.206   66.993   119.468 1.00 25.73 ? 145 SER A C   1 
ATOM   485   O O   . SER A 1 63  ? 2.278   67.767   119.267 1.00 25.63 ? 145 SER A O   1 
ATOM   486   C CB  . SER A 1 63  ? 2.149   64.921   118.598 1.00 23.72 ? 145 SER A CB  1 
ATOM   487   O OG  . SER A 1 63  ? 1.000   65.691   118.404 1.00 25.63 ? 145 SER A OG  1 
ATOM   488   N N   . ASN A 1 64  ? 4.111   67.154   120.432 1.00 26.92 ? 146 ASN A N   1 
ATOM   489   C CA  . ASN A 1 64  ? 4.051   68.255   121.377 1.00 29.14 ? 146 ASN A CA  1 
ATOM   490   C C   . ASN A 1 64  ? 3.702   69.619   120.769 1.00 31.40 ? 146 ASN A C   1 
ATOM   491   O O   . ASN A 1 64  ? 2.719   69.733   120.046 1.00 35.76 ? 146 ASN A O   1 
ATOM   492   C CB  . ASN A 1 64  ? 5.351   68.344   122.175 1.00 28.58 ? 146 ASN A CB  1 
ATOM   493   C CG  . ASN A 1 64  ? 5.105   68.729   123.617 1.00 28.25 ? 146 ASN A CG  1 
ATOM   494   O OD1 . ASN A 1 64  ? 5.981   68.625   124.466 1.00 32.09 ? 146 ASN A OD1 1 
ATOM   495   N ND2 . ASN A 1 64  ? 3.898   69.177   123.898 1.00 28.39 ? 146 ASN A ND2 1 
ATOM   496   N N   . GLY A 1 65  ? 4.479   70.656   121.060 1.00 29.48 ? 147 GLY A N   1 
ATOM   497   C CA  . GLY A 1 65  ? 4.160   71.977   120.535 1.00 29.06 ? 147 GLY A CA  1 
ATOM   498   C C   . GLY A 1 65  ? 3.999   72.158   119.032 1.00 28.93 ? 147 GLY A C   1 
ATOM   499   O O   . GLY A 1 65  ? 4.566   73.088   118.459 1.00 27.69 ? 147 GLY A O   1 
ATOM   500   N N   . THR A 1 66  ? 3.214   71.293   118.398 1.00 28.93 ? 148 THR A N   1 
ATOM   501   C CA  . THR A 1 66  ? 2.984   71.349   116.960 1.00 30.72 ? 148 THR A CA  1 
ATOM   502   C C   . THR A 1 66  ? 2.120   72.546   116.553 1.00 32.32 ? 148 THR A C   1 
ATOM   503   O O   . THR A 1 66  ? 1.466   72.550   115.510 1.00 32.96 ? 148 THR A O   1 
ATOM   504   C CB  . THR A 1 66  ? 2.345   70.037   116.469 1.00 29.97 ? 148 THR A CB  1 
ATOM   505   O OG1 . THR A 1 66  ? 1.276   69.664   117.342 1.00 27.37 ? 148 THR A OG1 1 
ATOM   506   C CG2 . THR A 1 66  ? 3.379   68.930   116.451 1.00 29.61 ? 148 THR A CG2 1 
ATOM   507   N N   . VAL A 1 67  ? 2.146   73.576   117.385 1.00 34.07 ? 149 VAL A N   1 
ATOM   508   C CA  . VAL A 1 67  ? 1.387   74.783   117.123 1.00 34.56 ? 149 VAL A CA  1 
ATOM   509   C C   . VAL A 1 67  ? 2.317   75.885   116.625 1.00 34.64 ? 149 VAL A C   1 
ATOM   510   O O   . VAL A 1 67  ? 1.852   76.905   116.119 1.00 33.07 ? 149 VAL A O   1 
ATOM   511   C CB  . VAL A 1 67  ? 0.707   75.278   118.403 1.00 35.42 ? 149 VAL A CB  1 
ATOM   512   C CG1 . VAL A 1 67  ? -0.421  76.236   118.065 1.00 35.39 ? 149 VAL A CG1 1 
ATOM   513   C CG2 . VAL A 1 67  ? 0.204   74.098   119.190 1.00 39.00 ? 149 VAL A CG2 1 
ATOM   514   N N   . LYS A 1 68  ? 3.626   75.657   116.752 1.00 34.96 ? 150 LYS A N   1 
ATOM   515   C CA  . LYS A 1 68  ? 4.654   76.635   116.376 1.00 36.65 ? 150 LYS A CA  1 
ATOM   516   C C   . LYS A 1 68  ? 4.674   77.225   114.962 1.00 36.13 ? 150 LYS A C   1 
ATOM   517   O O   . LYS A 1 68  ? 5.222   78.317   114.767 1.00 38.05 ? 150 LYS A O   1 
ATOM   518   C CB  . LYS A 1 68  ? 6.051   76.086   116.704 1.00 37.94 ? 150 LYS A CB  1 
ATOM   519   C CG  . LYS A 1 68  ? 6.377   74.755   116.046 1.00 42.58 ? 150 LYS A CG  1 
ATOM   520   C CD  . LYS A 1 68  ? 7.768   74.263   116.445 1.00 44.14 ? 150 LYS A CD  1 
ATOM   521   C CE  . LYS A 1 68  ? 8.019   72.834   115.965 1.00 43.96 ? 150 LYS A CE  1 
ATOM   522   N NZ  . LYS A 1 68  ? 9.401   72.384   116.297 1.00 44.57 ? 150 LYS A NZ  1 
ATOM   523   N N   . ASP A 1 69  ? 4.092   76.533   113.988 1.00 32.40 ? 151 ASP A N   1 
ATOM   524   C CA  . ASP A 1 69  ? 4.071   77.024   112.605 1.00 29.85 ? 151 ASP A CA  1 
ATOM   525   C C   . ASP A 1 69  ? 5.261   76.587   111.778 1.00 27.16 ? 151 ASP A C   1 
ATOM   526   O O   . ASP A 1 69  ? 5.171   75.667   110.972 1.00 27.45 ? 151 ASP A O   1 
ATOM   527   C CB  . ASP A 1 69  ? 4.028   78.552   112.528 1.00 30.57 ? 151 ASP A CB  1 
ATOM   528   C CG  . ASP A 1 69  ? 2.629   79.098   112.546 1.00 33.24 ? 151 ASP A CG  1 
ATOM   529   O OD1 . ASP A 1 69  ? 1.773   78.515   111.854 1.00 34.72 ? 151 ASP A OD1 1 
ATOM   530   O OD2 . ASP A 1 69  ? 2.383   80.119   113.227 1.00 33.32 ? 151 ASP A OD2 1 
ATOM   531   N N   . ARG A 1 70  ? 6.379   77.274   111.971 1.00 24.66 ? 152 ARG A N   1 
ATOM   532   C CA  . ARG A 1 70  ? 7.587   76.992   111.207 1.00 23.84 ? 152 ARG A CA  1 
ATOM   533   C C   . ARG A 1 70  ? 8.675   76.252   111.995 1.00 23.80 ? 152 ARG A C   1 
ATOM   534   O O   . ARG A 1 70  ? 8.967   76.574   113.151 1.00 25.22 ? 152 ARG A O   1 
ATOM   535   C CB  . ARG A 1 70  ? 8.139   78.305   110.622 1.00 20.17 ? 152 ARG A CB  1 
ATOM   536   C CG  . ARG A 1 70  ? 7.115   79.092   109.788 1.00 18.08 ? 152 ARG A CG  1 
ATOM   537   C CD  . ARG A 1 70  ? 7.649   80.450   109.285 1.00 16.14 ? 152 ARG A CD  1 
ATOM   538   N NE  . ARG A 1 70  ? 7.933   81.440   110.330 1.00 11.59 ? 152 ARG A NE  1 
ATOM   539   C CZ  . ARG A 1 70  ? 7.027   81.994   111.136 1.00 11.15 ? 152 ARG A CZ  1 
ATOM   540   N NH1 . ARG A 1 70  ? 7.407   82.884   112.037 1.00 9.97  ? 152 ARG A NH1 1 
ATOM   541   N NH2 . ARG A 1 70  ? 5.749   81.660   111.056 1.00 9.14  ? 152 ARG A NH2 1 
ATOM   542   N N   . SER A 1 71  ? 9.259   75.247   111.350 1.00 22.13 ? 153 SER A N   1 
ATOM   543   C CA  . SER A 1 71  ? 10.313  74.435   111.944 1.00 21.10 ? 153 SER A CA  1 
ATOM   544   C C   . SER A 1 71  ? 11.014  73.629   110.850 1.00 20.20 ? 153 SER A C   1 
ATOM   545   O O   . SER A 1 71  ? 10.460  73.410   109.771 1.00 18.46 ? 153 SER A O   1 
ATOM   546   C CB  . SER A 1 71  ? 9.741   73.475   112.992 1.00 20.29 ? 153 SER A CB  1 
ATOM   547   O OG  . SER A 1 71  ? 9.638   72.152   112.487 1.00 22.31 ? 153 SER A OG  1 
ATOM   548   N N   . PRO A 1 72  ? 12.253  73.187   111.119 1.00 19.77 ? 154 PRO A N   1 
ATOM   549   C CA  . PRO A 1 72  ? 13.078  72.400   110.193 1.00 19.09 ? 154 PRO A CA  1 
ATOM   550   C C   . PRO A 1 72  ? 12.494  71.030   109.842 1.00 19.97 ? 154 PRO A C   1 
ATOM   551   O O   . PRO A 1 72  ? 12.870  70.440   108.830 1.00 21.37 ? 154 PRO A O   1 
ATOM   552   C CB  . PRO A 1 72  ? 14.400  72.260   110.943 1.00 18.68 ? 154 PRO A CB  1 
ATOM   553   C CG  . PRO A 1 72  ? 14.458  73.501   111.773 1.00 20.13 ? 154 PRO A CG  1 
ATOM   554   C CD  . PRO A 1 72  ? 13.047  73.625   112.284 1.00 19.33 ? 154 PRO A CD  1 
ATOM   555   N N   . HIS A 1 73  ? 11.580  70.538   110.678 1.00 19.09 ? 155 HIS A N   1 
ATOM   556   C CA  . HIS A 1 73  ? 10.965  69.219   110.496 1.00 19.11 ? 155 HIS A CA  1 
ATOM   557   C C   . HIS A 1 73  ? 9.682   69.227   109.677 1.00 19.11 ? 155 HIS A C   1 
ATOM   558   O O   . HIS A 1 73  ? 9.126   68.177   109.361 1.00 20.75 ? 155 HIS A O   1 
ATOM   559   C CB  . HIS A 1 73  ? 10.673  68.612   111.866 1.00 18.06 ? 155 HIS A CB  1 
ATOM   560   C CG  . HIS A 1 73  ? 11.810  68.741   112.825 1.00 16.37 ? 155 HIS A CG  1 
ATOM   561   N ND1 . HIS A 1 73  ? 11.669  69.298   114.078 1.00 15.19 ? 155 HIS A ND1 1 
ATOM   562   C CD2 . HIS A 1 73  ? 13.120  68.427   112.697 1.00 15.11 ? 155 HIS A CD2 1 
ATOM   563   C CE1 . HIS A 1 73  ? 12.844  69.326   114.679 1.00 14.48 ? 155 HIS A CE1 1 
ATOM   564   N NE2 . HIS A 1 73  ? 13.742  68.804   113.862 1.00 14.98 ? 155 HIS A NE2 1 
ATOM   565   N N   . ARG A 1 74  ? 9.207   70.415   109.346 1.00 19.43 ? 156 ARG A N   1 
ATOM   566   C CA  . ARG A 1 74  ? 7.985   70.572   108.571 1.00 19.90 ? 156 ARG A CA  1 
ATOM   567   C C   . ARG A 1 74  ? 8.232   70.072   107.131 1.00 18.64 ? 156 ARG A C   1 
ATOM   568   O O   . ARG A 1 74  ? 9.210   70.470   106.497 1.00 18.36 ? 156 ARG A O   1 
ATOM   569   C CB  . ARG A 1 74  ? 7.617   72.058   108.564 1.00 22.63 ? 156 ARG A CB  1 
ATOM   570   C CG  . ARG A 1 74  ? 6.164   72.385   108.712 1.00 24.33 ? 156 ARG A CG  1 
ATOM   571   C CD  . ARG A 1 74  ? 5.682   72.321   110.137 1.00 24.77 ? 156 ARG A CD  1 
ATOM   572   N NE  . ARG A 1 74  ? 4.238   72.086   110.131 1.00 28.72 ? 156 ARG A NE  1 
ATOM   573   C CZ  . ARG A 1 74  ? 3.330   72.984   109.768 1.00 28.59 ? 156 ARG A CZ  1 
ATOM   574   N NH1 . ARG A 1 74  ? 2.039   72.670   109.784 1.00 28.23 ? 156 ARG A NH1 1 
ATOM   575   N NH2 . ARG A 1 74  ? 3.710   74.203   109.415 1.00 31.69 ? 156 ARG A NH2 1 
ATOM   576   N N   . THR A 1 75  ? 7.365   69.196   106.623 1.00 16.36 ? 157 THR A N   1 
ATOM   577   C CA  . THR A 1 75  ? 7.518   68.683   105.264 1.00 14.26 ? 157 THR A CA  1 
ATOM   578   C C   . THR A 1 75  ? 6.207   68.588   104.490 1.00 14.29 ? 157 THR A C   1 
ATOM   579   O O   . THR A 1 75  ? 5.146   68.326   105.060 1.00 15.55 ? 157 THR A O   1 
ATOM   580   C CB  . THR A 1 75  ? 8.172   67.287   105.239 1.00 14.42 ? 157 THR A CB  1 
ATOM   581   O OG1 . THR A 1 75  ? 7.309   66.338   105.875 1.00 12.21 ? 157 THR A OG1 1 
ATOM   582   C CG2 . THR A 1 75  ? 9.521   67.314   105.937 1.00 14.38 ? 157 THR A CG2 1 
ATOM   583   N N   . LEU A 1 76  ? 6.303   68.798   103.182 1.00 12.76 ? 158 LEU A N   1 
ATOM   584   C CA  . LEU A 1 76  ? 5.163   68.748   102.275 1.00 11.52 ? 158 LEU A CA  1 
ATOM   585   C C   . LEU A 1 76  ? 5.029   67.345   101.708 1.00 12.41 ? 158 LEU A C   1 
ATOM   586   O O   . LEU A 1 76  ? 5.946   66.839   101.060 1.00 12.17 ? 158 LEU A O   1 
ATOM   587   C CB  . LEU A 1 76  ? 5.369   69.733   101.123 1.00 10.49 ? 158 LEU A CB  1 
ATOM   588   C CG  . LEU A 1 76  ? 4.335   69.698   100.002 1.00 9.44  ? 158 LEU A CG  1 
ATOM   589   C CD1 . LEU A 1 76  ? 3.004   70.145   100.554 1.00 9.91  ? 158 LEU A CD1 1 
ATOM   590   C CD2 . LEU A 1 76  ? 4.767   70.595   98.855  1.00 9.64  ? 158 LEU A CD2 1 
ATOM   591   N N   . MET A 1 77  ? 3.883   66.720   101.949 1.00 12.21 ? 159 MET A N   1 
ATOM   592   C CA  . MET A 1 77  ? 3.642   65.369   101.455 1.00 12.43 ? 159 MET A CA  1 
ATOM   593   C C   . MET A 1 77  ? 2.235   65.263   100.883 1.00 12.54 ? 159 MET A C   1 
ATOM   594   O O   . MET A 1 77  ? 1.434   66.184   101.043 1.00 11.04 ? 159 MET A O   1 
ATOM   595   C CB  . MET A 1 77  ? 3.846   64.364   102.588 1.00 12.43 ? 159 MET A CB  1 
ATOM   596   C CG  . MET A 1 77  ? 5.265   64.377   103.135 1.00 14.11 ? 159 MET A CG  1 
ATOM   597   S SD  . MET A 1 77  ? 5.577   63.201   104.483 1.00 15.72 ? 159 MET A SD  1 
ATOM   598   C CE  . MET A 1 77  ? 6.136   61.769   103.587 1.00 15.45 ? 159 MET A CE  1 
ATOM   599   N N   . SER A 1 78  ? 1.934   64.152   100.211 1.00 12.65 ? 160 SER A N   1 
ATOM   600   C CA  . SER A 1 78  ? 0.607   63.976   99.623  1.00 13.42 ? 160 SER A CA  1 
ATOM   601   C C   . SER A 1 78  ? 0.123   62.534   99.560  1.00 13.89 ? 160 SER A C   1 
ATOM   602   O O   . SER A 1 78  ? 0.909   61.596   99.607  1.00 16.26 ? 160 SER A O   1 
ATOM   603   C CB  . SER A 1 78  ? 0.567   64.576   98.208  1.00 14.35 ? 160 SER A CB  1 
ATOM   604   O OG  . SER A 1 78  ? 1.421   63.880   97.308  1.00 13.57 ? 160 SER A OG  1 
ATOM   605   N N   . CYS A 1 79  ? -1.189  62.374   99.454  1.00 13.60 ? 161 CYS A N   1 
ATOM   606   C CA  . CYS A 1 79  ? -1.816  61.065   99.352  1.00 14.96 ? 161 CYS A CA  1 
ATOM   607   C C   . CYS A 1 79  ? -3.140  61.245   98.626  1.00 13.94 ? 161 CYS A C   1 
ATOM   608   O O   . CYS A 1 79  ? -3.607  62.366   98.445  1.00 13.94 ? 161 CYS A O   1 
ATOM   609   C CB  . CYS A 1 79  ? -2.053  60.463   100.739 1.00 15.56 ? 161 CYS A CB  1 
ATOM   610   S SG  . CYS A 1 79  ? -3.216  61.368   101.776 1.00 17.03 ? 161 CYS A SG  1 
ATOM   611   N N   . PRO A 1 80  ? -3.751  60.149   98.172  1.00 14.12 ? 162 PRO A N   1 
ATOM   612   C CA  . PRO A 1 80  ? -5.031  60.299   97.468  1.00 15.73 ? 162 PRO A CA  1 
ATOM   613   C C   . PRO A 1 80  ? -6.146  60.873   98.345  1.00 15.28 ? 162 PRO A C   1 
ATOM   614   O O   . PRO A 1 80  ? -6.218  60.586   99.541  1.00 16.13 ? 162 PRO A O   1 
ATOM   615   C CB  . PRO A 1 80  ? -5.324  58.876   96.966  1.00 14.12 ? 162 PRO A CB  1 
ATOM   616   C CG  . PRO A 1 80  ? -4.534  58.006   97.875  1.00 14.50 ? 162 PRO A CG  1 
ATOM   617   C CD  . PRO A 1 80  ? -3.256  58.770   98.068  1.00 14.22 ? 162 PRO A CD  1 
ATOM   618   N N   . VAL A 1 81  ? -7.005  61.693   97.744  1.00 15.09 ? 163 VAL A N   1 
ATOM   619   C CA  . VAL A 1 81  ? -8.106  62.312   98.477  1.00 16.49 ? 163 VAL A CA  1 
ATOM   620   C C   . VAL A 1 81  ? -8.956  61.327   99.265  1.00 16.24 ? 163 VAL A C   1 
ATOM   621   O O   . VAL A 1 81  ? -9.288  60.246   98.784  1.00 15.60 ? 163 VAL A O   1 
ATOM   622   C CB  . VAL A 1 81  ? -9.050  63.106   97.542  1.00 15.94 ? 163 VAL A CB  1 
ATOM   623   C CG1 . VAL A 1 81  ? -8.470  64.469   97.259  1.00 16.20 ? 163 VAL A CG1 1 
ATOM   624   C CG2 . VAL A 1 81  ? -9.257  62.351   96.250  1.00 16.55 ? 163 VAL A CG2 1 
ATOM   625   N N   . GLY A 1 82  ? -9.303  61.716   100.485 1.00 15.93 ? 164 GLY A N   1 
ATOM   626   C CA  . GLY A 1 82  ? -10.128 60.872   101.328 1.00 16.32 ? 164 GLY A CA  1 
ATOM   627   C C   . GLY A 1 82  ? -9.346  59.985   102.275 1.00 16.33 ? 164 GLY A C   1 
ATOM   628   O O   . GLY A 1 82  ? -9.886  59.512   103.280 1.00 15.96 ? 164 GLY A O   1 
ATOM   629   N N   . GLU A 1 83  ? -8.074  59.760   101.964 1.00 16.52 ? 165 GLU A N   1 
ATOM   630   C CA  . GLU A 1 83  ? -7.233  58.916   102.799 1.00 16.59 ? 165 GLU A CA  1 
ATOM   631   C C   . GLU A 1 83  ? -6.550  59.699   103.912 1.00 16.59 ? 165 GLU A C   1 
ATOM   632   O O   . GLU A 1 83  ? -6.176  60.859   103.738 1.00 17.31 ? 165 GLU A O   1 
ATOM   633   C CB  . GLU A 1 83  ? -6.179  58.212   101.941 1.00 16.72 ? 165 GLU A CB  1 
ATOM   634   C CG  . GLU A 1 83  ? -6.735  57.090   101.090 1.00 19.33 ? 165 GLU A CG  1 
ATOM   635   C CD  . GLU A 1 83  ? -5.690  56.483   100.184 1.00 20.82 ? 165 GLU A CD  1 
ATOM   636   O OE1 . GLU A 1 83  ? -4.503  56.483   100.572 1.00 22.85 ? 165 GLU A OE1 1 
ATOM   637   O OE2 . GLU A 1 83  ? -6.051  55.999   99.091  1.00 22.37 ? 165 GLU A OE2 1 
ATOM   638   N N   . ALA A 1 84  ? -6.401  59.065   105.065 1.00 16.31 ? 166 ALA A N   1 
ATOM   639   C CA  . ALA A 1 84  ? -5.740  59.712   106.189 1.00 17.13 ? 166 ALA A CA  1 
ATOM   640   C C   . ALA A 1 84  ? -4.246  59.758   105.871 1.00 17.18 ? 166 ALA A C   1 
ATOM   641   O O   . ALA A 1 84  ? -3.673  58.768   105.432 1.00 16.83 ? 166 ALA A O   1 
ATOM   642   C CB  . ALA A 1 84  ? -5.984  58.921   107.470 1.00 14.37 ? 166 ALA A CB  1 
ATOM   643   N N   . PRO A 1 85  ? -3.601  60.916   106.072 1.00 18.06 ? 167 PRO A N   1 
ATOM   644   C CA  . PRO A 1 85  ? -2.167  61.033   105.791 1.00 18.13 ? 167 PRO A CA  1 
ATOM   645   C C   . PRO A 1 85  ? -1.329  60.210   106.770 1.00 18.51 ? 167 PRO A C   1 
ATOM   646   O O   . PRO A 1 85  ? -1.409  60.388   107.991 1.00 19.87 ? 167 PRO A O   1 
ATOM   647   C CB  . PRO A 1 85  ? -1.917  62.533   105.901 1.00 18.19 ? 167 PRO A CB  1 
ATOM   648   C CG  . PRO A 1 85  ? -2.911  62.958   106.930 1.00 18.93 ? 167 PRO A CG  1 
ATOM   649   C CD  . PRO A 1 85  ? -4.155  62.204   106.518 1.00 17.97 ? 167 PRO A CD  1 
ATOM   650   N N   . SER A 1 86  ? -0.531  59.303   106.218 1.00 18.19 ? 168 SER A N   1 
ATOM   651   C CA  . SER A 1 86  ? 0.314   58.415   107.002 1.00 16.81 ? 168 SER A CA  1 
ATOM   652   C C   . SER A 1 86  ? 1.625   58.155   106.283 1.00 17.05 ? 168 SER A C   1 
ATOM   653   O O   . SER A 1 86  ? 1.734   58.369   105.083 1.00 17.56 ? 168 SER A O   1 
ATOM   654   C CB  . SER A 1 86  ? -0.416  57.093   107.225 1.00 17.20 ? 168 SER A CB  1 
ATOM   655   O OG  . SER A 1 86  ? 0.484   56.000   107.223 1.00 17.34 ? 168 SER A OG  1 
ATOM   656   N N   . PRO A 1 87  ? 2.645   57.687   107.017 1.00 17.76 ? 169 PRO A N   1 
ATOM   657   C CA  . PRO A 1 87  ? 3.961   57.388   106.457 1.00 16.84 ? 169 PRO A CA  1 
ATOM   658   C C   . PRO A 1 87  ? 3.908   56.133   105.603 1.00 16.72 ? 169 PRO A C   1 
ATOM   659   O O   . PRO A 1 87  ? 4.902   55.736   104.994 1.00 19.79 ? 169 PRO A O   1 
ATOM   660   C CB  . PRO A 1 87  ? 4.810   57.191   107.698 1.00 18.24 ? 169 PRO A CB  1 
ATOM   661   C CG  . PRO A 1 87  ? 3.834   56.543   108.644 1.00 18.22 ? 169 PRO A CG  1 
ATOM   662   C CD  . PRO A 1 87  ? 2.630   57.427   108.468 1.00 18.74 ? 169 PRO A CD  1 
ATOM   663   N N   . TYR A 1 88  A 2.737   55.514   105.558 1.00 14.35 ? 169 TYR A N   1 
ATOM   664   C CA  . TYR A 1 88  A 2.552   54.291   104.802 1.00 13.55 ? 169 TYR A CA  1 
ATOM   665   C C   . TYR A 1 88  A 1.834   54.558   103.493 1.00 13.83 ? 169 TYR A C   1 
ATOM   666   O O   . TYR A 1 88  A 1.915   53.766   102.560 1.00 13.20 ? 169 TYR A O   1 
ATOM   667   C CB  . TYR A 1 88  A 1.748   53.287   105.636 1.00 11.83 ? 169 TYR A CB  1 
ATOM   668   C CG  . TYR A 1 88  A 2.282   53.094   107.044 1.00 13.24 ? 169 TYR A CG  1 
ATOM   669   C CD1 . TYR A 1 88  A 1.422   52.747   108.091 1.00 13.30 ? 169 TYR A CD1 1 
ATOM   670   C CD2 . TYR A 1 88  A 3.640   53.285   107.340 1.00 11.45 ? 169 TYR A CD2 1 
ATOM   671   C CE1 . TYR A 1 88  A 1.892   52.603   109.389 1.00 11.97 ? 169 TYR A CE1 1 
ATOM   672   C CE2 . TYR A 1 88  A 4.118   53.142   108.634 1.00 10.85 ? 169 TYR A CE2 1 
ATOM   673   C CZ  . TYR A 1 88  A 3.237   52.802   109.654 1.00 12.54 ? 169 TYR A CZ  1 
ATOM   674   O OH  . TYR A 1 88  A 3.691   52.654   110.942 1.00 13.81 ? 169 TYR A OH  1 
ATOM   675   N N   . ASN A 1 89  ? 1.129   55.679   103.416 1.00 14.72 ? 170 ASN A N   1 
ATOM   676   C CA  . ASN A 1 89  ? 0.392   55.996   102.204 1.00 14.49 ? 170 ASN A CA  1 
ATOM   677   C C   . ASN A 1 89  ? 0.765   57.346   101.605 1.00 14.78 ? 170 ASN A C   1 
ATOM   678   O O   . ASN A 1 89  ? 0.175   57.760   100.609 1.00 15.13 ? 170 ASN A O   1 
ATOM   679   C CB  . ASN A 1 89  ? -1.114  55.950   102.497 1.00 13.54 ? 170 ASN A CB  1 
ATOM   680   C CG  . ASN A 1 89  ? -1.639  57.229   103.140 1.00 14.47 ? 170 ASN A CG  1 
ATOM   681   O OD1 . ASN A 1 89  ? -0.953  57.881   103.915 1.00 12.69 ? 170 ASN A OD1 1 
ATOM   682   N ND2 . ASN A 1 89  ? -2.880  57.574   102.825 1.00 16.36 ? 170 ASN A ND2 1 
ATOM   683   N N   . SER A 1 90  ? 1.758   58.015   102.191 1.00 14.96 ? 171 SER A N   1 
ATOM   684   C CA  . SER A 1 90  ? 2.155   59.342   101.724 1.00 15.74 ? 171 SER A CA  1 
ATOM   685   C C   . SER A 1 90  ? 3.406   59.482   100.877 1.00 16.29 ? 171 SER A C   1 
ATOM   686   O O   . SER A 1 90  ? 4.470   58.951   101.201 1.00 16.68 ? 171 SER A O   1 
ATOM   687   C CB  . SER A 1 90  ? 2.278   60.294   102.913 1.00 15.80 ? 171 SER A CB  1 
ATOM   688   O OG  . SER A 1 90  ? 1.006   60.585   103.455 1.00 13.97 ? 171 SER A OG  1 
ATOM   689   N N   . ARG A 1 91  ? 3.264   60.225   99.789  1.00 15.46 ? 172 ARG A N   1 
ATOM   690   C CA  . ARG A 1 91  ? 4.375   60.488   98.898  1.00 15.65 ? 172 ARG A CA  1 
ATOM   691   C C   . ARG A 1 91  ? 5.103   61.709   99.443  1.00 14.88 ? 172 ARG A C   1 
ATOM   692   O O   . ARG A 1 91  ? 4.458   62.670   99.857  1.00 15.76 ? 172 ARG A O   1 
ATOM   693   C CB  . ARG A 1 91  ? 3.861   60.801   97.497  1.00 18.25 ? 172 ARG A CB  1 
ATOM   694   C CG  . ARG A 1 91  ? 4.953   61.282   96.557  1.00 24.32 ? 172 ARG A CG  1 
ATOM   695   C CD  . ARG A 1 91  ? 4.385   61.876   95.287  1.00 27.91 ? 172 ARG A CD  1 
ATOM   696   N NE  . ARG A 1 91  ? 3.642   60.907   94.489  1.00 31.75 ? 172 ARG A NE  1 
ATOM   697   C CZ  . ARG A 1 91  ? 2.870   61.250   93.461  1.00 35.48 ? 172 ARG A CZ  1 
ATOM   698   N NH1 . ARG A 1 91  ? 2.220   60.314   92.765  1.00 36.39 ? 172 ARG A NH1 1 
ATOM   699   N NH2 . ARG A 1 91  ? 2.735   62.539   93.137  1.00 36.25 ? 172 ARG A NH2 1 
ATOM   700   N N   . PHE A 1 92  ? 6.431   61.680   99.464  1.00 13.97 ? 173 PHE A N   1 
ATOM   701   C CA  . PHE A 1 92  ? 7.177   62.843   99.941  1.00 14.19 ? 173 PHE A CA  1 
ATOM   702   C C   . PHE A 1 92  ? 7.262   63.827   98.776  1.00 15.27 ? 173 PHE A C   1 
ATOM   703   O O   . PHE A 1 92  ? 7.448   63.418   97.629  1.00 16.03 ? 173 PHE A O   1 
ATOM   704   C CB  . PHE A 1 92  ? 8.593   62.477   100.378 1.00 11.87 ? 173 PHE A CB  1 
ATOM   705   C CG  . PHE A 1 92  ? 9.394   63.658   100.856 1.00 12.10 ? 173 PHE A CG  1 
ATOM   706   C CD1 . PHE A 1 92  ? 9.288   64.107   102.172 1.00 12.60 ? 173 PHE A CD1 1 
ATOM   707   C CD2 . PHE A 1 92  ? 10.223  64.355   99.978  1.00 9.95  ? 173 PHE A CD2 1 
ATOM   708   C CE1 . PHE A 1 92  ? 10.001  65.241   102.606 1.00 12.52 ? 173 PHE A CE1 1 
ATOM   709   C CE2 . PHE A 1 92  ? 10.934  65.484   100.401 1.00 10.21 ? 173 PHE A CE2 1 
ATOM   710   C CZ  . PHE A 1 92  ? 10.825  65.928   101.713 1.00 11.44 ? 173 PHE A CZ  1 
ATOM   711   N N   . GLU A 1 93  ? 7.136   65.117   99.068  1.00 14.59 ? 174 GLU A N   1 
ATOM   712   C CA  . GLU A 1 93  ? 7.180   66.126   98.026  1.00 15.86 ? 174 GLU A CA  1 
ATOM   713   C C   . GLU A 1 93  ? 8.316   67.129   98.207  1.00 16.68 ? 174 GLU A C   1 
ATOM   714   O O   . GLU A 1 93  ? 9.098   67.364   97.280  1.00 16.53 ? 174 GLU A O   1 
ATOM   715   C CB  . GLU A 1 93  ? 5.843   66.863   97.976  1.00 15.82 ? 174 GLU A CB  1 
ATOM   716   C CG  . GLU A 1 93  ? 4.637   65.944   97.799  1.00 19.64 ? 174 GLU A CG  1 
ATOM   717   C CD  . GLU A 1 93  ? 4.461   65.452   96.368  1.00 20.00 ? 174 GLU A CD  1 
ATOM   718   O OE1 . GLU A 1 93  ? 3.522   64.663   96.116  1.00 20.92 ? 174 GLU A OE1 1 
ATOM   719   O OE2 . GLU A 1 93  ? 5.256   65.862   95.493  1.00 21.74 ? 174 GLU A OE2 1 
ATOM   720   N N   . SER A 1 94  ? 8.414   67.720   99.395  1.00 15.95 ? 175 SER A N   1 
ATOM   721   C CA  . SER A 1 94  ? 9.463   68.702   99.638  1.00 16.43 ? 175 SER A CA  1 
ATOM   722   C C   . SER A 1 94  ? 9.549   69.084   101.113 1.00 15.99 ? 175 SER A C   1 
ATOM   723   O O   . SER A 1 94  ? 8.646   68.774   101.887 1.00 16.16 ? 175 SER A O   1 
ATOM   724   C CB  . SER A 1 94  ? 9.192   69.953   98.787  1.00 15.73 ? 175 SER A CB  1 
ATOM   725   O OG  . SER A 1 94  ? 10.357  70.750   98.652  1.00 18.70 ? 175 SER A OG  1 
ATOM   726   N N   . VAL A 1 95  ? 10.646  69.733   101.504 1.00 14.56 ? 176 VAL A N   1 
ATOM   727   C CA  . VAL A 1 95  ? 10.814  70.185   102.885 1.00 14.64 ? 176 VAL A CA  1 
ATOM   728   C C   . VAL A 1 95  ? 10.205  71.589   102.921 1.00 14.61 ? 176 VAL A C   1 
ATOM   729   O O   . VAL A 1 95  ? 10.632  72.470   102.169 1.00 14.91 ? 176 VAL A O   1 
ATOM   730   C CB  . VAL A 1 95  ? 12.305  70.277   103.290 1.00 14.07 ? 176 VAL A CB  1 
ATOM   731   C CG1 . VAL A 1 95  ? 12.412  70.792   104.707 1.00 12.39 ? 176 VAL A CG1 1 
ATOM   732   C CG2 . VAL A 1 95  ? 12.987  68.908   103.162 1.00 12.09 ? 176 VAL A CG2 1 
ATOM   733   N N   . ALA A 1 96  ? 9.206   71.805   103.774 1.00 13.74 ? 177 ALA A N   1 
ATOM   734   C CA  . ALA A 1 96  ? 8.581   73.117   103.808 1.00 13.52 ? 177 ALA A CA  1 
ATOM   735   C C   . ALA A 1 96  ? 7.637   73.420   104.959 1.00 14.47 ? 177 ALA A C   1 
ATOM   736   O O   . ALA A 1 96  ? 6.999   72.525   105.520 1.00 14.07 ? 177 ALA A O   1 
ATOM   737   C CB  . ALA A 1 96  ? 7.841   73.336   102.512 1.00 13.42 ? 177 ALA A CB  1 
ATOM   738   N N   . TRP A 1 97  ? 7.552   74.701   105.301 1.00 12.76 ? 178 TRP A N   1 
ATOM   739   C CA  . TRP A 1 97  ? 6.623   75.138   106.323 1.00 14.37 ? 178 TRP A CA  1 
ATOM   740   C C   . TRP A 1 97  ? 5.613   76.071   105.651 1.00 14.73 ? 178 TRP A C   1 
ATOM   741   O O   . TRP A 1 97  ? 4.874   76.804   106.303 1.00 15.75 ? 178 TRP A O   1 
ATOM   742   C CB  . TRP A 1 97  ? 7.330   75.819   107.519 1.00 15.18 ? 178 TRP A CB  1 
ATOM   743   C CG  . TRP A 1 97  ? 8.476   76.752   107.229 1.00 16.55 ? 178 TRP A CG  1 
ATOM   744   C CD1 . TRP A 1 97  ? 9.800   76.525   107.488 1.00 17.15 ? 178 TRP A CD1 1 
ATOM   745   C CD2 . TRP A 1 97  ? 8.401   78.065   106.659 1.00 17.97 ? 178 TRP A CD2 1 
ATOM   746   N NE1 . TRP A 1 97  ? 10.553  77.611   107.116 1.00 17.58 ? 178 TRP A NE1 1 
ATOM   747   C CE2 . TRP A 1 97  ? 9.722   78.572   106.602 1.00 18.01 ? 178 TRP A CE2 1 
ATOM   748   C CE3 . TRP A 1 97  ? 7.349   78.863   106.186 1.00 17.54 ? 178 TRP A CE3 1 
ATOM   749   C CZ2 . TRP A 1 97  ? 10.019  79.841   106.091 1.00 16.69 ? 178 TRP A CZ2 1 
ATOM   750   C CZ3 . TRP A 1 97  ? 7.645   80.125   105.673 1.00 18.26 ? 178 TRP A CZ3 1 
ATOM   751   C CH2 . TRP A 1 97  ? 8.972   80.599   105.630 1.00 18.07 ? 178 TRP A CH2 1 
ATOM   752   N N   . SER A 1 98  ? 5.594   76.018   104.323 1.00 15.21 ? 179 SER A N   1 
ATOM   753   C CA  . SER A 1 98  ? 4.683   76.811   103.502 1.00 14.69 ? 179 SER A CA  1 
ATOM   754   C C   . SER A 1 98  ? 4.796   76.248   102.081 1.00 15.08 ? 179 SER A C   1 
ATOM   755   O O   . SER A 1 98  ? 5.909   76.085   101.576 1.00 16.07 ? 179 SER A O   1 
ATOM   756   C CB  . SER A 1 98  ? 5.091   78.287   103.528 1.00 14.20 ? 179 SER A CB  1 
ATOM   757   O OG  . SER A 1 98  ? 4.072   79.110   102.984 1.00 12.31 ? 179 SER A OG  1 
ATOM   758   N N   . ALA A 1 99  ? 3.663   75.957   101.436 1.00 14.15 ? 180 ALA A N   1 
ATOM   759   C CA  . ALA A 1 99  ? 3.697   75.365   100.099 1.00 14.26 ? 180 ALA A CA  1 
ATOM   760   C C   . ALA A 1 99  ? 2.550   75.663   99.142  1.00 14.78 ? 180 ALA A C   1 
ATOM   761   O O   . ALA A 1 99  ? 1.605   76.387   99.452  1.00 15.64 ? 180 ALA A O   1 
ATOM   762   C CB  . ALA A 1 99  ? 3.833   73.860   100.224 1.00 14.35 ? 180 ALA A CB  1 
ATOM   763   N N   . SER A 1 100 ? 2.665   75.069   97.961  1.00 14.71 ? 181 SER A N   1 
ATOM   764   C CA  . SER A 1 100 ? 1.672   75.187   96.905  1.00 16.39 ? 181 SER A CA  1 
ATOM   765   C C   . SER A 1 100 ? 2.019   74.110   95.893  1.00 17.26 ? 181 SER A C   1 
ATOM   766   O O   . SER A 1 100 ? 3.134   73.581   95.923  1.00 17.76 ? 181 SER A O   1 
ATOM   767   C CB  . SER A 1 100 ? 1.739   76.566   96.241  1.00 16.73 ? 181 SER A CB  1 
ATOM   768   O OG  . SER A 1 100 ? 0.825   76.649   95.164  1.00 15.59 ? 181 SER A OG  1 
ATOM   769   N N   . ALA A 1 101 ? 1.071   73.775   95.013  1.00 17.66 ? 182 ALA A N   1 
ATOM   770   C CA  . ALA A 1 101 ? 1.300   72.762   93.979  1.00 16.85 ? 182 ALA A CA  1 
ATOM   771   C C   . ALA A 1 101 ? 0.155   72.692   92.979  1.00 16.50 ? 182 ALA A C   1 
ATOM   772   O O   . ALA A 1 101 ? -0.989  72.993   93.313  1.00 17.67 ? 182 ALA A O   1 
ATOM   773   C CB  . ALA A 1 101 ? 1.506   71.398   94.618  1.00 16.60 ? 182 ALA A CB  1 
ATOM   774   N N   . CYS A 1 102 ? 0.478   72.308   91.747  1.00 16.55 ? 183 CYS A N   1 
ATOM   775   C CA  . CYS A 1 102 ? -0.517  72.163   90.681  1.00 17.23 ? 183 CYS A CA  1 
ATOM   776   C C   . CYS A 1 102 ? 0.039   71.295   89.557  1.00 16.74 ? 183 CYS A C   1 
ATOM   777   O O   . CYS A 1 102 ? 1.255   71.215   89.377  1.00 16.65 ? 183 CYS A O   1 
ATOM   778   C CB  . CYS A 1 102 ? -0.942  73.534   90.133  1.00 18.35 ? 183 CYS A CB  1 
ATOM   779   S SG  . CYS A 1 102 ? 0.437   74.657   89.757  1.00 19.85 ? 183 CYS A SG  1 
ATOM   780   N N   . HIS A 1 103 ? -0.856  70.630   88.827  1.00 16.65 ? 184 HIS A N   1 
ATOM   781   C CA  . HIS A 1 103 ? -0.480  69.751   87.714  1.00 16.62 ? 184 HIS A CA  1 
ATOM   782   C C   . HIS A 1 103 ? -0.830  70.447   86.398  1.00 17.43 ? 184 HIS A C   1 
ATOM   783   O O   . HIS A 1 103 ? -1.959  70.901   86.224  1.00 17.68 ? 184 HIS A O   1 
ATOM   784   C CB  . HIS A 1 103 ? -1.235  68.421   87.825  1.00 15.68 ? 184 HIS A CB  1 
ATOM   785   C CG  . HIS A 1 103 ? -0.647  67.316   86.995  1.00 15.85 ? 184 HIS A CG  1 
ATOM   786   N ND1 . HIS A 1 103 ? 0.017   66.237   87.549  1.00 12.45 ? 184 HIS A ND1 1 
ATOM   787   C CD2 . HIS A 1 103 ? -0.603  67.129   85.654  1.00 13.21 ? 184 HIS A CD2 1 
ATOM   788   C CE1 . HIS A 1 103 ? 0.441   65.442   86.587  1.00 12.37 ? 184 HIS A CE1 1 
ATOM   789   N NE2 . HIS A 1 103 ? 0.080   65.960   85.425  1.00 11.38 ? 184 HIS A NE2 1 
ATOM   790   N N   . ASP A 1 104 ? 0.127   70.520   85.473  1.00 18.02 ? 185 ASP A N   1 
ATOM   791   C CA  . ASP A 1 104 ? -0.088  71.207   84.192  1.00 18.48 ? 185 ASP A CA  1 
ATOM   792   C C   . ASP A 1 104 ? -0.532  70.324   83.040  1.00 18.85 ? 185 ASP A C   1 
ATOM   793   O O   . ASP A 1 104 ? -0.493  70.745   81.883  1.00 19.77 ? 185 ASP A O   1 
ATOM   794   C CB  . ASP A 1 104 ? 1.188   71.927   83.758  1.00 18.12 ? 185 ASP A CB  1 
ATOM   795   C CG  . ASP A 1 104 ? 2.287   70.961   83.320  1.00 19.36 ? 185 ASP A CG  1 
ATOM   796   O OD1 . ASP A 1 104 ? 2.087   69.727   83.403  1.00 22.51 ? 185 ASP A OD1 1 
ATOM   797   O OD2 . ASP A 1 104 ? 3.358   71.433   82.891  1.00 19.12 ? 185 ASP A OD2 1 
ATOM   798   N N   . GLY A 1 105 ? -0.946  69.104   83.345  1.00 19.50 ? 186 GLY A N   1 
ATOM   799   C CA  . GLY A 1 105 ? -1.363  68.196   82.292  1.00 19.99 ? 186 GLY A CA  1 
ATOM   800   C C   . GLY A 1 105 ? -0.292  67.150   82.038  1.00 20.02 ? 186 GLY A C   1 
ATOM   801   O O   . GLY A 1 105 ? -0.596  66.033   81.623  1.00 19.56 ? 186 GLY A O   1 
ATOM   802   N N   . THR A 1 106 ? 0.964   67.512   82.301  1.00 19.63 ? 187 THR A N   1 
ATOM   803   C CA  . THR A 1 106 ? 2.074   66.596   82.097  1.00 19.77 ? 187 THR A CA  1 
ATOM   804   C C   . THR A 1 106 ? 2.663   66.112   83.430  1.00 20.52 ? 187 THR A C   1 
ATOM   805   O O   . THR A 1 106 ? 2.736   64.905   83.681  1.00 20.76 ? 187 THR A O   1 
ATOM   806   C CB  . THR A 1 106 ? 3.197   67.259   81.237  1.00 20.36 ? 187 THR A CB  1 
ATOM   807   O OG1 . THR A 1 106 ? 2.702   67.523   79.919  1.00 17.91 ? 187 THR A OG1 1 
ATOM   808   C CG2 . THR A 1 106 ? 4.413   66.343   81.126  1.00 18.53 ? 187 THR A CG2 1 
ATOM   809   N N   . SER A 1 107 ? 3.090   67.041   84.282  1.00 19.43 ? 188 SER A N   1 
ATOM   810   C CA  . SER A 1 107 ? 3.674   66.654   85.561  1.00 18.54 ? 188 SER A CA  1 
ATOM   811   C C   . SER A 1 107 ? 3.284   67.596   86.684  1.00 18.42 ? 188 SER A C   1 
ATOM   812   O O   . SER A 1 107 ? 2.775   68.705   86.452  1.00 17.95 ? 188 SER A O   1 
ATOM   813   C CB  . SER A 1 107 ? 5.200   66.605   85.460  1.00 20.57 ? 188 SER A CB  1 
ATOM   814   O OG  . SER A 1 107 ? 5.733   67.884   85.167  1.00 20.00 ? 188 SER A OG  1 
ATOM   815   N N   . TRP A 1 108 ? 3.542   67.140   87.906  1.00 16.60 ? 189 TRP A N   1 
ATOM   816   C CA  . TRP A 1 108 ? 3.257   67.914   89.100  1.00 14.42 ? 189 TRP A CA  1 
ATOM   817   C C   . TRP A 1 108 ? 4.303   68.974   89.347  1.00 14.89 ? 189 TRP A C   1 
ATOM   818   O O   . TRP A 1 108 ? 5.495   68.756   89.149  1.00 16.37 ? 189 TRP A O   1 
ATOM   819   C CB  . TRP A 1 108 ? 3.205   67.024   90.345  1.00 11.76 ? 189 TRP A CB  1 
ATOM   820   C CG  . TRP A 1 108 ? 1.915   66.313   90.525  1.00 10.33 ? 189 TRP A CG  1 
ATOM   821   C CD1 . TRP A 1 108 ? 1.665   65.014   90.248  1.00 7.66  ? 189 TRP A CD1 1 
ATOM   822   C CD2 . TRP A 1 108 ? 0.672   66.882   90.966  1.00 8.70  ? 189 TRP A CD2 1 
ATOM   823   N NE1 . TRP A 1 108 ? 0.345   64.726   90.481  1.00 12.11 ? 189 TRP A NE1 1 
ATOM   824   C CE2 . TRP A 1 108 ? -0.290  65.856   90.924  1.00 8.28  ? 189 TRP A CE2 1 
ATOM   825   C CE3 . TRP A 1 108 ? 0.282   68.160   91.394  1.00 9.83  ? 189 TRP A CE3 1 
ATOM   826   C CZ2 . TRP A 1 108 ? -1.628  66.062   91.285  1.00 8.52  ? 189 TRP A CZ2 1 
ATOM   827   C CZ3 . TRP A 1 108 ? -1.055  68.370   91.757  1.00 8.96  ? 189 TRP A CZ3 1 
ATOM   828   C CH2 . TRP A 1 108 ? -1.989  67.322   91.699  1.00 8.47  ? 189 TRP A CH2 1 
ATOM   829   N N   . LEU A 1 109 ? 3.838   70.128   89.788  1.00 14.56 ? 190 LEU A N   1 
ATOM   830   C CA  . LEU A 1 109 ? 4.714   71.224   90.136  1.00 13.95 ? 190 LEU A CA  1 
ATOM   831   C C   . LEU A 1 109 ? 4.485   71.440   91.626  1.00 13.37 ? 190 LEU A C   1 
ATOM   832   O O   . LEU A 1 109 ? 3.357   71.685   92.048  1.00 13.74 ? 190 LEU A O   1 
ATOM   833   C CB  . LEU A 1 109 ? 4.334   72.496   89.363  1.00 13.34 ? 190 LEU A CB  1 
ATOM   834   C CG  . LEU A 1 109 ? 4.723   73.824   90.028  1.00 14.53 ? 190 LEU A CG  1 
ATOM   835   C CD1 . LEU A 1 109 ? 6.235   73.907   90.211  1.00 14.05 ? 190 LEU A CD1 1 
ATOM   836   C CD2 . LEU A 1 109 ? 4.230   74.980   89.185  1.00 14.25 ? 190 LEU A CD2 1 
ATOM   837   N N   . THR A 1 110 ? 5.533   71.310   92.427  1.00 13.26 ? 191 THR A N   1 
ATOM   838   C CA  . THR A 1 110 ? 5.384   71.553   93.856  1.00 14.83 ? 191 THR A CA  1 
ATOM   839   C C   . THR A 1 110 ? 6.250   72.741   94.247  1.00 14.74 ? 191 THR A C   1 
ATOM   840   O O   . THR A 1 110 ? 7.291   72.998   93.636  1.00 15.06 ? 191 THR A O   1 
ATOM   841   C CB  . THR A 1 110 ? 5.788   70.335   94.736  1.00 13.66 ? 191 THR A CB  1 
ATOM   842   O OG1 . THR A 1 110 ? 7.133   69.948   94.446  1.00 13.69 ? 191 THR A OG1 1 
ATOM   843   C CG2 . THR A 1 110 ? 4.842   69.172   94.509  1.00 11.41 ? 191 THR A CG2 1 
ATOM   844   N N   . ILE A 1 111 ? 5.801   73.461   95.268  1.00 14.08 ? 192 ILE A N   1 
ATOM   845   C CA  . ILE A 1 111 ? 6.501   74.629   95.772  1.00 13.48 ? 192 ILE A CA  1 
ATOM   846   C C   . ILE A 1 111 ? 6.616   74.520   97.293  1.00 14.02 ? 192 ILE A C   1 
ATOM   847   O O   . ILE A 1 111 ? 5.610   74.515   98.008  1.00 13.60 ? 192 ILE A O   1 
ATOM   848   C CB  . ILE A 1 111 ? 5.745   75.921   95.381  1.00 12.78 ? 192 ILE A CB  1 
ATOM   849   C CG1 . ILE A 1 111 ? 5.768   76.094   93.859  1.00 12.04 ? 192 ILE A CG1 1 
ATOM   850   C CG2 . ILE A 1 111 ? 6.383   77.120   96.033  1.00 11.88 ? 192 ILE A CG2 1 
ATOM   851   C CD1 . ILE A 1 111 ? 4.840   77.168   93.345  1.00 9.66  ? 192 ILE A CD1 1 
ATOM   852   N N   . GLY A 1 112 ? 7.855   74.418   97.772  1.00 14.28 ? 193 GLY A N   1 
ATOM   853   C CA  . GLY A 1 112 ? 8.104   74.300   99.198  1.00 13.24 ? 193 GLY A CA  1 
ATOM   854   C C   . GLY A 1 112 ? 9.115   75.285   99.755  1.00 13.46 ? 193 GLY A C   1 
ATOM   855   O O   . GLY A 1 112 ? 10.286  75.310   99.361  1.00 14.00 ? 193 GLY A O   1 
ATOM   856   N N   . ILE A 1 113 ? 8.648   76.102   100.691 1.00 13.81 ? 194 ILE A N   1 
ATOM   857   C CA  . ILE A 1 113 ? 9.479   77.111   101.332 1.00 13.65 ? 194 ILE A CA  1 
ATOM   858   C C   . ILE A 1 113 ? 10.003  76.612   102.678 1.00 14.57 ? 194 ILE A C   1 
ATOM   859   O O   . ILE A 1 113 ? 9.253   76.050   103.482 1.00 14.81 ? 194 ILE A O   1 
ATOM   860   C CB  . ILE A 1 113 ? 8.675   78.404   101.586 1.00 12.89 ? 194 ILE A CB  1 
ATOM   861   C CG1 . ILE A 1 113 ? 8.058   78.899   100.280 1.00 11.80 ? 194 ILE A CG1 1 
ATOM   862   C CG2 . ILE A 1 113 ? 9.569   79.460   102.221 1.00 8.82  ? 194 ILE A CG2 1 
ATOM   863   C CD1 . ILE A 1 113 ? 7.137   80.090   100.455 1.00 11.28 ? 194 ILE A CD1 1 
ATOM   864   N N   . SER A 1 114 ? 11.292  76.830   102.919 1.00 14.67 ? 195 SER A N   1 
ATOM   865   C CA  . SER A 1 114 ? 11.916  76.428   104.172 1.00 13.97 ? 195 SER A CA  1 
ATOM   866   C C   . SER A 1 114 ? 13.059  77.403   104.489 1.00 13.92 ? 195 SER A C   1 
ATOM   867   O O   . SER A 1 114 ? 13.301  78.344   103.734 1.00 14.53 ? 195 SER A O   1 
ATOM   868   C CB  . SER A 1 114 ? 12.430  74.985   104.058 1.00 13.25 ? 195 SER A CB  1 
ATOM   869   O OG  . SER A 1 114 ? 12.734  74.444   105.333 1.00 15.17 ? 195 SER A OG  1 
ATOM   870   N N   . GLY A 1 115 ? 13.757  77.183   105.599 1.00 13.69 ? 196 GLY A N   1 
ATOM   871   C CA  . GLY A 1 115 ? 14.849  78.066   105.965 1.00 13.88 ? 196 GLY A CA  1 
ATOM   872   C C   . GLY A 1 115 ? 14.416  79.048   107.034 1.00 14.64 ? 196 GLY A C   1 
ATOM   873   O O   . GLY A 1 115 ? 13.262  79.015   107.452 1.00 16.74 ? 196 GLY A O   1 
ATOM   874   N N   . PRO A 1 116 ? 15.304  79.947   107.486 1.00 14.34 ? 197 PRO A N   1 
ATOM   875   C CA  . PRO A 1 116 ? 14.966  80.931   108.524 1.00 13.98 ? 197 PRO A CA  1 
ATOM   876   C C   . PRO A 1 116 ? 14.046  82.043   108.023 1.00 14.68 ? 197 PRO A C   1 
ATOM   877   O O   . PRO A 1 116 ? 13.959  82.304   106.819 1.00 13.28 ? 197 PRO A O   1 
ATOM   878   C CB  . PRO A 1 116 ? 16.332  81.454   108.948 1.00 13.21 ? 197 PRO A CB  1 
ATOM   879   C CG  . PRO A 1 116 ? 17.075  81.466   107.640 1.00 14.14 ? 197 PRO A CG  1 
ATOM   880   C CD  . PRO A 1 116 ? 16.691  80.129   107.019 1.00 14.10 ? 197 PRO A CD  1 
ATOM   881   N N   . ASP A 1 117 ? 13.370  82.707   108.951 1.00 14.35 ? 198 ASP A N   1 
ATOM   882   C CA  . ASP A 1 117 ? 12.458  83.786   108.588 1.00 14.81 ? 198 ASP A CA  1 
ATOM   883   C C   . ASP A 1 117 ? 13.113  84.920   107.801 1.00 14.85 ? 198 ASP A C   1 
ATOM   884   O O   . ASP A 1 117 ? 12.466  85.554   106.970 1.00 14.91 ? 198 ASP A O   1 
ATOM   885   C CB  . ASP A 1 117 ? 11.792  84.346   109.841 1.00 14.02 ? 198 ASP A CB  1 
ATOM   886   C CG  . ASP A 1 117 ? 10.942  83.311   110.552 1.00 15.60 ? 198 ASP A CG  1 
ATOM   887   O OD1 . ASP A 1 117 ? 10.681  82.252   109.945 1.00 14.62 ? 198 ASP A OD1 1 
ATOM   888   O OD2 . ASP A 1 117 ? 10.533  83.554   111.709 1.00 15.98 ? 198 ASP A OD2 1 
ATOM   889   N N   . ASN A 1 118 ? 14.394  85.172   108.047 1.00 15.38 ? 199 ASN A N   1 
ATOM   890   C CA  . ASN A 1 118 ? 15.086  86.242   107.347 1.00 15.07 ? 199 ASN A CA  1 
ATOM   891   C C   . ASN A 1 118 ? 15.774  85.858   106.042 1.00 15.78 ? 199 ASN A C   1 
ATOM   892   O O   . ASN A 1 118 ? 16.567  86.643   105.526 1.00 17.47 ? 199 ASN A O   1 
ATOM   893   C CB  . ASN A 1 118 ? 16.116  86.897   108.263 1.00 16.04 ? 199 ASN A CB  1 
ATOM   894   C CG  . ASN A 1 118 ? 17.181  85.929   108.717 1.00 16.30 ? 199 ASN A CG  1 
ATOM   895   O OD1 . ASN A 1 118 ? 17.629  85.079   107.953 1.00 15.08 ? 199 ASN A OD1 1 
ATOM   896   N ND2 . ASN A 1 118 ? 17.600  86.061   109.962 1.00 16.62 ? 199 ASN A ND2 1 
ATOM   897   N N   . GLY A 1 119 ? 15.496  84.670   105.508 1.00 15.75 ? 200 GLY A N   1 
ATOM   898   C CA  . GLY A 1 119 ? 16.118  84.282   104.247 1.00 14.71 ? 200 GLY A CA  1 
ATOM   899   C C   . GLY A 1 119 ? 15.541  83.019   103.630 1.00 16.41 ? 200 GLY A C   1 
ATOM   900   O O   . GLY A 1 119 ? 16.248  82.282   102.943 1.00 15.71 ? 200 GLY A O   1 
ATOM   901   N N   . ALA A 1 120 ? 14.253  82.773   103.858 1.00 14.50 ? 201 ALA A N   1 
ATOM   902   C CA  . ALA A 1 120 ? 13.607  81.576   103.346 1.00 14.60 ? 201 ALA A CA  1 
ATOM   903   C C   . ALA A 1 120 ? 13.690  81.441   101.826 1.00 15.35 ? 201 ALA A C   1 
ATOM   904   O O   . ALA A 1 120 ? 13.641  82.428   101.097 1.00 14.62 ? 201 ALA A O   1 
ATOM   905   C CB  . ALA A 1 120 ? 12.150  81.539   103.800 1.00 14.23 ? 201 ALA A CB  1 
ATOM   906   N N   . VAL A 1 121 ? 13.822  80.204   101.359 1.00 13.56 ? 202 VAL A N   1 
ATOM   907   C CA  . VAL A 1 121 ? 13.904  79.937   99.937  1.00 16.11 ? 202 VAL A CA  1 
ATOM   908   C C   . VAL A 1 121 ? 12.898  78.880   99.510  1.00 16.30 ? 202 VAL A C   1 
ATOM   909   O O   . VAL A 1 121 ? 12.806  77.807   100.114 1.00 16.24 ? 202 VAL A O   1 
ATOM   910   C CB  . VAL A 1 121 ? 15.337  79.484   99.505  1.00 16.86 ? 202 VAL A CB  1 
ATOM   911   C CG1 . VAL A 1 121 ? 15.984  78.673   100.597 1.00 20.69 ? 202 VAL A CG1 1 
ATOM   912   C CG2 . VAL A 1 121 ? 15.258  78.626   98.247  1.00 16.22 ? 202 VAL A CG2 1 
ATOM   913   N N   . ALA A 1 122 ? 12.137  79.207   98.468  1.00 15.86 ? 203 ALA A N   1 
ATOM   914   C CA  . ALA A 1 122 ? 11.141  78.297   97.926  1.00 16.91 ? 203 ALA A CA  1 
ATOM   915   C C   . ALA A 1 122 ? 11.836  77.430   96.897  1.00 16.41 ? 203 ALA A C   1 
ATOM   916   O O   . ALA A 1 122 ? 12.491  77.943   95.997  1.00 18.30 ? 203 ALA A O   1 
ATOM   917   C CB  . ALA A 1 122 ? 10.006  79.073   97.279  1.00 14.00 ? 203 ALA A CB  1 
ATOM   918   N N   . VAL A 1 123 ? 11.708  76.118   97.047  1.00 16.44 ? 204 VAL A N   1 
ATOM   919   C CA  . VAL A 1 123 ? 12.330  75.182   96.122  1.00 16.22 ? 204 VAL A CA  1 
ATOM   920   C C   . VAL A 1 123 ? 11.241  74.630   95.219  1.00 16.64 ? 204 VAL A C   1 
ATOM   921   O O   . VAL A 1 123 ? 10.335  73.958   95.693  1.00 18.11 ? 204 VAL A O   1 
ATOM   922   C CB  . VAL A 1 123 ? 13.000  74.004   96.884  1.00 16.21 ? 204 VAL A CB  1 
ATOM   923   C CG1 . VAL A 1 123 ? 13.651  73.044   95.893  1.00 16.33 ? 204 VAL A CG1 1 
ATOM   924   C CG2 . VAL A 1 123 ? 14.038  74.531   97.866  1.00 11.84 ? 204 VAL A CG2 1 
ATOM   925   N N   . LEU A 1 124 ? 11.322  74.919   93.924  1.00 16.63 ? 205 LEU A N   1 
ATOM   926   C CA  . LEU A 1 124 ? 10.320  74.437   92.980  1.00 16.67 ? 205 LEU A CA  1 
ATOM   927   C C   . LEU A 1 124 ? 10.752  73.115   92.388  1.00 17.74 ? 205 LEU A C   1 
ATOM   928   O O   . LEU A 1 124 ? 11.932  72.923   92.077  1.00 18.84 ? 205 LEU A O   1 
ATOM   929   C CB  . LEU A 1 124 ? 10.117  75.416   91.823  1.00 16.03 ? 205 LEU A CB  1 
ATOM   930   C CG  . LEU A 1 124 ? 9.851   76.900   92.058  1.00 17.28 ? 205 LEU A CG  1 
ATOM   931   C CD1 . LEU A 1 124 ? 9.144   77.442   90.825  1.00 16.88 ? 205 LEU A CD1 1 
ATOM   932   C CD2 . LEU A 1 124 ? 9.008   77.124   93.275  1.00 16.63 ? 205 LEU A CD2 1 
ATOM   933   N N   . LYS A 1 125 ? 9.798   72.203   92.224  1.00 16.47 ? 206 LYS A N   1 
ATOM   934   C CA  . LYS A 1 125 ? 10.101  70.910   91.640  1.00 16.33 ? 206 LYS A CA  1 
ATOM   935   C C   . LYS A 1 125 ? 9.100   70.526   90.571  1.00 16.01 ? 206 LYS A C   1 
ATOM   936   O O   . LYS A 1 125 ? 7.894   70.752   90.711  1.00 14.46 ? 206 LYS A O   1 
ATOM   937   C CB  . LYS A 1 125 ? 10.107  69.811   92.698  1.00 17.02 ? 206 LYS A CB  1 
ATOM   938   C CG  . LYS A 1 125 ? 11.212  69.898   93.731  1.00 18.08 ? 206 LYS A CG  1 
ATOM   939   C CD  . LYS A 1 125 ? 11.089  68.734   94.695  1.00 17.22 ? 206 LYS A CD  1 
ATOM   940   C CE  . LYS A 1 125 ? 12.080  68.823   95.831  1.00 17.22 ? 206 LYS A CE  1 
ATOM   941   N NZ  . LYS A 1 125 ? 11.876  67.675   96.752  1.00 18.88 ? 206 LYS A NZ  1 
ATOM   942   N N   . TYR A 1 126 ? 9.621   69.953   89.493  1.00 15.13 ? 207 TYR A N   1 
ATOM   943   C CA  . TYR A 1 126 ? 8.790   69.475   88.411  1.00 15.30 ? 207 TYR A CA  1 
ATOM   944   C C   . TYR A 1 126 ? 9.071   67.973   88.417  1.00 17.12 ? 207 TYR A C   1 
ATOM   945   O O   . TYR A 1 126 ? 10.227  67.548   88.380  1.00 18.83 ? 207 TYR A O   1 
ATOM   946   C CB  . TYR A 1 126 ? 9.203   70.131   87.091  1.00 13.70 ? 207 TYR A CB  1 
ATOM   947   C CG  . TYR A 1 126 ? 8.162   70.025   85.997  1.00 12.91 ? 207 TYR A CG  1 
ATOM   948   C CD1 . TYR A 1 126 ? 8.376   69.216   84.878  1.00 11.58 ? 207 TYR A CD1 1 
ATOM   949   C CD2 . TYR A 1 126 ? 6.955   70.730   86.081  1.00 10.05 ? 207 TYR A CD2 1 
ATOM   950   C CE1 . TYR A 1 126 ? 7.419   69.109   83.871  1.00 8.67  ? 207 TYR A CE1 1 
ATOM   951   C CE2 . TYR A 1 126 ? 5.994   70.627   85.079  1.00 8.71  ? 207 TYR A CE2 1 
ATOM   952   C CZ  . TYR A 1 126 ? 6.234   69.813   83.980  1.00 9.88  ? 207 TYR A CZ  1 
ATOM   953   O OH  . TYR A 1 126 ? 5.287   69.684   82.993  1.00 13.41 ? 207 TYR A OH  1 
ATOM   954   N N   . ASN A 1 127 ? 8.012   67.177   88.501  1.00 17.55 ? 208 ASN A N   1 
ATOM   955   C CA  . ASN A 1 127 ? 8.119   65.721   88.556  1.00 17.60 ? 208 ASN A CA  1 
ATOM   956   C C   . ASN A 1 127 ? 9.107   65.258   89.625  1.00 16.90 ? 208 ASN A C   1 
ATOM   957   O O   . ASN A 1 127 ? 9.823   64.276   89.437  1.00 16.39 ? 208 ASN A O   1 
ATOM   958   C CB  . ASN A 1 127 ? 8.521   65.132   87.201  1.00 18.87 ? 208 ASN A CB  1 
ATOM   959   C CG  . ASN A 1 127 ? 7.825   63.797   86.920  1.00 21.68 ? 208 ASN A CG  1 
ATOM   960   O OD1 . ASN A 1 127 ? 7.767   62.911   87.779  1.00 19.65 ? 208 ASN A OD1 1 
ATOM   961   N ND2 . ASN A 1 127 ? 7.288   63.653   85.710  1.00 25.42 ? 208 ASN A ND2 1 
ATOM   962   N N   . GLY A 1 128 ? 9.150   65.975   90.744  1.00 15.89 ? 209 GLY A N   1 
ATOM   963   C CA  . GLY A 1 128 ? 10.039  65.596   91.830  1.00 16.40 ? 209 GLY A CA  1 
ATOM   964   C C   . GLY A 1 128 ? 11.485  66.053   91.757  1.00 16.90 ? 209 GLY A C   1 
ATOM   965   O O   . GLY A 1 128 ? 12.258  65.781   92.672  1.00 16.45 ? 209 GLY A O   1 
ATOM   966   N N   . ILE A 1 129 ? 11.865  66.731   90.677  1.00 16.86 ? 210 ILE A N   1 
ATOM   967   C CA  . ILE A 1 129 ? 13.237  67.214   90.537  1.00 17.52 ? 210 ILE A CA  1 
ATOM   968   C C   . ILE A 1 129 ? 13.270  68.736   90.512  1.00 15.69 ? 210 ILE A C   1 
ATOM   969   O O   . ILE A 1 129 ? 12.503  69.377   89.789  1.00 15.92 ? 210 ILE A O   1 
ATOM   970   C CB  . ILE A 1 129 ? 13.921  66.647   89.259  1.00 18.33 ? 210 ILE A CB  1 
ATOM   971   C CG1 . ILE A 1 129 ? 13.080  66.966   88.028  1.00 23.38 ? 210 ILE A CG1 1 
ATOM   972   C CG2 . ILE A 1 129 ? 14.068  65.136   89.380  1.00 19.17 ? 210 ILE A CG2 1 
ATOM   973   C CD1 . ILE A 1 129 ? 13.357  66.058   86.819  1.00 25.05 ? 210 ILE A CD1 1 
ATOM   974   N N   . ILE A 1 130 ? 14.158  69.298   91.325  1.00 13.73 ? 211 ILE A N   1 
ATOM   975   C CA  . ILE A 1 130 ? 14.318  70.742   91.439  1.00 14.42 ? 211 ILE A CA  1 
ATOM   976   C C   . ILE A 1 130 ? 14.547  71.441   90.090  1.00 14.33 ? 211 ILE A C   1 
ATOM   977   O O   . ILE A 1 130 ? 15.494  71.116   89.375  1.00 12.95 ? 211 ILE A O   1 
ATOM   978   C CB  . ILE A 1 130 ? 15.484  71.088   92.399  1.00 13.13 ? 211 ILE A CB  1 
ATOM   979   C CG1 . ILE A 1 130 ? 15.191  70.522   93.796  1.00 12.89 ? 211 ILE A CG1 1 
ATOM   980   C CG2 . ILE A 1 130 ? 15.671  72.588   92.459  1.00 12.43 ? 211 ILE A CG2 1 
ATOM   981   C CD1 . ILE A 1 130 ? 16.200  70.899   94.862  1.00 12.42 ? 211 ILE A CD1 1 
ATOM   982   N N   . THR A 1 131 ? 13.668  72.393   89.757  1.00 14.25 ? 212 THR A N   1 
ATOM   983   C CA  . THR A 1 131 ? 13.747  73.146   88.499  1.00 14.24 ? 212 THR A CA  1 
ATOM   984   C C   . THR A 1 131 ? 14.023  74.647   88.677  1.00 16.12 ? 212 THR A C   1 
ATOM   985   O O   . THR A 1 131 ? 14.270  75.356   87.701  1.00 17.58 ? 212 THR A O   1 
ATOM   986   C CB  . THR A 1 131 ? 12.457  73.019   87.675  1.00 12.14 ? 212 THR A CB  1 
ATOM   987   O OG1 . THR A 1 131 ? 11.323  73.222   88.529  1.00 13.02 ? 212 THR A OG1 1 
ATOM   988   C CG2 . THR A 1 131 ? 12.378  71.672   87.011  1.00 8.11  ? 212 THR A CG2 1 
ATOM   989   N N   . ASP A 1 132 ? 13.960  75.134   89.912  1.00 16.31 ? 213 ASP A N   1 
ATOM   990   C CA  . ASP A 1 132 ? 14.237  76.537   90.177  1.00 18.02 ? 213 ASP A CA  1 
ATOM   991   C C   . ASP A 1 132 ? 14.207  76.844   91.667  1.00 18.66 ? 213 ASP A C   1 
ATOM   992   O O   . ASP A 1 132 ? 13.748  76.039   92.465  1.00 18.52 ? 213 ASP A O   1 
ATOM   993   C CB  . ASP A 1 132 ? 13.227  77.439   89.459  1.00 20.01 ? 213 ASP A CB  1 
ATOM   994   C CG  . ASP A 1 132 ? 13.772  78.839   89.221  1.00 21.40 ? 213 ASP A CG  1 
ATOM   995   O OD1 . ASP A 1 132 ? 14.929  79.094   89.632  1.00 19.78 ? 213 ASP A OD1 1 
ATOM   996   O OD2 . ASP A 1 132 ? 13.057  79.674   88.617  1.00 21.95 ? 213 ASP A OD2 1 
ATOM   997   N N   . THR A 1 133 ? 14.710  78.020   92.027  1.00 20.06 ? 214 THR A N   1 
ATOM   998   C CA  . THR A 1 133 ? 14.730  78.489   93.413  1.00 19.90 ? 214 THR A CA  1 
ATOM   999   C C   . THR A 1 133 ? 14.381  79.979   93.466  1.00 19.53 ? 214 THR A C   1 
ATOM   1000  O O   . THR A 1 133 ? 14.735  80.734   92.569  1.00 19.00 ? 214 THR A O   1 
ATOM   1001  C CB  . THR A 1 133 ? 16.119  78.278   94.062  1.00 19.71 ? 214 THR A CB  1 
ATOM   1002  O OG1 . THR A 1 133 ? 16.133  77.034   94.772  1.00 19.73 ? 214 THR A OG1 1 
ATOM   1003  C CG2 . THR A 1 133 ? 16.432  79.402   95.021  1.00 19.77 ? 214 THR A CG2 1 
ATOM   1004  N N   . ILE A 1 134 ? 13.682  80.387   94.521  1.00 20.02 ? 215 ILE A N   1 
ATOM   1005  C CA  . ILE A 1 134 ? 13.297  81.781   94.708  1.00 19.70 ? 215 ILE A CA  1 
ATOM   1006  C C   . ILE A 1 134 ? 13.598  82.158   96.151  1.00 21.02 ? 215 ILE A C   1 
ATOM   1007  O O   . ILE A 1 134 ? 12.970  81.630   97.070  1.00 20.95 ? 215 ILE A O   1 
ATOM   1008  C CB  . ILE A 1 134 ? 11.795  81.976   94.477  1.00 20.44 ? 215 ILE A CB  1 
ATOM   1009  C CG1 . ILE A 1 134 ? 11.398  81.396   93.115  1.00 20.30 ? 215 ILE A CG1 1 
ATOM   1010  C CG2 . ILE A 1 134 ? 11.444  83.456   94.560  1.00 18.77 ? 215 ILE A CG2 1 
ATOM   1011  C CD1 . ILE A 1 134 ? 9.894   81.275   92.921  1.00 21.91 ? 215 ILE A CD1 1 
ATOM   1012  N N   . LYS A 1 135 ? 14.561  83.057   96.356  1.00 21.91 ? 216 LYS A N   1 
ATOM   1013  C CA  . LYS A 1 135 ? 14.918  83.495   97.707  1.00 22.79 ? 216 LYS A CA  1 
ATOM   1014  C C   . LYS A 1 135 ? 14.113  84.713   98.133  1.00 21.11 ? 216 LYS A C   1 
ATOM   1015  O O   . LYS A 1 135 ? 13.692  85.506   97.298  1.00 20.34 ? 216 LYS A O   1 
ATOM   1016  C CB  . LYS A 1 135 ? 16.416  83.823   97.798  1.00 26.84 ? 216 LYS A CB  1 
ATOM   1017  C CG  . LYS A 1 135 ? 16.961  84.715   96.654  1.00 33.31 ? 216 LYS A CG  1 
ATOM   1018  C CD  . LYS A 1 135 ? 18.473  85.028   96.845  1.00 35.34 ? 216 LYS A CD  1 
ATOM   1019  C CE  . LYS A 1 135 ? 19.166  85.488   95.542  1.00 35.90 ? 216 LYS A CE  1 
ATOM   1020  N NZ  . LYS A 1 135 ? 19.311  84.392   94.514  1.00 34.35 ? 216 LYS A NZ  1 
ATOM   1021  N N   . SER A 1 136 ? 13.897  84.840   99.440  1.00 21.03 ? 217 SER A N   1 
ATOM   1022  C CA  . SER A 1 136 ? 13.158  85.960   100.022 1.00 20.08 ? 217 SER A CA  1 
ATOM   1023  C C   . SER A 1 136 ? 13.775  87.258   99.515  1.00 20.87 ? 217 SER A C   1 
ATOM   1024  O O   . SER A 1 136 ? 14.998  87.363   99.441  1.00 20.37 ? 217 SER A O   1 
ATOM   1025  C CB  . SER A 1 136 ? 13.260  85.900   101.549 1.00 19.57 ? 217 SER A CB  1 
ATOM   1026  O OG  . SER A 1 136 ? 12.803  87.093   102.164 1.00 18.17 ? 217 SER A OG  1 
ATOM   1027  N N   . TRP A 1 137 ? 12.940  88.239   99.169  1.00 20.53 ? 218 TRP A N   1 
ATOM   1028  C CA  . TRP A 1 137 ? 13.439  89.518   98.658  1.00 21.29 ? 218 TRP A CA  1 
ATOM   1029  C C   . TRP A 1 137 ? 13.279  90.680   99.639  1.00 22.57 ? 218 TRP A C   1 
ATOM   1030  O O   . TRP A 1 137 ? 13.714  91.806   99.359  1.00 23.16 ? 218 TRP A O   1 
ATOM   1031  C CB  . TRP A 1 137 ? 12.764  89.857   97.323  1.00 19.09 ? 218 TRP A CB  1 
ATOM   1032  C CG  . TRP A 1 137 ? 11.284  90.047   97.405  1.00 19.09 ? 218 TRP A CG  1 
ATOM   1033  C CD1 . TRP A 1 137 ? 10.623  91.201   97.682  1.00 18.47 ? 218 TRP A CD1 1 
ATOM   1034  C CD2 . TRP A 1 137 ? 10.275  89.043   97.206  1.00 17.64 ? 218 TRP A CD2 1 
ATOM   1035  N NE1 . TRP A 1 137 ? 9.263   90.987   97.665  1.00 18.95 ? 218 TRP A NE1 1 
ATOM   1036  C CE2 . TRP A 1 137 ? 9.023   89.670   97.377  1.00 17.86 ? 218 TRP A CE2 1 
ATOM   1037  C CE3 . TRP A 1 137 ? 10.311  87.676   96.900  1.00 17.01 ? 218 TRP A CE3 1 
ATOM   1038  C CZ2 . TRP A 1 137 ? 7.812   88.977   97.252  1.00 16.86 ? 218 TRP A CZ2 1 
ATOM   1039  C CZ3 . TRP A 1 137 ? 9.113   86.989   96.775  1.00 16.49 ? 218 TRP A CZ3 1 
ATOM   1040  C CH2 . TRP A 1 137 ? 7.876   87.644   96.951  1.00 17.12 ? 218 TRP A CH2 1 
ATOM   1041  N N   . ARG A 1 138 ? 12.672  90.395   100.788 1.00 22.35 ? 219 ARG A N   1 
ATOM   1042  C CA  . ARG A 1 138 ? 12.456  91.388   101.839 1.00 23.85 ? 219 ARG A CA  1 
ATOM   1043  C C   . ARG A 1 138 ? 12.930  90.827   103.180 1.00 23.12 ? 219 ARG A C   1 
ATOM   1044  O O   . ARG A 1 138 ? 12.836  91.490   104.213 1.00 22.27 ? 219 ARG A O   1 
ATOM   1045  C CB  . ARG A 1 138 ? 10.966  91.748   101.944 1.00 27.83 ? 219 ARG A CB  1 
ATOM   1046  C CG  . ARG A 1 138 ? 10.473  92.719   100.882 1.00 32.52 ? 219 ARG A CG  1 
ATOM   1047  C CD  . ARG A 1 138 ? 11.072  94.105   101.111 1.00 36.73 ? 219 ARG A CD  1 
ATOM   1048  N NE  . ARG A 1 138 ? 10.860  94.981   99.962  1.00 42.65 ? 219 ARG A NE  1 
ATOM   1049  C CZ  . ARG A 1 138 ? 11.556  96.095   99.736  1.00 46.40 ? 219 ARG A CZ  1 
ATOM   1050  N NH1 . ARG A 1 138 ? 12.509  96.474   100.588 1.00 46.53 ? 219 ARG A NH1 1 
ATOM   1051  N NH2 . ARG A 1 138 ? 11.324  96.817   98.641  1.00 47.83 ? 219 ARG A NH2 1 
ATOM   1052  N N   . ASN A 1 139 ? 13.424  89.594   103.155 1.00 22.06 ? 220 ASN A N   1 
ATOM   1053  C CA  . ASN A 1 139 ? 13.913  88.927   104.356 1.00 21.70 ? 220 ASN A CA  1 
ATOM   1054  C C   . ASN A 1 139 ? 12.917  88.919   105.511 1.00 21.14 ? 220 ASN A C   1 
ATOM   1055  O O   . ASN A 1 139 ? 13.292  89.170   106.654 1.00 21.07 ? 220 ASN A O   1 
ATOM   1056  C CB  . ASN A 1 139 ? 15.212  89.571   104.843 1.00 22.13 ? 220 ASN A CB  1 
ATOM   1057  C CG  . ASN A 1 139 ? 16.327  89.484   103.826 1.00 22.35 ? 220 ASN A CG  1 
ATOM   1058  O OD1 . ASN A 1 139 ? 16.275  88.695   102.876 1.00 24.78 ? 220 ASN A OD1 1 
ATOM   1059  N ND2 . ASN A 1 139 ? 17.354  90.287   104.027 1.00 21.25 ? 220 ASN A ND2 1 
ATOM   1060  N N   . ASN A 1 140 ? 11.652  88.636   105.231 1.00 19.94 ? 221 ASN A N   1 
ATOM   1061  C CA  . ASN A 1 140 ? 10.675  88.591   106.308 1.00 18.24 ? 221 ASN A CA  1 
ATOM   1062  C C   . ASN A 1 140 ? 9.594   87.539   106.067 1.00 18.45 ? 221 ASN A C   1 
ATOM   1063  O O   . ASN A 1 140 ? 8.444   87.858   105.756 1.00 18.58 ? 221 ASN A O   1 
ATOM   1064  C CB  . ASN A 1 140 ? 10.050  89.971   106.518 1.00 15.30 ? 221 ASN A CB  1 
ATOM   1065  C CG  . ASN A 1 140 ? 9.119   90.016   107.712 1.00 13.88 ? 221 ASN A CG  1 
ATOM   1066  O OD1 . ASN A 1 140 ? 9.035   89.067   108.491 1.00 13.89 ? 221 ASN A OD1 1 
ATOM   1067  N ND2 . ASN A 1 140 ? 8.417   91.131   107.867 1.00 13.96 ? 221 ASN A ND2 1 
ATOM   1068  N N   . ILE A 1 141 ? 10.001  86.281   106.213 1.00 17.92 ? 222 ILE A N   1 
ATOM   1069  C CA  . ILE A 1 141 ? 9.132   85.122   106.062 1.00 17.46 ? 222 ILE A CA  1 
ATOM   1070  C C   . ILE A 1 141 ? 8.481   84.939   104.693 1.00 18.31 ? 222 ILE A C   1 
ATOM   1071  O O   . ILE A 1 141 ? 7.258   85.065   104.564 1.00 19.09 ? 222 ILE A O   1 
ATOM   1072  C CB  . ILE A 1 141 ? 8.024   85.142   107.135 1.00 17.38 ? 222 ILE A CB  1 
ATOM   1073  C CG1 . ILE A 1 141 ? 8.653   85.375   108.510 1.00 17.48 ? 222 ILE A CG1 1 
ATOM   1074  C CG2 . ILE A 1 141 ? 7.265   83.814   107.148 1.00 16.00 ? 222 ILE A CG2 1 
ATOM   1075  C CD1 . ILE A 1 141 ? 7.642   85.457   109.633 1.00 17.28 ? 222 ILE A CD1 1 
ATOM   1076  N N   . LEU A 1 142 ? 9.282   84.642   103.669 1.00 17.87 ? 223 LEU A N   1 
ATOM   1077  C CA  . LEU A 1 142 ? 8.715   84.417   102.336 1.00 17.68 ? 223 LEU A CA  1 
ATOM   1078  C C   . LEU A 1 142 ? 7.676   83.307   102.493 1.00 16.86 ? 223 LEU A C   1 
ATOM   1079  O O   . LEU A 1 142 ? 7.967   82.248   103.052 1.00 18.58 ? 223 LEU A O   1 
ATOM   1080  C CB  . LEU A 1 142 ? 9.798   83.979   101.343 1.00 17.39 ? 223 LEU A CB  1 
ATOM   1081  C CG  . LEU A 1 142 ? 9.298   83.453   99.991  1.00 15.33 ? 223 LEU A CG  1 
ATOM   1082  C CD1 . LEU A 1 142 ? 8.748   84.577   99.120  1.00 14.72 ? 223 LEU A CD1 1 
ATOM   1083  C CD2 . LEU A 1 142 ? 10.445  82.775   99.296  1.00 15.84 ? 223 LEU A CD2 1 
ATOM   1084  N N   . ARG A 1 143 ? 6.466   83.555   102.013 1.00 16.16 ? 224 ARG A N   1 
ATOM   1085  C CA  . ARG A 1 143 ? 5.386   82.589   102.141 1.00 15.25 ? 224 ARG A CA  1 
ATOM   1086  C C   . ARG A 1 143 ? 4.525   82.542   100.887 1.00 17.33 ? 224 ARG A C   1 
ATOM   1087  O O   . ARG A 1 143 ? 4.617   83.427   100.026 1.00 17.63 ? 224 ARG A O   1 
ATOM   1088  C CB  . ARG A 1 143 ? 4.534   82.931   103.368 1.00 15.94 ? 224 ARG A CB  1 
ATOM   1089  C CG  . ARG A 1 143 ? 4.292   84.431   103.591 1.00 13.60 ? 224 ARG A CG  1 
ATOM   1090  C CD  . ARG A 1 143 ? 3.724   84.711   104.991 1.00 13.60 ? 224 ARG A CD  1 
ATOM   1091  N NE  . ARG A 1 143 ? 3.363   86.117   105.180 1.00 14.30 ? 224 ARG A NE  1 
ATOM   1092  C CZ  . ARG A 1 143 ? 4.230   87.128   105.149 1.00 13.33 ? 224 ARG A CZ  1 
ATOM   1093  N NH1 . ARG A 1 143 ? 3.812   88.372   105.326 1.00 11.92 ? 224 ARG A NH1 1 
ATOM   1094  N NH2 . ARG A 1 143 ? 5.522   86.899   104.944 1.00 16.20 ? 224 ARG A NH2 1 
ATOM   1095  N N   . THR A 1 144 ? 3.686   81.511   100.780 1.00 17.09 ? 225 THR A N   1 
ATOM   1096  C CA  . THR A 1 144 ? 2.850   81.366   99.599  1.00 16.04 ? 225 THR A CA  1 
ATOM   1097  C C   . THR A 1 144 ? 1.401   80.912   99.853  1.00 15.72 ? 225 THR A C   1 
ATOM   1098  O O   . THR A 1 144 ? 0.877   81.042   100.963 1.00 15.84 ? 225 THR A O   1 
ATOM   1099  C CB  . THR A 1 144 ? 3.549   80.428   98.565  1.00 16.09 ? 225 THR A CB  1 
ATOM   1100  O OG1 . THR A 1 144 ? 2.916   80.567   97.288  1.00 16.81 ? 225 THR A OG1 1 
ATOM   1101  C CG2 . THR A 1 144 ? 3.487   78.971   99.014  1.00 16.31 ? 225 THR A CG2 1 
ATOM   1102  N N   . GLN A 1 145 ? 0.779   80.366   98.812  1.00 14.72 ? 226 GLN A N   1 
ATOM   1103  C CA  . GLN A 1 145 ? -0.618  79.949   98.823  1.00 15.51 ? 226 GLN A CA  1 
ATOM   1104  C C   . GLN A 1 145 ? -1.198  79.017   99.873  1.00 16.28 ? 226 GLN A C   1 
ATOM   1105  O O   . GLN A 1 145 ? -2.249  79.311   100.432 1.00 16.26 ? 226 GLN A O   1 
ATOM   1106  C CB  . GLN A 1 145 ? -0.987  79.379   97.462  1.00 15.49 ? 226 GLN A CB  1 
ATOM   1107  C CG  . GLN A 1 145 ? -0.769  80.325   96.310  1.00 16.37 ? 226 GLN A CG  1 
ATOM   1108  C CD  . GLN A 1 145 ? -1.419  79.815   95.044  1.00 18.64 ? 226 GLN A CD  1 
ATOM   1109  O OE1 . GLN A 1 145 ? -2.649  79.694   94.972  1.00 19.04 ? 226 GLN A OE1 1 
ATOM   1110  N NE2 . GLN A 1 145 ? -0.603  79.500   94.039  1.00 17.39 ? 226 GLN A NE2 1 
ATOM   1111  N N   . GLU A 1 146 ? -0.546  77.889   100.125 1.00 16.63 ? 227 GLU A N   1 
ATOM   1112  C CA  . GLU A 1 146 ? -1.070  76.916   101.077 1.00 17.34 ? 227 GLU A CA  1 
ATOM   1113  C C   . GLU A 1 146 ? -2.335  76.294   100.458 1.00 17.58 ? 227 GLU A C   1 
ATOM   1114  O O   . GLU A 1 146 ? -3.255  75.884   101.165 1.00 17.17 ? 227 GLU A O   1 
ATOM   1115  C CB  . GLU A 1 146 ? -1.394  77.577   102.431 1.00 18.30 ? 227 GLU A CB  1 
ATOM   1116  C CG  . GLU A 1 146 ? -0.250  78.417   103.031 1.00 21.61 ? 227 GLU A CG  1 
ATOM   1117  C CD  . GLU A 1 146 ? 0.943   77.590   103.502 1.00 22.82 ? 227 GLU A CD  1 
ATOM   1118  O OE1 . GLU A 1 146 ? 1.419   76.720   102.739 1.00 22.58 ? 227 GLU A OE1 1 
ATOM   1119  O OE2 . GLU A 1 146 ? 1.420   77.822   104.643 1.00 26.66 ? 227 GLU A OE2 1 
ATOM   1120  N N   . SER A 1 147 ? -2.364  76.266   99.120  1.00 18.04 ? 228 SER A N   1 
ATOM   1121  C CA  . SER A 1 147 ? -3.443  75.673   98.314  1.00 17.11 ? 228 SER A CA  1 
ATOM   1122  C C   . SER A 1 147 ? -2.865  75.430   96.917  1.00 17.69 ? 228 SER A C   1 
ATOM   1123  O O   . SER A 1 147 ? -1.654  75.523   96.732  1.00 18.70 ? 228 SER A O   1 
ATOM   1124  C CB  . SER A 1 147 ? -4.702  76.562   98.243  1.00 15.77 ? 228 SER A CB  1 
ATOM   1125  O OG  . SER A 1 147 ? -4.458  77.845   97.713  1.00 16.72 ? 228 SER A OG  1 
ATOM   1126  N N   . GLU A 1 148 ? -3.702  75.133   95.931  1.00 17.57 ? 229 GLU A N   1 
ATOM   1127  C CA  . GLU A 1 148 ? -3.183  74.833   94.602  1.00 17.95 ? 229 GLU A CA  1 
ATOM   1128  C C   . GLU A 1 148 ? -2.904  76.050   93.742  1.00 19.18 ? 229 GLU A C   1 
ATOM   1129  O O   . GLU A 1 148 ? -3.588  77.064   93.848  1.00 21.05 ? 229 GLU A O   1 
ATOM   1130  C CB  . GLU A 1 148 ? -4.145  73.905   93.843  1.00 17.55 ? 229 GLU A CB  1 
ATOM   1131  C CG  . GLU A 1 148 ? -5.455  74.572   93.451  1.00 18.04 ? 229 GLU A CG  1 
ATOM   1132  C CD  . GLU A 1 148 ? -6.276  73.790   92.417  1.00 21.04 ? 229 GLU A CD  1 
ATOM   1133  O OE1 . GLU A 1 148 ? -7.278  74.353   91.910  1.00 22.18 ? 229 GLU A OE1 1 
ATOM   1134  O OE2 . GLU A 1 148 ? -5.937  72.624   92.107  1.00 19.92 ? 229 GLU A OE2 1 
ATOM   1135  N N   . CYS A 1 149 ? -1.879  75.944   92.899  1.00 18.58 ? 230 CYS A N   1 
ATOM   1136  C CA  . CYS A 1 149 ? -1.543  77.011   91.981  1.00 17.96 ? 230 CYS A CA  1 
ATOM   1137  C C   . CYS A 1 149 ? -2.349  76.718   90.730  1.00 17.75 ? 230 CYS A C   1 
ATOM   1138  O O   . CYS A 1 149 ? -2.863  75.615   90.578  1.00 18.47 ? 230 CYS A O   1 
ATOM   1139  C CB  . CYS A 1 149 ? -0.043  77.035   91.666  1.00 19.57 ? 230 CYS A CB  1 
ATOM   1140  S SG  . CYS A 1 149 ? 0.860   75.448   91.577  1.00 20.47 ? 230 CYS A SG  1 
ATOM   1141  N N   . ALA A 1 150 ? -2.467  77.688   89.834  1.00 16.75 ? 231 ALA A N   1 
ATOM   1142  C CA  . ALA A 1 150 ? -3.271  77.488   88.631  1.00 15.71 ? 231 ALA A CA  1 
ATOM   1143  C C   . ALA A 1 150 ? -2.463  77.357   87.343  1.00 14.41 ? 231 ALA A C   1 
ATOM   1144  O O   . ALA A 1 150 ? -1.535  78.119   87.105  1.00 11.66 ? 231 ALA A O   1 
ATOM   1145  C CB  . ALA A 1 150 ? -4.288  78.625   88.503  1.00 13.01 ? 231 ALA A CB  1 
ATOM   1146  N N   . CYS A 1 151 ? -2.821  76.390   86.508  1.00 15.49 ? 232 CYS A N   1 
ATOM   1147  C CA  . CYS A 1 151 ? -2.097  76.210   85.252  1.00 18.33 ? 232 CYS A CA  1 
ATOM   1148  C C   . CYS A 1 151 ? -2.986  76.478   84.044  1.00 17.57 ? 232 CYS A C   1 
ATOM   1149  O O   . CYS A 1 151 ? -4.144  76.096   84.021  1.00 17.12 ? 232 CYS A O   1 
ATOM   1150  C CB  . CYS A 1 151 ? -1.511  74.794   85.155  1.00 19.17 ? 232 CYS A CB  1 
ATOM   1151  S SG  . CYS A 1 151 ? -0.420  74.247   86.524  1.00 24.32 ? 232 CYS A SG  1 
ATOM   1152  N N   . VAL A 1 152 ? -2.429  77.149   83.045  1.00 19.06 ? 233 VAL A N   1 
ATOM   1153  C CA  . VAL A 1 152 ? -3.152  77.462   81.815  1.00 19.04 ? 233 VAL A CA  1 
ATOM   1154  C C   . VAL A 1 152 ? -2.256  77.314   80.591  1.00 19.53 ? 233 VAL A C   1 
ATOM   1155  O O   . VAL A 1 152 ? -1.123  77.794   80.585  1.00 20.82 ? 233 VAL A O   1 
ATOM   1156  C CB  . VAL A 1 152 ? -3.674  78.903   81.834  1.00 19.55 ? 233 VAL A CB  1 
ATOM   1157  C CG1 . VAL A 1 152 ? -4.174  79.289   80.452  1.00 20.27 ? 233 VAL A CG1 1 
ATOM   1158  C CG2 . VAL A 1 152 ? -4.784  79.031   82.849  1.00 19.12 ? 233 VAL A CG2 1 
ATOM   1159  N N   . ASN A 1 153 ? -2.756  76.639   79.561  1.00 19.31 ? 234 ASN A N   1 
ATOM   1160  C CA  . ASN A 1 153 ? -2.002  76.471   78.317  1.00 18.99 ? 234 ASN A CA  1 
ATOM   1161  C C   . ASN A 1 153 ? -0.517  76.146   78.509  1.00 18.57 ? 234 ASN A C   1 
ATOM   1162  O O   . ASN A 1 153 ? 0.320   76.604   77.748  1.00 20.21 ? 234 ASN A O   1 
ATOM   1163  C CB  . ASN A 1 153 ? -2.184  77.747   77.460  1.00 20.56 ? 234 ASN A CB  1 
ATOM   1164  C CG  . ASN A 1 153 ? -1.309  77.780   76.203  1.00 20.42 ? 234 ASN A CG  1 
ATOM   1165  O OD1 . ASN A 1 153 ? -1.147  76.777   75.504  1.00 19.14 ? 234 ASN A OD1 1 
ATOM   1166  N ND2 . ASN A 1 153 ? -0.760  78.960   75.903  1.00 19.19 ? 234 ASN A ND2 1 
ATOM   1167  N N   . GLY A 1 154 ? -0.189  75.359   79.527  1.00 17.82 ? 235 GLY A N   1 
ATOM   1168  C CA  . GLY A 1 154 ? 1.199   74.985   79.741  1.00 16.50 ? 235 GLY A CA  1 
ATOM   1169  C C   . GLY A 1 154 ? 1.986   75.832   80.723  1.00 17.60 ? 235 GLY A C   1 
ATOM   1170  O O   . GLY A 1 154 ? 3.190   75.647   80.874  1.00 17.35 ? 235 GLY A O   1 
ATOM   1171  N N   . SER A 1 155 ? 1.317   76.765   81.394  1.00 17.84 ? 236 SER A N   1 
ATOM   1172  C CA  . SER A 1 155 ? 1.990   77.626   82.365  1.00 16.59 ? 236 SER A CA  1 
ATOM   1173  C C   . SER A 1 155 ? 1.208   77.613   83.672  1.00 17.57 ? 236 SER A C   1 
ATOM   1174  O O   . SER A 1 155 ? -0.028  77.570   83.678  1.00 17.29 ? 236 SER A O   1 
ATOM   1175  C CB  . SER A 1 155 ? 2.075   79.060   81.847  1.00 13.78 ? 236 SER A CB  1 
ATOM   1176  O OG  . SER A 1 155 ? 2.628   79.102   80.551  1.00 15.90 ? 236 SER A OG  1 
ATOM   1177  N N   . CYS A 1 156 ? 1.928   77.645   84.783  1.00 17.52 ? 237 CYS A N   1 
ATOM   1178  C CA  . CYS A 1 156 ? 1.283   77.647   86.082  1.00 18.25 ? 237 CYS A CA  1 
ATOM   1179  C C   . CYS A 1 156 ? 1.661   78.941   86.788  1.00 17.52 ? 237 CYS A C   1 
ATOM   1180  O O   . CYS A 1 156 ? 2.790   79.412   86.668  1.00 19.08 ? 237 CYS A O   1 
ATOM   1181  C CB  . CYS A 1 156 ? 1.722   76.425   86.881  1.00 18.69 ? 237 CYS A CB  1 
ATOM   1182  S SG  . CYS A 1 156 ? 1.471   74.843   86.006  1.00 24.99 ? 237 CYS A SG  1 
ATOM   1183  N N   . PHE A 1 157 ? 0.709   79.522   87.508  1.00 16.21 ? 238 PHE A N   1 
ATOM   1184  C CA  . PHE A 1 157 ? 0.947   80.777   88.197  1.00 17.13 ? 238 PHE A CA  1 
ATOM   1185  C C   . PHE A 1 157 ? 0.657   80.673   89.692  1.00 18.10 ? 238 PHE A C   1 
ATOM   1186  O O   . PHE A 1 157 ? -0.274  79.977   90.117  1.00 17.83 ? 238 PHE A O   1 
ATOM   1187  C CB  . PHE A 1 157 ? 0.070   81.886   87.606  1.00 18.08 ? 238 PHE A CB  1 
ATOM   1188  C CG  . PHE A 1 157 ? 0.034   81.915   86.104  1.00 17.47 ? 238 PHE A CG  1 
ATOM   1189  C CD1 . PHE A 1 157 ? -0.723  80.991   85.395  1.00 16.41 ? 238 PHE A CD1 1 
ATOM   1190  C CD2 . PHE A 1 157 ? 0.737   82.886   85.399  1.00 17.84 ? 238 PHE A CD2 1 
ATOM   1191  C CE1 . PHE A 1 157 ? -0.783  81.031   84.011  1.00 16.39 ? 238 PHE A CE1 1 
ATOM   1192  C CE2 . PHE A 1 157 ? 0.686   82.938   84.015  1.00 17.48 ? 238 PHE A CE2 1 
ATOM   1193  C CZ  . PHE A 1 157 ? -0.078  82.006   83.317  1.00 18.09 ? 238 PHE A CZ  1 
ATOM   1194  N N   . THR A 1 158 ? 1.450   81.383   90.485  1.00 17.33 ? 239 THR A N   1 
ATOM   1195  C CA  . THR A 1 158 ? 1.275   81.368   91.928  1.00 18.69 ? 239 THR A CA  1 
ATOM   1196  C C   . THR A 1 158 ? 1.481   82.775   92.470  1.00 16.95 ? 239 THR A C   1 
ATOM   1197  O O   . THR A 1 158 ? 1.864   83.686   91.739  1.00 16.98 ? 239 THR A O   1 
ATOM   1198  C CB  . THR A 1 158 ? 2.296   80.406   92.589  1.00 19.82 ? 239 THR A CB  1 
ATOM   1199  O OG1 . THR A 1 158 ? 1.947   80.183   93.962  1.00 20.69 ? 239 THR A OG1 1 
ATOM   1200  C CG2 . THR A 1 158 ? 3.694   80.996   92.515  1.00 20.11 ? 239 THR A CG2 1 
ATOM   1201  N N   . VAL A 1 159 ? 1.214   82.941   93.757  1.00 16.21 ? 240 VAL A N   1 
ATOM   1202  C CA  . VAL A 1 159 ? 1.375   84.225   94.421  1.00 15.43 ? 240 VAL A CA  1 
ATOM   1203  C C   . VAL A 1 159 ? 2.209   84.019   95.682  1.00 16.34 ? 240 VAL A C   1 
ATOM   1204  O O   . VAL A 1 159 ? 2.050   83.015   96.381  1.00 16.76 ? 240 VAL A O   1 
ATOM   1205  C CB  . VAL A 1 159 ? 0.015   84.821   94.828  1.00 14.04 ? 240 VAL A CB  1 
ATOM   1206  C CG1 . VAL A 1 159 ? 0.228   86.123   95.581  1.00 11.84 ? 240 VAL A CG1 1 
ATOM   1207  C CG2 . VAL A 1 159 ? -0.851  85.040   93.597  1.00 12.13 ? 240 VAL A CG2 1 
ATOM   1208  N N   . MET A 1 160 ? 3.105   84.961   95.957  1.00 16.27 ? 241 MET A N   1 
ATOM   1209  C CA  . MET A 1 160 ? 3.953   84.892   97.139  1.00 16.44 ? 241 MET A CA  1 
ATOM   1210  C C   . MET A 1 160 ? 3.995   86.250   97.831  1.00 15.64 ? 241 MET A C   1 
ATOM   1211  O O   . MET A 1 160 ? 3.777   87.292   97.209  1.00 13.83 ? 241 MET A O   1 
ATOM   1212  C CB  . MET A 1 160 ? 5.380   84.451   96.774  1.00 16.12 ? 241 MET A CB  1 
ATOM   1213  C CG  . MET A 1 160 ? 5.462   83.104   96.079  1.00 17.09 ? 241 MET A CG  1 
ATOM   1214  S SD  . MET A 1 160 ? 7.139   82.417   96.050  1.00 19.59 ? 241 MET A SD  1 
ATOM   1215  C CE  . MET A 1 160 ? 6.853   80.814   96.712  1.00 19.24 ? 241 MET A CE  1 
ATOM   1216  N N   . THR A 1 161 ? 4.276   86.223   99.126  1.00 15.52 ? 242 THR A N   1 
ATOM   1217  C CA  . THR A 1 161 ? 4.334   87.431   99.928  1.00 17.74 ? 242 THR A CA  1 
ATOM   1218  C C   . THR A 1 161 ? 5.589   87.429   100.784 1.00 19.29 ? 242 THR A C   1 
ATOM   1219  O O   . THR A 1 161 ? 6.012   86.387   101.291 1.00 20.92 ? 242 THR A O   1 
ATOM   1220  C CB  . THR A 1 161 ? 3.118   87.529   100.872 1.00 18.00 ? 242 THR A CB  1 
ATOM   1221  O OG1 . THR A 1 161 ? 1.920   87.654   100.099 1.00 16.57 ? 242 THR A OG1 1 
ATOM   1222  C CG2 . THR A 1 161 ? 3.254   88.729   101.807 1.00 18.87 ? 242 THR A CG2 1 
ATOM   1223  N N   . ASP A 1 162 ? 6.185   88.602   100.938 1.00 20.13 ? 243 ASP A N   1 
ATOM   1224  C CA  . ASP A 1 162 ? 7.375   88.755   101.755 1.00 20.39 ? 243 ASP A CA  1 
ATOM   1225  C C   . ASP A 1 162 ? 7.196   90.091   102.444 1.00 21.62 ? 243 ASP A C   1 
ATOM   1226  O O   . ASP A 1 162 ? 6.955   91.116   101.796 1.00 22.88 ? 243 ASP A O   1 
ATOM   1227  C CB  . ASP A 1 162 ? 8.631   88.754   100.881 1.00 20.85 ? 243 ASP A CB  1 
ATOM   1228  C CG  . ASP A 1 162 ? 9.893   88.397   101.660 1.00 20.14 ? 243 ASP A CG  1 
ATOM   1229  O OD1 . ASP A 1 162 ? 10.912  88.088   101.008 1.00 18.95 ? 243 ASP A OD1 1 
ATOM   1230  O OD2 . ASP A 1 162 ? 9.869   88.428   102.913 1.00 19.21 ? 243 ASP A OD2 1 
ATOM   1231  N N   . GLY A 1 163 ? 7.292   90.080   103.762 1.00 21.25 ? 244 GLY A N   1 
ATOM   1232  C CA  . GLY A 1 163 ? 7.116   91.303   104.508 1.00 21.20 ? 244 GLY A CA  1 
ATOM   1233  C C   . GLY A 1 163 ? 6.270   91.037   105.738 1.00 21.87 ? 244 GLY A C   1 
ATOM   1234  O O   . GLY A 1 163 ? 6.097   89.889   106.146 1.00 22.84 ? 244 GLY A O   1 
ATOM   1235  N N   . PRO A 1 164 ? 5.729   92.088   106.358 1.00 21.51 ? 245 PRO A N   1 
ATOM   1236  C CA  . PRO A 1 164 ? 4.901   91.946   107.560 1.00 20.46 ? 245 PRO A CA  1 
ATOM   1237  C C   . PRO A 1 164 ? 3.490   91.381   107.369 1.00 18.97 ? 245 PRO A C   1 
ATOM   1238  O O   . PRO A 1 164 ? 2.806   91.699   106.395 1.00 18.63 ? 245 PRO A O   1 
ATOM   1239  C CB  . PRO A 1 164 ? 4.849   93.375   108.120 1.00 20.01 ? 245 PRO A CB  1 
ATOM   1240  C CG  . PRO A 1 164 ? 6.088   94.021   107.572 1.00 21.17 ? 245 PRO A CG  1 
ATOM   1241  C CD  . PRO A 1 164 ? 6.121   93.495   106.159 1.00 22.47 ? 245 PRO A CD  1 
ATOM   1242  N N   . SER A 1 165 ? 3.068   90.537   108.305 1.00 16.47 ? 246 SER A N   1 
ATOM   1243  C CA  . SER A 1 165 ? 1.716   90.014   108.275 1.00 17.78 ? 246 SER A CA  1 
ATOM   1244  C C   . SER A 1 165 ? 0.980   91.093   109.065 1.00 17.84 ? 246 SER A C   1 
ATOM   1245  O O   . SER A 1 165 ? -0.235  91.062   109.243 1.00 17.71 ? 246 SER A O   1 
ATOM   1246  C CB  . SER A 1 165 ? 1.632   88.650   108.977 1.00 17.06 ? 246 SER A CB  1 
ATOM   1247  O OG  . SER A 1 165 ? 2.086   88.686   110.319 1.00 17.05 ? 246 SER A OG  1 
ATOM   1248  N N   . ASN A 1 166 ? 1.775   92.079   109.477 1.00 18.92 ? 247 ASN A N   1 
ATOM   1249  C CA  . ASN A 1 166 ? 1.379   93.229   110.282 1.00 19.28 ? 247 ASN A CA  1 
ATOM   1250  C C   . ASN A 1 166 ? 0.971   94.522   109.551 1.00 19.62 ? 247 ASN A C   1 
ATOM   1251  O O   . ASN A 1 166 ? 0.338   95.388   110.149 1.00 18.83 ? 247 ASN A O   1 
ATOM   1252  C CB  . ASN A 1 166 ? 2.532   93.573   111.222 1.00 17.32 ? 247 ASN A CB  1 
ATOM   1253  C CG  . ASN A 1 166 ? 2.131   93.498   112.664 1.00 18.57 ? 247 ASN A CG  1 
ATOM   1254  O OD1 . ASN A 1 166 ? 0.952   93.336   112.972 1.00 21.15 ? 247 ASN A OD1 1 
ATOM   1255  N ND2 . ASN A 1 166 ? 3.100   93.621   113.563 1.00 16.08 ? 247 ASN A ND2 1 
ATOM   1256  N N   . GLY A 1 167 ? 1.367   94.673   108.288 1.00 19.48 ? 248 GLY A N   1 
ATOM   1257  C CA  . GLY A 1 167 ? 1.038   95.873   107.537 1.00 18.63 ? 248 GLY A CA  1 
ATOM   1258  C C   . GLY A 1 167 ? 1.415   95.707   106.072 1.00 20.78 ? 248 GLY A C   1 
ATOM   1259  O O   . GLY A 1 167 ? 1.420   94.579   105.561 1.00 19.82 ? 248 GLY A O   1 
ATOM   1260  N N   . GLN A 1 168 ? 1.729   96.816   105.395 1.00 20.62 ? 249 GLN A N   1 
ATOM   1261  C CA  . GLN A 1 168 ? 2.108   96.794   103.979 1.00 19.77 ? 249 GLN A CA  1 
ATOM   1262  C C   . GLN A 1 168 ? 3.204   95.767   103.722 1.00 19.68 ? 249 GLN A C   1 
ATOM   1263  O O   . GLN A 1 168 ? 4.280   95.851   104.307 1.00 20.48 ? 249 GLN A O   1 
ATOM   1264  C CB  . GLN A 1 168 ? 2.640   98.168   103.540 1.00 20.37 ? 249 GLN A CB  1 
ATOM   1265  C CG  . GLN A 1 168 ? 1.855   98.864   102.433 1.00 21.92 ? 249 GLN A CG  1 
ATOM   1266  C CD  . GLN A 1 168 ? 1.507   97.948   101.273 1.00 23.74 ? 249 GLN A CD  1 
ATOM   1267  O OE1 . GLN A 1 168 ? 2.339   97.171   100.805 1.00 27.13 ? 249 GLN A OE1 1 
ATOM   1268  N NE2 . GLN A 1 168 ? 0.274   98.042   100.798 1.00 23.97 ? 249 GLN A NE2 1 
ATOM   1269  N N   . ALA A 1 169 ? 2.942   94.807   102.844 1.00 18.79 ? 250 ALA A N   1 
ATOM   1270  C CA  . ALA A 1 169 ? 3.944   93.799   102.512 1.00 17.00 ? 250 ALA A CA  1 
ATOM   1271  C C   . ALA A 1 169 ? 4.130   93.773   101.000 1.00 16.74 ? 250 ALA A C   1 
ATOM   1272  O O   . ALA A 1 169 ? 3.350   94.378   100.269 1.00 17.10 ? 250 ALA A O   1 
ATOM   1273  C CB  . ALA A 1 169 ? 3.515   92.434   103.017 1.00 16.68 ? 250 ALA A CB  1 
ATOM   1274  N N   . SER A 1 170 ? 5.162   93.078   100.533 1.00 15.85 ? 251 SER A N   1 
ATOM   1275  C CA  . SER A 1 170 ? 5.443   92.997   99.108  1.00 14.41 ? 251 SER A CA  1 
ATOM   1276  C C   . SER A 1 170 ? 4.795   91.749   98.505  1.00 14.77 ? 251 SER A C   1 
ATOM   1277  O O   . SER A 1 170 ? 4.950   90.637   99.015  1.00 15.16 ? 251 SER A O   1 
ATOM   1278  C CB  . SER A 1 170 ? 6.962   92.992   98.877  1.00 15.66 ? 251 SER A CB  1 
ATOM   1279  O OG  . SER A 1 170 ? 7.296   92.980   97.496  1.00 16.54 ? 251 SER A OG  1 
ATOM   1280  N N   . TYR A 1 171 ? 4.070   91.943   97.411  1.00 14.28 ? 252 TYR A N   1 
ATOM   1281  C CA  . TYR A 1 171 ? 3.385   90.849   96.746  1.00 14.04 ? 252 TYR A CA  1 
ATOM   1282  C C   . TYR A 1 171 ? 3.882   90.613   95.323  1.00 15.37 ? 252 TYR A C   1 
ATOM   1283  O O   . TYR A 1 171 ? 4.092   91.559   94.556  1.00 17.17 ? 252 TYR A O   1 
ATOM   1284  C CB  . TYR A 1 171 ? 1.888   91.138   96.720  1.00 12.14 ? 252 TYR A CB  1 
ATOM   1285  C CG  . TYR A 1 171 ? 1.416   91.819   97.973  1.00 12.56 ? 252 TYR A CG  1 
ATOM   1286  C CD1 . TYR A 1 171 ? 1.040   93.159   97.964  1.00 10.94 ? 252 TYR A CD1 1 
ATOM   1287  C CD2 . TYR A 1 171 ? 1.411   91.141   99.193  1.00 13.62 ? 252 TYR A CD2 1 
ATOM   1288  C CE1 . TYR A 1 171 ? 0.678   93.810   99.143  1.00 11.43 ? 252 TYR A CE1 1 
ATOM   1289  C CE2 . TYR A 1 171 ? 1.051   91.784   100.374 1.00 13.38 ? 252 TYR A CE2 1 
ATOM   1290  C CZ  . TYR A 1 171 ? 0.689   93.112   100.343 1.00 11.77 ? 252 TYR A CZ  1 
ATOM   1291  O OH  . TYR A 1 171 ? 0.339   93.728   101.516 1.00 13.26 ? 252 TYR A OH  1 
ATOM   1292  N N   . LYS A 1 172 ? 4.048   89.344   94.964  1.00 15.35 ? 253 LYS A N   1 
ATOM   1293  C CA  . LYS A 1 172 ? 4.506   88.997   93.628  1.00 15.47 ? 253 LYS A CA  1 
ATOM   1294  C C   . LYS A 1 172 ? 3.765   87.822   92.993  1.00 15.71 ? 253 LYS A C   1 
ATOM   1295  O O   . LYS A 1 172 ? 3.369   86.872   93.671  1.00 15.63 ? 253 LYS A O   1 
ATOM   1296  C CB  . LYS A 1 172 ? 5.997   88.672   93.650  1.00 16.29 ? 253 LYS A CB  1 
ATOM   1297  C CG  . LYS A 1 172 ? 6.906   89.824   93.993  1.00 16.45 ? 253 LYS A CG  1 
ATOM   1298  C CD  . LYS A 1 172 ? 8.328   89.408   93.716  1.00 18.46 ? 253 LYS A CD  1 
ATOM   1299  C CE  . LYS A 1 172 ? 9.331   90.478   94.091  1.00 19.78 ? 253 LYS A CE  1 
ATOM   1300  N NZ  . LYS A 1 172 ? 10.679  90.094   93.579  1.00 20.99 ? 253 LYS A NZ  1 
ATOM   1301  N N   . ILE A 1 173 ? 3.594   87.902   91.678  1.00 15.00 ? 254 ILE A N   1 
ATOM   1302  C CA  . ILE A 1 173 ? 2.945   86.851   90.900  1.00 16.74 ? 254 ILE A CA  1 
ATOM   1303  C C   . ILE A 1 173 ? 4.011   86.173   90.056  1.00 17.50 ? 254 ILE A C   1 
ATOM   1304  O O   . ILE A 1 173 ? 4.766   86.841   89.346  1.00 16.97 ? 254 ILE A O   1 
ATOM   1305  C CB  . ILE A 1 173 ? 1.918   87.403   89.921  1.00 17.38 ? 254 ILE A CB  1 
ATOM   1306  C CG1 . ILE A 1 173 ? 0.695   87.927   90.660  1.00 19.83 ? 254 ILE A CG1 1 
ATOM   1307  C CG2 . ILE A 1 173 ? 1.527   86.318   88.949  1.00 19.77 ? 254 ILE A CG2 1 
ATOM   1308  C CD1 . ILE A 1 173 ? -0.284  88.615   89.733  1.00 21.52 ? 254 ILE A CD1 1 
ATOM   1309  N N   . PHE A 1 174 ? 4.071   84.849   90.112  1.00 17.67 ? 255 PHE A N   1 
ATOM   1310  C CA  . PHE A 1 174 ? 5.063   84.141   89.325  1.00 16.41 ? 255 PHE A CA  1 
ATOM   1311  C C   . PHE A 1 174 ? 4.433   83.287   88.243  1.00 15.89 ? 255 PHE A C   1 
ATOM   1312  O O   . PHE A 1 174 ? 3.390   82.674   88.444  1.00 16.19 ? 255 PHE A O   1 
ATOM   1313  C CB  . PHE A 1 174 ? 5.942   83.274   90.227  1.00 17.18 ? 255 PHE A CB  1 
ATOM   1314  C CG  . PHE A 1 174 ? 6.676   84.048   91.287  1.00 16.90 ? 255 PHE A CG  1 
ATOM   1315  C CD1 . PHE A 1 174 ? 6.007   84.518   92.414  1.00 18.38 ? 255 PHE A CD1 1 
ATOM   1316  C CD2 . PHE A 1 174 ? 8.036   84.306   91.162  1.00 17.18 ? 255 PHE A CD2 1 
ATOM   1317  C CE1 . PHE A 1 174 ? 6.687   85.233   93.405  1.00 17.18 ? 255 PHE A CE1 1 
ATOM   1318  C CE2 . PHE A 1 174 ? 8.721   85.018   92.143  1.00 16.39 ? 255 PHE A CE2 1 
ATOM   1319  C CZ  . PHE A 1 174 ? 8.044   85.480   93.267  1.00 17.09 ? 255 PHE A CZ  1 
ATOM   1320  N N   . LYS A 1 175 ? 5.064   83.288   87.075  1.00 16.28 ? 256 LYS A N   1 
ATOM   1321  C CA  . LYS A 1 175 ? 4.609   82.491   85.944  1.00 15.77 ? 256 LYS A CA  1 
ATOM   1322  C C   . LYS A 1 175 ? 5.728   81.495   85.693  1.00 16.39 ? 256 LYS A C   1 
ATOM   1323  O O   . LYS A 1 175 ? 6.895   81.881   85.604  1.00 18.78 ? 256 LYS A O   1 
ATOM   1324  C CB  . LYS A 1 175 ? 4.409   83.351   84.700  1.00 14.02 ? 256 LYS A CB  1 
ATOM   1325  C CG  . LYS A 1 175 ? 4.025   82.521   83.485  1.00 14.64 ? 256 LYS A CG  1 
ATOM   1326  C CD  . LYS A 1 175 ? 4.015   83.319   82.198  1.00 14.42 ? 256 LYS A CD  1 
ATOM   1327  C CE  . LYS A 1 175 ? 3.668   82.419   81.034  1.00 15.57 ? 256 LYS A CE  1 
ATOM   1328  N NZ  . LYS A 1 175 ? 3.453   83.195   79.803  1.00 17.47 ? 256 LYS A NZ  1 
ATOM   1329  N N   . MET A 1 176 ? 5.391   80.218   85.580  1.00 16.02 ? 257 MET A N   1 
ATOM   1330  C CA  . MET A 1 176 ? 6.423   79.217   85.367  1.00 16.13 ? 257 MET A CA  1 
ATOM   1331  C C   . MET A 1 176 ? 6.076   78.169   84.338  1.00 15.67 ? 257 MET A C   1 
ATOM   1332  O O   . MET A 1 176 ? 4.905   77.886   84.090  1.00 15.76 ? 257 MET A O   1 
ATOM   1333  C CB  . MET A 1 176 ? 6.763   78.552   86.697  1.00 17.02 ? 257 MET A CB  1 
ATOM   1334  C CG  . MET A 1 176 ? 5.651   78.663   87.693  1.00 19.14 ? 257 MET A CG  1 
ATOM   1335  S SD  . MET A 1 176 ? 6.209   78.980   89.387  1.00 20.04 ? 257 MET A SD  1 
ATOM   1336  C CE  . MET A 1 176 ? 4.666   78.803   90.187  1.00 18.42 ? 257 MET A CE  1 
ATOM   1337  N N   . GLU A 1 177 ? 7.117   77.602   83.742  1.00 15.11 ? 258 GLU A N   1 
ATOM   1338  C CA  . GLU A 1 177 ? 6.969   76.569   82.728  1.00 17.34 ? 258 GLU A CA  1 
ATOM   1339  C C   . GLU A 1 177 ? 7.953   75.437   83.034  1.00 17.75 ? 258 GLU A C   1 
ATOM   1340  O O   . GLU A 1 177 ? 9.167   75.649   83.105  1.00 18.45 ? 258 GLU A O   1 
ATOM   1341  C CB  . GLU A 1 177 ? 7.200   77.179   81.335  1.00 16.82 ? 258 GLU A CB  1 
ATOM   1342  C CG  . GLU A 1 177 ? 6.150   78.248   81.001  1.00 20.00 ? 258 GLU A CG  1 
ATOM   1343  C CD  . GLU A 1 177 ? 6.322   78.905   79.634  1.00 21.70 ? 258 GLU A CD  1 
ATOM   1344  O OE1 . GLU A 1 177 ? 5.491   79.785   79.306  1.00 20.98 ? 258 GLU A OE1 1 
ATOM   1345  O OE2 . GLU A 1 177 ? 7.273   78.550   78.892  1.00 24.44 ? 258 GLU A OE2 1 
ATOM   1346  N N   . LYS A 1 178 ? 7.407   74.239   83.230  1.00 18.65 ? 259 LYS A N   1 
ATOM   1347  C CA  . LYS A 1 178 ? 8.181   73.053   83.574  1.00 18.46 ? 259 LYS A CA  1 
ATOM   1348  C C   . LYS A 1 178 ? 8.910   73.294   84.878  1.00 18.40 ? 259 LYS A C   1 
ATOM   1349  O O   . LYS A 1 178 ? 10.021  72.802   85.080  1.00 18.47 ? 259 LYS A O   1 
ATOM   1350  C CB  . LYS A 1 178 ? 9.192   72.721   82.491  1.00 20.45 ? 259 LYS A CB  1 
ATOM   1351  C CG  . LYS A 1 178 ? 8.591   72.421   81.147  1.00 23.51 ? 259 LYS A CG  1 
ATOM   1352  C CD  . LYS A 1 178 ? 9.701   72.020   80.189  1.00 26.95 ? 259 LYS A CD  1 
ATOM   1353  C CE  . LYS A 1 178 ? 9.295   72.236   78.735  1.00 29.70 ? 259 LYS A CE  1 
ATOM   1354  N NZ  . LYS A 1 178 ? 10.400  71.825   77.810  1.00 33.29 ? 259 LYS A NZ  1 
ATOM   1355  N N   . GLY A 1 179 ? 8.287   74.080   85.751  1.00 18.13 ? 260 GLY A N   1 
ATOM   1356  C CA  . GLY A 1 179 ? 8.873   74.372   87.047  1.00 17.29 ? 260 GLY A CA  1 
ATOM   1357  C C   . GLY A 1 179 ? 9.911   75.478   87.105  1.00 17.89 ? 260 GLY A C   1 
ATOM   1358  O O   . GLY A 1 179 ? 10.545  75.677   88.140  1.00 18.33 ? 260 GLY A O   1 
ATOM   1359  N N   . LYS A 1 180 ? 10.099  76.202   86.007  1.00 18.80 ? 261 LYS A N   1 
ATOM   1360  C CA  . LYS A 1 180 ? 11.077  77.290   85.981  1.00 19.44 ? 261 LYS A CA  1 
ATOM   1361  C C   . LYS A 1 180 ? 10.370  78.640   85.841  1.00 17.56 ? 261 LYS A C   1 
ATOM   1362  O O   . LYS A 1 180 ? 9.460   78.787   85.022  1.00 17.74 ? 261 LYS A O   1 
ATOM   1363  C CB  . LYS A 1 180 ? 12.068  77.077   84.820  1.00 20.88 ? 261 LYS A CB  1 
ATOM   1364  C CG  . LYS A 1 180 ? 13.096  78.192   84.644  1.00 24.29 ? 261 LYS A CG  1 
ATOM   1365  C CD  . LYS A 1 180 ? 14.158  77.861   83.583  1.00 25.75 ? 261 LYS A CD  1 
ATOM   1366  C CE  . LYS A 1 180 ? 15.360  77.107   84.171  1.00 30.06 ? 261 LYS A CE  1 
ATOM   1367  N NZ  . LYS A 1 180 ? 15.102  75.659   84.558  1.00 30.49 ? 261 LYS A NZ  1 
ATOM   1368  N N   . VAL A 1 181 ? 10.778  79.617   86.649  1.00 16.06 ? 262 VAL A N   1 
ATOM   1369  C CA  . VAL A 1 181 ? 10.179  80.953   86.596  1.00 15.30 ? 262 VAL A CA  1 
ATOM   1370  C C   . VAL A 1 181 ? 10.578  81.648   85.292  1.00 15.37 ? 262 VAL A C   1 
ATOM   1371  O O   . VAL A 1 181 ? 11.743  81.965   85.100  1.00 16.59 ? 262 VAL A O   1 
ATOM   1372  C CB  . VAL A 1 181 ? 10.636  81.832   87.797  1.00 13.91 ? 262 VAL A CB  1 
ATOM   1373  C CG1 . VAL A 1 181 ? 10.070  83.234   87.664  1.00 11.83 ? 262 VAL A CG1 1 
ATOM   1374  C CG2 . VAL A 1 181 ? 10.177  81.214   89.107  1.00 11.51 ? 262 VAL A CG2 1 
ATOM   1375  N N   . VAL A 1 182 ? 9.613   81.869   84.401  1.00 14.98 ? 263 VAL A N   1 
ATOM   1376  C CA  . VAL A 1 182 ? 9.881   82.519   83.113  1.00 16.11 ? 263 VAL A CA  1 
ATOM   1377  C C   . VAL A 1 182 ? 9.571   84.016   83.143  1.00 17.55 ? 263 VAL A C   1 
ATOM   1378  O O   . VAL A 1 182 ? 10.046  84.771   82.288  1.00 18.00 ? 263 VAL A O   1 
ATOM   1379  C CB  . VAL A 1 182 ? 9.071   81.867   81.956  1.00 15.38 ? 263 VAL A CB  1 
ATOM   1380  C CG1 . VAL A 1 182 ? 9.633   80.500   81.634  1.00 14.63 ? 263 VAL A CG1 1 
ATOM   1381  C CG2 . VAL A 1 182 ? 7.604   81.745   82.346  1.00 13.23 ? 263 VAL A CG2 1 
ATOM   1382  N N   . LYS A 1 183 ? 8.757   84.428   84.116  1.00 17.88 ? 264 LYS A N   1 
ATOM   1383  C CA  . LYS A 1 183 ? 8.396   85.828   84.311  1.00 17.64 ? 264 LYS A CA  1 
ATOM   1384  C C   . LYS A 1 183 ? 7.827   86.029   85.699  1.00 18.40 ? 264 LYS A C   1 
ATOM   1385  O O   . LYS A 1 183 ? 7.310   85.097   86.303  1.00 18.77 ? 264 LYS A O   1 
ATOM   1386  C CB  . LYS A 1 183 ? 7.362   86.298   83.300  1.00 17.85 ? 264 LYS A CB  1 
ATOM   1387  C CG  . LYS A 1 183 ? 7.054   87.780   83.459  1.00 17.69 ? 264 LYS A CG  1 
ATOM   1388  C CD  . LYS A 1 183 ? 6.217   88.317   82.331  1.00 19.96 ? 264 LYS A CD  1 
ATOM   1389  C CE  . LYS A 1 183 ? 6.270   89.837   82.314  1.00 21.57 ? 264 LYS A CE  1 
ATOM   1390  N NZ  . LYS A 1 183 ? 5.504   90.403   81.165  1.00 24.30 ? 264 LYS A NZ  1 
ATOM   1391  N N   . SER A 1 184 ? 7.920   87.255   86.199  1.00 19.91 ? 265 SER A N   1 
ATOM   1392  C CA  . SER A 1 184 ? 7.412   87.590   87.522  1.00 19.50 ? 265 SER A CA  1 
ATOM   1393  C C   . SER A 1 184 ? 7.120   89.077   87.608  1.00 19.57 ? 265 SER A C   1 
ATOM   1394  O O   . SER A 1 184 ? 7.826   89.895   87.016  1.00 21.74 ? 265 SER A O   1 
ATOM   1395  C CB  . SER A 1 184 ? 8.445   87.242   88.585  1.00 20.27 ? 265 SER A CB  1 
ATOM   1396  O OG  . SER A 1 184 ? 9.453   88.238   88.636  1.00 19.91 ? 265 SER A OG  1 
ATOM   1397  N N   . VAL A 1 185 ? 6.088   89.432   88.359  1.00 18.91 ? 266 VAL A N   1 
ATOM   1398  C CA  . VAL A 1 185 ? 5.728   90.830   88.520  1.00 17.61 ? 266 VAL A CA  1 
ATOM   1399  C C   . VAL A 1 185 ? 5.368   91.116   89.960  1.00 18.38 ? 266 VAL A C   1 
ATOM   1400  O O   . VAL A 1 185 ? 4.799   90.264   90.645  1.00 17.12 ? 266 VAL A O   1 
ATOM   1401  C CB  . VAL A 1 185 ? 4.524   91.201   87.652  1.00 18.22 ? 266 VAL A CB  1 
ATOM   1402  C CG1 . VAL A 1 185 ? 4.139   92.639   87.910  1.00 17.04 ? 266 VAL A CG1 1 
ATOM   1403  C CG2 . VAL A 1 185 ? 4.851   90.977   86.181  1.00 18.53 ? 266 VAL A CG2 1 
ATOM   1404  N N   . GLU A 1 186 ? 5.710   92.310   90.434  1.00 20.06 ? 267 GLU A N   1 
ATOM   1405  C CA  . GLU A 1 186 ? 5.363   92.668   91.797  1.00 22.23 ? 267 GLU A CA  1 
ATOM   1406  C C   . GLU A 1 186 ? 4.155   93.570   91.736  1.00 22.36 ? 267 GLU A C   1 
ATOM   1407  O O   . GLU A 1 186 ? 4.137   94.533   90.981  1.00 23.90 ? 267 GLU A O   1 
ATOM   1408  C CB  . GLU A 1 186 ? 6.494   93.402   92.504  1.00 22.29 ? 267 GLU A CB  1 
ATOM   1409  C CG  . GLU A 1 186 ? 6.158   93.677   93.963  1.00 23.38 ? 267 GLU A CG  1 
ATOM   1410  C CD  . GLU A 1 186 ? 7.309   94.294   94.711  1.00 25.29 ? 267 GLU A CD  1 
ATOM   1411  O OE1 . GLU A 1 186 ? 8.461   93.855   94.509  1.00 26.74 ? 267 GLU A OE1 1 
ATOM   1412  O OE2 . GLU A 1 186 ? 7.063   95.209   95.516  1.00 27.37 ? 267 GLU A OE2 1 
ATOM   1413  N N   . LEU A 1 187 ? 3.142   93.252   92.529  1.00 22.34 ? 268 LEU A N   1 
ATOM   1414  C CA  . LEU A 1 187 ? 1.935   94.050   92.538  1.00 22.47 ? 268 LEU A CA  1 
ATOM   1415  C C   . LEU A 1 187 ? 2.127   95.431   93.160  1.00 22.71 ? 268 LEU A C   1 
ATOM   1416  O O   . LEU A 1 187 ? 2.804   95.605   94.183  1.00 21.44 ? 268 LEU A O   1 
ATOM   1417  C CB  . LEU A 1 187 ? 0.822   93.308   93.278  1.00 22.51 ? 268 LEU A CB  1 
ATOM   1418  C CG  . LEU A 1 187 ? 0.406   91.946   92.711  1.00 22.16 ? 268 LEU A CG  1 
ATOM   1419  C CD1 . LEU A 1 187 ? -0.806  91.448   93.482  1.00 19.54 ? 268 LEU A CD1 1 
ATOM   1420  C CD2 . LEU A 1 187 ? 0.076   92.066   91.219  1.00 21.22 ? 268 LEU A CD2 1 
ATOM   1421  N N   . ASP A 1 188 ? 1.526   96.412   92.505  1.00 23.65 ? 269 ASP A N   1 
ATOM   1422  C CA  . ASP A 1 188 ? 1.552   97.788   92.958  1.00 23.74 ? 269 ASP A CA  1 
ATOM   1423  C C   . ASP A 1 188 ? 0.227   97.900   93.703  1.00 23.76 ? 269 ASP A C   1 
ATOM   1424  O O   . ASP A 1 188 ? -0.742  98.472   93.204  1.00 23.92 ? 269 ASP A O   1 
ATOM   1425  C CB  . ASP A 1 188 ? 1.574   98.728   91.753  1.00 24.07 ? 269 ASP A CB  1 
ATOM   1426  C CG  . ASP A 1 188 ? 1.772   100.179  92.145  1.00 23.92 ? 269 ASP A CG  1 
ATOM   1427  O OD1 . ASP A 1 188 ? 2.024   100.450  93.336  1.00 24.00 ? 269 ASP A OD1 1 
ATOM   1428  O OD2 . ASP A 1 188 ? 1.688   101.049  91.251  1.00 26.05 ? 269 ASP A OD2 1 
ATOM   1429  N N   . ALA A 1 189 ? 0.191   97.323   94.896  1.00 23.43 ? 270 ALA A N   1 
ATOM   1430  C CA  . ALA A 1 189 ? -1.017  97.316   95.694  1.00 22.54 ? 270 ALA A CA  1 
ATOM   1431  C C   . ALA A 1 189 ? -0.881  98.086   96.999  1.00 21.28 ? 270 ALA A C   1 
ATOM   1432  O O   . ALA A 1 189 ? -0.808  97.504   98.083  1.00 21.28 ? 270 ALA A O   1 
ATOM   1433  C CB  . ALA A 1 189 ? -1.429  95.878   95.973  1.00 23.08 ? 270 ALA A CB  1 
ATOM   1434  N N   . PRO A 1 190 ? -0.828  99.414   96.916  1.00 19.82 ? 271 PRO A N   1 
ATOM   1435  C CA  . PRO A 1 190 ? -0.709  100.142  98.178  1.00 18.93 ? 271 PRO A CA  1 
ATOM   1436  C C   . PRO A 1 190 ? -2.004  100.008  98.988  1.00 17.93 ? 271 PRO A C   1 
ATOM   1437  O O   . PRO A 1 190 ? -3.101  100.056  98.433  1.00 16.66 ? 271 PRO A O   1 
ATOM   1438  C CB  . PRO A 1 190 ? -0.429  101.573  97.721  1.00 19.07 ? 271 PRO A CB  1 
ATOM   1439  C CG  . PRO A 1 190 ? -1.123  101.648  96.382  1.00 19.01 ? 271 PRO A CG  1 
ATOM   1440  C CD  . PRO A 1 190 ? -0.743  100.325  95.761  1.00 19.84 ? 271 PRO A CD  1 
ATOM   1441  N N   . ASN A 1 191 ? -1.853  99.823   100.297 1.00 18.05 ? 272 ASN A N   1 
ATOM   1442  C CA  . ASN A 1 191 ? -2.966  99.670   101.239 1.00 17.66 ? 272 ASN A CA  1 
ATOM   1443  C C   . ASN A 1 191 ? -3.688  98.319   101.114 1.00 18.77 ? 272 ASN A C   1 
ATOM   1444  O O   . ASN A 1 191 ? -4.724  98.081   101.739 1.00 17.93 ? 272 ASN A O   1 
ATOM   1445  C CB  . ASN A 1 191 ? -3.959  100.824  101.085 1.00 15.09 ? 272 ASN A CB  1 
ATOM   1446  C CG  . ASN A 1 191 ? -4.929  100.908  102.245 1.00 14.89 ? 272 ASN A CG  1 
ATOM   1447  O OD1 . ASN A 1 191 ? -4.531  100.839  103.404 1.00 12.31 ? 272 ASN A OD1 1 
ATOM   1448  N ND2 . ASN A 1 191 ? -6.204  101.064  101.937 1.00 15.61 ? 272 ASN A ND2 1 
ATOM   1449  N N   . TYR A 1 192 ? -3.123  97.434   100.297 1.00 19.10 ? 273 TYR A N   1 
ATOM   1450  C CA  . TYR A 1 192 ? -3.671  96.098   100.106 1.00 18.81 ? 273 TYR A CA  1 
ATOM   1451  C C   . TYR A 1 192 ? -2.814  95.114   100.909 1.00 18.33 ? 273 TYR A C   1 
ATOM   1452  O O   . TYR A 1 192 ? -1.695  95.439   101.299 1.00 16.95 ? 273 TYR A O   1 
ATOM   1453  C CB  . TYR A 1 192 ? -3.599  95.698   98.636  1.00 18.80 ? 273 TYR A CB  1 
ATOM   1454  C CG  . TYR A 1 192 ? -4.723  96.190   97.771  1.00 18.77 ? 273 TYR A CG  1 
ATOM   1455  C CD1 . TYR A 1 192 ? -4.884  97.542   97.498  1.00 18.48 ? 273 TYR A CD1 1 
ATOM   1456  C CD2 . TYR A 1 192 ? -5.598  95.283   97.166  1.00 19.28 ? 273 TYR A CD2 1 
ATOM   1457  C CE1 . TYR A 1 192 ? -5.883  97.981   96.639  1.00 18.53 ? 273 TYR A CE1 1 
ATOM   1458  C CE2 . TYR A 1 192 ? -6.594  95.708   96.309  1.00 17.62 ? 273 TYR A CE2 1 
ATOM   1459  C CZ  . TYR A 1 192 ? -6.731  97.054   96.048  1.00 18.72 ? 273 TYR A CZ  1 
ATOM   1460  O OH  . TYR A 1 192 ? -7.703  97.458   95.170  1.00 20.82 ? 273 TYR A OH  1 
ATOM   1461  N N   . HIS A 1 193 ? -3.341  93.919   101.153 1.00 18.37 ? 274 HIS A N   1 
ATOM   1462  C CA  . HIS A 1 193 ? -2.586  92.887   101.861 1.00 18.21 ? 274 HIS A CA  1 
ATOM   1463  C C   . HIS A 1 193 ? -3.000  91.542   101.301 1.00 18.35 ? 274 HIS A C   1 
ATOM   1464  O O   . HIS A 1 193 ? -4.185  91.201   101.309 1.00 17.69 ? 274 HIS A O   1 
ATOM   1465  C CB  . HIS A 1 193 ? -2.859  92.914   103.365 1.00 17.96 ? 274 HIS A CB  1 
ATOM   1466  C CG  . HIS A 1 193 ? -1.788  92.256   104.181 1.00 18.41 ? 274 HIS A CG  1 
ATOM   1467  N ND1 . HIS A 1 193 ? -1.991  91.086   104.883 1.00 17.22 ? 274 HIS A ND1 1 
ATOM   1468  C CD2 . HIS A 1 193 ? -0.507  92.621   104.431 1.00 18.59 ? 274 HIS A CD2 1 
ATOM   1469  C CE1 . HIS A 1 193 ? -0.887  90.766   105.532 1.00 16.76 ? 274 HIS A CE1 1 
ATOM   1470  N NE2 . HIS A 1 193 ? 0.031   91.681   105.275 1.00 17.51 ? 274 HIS A NE2 1 
ATOM   1471  N N   . TYR A 1 194 ? -2.024  90.789   100.803 1.00 18.22 ? 275 TYR A N   1 
ATOM   1472  C CA  . TYR A 1 194 ? -2.293  89.481   100.230 1.00 16.41 ? 275 TYR A CA  1 
ATOM   1473  C C   . TYR A 1 194 ? -1.562  88.355   100.921 1.00 16.40 ? 275 TYR A C   1 
ATOM   1474  O O   . TYR A 1 194 ? -0.352  88.412   101.115 1.00 15.31 ? 275 TYR A O   1 
ATOM   1475  C CB  . TYR A 1 194 ? -1.915  89.443   98.750  1.00 17.39 ? 275 TYR A CB  1 
ATOM   1476  C CG  . TYR A 1 194 ? -2.797  90.278   97.860  1.00 19.38 ? 275 TYR A CG  1 
ATOM   1477  C CD1 . TYR A 1 194 ? -2.401  91.544   97.442  1.00 19.77 ? 275 TYR A CD1 1 
ATOM   1478  C CD2 . TYR A 1 194 ? -4.037  89.808   97.449  1.00 19.77 ? 275 TYR A CD2 1 
ATOM   1479  C CE1 . TYR A 1 194 ? -3.224  92.321   96.631  1.00 20.45 ? 275 TYR A CE1 1 
ATOM   1480  C CE2 . TYR A 1 194 ? -4.865  90.577   96.647  1.00 20.45 ? 275 TYR A CE2 1 
ATOM   1481  C CZ  . TYR A 1 194 ? -4.453  91.831   96.240  1.00 20.43 ? 275 TYR A CZ  1 
ATOM   1482  O OH  . TYR A 1 194 ? -5.279  92.587   95.444  1.00 22.17 ? 275 TYR A OH  1 
ATOM   1483  N N   . GLU A 1 195 ? -2.309  87.317   101.276 1.00 17.45 ? 276 GLU A N   1 
ATOM   1484  C CA  . GLU A 1 195 ? -1.734  86.145   101.908 1.00 18.16 ? 276 GLU A CA  1 
ATOM   1485  C C   . GLU A 1 195 ? -2.593  84.916   101.704 1.00 17.63 ? 276 GLU A C   1 
ATOM   1486  O O   . GLU A 1 195 ? -3.814  85.003   101.667 1.00 19.63 ? 276 GLU A O   1 
ATOM   1487  C CB  . GLU A 1 195 ? -1.493  86.397   103.401 1.00 19.83 ? 276 GLU A CB  1 
ATOM   1488  C CG  . GLU A 1 195 ? 0.003   86.550   103.701 1.00 24.91 ? 276 GLU A CG  1 
ATOM   1489  C CD  . GLU A 1 195 ? 0.290   87.481   104.851 1.00 26.23 ? 276 GLU A CD  1 
ATOM   1490  O OE1 . GLU A 1 195 ? 1.470   87.656   105.200 1.00 27.86 ? 276 GLU A OE1 1 
ATOM   1491  O OE2 . GLU A 1 195 ? -0.664  88.044   105.412 1.00 30.74 ? 276 GLU A OE2 1 
ATOM   1492  N N   . GLU A 1 196 ? -1.937  83.775   101.538 1.00 17.18 ? 277 GLU A N   1 
ATOM   1493  C CA  . GLU A 1 196 ? -2.619  82.508   101.349 1.00 15.52 ? 277 GLU A CA  1 
ATOM   1494  C C   . GLU A 1 196 ? -3.742  82.577   100.317 1.00 16.08 ? 277 GLU A C   1 
ATOM   1495  O O   . GLU A 1 196 ? -4.887  82.209   100.593 1.00 17.71 ? 277 GLU A O   1 
ATOM   1496  C CB  . GLU A 1 196 ? -3.152  82.039   102.696 1.00 15.54 ? 277 GLU A CB  1 
ATOM   1497  C CG  . GLU A 1 196 ? -2.106  82.140   103.796 1.00 14.26 ? 277 GLU A CG  1 
ATOM   1498  C CD  . GLU A 1 196 ? -2.611  81.691   105.150 1.00 14.37 ? 277 GLU A CD  1 
ATOM   1499  O OE1 . GLU A 1 196 ? -3.804  81.900   105.446 1.00 15.24 ? 277 GLU A OE1 1 
ATOM   1500  O OE2 . GLU A 1 196 ? -1.810  81.145   105.927 1.00 15.56 ? 277 GLU A OE2 1 
ATOM   1501  N N   . CYS A 1 197 ? -3.400  83.048   99.122  1.00 16.28 ? 278 CYS A N   1 
ATOM   1502  C CA  . CYS A 1 197 ? -4.352  83.162   98.022  1.00 15.76 ? 278 CYS A CA  1 
ATOM   1503  C C   . CYS A 1 197 ? -4.822  81.818   97.492  1.00 15.62 ? 278 CYS A C   1 
ATOM   1504  O O   . CYS A 1 197 ? -4.075  80.838   97.473  1.00 15.51 ? 278 CYS A O   1 
ATOM   1505  C CB  . CYS A 1 197 ? -3.730  83.910   96.840  1.00 15.98 ? 278 CYS A CB  1 
ATOM   1506  S SG  . CYS A 1 197 ? -3.392  85.668   97.129  1.00 18.94 ? 278 CYS A SG  1 
ATOM   1507  N N   . SER A 1 198 ? -6.069  81.794   97.049  1.00 14.09 ? 279 SER A N   1 
ATOM   1508  C CA  . SER A 1 198 ? -6.645  80.610   96.454  1.00 14.16 ? 279 SER A CA  1 
ATOM   1509  C C   . SER A 1 198 ? -6.870  81.054   95.013  1.00 14.41 ? 279 SER A C   1 
ATOM   1510  O O   . SER A 1 198 ? -7.693  81.929   94.743  1.00 13.79 ? 279 SER A O   1 
ATOM   1511  C CB  . SER A 1 198 ? -7.957  80.261   97.149  1.00 15.96 ? 279 SER A CB  1 
ATOM   1512  O OG  . SER A 1 198 ? -7.729  79.938   98.511  1.00 17.65 ? 279 SER A OG  1 
ATOM   1513  N N   . CYS A 1 199 ? -6.112  80.484   94.087  1.00 13.99 ? 280 CYS A N   1 
ATOM   1514  C CA  . CYS A 1 199 ? -6.240  80.893   92.696  1.00 14.62 ? 280 CYS A CA  1 
ATOM   1515  C C   . CYS A 1 199 ? -6.788  79.819   91.778  1.00 15.94 ? 280 CYS A C   1 
ATOM   1516  O O   . CYS A 1 199 ? -6.360  78.671   91.822  1.00 16.02 ? 280 CYS A O   1 
ATOM   1517  C CB  . CYS A 1 199 ? -4.894  81.338   92.149  1.00 15.13 ? 280 CYS A CB  1 
ATOM   1518  S SG  . CYS A 1 199 ? -3.970  82.597   93.092  1.00 16.83 ? 280 CYS A SG  1 
ATOM   1519  N N   . TYR A 1 200 ? -7.738  80.204   90.935  1.00 16.95 ? 281 TYR A N   1 
ATOM   1520  C CA  . TYR A 1 200 ? -8.320  79.273   89.991  1.00 16.38 ? 281 TYR A CA  1 
ATOM   1521  C C   . TYR A 1 200 ? -8.287  79.829   88.575  1.00 17.17 ? 281 TYR A C   1 
ATOM   1522  O O   . TYR A 1 200 ? -8.368  81.039   88.356  1.00 16.39 ? 281 TYR A O   1 
ATOM   1523  C CB  . TYR A 1 200 ? -9.769  78.935   90.369  1.00 15.76 ? 281 TYR A CB  1 
ATOM   1524  C CG  . TYR A 1 200 ? -10.743 80.091   90.293  1.00 17.35 ? 281 TYR A CG  1 
ATOM   1525  C CD1 . TYR A 1 200 ? -11.004 80.886   91.409  1.00 18.39 ? 281 TYR A CD1 1 
ATOM   1526  C CD2 . TYR A 1 200 ? -11.416 80.385   89.106  1.00 17.36 ? 281 TYR A CD2 1 
ATOM   1527  C CE1 . TYR A 1 200 ? -11.918 81.946   91.342  1.00 18.30 ? 281 TYR A CE1 1 
ATOM   1528  C CE2 . TYR A 1 200 ? -12.324 81.436   89.029  1.00 17.74 ? 281 TYR A CE2 1 
ATOM   1529  C CZ  . TYR A 1 200 ? -12.570 82.212   90.147  1.00 18.03 ? 281 TYR A CZ  1 
ATOM   1530  O OH  . TYR A 1 200 ? -13.458 83.257   90.060  1.00 18.79 ? 281 TYR A OH  1 
ATOM   1531  N N   . PRO A 1 201 ? -8.151  78.938   87.588  1.00 18.77 ? 282 PRO A N   1 
ATOM   1532  C CA  . PRO A 1 201 ? -8.118  79.383   86.193  1.00 17.47 ? 282 PRO A CA  1 
ATOM   1533  C C   . PRO A 1 201 ? -9.547  79.575   85.694  1.00 18.09 ? 282 PRO A C   1 
ATOM   1534  O O   . PRO A 1 201 ? -10.465 78.905   86.172  1.00 17.09 ? 282 PRO A O   1 
ATOM   1535  C CB  . PRO A 1 201 ? -7.399  78.234   85.488  1.00 18.10 ? 282 PRO A CB  1 
ATOM   1536  C CG  . PRO A 1 201 ? -7.865  77.031   86.280  1.00 17.58 ? 282 PRO A CG  1 
ATOM   1537  C CD  . PRO A 1 201 ? -7.783  77.514   87.708  1.00 16.47 ? 282 PRO A CD  1 
ATOM   1538  N N   . ASN A 1 202 ? -9.727  80.501   84.750  1.00 18.47 ? 283 ASN A N   1 
ATOM   1539  C CA  . ASN A 1 202 ? -11.038 80.780   84.167  1.00 17.74 ? 283 ASN A CA  1 
ATOM   1540  C C   . ASN A 1 202 ? -10.917 81.585   82.862  1.00 17.41 ? 283 ASN A C   1 
ATOM   1541  O O   . ASN A 1 202 ? -10.389 82.699   82.845  1.00 15.74 ? 283 ASN A O   1 
ATOM   1542  C CB  . ASN A 1 202 ? -11.930 81.520   85.179  1.00 19.18 ? 283 ASN A CB  1 
ATOM   1543  C CG  . ASN A 1 202 ? -13.310 81.830   84.620  1.00 20.22 ? 283 ASN A CG  1 
ATOM   1544  O OD1 . ASN A 1 202 ? -13.495 82.823   83.918  1.00 22.25 ? 283 ASN A OD1 1 
ATOM   1545  N ND2 . ASN A 1 202 ? -14.278 80.968   84.908  1.00 19.62 ? 283 ASN A ND2 1 
ATOM   1546  N N   . ALA A 1 203 ? -11.406 81.000   81.772  1.00 16.49 ? 284 ALA A N   1 
ATOM   1547  C CA  . ALA A 1 203 ? -11.352 81.631   80.461  1.00 16.58 ? 284 ALA A CA  1 
ATOM   1548  C C   . ALA A 1 203 ? -9.943  82.124   80.114  1.00 16.81 ? 284 ALA A C   1 
ATOM   1549  O O   . ALA A 1 203 ? -9.762  83.247   79.638  1.00 16.92 ? 284 ALA A O   1 
ATOM   1550  C CB  . ALA A 1 203 ? -12.353 82.785   80.393  1.00 15.43 ? 284 ALA A CB  1 
ATOM   1551  N N   . GLY A 1 204 ? -8.949  81.280   80.370  1.00 17.17 ? 285 GLY A N   1 
ATOM   1552  C CA  . GLY A 1 204 ? -7.571  81.617   80.052  1.00 18.52 ? 285 GLY A CA  1 
ATOM   1553  C C   . GLY A 1 204 ? -6.827  82.563   80.976  1.00 20.18 ? 285 GLY A C   1 
ATOM   1554  O O   . GLY A 1 204 ? -5.684  82.926   80.689  1.00 21.24 ? 285 GLY A O   1 
ATOM   1555  N N   . GLU A 1 205 ? -7.454  82.959   82.079  1.00 20.52 ? 286 GLU A N   1 
ATOM   1556  C CA  . GLU A 1 205 ? -6.831  83.867   83.032  1.00 20.91 ? 286 GLU A CA  1 
ATOM   1557  C C   . GLU A 1 205 ? -6.969  83.326   84.447  1.00 20.93 ? 286 GLU A C   1 
ATOM   1558  O O   . GLU A 1 205 ? -7.704  82.368   84.681  1.00 21.44 ? 286 GLU A O   1 
ATOM   1559  C CB  . GLU A 1 205 ? -7.478  85.245   82.926  1.00 23.35 ? 286 GLU A CB  1 
ATOM   1560  C CG  . GLU A 1 205 ? -7.332  85.839   81.542  1.00 28.20 ? 286 GLU A CG  1 
ATOM   1561  C CD  . GLU A 1 205 ? -7.936  87.223   81.417  1.00 30.02 ? 286 GLU A CD  1 
ATOM   1562  O OE1 . GLU A 1 205 ? -7.568  88.113   82.216  1.00 31.04 ? 286 GLU A OE1 1 
ATOM   1563  O OE2 . GLU A 1 205 ? -8.773  87.422   80.510  1.00 31.75 ? 286 GLU A OE2 1 
ATOM   1564  N N   . ILE A 1 206 ? -6.273  83.948   85.393  1.00 19.37 ? 287 ILE A N   1 
ATOM   1565  C CA  . ILE A 1 206 ? -6.306  83.488   86.768  1.00 18.48 ? 287 ILE A CA  1 
ATOM   1566  C C   . ILE A 1 206 ? -6.954  84.488   87.708  1.00 19.16 ? 287 ILE A C   1 
ATOM   1567  O O   . ILE A 1 206 ? -6.761  85.701   87.576  1.00 19.81 ? 287 ILE A O   1 
ATOM   1568  C CB  . ILE A 1 206 ? -4.879  83.184   87.283  1.00 18.70 ? 287 ILE A CB  1 
ATOM   1569  C CG1 . ILE A 1 206 ? -4.299  81.996   86.522  1.00 19.38 ? 287 ILE A CG1 1 
ATOM   1570  C CG2 . ILE A 1 206 ? -4.903  82.862   88.776  1.00 18.59 ? 287 ILE A CG2 1 
ATOM   1571  C CD1 . ILE A 1 206 ? -4.041  82.263   85.062  1.00 21.60 ? 287 ILE A CD1 1 
ATOM   1572  N N   . THR A 1 207 ? -7.722  83.966   88.660  1.00 17.27 ? 288 THR A N   1 
ATOM   1573  C CA  . THR A 1 207 ? -8.389  84.787   89.660  1.00 15.45 ? 288 THR A CA  1 
ATOM   1574  C C   . THR A 1 207 ? -8.030  84.267   91.049  1.00 16.00 ? 288 THR A C   1 
ATOM   1575  O O   . THR A 1 207 ? -8.109  83.065   91.318  1.00 15.30 ? 288 THR A O   1 
ATOM   1576  C CB  . THR A 1 207 ? -9.909  84.725   89.510  1.00 14.52 ? 288 THR A CB  1 
ATOM   1577  O OG1 . THR A 1 207 ? -10.267 85.106   88.181  1.00 15.99 ? 288 THR A OG1 1 
ATOM   1578  C CG2 . THR A 1 207 ? -10.581 85.663   90.505  1.00 13.45 ? 288 THR A CG2 1 
ATOM   1579  N N   . CYS A 1 208 ? -7.634  85.172   91.930  1.00 15.73 ? 289 CYS A N   1 
ATOM   1580  C CA  . CYS A 1 208 ? -7.287  84.777   93.278  1.00 15.74 ? 289 CYS A CA  1 
ATOM   1581  C C   . CYS A 1 208 ? -8.054  85.592   94.312  1.00 15.92 ? 289 CYS A C   1 
ATOM   1582  O O   . CYS A 1 208 ? -8.225  86.801   94.172  1.00 15.90 ? 289 CYS A O   1 
ATOM   1583  C CB  . CYS A 1 208 ? -5.798  84.976   93.541  1.00 17.68 ? 289 CYS A CB  1 
ATOM   1584  S SG  . CYS A 1 208 ? -4.593  84.367   92.321  1.00 18.32 ? 289 CYS A SG  1 
ATOM   1585  N N   . VAL A 1 209 ? -8.519  84.906   95.349  1.00 15.22 ? 290 VAL A N   1 
ATOM   1586  C CA  . VAL A 1 209 ? -9.220  85.531   96.458  1.00 14.10 ? 290 VAL A CA  1 
ATOM   1587  C C   . VAL A 1 209 ? -8.328  85.108   97.609  1.00 15.24 ? 290 VAL A C   1 
ATOM   1588  O O   . VAL A 1 209 ? -8.080  83.922   97.801  1.00 15.10 ? 290 VAL A O   1 
ATOM   1589  C CB  . VAL A 1 209 ? -10.644 84.976   96.619  1.00 13.95 ? 290 VAL A CB  1 
ATOM   1590  C CG1 . VAL A 1 209 ? -11.262 85.470   97.924  1.00 12.44 ? 290 VAL A CG1 1 
ATOM   1591  C CG2 . VAL A 1 209 ? -11.497 85.428   95.437  1.00 12.77 ? 290 VAL A CG2 1 
ATOM   1592  N N   . CYS A 1 210 ? -7.832  86.087   98.359  1.00 15.70 ? 291 CYS A N   1 
ATOM   1593  C CA  . CYS A 1 210 ? -6.898  85.823   99.432  1.00 14.63 ? 291 CYS A CA  1 
ATOM   1594  C C   . CYS A 1 210 ? -7.319  86.302   100.803 1.00 15.19 ? 291 CYS A C   1 
ATOM   1595  O O   . CYS A 1 210 ? -8.461  86.680   101.029 1.00 13.69 ? 291 CYS A O   1 
ATOM   1596  C CB  . CYS A 1 210 ? -5.570  86.468   99.071  1.00 15.07 ? 291 CYS A CB  1 
ATOM   1597  S SG  . CYS A 1 210 ? -5.257  86.491   97.276  1.00 16.85 ? 291 CYS A SG  1 
ATOM   1598  N N   . ARG A 1 211 ? -6.349  86.301   101.710 1.00 15.88 ? 292 ARG A N   1 
ATOM   1599  C CA  . ARG A 1 211 ? -6.556  86.714   103.090 1.00 15.74 ? 292 ARG A CA  1 
ATOM   1600  C C   . ARG A 1 211 ? -5.842  88.020   103.447 1.00 16.56 ? 292 ARG A C   1 
ATOM   1601  O O   . ARG A 1 211 ? -4.658  88.173   103.149 1.00 16.27 ? 292 ARG A O   1 
ATOM   1602  C CB  . ARG A 1 211 ? -6.055  85.603   104.011 1.00 14.39 ? 292 ARG A CB  1 
ATOM   1603  C CG  . ARG A 1 211 ? -5.768  86.016   105.436 1.00 14.25 ? 292 ARG A CG  1 
ATOM   1604  C CD  . ARG A 1 211 ? -5.104  84.856   106.154 1.00 15.20 ? 292 ARG A CD  1 
ATOM   1605  N NE  . ARG A 1 211 ? -4.765  85.151   107.538 1.00 15.02 ? 292 ARG A NE  1 
ATOM   1606  C CZ  . ARG A 1 211 ? -4.438  84.221   108.433 1.00 17.19 ? 292 ARG A CZ  1 
ATOM   1607  N NH1 . ARG A 1 211 ? -4.135  84.568   109.686 1.00 14.78 ? 292 ARG A NH1 1 
ATOM   1608  N NH2 . ARG A 1 211 ? -4.428  82.939   108.080 1.00 13.64 ? 292 ARG A NH2 1 
ATOM   1609  N N   . ASP A 1 212 ? -6.566  88.958   104.066 1.00 16.62 ? 293 ASP A N   1 
ATOM   1610  C CA  . ASP A 1 212 ? -5.974  90.225   104.515 1.00 17.40 ? 293 ASP A CA  1 
ATOM   1611  C C   . ASP A 1 212 ? -5.850  90.113   106.037 1.00 17.07 ? 293 ASP A C   1 
ATOM   1612  O O   . ASP A 1 212 ? -6.847  90.190   106.784 1.00 17.74 ? 293 ASP A O   1 
ATOM   1613  C CB  . ASP A 1 212 ? -6.842  91.432   104.134 1.00 19.84 ? 293 ASP A CB  1 
ATOM   1614  C CG  . ASP A 1 212 ? -6.264  92.758   104.645 1.00 22.07 ? 293 ASP A CG  1 
ATOM   1615  O OD1 . ASP A 1 212 ? -6.524  93.814   104.017 1.00 22.11 ? 293 ASP A OD1 1 
ATOM   1616  O OD2 . ASP A 1 212 ? -5.561  92.747   105.684 1.00 21.93 ? 293 ASP A OD2 1 
ATOM   1617  N N   . ASN A 1 213 ? -4.611  89.920   106.477 1.00 15.19 ? 294 ASN A N   1 
ATOM   1618  C CA  . ASN A 1 213 ? -4.282  89.728   107.884 1.00 15.13 ? 294 ASN A CA  1 
ATOM   1619  C C   . ASN A 1 213 ? -3.913  91.048   108.551 1.00 14.99 ? 294 ASN A C   1 
ATOM   1620  O O   . ASN A 1 213 ? -3.764  91.147   109.776 1.00 13.97 ? 294 ASN A O   1 
ATOM   1621  C CB  . ASN A 1 213 ? -3.103  88.752   107.978 1.00 14.01 ? 294 ASN A CB  1 
ATOM   1622  C CG  . ASN A 1 213 ? -2.946  88.157   109.354 1.00 14.61 ? 294 ASN A CG  1 
ATOM   1623  O OD1 . ASN A 1 213 ? -3.820  87.434   109.825 1.00 14.78 ? 294 ASN A OD1 1 
ATOM   1624  N ND2 . ASN A 1 213 ? -1.827  88.455   110.011 1.00 13.33 ? 294 ASN A ND2 1 
ATOM   1625  N N   . TRP A 1 214 ? -3.775  92.062   107.715 1.00 15.09 ? 295 TRP A N   1 
ATOM   1626  C CA  . TRP A 1 214 ? -3.389  93.384   108.152 1.00 14.75 ? 295 TRP A CA  1 
ATOM   1627  C C   . TRP A 1 214 ? -4.528  94.226   108.725 1.00 15.69 ? 295 TRP A C   1 
ATOM   1628  O O   . TRP A 1 214 ? -4.571  94.494   109.930 1.00 13.11 ? 295 TRP A O   1 
ATOM   1629  C CB  . TRP A 1 214 ? -2.730  94.075   106.968 1.00 14.51 ? 295 TRP A CB  1 
ATOM   1630  C CG  . TRP A 1 214 ? -2.400  95.504   107.142 1.00 14.23 ? 295 TRP A CG  1 
ATOM   1631  C CD1 . TRP A 1 214 ? -2.323  96.204   108.310 1.00 14.46 ? 295 TRP A CD1 1 
ATOM   1632  C CD2 . TRP A 1 214 ? -2.060  96.417   106.102 1.00 13.53 ? 295 TRP A CD2 1 
ATOM   1633  N NE1 . TRP A 1 214 ? -1.957  97.503   108.061 1.00 15.12 ? 295 TRP A NE1 1 
ATOM   1634  C CE2 . TRP A 1 214 ? -1.788  97.662   106.708 1.00 15.21 ? 295 TRP A CE2 1 
ATOM   1635  C CE3 . TRP A 1 214 ? -1.956  96.307   104.710 1.00 12.55 ? 295 TRP A CE3 1 
ATOM   1636  C CZ2 . TRP A 1 214 ? -1.419  98.795   105.969 1.00 14.06 ? 295 TRP A CZ2 1 
ATOM   1637  C CZ3 . TRP A 1 214 ? -1.587  97.434   103.974 1.00 13.82 ? 295 TRP A CZ3 1 
ATOM   1638  C CH2 . TRP A 1 214 ? -1.325  98.661   104.608 1.00 13.31 ? 295 TRP A CH2 1 
ATOM   1639  N N   . HIS A 1 215 ? -5.460  94.612   107.860 1.00 16.92 ? 296 HIS A N   1 
ATOM   1640  C CA  . HIS A 1 215 ? -6.567  95.461   108.269 1.00 17.76 ? 296 HIS A CA  1 
ATOM   1641  C C   . HIS A 1 215 ? -7.843  95.284   107.436 1.00 18.19 ? 296 HIS A C   1 
ATOM   1642  O O   . HIS A 1 215 ? -8.479  96.265   107.060 1.00 19.49 ? 296 HIS A O   1 
ATOM   1643  C CB  . HIS A 1 215 ? -6.102  96.920   108.197 1.00 19.33 ? 296 HIS A CB  1 
ATOM   1644  C CG  . HIS A 1 215 ? -5.546  97.308   106.857 1.00 19.42 ? 296 HIS A CG  1 
ATOM   1645  N ND1 . HIS A 1 215 ? -5.721  96.542   105.729 1.00 21.58 ? 296 HIS A ND1 1 
ATOM   1646  C CD2 . HIS A 1 215 ? -4.896  98.428   106.458 1.00 20.17 ? 296 HIS A CD2 1 
ATOM   1647  C CE1 . HIS A 1 215 ? -5.208  97.174   104.682 1.00 19.36 ? 296 HIS A CE1 1 
ATOM   1648  N NE2 . HIS A 1 215 ? -4.705  98.318   105.099 1.00 20.39 ? 296 HIS A NE2 1 
ATOM   1649  N N   . GLY A 1 216 ? -8.223  94.040   107.159 1.00 19.59 ? 297 GLY A N   1 
ATOM   1650  C CA  . GLY A 1 216 ? -9.414  93.798   106.360 1.00 18.92 ? 297 GLY A CA  1 
ATOM   1651  C C   . GLY A 1 216 ? -10.291 92.629   106.789 1.00 20.10 ? 297 GLY A C   1 
ATOM   1652  O O   . GLY A 1 216 ? -9.803  91.521   107.020 1.00 20.07 ? 297 GLY A O   1 
ATOM   1653  N N   . SER A 1 217 ? -11.593 92.895   106.895 1.00 20.85 ? 298 SER A N   1 
ATOM   1654  C CA  . SER A 1 217 ? -12.596 91.897   107.270 1.00 21.33 ? 298 SER A CA  1 
ATOM   1655  C C   . SER A 1 217 ? -13.129 91.202   106.020 1.00 21.13 ? 298 SER A C   1 
ATOM   1656  O O   . SER A 1 217 ? -13.686 90.110   106.093 1.00 22.10 ? 298 SER A O   1 
ATOM   1657  C CB  . SER A 1 217 ? -13.783 92.553   107.978 1.00 19.96 ? 298 SER A CB  1 
ATOM   1658  O OG  . SER A 1 217 ? -13.526 92.718   109.345 1.00 22.31 ? 298 SER A OG  1 
ATOM   1659  N N   . ASN A 1 218 ? -12.998 91.872   104.884 1.00 18.78 ? 299 ASN A N   1 
ATOM   1660  C CA  . ASN A 1 218 ? -13.450 91.325   103.616 1.00 18.07 ? 299 ASN A CA  1 
ATOM   1661  C C   . ASN A 1 218 ? -12.224 90.775   102.880 1.00 17.38 ? 299 ASN A C   1 
ATOM   1662  O O   . ASN A 1 218 ? -11.090 91.035   103.281 1.00 17.23 ? 299 ASN A O   1 
ATOM   1663  C CB  . ASN A 1 218 ? -14.145 92.421   102.800 1.00 19.01 ? 299 ASN A CB  1 
ATOM   1664  C CG  . ASN A 1 218 ? -13.326 93.700   102.716 1.00 19.50 ? 299 ASN A CG  1 
ATOM   1665  O OD1 . ASN A 1 218 ? -12.586 94.045   103.650 1.00 20.20 ? 299 ASN A OD1 1 
ATOM   1666  N ND2 . ASN A 1 218 ? -13.471 94.423   101.608 1.00 17.42 ? 299 ASN A ND2 1 
ATOM   1667  N N   . ARG A 1 219 ? -12.439 90.025   101.806 1.00 15.65 ? 300 ARG A N   1 
ATOM   1668  C CA  . ARG A 1 219 ? -11.304 89.448   101.101 1.00 15.45 ? 300 ARG A CA  1 
ATOM   1669  C C   . ARG A 1 219 ? -10.807 90.206   99.878  1.00 14.91 ? 300 ARG A C   1 
ATOM   1670  O O   . ARG A 1 219 ? -11.595 90.692   99.070  1.00 15.66 ? 300 ARG A O   1 
ATOM   1671  C CB  . ARG A 1 219 ? -11.605 87.988   100.726 1.00 13.13 ? 300 ARG A CB  1 
ATOM   1672  C CG  . ARG A 1 219 ? -11.760 87.090   101.948 1.00 10.90 ? 300 ARG A CG  1 
ATOM   1673  C CD  . ARG A 1 219 ? -11.649 85.611   101.610 1.00 12.43 ? 300 ARG A CD  1 
ATOM   1674  N NE  . ARG A 1 219 ? -11.766 84.781   102.813 1.00 14.24 ? 300 ARG A NE  1 
ATOM   1675  C CZ  . ARG A 1 219 ? -10.793 84.582   103.702 1.00 13.14 ? 300 ARG A CZ  1 
ATOM   1676  N NH1 . ARG A 1 219 ? -11.014 83.818   104.766 1.00 12.19 ? 300 ARG A NH1 1 
ATOM   1677  N NH2 . ARG A 1 219 ? -9.593  85.122   103.521 1.00 11.87 ? 300 ARG A NH2 1 
ATOM   1678  N N   . PRO A 1 220 ? -9.476  90.349   99.755  1.00 14.35 ? 301 PRO A N   1 
ATOM   1679  C CA  . PRO A 1 220 ? -8.868  91.045   98.617  1.00 15.33 ? 301 PRO A CA  1 
ATOM   1680  C C   . PRO A 1 220 ? -8.702  90.066   97.450  1.00 15.66 ? 301 PRO A C   1 
ATOM   1681  O O   . PRO A 1 220 ? -8.688  88.851   97.656  1.00 15.46 ? 301 PRO A O   1 
ATOM   1682  C CB  . PRO A 1 220 ? -7.530  91.510   99.180  1.00 14.51 ? 301 PRO A CB  1 
ATOM   1683  C CG  . PRO A 1 220 ? -7.174  90.386   100.114 1.00 14.76 ? 301 PRO A CG  1 
ATOM   1684  C CD  . PRO A 1 220 ? -8.486  90.141   100.828 1.00 13.14 ? 301 PRO A CD  1 
ATOM   1685  N N   . TRP A 1 221 ? -8.578  90.591   96.232  1.00 16.43 ? 302 TRP A N   1 
ATOM   1686  C CA  . TRP A 1 221 ? -8.415  89.739   95.053  1.00 16.39 ? 302 TRP A CA  1 
ATOM   1687  C C   . TRP A 1 221 ? -7.460  90.270   93.985  1.00 16.05 ? 302 TRP A C   1 
ATOM   1688  O O   . TRP A 1 221 ? -7.142  91.459   93.938  1.00 16.92 ? 302 TRP A O   1 
ATOM   1689  C CB  . TRP A 1 221 ? -9.776  89.467   94.399  1.00 15.24 ? 302 TRP A CB  1 
ATOM   1690  C CG  . TRP A 1 221 ? -10.526 90.701   93.936  1.00 15.15 ? 302 TRP A CG  1 
ATOM   1691  C CD1 . TRP A 1 221 ? -11.523 91.348   94.604  1.00 15.17 ? 302 TRP A CD1 1 
ATOM   1692  C CD2 . TRP A 1 221 ? -10.393 91.376   92.675  1.00 14.38 ? 302 TRP A CD2 1 
ATOM   1693  N NE1 . TRP A 1 221 ? -12.027 92.371   93.839  1.00 14.59 ? 302 TRP A NE1 1 
ATOM   1694  C CE2 . TRP A 1 221 ? -11.353 92.412   92.649  1.00 13.94 ? 302 TRP A CE2 1 
ATOM   1695  C CE3 . TRP A 1 221 ? -9.560  91.202   91.562  1.00 14.20 ? 302 TRP A CE3 1 
ATOM   1696  C CZ2 . TRP A 1 221 ? -11.510 93.269   91.557  1.00 13.69 ? 302 TRP A CZ2 1 
ATOM   1697  C CZ3 . TRP A 1 221 ? -9.715  92.056   90.472  1.00 14.67 ? 302 TRP A CZ3 1 
ATOM   1698  C CH2 . TRP A 1 221 ? -10.687 93.076   90.482  1.00 14.11 ? 302 TRP A CH2 1 
ATOM   1699  N N   . VAL A 1 222 ? -7.008  89.367   93.125  1.00 15.50 ? 303 VAL A N   1 
ATOM   1700  C CA  . VAL A 1 222 ? -6.113  89.721   92.031  1.00 17.00 ? 303 VAL A CA  1 
ATOM   1701  C C   . VAL A 1 222 ? -6.419  88.774   90.899  1.00 17.39 ? 303 VAL A C   1 
ATOM   1702  O O   . VAL A 1 222 ? -6.537  87.570   91.106  1.00 16.83 ? 303 VAL A O   1 
ATOM   1703  C CB  . VAL A 1 222 ? -4.615  89.500   92.346  1.00 17.21 ? 303 VAL A CB  1 
ATOM   1704  C CG1 . VAL A 1 222 ? -3.760  90.223   91.306  1.00 16.85 ? 303 VAL A CG1 1 
ATOM   1705  C CG2 . VAL A 1 222 ? -4.288  89.959   93.711  1.00 18.65 ? 303 VAL A CG2 1 
ATOM   1706  N N   . SER A 1 223 ? -6.557  89.319   89.703  1.00 17.52 ? 304 SER A N   1 
ATOM   1707  C CA  . SER A 1 223 ? -6.810  88.490   88.547  1.00 19.38 ? 304 SER A CA  1 
ATOM   1708  C C   . SER A 1 223 ? -5.774  88.965   87.555  1.00 19.75 ? 304 SER A C   1 
ATOM   1709  O O   . SER A 1 223 ? -5.351  90.124   87.607  1.00 19.43 ? 304 SER A O   1 
ATOM   1710  C CB  . SER A 1 223 ? -8.228  88.701   88.022  1.00 18.24 ? 304 SER A CB  1 
ATOM   1711  O OG  . SER A 1 223 ? -8.466  90.068   87.767  1.00 24.22 ? 304 SER A OG  1 
ATOM   1712  N N   . PHE A 1 224 ? -5.332  88.070   86.683  1.00 19.58 ? 305 PHE A N   1 
ATOM   1713  C CA  . PHE A 1 224 ? -4.327  88.442   85.709  1.00 21.72 ? 305 PHE A CA  1 
ATOM   1714  C C   . PHE A 1 224 ? -4.279  87.521   84.503  1.00 23.12 ? 305 PHE A C   1 
ATOM   1715  O O   . PHE A 1 224 ? -4.718  86.375   84.566  1.00 24.34 ? 305 PHE A O   1 
ATOM   1716  C CB  . PHE A 1 224 ? -2.958  88.511   86.389  1.00 19.16 ? 305 PHE A CB  1 
ATOM   1717  C CG  . PHE A 1 224 ? -2.617  87.296   87.200  1.00 17.70 ? 305 PHE A CG  1 
ATOM   1718  C CD1 . PHE A 1 224 ? -1.955  86.222   86.630  1.00 17.21 ? 305 PHE A CD1 1 
ATOM   1719  C CD2 . PHE A 1 224 ? -2.941  87.239   88.549  1.00 18.41 ? 305 PHE A CD2 1 
ATOM   1720  C CE1 . PHE A 1 224 ? -1.618  85.110   87.395  1.00 17.82 ? 305 PHE A CE1 1 
ATOM   1721  C CE2 . PHE A 1 224 ? -2.608  86.132   89.320  1.00 17.71 ? 305 PHE A CE2 1 
ATOM   1722  C CZ  . PHE A 1 224 ? -1.944  85.069   88.742  1.00 16.47 ? 305 PHE A CZ  1 
ATOM   1723  N N   . ASN A 1 225 ? -3.751  88.056   83.407  1.00 24.71 ? 306 ASN A N   1 
ATOM   1724  C CA  . ASN A 1 225 ? -3.607  87.352   82.138  1.00 27.34 ? 306 ASN A CA  1 
ATOM   1725  C C   . ASN A 1 225 ? -2.321  86.508   82.130  1.00 26.13 ? 306 ASN A C   1 
ATOM   1726  O O   . ASN A 1 225 ? -1.581  86.473   83.112  1.00 25.41 ? 306 ASN A O   1 
ATOM   1727  C CB  . ASN A 1 225 ? -3.582  88.396   81.008  1.00 32.70 ? 306 ASN A CB  1 
ATOM   1728  C CG  . ASN A 1 225 ? -3.269  87.795   79.650  1.00 39.43 ? 306 ASN A CG  1 
ATOM   1729  O OD1 . ASN A 1 225 ? -3.695  86.666   79.324  1.00 43.18 ? 306 ASN A OD1 1 
ATOM   1730  N ND2 . ASN A 1 225 ? -2.528  88.548   78.833  1.00 42.48 ? 306 ASN A ND2 1 
ATOM   1731  N N   . GLN A 1 226 ? -2.049  85.835   81.021  1.00 25.29 ? 308 GLN A N   1 
ATOM   1732  C CA  . GLN A 1 226 ? -0.859  85.010   80.925  1.00 25.40 ? 308 GLN A CA  1 
ATOM   1733  C C   . GLN A 1 226 ? 0.433   85.781   80.743  1.00 25.71 ? 308 GLN A C   1 
ATOM   1734  O O   . GLN A 1 226 ? 1.484   85.179   80.539  1.00 27.13 ? 308 GLN A O   1 
ATOM   1735  C CB  . GLN A 1 226 ? -1.025  83.981   79.817  1.00 25.12 ? 308 GLN A CB  1 
ATOM   1736  C CG  . GLN A 1 226 ? -1.873  82.817   80.276  1.00 25.67 ? 308 GLN A CG  1 
ATOM   1737  C CD  . GLN A 1 226 ? -2.533  82.093   79.133  1.00 27.06 ? 308 GLN A CD  1 
ATOM   1738  O OE1 . GLN A 1 226 ? -1.863  81.514   78.274  1.00 26.71 ? 308 GLN A OE1 1 
ATOM   1739  N NE2 . GLN A 1 226 ? -3.864  82.125   79.108  1.00 27.62 ? 308 GLN A NE2 1 
ATOM   1740  N N   . ASN A 1 227 ? 0.348   87.108   80.809  1.00 25.55 ? 309 ASN A N   1 
ATOM   1741  C CA  . ASN A 1 227 ? 1.521   87.966   80.723  1.00 25.28 ? 309 ASN A CA  1 
ATOM   1742  C C   . ASN A 1 227 ? 1.563   88.805   81.992  1.00 24.35 ? 309 ASN A C   1 
ATOM   1743  O O   . ASN A 1 227 ? 2.109   89.907   82.011  1.00 24.01 ? 309 ASN A O   1 
ATOM   1744  C CB  . ASN A 1 227 ? 1.464   88.879   79.503  1.00 29.15 ? 309 ASN A CB  1 
ATOM   1745  C CG  . ASN A 1 227 ? 1.753   88.144   78.227  1.00 32.68 ? 309 ASN A CG  1 
ATOM   1746  O OD1 . ASN A 1 227 ? 2.818   87.519   78.081  1.00 35.07 ? 309 ASN A OD1 1 
ATOM   1747  N ND2 . ASN A 1 227 ? 0.810   88.199   77.285  1.00 33.77 ? 309 ASN A ND2 1 
ATOM   1748  N N   . LEU A 1 228 ? 0.951   88.278   83.047  1.00 23.08 ? 310 LEU A N   1 
ATOM   1749  C CA  . LEU A 1 228 ? 0.929   88.940   84.342  1.00 21.65 ? 310 LEU A CA  1 
ATOM   1750  C C   . LEU A 1 228 ? 0.387   90.370   84.343  1.00 21.38 ? 310 LEU A C   1 
ATOM   1751  O O   . LEU A 1 228 ? 0.746   91.178   85.196  1.00 20.58 ? 310 LEU A O   1 
ATOM   1752  C CB  . LEU A 1 228 ? 2.334   88.900   84.948  1.00 21.49 ? 310 LEU A CB  1 
ATOM   1753  C CG  . LEU A 1 228 ? 2.742   87.616   85.684  1.00 21.20 ? 310 LEU A CG  1 
ATOM   1754  C CD1 . LEU A 1 228 ? 1.992   86.410   85.160  1.00 20.86 ? 310 LEU A CD1 1 
ATOM   1755  C CD2 . LEU A 1 228 ? 4.240   87.424   85.550  1.00 21.56 ? 310 LEU A CD2 1 
ATOM   1756  N N   . GLU A 1 229 ? -0.453  90.693   83.368  1.00 21.18 ? 311 GLU A N   1 
ATOM   1757  C CA  . GLU A 1 229 ? -1.081  92.001   83.340  1.00 20.87 ? 311 GLU A CA  1 
ATOM   1758  C C   . GLU A 1 229 ? -2.211  91.719   84.323  1.00 20.55 ? 311 GLU A C   1 
ATOM   1759  O O   . GLU A 1 229 ? -2.943  90.736   84.161  1.00 19.65 ? 311 GLU A O   1 
ATOM   1760  C CB  . GLU A 1 229 ? -1.605  92.305   81.940  1.00 22.96 ? 311 GLU A CB  1 
ATOM   1761  C CG  . GLU A 1 229 ? -0.491  92.357   80.915  1.00 27.26 ? 311 GLU A CG  1 
ATOM   1762  C CD  . GLU A 1 229 ? -0.986  92.291   79.477  1.00 30.89 ? 311 GLU A CD  1 
ATOM   1763  O OE1 . GLU A 1 229 ? -1.760  91.363   79.144  1.00 34.30 ? 311 GLU A OE1 1 
ATOM   1764  O OE2 . GLU A 1 229 ? -0.592  93.157   78.668  1.00 32.81 ? 311 GLU A OE2 1 
ATOM   1765  N N   . TYR A 1 230 ? -2.352  92.567   85.338  1.00 19.26 ? 312 TYR A N   1 
ATOM   1766  C CA  . TYR A 1 230 ? -3.338  92.330   86.383  1.00 18.85 ? 312 TYR A CA  1 
ATOM   1767  C C   . TYR A 1 230 ? -4.286  93.458   86.796  1.00 19.80 ? 312 TYR A C   1 
ATOM   1768  O O   . TYR A 1 230 ? -4.181  94.601   86.358  1.00 20.05 ? 312 TYR A O   1 
ATOM   1769  C CB  . TYR A 1 230 ? -2.587  91.869   87.625  1.00 17.70 ? 312 TYR A CB  1 
ATOM   1770  C CG  . TYR A 1 230 ? -1.670  92.951   88.166  1.00 16.10 ? 312 TYR A CG  1 
ATOM   1771  C CD1 . TYR A 1 230 ? -2.170  93.978   88.971  1.00 15.75 ? 312 TYR A CD1 1 
ATOM   1772  C CD2 . TYR A 1 230 ? -0.325  92.992   87.812  1.00 15.39 ? 312 TYR A CD2 1 
ATOM   1773  C CE1 . TYR A 1 230 ? -1.354  95.020   89.406  1.00 15.64 ? 312 TYR A CE1 1 
ATOM   1774  C CE2 . TYR A 1 230 ? 0.502   94.033   88.242  1.00 15.42 ? 312 TYR A CE2 1 
ATOM   1775  C CZ  . TYR A 1 230 ? -0.023  95.043   89.039  1.00 15.48 ? 312 TYR A CZ  1 
ATOM   1776  O OH  . TYR A 1 230 ? 0.776   96.069   89.468  1.00 15.28 ? 312 TYR A OH  1 
ATOM   1777  N N   . GLN A 1 231 ? -5.196  93.092   87.693  1.00 21.32 ? 313 GLN A N   1 
ATOM   1778  C CA  . GLN A 1 231 ? -6.195  93.987   88.268  1.00 22.33 ? 313 GLN A CA  1 
ATOM   1779  C C   . GLN A 1 231 ? -6.398  93.518   89.701  1.00 20.79 ? 313 GLN A C   1 
ATOM   1780  O O   . GLN A 1 231 ? -6.397  92.317   89.974  1.00 20.50 ? 313 GLN A O   1 
ATOM   1781  C CB  . GLN A 1 231 ? -7.526  93.869   87.533  1.00 24.53 ? 313 GLN A CB  1 
ATOM   1782  C CG  . GLN A 1 231 ? -7.513  94.345   86.102  1.00 28.85 ? 313 GLN A CG  1 
ATOM   1783  C CD  . GLN A 1 231 ? -8.892  94.240   85.454  1.00 32.32 ? 313 GLN A CD  1 
ATOM   1784  O OE1 . GLN A 1 231 ? -9.095  94.683   84.321  1.00 35.54 ? 313 GLN A OE1 1 
ATOM   1785  N NE2 . GLN A 1 231 ? -9.846  93.650   86.171  1.00 33.23 ? 313 GLN A NE2 1 
ATOM   1786  N N   . ILE A 1 232 ? -6.588  94.456   90.612  1.00 20.41 ? 314 ILE A N   1 
ATOM   1787  C CA  . ILE A 1 232 ? -6.789  94.105   92.011  1.00 20.02 ? 314 ILE A CA  1 
ATOM   1788  C C   . ILE A 1 232 ? -8.100  94.679   92.533  1.00 20.42 ? 314 ILE A C   1 
ATOM   1789  O O   . ILE A 1 232 ? -8.746  95.477   91.866  1.00 21.39 ? 314 ILE A O   1 
ATOM   1790  C CB  . ILE A 1 232 ? -5.638  94.646   92.862  1.00 18.62 ? 314 ILE A CB  1 
ATOM   1791  C CG1 . ILE A 1 232 ? -5.457  96.140   92.573  1.00 18.32 ? 314 ILE A CG1 1 
ATOM   1792  C CG2 . ILE A 1 232 ? -4.363  93.871   92.566  1.00 19.58 ? 314 ILE A CG2 1 
ATOM   1793  C CD1 . ILE A 1 232 ? -4.252  96.785   93.248  1.00 16.62 ? 314 ILE A CD1 1 
ATOM   1794  N N   . GLY A 1 233 ? -8.485  94.264   93.733  1.00 20.83 ? 315 GLY A N   1 
ATOM   1795  C CA  . GLY A 1 233 ? -9.700  94.768   94.336  1.00 19.25 ? 315 GLY A CA  1 
ATOM   1796  C C   . GLY A 1 233 ? -10.021 94.028   95.617  1.00 19.79 ? 315 GLY A C   1 
ATOM   1797  O O   . GLY A 1 233 ? -9.214  93.235   96.107  1.00 17.16 ? 315 GLY A O   1 
ATOM   1798  N N   . TYR A 1 234 ? -11.203 94.313   96.160  1.00 19.70 ? 316 TYR A N   1 
ATOM   1799  C CA  . TYR A 1 234 ? -11.698 93.669   97.368  1.00 20.21 ? 316 TYR A CA  1 
ATOM   1800  C C   . TYR A 1 234 ? -13.152 93.275   97.071  1.00 20.84 ? 316 TYR A C   1 
ATOM   1801  O O   . TYR A 1 234 ? -13.847 93.961   96.313  1.00 22.32 ? 316 TYR A O   1 
ATOM   1802  C CB  . TYR A 1 234 ? -11.648 94.632   98.572  1.00 20.12 ? 316 TYR A CB  1 
ATOM   1803  C CG  . TYR A 1 234 ? -10.339 94.656   99.356  1.00 20.35 ? 316 TYR A CG  1 
ATOM   1804  C CD1 . TYR A 1 234 ? -9.189  95.260   98.836  1.00 20.06 ? 316 TYR A CD1 1 
ATOM   1805  C CD2 . TYR A 1 234 ? -10.254 94.076   100.627 1.00 19.46 ? 316 TYR A CD2 1 
ATOM   1806  C CE1 . TYR A 1 234 ? -7.977  95.284   99.573  1.00 20.35 ? 316 TYR A CE1 1 
ATOM   1807  C CE2 . TYR A 1 234 ? -9.056  94.091   101.368 1.00 19.43 ? 316 TYR A CE2 1 
ATOM   1808  C CZ  . TYR A 1 234 ? -7.921  94.693   100.839 1.00 19.85 ? 316 TYR A CZ  1 
ATOM   1809  O OH  . TYR A 1 234 ? -6.745  94.689   101.567 1.00 16.51 ? 316 TYR A OH  1 
ATOM   1810  N N   . ILE A 1 235 ? -13.606 92.161   97.635  1.00 19.07 ? 317 ILE A N   1 
ATOM   1811  C CA  . ILE A 1 235 ? -14.982 91.728   97.431  1.00 17.54 ? 317 ILE A CA  1 
ATOM   1812  C C   . ILE A 1 235 ? -15.822 92.749   98.183  1.00 17.68 ? 317 ILE A C   1 
ATOM   1813  O O   . ILE A 1 235 ? -15.615 92.973   99.382  1.00 18.06 ? 317 ILE A O   1 
ATOM   1814  C CB  . ILE A 1 235 ? -15.200 90.316   97.993  1.00 16.55 ? 317 ILE A CB  1 
ATOM   1815  C CG1 . ILE A 1 235 ? -14.337 89.320   97.202  1.00 16.27 ? 317 ILE A CG1 1 
ATOM   1816  C CG2 . ILE A 1 235 ? -16.672 89.961   97.926  1.00 17.05 ? 317 ILE A CG2 1 
ATOM   1817  C CD1 . ILE A 1 235 ? -14.373 87.897   97.716  1.00 14.15 ? 317 ILE A CD1 1 
ATOM   1818  N N   . CYS A 1 236 ? -16.769 93.360   97.481  1.00 17.55 ? 318 CYS A N   1 
ATOM   1819  C CA  . CYS A 1 236 ? -17.585 94.420   98.057  1.00 17.96 ? 318 CYS A CA  1 
ATOM   1820  C C   . CYS A 1 236 ? -18.764 94.046   98.957  1.00 18.60 ? 318 CYS A C   1 
ATOM   1821  O O   . CYS A 1 236 ? -19.248 94.884   99.721  1.00 19.89 ? 318 CYS A O   1 
ATOM   1822  C CB  . CYS A 1 236 ? -18.092 95.327   96.937  1.00 19.47 ? 318 CYS A CB  1 
ATOM   1823  S SG  . CYS A 1 236 ? -16.936 95.803   95.605  1.00 20.75 ? 318 CYS A SG  1 
ATOM   1824  N N   . SER A 1 237 ? -19.219 92.800   98.873  1.00 18.21 ? 319 SER A N   1 
ATOM   1825  C CA  . SER A 1 237 ? -20.355 92.305   99.649  1.00 17.20 ? 319 SER A CA  1 
ATOM   1826  C C   . SER A 1 237 ? -20.331 92.575   101.159 1.00 17.35 ? 319 SER A C   1 
ATOM   1827  O O   . SER A 1 237 ? -19.296 92.470   101.811 1.00 16.66 ? 319 SER A O   1 
ATOM   1828  C CB  . SER A 1 237 ? -20.498 90.794   99.414  1.00 17.64 ? 319 SER A CB  1 
ATOM   1829  O OG  . SER A 1 237 ? -21.642 90.254   100.053 1.00 16.88 ? 319 SER A OG  1 
ATOM   1830  N N   . GLY A 1 238 ? -21.493 92.921   101.705 1.00 18.21 ? 320 GLY A N   1 
ATOM   1831  C CA  . GLY A 1 238 ? -21.608 93.154   103.133 1.00 18.50 ? 320 GLY A CA  1 
ATOM   1832  C C   . GLY A 1 238 ? -21.669 91.816   103.864 1.00 19.31 ? 320 GLY A C   1 
ATOM   1833  O O   . GLY A 1 238 ? -22.024 91.743   105.043 1.00 18.51 ? 320 GLY A O   1 
ATOM   1834  N N   . VAL A 1 239 ? -21.356 90.744   103.141 1.00 19.60 ? 321 VAL A N   1 
ATOM   1835  C CA  . VAL A 1 239 ? -21.334 89.399   103.711 1.00 19.60 ? 321 VAL A CA  1 
ATOM   1836  C C   . VAL A 1 239 ? -19.856 89.131   103.834 1.00 19.42 ? 321 VAL A C   1 
ATOM   1837  O O   . VAL A 1 239 ? -19.255 88.465   102.998 1.00 19.91 ? 321 VAL A O   1 
ATOM   1838  C CB  . VAL A 1 239 ? -21.986 88.365   102.768 1.00 19.75 ? 321 VAL A CB  1 
ATOM   1839  C CG1 . VAL A 1 239 ? -21.932 86.966   103.389 1.00 18.97 ? 321 VAL A CG1 1 
ATOM   1840  C CG2 . VAL A 1 239 ? -23.429 88.766   102.500 1.00 19.10 ? 321 VAL A CG2 1 
ATOM   1841  N N   . PHE A 1 240 ? -19.274 89.700   104.879 1.00 19.37 ? 322 PHE A N   1 
ATOM   1842  C CA  . PHE A 1 240 ? -17.846 89.598   105.126 1.00 19.61 ? 322 PHE A CA  1 
ATOM   1843  C C   . PHE A 1 240 ? -17.342 88.160   105.165 1.00 19.69 ? 322 PHE A C   1 
ATOM   1844  O O   . PHE A 1 240 ? -17.880 87.321   105.903 1.00 20.23 ? 322 PHE A O   1 
ATOM   1845  C CB  . PHE A 1 240 ? -17.527 90.345   106.415 1.00 20.52 ? 322 PHE A CB  1 
ATOM   1846  C CG  . PHE A 1 240 ? -18.082 91.744   106.444 1.00 20.88 ? 322 PHE A CG  1 
ATOM   1847  C CD1 . PHE A 1 240 ? -18.971 92.136   107.449 1.00 21.01 ? 322 PHE A CD1 1 
ATOM   1848  C CD2 . PHE A 1 240 ? -17.722 92.670   105.467 1.00 20.09 ? 322 PHE A CD2 1 
ATOM   1849  C CE1 . PHE A 1 240 ? -19.492 93.436   107.482 1.00 19.61 ? 322 PHE A CE1 1 
ATOM   1850  C CE2 . PHE A 1 240 ? -18.235 93.970   105.486 1.00 19.22 ? 322 PHE A CE2 1 
ATOM   1851  C CZ  . PHE A 1 240 ? -19.121 94.353   106.497 1.00 20.99 ? 322 PHE A CZ  1 
ATOM   1852  N N   . GLY A 1 241 ? -16.296 87.891   104.383 1.00 18.32 ? 323 GLY A N   1 
ATOM   1853  C CA  . GLY A 1 241 ? -15.756 86.546   104.296 1.00 18.97 ? 323 GLY A CA  1 
ATOM   1854  C C   . GLY A 1 241 ? -14.558 86.126   105.136 1.00 19.98 ? 323 GLY A C   1 
ATOM   1855  O O   . GLY A 1 241 ? -14.267 84.940   105.198 1.00 20.66 ? 323 GLY A O   1 
ATOM   1856  N N   . ASP A 1 242 ? -13.855 87.065   105.767 1.00 18.62 ? 324 ASP A N   1 
ATOM   1857  C CA  . ASP A 1 242 ? -12.688 86.736   106.595 1.00 17.59 ? 324 ASP A CA  1 
ATOM   1858  C C   . ASP A 1 242 ? -13.148 86.376   108.011 1.00 18.02 ? 324 ASP A C   1 
ATOM   1859  O O   . ASP A 1 242 ? -14.298 86.609   108.373 1.00 17.87 ? 324 ASP A O   1 
ATOM   1860  C CB  . ASP A 1 242 ? -11.734 87.952   106.661 1.00 17.36 ? 324 ASP A CB  1 
ATOM   1861  C CG  . ASP A 1 242 ? -10.338 87.596   107.186 1.00 16.53 ? 324 ASP A CG  1 
ATOM   1862  O OD1 . ASP A 1 242 ? -9.541  88.528   107.482 1.00 17.05 ? 324 ASP A OD1 1 
ATOM   1863  O OD2 . ASP A 1 242 ? -10.036 86.386   107.294 1.00 17.08 ? 324 ASP A OD2 1 
ATOM   1864  N N   . ASN A 1 243 ? -12.256 85.784   108.802 1.00 17.90 ? 325 ASN A N   1 
ATOM   1865  C CA  . ASN A 1 243 ? -12.560 85.450   110.206 1.00 17.88 ? 325 ASN A CA  1 
ATOM   1866  C C   . ASN A 1 243 ? -11.283 85.759   110.999 1.00 18.23 ? 325 ASN A C   1 
ATOM   1867  O O   . ASN A 1 243 ? -10.237 85.163   110.759 1.00 18.17 ? 325 ASN A O   1 
ATOM   1868  C CB  . ASN A 1 243 ? -12.985 83.991   110.355 1.00 17.46 ? 325 ASN A CB  1 
ATOM   1869  C CG  . ASN A 1 243 ? -13.128 83.567   111.824 1.00 17.80 ? 325 ASN A CG  1 
ATOM   1870  O OD1 . ASN A 1 243 ? -12.177 83.105   112.441 1.00 18.59 ? 325 ASN A OD1 1 
ATOM   1871  N ND2 . ASN A 1 243 ? -14.319 83.738   112.381 1.00 16.87 ? 325 ASN A ND2 1 
ATOM   1872  N N   . PRO A 1 244 ? -11.381 86.599   112.040 1.00 19.35 ? 326 PRO A N   1 
ATOM   1873  C CA  . PRO A 1 244 ? -12.549 87.360   112.500 1.00 17.69 ? 326 PRO A CA  1 
ATOM   1874  C C   . PRO A 1 244 ? -13.136 88.329   111.516 1.00 17.38 ? 326 PRO A C   1 
ATOM   1875  O O   . PRO A 1 244 ? -12.541 88.613   110.480 1.00 16.75 ? 326 PRO A O   1 
ATOM   1876  C CB  . PRO A 1 244 ? -12.028 88.050   113.753 1.00 17.86 ? 326 PRO A CB  1 
ATOM   1877  C CG  . PRO A 1 244 ? -10.655 88.416   113.352 1.00 18.60 ? 326 PRO A CG  1 
ATOM   1878  C CD  . PRO A 1 244 ? -10.148 87.144   112.658 1.00 18.78 ? 326 PRO A CD  1 
ATOM   1879  N N   . ARG A 1 245 ? -14.305 88.847   111.869 1.00 16.81 ? 327 ARG A N   1 
ATOM   1880  C CA  . ARG A 1 245 ? -15.038 89.788   111.045 1.00 17.44 ? 327 ARG A CA  1 
ATOM   1881  C C   . ARG A 1 245 ? -16.190 90.311   111.904 1.00 19.31 ? 327 ARG A C   1 
ATOM   1882  O O   . ARG A 1 245 ? -16.557 89.686   112.899 1.00 21.27 ? 327 ARG A O   1 
ATOM   1883  C CB  . ARG A 1 245 ? -15.630 89.070   109.828 1.00 15.81 ? 327 ARG A CB  1 
ATOM   1884  C CG  . ARG A 1 245 ? -16.691 88.025   110.195 1.00 12.82 ? 327 ARG A CG  1 
ATOM   1885  C CD  . ARG A 1 245 ? -17.501 87.611   108.971 1.00 12.38 ? 327 ARG A CD  1 
ATOM   1886  N NE  . ARG A 1 245 ? -18.529 86.614   109.271 1.00 10.72 ? 327 ARG A NE  1 
ATOM   1887  C CZ  . ARG A 1 245 ? -18.314 85.303   109.368 1.00 10.11 ? 327 ARG A CZ  1 
ATOM   1888  N NH1 . ARG A 1 245 ? -19.323 84.492   109.644 1.00 12.25 ? 327 ARG A NH1 1 
ATOM   1889  N NH2 . ARG A 1 245 ? -17.106 84.793   109.179 1.00 8.06  ? 327 ARG A NH2 1 
ATOM   1890  N N   . PRO A 1 246 ? -16.774 91.460   111.530 1.00 18.97 ? 328 PRO A N   1 
ATOM   1891  C CA  . PRO A 1 246 ? -17.891 92.032   112.285 1.00 18.79 ? 328 PRO A CA  1 
ATOM   1892  C C   . PRO A 1 246 ? -19.175 91.409   111.754 1.00 19.38 ? 328 PRO A C   1 
ATOM   1893  O O   . PRO A 1 246 ? -19.152 90.722   110.732 1.00 20.57 ? 328 PRO A O   1 
ATOM   1894  C CB  . PRO A 1 246 ? -17.809 93.509   111.933 1.00 18.09 ? 328 PRO A CB  1 
ATOM   1895  C CG  . PRO A 1 246 ? -17.420 93.450   110.486 1.00 17.41 ? 328 PRO A CG  1 
ATOM   1896  C CD  . PRO A 1 246 ? -16.319 92.397   110.484 1.00 18.00 ? 328 PRO A CD  1 
ATOM   1897  N N   . ASN A 1 247 ? -20.290 91.636   112.440 1.00 20.00 ? 329 ASN A N   1 
ATOM   1898  C CA  . ASN A 1 247 ? -21.571 91.116   111.965 1.00 20.64 ? 329 ASN A CA  1 
ATOM   1899  C C   . ASN A 1 247 ? -21.822 91.723   110.585 1.00 20.73 ? 329 ASN A C   1 
ATOM   1900  O O   . ASN A 1 247 ? -21.322 92.803   110.286 1.00 20.42 ? 329 ASN A O   1 
ATOM   1901  C CB  . ASN A 1 247 ? -22.710 91.528   112.903 1.00 19.97 ? 329 ASN A CB  1 
ATOM   1902  C CG  . ASN A 1 247 ? -22.623 90.860   114.243 1.00 20.87 ? 329 ASN A CG  1 
ATOM   1903  O OD1 . ASN A 1 247 ? -22.572 89.639   114.328 1.00 23.63 ? 329 ASN A OD1 1 
ATOM   1904  N ND2 . ASN A 1 247 ? -22.607 91.653   115.305 1.00 21.79 ? 329 ASN A ND2 1 
ATOM   1905  N N   . ASP A 1 248 ? -22.604 91.031   109.762 1.00 21.64 ? 330 ASP A N   1 
ATOM   1906  C CA  . ASP A 1 248 ? -22.921 91.495   108.415 1.00 22.76 ? 330 ASP A CA  1 
ATOM   1907  C C   . ASP A 1 248 ? -23.576 92.872   108.358 1.00 24.07 ? 330 ASP A C   1 
ATOM   1908  O O   . ASP A 1 248 ? -24.437 93.210   109.181 1.00 24.56 ? 330 ASP A O   1 
ATOM   1909  C CB  . ASP A 1 248 ? -23.824 90.487   107.705 1.00 23.14 ? 330 ASP A CB  1 
ATOM   1910  C CG  . ASP A 1 248 ? -23.110 89.183   107.395 1.00 24.88 ? 330 ASP A CG  1 
ATOM   1911  O OD1 . ASP A 1 248 ? -21.887 89.223   107.126 1.00 24.81 ? 330 ASP A OD1 1 
ATOM   1912  O OD2 . ASP A 1 248 ? -23.773 88.121   107.406 1.00 24.33 ? 330 ASP A OD2 1 
ATOM   1913  N N   . GLY A 1 249 ? -23.166 93.664   107.373 1.00 23.60 ? 331 GLY A N   1 
ATOM   1914  C CA  . GLY A 1 249 ? -23.727 94.992   107.231 1.00 23.77 ? 331 GLY A CA  1 
ATOM   1915  C C   . GLY A 1 249 ? -23.452 95.601   105.871 1.00 23.25 ? 331 GLY A C   1 
ATOM   1916  O O   . GLY A 1 249 ? -23.762 95.012   104.827 1.00 23.19 ? 331 GLY A O   1 
ATOM   1917  N N   . THR A 1 250 ? -22.869 96.792   105.890 1.00 22.68 ? 332 THR A N   1 
ATOM   1918  C CA  . THR A 1 250 ? -22.541 97.493   104.665 1.00 23.15 ? 332 THR A CA  1 
ATOM   1919  C C   . THR A 1 250 ? -21.078 97.210   104.358 1.00 22.70 ? 332 THR A C   1 
ATOM   1920  O O   . THR A 1 250 ? -20.194 97.527   105.155 1.00 21.60 ? 332 THR A O   1 
ATOM   1921  C CB  . THR A 1 250 ? -22.750 99.005   104.829 1.00 24.25 ? 332 THR A CB  1 
ATOM   1922  O OG1 . THR A 1 250 ? -24.032 99.253   105.427 1.00 25.74 ? 332 THR A OG1 1 
ATOM   1923  C CG2 . THR A 1 250 ? -22.688 99.697   103.469 1.00 23.98 ? 332 THR A CG2 1 
ATOM   1924  N N   . GLY A 1 251 ? -20.840 96.600   103.203 1.00 21.87 ? 333 GLY A N   1 
ATOM   1925  C CA  . GLY A 1 251 ? -19.499 96.246   102.820 1.00 22.05 ? 333 GLY A CA  1 
ATOM   1926  C C   . GLY A 1 251 ? -18.740 97.398   102.224 1.00 22.53 ? 333 GLY A C   1 
ATOM   1927  O O   . GLY A 1 251 ? -19.127 98.551   102.343 1.00 22.76 ? 333 GLY A O   1 
ATOM   1928  N N   . SER A 1 252 ? -17.632 97.084   101.577 1.00 23.16 ? 335 SER A N   1 
ATOM   1929  C CA  . SER A 1 252 ? -16.817 98.110   100.962 1.00 23.73 ? 335 SER A CA  1 
ATOM   1930  C C   . SER A 1 252 ? -15.968 97.473   99.887  1.00 24.68 ? 335 SER A C   1 
ATOM   1931  O O   . SER A 1 252 ? -15.516 96.348   100.021 1.00 24.15 ? 335 SER A O   1 
ATOM   1932  C CB  . SER A 1 252 ? -15.903 98.747   101.989 1.00 24.08 ? 335 SER A CB  1 
ATOM   1933  O OG  . SER A 1 252 ? -14.912 99.531   101.344 1.00 24.52 ? 335 SER A OG  1 
ATOM   1934  N N   . CYS A 1 253 ? -15.739 98.194   98.806  1.00 25.58 ? 336 CYS A N   1 
ATOM   1935  C CA  . CYS A 1 253 ? -14.931 97.624   97.750  1.00 26.83 ? 336 CYS A CA  1 
ATOM   1936  C C   . CYS A 1 253 ? -13.448 97.779   98.140  1.00 25.76 ? 336 CYS A C   1 
ATOM   1937  O O   . CYS A 1 253 ? -12.533 97.430   97.370  1.00 25.96 ? 336 CYS A O   1 
ATOM   1938  C CB  . CYS A 1 253 ? -15.238 98.297   96.419  1.00 26.49 ? 336 CYS A CB  1 
ATOM   1939  S SG  . CYS A 1 253 ? -16.821 97.838   95.644  1.00 30.14 ? 336 CYS A SG  1 
ATOM   1940  N N   . GLY A 1 254 ? -13.205 98.256   99.361  1.00 24.87 ? 339 GLY A N   1 
ATOM   1941  C CA  . GLY A 1 254 ? -11.832 98.409   99.810  1.00 23.44 ? 339 GLY A CA  1 
ATOM   1942  C C   . GLY A 1 254 ? -11.706 97.699   101.132 1.00 22.92 ? 339 GLY A C   1 
ATOM   1943  O O   . GLY A 1 254 ? -12.665 97.072   101.595 1.00 22.02 ? 339 GLY A O   1 
ATOM   1944  N N   . PRO A 1 255 ? -10.541 97.778   101.768 1.00 21.86 ? 340 PRO A N   1 
ATOM   1945  C CA  . PRO A 1 255 ? -10.353 97.111   103.056 1.00 21.25 ? 340 PRO A CA  1 
ATOM   1946  C C   . PRO A 1 255 ? -11.332 97.549   104.146 1.00 21.01 ? 340 PRO A C   1 
ATOM   1947  O O   . PRO A 1 255 ? -11.393 98.735   104.461 1.00 20.98 ? 340 PRO A O   1 
ATOM   1948  C CB  . PRO A 1 255 ? -8.926  97.507   103.452 1.00 23.51 ? 340 PRO A CB  1 
ATOM   1949  C CG  . PRO A 1 255 ? -8.252  97.842   102.146 1.00 23.94 ? 340 PRO A CG  1 
ATOM   1950  C CD  . PRO A 1 255 ? -9.343  98.541   101.376 1.00 22.57 ? 340 PRO A CD  1 
ATOM   1951  N N   . VAL A 1 256 ? -12.072 96.601   104.725 1.00 20.32 ? 341 VAL A N   1 
ATOM   1952  C CA  . VAL A 1 256 ? -13.000 96.891   105.817 1.00 20.07 ? 341 VAL A CA  1 
ATOM   1953  C C   . VAL A 1 256 ? -12.180 96.688   107.108 1.00 20.95 ? 341 VAL A C   1 
ATOM   1954  O O   . VAL A 1 256 ? -11.934 95.563   107.543 1.00 20.69 ? 341 VAL A O   1 
ATOM   1955  C CB  . VAL A 1 256 ? -14.208 95.918   105.802 1.00 19.87 ? 341 VAL A CB  1 
ATOM   1956  C CG1 . VAL A 1 256 ? -15.096 96.201   106.987 1.00 17.95 ? 341 VAL A CG1 1 
ATOM   1957  C CG2 . VAL A 1 256 ? -15.008 96.040   104.503 1.00 18.12 ? 341 VAL A CG2 1 
ATOM   1958  N N   . SER A 1 257 ? -11.724 97.791   107.683 1.00 21.46 ? 342 SER A N   1 
ATOM   1959  C CA  . SER A 1 257 ? -10.889 97.771   108.879 1.00 23.76 ? 342 SER A CA  1 
ATOM   1960  C C   . SER A 1 257 ? -11.461 97.173   110.180 1.00 24.99 ? 342 SER A C   1 
ATOM   1961  O O   . SER A 1 257 ? -10.680 96.775   111.053 1.00 25.80 ? 342 SER A O   1 
ATOM   1962  C CB  . SER A 1 257 ? -10.441 99.186   109.190 1.00 23.66 ? 342 SER A CB  1 
ATOM   1963  O OG  . SER A 1 257 ? -11.453 99.857   109.914 1.00 24.17 ? 342 SER A OG  1 
ATOM   1964  N N   . SER A 1 258 ? -12.785 97.144   110.344 1.00 25.31 ? 344 SER A N   1 
ATOM   1965  C CA  . SER A 1 258 ? -13.343 96.630   111.580 1.00 26.76 ? 344 SER A CA  1 
ATOM   1966  C C   . SER A 1 258 ? -13.127 95.165   111.768 1.00 25.62 ? 344 SER A C   1 
ATOM   1967  O O   . SER A 1 258 ? -13.709 94.363   111.056 1.00 22.72 ? 344 SER A O   1 
ATOM   1968  C CB  . SER A 1 258 ? -14.843 96.958   111.707 1.00 28.25 ? 344 SER A CB  1 
ATOM   1969  O OG  . SER A 1 258 ? -15.642 96.112   110.895 1.00 34.42 ? 344 SER A OG  1 
ATOM   1970  N N   . ASN A 1 259 ? -12.272 94.827   112.725 1.00 24.63 ? 345 ASN A N   1 
ATOM   1971  C CA  . ASN A 1 259 ? -12.010 93.440   113.031 1.00 26.30 ? 345 ASN A CA  1 
ATOM   1972  C C   . ASN A 1 259 ? -11.193 92.610   112.076 1.00 26.07 ? 345 ASN A C   1 
ATOM   1973  O O   . ASN A 1 259 ? -11.021 91.447   112.356 1.00 26.92 ? 345 ASN A O   1 
ATOM   1974  C CB  . ASN A 1 259 ? -13.327 92.712   113.280 1.00 27.37 ? 345 ASN A CB  1 
ATOM   1975  C CG  . ASN A 1 259 ? -13.370 92.101   114.639 1.00 29.29 ? 345 ASN A CG  1 
ATOM   1976  O OD1 . ASN A 1 259 ? -12.356 91.595   115.124 1.00 32.43 ? 345 ASN A OD1 1 
ATOM   1977  N ND2 . ASN A 1 259 ? -14.521 92.155   115.282 1.00 27.75 ? 345 ASN A ND2 1 
ATOM   1978  N N   . GLY A 1 260 A -10.656 93.168   110.996 1.00 26.48 ? 345 GLY A N   1 
ATOM   1979  C CA  . GLY A 1 260 A -9.904  92.326   110.091 1.00 27.64 ? 345 GLY A CA  1 
ATOM   1980  C C   . GLY A 1 260 A -8.426  92.280   110.352 1.00 26.92 ? 345 GLY A C   1 
ATOM   1981  O O   . GLY A 1 260 A -7.693  91.841   109.483 1.00 27.05 ? 345 GLY A O   1 
ATOM   1982  N N   . ALA A 1 261 ? -7.993  92.716   111.533 1.00 27.31 ? 346 ALA A N   1 
ATOM   1983  C CA  . ALA A 1 261 ? -6.567  92.725   111.879 1.00 26.98 ? 346 ALA A CA  1 
ATOM   1984  C C   . ALA A 1 261 ? -5.889  91.351   111.907 1.00 27.96 ? 346 ALA A C   1 
ATOM   1985  O O   . ALA A 1 261 ? -4.690  91.255   112.161 1.00 31.45 ? 346 ALA A O   1 
ATOM   1986  C CB  . ALA A 1 261 ? -6.349  93.415   113.209 1.00 27.80 ? 346 ALA A CB  1 
ATOM   1987  N N   . TYR A 1 262 ? -6.648  90.289   111.666 1.00 25.91 ? 347 TYR A N   1 
ATOM   1988  C CA  . TYR A 1 262 ? -6.098  88.931   111.628 1.00 22.57 ? 347 TYR A CA  1 
ATOM   1989  C C   . TYR A 1 262 ? -6.851  88.261   110.479 1.00 21.14 ? 347 TYR A C   1 
ATOM   1990  O O   . TYR A 1 262 ? -7.089  88.897   109.446 1.00 23.08 ? 347 TYR A O   1 
ATOM   1991  C CB  . TYR A 1 262 ? -6.344  88.232   112.979 1.00 23.55 ? 347 TYR A CB  1 
ATOM   1992  C CG  . TYR A 1 262 ? -5.843  86.797   113.137 1.00 24.55 ? 347 TYR A CG  1 
ATOM   1993  C CD1 . TYR A 1 262 ? -4.536  86.422   112.781 1.00 24.67 ? 347 TYR A CD1 1 
ATOM   1994  C CD2 . TYR A 1 262 ? -6.668  85.823   113.703 1.00 23.67 ? 347 TYR A CD2 1 
ATOM   1995  C CE1 . TYR A 1 262 ? -4.078  85.103   112.995 1.00 22.45 ? 347 TYR A CE1 1 
ATOM   1996  C CE2 . TYR A 1 262 ? -6.219  84.520   113.918 1.00 22.09 ? 347 TYR A CE2 1 
ATOM   1997  C CZ  . TYR A 1 262 ? -4.936  84.167   113.564 1.00 22.91 ? 347 TYR A CZ  1 
ATOM   1998  O OH  . TYR A 1 262 ? -4.544  82.866   113.762 1.00 23.36 ? 347 TYR A OH  1 
ATOM   1999  N N   . GLY A 1 263 ? -7.248  87.008   110.641 1.00 18.66 ? 348 GLY A N   1 
ATOM   2000  C CA  . GLY A 1 263 ? -7.969  86.351   109.570 1.00 16.24 ? 348 GLY A CA  1 
ATOM   2001  C C   . GLY A 1 263 ? -7.743  84.856   109.490 1.00 16.40 ? 348 GLY A C   1 
ATOM   2002  O O   . GLY A 1 263 ? -7.236  84.213   110.418 1.00 15.85 ? 348 GLY A O   1 
ATOM   2003  N N   . VAL A 1 264 ? -8.129  84.304   108.354 1.00 15.70 ? 349 VAL A N   1 
ATOM   2004  C CA  . VAL A 1 264 ? -7.990  82.894   108.107 1.00 15.37 ? 349 VAL A CA  1 
ATOM   2005  C C   . VAL A 1 264 ? -7.968  82.736   106.593 1.00 14.98 ? 349 VAL A C   1 
ATOM   2006  O O   . VAL A 1 264 ? -8.472  83.587   105.874 1.00 15.16 ? 349 VAL A O   1 
ATOM   2007  C CB  . VAL A 1 264 ? -9.180  82.133   108.727 1.00 15.48 ? 349 VAL A CB  1 
ATOM   2008  C CG1 . VAL A 1 264 ? -10.460 82.428   107.973 1.00 13.16 ? 349 VAL A CG1 1 
ATOM   2009  C CG2 . VAL A 1 264 ? -8.886  80.660   108.744 1.00 16.69 ? 349 VAL A CG2 1 
ATOM   2010  N N   . LYS A 1 265 ? -7.372  81.660   106.102 1.00 14.87 ? 350 LYS A N   1 
ATOM   2011  C CA  . LYS A 1 265 ? -7.323  81.457   104.667 1.00 14.99 ? 350 LYS A CA  1 
ATOM   2012  C C   . LYS A 1 265 ? -8.708  81.065   104.170 1.00 15.62 ? 350 LYS A C   1 
ATOM   2013  O O   . LYS A 1 265 ? -9.403  80.265   104.805 1.00 15.88 ? 350 LYS A O   1 
ATOM   2014  C CB  . LYS A 1 265 ? -6.310  80.377   104.313 1.00 15.03 ? 350 LYS A CB  1 
ATOM   2015  C CG  . LYS A 1 265 ? -6.288  80.008   102.846 1.00 13.81 ? 350 LYS A CG  1 
ATOM   2016  C CD  . LYS A 1 265 ? -5.276  78.915   102.593 1.00 13.09 ? 350 LYS A CD  1 
ATOM   2017  C CE  . LYS A 1 265 ? -5.420  78.312   101.194 1.00 13.49 ? 350 LYS A CE  1 
ATOM   2018  N NZ  . LYS A 1 265 ? -5.164  79.285   100.097 1.00 10.76 ? 350 LYS A NZ  1 
ATOM   2019  N N   . GLY A 1 266 ? -9.104  81.655   103.045 1.00 14.40 ? 351 GLY A N   1 
ATOM   2020  C CA  . GLY A 1 266 ? -10.404 81.377   102.469 1.00 14.36 ? 351 GLY A CA  1 
ATOM   2021  C C   . GLY A 1 266 ? -10.390 81.474   100.955 1.00 15.18 ? 351 GLY A C   1 
ATOM   2022  O O   . GLY A 1 266 ? -9.333  81.552   100.337 1.00 14.26 ? 351 GLY A O   1 
ATOM   2023  N N   . PHE A 1 267 ? -11.571 81.490   100.353 1.00 15.37 ? 352 PHE A N   1 
ATOM   2024  C CA  . PHE A 1 267 ? -11.672 81.549   98.904  1.00 14.45 ? 352 PHE A CA  1 
ATOM   2025  C C   . PHE A 1 267 ? -13.049 82.045   98.481  1.00 14.92 ? 352 PHE A C   1 
ATOM   2026  O O   . PHE A 1 267 ? -13.913 82.290   99.322  1.00 14.65 ? 352 PHE A O   1 
ATOM   2027  C CB  . PHE A 1 267 ? -11.484 80.156   98.322  1.00 13.16 ? 352 PHE A CB  1 
ATOM   2028  C CG  . PHE A 1 267 ? -12.622 79.246   98.622  1.00 13.14 ? 352 PHE A CG  1 
ATOM   2029  C CD1 . PHE A 1 267 ? -12.709 78.609   99.854  1.00 12.11 ? 352 PHE A CD1 1 
ATOM   2030  C CD2 . PHE A 1 267 ? -13.668 79.106   97.714  1.00 13.32 ? 352 PHE A CD2 1 
ATOM   2031  C CE1 . PHE A 1 267 ? -13.822 77.853   100.185 1.00 12.19 ? 352 PHE A CE1 1 
ATOM   2032  C CE2 . PHE A 1 267 ? -14.789 78.348   98.039  1.00 13.05 ? 352 PHE A CE2 1 
ATOM   2033  C CZ  . PHE A 1 267 ? -14.865 77.722   99.279  1.00 12.22 ? 352 PHE A CZ  1 
ATOM   2034  N N   . SER A 1 268 ? -13.239 82.160   97.167  1.00 15.55 ? 353 SER A N   1 
ATOM   2035  C CA  . SER A 1 268 ? -14.500 82.584   96.574  1.00 16.04 ? 353 SER A CA  1 
ATOM   2036  C C   . SER A 1 268 ? -14.481 82.390   95.073  1.00 16.73 ? 353 SER A C   1 
ATOM   2037  O O   . SER A 1 268 ? -13.426 82.464   94.449  1.00 16.21 ? 353 SER A O   1 
ATOM   2038  C CB  . SER A 1 268 ? -14.789 84.052   96.878  1.00 16.73 ? 353 SER A CB  1 
ATOM   2039  O OG  . SER A 1 268 ? -15.147 84.223   98.235  1.00 19.17 ? 353 SER A OG  1 
ATOM   2040  N N   . PHE A 1 269 ? -15.657 82.135   94.503  1.00 16.68 ? 354 PHE A N   1 
ATOM   2041  C CA  . PHE A 1 269 ? -15.799 81.951   93.065  1.00 16.50 ? 354 PHE A CA  1 
ATOM   2042  C C   . PHE A 1 269 ? -16.686 83.039   92.499  1.00 18.00 ? 354 PHE A C   1 
ATOM   2043  O O   . PHE A 1 269 ? -17.836 83.222   92.924  1.00 19.37 ? 354 PHE A O   1 
ATOM   2044  C CB  . PHE A 1 269 ? -16.399 80.589   92.742  1.00 16.15 ? 354 PHE A CB  1 
ATOM   2045  C CG  . PHE A 1 269 ? -15.484 79.451   93.048  1.00 15.31 ? 354 PHE A CG  1 
ATOM   2046  C CD1 . PHE A 1 269 ? -15.750 78.593   94.108  1.00 14.31 ? 354 PHE A CD1 1 
ATOM   2047  C CD2 . PHE A 1 269 ? -14.344 79.245   92.288  1.00 14.79 ? 354 PHE A CD2 1 
ATOM   2048  C CE1 . PHE A 1 269 ? -14.893 77.549   94.404  1.00 14.20 ? 354 PHE A CE1 1 
ATOM   2049  C CE2 . PHE A 1 269 ? -13.475 78.197   92.581  1.00 15.71 ? 354 PHE A CE2 1 
ATOM   2050  C CZ  . PHE A 1 269 ? -13.753 77.347   93.642  1.00 14.99 ? 354 PHE A CZ  1 
ATOM   2051  N N   . LYS A 1 270 ? -16.141 83.765   91.532  1.00 18.07 ? 355 LYS A N   1 
ATOM   2052  C CA  . LYS A 1 270 ? -16.856 84.859   90.901  1.00 17.35 ? 355 LYS A CA  1 
ATOM   2053  C C   . LYS A 1 270 ? -17.516 84.415   89.610  1.00 17.36 ? 355 LYS A C   1 
ATOM   2054  O O   . LYS A 1 270 ? -16.887 83.776   88.768  1.00 17.69 ? 355 LYS A O   1 
ATOM   2055  C CB  . LYS A 1 270 ? -15.885 86.018   90.631  1.00 16.42 ? 355 LYS A CB  1 
ATOM   2056  C CG  . LYS A 1 270 ? -16.346 87.037   89.595  1.00 15.11 ? 355 LYS A CG  1 
ATOM   2057  C CD  . LYS A 1 270 ? -15.317 88.149   89.452  1.00 14.22 ? 355 LYS A CD  1 
ATOM   2058  C CE  . LYS A 1 270 ? -15.320 88.755   88.049  1.00 16.29 ? 355 LYS A CE  1 
ATOM   2059  N NZ  . LYS A 1 270 ? -16.575 89.460   87.673  1.00 13.77 ? 355 LYS A NZ  1 
ATOM   2060  N N   . TYR A 1 271 ? -18.799 84.740   89.484  1.00 17.79 ? 356 TYR A N   1 
ATOM   2061  C CA  . TYR A 1 271 ? -19.584 84.447   88.287  1.00 17.63 ? 356 TYR A CA  1 
ATOM   2062  C C   . TYR A 1 271 ? -20.235 85.777   87.922  1.00 18.41 ? 356 TYR A C   1 
ATOM   2063  O O   . TYR A 1 271 ? -21.187 86.209   88.588  1.00 18.74 ? 356 TYR A O   1 
ATOM   2064  C CB  . TYR A 1 271 ? -20.675 83.400   88.564  1.00 15.88 ? 356 TYR A CB  1 
ATOM   2065  C CG  . TYR A 1 271 ? -20.183 81.976   88.738  1.00 13.91 ? 356 TYR A CG  1 
ATOM   2066  C CD1 . TYR A 1 271 ? -19.750 81.513   89.978  1.00 10.69 ? 356 TYR A CD1 1 
ATOM   2067  C CD2 . TYR A 1 271 ? -20.183 81.081   87.660  1.00 12.71 ? 356 TYR A CD2 1 
ATOM   2068  C CE1 . TYR A 1 271 ? -19.335 80.198   90.149  1.00 10.82 ? 356 TYR A CE1 1 
ATOM   2069  C CE2 . TYR A 1 271 ? -19.769 79.765   87.820  1.00 12.65 ? 356 TYR A CE2 1 
ATOM   2070  C CZ  . TYR A 1 271 ? -19.350 79.327   89.068  1.00 12.90 ? 356 TYR A CZ  1 
ATOM   2071  O OH  . TYR A 1 271 ? -18.978 78.014   89.243  1.00 14.03 ? 356 TYR A OH  1 
ATOM   2072  N N   . GLY A 1 272 ? -19.724 86.434   86.882  1.00 19.36 ? 357 GLY A N   1 
ATOM   2073  C CA  . GLY A 1 272 ? -20.276 87.725   86.509  1.00 20.05 ? 357 GLY A CA  1 
ATOM   2074  C C   . GLY A 1 272 ? -20.053 88.635   87.707  1.00 21.09 ? 357 GLY A C   1 
ATOM   2075  O O   . GLY A 1 272 ? -18.955 88.659   88.261  1.00 21.46 ? 357 GLY A O   1 
ATOM   2076  N N   . ASN A 1 273 ? -21.079 89.368   88.124  1.00 20.80 ? 358 ASN A N   1 
ATOM   2077  C CA  . ASN A 1 273 ? -20.940 90.238   89.278  1.00 22.54 ? 358 ASN A CA  1 
ATOM   2078  C C   . ASN A 1 273 ? -21.378 89.538   90.568  1.00 22.99 ? 358 ASN A C   1 
ATOM   2079  O O   . ASN A 1 273 ? -21.531 90.171   91.607  1.00 23.58 ? 358 ASN A O   1 
ATOM   2080  C CB  . ASN A 1 273 ? -21.735 91.536   89.073  1.00 25.01 ? 358 ASN A CB  1 
ATOM   2081  C CG  . ASN A 1 273 ? -21.042 92.498   88.111  1.00 26.82 ? 358 ASN A CG  1 
ATOM   2082  O OD1 . ASN A 1 273 ? -19.871 92.838   88.297  1.00 28.22 ? 358 ASN A OD1 1 
ATOM   2083  N ND2 . ASN A 1 273 ? -21.761 92.945   87.085  1.00 27.32 ? 358 ASN A ND2 1 
ATOM   2084  N N   . GLY A 1 274 ? -21.555 88.225   90.511  1.00 22.06 ? 359 GLY A N   1 
ATOM   2085  C CA  . GLY A 1 274 ? -21.963 87.505   91.701  1.00 22.30 ? 359 GLY A CA  1 
ATOM   2086  C C   . GLY A 1 274 ? -20.807 86.703   92.266  1.00 23.21 ? 359 GLY A C   1 
ATOM   2087  O O   . GLY A 1 274 ? -19.774 86.555   91.604  1.00 23.36 ? 359 GLY A O   1 
ATOM   2088  N N   . VAL A 1 275 ? -20.979 86.173   93.475  1.00 21.86 ? 360 VAL A N   1 
ATOM   2089  C CA  . VAL A 1 275 ? -19.924 85.405   94.114  1.00 21.99 ? 360 VAL A CA  1 
ATOM   2090  C C   . VAL A 1 275 ? -20.412 84.341   95.073  1.00 20.80 ? 360 VAL A C   1 
ATOM   2091  O O   . VAL A 1 275 ? -21.414 84.522   95.763  1.00 20.56 ? 360 VAL A O   1 
ATOM   2092  C CB  . VAL A 1 275 ? -18.971 86.317   94.917  1.00 22.95 ? 360 VAL A CB  1 
ATOM   2093  C CG1 . VAL A 1 275 ? -18.205 87.205   93.986  1.00 24.78 ? 360 VAL A CG1 1 
ATOM   2094  C CG2 . VAL A 1 275 ? -19.767 87.155   95.908  1.00 22.26 ? 360 VAL A CG2 1 
ATOM   2095  N N   . TRP A 1 276 ? -19.684 83.229   95.107  1.00 19.54 ? 361 TRP A N   1 
ATOM   2096  C CA  . TRP A 1 276 ? -19.991 82.131   96.010  1.00 18.88 ? 361 TRP A CA  1 
ATOM   2097  C C   . TRP A 1 276 ? -18.974 82.279   97.116  1.00 19.04 ? 361 TRP A C   1 
ATOM   2098  O O   . TRP A 1 276 ? -17.767 82.110   96.896  1.00 18.81 ? 361 TRP A O   1 
ATOM   2099  C CB  . TRP A 1 276 ? -19.806 80.768   95.337  1.00 18.21 ? 361 TRP A CB  1 
ATOM   2100  C CG  . TRP A 1 276 ? -21.062 80.161   94.794  1.00 17.52 ? 361 TRP A CG  1 
ATOM   2101  C CD1 . TRP A 1 276 ? -21.414 80.043   93.480  1.00 16.94 ? 361 TRP A CD1 1 
ATOM   2102  C CD2 . TRP A 1 276 ? -22.124 79.560   95.550  1.00 17.62 ? 361 TRP A CD2 1 
ATOM   2103  N NE1 . TRP A 1 276 ? -22.626 79.402   93.368  1.00 18.16 ? 361 TRP A NE1 1 
ATOM   2104  C CE2 . TRP A 1 276 ? -23.085 79.092   94.624  1.00 16.82 ? 361 TRP A CE2 1 
ATOM   2105  C CE3 . TRP A 1 276 ? -22.355 79.366   96.921  1.00 16.66 ? 361 TRP A CE3 1 
ATOM   2106  C CZ2 . TRP A 1 276 ? -24.260 78.446   95.019  1.00 16.40 ? 361 TRP A CZ2 1 
ATOM   2107  C CZ3 . TRP A 1 276 ? -23.526 78.723   97.319  1.00 16.40 ? 361 TRP A CZ3 1 
ATOM   2108  C CH2 . TRP A 1 276 ? -24.463 78.269   96.367  1.00 17.66 ? 361 TRP A CH2 1 
ATOM   2109  N N   . ILE A 1 277 ? -19.465 82.607   98.302  1.00 18.01 ? 362 ILE A N   1 
ATOM   2110  C CA  . ILE A 1 277 ? -18.609 82.803   99.450  1.00 17.31 ? 362 ILE A CA  1 
ATOM   2111  C C   . ILE A 1 277 ? -18.573 81.591   100.374 1.00 17.78 ? 362 ILE A C   1 
ATOM   2112  O O   . ILE A 1 277 ? -19.602 80.965   100.652 1.00 17.57 ? 362 ILE A O   1 
ATOM   2113  C CB  . ILE A 1 277 ? -19.085 84.019   100.273 1.00 18.22 ? 362 ILE A CB  1 
ATOM   2114  C CG1 . ILE A 1 277 ? -19.014 85.282   99.414  1.00 18.46 ? 362 ILE A CG1 1 
ATOM   2115  C CG2 . ILE A 1 277 ? -18.245 84.166   101.550 1.00 16.51 ? 362 ILE A CG2 1 
ATOM   2116  C CD1 . ILE A 1 277 ? -19.620 86.499   100.085 1.00 18.07 ? 362 ILE A CD1 1 
ATOM   2117  N N   . GLY A 1 278 ? -17.370 81.268   100.831 1.00 16.15 ? 363 GLY A N   1 
ATOM   2118  C CA  . GLY A 1 278 ? -17.188 80.185   101.769 1.00 16.14 ? 363 GLY A CA  1 
ATOM   2119  C C   . GLY A 1 278 ? -16.712 80.914   103.012 1.00 17.41 ? 363 GLY A C   1 
ATOM   2120  O O   . GLY A 1 278 ? -15.858 81.798   102.912 1.00 16.46 ? 363 GLY A O   1 
ATOM   2121  N N   . ARG A 1 279 ? -17.259 80.589   104.178 1.00 16.71 ? 364 ARG A N   1 
ATOM   2122  C CA  . ARG A 1 279 ? -16.833 81.281   105.394 1.00 17.26 ? 364 ARG A CA  1 
ATOM   2123  C C   . ARG A 1 279 ? -17.226 80.521   106.646 1.00 17.00 ? 364 ARG A C   1 
ATOM   2124  O O   . ARG A 1 279 ? -18.003 79.566   106.586 1.00 18.76 ? 364 ARG A O   1 
ATOM   2125  C CB  . ARG A 1 279 ? -17.432 82.699   105.450 1.00 16.21 ? 364 ARG A CB  1 
ATOM   2126  C CG  . ARG A 1 279 ? -18.921 82.775   105.849 1.00 16.52 ? 364 ARG A CG  1 
ATOM   2127  C CD  . ARG A 1 279 ? -19.416 84.229   105.928 1.00 15.76 ? 364 ARG A CD  1 
ATOM   2128  N NE  . ARG A 1 279 ? -20.720 84.374   106.579 1.00 14.66 ? 364 ARG A NE  1 
ATOM   2129  C CZ  . ARG A 1 279 ? -21.350 85.535   106.751 1.00 13.48 ? 364 ARG A CZ  1 
ATOM   2130  N NH1 . ARG A 1 279 ? -22.529 85.572   107.350 1.00 14.00 ? 364 ARG A NH1 1 
ATOM   2131  N NH2 . ARG A 1 279 ? -20.810 86.666   106.321 1.00 14.41 ? 364 ARG A NH2 1 
ATOM   2132  N N   . THR A 1 280 ? -16.680 80.939   107.779 1.00 16.03 ? 365 THR A N   1 
ATOM   2133  C CA  . THR A 1 280 ? -17.007 80.300   109.044 1.00 17.30 ? 365 THR A CA  1 
ATOM   2134  C C   . THR A 1 280 ? -18.397 80.783   109.470 1.00 18.28 ? 365 THR A C   1 
ATOM   2135  O O   . THR A 1 280 ? -18.897 81.776   108.945 1.00 18.88 ? 365 THR A O   1 
ATOM   2136  C CB  . THR A 1 280 ? -15.998 80.689   110.143 1.00 17.53 ? 365 THR A CB  1 
ATOM   2137  O OG1 . THR A 1 280 ? -16.223 82.049   110.543 1.00 16.36 ? 365 THR A OG1 1 
ATOM   2138  C CG2 . THR A 1 280 ? -14.575 80.529   109.635 1.00 16.05 ? 365 THR A CG2 1 
ATOM   2139  N N   . LYS A 1 281 ? -19.037 80.091   110.404 1.00 18.58 ? 366 LYS A N   1 
ATOM   2140  C CA  . LYS A 1 281 ? -20.348 80.550   110.847 1.00 20.02 ? 366 LYS A CA  1 
ATOM   2141  C C   . LYS A 1 281 ? -20.165 81.584   111.965 1.00 20.57 ? 366 LYS A C   1 
ATOM   2142  O O   . LYS A 1 281 ? -20.937 82.537   112.079 1.00 18.75 ? 366 LYS A O   1 
ATOM   2143  C CB  . LYS A 1 281 ? -21.194 79.372   111.315 1.00 18.77 ? 366 LYS A CB  1 
ATOM   2144  C CG  . LYS A 1 281 ? -21.414 78.362   110.208 1.00 19.49 ? 366 LYS A CG  1 
ATOM   2145  C CD  . LYS A 1 281 ? -22.274 77.202   110.654 1.00 18.15 ? 366 LYS A CD  1 
ATOM   2146  C CE  . LYS A 1 281 ? -23.719 77.473   110.345 1.00 17.50 ? 366 LYS A CE  1 
ATOM   2147  N NZ  . LYS A 1 281 ? -23.896 77.682   108.893 1.00 16.39 ? 366 LYS A NZ  1 
ATOM   2148  N N   . SER A 1 282 ? -19.114 81.397   112.759 1.00 20.98 ? 367 SER A N   1 
ATOM   2149  C CA  . SER A 1 282 ? -18.784 82.299   113.860 1.00 22.08 ? 367 SER A CA  1 
ATOM   2150  C C   . SER A 1 282 ? -17.952 83.507   113.380 1.00 22.63 ? 367 SER A C   1 
ATOM   2151  O O   . SER A 1 282 ? -17.135 83.386   112.468 1.00 21.90 ? 367 SER A O   1 
ATOM   2152  C CB  . SER A 1 282 ? -18.007 81.530   114.924 1.00 21.15 ? 367 SER A CB  1 
ATOM   2153  O OG  . SER A 1 282 ? -17.290 82.420   115.755 1.00 21.94 ? 367 SER A OG  1 
ATOM   2154  N N   . THR A 1 283 ? -18.162 84.665   114.001 1.00 23.94 ? 368 THR A N   1 
ATOM   2155  C CA  . THR A 1 283 ? -17.437 85.882   113.630 1.00 25.04 ? 368 THR A CA  1 
ATOM   2156  C C   . THR A 1 283 ? -16.163 86.104   114.442 1.00 25.04 ? 368 THR A C   1 
ATOM   2157  O O   . THR A 1 283 ? -15.361 86.964   114.082 1.00 26.11 ? 368 THR A O   1 
ATOM   2158  C CB  . THR A 1 283 ? -18.297 87.131   113.832 1.00 26.77 ? 368 THR A CB  1 
ATOM   2159  O OG1 . THR A 1 283 ? -19.474 87.041   113.020 1.00 20.00 ? 368 THR A OG1 1 
ATOM   2160  C CG2 . THR A 1 283 ? -17.523 88.380   113.440 1.00 20.00 ? 368 THR A CG2 1 
ATOM   2161  N N   . ASN A 1 284 ? -15.977 85.339   115.521 1.00 24.44 ? 369 ASN A N   1 
ATOM   2162  C CA  . ASN A 1 284 ? -14.793 85.479   116.380 1.00 25.41 ? 369 ASN A CA  1 
ATOM   2163  C C   . ASN A 1 284 ? -13.765 84.360   116.276 1.00 23.88 ? 369 ASN A C   1 
ATOM   2164  O O   . ASN A 1 284 ? -12.564 84.612   116.291 1.00 23.12 ? 369 ASN A O   1 
ATOM   2165  C CB  . ASN A 1 284 ? -15.204 85.591   117.843 1.00 29.16 ? 369 ASN A CB  1 
ATOM   2166  C CG  . ASN A 1 284 ? -16.244 86.646   118.063 1.00 34.71 ? 369 ASN A CG  1 
ATOM   2167  O OD1 . ASN A 1 284 ? -16.052 87.806   117.686 1.00 37.48 ? 369 ASN A OD1 1 
ATOM   2168  N ND2 . ASN A 1 284 ? -17.367 86.259   118.674 1.00 37.22 ? 369 ASN A ND2 1 
ATOM   2169  N N   . SER A 1 285 ? -14.234 83.123   116.205 1.00 22.46 ? 370 SER A N   1 
ATOM   2170  C CA  . SER A 1 285 ? -13.324 81.999   116.112 1.00 21.00 ? 370 SER A CA  1 
ATOM   2171  C C   . SER A 1 285 ? -13.631 81.137   114.906 1.00 20.02 ? 370 SER A C   1 
ATOM   2172  O O   . SER A 1 285 ? -14.705 81.231   114.318 1.00 18.40 ? 370 SER A O   1 
ATOM   2173  C CB  . SER A 1 285 ? -13.389 81.152   117.389 1.00 21.86 ? 370 SER A CB  1 
ATOM   2174  O OG  . SER A 1 285 ? -14.710 80.701   117.648 1.00 23.12 ? 370 SER A OG  1 
ATOM   2175  N N   . ARG A 1 286 ? -12.669 80.299   114.547 1.00 19.56 ? 371 ARG A N   1 
ATOM   2176  C CA  . ARG A 1 286 ? -12.810 79.400   113.413 1.00 20.43 ? 371 ARG A CA  1 
ATOM   2177  C C   . ARG A 1 286 ? -13.759 78.268   113.777 1.00 19.31 ? 371 ARG A C   1 
ATOM   2178  O O   . ARG A 1 286 ? -13.341 77.144   114.027 1.00 19.12 ? 371 ARG A O   1 
ATOM   2179  C CB  . ARG A 1 286 ? -11.430 78.863   113.010 1.00 21.01 ? 371 ARG A CB  1 
ATOM   2180  C CG  . ARG A 1 286 ? -10.497 79.989   112.569 1.00 20.86 ? 371 ARG A CG  1 
ATOM   2181  C CD  . ARG A 1 286 ? -9.024  79.597   112.481 1.00 19.50 ? 371 ARG A CD  1 
ATOM   2182  N NE  . ARG A 1 286 ? -8.222  80.763   112.104 1.00 20.75 ? 371 ARG A NE  1 
ATOM   2183  C CZ  . ARG A 1 286 ? -6.934  80.732   111.770 1.00 20.82 ? 371 ARG A CZ  1 
ATOM   2184  N NH1 . ARG A 1 286 ? -6.306  81.856   111.441 1.00 18.53 ? 371 ARG A NH1 1 
ATOM   2185  N NH2 . ARG A 1 286 ? -6.276  79.583   111.764 1.00 20.25 ? 371 ARG A NH2 1 
ATOM   2186  N N   . SER A 1 287 ? -15.046 78.595   113.798 1.00 19.77 ? 372 SER A N   1 
ATOM   2187  C CA  . SER A 1 287 ? -16.097 77.648   114.139 1.00 19.47 ? 372 SER A CA  1 
ATOM   2188  C C   . SER A 1 287 ? -17.141 77.622   113.028 1.00 19.51 ? 372 SER A C   1 
ATOM   2189  O O   . SER A 1 287 ? -17.637 78.668   112.608 1.00 19.90 ? 372 SER A O   1 
ATOM   2190  C CB  . SER A 1 287 ? -16.766 78.057   115.461 1.00 19.23 ? 372 SER A CB  1 
ATOM   2191  O OG  . SER A 1 287 ? -15.811 78.299   116.481 1.00 17.84 ? 372 SER A OG  1 
ATOM   2192  N N   . GLY A 1 288 ? -17.470 76.420   112.563 1.00 20.20 ? 373 GLY A N   1 
ATOM   2193  C CA  . GLY A 1 288 ? -18.451 76.255   111.500 1.00 18.97 ? 373 GLY A CA  1 
ATOM   2194  C C   . GLY A 1 288 ? -18.023 76.754   110.129 1.00 18.45 ? 373 GLY A C   1 
ATOM   2195  O O   . GLY A 1 288 ? -17.066 77.525   110.001 1.00 17.82 ? 373 GLY A O   1 
ATOM   2196  N N   . PHE A 1 289 ? -18.735 76.308   109.097 1.00 17.25 ? 374 PHE A N   1 
ATOM   2197  C CA  . PHE A 1 289 ? -18.453 76.728   107.732 1.00 17.01 ? 374 PHE A CA  1 
ATOM   2198  C C   . PHE A 1 289 ? -19.753 76.709   106.944 1.00 18.23 ? 374 PHE A C   1 
ATOM   2199  O O   . PHE A 1 289 ? -20.679 75.974   107.289 1.00 19.08 ? 374 PHE A O   1 
ATOM   2200  C CB  . PHE A 1 289 ? -17.445 75.800   107.060 1.00 14.96 ? 374 PHE A CB  1 
ATOM   2201  C CG  . PHE A 1 289 ? -16.757 76.421   105.873 1.00 13.34 ? 374 PHE A CG  1 
ATOM   2202  C CD1 . PHE A 1 289 ? -15.686 77.293   106.053 1.00 12.93 ? 374 PHE A CD1 1 
ATOM   2203  C CD2 . PHE A 1 289 ? -17.178 76.145   104.578 1.00 11.41 ? 374 PHE A CD2 1 
ATOM   2204  C CE1 . PHE A 1 289 ? -15.043 77.881   104.961 1.00 10.74 ? 374 PHE A CE1 1 
ATOM   2205  C CE2 . PHE A 1 289 ? -16.540 76.730   103.481 1.00 12.26 ? 374 PHE A CE2 1 
ATOM   2206  C CZ  . PHE A 1 289 ? -15.472 77.598   103.675 1.00 11.36 ? 374 PHE A CZ  1 
ATOM   2207  N N   . GLU A 1 290 ? -19.818 77.513   105.886 1.00 17.29 ? 375 GLU A N   1 
ATOM   2208  C CA  . GLU A 1 290 ? -21.020 77.599   105.070 1.00 17.11 ? 375 GLU A CA  1 
ATOM   2209  C C   . GLU A 1 290 ? -20.731 78.258   103.727 1.00 16.87 ? 375 GLU A C   1 
ATOM   2210  O O   . GLU A 1 290 ? -19.817 79.071   103.607 1.00 16.61 ? 375 GLU A O   1 
ATOM   2211  C CB  . GLU A 1 290 ? -22.093 78.414   105.810 1.00 18.02 ? 375 GLU A CB  1 
ATOM   2212  C CG  . GLU A 1 290 ? -21.591 79.774   106.307 1.00 20.11 ? 375 GLU A CG  1 
ATOM   2213  C CD  . GLU A 1 290 ? -22.650 80.579   107.071 1.00 23.46 ? 375 GLU A CD  1 
ATOM   2214  O OE1 . GLU A 1 290 ? -23.403 79.971   107.863 1.00 26.01 ? 375 GLU A OE1 1 
ATOM   2215  O OE2 . GLU A 1 290 ? -22.723 81.822   106.899 1.00 22.82 ? 375 GLU A OE2 1 
ATOM   2216  N N   . MET A 1 291 ? -21.512 77.889   102.718 1.00 16.51 ? 376 MET A N   1 
ATOM   2217  C CA  . MET A 1 291 ? -21.386 78.466   101.386 1.00 17.27 ? 376 MET A CA  1 
ATOM   2218  C C   . MET A 1 291 ? -22.552 79.447   101.205 1.00 17.58 ? 376 MET A C   1 
ATOM   2219  O O   . MET A 1 291 ? -23.679 79.158   101.610 1.00 16.79 ? 376 MET A O   1 
ATOM   2220  C CB  . MET A 1 291 ? -21.448 77.372   100.316 1.00 16.90 ? 376 MET A CB  1 
ATOM   2221  C CG  . MET A 1 291 ? -20.255 76.424   100.317 1.00 17.16 ? 376 MET A CG  1 
ATOM   2222  S SD  . MET A 1 291 ? -18.682 77.303   100.204 1.00 19.89 ? 376 MET A SD  1 
ATOM   2223  C CE  . MET A 1 291 ? -18.813 78.054   98.585  1.00 17.28 ? 376 MET A CE  1 
ATOM   2224  N N   . ILE A 1 292 ? -22.279 80.607   100.612 1.00 17.28 ? 377 ILE A N   1 
ATOM   2225  C CA  . ILE A 1 292 ? -23.316 81.611   100.401 1.00 16.99 ? 377 ILE A CA  1 
ATOM   2226  C C   . ILE A 1 292 ? -23.293 82.184   98.986  1.00 18.02 ? 377 ILE A C   1 
ATOM   2227  O O   . ILE A 1 292 ? -22.231 82.504   98.444  1.00 17.17 ? 377 ILE A O   1 
ATOM   2228  C CB  . ILE A 1 292 ? -23.165 82.779   101.396 1.00 16.83 ? 377 ILE A CB  1 
ATOM   2229  C CG1 . ILE A 1 292 ? -23.392 82.287   102.825 1.00 16.16 ? 377 ILE A CG1 1 
ATOM   2230  C CG2 . ILE A 1 292 ? -24.151 83.894   101.050 1.00 18.81 ? 377 ILE A CG2 1 
ATOM   2231  C CD1 . ILE A 1 292 ? -23.141 83.341   103.874 1.00 13.34 ? 377 ILE A CD1 1 
ATOM   2232  N N   . TRP A 1 293 ? -24.469 82.305   98.382  1.00 18.45 ? 378 TRP A N   1 
ATOM   2233  C CA  . TRP A 1 293 ? -24.555 82.861   97.044  1.00 20.48 ? 378 TRP A CA  1 
ATOM   2234  C C   . TRP A 1 293 ? -25.119 84.275   97.104  1.00 21.94 ? 378 TRP A C   1 
ATOM   2235  O O   . TRP A 1 293 ? -26.285 84.491   97.459  1.00 21.36 ? 378 TRP A O   1 
ATOM   2236  C CB  . TRP A 1 293 ? -25.430 81.998   96.138  1.00 21.42 ? 378 TRP A CB  1 
ATOM   2237  C CG  . TRP A 1 293 ? -25.725 82.649   94.793  1.00 23.28 ? 378 TRP A CG  1 
ATOM   2238  C CD1 . TRP A 1 293 ? -26.956 82.961   94.281  1.00 22.77 ? 378 TRP A CD1 1 
ATOM   2239  C CD2 . TRP A 1 293 ? -24.768 83.055   93.802  1.00 23.00 ? 378 TRP A CD2 1 
ATOM   2240  N NE1 . TRP A 1 293 ? -26.823 83.532   93.035  1.00 22.79 ? 378 TRP A NE1 1 
ATOM   2241  C CE2 . TRP A 1 293 ? -25.493 83.601   92.718  1.00 22.54 ? 378 TRP A CE2 1 
ATOM   2242  C CE3 . TRP A 1 293 ? -23.371 83.009   93.726  1.00 22.97 ? 378 TRP A CE3 1 
ATOM   2243  C CZ2 . TRP A 1 293 ? -24.869 84.097   91.572  1.00 23.09 ? 378 TRP A CZ2 1 
ATOM   2244  C CZ3 . TRP A 1 293 ? -22.748 83.501   92.586  1.00 24.01 ? 378 TRP A CZ3 1 
ATOM   2245  C CH2 . TRP A 1 293 ? -23.499 84.039   91.522  1.00 22.75 ? 378 TRP A CH2 1 
ATOM   2246  N N   . ASP A 1 294 ? -24.262 85.234   96.777  1.00 23.03 ? 379 ASP A N   1 
ATOM   2247  C CA  . ASP A 1 294 ? -24.643 86.634   96.757  1.00 25.10 ? 379 ASP A CA  1 
ATOM   2248  C C   . ASP A 1 294 ? -24.522 87.115   95.315  1.00 25.99 ? 379 ASP A C   1 
ATOM   2249  O O   . ASP A 1 294 ? -23.435 87.498   94.874  1.00 26.66 ? 379 ASP A O   1 
ATOM   2250  C CB  . ASP A 1 294 ? -23.717 87.466   97.656  1.00 22.53 ? 379 ASP A CB  1 
ATOM   2251  C CG  . ASP A 1 294 ? -24.152 88.918   97.748  1.00 22.46 ? 379 ASP A CG  1 
ATOM   2252  O OD1 . ASP A 1 294 ? -24.725 89.432   96.765  1.00 20.39 ? 379 ASP A OD1 1 
ATOM   2253  O OD2 . ASP A 1 294 ? -23.918 89.553   98.799  1.00 22.74 ? 379 ASP A OD2 1 
ATOM   2254  N N   . PRO A 1 295 ? -25.625 87.069   94.549  1.00 27.82 ? 380 PRO A N   1 
ATOM   2255  C CA  . PRO A 1 295 ? -25.507 87.539   93.164  1.00 28.66 ? 380 PRO A CA  1 
ATOM   2256  C C   . PRO A 1 295 ? -25.094 88.994   93.257  1.00 29.52 ? 380 PRO A C   1 
ATOM   2257  O O   . PRO A 1 295 ? -25.316 89.629   94.284  1.00 30.88 ? 380 PRO A O   1 
ATOM   2258  C CB  . PRO A 1 295 ? -26.920 87.357   92.614  1.00 28.53 ? 380 PRO A CB  1 
ATOM   2259  C CG  . PRO A 1 295 ? -27.790 87.573   93.827  1.00 27.91 ? 380 PRO A CG  1 
ATOM   2260  C CD  . PRO A 1 295 ? -27.033 86.811   94.907  1.00 28.73 ? 380 PRO A CD  1 
ATOM   2261  N N   . ASN A 1 296 ? -24.471 89.531   92.223  1.00 31.17 ? 381 ASN A N   1 
ATOM   2262  C CA  . ASN A 1 296 ? -24.070 90.937   92.300  1.00 33.92 ? 381 ASN A CA  1 
ATOM   2263  C C   . ASN A 1 296 ? -23.488 91.277   93.702  1.00 32.09 ? 381 ASN A C   1 
ATOM   2264  O O   . ASN A 1 296 ? -23.840 92.293   94.299  1.00 32.39 ? 381 ASN A O   1 
ATOM   2265  C CB  . ASN A 1 296 ? -25.293 91.827   92.005  1.00 37.66 ? 381 ASN A CB  1 
ATOM   2266  C CG  . ASN A 1 296 ? -26.079 91.369   90.755  1.00 41.64 ? 381 ASN A CG  1 
ATOM   2267  O OD1 . ASN A 1 296 ? -25.584 91.454   89.620  1.00 41.48 ? 381 ASN A OD1 1 
ATOM   2268  N ND2 . ASN A 1 296 ? -27.311 90.879   90.971  1.00 41.73 ? 381 ASN A ND2 1 
ATOM   2269  N N   . GLY A 1 297 ? -22.612 90.414   94.219  1.00 30.94 ? 382 GLY A N   1 
ATOM   2270  C CA  . GLY A 1 297 ? -22.005 90.634   95.529  1.00 27.65 ? 382 GLY A CA  1 
ATOM   2271  C C   . GLY A 1 297 ? -20.504 90.895   95.445  1.00 26.05 ? 382 GLY A C   1 
ATOM   2272  O O   . GLY A 1 297 ? -19.836 91.230   96.431  1.00 23.55 ? 382 GLY A O   1 
ATOM   2273  N N   . TRP A 1 298 ? -19.970 90.734   94.244  1.00 24.16 ? 383 TRP A N   1 
ATOM   2274  C CA  . TRP A 1 298 ? -18.559 90.964   93.997  1.00 23.00 ? 383 TRP A CA  1 
ATOM   2275  C C   . TRP A 1 298 ? -18.319 92.451   93.827  1.00 22.56 ? 383 TRP A C   1 
ATOM   2276  O O   . TRP A 1 298 ? -17.254 92.963   94.155  1.00 22.09 ? 383 TRP A O   1 
ATOM   2277  C CB  . TRP A 1 298 ? -18.150 90.231   92.722  1.00 22.40 ? 383 TRP A CB  1 
ATOM   2278  C CG  . TRP A 1 298 ? -16.741 90.455   92.284  1.00 21.43 ? 383 TRP A CG  1 
ATOM   2279  C CD1 . TRP A 1 298 ? -16.274 91.473   91.506  1.00 20.45 ? 383 TRP A CD1 1 
ATOM   2280  C CD2 . TRP A 1 298 ? -15.618 89.614   92.563  1.00 21.19 ? 383 TRP A CD2 1 
ATOM   2281  N NE1 . TRP A 1 298 ? -14.929 91.314   91.280  1.00 21.67 ? 383 TRP A NE1 1 
ATOM   2282  C CE2 . TRP A 1 298 ? -14.501 90.180   91.920  1.00 20.79 ? 383 TRP A CE2 1 
ATOM   2283  C CE3 . TRP A 1 298 ? -15.447 88.432   93.297  1.00 21.63 ? 383 TRP A CE3 1 
ATOM   2284  C CZ2 . TRP A 1 298 ? -13.231 89.606   91.984  1.00 21.65 ? 383 TRP A CZ2 1 
ATOM   2285  C CZ3 . TRP A 1 298 ? -14.182 87.859   93.360  1.00 20.44 ? 383 TRP A CZ3 1 
ATOM   2286  C CH2 . TRP A 1 298 ? -13.093 88.448   92.709  1.00 20.69 ? 383 TRP A CH2 1 
ATOM   2287  N N   . THR A 1 299 ? -19.333 93.140   93.318  1.00 21.94 ? 384 THR A N   1 
ATOM   2288  C CA  . THR A 1 299 ? -19.236 94.565   93.055  1.00 22.23 ? 384 THR A CA  1 
ATOM   2289  C C   . THR A 1 299 ? -20.159 95.440   93.899  1.00 22.32 ? 384 THR A C   1 
ATOM   2290  O O   . THR A 1 299 ? -19.947 96.641   93.991  1.00 22.24 ? 384 THR A O   1 
ATOM   2291  C CB  . THR A 1 299 ? -19.558 94.847   91.579  1.00 21.59 ? 384 THR A CB  1 
ATOM   2292  O OG1 . THR A 1 299 ? -20.754 94.143   91.231  1.00 20.16 ? 384 THR A OG1 1 
ATOM   2293  C CG2 . THR A 1 299 ? -18.421 94.402   90.671  1.00 19.60 ? 384 THR A CG2 1 
ATOM   2294  N N   . GLU A 1 300 ? -21.181 94.851   94.506  1.00 23.62 ? 385 GLU A N   1 
ATOM   2295  C CA  . GLU A 1 300 ? -22.115 95.644   95.292  1.00 25.01 ? 385 GLU A CA  1 
ATOM   2296  C C   . GLU A 1 300 ? -21.858 95.563   96.781  1.00 26.30 ? 385 GLU A C   1 
ATOM   2297  O O   . GLU A 1 300 ? -21.159 94.672   97.260  1.00 26.55 ? 385 GLU A O   1 
ATOM   2298  C CB  . GLU A 1 300 ? -23.562 95.232   94.999  1.00 25.35 ? 385 GLU A CB  1 
ATOM   2299  C CG  . GLU A 1 300 ? -24.023 95.463   93.556  1.00 27.40 ? 385 GLU A CG  1 
ATOM   2300  C CD  . GLU A 1 300 ? -23.856 96.914   93.080  1.00 30.80 ? 385 GLU A CD  1 
ATOM   2301  O OE1 . GLU A 1 300 ? -24.180 97.847   93.853  1.00 29.91 ? 385 GLU A OE1 1 
ATOM   2302  O OE2 . GLU A 1 300 ? -23.413 97.117   91.921  1.00 31.33 ? 385 GLU A OE2 1 
ATOM   2303  N N   . THR A 1 301 ? -22.453 96.502   97.508  1.00 27.74 ? 386 THR A N   1 
ATOM   2304  C CA  . THR A 1 301 ? -22.289 96.590   98.947  1.00 29.05 ? 386 THR A CA  1 
ATOM   2305  C C   . THR A 1 301 ? -23.589 96.456   99.735  1.00 30.25 ? 386 THR A C   1 
ATOM   2306  O O   . THR A 1 301 ? -24.239 97.451   100.056 1.00 34.71 ? 386 THR A O   1 
ATOM   2307  C CB  . THR A 1 301 ? -21.655 97.928   99.322  1.00 29.05 ? 386 THR A CB  1 
ATOM   2308  O OG1 . THR A 1 301 ? -20.395 98.062   98.656  1.00 27.18 ? 386 THR A OG1 1 
ATOM   2309  C CG2 . THR A 1 301 ? -21.457 98.010   100.821 1.00 29.32 ? 386 THR A CG2 1 
ATOM   2310  N N   . ASP A 1 302 ? -23.983 95.230   100.024 1.00 29.28 ? 387 ASP A N   1 
ATOM   2311  C CA  . ASP A 1 302 ? -25.172 94.985   100.816 1.00 28.96 ? 387 ASP A CA  1 
ATOM   2312  C C   . ASP A 1 302 ? -24.963 93.630   101.430 1.00 28.64 ? 387 ASP A C   1 
ATOM   2313  O O   . ASP A 1 302 ? -24.129 92.852   100.960 1.00 28.71 ? 387 ASP A O   1 
ATOM   2314  C CB  . ASP A 1 302 ? -26.468 95.008   99.983  1.00 29.47 ? 387 ASP A CB  1 
ATOM   2315  C CG  . ASP A 1 302 ? -26.395 94.147   98.731  1.00 29.65 ? 387 ASP A CG  1 
ATOM   2316  O OD1 . ASP A 1 302 ? -25.874 94.642   97.712  1.00 30.59 ? 387 ASP A OD1 1 
ATOM   2317  O OD2 . ASP A 1 302 ? -26.853 92.979   98.760  1.00 30.66 ? 387 ASP A OD2 1 
ATOM   2318  N N   . SER A 1 303 ? -25.702 93.360   102.495 1.00 27.98 ? 388 SER A N   1 
ATOM   2319  C CA  . SER A 1 303 ? -25.588 92.098   103.195 1.00 27.22 ? 388 SER A CA  1 
ATOM   2320  C C   . SER A 1 303 ? -26.644 91.074   102.768 1.00 27.02 ? 388 SER A C   1 
ATOM   2321  O O   . SER A 1 303 ? -26.740 90.004   103.367 1.00 27.70 ? 388 SER A O   1 
ATOM   2322  C CB  . SER A 1 303 ? -25.681 92.352   104.704 1.00 27.92 ? 388 SER A CB  1 
ATOM   2323  O OG  . SER A 1 303 ? -26.754 93.233   105.015 1.00 27.45 ? 388 SER A OG  1 
ATOM   2324  N N   . SER A 1 304 ? -27.426 91.382   101.736 1.00 25.64 ? 389 SER A N   1 
ATOM   2325  C CA  . SER A 1 304 ? -28.467 90.451   101.307 1.00 25.38 ? 389 SER A CA  1 
ATOM   2326  C C   . SER A 1 304 ? -27.934 89.419   100.333 1.00 25.36 ? 389 SER A C   1 
ATOM   2327  O O   . SER A 1 304 ? -27.038 89.706   99.528  1.00 24.91 ? 389 SER A O   1 
ATOM   2328  C CB  . SER A 1 304 ? -29.629 91.194   100.664 1.00 23.52 ? 389 SER A CB  1 
ATOM   2329  O OG  . SER A 1 304 ? -29.244 91.698   99.408  1.00 24.74 ? 389 SER A OG  1 
ATOM   2330  N N   . PHE A 1 305 ? -28.508 88.220   100.410 1.00 26.20 ? 390 PHE A N   1 
ATOM   2331  C CA  . PHE A 1 305 ? -28.098 87.098   99.566  1.00 25.73 ? 390 PHE A CA  1 
ATOM   2332  C C   . PHE A 1 305 ? -29.245 86.106   99.311  1.00 24.88 ? 390 PHE A C   1 
ATOM   2333  O O   . PHE A 1 305 ? -30.221 86.028   100.071 1.00 23.45 ? 390 PHE A O   1 
ATOM   2334  C CB  . PHE A 1 305 ? -26.911 86.376   100.217 1.00 24.88 ? 390 PHE A CB  1 
ATOM   2335  C CG  . PHE A 1 305 ? -27.226 85.785   101.564 1.00 23.57 ? 390 PHE A CG  1 
ATOM   2336  C CD1 . PHE A 1 305 ? -27.718 84.486   101.674 1.00 24.15 ? 390 PHE A CD1 1 
ATOM   2337  C CD2 . PHE A 1 305 ? -27.039 86.529   102.723 1.00 25.15 ? 390 PHE A CD2 1 
ATOM   2338  C CE1 . PHE A 1 305 ? -28.018 83.930   102.924 1.00 24.96 ? 390 PHE A CE1 1 
ATOM   2339  C CE2 . PHE A 1 305 ? -27.334 85.984   103.984 1.00 26.73 ? 390 PHE A CE2 1 
ATOM   2340  C CZ  . PHE A 1 305 ? -27.826 84.677   104.081 1.00 24.97 ? 390 PHE A CZ  1 
ATOM   2341  N N   . SER A 1 306 ? -29.085 85.326   98.249  1.00 23.74 ? 391 SER A N   1 
ATOM   2342  C CA  . SER A 1 306 ? -30.091 84.367   97.822  1.00 23.38 ? 391 SER A CA  1 
ATOM   2343  C C   . SER A 1 306 ? -30.016 82.958   98.429  1.00 23.12 ? 391 SER A C   1 
ATOM   2344  O O   . SER A 1 306 ? -31.024 82.427   98.907  1.00 22.06 ? 391 SER A O   1 
ATOM   2345  C CB  . SER A 1 306 ? -30.026 84.268   96.303  1.00 22.43 ? 391 SER A CB  1 
ATOM   2346  O OG  . SER A 1 306 ? -29.789 85.550   95.754  1.00 21.66 ? 391 SER A OG  1 
ATOM   2347  N N   . VAL A 1 307 ? -28.830 82.354   98.409  1.00 21.42 ? 392 VAL A N   1 
ATOM   2348  C CA  . VAL A 1 307 ? -28.683 81.001   98.925  1.00 20.22 ? 392 VAL A CA  1 
ATOM   2349  C C   . VAL A 1 307 ? -27.637 80.794   100.010 1.00 19.40 ? 392 VAL A C   1 
ATOM   2350  O O   . VAL A 1 307 ? -26.591 81.439   100.018 1.00 19.56 ? 392 VAL A O   1 
ATOM   2351  C CB  . VAL A 1 307 ? -28.352 80.023   97.781  1.00 21.10 ? 392 VAL A CB  1 
ATOM   2352  C CG1 . VAL A 1 307 ? -28.441 78.588   98.286  1.00 18.94 ? 392 VAL A CG1 1 
ATOM   2353  C CG2 . VAL A 1 307 ? -29.299 80.253   96.605  1.00 20.21 ? 392 VAL A CG2 1 
ATOM   2354  N N   . LYS A 1 308 ? -27.929 79.881   100.927 1.00 18.02 ? 394 LYS A N   1 
ATOM   2355  C CA  . LYS A 1 308 ? -26.998 79.549   101.999 1.00 17.24 ? 394 LYS A CA  1 
ATOM   2356  C C   . LYS A 1 308 ? -27.033 78.041   102.230 1.00 16.32 ? 394 LYS A C   1 
ATOM   2357  O O   . LYS A 1 308 ? -28.103 77.467   102.457 1.00 15.40 ? 394 LYS A O   1 
ATOM   2358  C CB  . LYS A 1 308 ? -27.370 80.253   103.299 1.00 17.19 ? 394 LYS A CB  1 
ATOM   2359  C CG  . LYS A 1 308 ? -26.420 79.937   104.451 1.00 18.22 ? 394 LYS A CG  1 
ATOM   2360  C CD  . LYS A 1 308 ? -27.149 79.953   105.788 1.00 19.98 ? 394 LYS A CD  1 
ATOM   2361  C CE  . LYS A 1 308 ? -26.251 80.424   106.912 1.00 23.00 ? 394 LYS A CE  1 
ATOM   2362  N NZ  . LYS A 1 308 ? -25.883 81.867   106.789 1.00 23.25 ? 394 LYS A NZ  1 
ATOM   2363  N N   . GLN A 1 309 ? -25.867 77.406   102.155 1.00 13.81 ? 395 GLN A N   1 
ATOM   2364  C CA  . GLN A 1 309 ? -25.763 75.974   102.370 1.00 14.24 ? 395 GLN A CA  1 
ATOM   2365  C C   . GLN A 1 309 ? -24.806 75.675   103.526 1.00 16.17 ? 395 GLN A C   1 
ATOM   2366  O O   . GLN A 1 309 ? -23.635 76.071   103.503 1.00 17.26 ? 395 GLN A O   1 
ATOM   2367  C CB  . GLN A 1 309 ? -25.280 75.271   101.098 1.00 13.66 ? 395 GLN A CB  1 
ATOM   2368  C CG  . GLN A 1 309 ? -25.152 73.744   101.254 1.00 15.01 ? 395 GLN A CG  1 
ATOM   2369  C CD  . GLN A 1 309 ? -24.640 73.043   99.996  1.00 16.19 ? 395 GLN A CD  1 
ATOM   2370  O OE1 . GLN A 1 309 ? -24.460 71.823   99.979  1.00 14.84 ? 395 GLN A OE1 1 
ATOM   2371  N NE2 . GLN A 1 309 ? -24.404 73.813   98.942  1.00 16.90 ? 395 GLN A NE2 1 
ATOM   2372  N N   . ASP A 1 310 ? -25.310 74.987   104.544 1.00 14.76 ? 396 ASP A N   1 
ATOM   2373  C CA  . ASP A 1 310 ? -24.484 74.639   105.687 1.00 16.00 ? 396 ASP A CA  1 
ATOM   2374  C C   . ASP A 1 310 ? -23.492 73.511   105.373 1.00 14.21 ? 396 ASP A C   1 
ATOM   2375  O O   . ASP A 1 310 ? -23.843 72.539   104.709 1.00 12.90 ? 396 ASP A O   1 
ATOM   2376  C CB  . ASP A 1 310 ? -25.366 74.222   106.875 1.00 16.22 ? 396 ASP A CB  1 
ATOM   2377  C CG  . ASP A 1 310 ? -26.249 75.352   107.377 1.00 19.23 ? 396 ASP A CG  1 
ATOM   2378  O OD1 . ASP A 1 310 ? -25.751 76.490   107.522 1.00 20.39 ? 396 ASP A OD1 1 
ATOM   2379  O OD2 . ASP A 1 310 ? -27.445 75.103   107.643 1.00 21.70 ? 396 ASP A OD2 1 
ATOM   2380  N N   . ILE A 1 311 ? -22.255 73.656   105.851 1.00 13.45 ? 397 ILE A N   1 
ATOM   2381  C CA  . ILE A 1 311 ? -21.218 72.634   105.672 1.00 13.78 ? 397 ILE A CA  1 
ATOM   2382  C C   . ILE A 1 311 ? -20.717 72.137   107.047 1.00 14.51 ? 397 ILE A C   1 
ATOM   2383  O O   . ILE A 1 311 ? -20.451 70.943   107.227 1.00 14.47 ? 397 ILE A O   1 
ATOM   2384  C CB  . ILE A 1 311 ? -20.024 73.150   104.802 1.00 12.58 ? 397 ILE A CB  1 
ATOM   2385  C CG1 . ILE A 1 311 ? -20.328 72.952   103.312 1.00 15.62 ? 397 ILE A CG1 1 
ATOM   2386  C CG2 . ILE A 1 311 ? -18.764 72.332   105.069 1.00 12.38 ? 397 ILE A CG2 1 
ATOM   2387  C CD1 . ILE A 1 311 ? -21.444 73.776   102.772 1.00 15.01 ? 397 ILE A CD1 1 
ATOM   2388  N N   . VAL A 1 312 ? -20.594 73.046   108.016 1.00 14.52 ? 398 VAL A N   1 
ATOM   2389  C CA  . VAL A 1 312 ? -20.164 72.671   109.370 1.00 14.74 ? 398 VAL A CA  1 
ATOM   2390  C C   . VAL A 1 312 ? -20.878 73.519   110.431 1.00 16.54 ? 398 VAL A C   1 
ATOM   2391  O O   . VAL A 1 312 ? -20.809 74.750   110.404 1.00 17.28 ? 398 VAL A O   1 
ATOM   2392  C CB  . VAL A 1 312 ? -18.647 72.827   109.554 1.00 13.20 ? 398 VAL A CB  1 
ATOM   2393  C CG1 . VAL A 1 312 ? -18.256 72.429   110.957 1.00 12.01 ? 398 VAL A CG1 1 
ATOM   2394  C CG2 . VAL A 1 312 ? -17.908 71.965   108.548 1.00 13.46 ? 398 VAL A CG2 1 
ATOM   2395  N N   . ALA A 1 313 ? -21.570 72.850   111.353 1.00 17.31 ? 399 ALA A N   1 
ATOM   2396  C CA  . ALA A 1 313 ? -22.307 73.517   112.428 1.00 17.17 ? 399 ALA A CA  1 
ATOM   2397  C C   . ALA A 1 313 ? -21.398 74.456   113.212 1.00 17.20 ? 399 ALA A C   1 
ATOM   2398  O O   . ALA A 1 313 ? -20.196 74.218   113.302 1.00 16.43 ? 399 ALA A O   1 
ATOM   2399  C CB  . ALA A 1 313 ? -22.925 72.477   113.363 1.00 14.81 ? 399 ALA A CB  1 
ATOM   2400  N N   . ILE A 1 314 ? -21.979 75.523   113.765 1.00 18.91 ? 400 ILE A N   1 
ATOM   2401  C CA  . ILE A 1 314 ? -21.226 76.518   114.544 1.00 20.97 ? 400 ILE A CA  1 
ATOM   2402  C C   . ILE A 1 314 ? -20.646 75.893   115.804 1.00 19.83 ? 400 ILE A C   1 
ATOM   2403  O O   . ILE A 1 314 ? -19.727 76.439   116.412 1.00 19.41 ? 400 ILE A O   1 
ATOM   2404  C CB  . ILE A 1 314 ? -22.115 77.689   115.035 1.00 23.87 ? 400 ILE A CB  1 
ATOM   2405  C CG1 . ILE A 1 314 ? -23.182 78.022   113.992 1.00 28.82 ? 400 ILE A CG1 1 
ATOM   2406  C CG2 . ILE A 1 314 ? -21.250 78.934   115.288 1.00 23.79 ? 400 ILE A CG2 1 
ATOM   2407  C CD1 . ILE A 1 314 ? -24.363 78.859   114.551 1.00 29.99 ? 400 ILE A CD1 1 
ATOM   2408  N N   . THR A 1 315 ? -21.198 74.749   116.190 1.00 18.56 ? 401 THR A N   1 
ATOM   2409  C CA  . THR A 1 315 ? -20.767 74.070   117.391 1.00 18.92 ? 401 THR A CA  1 
ATOM   2410  C C   . THR A 1 315 ? -19.490 73.294   117.193 1.00 17.90 ? 401 THR A C   1 
ATOM   2411  O O   . THR A 1 315 ? -18.941 72.747   118.139 1.00 18.07 ? 401 THR A O   1 
ATOM   2412  C CB  . THR A 1 315 ? -21.857 73.112   117.883 1.00 20.78 ? 401 THR A CB  1 
ATOM   2413  O OG1 . THR A 1 315 ? -22.275 72.277   116.798 1.00 20.47 ? 401 THR A OG1 1 
ATOM   2414  C CG2 . THR A 1 315 ? -23.053 73.895   118.407 1.00 20.29 ? 401 THR A CG2 1 
ATOM   2415  N N   . ASP A 1 316 ? -19.001 73.256   115.965 1.00 17.82 ? 402 ASP A N   1 
ATOM   2416  C CA  . ASP A 1 316 ? -17.785 72.513   115.689 1.00 17.45 ? 402 ASP A CA  1 
ATOM   2417  C C   . ASP A 1 316 ? -16.689 73.316   115.023 1.00 16.37 ? 402 ASP A C   1 
ATOM   2418  O O   . ASP A 1 316 ? -16.954 74.279   114.305 1.00 17.47 ? 402 ASP A O   1 
ATOM   2419  C CB  . ASP A 1 316 ? -18.139 71.285   114.870 1.00 17.96 ? 402 ASP A CB  1 
ATOM   2420  C CG  . ASP A 1 316 ? -18.921 70.279   115.681 1.00 20.07 ? 402 ASP A CG  1 
ATOM   2421  O OD1 . ASP A 1 316 ? -18.271 69.460   116.370 1.00 20.54 ? 402 ASP A OD1 1 
ATOM   2422  O OD2 . ASP A 1 316 ? -20.178 70.323   115.653 1.00 19.90 ? 402 ASP A OD2 1 
ATOM   2423  N N   . TRP A 1 317 ? -15.453 72.908   115.279 1.00 14.88 ? 403 TRP A N   1 
ATOM   2424  C CA  . TRP A 1 317 ? -14.293 73.586   114.737 1.00 15.72 ? 403 TRP A CA  1 
ATOM   2425  C C   . TRP A 1 317 ? -14.077 73.386   113.241 1.00 17.76 ? 403 TRP A C   1 
ATOM   2426  O O   . TRP A 1 317 ? -14.202 72.271   112.706 1.00 18.36 ? 403 TRP A O   1 
ATOM   2427  C CB  . TRP A 1 317 ? -13.029 73.145   115.478 1.00 16.15 ? 403 TRP A CB  1 
ATOM   2428  C CG  . TRP A 1 317 ? -13.113 73.308   116.964 1.00 18.77 ? 403 TRP A CG  1 
ATOM   2429  C CD1 . TRP A 1 317 ? -13.287 72.320   117.887 1.00 17.90 ? 403 TRP A CD1 1 
ATOM   2430  C CD2 . TRP A 1 317 ? -13.094 74.543   117.696 1.00 19.96 ? 403 TRP A CD2 1 
ATOM   2431  N NE1 . TRP A 1 317 ? -13.382 72.860   119.150 1.00 20.05 ? 403 TRP A NE1 1 
ATOM   2432  C CE2 . TRP A 1 317 ? -13.267 74.221   119.063 1.00 19.72 ? 403 TRP A CE2 1 
ATOM   2433  C CE3 . TRP A 1 317 ? -12.946 75.890   117.330 1.00 19.41 ? 403 TRP A CE3 1 
ATOM   2434  C CZ2 . TRP A 1 317 ? -13.302 75.197   120.068 1.00 19.59 ? 403 TRP A CZ2 1 
ATOM   2435  C CZ3 . TRP A 1 317 ? -12.980 76.863   118.333 1.00 19.84 ? 403 TRP A CZ3 1 
ATOM   2436  C CH2 . TRP A 1 317 ? -13.157 76.508   119.685 1.00 18.77 ? 403 TRP A CH2 1 
ATOM   2437  N N   . SER A 1 318 ? -13.765 74.488   112.570 1.00 16.29 ? 404 SER A N   1 
ATOM   2438  C CA  . SER A 1 318 ? -13.456 74.456   111.149 1.00 15.92 ? 404 SER A CA  1 
ATOM   2439  C C   . SER A 1 318 ? -12.042 75.030   111.084 1.00 14.65 ? 404 SER A C   1 
ATOM   2440  O O   . SER A 1 318 ? -11.235 74.763   111.967 1.00 13.58 ? 404 SER A O   1 
ATOM   2441  C CB  . SER A 1 318 ? -14.453 75.295   110.329 1.00 15.61 ? 404 SER A CB  1 
ATOM   2442  O OG  . SER A 1 318 ? -14.533 76.636   110.779 1.00 17.60 ? 404 SER A OG  1 
ATOM   2443  N N   . GLY A 1 319 ? -11.738 75.818   110.063 1.00 13.68 ? 405 GLY A N   1 
ATOM   2444  C CA  . GLY A 1 319 ? -10.402 76.374   109.956 1.00 13.17 ? 405 GLY A CA  1 
ATOM   2445  C C   . GLY A 1 319 ? -10.127 76.855   108.552 1.00 12.57 ? 405 GLY A C   1 
ATOM   2446  O O   . GLY A 1 319 ? -10.981 77.489   107.940 1.00 13.33 ? 405 GLY A O   1 
ATOM   2447  N N   . TYR A 1 320 ? -8.941  76.567   108.032 1.00 11.64 ? 406 TYR A N   1 
ATOM   2448  C CA  . TYR A 1 320 ? -8.609  76.989   106.672 1.00 12.73 ? 406 TYR A CA  1 
ATOM   2449  C C   . TYR A 1 320 ? -9.568  76.375   105.670 1.00 12.91 ? 406 TYR A C   1 
ATOM   2450  O O   . TYR A 1 320 ? -10.262 75.416   105.969 1.00 15.00 ? 406 TYR A O   1 
ATOM   2451  C CB  . TYR A 1 320 ? -7.188  76.562   106.297 1.00 10.81 ? 406 TYR A CB  1 
ATOM   2452  C CG  . TYR A 1 320 ? -6.108  77.538   106.686 1.00 10.16 ? 406 TYR A CG  1 
ATOM   2453  C CD1 . TYR A 1 320 ? -6.315  78.474   107.692 1.00 9.17  ? 406 TYR A CD1 1 
ATOM   2454  C CD2 . TYR A 1 320 ? -4.862  77.493   106.076 1.00 7.79  ? 406 TYR A CD2 1 
ATOM   2455  C CE1 . TYR A 1 320 ? -5.307  79.334   108.080 1.00 10.25 ? 406 TYR A CE1 1 
ATOM   2456  C CE2 . TYR A 1 320 ? -3.859  78.340   106.452 1.00 9.23  ? 406 TYR A CE2 1 
ATOM   2457  C CZ  . TYR A 1 320 ? -4.082  79.261   107.458 1.00 11.75 ? 406 TYR A CZ  1 
ATOM   2458  O OH  . TYR A 1 320 ? -3.066  80.096   107.856 1.00 12.88 ? 406 TYR A OH  1 
ATOM   2459  N N   . SER A 1 321 ? -9.599  76.940   104.475 1.00 12.45 ? 407 SER A N   1 
ATOM   2460  C CA  . SER A 1 321 ? -10.436 76.427   103.404 1.00 10.91 ? 407 SER A CA  1 
ATOM   2461  C C   . SER A 1 321 ? -9.875  77.017   102.125 1.00 11.11 ? 407 SER A C   1 
ATOM   2462  O O   . SER A 1 321 ? -9.354  78.135   102.121 1.00 9.51  ? 407 SER A O   1 
ATOM   2463  C CB  . SER A 1 321 ? -11.909 76.832   103.599 1.00 10.81 ? 407 SER A CB  1 
ATOM   2464  O OG  . SER A 1 321 ? -12.123 78.213   103.400 1.00 9.55  ? 407 SER A OG  1 
ATOM   2465  N N   . GLY A 1 322 ? -9.955  76.262   101.041 1.00 11.44 ? 408 GLY A N   1 
ATOM   2466  C CA  . GLY A 1 322 ? -9.430  76.777   99.796  1.00 13.14 ? 408 GLY A CA  1 
ATOM   2467  C C   . GLY A 1 322 ? -10.141 76.191   98.610  1.00 15.28 ? 408 GLY A C   1 
ATOM   2468  O O   . GLY A 1 322 ? -10.921 75.247   98.743  1.00 17.44 ? 408 GLY A O   1 
ATOM   2469  N N   . SER A 1 323 ? -9.865  76.748   97.442  1.00 14.70 ? 409 SER A N   1 
ATOM   2470  C CA  . SER A 1 323 ? -10.479 76.271   96.216  1.00 15.35 ? 409 SER A CA  1 
ATOM   2471  C C   . SER A 1 323 ? -9.550  75.332   95.452  1.00 15.64 ? 409 SER A C   1 
ATOM   2472  O O   . SER A 1 323 ? -8.335  75.360   95.631  1.00 15.12 ? 409 SER A O   1 
ATOM   2473  C CB  . SER A 1 323 ? -10.801 77.456   95.301  1.00 14.56 ? 409 SER A CB  1 
ATOM   2474  O OG  . SER A 1 323 ? -9.605  77.991   94.744  1.00 10.37 ? 409 SER A OG  1 
ATOM   2475  N N   . PHE A 1 324 ? -10.147 74.493   94.614  1.00 16.23 ? 410 PHE A N   1 
ATOM   2476  C CA  . PHE A 1 324 ? -9.408  73.603   93.721  1.00 17.60 ? 410 PHE A CA  1 
ATOM   2477  C C   . PHE A 1 324 ? -10.324 73.282   92.540  1.00 18.25 ? 410 PHE A C   1 
ATOM   2478  O O   . PHE A 1 324 ? -11.550 73.399   92.639  1.00 17.63 ? 410 PHE A O   1 
ATOM   2479  C CB  . PHE A 1 324 ? -8.883  72.329   94.419  1.00 16.84 ? 410 PHE A CB  1 
ATOM   2480  C CG  . PHE A 1 324 ? -9.931  71.308   94.751  1.00 17.97 ? 410 PHE A CG  1 
ATOM   2481  C CD1 . PHE A 1 324 ? -10.762 71.474   95.848  1.00 17.97 ? 410 PHE A CD1 1 
ATOM   2482  C CD2 . PHE A 1 324 ? -10.025 70.131   94.011  1.00 18.42 ? 410 PHE A CD2 1 
ATOM   2483  C CE1 . PHE A 1 324 ? -11.666 70.478   96.214  1.00 19.80 ? 410 PHE A CE1 1 
ATOM   2484  C CE2 . PHE A 1 324 ? -10.931 69.123   94.369  1.00 18.77 ? 410 PHE A CE2 1 
ATOM   2485  C CZ  . PHE A 1 324 ? -11.750 69.295   95.471  1.00 17.73 ? 410 PHE A CZ  1 
ATOM   2486  N N   . VAL A 1 325 ? -9.741  72.898   91.415  1.00 17.62 ? 411 VAL A N   1 
ATOM   2487  C CA  . VAL A 1 325 ? -10.556 72.645   90.239  1.00 18.74 ? 411 VAL A CA  1 
ATOM   2488  C C   . VAL A 1 325 ? -10.321 71.311   89.554  1.00 18.53 ? 411 VAL A C   1 
ATOM   2489  O O   . VAL A 1 325 ? -9.369  70.597   89.846  1.00 19.24 ? 411 VAL A O   1 
ATOM   2490  C CB  . VAL A 1 325 ? -10.340 73.761   89.183  1.00 19.92 ? 411 VAL A CB  1 
ATOM   2491  C CG1 . VAL A 1 325 ? -11.263 73.553   88.031  1.00 23.04 ? 411 VAL A CG1 1 
ATOM   2492  C CG2 . VAL A 1 325 ? -10.597 75.113   89.781  1.00 20.72 ? 411 VAL A CG2 1 
ATOM   2493  N N   . GLN A 1 326 ? -11.220 70.990   88.636  1.00 18.06 ? 412 GLN A N   1 
ATOM   2494  C CA  . GLN A 1 326 ? -11.140 69.771   87.857  1.00 17.12 ? 412 GLN A CA  1 
ATOM   2495  C C   . GLN A 1 326 ? -11.349 70.224   86.419  1.00 16.45 ? 412 GLN A C   1 
ATOM   2496  O O   . GLN A 1 326 ? -12.427 70.692   86.046  1.00 15.56 ? 412 GLN A O   1 
ATOM   2497  C CB  . GLN A 1 326 ? -12.227 68.781   88.300  1.00 16.77 ? 412 GLN A CB  1 
ATOM   2498  C CG  . GLN A 1 326 ? -12.121 68.392   89.764  1.00 13.79 ? 412 GLN A CG  1 
ATOM   2499  C CD  . GLN A 1 326 ? -12.946 67.171   90.128  1.00 13.89 ? 412 GLN A CD  1 
ATOM   2500  O OE1 . GLN A 1 326 ? -14.156 67.132   89.921  1.00 14.13 ? 412 GLN A OE1 1 
ATOM   2501  N NE2 . GLN A 1 326 ? -12.287 66.170   90.690  1.00 15.23 ? 412 GLN A NE2 1 
ATOM   2502  N N   . HIS A 1 327 A -10.291 70.113   85.629  1.00 16.40 ? 412 HIS A N   1 
ATOM   2503  C CA  . HIS A 1 327 A -10.308 70.521   84.231  1.00 15.99 ? 412 HIS A CA  1 
ATOM   2504  C C   . HIS A 1 327 A -10.986 69.520   83.325  1.00 16.42 ? 412 HIS A C   1 
ATOM   2505  O O   . HIS A 1 327 A -11.158 68.360   83.684  1.00 16.50 ? 412 HIS A O   1 
ATOM   2506  C CB  . HIS A 1 327 A -8.883  70.706   83.720  1.00 17.61 ? 412 HIS A CB  1 
ATOM   2507  C CG  . HIS A 1 327 A -8.197  71.925   84.240  1.00 17.94 ? 412 HIS A CG  1 
ATOM   2508  N ND1 . HIS A 1 327 A -8.143  73.104   83.529  1.00 18.22 ? 412 HIS A ND1 1 
ATOM   2509  C CD2 . HIS A 1 327 A -7.511  72.145   85.385  1.00 18.35 ? 412 HIS A CD2 1 
ATOM   2510  C CE1 . HIS A 1 327 A -7.451  73.994   84.213  1.00 19.17 ? 412 HIS A CE1 1 
ATOM   2511  N NE2 . HIS A 1 327 A -7.055  73.437   85.344  1.00 18.08 ? 412 HIS A NE2 1 
ATOM   2512  N N   . PRO A 1 328 B -11.381 69.969   82.123  1.00 17.93 ? 412 PRO A N   1 
ATOM   2513  C CA  . PRO A 1 328 B -12.040 69.140   81.110  1.00 17.79 ? 412 PRO A CA  1 
ATOM   2514  C C   . PRO A 1 328 B -11.238 67.879   80.768  1.00 18.05 ? 412 PRO A C   1 
ATOM   2515  O O   . PRO A 1 328 B -11.812 66.823   80.523  1.00 19.06 ? 412 PRO A O   1 
ATOM   2516  C CB  . PRO A 1 328 B -12.153 70.090   79.925  1.00 17.54 ? 412 PRO A CB  1 
ATOM   2517  C CG  . PRO A 1 328 B -12.438 71.395   80.601  1.00 17.41 ? 412 PRO A CG  1 
ATOM   2518  C CD  . PRO A 1 328 B -11.457 71.399   81.754  1.00 18.17 ? 412 PRO A CD  1 
ATOM   2519  N N   . GLU A 1 329 C -9.915  67.970   80.753  1.00 18.33 ? 412 GLU A N   1 
ATOM   2520  C CA  . GLU A 1 329 C -9.134  66.784   80.424  1.00 19.37 ? 412 GLU A CA  1 
ATOM   2521  C C   . GLU A 1 329 C -9.243  65.703   81.509  1.00 19.87 ? 412 GLU A C   1 
ATOM   2522  O O   . GLU A 1 329 C -8.815  64.566   81.313  1.00 21.87 ? 412 GLU A O   1 
ATOM   2523  C CB  . GLU A 1 329 C -7.657  67.137   80.152  1.00 19.14 ? 412 GLU A CB  1 
ATOM   2524  C CG  . GLU A 1 329 C -7.226  68.570   80.466  1.00 21.55 ? 412 GLU A CG  1 
ATOM   2525  C CD  . GLU A 1 329 C -7.558  69.574   79.372  1.00 18.96 ? 412 GLU A CD  1 
ATOM   2526  O OE1 . GLU A 1 329 C -7.199  69.336   78.209  1.00 20.85 ? 412 GLU A OE1 1 
ATOM   2527  O OE2 . GLU A 1 329 C -8.161  70.617   79.682  1.00 20.20 ? 412 GLU A OE2 1 
ATOM   2528  N N   . LEU A 1 330 D -9.828  66.048   82.650  1.00 20.69 ? 412 LEU A N   1 
ATOM   2529  C CA  . LEU A 1 330 D -9.996  65.083   83.740  1.00 20.41 ? 412 LEU A CA  1 
ATOM   2530  C C   . LEU A 1 330 D -11.436 64.628   83.815  1.00 21.07 ? 412 LEU A C   1 
ATOM   2531  O O   . LEU A 1 330 D -11.724 63.444   83.979  1.00 21.74 ? 412 LEU A O   1 
ATOM   2532  C CB  . LEU A 1 330 D -9.637  65.703   85.098  1.00 17.55 ? 412 LEU A CB  1 
ATOM   2533  C CG  . LEU A 1 330 D -10.171 64.925   86.316  1.00 15.64 ? 412 LEU A CG  1 
ATOM   2534  C CD1 . LEU A 1 330 D -9.537  63.540   86.367  1.00 15.65 ? 412 LEU A CD1 1 
ATOM   2535  C CD2 . LEU A 1 330 D -9.875  65.672   87.597  1.00 13.66 ? 412 LEU A CD2 1 
ATOM   2536  N N   . THR A 1 331 ? -12.328 65.599   83.688  1.00 21.89 ? 413 THR A N   1 
ATOM   2537  C CA  . THR A 1 331 ? -13.757 65.384   83.790  1.00 22.76 ? 413 THR A CA  1 
ATOM   2538  C C   . THR A 1 331 ? -14.501 65.005   82.512  1.00 22.32 ? 413 THR A C   1 
ATOM   2539  O O   . THR A 1 331 ? -15.520 64.313   82.559  1.00 21.74 ? 413 THR A O   1 
ATOM   2540  C CB  . THR A 1 331 ? -14.407 66.633   84.353  1.00 23.48 ? 413 THR A CB  1 
ATOM   2541  O OG1 . THR A 1 331 ? -13.732 67.021   85.557  1.00 25.39 ? 413 THR A OG1 1 
ATOM   2542  C CG2 . THR A 1 331 ? -15.847 66.364   84.661  1.00 26.10 ? 413 THR A CG2 1 
ATOM   2543  N N   . GLY A 1 332 ? -14.000 65.457   81.373  1.00 22.25 ? 414 GLY A N   1 
ATOM   2544  C CA  . GLY A 1 332 ? -14.676 65.164   80.127  1.00 21.45 ? 414 GLY A CA  1 
ATOM   2545  C C   . GLY A 1 332 ? -15.663 66.276   79.821  1.00 22.37 ? 414 GLY A C   1 
ATOM   2546  O O   . GLY A 1 332 ? -16.144 66.387   78.697  1.00 24.79 ? 414 GLY A O   1 
ATOM   2547  N N   . LEU A 1 333 ? -15.977 67.094   80.822  1.00 21.25 ? 415 LEU A N   1 
ATOM   2548  C CA  . LEU A 1 333 ? -16.892 68.221   80.647  1.00 20.65 ? 415 LEU A CA  1 
ATOM   2549  C C   . LEU A 1 333 ? -16.321 69.234   79.656  1.00 22.40 ? 415 LEU A C   1 
ATOM   2550  O O   . LEU A 1 333 ? -15.223 69.053   79.118  1.00 22.21 ? 415 LEU A O   1 
ATOM   2551  C CB  . LEU A 1 333 ? -17.111 68.930   81.984  1.00 19.36 ? 415 LEU A CB  1 
ATOM   2552  C CG  . LEU A 1 333 ? -18.151 68.426   82.987  1.00 18.30 ? 415 LEU A CG  1 
ATOM   2553  C CD1 . LEU A 1 333 ? -18.392 66.948   82.824  1.00 18.64 ? 415 LEU A CD1 1 
ATOM   2554  C CD2 . LEU A 1 333 ? -17.681 68.765   84.384  1.00 16.92 ? 415 LEU A CD2 1 
ATOM   2555  N N   . ASP A 1 334 ? -17.066 70.313   79.429  1.00 23.81 ? 416 ASP A N   1 
ATOM   2556  C CA  . ASP A 1 334 ? -16.623 71.370   78.518  1.00 24.02 ? 416 ASP A CA  1 
ATOM   2557  C C   . ASP A 1 334 ? -16.451 72.668   79.301  1.00 22.68 ? 416 ASP A C   1 
ATOM   2558  O O   . ASP A 1 334 ? -16.460 73.752   78.729  1.00 24.29 ? 416 ASP A O   1 
ATOM   2559  C CB  . ASP A 1 334 ? -17.646 71.579   77.396  1.00 25.56 ? 416 ASP A CB  1 
ATOM   2560  C CG  . ASP A 1 334 ? -18.930 72.215   77.893  1.00 28.28 ? 416 ASP A CG  1 
ATOM   2561  O OD1 . ASP A 1 334 ? -19.144 72.208   79.129  1.00 30.71 ? 416 ASP A OD1 1 
ATOM   2562  O OD2 . ASP A 1 334 ? -19.728 72.711   77.055  1.00 28.65 ? 416 ASP A OD2 1 
ATOM   2563  N N   . CYS A 1 335 ? -16.311 72.552   80.614  1.00 20.80 ? 417 CYS A N   1 
ATOM   2564  C CA  . CYS A 1 335 ? -16.134 73.718   81.468  1.00 19.85 ? 417 CYS A CA  1 
ATOM   2565  C C   . CYS A 1 335 ? -15.263 73.358   82.662  1.00 17.29 ? 417 CYS A C   1 
ATOM   2566  O O   . CYS A 1 335 ? -15.181 72.206   83.048  1.00 17.73 ? 417 CYS A O   1 
ATOM   2567  C CB  . CYS A 1 335 ? -17.495 74.230   81.950  1.00 22.51 ? 417 CYS A CB  1 
ATOM   2568  S SG  . CYS A 1 335 ? -18.496 72.905   82.690  1.00 26.03 ? 417 CYS A SG  1 
ATOM   2569  N N   . ILE A 1 336 ? -14.593 74.347   83.232  1.00 16.47 ? 418 ILE A N   1 
ATOM   2570  C CA  . ILE A 1 336 ? -13.746 74.125   84.400  1.00 15.50 ? 418 ILE A CA  1 
ATOM   2571  C C   . ILE A 1 336 ? -14.634 74.063   85.641  1.00 15.12 ? 418 ILE A C   1 
ATOM   2572  O O   . ILE A 1 336 ? -15.294 75.033   85.970  1.00 14.80 ? 418 ILE A O   1 
ATOM   2573  C CB  . ILE A 1 336 ? -12.693 75.264   84.516  1.00 14.75 ? 418 ILE A CB  1 
ATOM   2574  C CG1 . ILE A 1 336 ? -11.606 75.032   83.464  1.00 14.84 ? 418 ILE A CG1 1 
ATOM   2575  C CG2 . ILE A 1 336 ? -12.095 75.323   85.900  1.00 11.25 ? 418 ILE A CG2 1 
ATOM   2576  C CD1 . ILE A 1 336 ? -10.604 76.135   83.347  1.00 14.02 ? 418 ILE A CD1 1 
ATOM   2577  N N   . ARG A 1 337 ? -14.648 72.909   86.310  1.00 15.24 ? 419 ARG A N   1 
ATOM   2578  C CA  . ARG A 1 337 ? -15.469 72.690   87.501  1.00 15.80 ? 419 ARG A CA  1 
ATOM   2579  C C   . ARG A 1 337 ? -14.899 73.205   88.829  1.00 16.44 ? 419 ARG A C   1 
ATOM   2580  O O   . ARG A 1 337 ? -13.746 72.955   89.174  1.00 16.92 ? 419 ARG A O   1 
ATOM   2581  C CB  . ARG A 1 337 ? -15.795 71.196   87.652  1.00 16.38 ? 419 ARG A CB  1 
ATOM   2582  C CG  . ARG A 1 337 ? -16.128 70.793   89.094  1.00 19.47 ? 419 ARG A CG  1 
ATOM   2583  C CD  . ARG A 1 337 ? -16.603 69.345   89.244  1.00 22.54 ? 419 ARG A CD  1 
ATOM   2584  N NE  . ARG A 1 337 ? -17.921 69.141   88.636  1.00 25.19 ? 419 ARG A NE  1 
ATOM   2585  C CZ  . ARG A 1 337 ? -18.587 67.990   88.652  1.00 24.31 ? 419 ARG A CZ  1 
ATOM   2586  N NH1 . ARG A 1 337 ? -18.068 66.926   89.246  1.00 24.90 ? 419 ARG A NH1 1 
ATOM   2587  N NH2 . ARG A 1 337 ? -19.773 67.905   88.068  1.00 24.21 ? 419 ARG A NH2 1 
ATOM   2588  N N   . PRO A 1 338 ? -15.721 73.926   89.601  1.00 16.66 ? 420 PRO A N   1 
ATOM   2589  C CA  . PRO A 1 338 ? -15.282 74.461   90.892  1.00 16.21 ? 420 PRO A CA  1 
ATOM   2590  C C   . PRO A 1 338 ? -15.587 73.506   92.060  1.00 17.90 ? 420 PRO A C   1 
ATOM   2591  O O   . PRO A 1 338 ? -16.676 72.925   92.133  1.00 17.25 ? 420 PRO A O   1 
ATOM   2592  C CB  . PRO A 1 338 ? -16.073 75.757   91.000  1.00 14.07 ? 420 PRO A CB  1 
ATOM   2593  C CG  . PRO A 1 338 ? -17.374 75.368   90.412  1.00 14.66 ? 420 PRO A CG  1 
ATOM   2594  C CD  . PRO A 1 338 ? -16.990 74.550   89.182  1.00 15.42 ? 420 PRO A CD  1 
ATOM   2595  N N   . CYS A 1 339 ? -14.613 73.344   92.954  1.00 17.63 ? 421 CYS A N   1 
ATOM   2596  C CA  . CYS A 1 339 ? -14.753 72.501   94.142  1.00 18.08 ? 421 CYS A CA  1 
ATOM   2597  C C   . CYS A 1 339 ? -14.037 73.271   95.263  1.00 16.87 ? 421 CYS A C   1 
ATOM   2598  O O   . CYS A 1 339 ? -13.494 74.345   95.028  1.00 18.19 ? 421 CYS A O   1 
ATOM   2599  C CB  . CYS A 1 339 ? -14.059 71.138   93.953  1.00 18.63 ? 421 CYS A CB  1 
ATOM   2600  S SG  . CYS A 1 339 ? -14.586 70.039   92.583  1.00 20.28 ? 421 CYS A SG  1 
ATOM   2601  N N   . PHE A 1 340 ? -14.043 72.742   96.477  1.00 14.73 ? 422 PHE A N   1 
ATOM   2602  C CA  . PHE A 1 340 ? -13.343 73.393   97.572  1.00 14.56 ? 422 PHE A CA  1 
ATOM   2603  C C   . PHE A 1 340 ? -13.139 72.437   98.738  1.00 14.45 ? 422 PHE A C   1 
ATOM   2604  O O   . PHE A 1 340 ? -13.814 71.407   98.840  1.00 13.45 ? 422 PHE A O   1 
ATOM   2605  C CB  . PHE A 1 340 ? -14.081 74.670   98.026  1.00 15.41 ? 422 PHE A CB  1 
ATOM   2606  C CG  . PHE A 1 340 ? -15.369 74.423   98.774  1.00 15.57 ? 422 PHE A CG  1 
ATOM   2607  C CD1 . PHE A 1 340 ? -15.362 74.220   100.153 1.00 15.26 ? 422 PHE A CD1 1 
ATOM   2608  C CD2 . PHE A 1 340 ? -16.593 74.416   98.103  1.00 13.75 ? 422 PHE A CD2 1 
ATOM   2609  C CE1 . PHE A 1 340 ? -16.554 74.017   100.859 1.00 14.67 ? 422 PHE A CE1 1 
ATOM   2610  C CE2 . PHE A 1 340 ? -17.784 74.212   98.797  1.00 14.48 ? 422 PHE A CE2 1 
ATOM   2611  C CZ  . PHE A 1 340 ? -17.764 74.013   100.181 1.00 13.51 ? 422 PHE A CZ  1 
ATOM   2612  N N   . TRP A 1 341 ? -12.191 72.776   99.606  1.00 13.20 ? 423 TRP A N   1 
ATOM   2613  C CA  . TRP A 1 341 ? -11.894 71.952   100.767 1.00 12.72 ? 423 TRP A CA  1 
ATOM   2614  C C   . TRP A 1 341 ? -11.930 72.786   102.040 1.00 11.72 ? 423 TRP A C   1 
ATOM   2615  O O   . TRP A 1 341 ? -11.844 74.015   101.987 1.00 11.28 ? 423 TRP A O   1 
ATOM   2616  C CB  . TRP A 1 341 ? -10.510 71.317   100.613 1.00 12.78 ? 423 TRP A CB  1 
ATOM   2617  C CG  . TRP A 1 341 ? -9.416  72.312   100.333 1.00 14.32 ? 423 TRP A CG  1 
ATOM   2618  C CD1 . TRP A 1 341 ? -8.890  72.638   99.112  1.00 15.32 ? 423 TRP A CD1 1 
ATOM   2619  C CD2 . TRP A 1 341 ? -8.742  73.129   101.287 1.00 14.05 ? 423 TRP A CD2 1 
ATOM   2620  N NE1 . TRP A 1 341 ? -7.930  73.606   99.250  1.00 14.84 ? 423 TRP A NE1 1 
ATOM   2621  C CE2 . TRP A 1 341 ? -7.818  73.928   100.574 1.00 14.98 ? 423 TRP A CE2 1 
ATOM   2622  C CE3 . TRP A 1 341 ? -8.829  73.270   102.675 1.00 14.70 ? 423 TRP A CE3 1 
ATOM   2623  C CZ2 . TRP A 1 341 ? -6.985  74.856   101.207 1.00 15.24 ? 423 TRP A CZ2 1 
ATOM   2624  C CZ3 . TRP A 1 341 ? -7.998  74.197   103.306 1.00 15.27 ? 423 TRP A CZ3 1 
ATOM   2625  C CH2 . TRP A 1 341 ? -7.090  74.976   102.570 1.00 14.80 ? 423 TRP A CH2 1 
ATOM   2626  N N   . VAL A 1 342 ? -12.064 72.112   103.180 1.00 10.74 ? 424 VAL A N   1 
ATOM   2627  C CA  . VAL A 1 342 ? -12.076 72.790   104.471 1.00 9.47  ? 424 VAL A CA  1 
ATOM   2628  C C   . VAL A 1 342 ? -11.211 72.044   105.488 1.00 11.56 ? 424 VAL A C   1 
ATOM   2629  O O   . VAL A 1 342 ? -11.367 70.836   105.677 1.00 12.87 ? 424 VAL A O   1 
ATOM   2630  C CB  . VAL A 1 342 ? -13.493 72.898   105.050 1.00 7.55  ? 424 VAL A CB  1 
ATOM   2631  C CG1 . VAL A 1 342 ? -13.485 73.829   106.247 1.00 5.96  ? 424 VAL A CG1 1 
ATOM   2632  C CG2 . VAL A 1 342 ? -14.457 73.404   104.002 1.00 7.69  ? 424 VAL A CG2 1 
ATOM   2633  N N   . GLU A 1 343 ? -10.284 72.765   106.119 1.00 12.35 ? 425 GLU A N   1 
ATOM   2634  C CA  . GLU A 1 343 ? -9.412  72.198   107.147 1.00 13.23 ? 425 GLU A CA  1 
ATOM   2635  C C   . GLU A 1 343 ? -10.136 72.259   108.495 1.00 13.80 ? 425 GLU A C   1 
ATOM   2636  O O   . GLU A 1 343 ? -10.606 73.321   108.904 1.00 13.97 ? 425 GLU A O   1 
ATOM   2637  C CB  . GLU A 1 343 ? -8.109  72.998   107.256 1.00 13.56 ? 425 GLU A CB  1 
ATOM   2638  C CG  . GLU A 1 343 ? -7.363  72.758   108.575 1.00 14.32 ? 425 GLU A CG  1 
ATOM   2639  C CD  . GLU A 1 343 ? -6.112  73.614   108.726 1.00 15.61 ? 425 GLU A CD  1 
ATOM   2640  O OE1 . GLU A 1 343 ? -6.222  74.859   108.718 1.00 12.81 ? 425 GLU A OE1 1 
ATOM   2641  O OE2 . GLU A 1 343 ? -5.014  73.035   108.858 1.00 14.33 ? 425 GLU A OE2 1 
ATOM   2642  N N   . LEU A 1 344 ? -10.239 71.121   109.173 1.00 13.66 ? 426 LEU A N   1 
ATOM   2643  C CA  . LEU A 1 344 ? -10.894 71.063   110.476 1.00 14.17 ? 426 LEU A CA  1 
ATOM   2644  C C   . LEU A 1 344 ? -9.794  70.959   111.538 1.00 15.04 ? 426 LEU A C   1 
ATOM   2645  O O   . LEU A 1 344 ? -9.314  69.866   111.848 1.00 13.31 ? 426 LEU A O   1 
ATOM   2646  C CB  . LEU A 1 344 ? -11.821 69.847   110.528 1.00 13.92 ? 426 LEU A CB  1 
ATOM   2647  C CG  . LEU A 1 344 ? -12.736 69.752   109.301 1.00 13.26 ? 426 LEU A CG  1 
ATOM   2648  C CD1 . LEU A 1 344 ? -13.362 68.381   109.212 1.00 13.25 ? 426 LEU A CD1 1 
ATOM   2649  C CD2 . LEU A 1 344 ? -13.802 70.824   109.372 1.00 13.54 ? 426 LEU A CD2 1 
ATOM   2650  N N   . ILE A 1 345 ? -9.403  72.113   112.079 1.00 15.51 ? 427 ILE A N   1 
ATOM   2651  C CA  . ILE A 1 345 ? -8.339  72.215   113.081 1.00 16.95 ? 427 ILE A CA  1 
ATOM   2652  C C   . ILE A 1 345 ? -8.735  71.803   114.495 1.00 17.50 ? 427 ILE A C   1 
ATOM   2653  O O   . ILE A 1 345 ? -9.696  72.325   115.043 1.00 17.68 ? 427 ILE A O   1 
ATOM   2654  C CB  . ILE A 1 345 ? -7.803  73.665   113.161 1.00 17.16 ? 427 ILE A CB  1 
ATOM   2655  C CG1 . ILE A 1 345 ? -7.234  74.094   111.808 1.00 18.23 ? 427 ILE A CG1 1 
ATOM   2656  C CG2 . ILE A 1 345 ? -6.733  73.770   114.241 1.00 17.02 ? 427 ILE A CG2 1 
ATOM   2657  C CD1 . ILE A 1 345 ? -6.877  75.568   111.743 1.00 17.04 ? 427 ILE A CD1 1 
ATOM   2658  N N   . ARG A 1 346 ? -7.979  70.881   115.087 1.00 18.57 ? 428 ARG A N   1 
ATOM   2659  C CA  . ARG A 1 346 ? -8.247  70.430   116.451 1.00 19.49 ? 428 ARG A CA  1 
ATOM   2660  C C   . ARG A 1 346 ? -7.029  70.681   117.322 1.00 20.02 ? 428 ARG A C   1 
ATOM   2661  O O   . ARG A 1 346 ? -5.906  70.719   116.825 1.00 21.59 ? 428 ARG A O   1 
ATOM   2662  C CB  . ARG A 1 346 ? -8.583  68.933   116.488 1.00 19.83 ? 428 ARG A CB  1 
ATOM   2663  C CG  . ARG A 1 346 ? -9.887  68.556   115.799 1.00 20.88 ? 428 ARG A CG  1 
ATOM   2664  C CD  . ARG A 1 346 ? -11.037 69.420   116.286 1.00 20.54 ? 428 ARG A CD  1 
ATOM   2665  N NE  . ARG A 1 346 ? -11.339 69.250   117.706 1.00 20.84 ? 428 ARG A NE  1 
ATOM   2666  C CZ  . ARG A 1 346 ? -12.009 68.222   118.220 1.00 21.63 ? 428 ARG A CZ  1 
ATOM   2667  N NH1 . ARG A 1 346 ? -12.237 68.165   119.528 1.00 22.16 ? 428 ARG A NH1 1 
ATOM   2668  N NH2 . ARG A 1 346 ? -12.450 67.248   117.432 1.00 21.63 ? 428 ARG A NH2 1 
ATOM   2669  N N   . GLY A 1 347 ? -7.257  70.846   118.622 1.00 20.80 ? 429 GLY A N   1 
ATOM   2670  C CA  . GLY A 1 347 ? -6.165  71.080   119.555 1.00 20.92 ? 429 GLY A CA  1 
ATOM   2671  C C   . GLY A 1 347 ? -5.983  72.535   119.945 1.00 21.46 ? 429 GLY A C   1 
ATOM   2672  O O   . GLY A 1 347 ? -6.957  73.259   120.173 1.00 20.84 ? 429 GLY A O   1 
ATOM   2673  N N   . ARG A 1 348 ? -4.724  72.957   120.021 1.00 22.07 ? 430 ARG A N   1 
ATOM   2674  C CA  . ARG A 1 348 ? -4.363  74.328   120.372 1.00 22.87 ? 430 ARG A CA  1 
ATOM   2675  C C   . ARG A 1 348 ? -4.605  75.320   119.223 1.00 22.55 ? 430 ARG A C   1 
ATOM   2676  O O   . ARG A 1 348 ? -4.511  74.972   118.044 1.00 22.68 ? 430 ARG A O   1 
ATOM   2677  C CB  . ARG A 1 348 ? -2.894  74.366   120.813 1.00 23.97 ? 430 ARG A CB  1 
ATOM   2678  C CG  . ARG A 1 348 ? -2.686  73.854   122.244 1.00 29.02 ? 430 ARG A CG  1 
ATOM   2679  C CD  . ARG A 1 348 ? -1.312  73.202   122.415 1.00 33.61 ? 430 ARG A CD  1 
ATOM   2680  N NE  . ARG A 1 348 ? -0.276  74.110   122.919 1.00 36.92 ? 430 ARG A NE  1 
ATOM   2681  C CZ  . ARG A 1 348 ? 1.000   74.073   122.533 1.00 37.89 ? 430 ARG A CZ  1 
ATOM   2682  N NH1 . ARG A 1 348 ? 1.404   73.176   121.631 1.00 35.82 ? 430 ARG A NH1 1 
ATOM   2683  N NH2 . ARG A 1 348 ? 1.875   74.928   123.053 1.00 36.99 ? 430 ARG A NH2 1 
ATOM   2684  N N   . PRO A 1 349 ? -4.892  76.585   119.558 1.00 22.86 ? 431 PRO A N   1 
ATOM   2685  C CA  . PRO A 1 349 ? -4.990  77.105   120.928 1.00 22.23 ? 431 PRO A CA  1 
ATOM   2686  C C   . PRO A 1 349 ? -6.364  76.995   121.610 1.00 22.86 ? 431 PRO A C   1 
ATOM   2687  O O   . PRO A 1 349 ? -6.480  77.198   122.822 1.00 23.87 ? 431 PRO A O   1 
ATOM   2688  C CB  . PRO A 1 349 ? -4.552  78.552   120.758 1.00 20.89 ? 431 PRO A CB  1 
ATOM   2689  C CG  . PRO A 1 349 ? -5.182  78.910   119.451 1.00 22.04 ? 431 PRO A CG  1 
ATOM   2690  C CD  . PRO A 1 349 ? -4.946  77.683   118.572 1.00 21.80 ? 431 PRO A CD  1 
ATOM   2691  N N   . LYS A 1 350 ? -7.400  76.669   120.847 1.00 22.95 ? 432 LYS A N   1 
ATOM   2692  C CA  . LYS A 1 350 ? -8.747  76.575   121.406 1.00 22.38 ? 432 LYS A CA  1 
ATOM   2693  C C   . LYS A 1 350 ? -9.021  75.419   122.367 1.00 21.76 ? 432 LYS A C   1 
ATOM   2694  O O   . LYS A 1 350 ? -9.938  75.491   123.178 1.00 21.53 ? 432 LYS A O   1 
ATOM   2695  C CB  . LYS A 1 350 ? -9.778  76.525   120.275 1.00 21.04 ? 432 LYS A CB  1 
ATOM   2696  C CG  . LYS A 1 350 ? -10.033 77.870   119.627 1.00 21.71 ? 432 LYS A CG  1 
ATOM   2697  C CD  . LYS A 1 350 ? -10.394 78.903   120.691 1.00 23.27 ? 432 LYS A CD  1 
ATOM   2698  C CE  . LYS A 1 350 ? -10.628 80.283   120.103 1.00 23.31 ? 432 LYS A CE  1 
ATOM   2699  N NZ  . LYS A 1 350 ? -10.421 81.343   121.157 1.00 25.54 ? 432 LYS A NZ  1 
ATOM   2700  N N   . GLU A 1 351 ? -8.235  74.356   122.280 1.00 21.85 ? 433 GLU A N   1 
ATOM   2701  C CA  . GLU A 1 351 ? -8.454  73.193   123.133 1.00 19.94 ? 433 GLU A CA  1 
ATOM   2702  C C   . GLU A 1 351 ? -7.212  72.832   123.931 1.00 18.82 ? 433 GLU A C   1 
ATOM   2703  O O   . GLU A 1 351 ? -6.089  72.971   123.449 1.00 15.10 ? 433 GLU A O   1 
ATOM   2704  C CB  . GLU A 1 351 ? -8.899  72.005   122.270 1.00 19.78 ? 433 GLU A CB  1 
ATOM   2705  C CG  . GLU A 1 351 ? -10.189 72.251   121.482 1.00 20.21 ? 433 GLU A CG  1 
ATOM   2706  C CD  . GLU A 1 351 ? -10.537 71.095   120.567 1.00 21.04 ? 433 GLU A CD  1 
ATOM   2707  O OE1 . GLU A 1 351 ? -9.912  70.992   119.491 1.00 20.83 ? 433 GLU A OE1 1 
ATOM   2708  O OE2 . GLU A 1 351 ? -11.417 70.280   120.930 1.00 21.39 ? 433 GLU A OE2 1 
ATOM   2709  N N   . SER A 1 352 ? -7.435  72.348   125.149 1.00 19.64 ? 435 SER A N   1 
ATOM   2710  C CA  . SER A 1 352 ? -6.345  71.994   126.040 1.00 20.89 ? 435 SER A CA  1 
ATOM   2711  C C   . SER A 1 352 ? -5.700  70.663   125.716 1.00 19.82 ? 435 SER A C   1 
ATOM   2712  O O   . SER A 1 352 ? -6.069  69.620   126.255 1.00 19.84 ? 435 SER A O   1 
ATOM   2713  C CB  . SER A 1 352 ? -6.820  72.000   127.497 1.00 22.86 ? 435 SER A CB  1 
ATOM   2714  O OG  . SER A 1 352 ? -7.688  70.913   127.749 1.00 29.23 ? 435 SER A OG  1 
ATOM   2715  N N   . THR A 1 353 ? -4.714  70.721   124.832 1.00 18.29 ? 436 THR A N   1 
ATOM   2716  C CA  . THR A 1 353 ? -3.964  69.548   124.418 1.00 16.92 ? 436 THR A CA  1 
ATOM   2717  C C   . THR A 1 353 ? -2.548  70.064   124.251 1.00 16.71 ? 436 THR A C   1 
ATOM   2718  O O   . THR A 1 353 ? -2.309  71.249   124.453 1.00 16.35 ? 436 THR A O   1 
ATOM   2719  C CB  . THR A 1 353 ? -4.489  68.981   123.073 1.00 15.30 ? 436 THR A CB  1 
ATOM   2720  O OG1 . THR A 1 353 ? -4.570  70.034   122.110 1.00 16.16 ? 436 THR A OG1 1 
ATOM   2721  C CG2 . THR A 1 353 ? -5.863  68.375   123.252 1.00 14.06 ? 436 THR A CG2 1 
ATOM   2722  N N   . ILE A 1 354 ? -1.607  69.193   123.909 1.00 16.51 ? 437 ILE A N   1 
ATOM   2723  C CA  . ILE A 1 354 ? -0.234  69.641   123.724 1.00 16.13 ? 437 ILE A CA  1 
ATOM   2724  C C   . ILE A 1 354 ? 0.047   69.752   122.235 1.00 17.06 ? 437 ILE A C   1 
ATOM   2725  O O   . ILE A 1 354 ? 1.160   70.093   121.838 1.00 16.26 ? 437 ILE A O   1 
ATOM   2726  C CB  . ILE A 1 354 ? 0.806   68.641   124.315 1.00 16.53 ? 437 ILE A CB  1 
ATOM   2727  C CG1 . ILE A 1 354 ? 0.811   67.343   123.495 1.00 16.01 ? 437 ILE A CG1 1 
ATOM   2728  C CG2 . ILE A 1 354 ? 0.499   68.354   125.774 1.00 14.58 ? 437 ILE A CG2 1 
ATOM   2729  C CD1 . ILE A 1 354 ? 1.848   66.329   123.954 1.00 15.11 ? 437 ILE A CD1 1 
ATOM   2730  N N   . TRP A 1 355 ? -0.967  69.477   121.416 1.00 16.65 ? 438 TRP A N   1 
ATOM   2731  C CA  . TRP A 1 355 ? -0.795  69.494   119.964 1.00 17.11 ? 438 TRP A CA  1 
ATOM   2732  C C   . TRP A 1 355 ? -1.835  70.258   119.147 1.00 17.03 ? 438 TRP A C   1 
ATOM   2733  O O   . TRP A 1 355 ? -2.830  70.761   119.671 1.00 17.40 ? 438 TRP A O   1 
ATOM   2734  C CB  . TRP A 1 355 ? -0.769  68.053   119.449 1.00 15.54 ? 438 TRP A CB  1 
ATOM   2735  C CG  . TRP A 1 355 ? -1.963  67.267   119.913 1.00 14.22 ? 438 TRP A CG  1 
ATOM   2736  C CD1 . TRP A 1 355 ? -2.130  66.675   121.131 1.00 12.52 ? 438 TRP A CD1 1 
ATOM   2737  C CD2 . TRP A 1 355 ? -3.191  67.062   119.199 1.00 14.87 ? 438 TRP A CD2 1 
ATOM   2738  N NE1 . TRP A 1 355 ? -3.383  66.119   121.226 1.00 10.82 ? 438 TRP A NE1 1 
ATOM   2739  C CE2 . TRP A 1 355 ? -4.058  66.342   120.056 1.00 12.80 ? 438 TRP A CE2 1 
ATOM   2740  C CE3 . TRP A 1 355 ? -3.647  67.419   117.919 1.00 14.00 ? 438 TRP A CE3 1 
ATOM   2741  C CZ2 . TRP A 1 355 ? -5.351  65.973   119.677 1.00 11.51 ? 438 TRP A CZ2 1 
ATOM   2742  C CZ3 . TRP A 1 355 ? -4.944  67.048   117.543 1.00 13.22 ? 438 TRP A CZ3 1 
ATOM   2743  C CH2 . TRP A 1 355 ? -5.775  66.335   118.420 1.00 11.52 ? 438 TRP A CH2 1 
ATOM   2744  N N   . THR A 1 356 ? -1.577  70.310   117.842 1.00 16.49 ? 439 THR A N   1 
ATOM   2745  C CA  . THR A 1 356 ? -2.457  70.945   116.871 1.00 15.92 ? 439 THR A CA  1 
ATOM   2746  C C   . THR A 1 356 ? -2.370  70.194   115.542 1.00 16.58 ? 439 THR A C   1 
ATOM   2747  O O   . THR A 1 356 ? -1.281  70.001   115.009 1.00 16.91 ? 439 THR A O   1 
ATOM   2748  C CB  . THR A 1 356 ? -2.061  72.391   116.595 1.00 15.29 ? 439 THR A CB  1 
ATOM   2749  O OG1 . THR A 1 356 ? -2.208  73.173   117.780 1.00 14.39 ? 439 THR A OG1 1 
ATOM   2750  C CG2 . THR A 1 356 ? -2.940  72.957   115.513 1.00 14.97 ? 439 THR A CG2 1 
ATOM   2751  N N   . SER A 1 357 ? -3.512  69.761   115.015 1.00 17.15 ? 440 SER A N   1 
ATOM   2752  C CA  . SER A 1 357 ? -3.543  69.068   113.725 1.00 16.55 ? 440 SER A CA  1 
ATOM   2753  C C   . SER A 1 357 ? -4.903  69.311   113.090 1.00 16.11 ? 440 SER A C   1 
ATOM   2754  O O   . SER A 1 357 ? -5.774  69.914   113.714 1.00 16.84 ? 440 SER A O   1 
ATOM   2755  C CB  . SER A 1 357 ? -3.303  67.563   113.893 1.00 17.56 ? 440 SER A CB  1 
ATOM   2756  O OG  . SER A 1 357 ? -3.054  66.951   112.636 1.00 18.05 ? 440 SER A OG  1 
ATOM   2757  N N   . GLY A 1 358 ? -5.087  68.847   111.857 1.00 15.74 ? 441 GLY A N   1 
ATOM   2758  C CA  . GLY A 1 358 ? -6.354  69.057   111.189 1.00 14.51 ? 441 GLY A CA  1 
ATOM   2759  C C   . GLY A 1 358 ? -6.837  67.930   110.300 1.00 14.63 ? 441 GLY A C   1 
ATOM   2760  O O   . GLY A 1 358 ? -6.060  67.101   109.846 1.00 12.90 ? 441 GLY A O   1 
ATOM   2761  N N   . SER A 1 359 ? -8.147  67.912   110.071 1.00 15.67 ? 442 SER A N   1 
ATOM   2762  C CA  . SER A 1 359 ? -8.807  66.928   109.218 1.00 16.36 ? 442 SER A CA  1 
ATOM   2763  C C   . SER A 1 359 ? -9.310  67.699   108.016 1.00 14.33 ? 442 SER A C   1 
ATOM   2764  O O   . SER A 1 359 ? -9.290  68.924   108.033 1.00 14.66 ? 442 SER A O   1 
ATOM   2765  C CB  . SER A 1 359 ? -10.009 66.306   109.943 1.00 18.14 ? 442 SER A CB  1 
ATOM   2766  O OG  . SER A 1 359 ? -9.772  64.940   110.224 1.00 24.18 ? 442 SER A OG  1 
ATOM   2767  N N   . SER A 1 360 ? -9.776  66.995   106.988 1.00 12.79 ? 443 SER A N   1 
ATOM   2768  C CA  . SER A 1 360 ? -10.300 67.666   105.806 1.00 12.42 ? 443 SER A CA  1 
ATOM   2769  C C   . SER A 1 360 ? -11.604 67.075   105.276 1.00 14.26 ? 443 SER A C   1 
ATOM   2770  O O   . SER A 1 360 ? -11.935 65.922   105.538 1.00 14.93 ? 443 SER A O   1 
ATOM   2771  C CB  . SER A 1 360 ? -9.254  67.670   104.681 1.00 11.71 ? 443 SER A CB  1 
ATOM   2772  O OG  . SER A 1 360 ? -9.099  66.396   104.077 1.00 10.69 ? 443 SER A OG  1 
ATOM   2773  N N   . ILE A 1 361 ? -12.351 67.907   104.552 1.00 15.33 ? 444 ILE A N   1 
ATOM   2774  C CA  . ILE A 1 361 ? -13.594 67.524   103.891 1.00 13.96 ? 444 ILE A CA  1 
ATOM   2775  C C   . ILE A 1 361 ? -13.604 68.382   102.635 1.00 15.25 ? 444 ILE A C   1 
ATOM   2776  O O   . ILE A 1 361 ? -12.998 69.455   102.624 1.00 15.91 ? 444 ILE A O   1 
ATOM   2777  C CB  . ILE A 1 361 ? -14.860 67.834   104.730 1.00 12.56 ? 444 ILE A CB  1 
ATOM   2778  C CG1 . ILE A 1 361 ? -14.825 69.272   105.239 1.00 12.23 ? 444 ILE A CG1 1 
ATOM   2779  C CG2 . ILE A 1 361 ? -14.995 66.829   105.850 1.00 11.99 ? 444 ILE A CG2 1 
ATOM   2780  C CD1 . ILE A 1 361 ? -16.086 69.684   105.966 1.00 12.55 ? 444 ILE A CD1 1 
ATOM   2781  N N   . SER A 1 362 ? -14.254 67.917   101.570 1.00 15.96 ? 445 SER A N   1 
ATOM   2782  C CA  . SER A 1 362 ? -14.299 68.700   100.341 1.00 16.51 ? 445 SER A CA  1 
ATOM   2783  C C   . SER A 1 362 ? -15.623 68.566   99.582  1.00 18.06 ? 445 SER A C   1 
ATOM   2784  O O   . SER A 1 362 ? -16.384 67.611   99.783  1.00 17.89 ? 445 SER A O   1 
ATOM   2785  C CB  . SER A 1 362 ? -13.147 68.309   99.427  1.00 17.67 ? 445 SER A CB  1 
ATOM   2786  O OG  . SER A 1 362 ? -13.340 67.007   98.910  1.00 21.51 ? 445 SER A OG  1 
ATOM   2787  N N   . PHE A 1 363 ? -15.889 69.536   98.706  1.00 18.43 ? 446 PHE A N   1 
ATOM   2788  C CA  . PHE A 1 363 ? -17.115 69.557   97.926  1.00 18.23 ? 446 PHE A CA  1 
ATOM   2789  C C   . PHE A 1 363 ? -16.860 70.000   96.493  1.00 18.40 ? 446 PHE A C   1 
ATOM   2790  O O   . PHE A 1 363 ? -15.799 70.534   96.177  1.00 17.43 ? 446 PHE A O   1 
ATOM   2791  C CB  . PHE A 1 363 ? -18.124 70.508   98.574  1.00 18.88 ? 446 PHE A CB  1 
ATOM   2792  C CG  . PHE A 1 363 ? -18.498 70.133   99.971  1.00 17.68 ? 446 PHE A CG  1 
ATOM   2793  C CD1 . PHE A 1 363 ? -17.626 70.357   101.027 1.00 17.01 ? 446 PHE A CD1 1 
ATOM   2794  C CD2 . PHE A 1 363 ? -19.712 69.513   100.229 1.00 18.27 ? 446 PHE A CD2 1 
ATOM   2795  C CE1 . PHE A 1 363 ? -17.958 69.963   102.319 1.00 16.33 ? 446 PHE A CE1 1 
ATOM   2796  C CE2 . PHE A 1 363 ? -20.047 69.119   101.521 1.00 16.84 ? 446 PHE A CE2 1 
ATOM   2797  C CZ  . PHE A 1 363 ? -19.165 69.345   102.562 1.00 13.17 ? 446 PHE A CZ  1 
ATOM   2798  N N   . CYS A 1 364 ? -17.844 69.777   95.629  1.00 19.22 ? 447 CYS A N   1 
ATOM   2799  C CA  . CYS A 1 364 ? -17.729 70.174   94.233  1.00 20.65 ? 447 CYS A CA  1 
ATOM   2800  C C   . CYS A 1 364 ? -19.001 70.833   93.694  1.00 21.95 ? 447 CYS A C   1 
ATOM   2801  O O   . CYS A 1 364 ? -20.100 70.558   94.178  1.00 22.24 ? 447 CYS A O   1 
ATOM   2802  C CB  . CYS A 1 364 ? -17.361 68.970   93.376  1.00 20.85 ? 447 CYS A CB  1 
ATOM   2803  S SG  . CYS A 1 364 ? -15.603 68.492   93.482  1.00 23.69 ? 447 CYS A SG  1 
ATOM   2804  N N   . GLY A 1 365 ? -18.822 71.693   92.689  1.00 22.32 ? 448 GLY A N   1 
ATOM   2805  C CA  . GLY A 1 365 ? -19.903 72.420   92.050  1.00 22.44 ? 448 GLY A CA  1 
ATOM   2806  C C   . GLY A 1 365 ? -21.251 71.736   91.936  1.00 24.32 ? 448 GLY A C   1 
ATOM   2807  O O   . GLY A 1 365 ? -22.078 71.855   92.833  1.00 27.25 ? 448 GLY A O   1 
ATOM   2808  N N   . VAL A 1 366 ? -21.516 71.065   90.825  1.00 23.82 ? 449 VAL A N   1 
ATOM   2809  C CA  . VAL A 1 366 ? -22.793 70.360   90.669  1.00 23.45 ? 449 VAL A CA  1 
ATOM   2810  C C   . VAL A 1 366 ? -24.037 71.179   90.296  1.00 23.14 ? 449 VAL A C   1 
ATOM   2811  O O   . VAL A 1 366 ? -24.286 72.247   90.846  1.00 22.19 ? 449 VAL A O   1 
ATOM   2812  C CB  . VAL A 1 366 ? -23.093 69.522   91.956  1.00 22.32 ? 449 VAL A CB  1 
ATOM   2813  C CG1 . VAL A 1 366 ? -24.546 69.139   92.041  1.00 21.37 ? 449 VAL A CG1 1 
ATOM   2814  C CG2 . VAL A 1 366 ? -22.236 68.267   91.943  1.00 23.62 ? 449 VAL A CG2 1 
ATOM   2815  N N   . ASN A 1 367 ? -24.811 70.642   89.351  1.00 24.63 ? 450 ASN A N   1 
ATOM   2816  C CA  . ASN A 1 367 ? -26.057 71.250   88.881  1.00 26.27 ? 450 ASN A CA  1 
ATOM   2817  C C   . ASN A 1 367 ? -27.240 70.718   89.649  1.00 25.72 ? 450 ASN A C   1 
ATOM   2818  O O   . ASN A 1 367 ? -28.127 71.472   90.040  1.00 28.17 ? 450 ASN A O   1 
ATOM   2819  C CB  . ASN A 1 367 ? -26.310 70.941   87.414  1.00 28.71 ? 450 ASN A CB  1 
ATOM   2820  C CG  . ASN A 1 367 ? -25.764 71.997   86.511  1.00 31.27 ? 450 ASN A CG  1 
ATOM   2821  O OD1 . ASN A 1 367 ? -25.735 73.180   86.877  1.00 30.52 ? 450 ASN A OD1 1 
ATOM   2822  N ND2 . ASN A 1 367 ? -25.345 71.595   85.308  1.00 32.76 ? 450 ASN A ND2 1 
ATOM   2823  N N   . SER A 1 368 ? -27.261 69.404   89.830  1.00 25.34 ? 451 SER A N   1 
ATOM   2824  C CA  . SER A 1 368 ? -28.325 68.721   90.555  1.00 24.21 ? 451 SER A CA  1 
ATOM   2825  C C   . SER A 1 368 ? -28.446 69.326   91.959  1.00 23.33 ? 451 SER A C   1 
ATOM   2826  O O   . SER A 1 368 ? -27.673 70.217   92.309  1.00 20.44 ? 451 SER A O   1 
ATOM   2827  C CB  . SER A 1 368 ? -27.976 67.241   90.613  1.00 24.75 ? 451 SER A CB  1 
ATOM   2828  O OG  . SER A 1 368 ? -26.584 67.081   90.398  1.00 22.39 ? 451 SER A OG  1 
ATOM   2829  N N   . ASP A 1 369 ? -29.385 68.864   92.781  1.00 24.52 ? 452 ASP A N   1 
ATOM   2830  C CA  . ASP A 1 369 ? -29.457 69.501   94.085  1.00 25.60 ? 452 ASP A CA  1 
ATOM   2831  C C   . ASP A 1 369 ? -28.484 68.974   95.107  1.00 23.71 ? 452 ASP A C   1 
ATOM   2832  O O   . ASP A 1 369 ? -27.736 68.024   94.879  1.00 21.53 ? 452 ASP A O   1 
ATOM   2833  C CB  . ASP A 1 369 ? -30.870 69.498   94.674  1.00 29.81 ? 452 ASP A CB  1 
ATOM   2834  C CG  . ASP A 1 369 ? -31.086 70.655   95.694  1.00 34.40 ? 452 ASP A CG  1 
ATOM   2835  O OD1 . ASP A 1 369 ? -30.427 71.714   95.553  1.00 34.39 ? 452 ASP A OD1 1 
ATOM   2836  O OD2 . ASP A 1 369 ? -31.929 70.518   96.620  1.00 37.38 ? 452 ASP A OD2 1 
ATOM   2837  N N   . THR A 1 370 ? -28.507 69.623   96.254  1.00 21.56 ? 453 THR A N   1 
ATOM   2838  C CA  . THR A 1 370 ? -27.596 69.293   97.312  1.00 20.12 ? 453 THR A CA  1 
ATOM   2839  C C   . THR A 1 370 ? -28.351 69.479   98.602  1.00 19.04 ? 453 THR A C   1 
ATOM   2840  O O   . THR A 1 370 ? -29.571 69.592   98.591  1.00 18.50 ? 453 THR A O   1 
ATOM   2841  C CB  . THR A 1 370 ? -26.409 70.259   97.247  1.00 20.80 ? 453 THR A CB  1 
ATOM   2842  O OG1 . THR A 1 370 ? -26.887 71.599   97.420  1.00 21.54 ? 453 THR A OG1 1 
ATOM   2843  C CG2 . THR A 1 370 ? -25.732 70.170   95.885  1.00 18.62 ? 453 THR A CG2 1 
ATOM   2844  N N   . VAL A 1 371 ? -27.627 69.499   99.710  1.00 18.23 ? 454 VAL A N   1 
ATOM   2845  C CA  . VAL A 1 371 ? -28.244 69.706   101.004 1.00 18.43 ? 454 VAL A CA  1 
ATOM   2846  C C   . VAL A 1 371 ? -27.229 70.232   101.986 1.00 19.22 ? 454 VAL A C   1 
ATOM   2847  O O   . VAL A 1 371 ? -26.025 69.986   101.854 1.00 18.55 ? 454 VAL A O   1 
ATOM   2848  C CB  . VAL A 1 371 ? -28.853 68.411   101.595 1.00 18.44 ? 454 VAL A CB  1 
ATOM   2849  C CG1 . VAL A 1 371 ? -30.122 68.057   100.848 1.00 21.61 ? 454 VAL A CG1 1 
ATOM   2850  C CG2 . VAL A 1 371 ? -27.839 67.272   101.538 1.00 14.78 ? 454 VAL A CG2 1 
ATOM   2851  N N   . GLY A 1 372 ? -27.733 70.972   102.966 1.00 18.91 ? 455 GLY A N   1 
ATOM   2852  C CA  . GLY A 1 372 ? -26.880 71.518   103.994 1.00 18.96 ? 455 GLY A CA  1 
ATOM   2853  C C   . GLY A 1 372 ? -26.915 70.540   105.148 1.00 19.42 ? 455 GLY A C   1 
ATOM   2854  O O   . GLY A 1 372 ? -27.929 69.874   105.381 1.00 18.73 ? 455 GLY A O   1 
ATOM   2855  N N   . TRP A 1 373 ? -25.802 70.449   105.861 1.00 17.78 ? 456 TRP A N   1 
ATOM   2856  C CA  . TRP A 1 373 ? -25.694 69.556   106.990 1.00 17.54 ? 456 TRP A CA  1 
ATOM   2857  C C   . TRP A 1 373 ? -24.397 69.896   107.718 1.00 18.28 ? 456 TRP A C   1 
ATOM   2858  O O   . TRP A 1 373 ? -23.840 70.982   107.539 1.00 18.27 ? 456 TRP A O   1 
ATOM   2859  C CB  . TRP A 1 373 ? -25.686 68.101   106.500 1.00 18.79 ? 456 TRP A CB  1 
ATOM   2860  C CG  . TRP A 1 373 ? -26.125 67.110   107.551 1.00 18.78 ? 456 TRP A CG  1 
ATOM   2861  C CD1 . TRP A 1 373 ? -27.077 67.308   108.513 1.00 17.66 ? 456 TRP A CD1 1 
ATOM   2862  C CD2 . TRP A 1 373 ? -25.652 65.768   107.728 1.00 18.76 ? 456 TRP A CD2 1 
ATOM   2863  N NE1 . TRP A 1 373 ? -27.225 66.178   109.278 1.00 17.65 ? 456 TRP A NE1 1 
ATOM   2864  C CE2 . TRP A 1 373 ? -26.363 65.216   108.822 1.00 18.65 ? 456 TRP A CE2 1 
ATOM   2865  C CE3 . TRP A 1 373 ? -24.697 64.979   107.075 1.00 18.78 ? 456 TRP A CE3 1 
ATOM   2866  C CZ2 . TRP A 1 373 ? -26.149 63.912   109.276 1.00 16.61 ? 456 TRP A CZ2 1 
ATOM   2867  C CZ3 . TRP A 1 373 ? -24.485 63.681   107.526 1.00 19.24 ? 456 TRP A CZ3 1 
ATOM   2868  C CH2 . TRP A 1 373 ? -25.210 63.164   108.619 1.00 19.12 ? 456 TRP A CH2 1 
ATOM   2869  N N   . SER A 1 374 ? -23.916 68.986   108.552 1.00 16.49 ? 457 SER A N   1 
ATOM   2870  C CA  . SER A 1 374 ? -22.674 69.248   109.257 1.00 16.24 ? 457 SER A CA  1 
ATOM   2871  C C   . SER A 1 374 ? -21.753 68.033   109.248 1.00 15.80 ? 457 SER A C   1 
ATOM   2872  O O   . SER A 1 374 ? -22.083 66.994   109.814 1.00 16.67 ? 457 SER A O   1 
ATOM   2873  C CB  . SER A 1 374 ? -22.961 69.677   110.695 1.00 14.76 ? 457 SER A CB  1 
ATOM   2874  O OG  . SER A 1 374 ? -21.768 69.722   111.449 1.00 13.41 ? 457 SER A OG  1 
ATOM   2875  N N   . TRP A 1 375 ? -20.609 68.176   108.586 1.00 14.23 ? 458 TRP A N   1 
ATOM   2876  C CA  . TRP A 1 375 ? -19.602 67.124   108.499 1.00 12.86 ? 458 TRP A CA  1 
ATOM   2877  C C   . TRP A 1 375 ? -18.357 67.582   109.248 1.00 13.50 ? 458 TRP A C   1 
ATOM   2878  O O   . TRP A 1 375 ? -17.375 67.984   108.631 1.00 14.82 ? 458 TRP A O   1 
ATOM   2879  C CB  . TRP A 1 375 ? -19.217 66.870   107.046 1.00 12.37 ? 458 TRP A CB  1 
ATOM   2880  C CG  . TRP A 1 375 ? -20.275 66.217   106.227 1.00 14.80 ? 458 TRP A CG  1 
ATOM   2881  C CD1 . TRP A 1 375 ? -20.520 64.877   106.109 1.00 13.56 ? 458 TRP A CD1 1 
ATOM   2882  C CD2 . TRP A 1 375 ? -21.239 66.875   105.399 1.00 14.52 ? 458 TRP A CD2 1 
ATOM   2883  N NE1 . TRP A 1 375 ? -21.572 64.663   105.256 1.00 13.89 ? 458 TRP A NE1 1 
ATOM   2884  C CE2 . TRP A 1 375 ? -22.034 65.873   104.807 1.00 14.44 ? 458 TRP A CE2 1 
ATOM   2885  C CE3 . TRP A 1 375 ? -21.508 68.217   105.099 1.00 13.40 ? 458 TRP A CE3 1 
ATOM   2886  C CZ2 . TRP A 1 375 ? -23.084 66.171   103.932 1.00 15.35 ? 458 TRP A CZ2 1 
ATOM   2887  C CZ3 . TRP A 1 375 ? -22.549 68.511   104.229 1.00 12.96 ? 458 TRP A CZ3 1 
ATOM   2888  C CH2 . TRP A 1 375 ? -23.321 67.495   103.657 1.00 13.29 ? 458 TRP A CH2 1 
ATOM   2889  N N   . PRO A 1 376 ? -18.377 67.526   110.590 1.00 15.50 ? 459 PRO A N   1 
ATOM   2890  C CA  . PRO A 1 376 ? -17.222 67.951   111.382 1.00 14.90 ? 459 PRO A CA  1 
ATOM   2891  C C   . PRO A 1 376 ? -16.161 66.859   111.571 1.00 17.22 ? 459 PRO A C   1 
ATOM   2892  O O   . PRO A 1 376 ? -16.344 65.705   111.177 1.00 16.91 ? 459 PRO A O   1 
ATOM   2893  C CB  . PRO A 1 376 ? -17.861 68.357   112.700 1.00 12.86 ? 459 PRO A CB  1 
ATOM   2894  C CG  . PRO A 1 376 ? -18.880 67.290   112.868 1.00 12.22 ? 459 PRO A CG  1 
ATOM   2895  C CD  . PRO A 1 376 ? -19.486 67.126   111.476 1.00 13.77 ? 459 PRO A CD  1 
ATOM   2896  N N   . ASP A 1 377 ? -15.056 67.248   112.195 1.00 19.12 ? 460 ASP A N   1 
ATOM   2897  C CA  . ASP A 1 377 ? -13.951 66.344   112.476 1.00 19.62 ? 460 ASP A CA  1 
ATOM   2898  C C   . ASP A 1 377 ? -14.391 65.095   113.256 1.00 19.69 ? 460 ASP A C   1 
ATOM   2899  O O   . ASP A 1 377 ? -14.047 63.970   112.893 1.00 19.43 ? 460 ASP A O   1 
ATOM   2900  C CB  . ASP A 1 377 ? -12.894 67.103   113.258 1.00 21.07 ? 460 ASP A CB  1 
ATOM   2901  C CG  . ASP A 1 377 ? -11.822 66.205   113.788 1.00 23.71 ? 460 ASP A CG  1 
ATOM   2902  O OD1 . ASP A 1 377 ? -11.971 65.738   114.937 1.00 24.86 ? 460 ASP A OD1 1 
ATOM   2903  O OD2 . ASP A 1 377 ? -10.843 65.957   113.046 1.00 25.18 ? 460 ASP A OD2 1 
ATOM   2904  N N   . GLY A 1 378 ? -15.142 65.300   114.333 1.00 19.51 ? 461 GLY A N   1 
ATOM   2905  C CA  . GLY A 1 378 ? -15.628 64.177   115.121 1.00 19.10 ? 461 GLY A CA  1 
ATOM   2906  C C   . GLY A 1 378 ? -14.680 63.532   116.121 1.00 18.15 ? 461 GLY A C   1 
ATOM   2907  O O   . GLY A 1 378 ? -15.031 62.530   116.742 1.00 17.41 ? 461 GLY A O   1 
ATOM   2908  N N   . ALA A 1 379 ? -13.479 64.074   116.283 1.00 18.19 ? 462 ALA A N   1 
ATOM   2909  C CA  . ALA A 1 379 ? -12.541 63.492   117.240 1.00 19.82 ? 462 ALA A CA  1 
ATOM   2910  C C   . ALA A 1 379 ? -12.880 63.991   118.639 1.00 19.93 ? 462 ALA A C   1 
ATOM   2911  O O   . ALA A 1 379 ? -13.247 65.151   118.802 1.00 19.86 ? 462 ALA A O   1 
ATOM   2912  C CB  . ALA A 1 379 ? -11.113 63.883   116.887 1.00 18.12 ? 462 ALA A CB  1 
ATOM   2913  N N   . GLU A 1 380 ? -12.786 63.126   119.644 1.00 20.96 ? 463 GLU A N   1 
ATOM   2914  C CA  . GLU A 1 380 ? -13.067 63.583   120.999 1.00 23.67 ? 463 GLU A CA  1 
ATOM   2915  C C   . GLU A 1 380 ? -11.773 63.826   121.764 1.00 21.83 ? 463 GLU A C   1 
ATOM   2916  O O   . GLU A 1 380 ? -10.982 62.919   121.977 1.00 20.44 ? 463 GLU A O   1 
ATOM   2917  C CB  . GLU A 1 380 ? -13.974 62.602   121.769 1.00 27.31 ? 463 GLU A CB  1 
ATOM   2918  C CG  . GLU A 1 380 ? -13.414 61.225   122.048 1.00 32.61 ? 463 GLU A CG  1 
ATOM   2919  C CD  . GLU A 1 380 ? -14.128 60.545   123.224 1.00 36.61 ? 463 GLU A CD  1 
ATOM   2920  O OE1 . GLU A 1 380 ? -13.908 60.974   124.388 1.00 35.27 ? 463 GLU A OE1 1 
ATOM   2921  O OE2 . GLU A 1 380 ? -14.916 59.590   122.977 1.00 37.46 ? 463 GLU A OE2 1 
ATOM   2922  N N   . LEU A 1 381 ? -11.554 65.078   122.147 1.00 22.07 ? 464 LEU A N   1 
ATOM   2923  C CA  . LEU A 1 381 ? -10.355 65.455   122.890 1.00 21.11 ? 464 LEU A CA  1 
ATOM   2924  C C   . LEU A 1 381 ? -10.642 65.518   124.393 1.00 21.98 ? 464 LEU A C   1 
ATOM   2925  O O   . LEU A 1 381 ? -11.803 65.628   124.811 1.00 22.06 ? 464 LEU A O   1 
ATOM   2926  C CB  . LEU A 1 381 ? -9.842  66.808   122.388 1.00 19.05 ? 464 LEU A CB  1 
ATOM   2927  C CG  . LEU A 1 381 ? -9.395  66.819   120.924 1.00 16.37 ? 464 LEU A CG  1 
ATOM   2928  C CD1 . LEU A 1 381 ? -8.837  68.157   120.522 1.00 13.48 ? 464 LEU A CD1 1 
ATOM   2929  C CD2 . LEU A 1 381 ? -8.347  65.774   120.761 1.00 16.54 ? 464 LEU A CD2 1 
ATOM   2930  N N   . PRO A 1 382 ? -9.590  65.427   125.227 1.00 22.07 ? 465 PRO A N   1 
ATOM   2931  C CA  . PRO A 1 382 ? -8.182  65.280   124.824 1.00 21.69 ? 465 PRO A CA  1 
ATOM   2932  C C   . PRO A 1 382 ? -7.825  63.834   124.495 1.00 21.97 ? 465 PRO A C   1 
ATOM   2933  O O   . PRO A 1 382 ? -8.625  62.929   124.746 1.00 22.78 ? 465 PRO A O   1 
ATOM   2934  C CB  . PRO A 1 382 ? -7.428  65.792   126.041 1.00 21.58 ? 465 PRO A CB  1 
ATOM   2935  C CG  . PRO A 1 382 ? -8.308  65.328   127.172 1.00 21.76 ? 465 PRO A CG  1 
ATOM   2936  C CD  . PRO A 1 382 ? -9.697  65.676   126.677 1.00 20.56 ? 465 PRO A CD  1 
ATOM   2937  N N   . PHE A 1 383 ? -6.638  63.625   123.923 1.00 20.78 ? 466 PHE A N   1 
ATOM   2938  C CA  . PHE A 1 383 ? -6.177  62.277   123.577 1.00 20.66 ? 466 PHE A CA  1 
ATOM   2939  C C   . PHE A 1 383 ? -5.329  61.748   124.717 1.00 20.33 ? 466 PHE A C   1 
ATOM   2940  O O   . PHE A 1 383 ? -5.068  62.476   125.676 1.00 20.50 ? 466 PHE A O   1 
ATOM   2941  C CB  . PHE A 1 383 ? -5.341  62.295   122.290 1.00 19.26 ? 466 PHE A CB  1 
ATOM   2942  C CG  . PHE A 1 383 ? -6.156  62.193   121.026 1.00 17.15 ? 466 PHE A CG  1 
ATOM   2943  C CD1 . PHE A 1 383 ? -7.508  62.532   121.016 1.00 15.68 ? 466 PHE A CD1 1 
ATOM   2944  C CD2 . PHE A 1 383 ? -5.556  61.793   119.829 1.00 15.88 ? 466 PHE A CD2 1 
ATOM   2945  C CE1 . PHE A 1 383 ? -8.253  62.476   119.832 1.00 14.68 ? 466 PHE A CE1 1 
ATOM   2946  C CE2 . PHE A 1 383 ? -6.289  61.733   118.639 1.00 12.39 ? 466 PHE A CE2 1 
ATOM   2947  C CZ  . PHE A 1 383 ? -7.638  62.075   118.642 1.00 14.17 ? 466 PHE A CZ  1 
ATOM   2948  N N   . THR A 1 384 ? -4.896  60.489   124.611 1.00 21.13 ? 467 THR A N   1 
ATOM   2949  C CA  . THR A 1 384 ? -4.057  59.865   125.644 1.00 20.95 ? 467 THR A CA  1 
ATOM   2950  C C   . THR A 1 384 ? -2.867  60.794   125.895 1.00 22.64 ? 467 THR A C   1 
ATOM   2951  O O   . THR A 1 384 ? -2.182  60.696   126.915 1.00 22.22 ? 467 THR A O   1 
ATOM   2952  C CB  . THR A 1 384 ? -3.578  58.464   125.201 1.00 19.82 ? 467 THR A CB  1 
ATOM   2953  O OG1 . THR A 1 384 ? -4.718  57.641   124.944 1.00 19.26 ? 467 THR A OG1 1 
ATOM   2954  C CG2 . THR A 1 384 ? -2.751  57.794   126.290 1.00 18.81 ? 467 THR A CG2 1 
ATOM   2955  N N   . ILE A 1 385 ? -2.674  61.710   124.943 1.00 24.65 ? 468 ILE A N   1 
ATOM   2956  C CA  . ILE A 1 385 ? -1.654  62.756   124.946 1.00 25.17 ? 468 ILE A CA  1 
ATOM   2957  C C   . ILE A 1 385 ? -0.314  62.319   124.383 1.00 27.82 ? 468 ILE A C   1 
ATOM   2958  O O   . ILE A 1 385 ? 0.029   62.799   123.267 1.00 28.32 ? 468 ILE A O   1 
ATOM   2959  C CB  . ILE A 1 385 ? -1.464  63.356   126.354 1.00 22.13 ? 468 ILE A CB  1 
ATOM   2960  C CG1 . ILE A 1 385 ? -2.663  64.255   126.711 1.00 21.59 ? 468 ILE A CG1 1 
ATOM   2961  C CG2 . ILE A 1 385 ? -0.182  64.134   126.403 1.00 21.66 ? 468 ILE A CG2 1 
ATOM   2962  C CD1 . ILE A 1 385 ? -2.739  64.663   128.207 1.00 16.55 ? 468 ILE A CD1 1 
ATOM   2963  N N   . VAL B 1 1   ? 4.226   35.242   77.188  1.00 26.20 ? 83  VAL B N   1 
ATOM   2964  C CA  . VAL B 1 1   ? 4.483   33.891   76.586  1.00 27.47 ? 83  VAL B CA  1 
ATOM   2965  C C   . VAL B 1 1   ? 4.813   32.867   77.674  1.00 28.22 ? 83  VAL B C   1 
ATOM   2966  O O   . VAL B 1 1   ? 5.463   33.203   78.665  1.00 28.98 ? 83  VAL B O   1 
ATOM   2967  C CB  . VAL B 1 1   ? 5.666   33.945   75.582  1.00 27.92 ? 83  VAL B CB  1 
ATOM   2968  C CG1 . VAL B 1 1   ? 5.995   32.543   75.080  1.00 27.59 ? 83  VAL B CG1 1 
ATOM   2969  C CG2 . VAL B 1 1   ? 5.312   34.853   74.400  1.00 27.21 ? 83  VAL B CG2 1 
ATOM   2970  N N   . LYS B 1 2   ? 4.378   31.620   77.480  1.00 28.11 ? 84  LYS B N   1 
ATOM   2971  C CA  . LYS B 1 2   ? 4.622   30.558   78.454  1.00 27.68 ? 84  LYS B CA  1 
ATOM   2972  C C   . LYS B 1 2   ? 6.084   30.214   78.740  1.00 27.81 ? 84  LYS B C   1 
ATOM   2973  O O   . LYS B 1 2   ? 6.960   30.281   77.878  1.00 26.36 ? 84  LYS B O   1 
ATOM   2974  C CB  . LYS B 1 2   ? 3.901   29.265   78.060  1.00 27.10 ? 84  LYS B CB  1 
ATOM   2975  C CG  . LYS B 1 2   ? 2.391   29.338   78.098  1.00 30.66 ? 84  LYS B CG  1 
ATOM   2976  C CD  . LYS B 1 2   ? 1.884   30.021   76.833  1.00 35.06 ? 84  LYS B CD  1 
ATOM   2977  C CE  . LYS B 1 2   ? 0.355   30.061   76.769  1.00 36.88 ? 84  LYS B CE  1 
ATOM   2978  N NZ  . LYS B 1 2   ? -0.116  30.273   75.350  1.00 34.90 ? 84  LYS B NZ  1 
ATOM   2979  N N   . LEU B 1 3   ? 6.313   29.820   79.984  1.00 28.38 ? 85  LEU B N   1 
ATOM   2980  C CA  . LEU B 1 3   ? 7.620   29.422   80.465  1.00 28.73 ? 85  LEU B CA  1 
ATOM   2981  C C   . LEU B 1 3   ? 8.013   28.075   79.874  1.00 28.49 ? 85  LEU B C   1 
ATOM   2982  O O   . LEU B 1 3   ? 7.344   27.075   80.114  1.00 30.15 ? 85  LEU B O   1 
ATOM   2983  C CB  . LEU B 1 3   ? 7.575   29.292   81.987  1.00 28.16 ? 85  LEU B CB  1 
ATOM   2984  C CG  . LEU B 1 3   ? 8.449   30.213   82.831  1.00 28.34 ? 85  LEU B CG  1 
ATOM   2985  C CD1 . LEU B 1 3   ? 8.192   31.662   82.467  1.00 26.21 ? 85  LEU B CD1 1 
ATOM   2986  C CD2 . LEU B 1 3   ? 8.141   29.957   84.300  1.00 28.17 ? 85  LEU B CD2 1 
ATOM   2987  N N   . ALA B 1 4   ? 9.085   28.041   79.093  1.00 28.59 ? 86  ALA B N   1 
ATOM   2988  C CA  . ALA B 1 4   ? 9.547   26.770   78.545  1.00 27.65 ? 86  ALA B CA  1 
ATOM   2989  C C   . ALA B 1 4   ? 10.417  26.187   79.647  1.00 28.42 ? 86  ALA B C   1 
ATOM   2990  O O   . ALA B 1 4   ? 11.235  26.895   80.261  1.00 29.37 ? 86  ALA B O   1 
ATOM   2991  C CB  . ALA B 1 4   ? 10.380  26.989   77.298  1.00 26.37 ? 86  ALA B CB  1 
ATOM   2992  N N   . GLY B 1 5   ? 10.242  24.908   79.923  1.00 27.89 ? 87  GLY B N   1 
ATOM   2993  C CA  . GLY B 1 5   ? 11.054  24.306   80.958  1.00 27.12 ? 87  GLY B CA  1 
ATOM   2994  C C   . GLY B 1 5   ? 11.857  23.197   80.333  1.00 26.70 ? 87  GLY B C   1 
ATOM   2995  O O   . GLY B 1 5   ? 12.092  22.166   80.954  1.00 26.96 ? 87  GLY B O   1 
ATOM   2996  N N   . ASN B 1 6   ? 12.270  23.403   79.089  1.00 25.95 ? 88  ASN B N   1 
ATOM   2997  C CA  . ASN B 1 6   ? 13.040  22.386   78.387  1.00 26.40 ? 88  ASN B CA  1 
ATOM   2998  C C   . ASN B 1 6   ? 14.541  22.522   78.666  1.00 25.09 ? 88  ASN B C   1 
ATOM   2999  O O   . ASN B 1 6   ? 15.343  21.688   78.240  1.00 26.38 ? 88  ASN B O   1 
ATOM   3000  C CB  . ASN B 1 6   ? 12.737  22.436   76.868  1.00 27.49 ? 88  ASN B CB  1 
ATOM   3001  C CG  . ASN B 1 6   ? 13.009  23.803   76.238  1.00 27.98 ? 88  ASN B CG  1 
ATOM   3002  O OD1 . ASN B 1 6   ? 12.863  23.976   75.021  1.00 29.53 ? 88  ASN B OD1 1 
ATOM   3003  N ND2 . ASN B 1 6   ? 13.406  24.775   77.056  1.00 27.84 ? 88  ASN B ND2 1 
ATOM   3004  N N   . SER B 1 7   ? 14.899  23.569   79.403  1.00 23.53 ? 89  SER B N   1 
ATOM   3005  C CA  . SER B 1 7   ? 16.279  23.864   79.772  1.00 21.32 ? 89  SER B CA  1 
ATOM   3006  C C   . SER B 1 7   ? 16.662  23.003   80.979  1.00 20.74 ? 89  SER B C   1 
ATOM   3007  O O   . SER B 1 7   ? 15.785  22.484   81.667  1.00 20.09 ? 89  SER B O   1 
ATOM   3008  C CB  . SER B 1 7   ? 16.378  25.357   80.103  1.00 22.70 ? 89  SER B CB  1 
ATOM   3009  O OG  . SER B 1 7   ? 17.440  25.647   80.986  1.00 24.17 ? 89  SER B OG  1 
ATOM   3010  N N   . SER B 1 8   ? 17.962  22.843   81.226  1.00 19.24 ? 90  SER B N   1 
ATOM   3011  C CA  . SER B 1 8   ? 18.448  22.034   82.346  1.00 19.87 ? 90  SER B CA  1 
ATOM   3012  C C   . SER B 1 8   ? 18.871  22.850   83.561  1.00 19.43 ? 90  SER B C   1 
ATOM   3013  O O   . SER B 1 8   ? 19.035  24.066   83.474  1.00 18.15 ? 90  SER B O   1 
ATOM   3014  C CB  . SER B 1 8   ? 19.640  21.177   81.908  1.00 21.05 ? 90  SER B CB  1 
ATOM   3015  O OG  . SER B 1 8   ? 19.261  20.210   80.938  1.00 24.97 ? 90  SER B OG  1 
ATOM   3016  N N   . LEU B 1 9   ? 19.051  22.170   84.694  1.00 18.73 ? 91  LEU B N   1 
ATOM   3017  C CA  . LEU B 1 9   ? 19.481  22.847   85.908  1.00 18.09 ? 91  LEU B CA  1 
ATOM   3018  C C   . LEU B 1 9   ? 20.867  23.435   85.680  1.00 19.73 ? 91  LEU B C   1 
ATOM   3019  O O   . LEU B 1 9   ? 21.735  22.783   85.096  1.00 18.92 ? 91  LEU B O   1 
ATOM   3020  C CB  . LEU B 1 9   ? 19.550  21.881   87.091  1.00 16.65 ? 91  LEU B CB  1 
ATOM   3021  C CG  . LEU B 1 9   ? 18.247  21.469   87.776  1.00 17.12 ? 91  LEU B CG  1 
ATOM   3022  C CD1 . LEU B 1 9   ? 18.574  20.677   89.038  1.00 14.32 ? 91  LEU B CD1 1 
ATOM   3023  C CD2 . LEU B 1 9   ? 17.425  22.709   88.122  1.00 15.72 ? 91  LEU B CD2 1 
ATOM   3024  N N   . CYS B 1 10  ? 21.062  24.669   86.140  1.00 19.79 ? 92  CYS B N   1 
ATOM   3025  C CA  . CYS B 1 10  ? 22.340  25.354   86.005  1.00 22.08 ? 92  CYS B CA  1 
ATOM   3026  C C   . CYS B 1 10  ? 23.374  24.712   86.928  1.00 21.93 ? 92  CYS B C   1 
ATOM   3027  O O   . CYS B 1 10  ? 23.064  24.359   88.066  1.00 23.55 ? 92  CYS B O   1 
ATOM   3028  C CB  . CYS B 1 10  ? 22.234  26.836   86.418  1.00 24.39 ? 92  CYS B CB  1 
ATOM   3029  S SG  . CYS B 1 10  ? 21.209  27.972   85.421  1.00 26.87 ? 92  CYS B SG  1 
ATOM   3030  N N   . PRO B 1 11  ? 24.611  24.530   86.443  1.00 21.39 ? 93  PRO B N   1 
ATOM   3031  C CA  . PRO B 1 11  ? 25.634  23.936   87.313  1.00 20.73 ? 93  PRO B CA  1 
ATOM   3032  C C   . PRO B 1 11  ? 25.970  24.983   88.380  1.00 19.14 ? 93  PRO B C   1 
ATOM   3033  O O   . PRO B 1 11  ? 25.865  26.175   88.110  1.00 20.21 ? 93  PRO B O   1 
ATOM   3034  C CB  . PRO B 1 11  ? 26.802  23.668   86.350  1.00 20.26 ? 93  PRO B CB  1 
ATOM   3035  C CG  . PRO B 1 11  ? 26.586  24.665   85.246  1.00 20.80 ? 93  PRO B CG  1 
ATOM   3036  C CD  . PRO B 1 11  ? 25.090  24.625   85.054  1.00 20.95 ? 93  PRO B CD  1 
ATOM   3037  N N   . ILE B 1 12  ? 26.366  24.550   89.576  1.00 18.24 ? 94  ILE B N   1 
ATOM   3038  C CA  . ILE B 1 12  ? 26.688  25.473   90.673  1.00 16.56 ? 94  ILE B CA  1 
ATOM   3039  C C   . ILE B 1 12  ? 27.746  24.909   91.610  1.00 16.95 ? 94  ILE B C   1 
ATOM   3040  O O   . ILE B 1 12  ? 27.990  23.705   91.633  1.00 17.29 ? 94  ILE B O   1 
ATOM   3041  C CB  . ILE B 1 12  ? 25.467  25.731   91.545  1.00 16.42 ? 94  ILE B CB  1 
ATOM   3042  C CG1 . ILE B 1 12  ? 24.998  24.396   92.139  1.00 14.99 ? 94  ILE B CG1 1 
ATOM   3043  C CG2 . ILE B 1 12  ? 24.382  26.425   90.743  1.00 15.13 ? 94  ILE B CG2 1 
ATOM   3044  C CD1 . ILE B 1 12  ? 23.747  24.476   92.993  1.00 16.41 ? 94  ILE B CD1 1 
ATOM   3045  N N   . ASN B 1 13  ? 28.339  25.777   92.422  1.00 17.42 ? 95  ASN B N   1 
ATOM   3046  C CA  . ASN B 1 13  ? 29.358  25.341   93.375  1.00 18.32 ? 95  ASN B CA  1 
ATOM   3047  C C   . ASN B 1 13  ? 28.931  25.503   94.822  1.00 18.53 ? 95  ASN B C   1 
ATOM   3048  O O   . ASN B 1 13  ? 29.358  24.740   95.682  1.00 19.83 ? 95  ASN B O   1 
ATOM   3049  C CB  . ASN B 1 13  ? 30.670  26.103   93.156  1.00 19.11 ? 95  ASN B CB  1 
ATOM   3050  C CG  . ASN B 1 13  ? 31.381  25.672   91.895  1.00 21.23 ? 95  ASN B CG  1 
ATOM   3051  O OD1 . ASN B 1 13  ? 31.612  24.483   91.676  1.00 19.99 ? 95  ASN B OD1 1 
ATOM   3052  N ND2 . ASN B 1 13  ? 31.739  26.637   91.056  1.00 22.96 ? 95  ASN B ND2 1 
ATOM   3053  N N   . GLY B 1 14  ? 28.099  26.507   95.087  1.00 19.04 ? 96  GLY B N   1 
ATOM   3054  C CA  . GLY B 1 14  ? 27.631  26.763   96.438  1.00 17.67 ? 96  GLY B CA  1 
ATOM   3055  C C   . GLY B 1 14  ? 26.362  27.599   96.429  1.00 17.19 ? 96  GLY B C   1 
ATOM   3056  O O   . GLY B 1 14  ? 25.731  27.749   95.394  1.00 16.07 ? 96  GLY B O   1 
ATOM   3057  N N   . TRP B 1 15  ? 25.993  28.161   97.574  1.00 17.05 ? 97  TRP B N   1 
ATOM   3058  C CA  . TRP B 1 15  ? 24.782  28.959   97.653  1.00 16.74 ? 97  TRP B CA  1 
ATOM   3059  C C   . TRP B 1 15  ? 25.016  30.354   98.217  1.00 16.28 ? 97  TRP B C   1 
ATOM   3060  O O   . TRP B 1 15  ? 25.774  30.543   99.168  1.00 16.54 ? 97  TRP B O   1 
ATOM   3061  C CB  . TRP B 1 15  ? 23.748  28.222   98.500  1.00 17.42 ? 97  TRP B CB  1 
ATOM   3062  C CG  . TRP B 1 15  ? 23.593  26.798   98.099  1.00 18.31 ? 97  TRP B CG  1 
ATOM   3063  C CD1 . TRP B 1 15  ? 24.358  25.744   98.509  1.00 19.95 ? 97  TRP B CD1 1 
ATOM   3064  C CD2 . TRP B 1 15  ? 22.626  26.262   97.184  1.00 19.31 ? 97  TRP B CD2 1 
ATOM   3065  N NE1 . TRP B 1 15  ? 23.926  24.583   97.909  1.00 21.00 ? 97  TRP B NE1 1 
ATOM   3066  C CE2 . TRP B 1 15  ? 22.865  24.876   97.087  1.00 20.19 ? 97  TRP B CE2 1 
ATOM   3067  C CE3 . TRP B 1 15  ? 21.579  26.822   96.434  1.00 18.89 ? 97  TRP B CE3 1 
ATOM   3068  C CZ2 . TRP B 1 15  ? 22.095  24.039   96.275  1.00 20.72 ? 97  TRP B CZ2 1 
ATOM   3069  C CZ3 . TRP B 1 15  ? 20.813  25.990   95.628  1.00 18.04 ? 97  TRP B CZ3 1 
ATOM   3070  C CH2 . TRP B 1 15  ? 21.076  24.615   95.554  1.00 19.97 ? 97  TRP B CH2 1 
ATOM   3071  N N   . ALA B 1 16  ? 24.351  31.336   97.624  1.00 15.45 ? 98  ALA B N   1 
ATOM   3072  C CA  . ALA B 1 16  ? 24.489  32.714   98.057  1.00 13.77 ? 98  ALA B CA  1 
ATOM   3073  C C   . ALA B 1 16  ? 23.189  33.167   98.696  1.00 13.94 ? 98  ALA B C   1 
ATOM   3074  O O   . ALA B 1 16  ? 22.112  32.832   98.197  1.00 13.33 ? 98  ALA B O   1 
ATOM   3075  C CB  . ALA B 1 16  ? 24.821  33.596   96.864  1.00 11.76 ? 98  ALA B CB  1 
ATOM   3076  N N   . VAL B 1 17  ? 23.290  33.926   99.794  1.00 14.29 ? 99  VAL B N   1 
ATOM   3077  C CA  . VAL B 1 17  ? 22.103  34.433   100.493 1.00 14.14 ? 99  VAL B CA  1 
ATOM   3078  C C   . VAL B 1 17  ? 21.291  35.308   99.547  1.00 14.40 ? 99  VAL B C   1 
ATOM   3079  O O   . VAL B 1 17  ? 21.839  36.171   98.858  1.00 14.37 ? 99  VAL B O   1 
ATOM   3080  C CB  . VAL B 1 17  ? 22.448  35.304   101.724 1.00 15.40 ? 99  VAL B CB  1 
ATOM   3081  C CG1 . VAL B 1 17  ? 21.604  34.862   102.916 1.00 12.80 ? 99  VAL B CG1 1 
ATOM   3082  C CG2 . VAL B 1 17  ? 23.933  35.253   102.021 1.00 15.95 ? 99  VAL B CG2 1 
ATOM   3083  N N   . TYR B 1 18  ? 19.983  35.084   99.539  1.00 14.03 ? 100 TYR B N   1 
ATOM   3084  C CA  . TYR B 1 18  ? 19.076  35.814   98.675  1.00 14.06 ? 100 TYR B CA  1 
ATOM   3085  C C   . TYR B 1 18  ? 18.164  36.735   99.491  1.00 14.59 ? 100 TYR B C   1 
ATOM   3086  O O   . TYR B 1 18  ? 18.054  37.924   99.199  1.00 14.40 ? 100 TYR B O   1 
ATOM   3087  C CB  . TYR B 1 18  ? 18.259  34.808   97.862  1.00 14.81 ? 100 TYR B CB  1 
ATOM   3088  C CG  . TYR B 1 18  ? 17.393  35.424   96.800  1.00 14.78 ? 100 TYR B CG  1 
ATOM   3089  C CD1 . TYR B 1 18  ? 17.961  36.153   95.753  1.00 15.36 ? 100 TYR B CD1 1 
ATOM   3090  C CD2 . TYR B 1 18  ? 16.006  35.295   96.845  1.00 15.17 ? 100 TYR B CD2 1 
ATOM   3091  C CE1 . TYR B 1 18  ? 17.176  36.741   94.781  1.00 15.16 ? 100 TYR B CE1 1 
ATOM   3092  C CE2 . TYR B 1 18  ? 15.204  35.883   95.869  1.00 17.48 ? 100 TYR B CE2 1 
ATOM   3093  C CZ  . TYR B 1 18  ? 15.801  36.605   94.846  1.00 17.15 ? 100 TYR B CZ  1 
ATOM   3094  O OH  . TYR B 1 18  ? 15.021  37.220   93.900  1.00 20.82 ? 100 TYR B OH  1 
ATOM   3095  N N   . SER B 1 19  ? 17.511  36.202   100.516 1.00 14.12 ? 101 SER B N   1 
ATOM   3096  C CA  . SER B 1 19  ? 16.653  37.044   101.332 1.00 14.65 ? 101 SER B CA  1 
ATOM   3097  C C   . SER B 1 19  ? 16.514  36.579   102.771 1.00 15.30 ? 101 SER B C   1 
ATOM   3098  O O   . SER B 1 19  ? 16.845  35.446   103.104 1.00 14.73 ? 101 SER B O   1 
ATOM   3099  C CB  . SER B 1 19  ? 15.263  37.130   100.719 1.00 14.13 ? 101 SER B CB  1 
ATOM   3100  O OG  . SER B 1 19  ? 14.608  35.879   100.814 1.00 16.00 ? 101 SER B OG  1 
ATOM   3101  N N   . LYS B 1 20  ? 16.017  37.486   103.610 1.00 15.51 ? 102 LYS B N   1 
ATOM   3102  C CA  . LYS B 1 20  ? 15.751  37.236   105.023 1.00 14.91 ? 102 LYS B CA  1 
ATOM   3103  C C   . LYS B 1 20  ? 14.682  38.275   105.381 1.00 16.26 ? 102 LYS B C   1 
ATOM   3104  O O   . LYS B 1 20  ? 14.875  39.467   105.163 1.00 17.06 ? 102 LYS B O   1 
ATOM   3105  C CB  . LYS B 1 20  ? 17.007  37.435   105.865 1.00 13.24 ? 102 LYS B CB  1 
ATOM   3106  C CG  . LYS B 1 20  ? 16.825  37.000   107.312 1.00 13.34 ? 102 LYS B CG  1 
ATOM   3107  C CD  . LYS B 1 20  ? 18.121  37.100   108.103 1.00 11.48 ? 102 LYS B CD  1 
ATOM   3108  C CE  . LYS B 1 20  ? 18.041  36.296   109.388 1.00 12.68 ? 102 LYS B CE  1 
ATOM   3109  N NZ  . LYS B 1 20  ? 16.916  36.723   110.267 1.00 12.00 ? 102 LYS B NZ  1 
ATOM   3110  N N   . ASP B 1 21  ? 13.554  37.832   105.924 1.00 16.31 ? 103 ASP B N   1 
ATOM   3111  C CA  . ASP B 1 21  ? 12.468  38.754   106.219 1.00 16.43 ? 103 ASP B CA  1 
ATOM   3112  C C   . ASP B 1 21  ? 12.297  39.281   107.642 1.00 15.79 ? 103 ASP B C   1 
ATOM   3113  O O   . ASP B 1 21  ? 11.542  40.225   107.848 1.00 16.10 ? 103 ASP B O   1 
ATOM   3114  C CB  . ASP B 1 21  ? 11.153  38.146   105.712 1.00 18.45 ? 103 ASP B CB  1 
ATOM   3115  C CG  . ASP B 1 21  ? 10.858  36.776   106.318 1.00 20.65 ? 103 ASP B CG  1 
ATOM   3116  O OD1 . ASP B 1 21  ? 9.974   36.070   105.793 1.00 21.93 ? 103 ASP B OD1 1 
ATOM   3117  O OD2 . ASP B 1 21  ? 11.494  36.402   107.328 1.00 25.22 ? 103 ASP B OD2 1 
ATOM   3118  N N   . ASN B 1 22  ? 12.985  38.685   108.613 1.00 16.02 ? 104 ASN B N   1 
ATOM   3119  C CA  . ASN B 1 22  ? 12.918  39.126   110.010 1.00 16.31 ? 104 ASN B CA  1 
ATOM   3120  C C   . ASN B 1 22  ? 11.497  39.385   110.488 1.00 18.01 ? 104 ASN B C   1 
ATOM   3121  O O   . ASN B 1 22  ? 11.269  40.214   111.365 1.00 19.44 ? 104 ASN B O   1 
ATOM   3122  C CB  . ASN B 1 22  ? 13.732  40.411   110.193 1.00 15.02 ? 104 ASN B CB  1 
ATOM   3123  C CG  . ASN B 1 22  ? 15.214  40.194   110.002 1.00 15.95 ? 104 ASN B CG  1 
ATOM   3124  O OD1 . ASN B 1 22  ? 15.827  40.783   109.117 1.00 19.18 ? 104 ASN B OD1 1 
ATOM   3125  N ND2 . ASN B 1 22  ? 15.799  39.348   110.830 1.00 13.34 ? 104 ASN B ND2 1 
ATOM   3126  N N   . SER B 1 23  ? 10.539  38.665   109.927 1.00 18.38 ? 105 SER B N   1 
ATOM   3127  C CA  . SER B 1 23  ? 9.152   38.877   110.283 1.00 18.12 ? 105 SER B CA  1 
ATOM   3128  C C   . SER B 1 23  ? 8.855   38.757   111.776 1.00 18.27 ? 105 SER B C   1 
ATOM   3129  O O   . SER B 1 23  ? 8.018   39.497   112.306 1.00 19.39 ? 105 SER B O   1 
ATOM   3130  C CB  . SER B 1 23  ? 8.265   37.918   109.486 1.00 17.47 ? 105 SER B CB  1 
ATOM   3131  O OG  . SER B 1 23  ? 8.556   36.578   109.809 1.00 18.97 ? 105 SER B OG  1 
ATOM   3132  N N   . ILE B 1 24  ? 9.531   37.846   112.464 1.00 16.57 ? 106 ILE B N   1 
ATOM   3133  C CA  . ILE B 1 24  ? 9.268   37.670   113.888 1.00 16.91 ? 106 ILE B CA  1 
ATOM   3134  C C   . ILE B 1 24  ? 9.887   38.741   114.784 1.00 17.21 ? 106 ILE B C   1 
ATOM   3135  O O   . ILE B 1 24  ? 9.286   39.138   115.787 1.00 17.76 ? 106 ILE B O   1 
ATOM   3136  C CB  . ILE B 1 24  ? 9.701   36.269   114.352 1.00 16.48 ? 106 ILE B CB  1 
ATOM   3137  C CG1 . ILE B 1 24  ? 8.933   35.234   113.531 1.00 15.39 ? 106 ILE B CG1 1 
ATOM   3138  C CG2 . ILE B 1 24  ? 9.407   36.084   115.842 1.00 15.58 ? 106 ILE B CG2 1 
ATOM   3139  C CD1 . ILE B 1 24  ? 9.348   33.817   113.759 1.00 17.09 ? 106 ILE B CD1 1 
ATOM   3140  N N   . ARG B 1 25  ? 11.080  39.210   114.441 1.00 16.88 ? 107 ARG B N   1 
ATOM   3141  C CA  . ARG B 1 25  ? 11.706  40.264   115.234 1.00 17.64 ? 107 ARG B CA  1 
ATOM   3142  C C   . ARG B 1 25  ? 10.844  41.519   115.037 1.00 15.84 ? 107 ARG B C   1 
ATOM   3143  O O   . ARG B 1 25  ? 10.455  42.185   115.995 1.00 16.00 ? 107 ARG B O   1 
ATOM   3144  C CB  . ARG B 1 25  ? 13.148  40.510   114.756 1.00 18.36 ? 107 ARG B CB  1 
ATOM   3145  C CG  . ARG B 1 25  ? 14.135  39.406   115.151 1.00 20.78 ? 107 ARG B CG  1 
ATOM   3146  C CD  . ARG B 1 25  ? 15.419  39.460   114.327 1.00 21.01 ? 107 ARG B CD  1 
ATOM   3147  N NE  . ARG B 1 25  ? 16.094  40.750   114.437 1.00 22.41 ? 107 ARG B NE  1 
ATOM   3148  C CZ  . ARG B 1 25  ? 16.718  41.181   115.530 1.00 22.98 ? 107 ARG B CZ  1 
ATOM   3149  N NH1 . ARG B 1 25  ? 17.303  42.372   115.529 1.00 24.54 ? 107 ARG B NH1 1 
ATOM   3150  N NH2 . ARG B 1 25  ? 16.768  40.420   116.616 1.00 21.73 ? 107 ARG B NH2 1 
ATOM   3151  N N   . ILE B 1 26  ? 10.528  41.809   113.781 1.00 13.65 ? 108 ILE B N   1 
ATOM   3152  C CA  . ILE B 1 26  ? 9.715   42.960   113.424 1.00 11.09 ? 108 ILE B CA  1 
ATOM   3153  C C   . ILE B 1 26  ? 8.319   42.890   114.042 1.00 11.87 ? 108 ILE B C   1 
ATOM   3154  O O   . ILE B 1 26  ? 7.829   43.864   114.606 1.00 11.30 ? 108 ILE B O   1 
ATOM   3155  C CB  . ILE B 1 26  ? 9.583   43.065   111.886 1.00 8.66  ? 108 ILE B CB  1 
ATOM   3156  C CG1 . ILE B 1 26  ? 10.970  43.252   111.262 1.00 5.61  ? 108 ILE B CG1 1 
ATOM   3157  C CG2 . ILE B 1 26  ? 8.649   44.201   111.520 1.00 6.10  ? 108 ILE B CG2 1 
ATOM   3158  C CD1 . ILE B 1 26  ? 10.998  43.104   109.766 1.00 4.64  ? 108 ILE B CD1 1 
ATOM   3159  N N   . GLY B 1 27  ? 7.687   41.726   113.925 1.00 12.84 ? 109 GLY B N   1 
ATOM   3160  C CA  . GLY B 1 27  ? 6.349   41.539   114.457 1.00 12.93 ? 109 GLY B CA  1 
ATOM   3161  C C   . GLY B 1 27  ? 6.231   41.752   115.954 1.00 13.39 ? 109 GLY B C   1 
ATOM   3162  O O   . GLY B 1 27  ? 5.131   41.797   116.494 1.00 14.13 ? 109 GLY B O   1 
ATOM   3163  N N   . SER B 1 28  ? 7.364   41.882   116.630 1.00 14.11 ? 110 SER B N   1 
ATOM   3164  C CA  . SER B 1 28  ? 7.364   42.102   118.068 1.00 14.78 ? 110 SER B CA  1 
ATOM   3165  C C   . SER B 1 28  ? 6.602   43.382   118.394 1.00 14.14 ? 110 SER B C   1 
ATOM   3166  O O   . SER B 1 28  ? 6.014   43.516   119.474 1.00 14.79 ? 110 SER B O   1 
ATOM   3167  C CB  . SER B 1 28  ? 8.794   42.208   118.576 1.00 16.05 ? 110 SER B CB  1 
ATOM   3168  O OG  . SER B 1 28  ? 8.810   42.511   119.958 1.00 19.37 ? 110 SER B OG  1 
ATOM   3169  N N   . LYS B 1 29  ? 6.632   44.313   117.445 1.00 13.16 ? 111 LYS B N   1 
ATOM   3170  C CA  . LYS B 1 29  ? 5.947   45.591   117.551 1.00 11.73 ? 111 LYS B CA  1 
ATOM   3171  C C   . LYS B 1 29  ? 5.039   45.751   116.355 1.00 12.61 ? 111 LYS B C   1 
ATOM   3172  O O   . LYS B 1 29  ? 3.881   46.124   116.494 1.00 12.68 ? 111 LYS B O   1 
ATOM   3173  C CB  . LYS B 1 29  ? 6.936   46.754   117.552 1.00 12.44 ? 111 LYS B CB  1 
ATOM   3174  C CG  . LYS B 1 29  ? 6.263   48.094   117.322 1.00 9.00  ? 111 LYS B CG  1 
ATOM   3175  C CD  . LYS B 1 29  ? 7.191   49.258   117.566 1.00 10.63 ? 111 LYS B CD  1 
ATOM   3176  C CE  . LYS B 1 29  ? 6.448   50.564   117.334 1.00 12.98 ? 111 LYS B CE  1 
ATOM   3177  N NZ  . LYS B 1 29  ? 7.308   51.765   117.480 1.00 15.55 ? 111 LYS B NZ  1 
ATOM   3178  N N   . GLY B 1 30  ? 5.583   45.472   115.176 1.00 12.77 ? 112 GLY B N   1 
ATOM   3179  C CA  . GLY B 1 30  ? 4.820   45.597   113.947 1.00 14.49 ? 112 GLY B CA  1 
ATOM   3180  C C   . GLY B 1 30  ? 3.644   44.643   113.772 1.00 15.97 ? 112 GLY B C   1 
ATOM   3181  O O   . GLY B 1 30  ? 3.552   43.589   114.418 1.00 15.10 ? 112 GLY B O   1 
ATOM   3182  N N   . ASP B 1 31  ? 2.732   45.025   112.885 1.00 15.22 ? 113 ASP B N   1 
ATOM   3183  C CA  . ASP B 1 31  ? 1.561   44.216   112.609 1.00 15.66 ? 113 ASP B CA  1 
ATOM   3184  C C   . ASP B 1 31  ? 1.940   43.202   111.545 1.00 15.30 ? 113 ASP B C   1 
ATOM   3185  O O   . ASP B 1 31  ? 1.739   43.423   110.352 1.00 15.06 ? 113 ASP B O   1 
ATOM   3186  C CB  . ASP B 1 31  ? 0.416   45.108   112.135 1.00 17.11 ? 113 ASP B CB  1 
ATOM   3187  C CG  . ASP B 1 31  ? 0.180   46.278   113.068 1.00 17.85 ? 113 ASP B CG  1 
ATOM   3188  O OD1 . ASP B 1 31  ? 0.398   46.112   114.290 1.00 17.59 ? 113 ASP B OD1 1 
ATOM   3189  O OD2 . ASP B 1 31  ? -0.226  47.353   112.585 1.00 18.25 ? 113 ASP B OD2 1 
ATOM   3190  N N   . VAL B 1 32  ? 2.500   42.091   112.001 1.00 14.43 ? 114 VAL B N   1 
ATOM   3191  C CA  . VAL B 1 32  ? 2.948   41.034   111.120 1.00 15.06 ? 114 VAL B CA  1 
ATOM   3192  C C   . VAL B 1 32  ? 2.175   39.755   111.386 1.00 15.02 ? 114 VAL B C   1 
ATOM   3193  O O   . VAL B 1 32  ? 2.090   39.288   112.517 1.00 16.71 ? 114 VAL B O   1 
ATOM   3194  C CB  . VAL B 1 32  ? 4.457   40.775   111.330 1.00 16.64 ? 114 VAL B CB  1 
ATOM   3195  C CG1 . VAL B 1 32  ? 4.976   39.772   110.317 1.00 16.24 ? 114 VAL B CG1 1 
ATOM   3196  C CG2 . VAL B 1 32  ? 5.218   42.083   111.222 1.00 15.26 ? 114 VAL B CG2 1 
ATOM   3197  N N   . PHE B 1 33  ? 1.606   39.197   110.330 1.00 14.08 ? 115 PHE B N   1 
ATOM   3198  C CA  . PHE B 1 33  ? 0.849   37.962   110.423 1.00 13.31 ? 115 PHE B CA  1 
ATOM   3199  C C   . PHE B 1 33  ? 1.610   36.848   111.131 1.00 14.62 ? 115 PHE B C   1 
ATOM   3200  O O   . PHE B 1 33  ? 2.837   36.749   111.006 1.00 14.30 ? 115 PHE B O   1 
ATOM   3201  C CB  . PHE B 1 33  ? 0.524   37.458   109.022 1.00 12.22 ? 115 PHE B CB  1 
ATOM   3202  C CG  . PHE B 1 33  ? -0.587  38.187   108.358 1.00 12.10 ? 115 PHE B CG  1 
ATOM   3203  C CD1 . PHE B 1 33  ? -0.393  38.786   107.119 1.00 10.76 ? 115 PHE B CD1 1 
ATOM   3204  C CD2 . PHE B 1 33  ? -1.838  38.254   108.955 1.00 10.64 ? 115 PHE B CD2 1 
ATOM   3205  C CE1 . PHE B 1 33  ? -1.434  39.445   106.480 1.00 11.90 ? 115 PHE B CE1 1 
ATOM   3206  C CE2 . PHE B 1 33  ? -2.880  38.907   108.328 1.00 11.67 ? 115 PHE B CE2 1 
ATOM   3207  C CZ  . PHE B 1 33  ? -2.678  39.506   107.086 1.00 12.11 ? 115 PHE B CZ  1 
ATOM   3208  N N   . VAL B 1 34  ? 0.891   36.018   111.887 1.00 13.71 ? 116 VAL B N   1 
ATOM   3209  C CA  . VAL B 1 34  ? 1.518   34.850   112.492 1.00 14.09 ? 116 VAL B CA  1 
ATOM   3210  C C   . VAL B 1 34  ? 1.373   33.840   111.344 1.00 13.91 ? 116 VAL B C   1 
ATOM   3211  O O   . VAL B 1 34  ? 0.294   33.681   110.784 1.00 12.20 ? 116 VAL B O   1 
ATOM   3212  C CB  . VAL B 1 34  ? 0.778   34.338   113.759 1.00 13.74 ? 116 VAL B CB  1 
ATOM   3213  C CG1 . VAL B 1 34  ? -0.655  34.778   113.761 1.00 16.38 ? 116 VAL B CG1 1 
ATOM   3214  C CG2 . VAL B 1 34  ? 0.863   32.814   113.819 1.00 11.65 ? 116 VAL B CG2 1 
ATOM   3215  N N   . ILE B 1 35  ? 2.460   33.177   110.973 1.00 15.89 ? 117 ILE B N   1 
ATOM   3216  C CA  . ILE B 1 35  ? 2.408   32.246   109.847 1.00 17.77 ? 117 ILE B CA  1 
ATOM   3217  C C   . ILE B 1 35  ? 3.128   30.911   110.041 1.00 17.99 ? 117 ILE B C   1 
ATOM   3218  O O   . ILE B 1 35  ? 3.684   30.623   111.101 1.00 19.45 ? 117 ILE B O   1 
ATOM   3219  C CB  . ILE B 1 35  ? 3.039   32.889   108.593 1.00 18.26 ? 117 ILE B CB  1 
ATOM   3220  C CG1 . ILE B 1 35  ? 4.540   33.103   108.845 1.00 17.60 ? 117 ILE B CG1 1 
ATOM   3221  C CG2 . ILE B 1 35  ? 2.352   34.208   108.274 1.00 17.90 ? 117 ILE B CG2 1 
ATOM   3222  C CD1 . ILE B 1 35  ? 5.361   33.267   107.598 1.00 16.85 ? 117 ILE B CD1 1 
ATOM   3223  N N   . ARG B 1 36  ? 3.107   30.118   108.975 1.00 16.52 ? 118 ARG B N   1 
ATOM   3224  C CA  . ARG B 1 36  ? 3.763   28.820   108.901 1.00 16.00 ? 118 ARG B CA  1 
ATOM   3225  C C   . ARG B 1 36  ? 3.701   28.386   107.441 1.00 15.75 ? 118 ARG B C   1 
ATOM   3226  O O   . ARG B 1 36  ? 3.008   29.004   106.632 1.00 15.68 ? 118 ARG B O   1 
ATOM   3227  C CB  . ARG B 1 36  ? 3.069   27.773   109.772 1.00 17.39 ? 118 ARG B CB  1 
ATOM   3228  C CG  . ARG B 1 36  ? 3.634   27.592   111.180 1.00 19.99 ? 118 ARG B CG  1 
ATOM   3229  C CD  . ARG B 1 36  ? 5.106   27.238   111.205 1.00 22.67 ? 118 ARG B CD  1 
ATOM   3230  N NE  . ARG B 1 36  ? 5.464   26.039   110.434 1.00 26.16 ? 118 ARG B NE  1 
ATOM   3231  C CZ  . ARG B 1 36  ? 5.350   24.782   110.859 1.00 24.99 ? 118 ARG B CZ  1 
ATOM   3232  N NH1 . ARG B 1 36  ? 5.715   23.786   110.060 1.00 23.02 ? 118 ARG B NH1 1 
ATOM   3233  N NH2 . ARG B 1 36  ? 4.875   24.521   112.072 1.00 26.30 ? 118 ARG B NH2 1 
ATOM   3234  N N   . GLU B 1 37  ? 4.438   27.336   107.102 1.00 15.08 ? 119 GLU B N   1 
ATOM   3235  C CA  . GLU B 1 37  ? 4.456   26.829   105.739 1.00 15.14 ? 119 GLU B CA  1 
ATOM   3236  C C   . GLU B 1 37  ? 4.696   27.917   104.675 1.00 14.10 ? 119 GLU B C   1 
ATOM   3237  O O   . GLU B 1 37  ? 3.915   28.076   103.743 1.00 13.13 ? 119 GLU B O   1 
ATOM   3238  C CB  . GLU B 1 37  ? 3.140   26.091   105.439 1.00 15.46 ? 119 GLU B CB  1 
ATOM   3239  C CG  . GLU B 1 37  ? 2.816   24.897   106.350 1.00 15.22 ? 119 GLU B CG  1 
ATOM   3240  C CD  . GLU B 1 37  ? 2.284   25.308   107.725 1.00 17.90 ? 119 GLU B CD  1 
ATOM   3241  O OE1 . GLU B 1 37  ? 1.404   26.200   107.786 1.00 17.55 ? 119 GLU B OE1 1 
ATOM   3242  O OE2 . GLU B 1 37  ? 2.732   24.736   108.745 1.00 16.93 ? 119 GLU B OE2 1 
ATOM   3243  N N   . PRO B 1 38  ? 5.774   28.698   104.816 1.00 14.46 ? 120 PRO B N   1 
ATOM   3244  C CA  . PRO B 1 38  ? 6.038   29.733   103.813 1.00 15.14 ? 120 PRO B CA  1 
ATOM   3245  C C   . PRO B 1 38  ? 6.824   29.128   102.648 1.00 16.77 ? 120 PRO B C   1 
ATOM   3246  O O   . PRO B 1 38  ? 7.471   28.085   102.815 1.00 17.12 ? 120 PRO B O   1 
ATOM   3247  C CB  . PRO B 1 38  ? 6.877   30.732   104.582 1.00 14.20 ? 120 PRO B CB  1 
ATOM   3248  C CG  . PRO B 1 38  ? 7.699   29.820   105.458 1.00 14.40 ? 120 PRO B CG  1 
ATOM   3249  C CD  . PRO B 1 38  ? 6.639   28.888   105.993 1.00 14.27 ? 120 PRO B CD  1 
ATOM   3250  N N   . PHE B 1 39  ? 6.758   29.765   101.475 1.00 16.26 ? 121 PHE B N   1 
ATOM   3251  C CA  . PHE B 1 39  ? 7.506   29.290   100.311 1.00 15.68 ? 121 PHE B CA  1 
ATOM   3252  C C   . PHE B 1 39  ? 7.643   30.335   99.209  1.00 16.18 ? 121 PHE B C   1 
ATOM   3253  O O   . PHE B 1 39  ? 6.770   31.184   99.027  1.00 18.16 ? 121 PHE B O   1 
ATOM   3254  C CB  . PHE B 1 39  ? 6.895   27.995   99.755  1.00 13.61 ? 121 PHE B CB  1 
ATOM   3255  C CG  . PHE B 1 39  ? 5.540   28.163   99.122  1.00 14.23 ? 121 PHE B CG  1 
ATOM   3256  C CD1 . PHE B 1 39  ? 5.419   28.569   97.794  1.00 12.13 ? 121 PHE B CD1 1 
ATOM   3257  C CD2 . PHE B 1 39  ? 4.381   27.878   99.842  1.00 12.01 ? 121 PHE B CD2 1 
ATOM   3258  C CE1 . PHE B 1 39  ? 4.163   28.684   97.194  1.00 13.01 ? 121 PHE B CE1 1 
ATOM   3259  C CE2 . PHE B 1 39  ? 3.122   27.995   99.245  1.00 12.11 ? 121 PHE B CE2 1 
ATOM   3260  C CZ  . PHE B 1 39  ? 3.014   28.397   97.921  1.00 11.10 ? 121 PHE B CZ  1 
ATOM   3261  N N   . ILE B 1 40  ? 8.754   30.274   98.485  1.00 15.42 ? 122 ILE B N   1 
ATOM   3262  C CA  . ILE B 1 40  ? 9.009   31.213   97.408  1.00 15.27 ? 122 ILE B CA  1 
ATOM   3263  C C   . ILE B 1 40  ? 8.748   30.602   96.041  1.00 15.89 ? 122 ILE B C   1 
ATOM   3264  O O   . ILE B 1 40  ? 9.036   29.437   95.798  1.00 17.02 ? 122 ILE B O   1 
ATOM   3265  C CB  . ILE B 1 40  ? 10.470  31.727   97.456  1.00 15.57 ? 122 ILE B CB  1 
ATOM   3266  C CG1 . ILE B 1 40  ? 10.713  32.472   98.772  1.00 14.97 ? 122 ILE B CG1 1 
ATOM   3267  C CG2 . ILE B 1 40  ? 10.742  32.645   96.268  1.00 14.85 ? 122 ILE B CG2 1 
ATOM   3268  C CD1 . ILE B 1 40  ? 12.144  32.912   98.988  1.00 16.23 ? 122 ILE B CD1 1 
ATOM   3269  N N   . SER B 1 41  ? 8.189   31.400   95.148  1.00 16.43 ? 123 SER B N   1 
ATOM   3270  C CA  . SER B 1 41  ? 7.900   30.953   93.801  1.00 17.66 ? 123 SER B CA  1 
ATOM   3271  C C   . SER B 1 41  ? 8.045   32.214   92.956  1.00 18.54 ? 123 SER B C   1 
ATOM   3272  O O   . SER B 1 41  ? 7.632   33.283   93.399  1.00 18.40 ? 123 SER B O   1 
ATOM   3273  C CB  . SER B 1 41  ? 6.480   30.398   93.737  1.00 18.52 ? 123 SER B CB  1 
ATOM   3274  O OG  . SER B 1 41  ? 6.185   29.880   92.447  1.00 20.57 ? 123 SER B OG  1 
ATOM   3275  N N   . CYS B 1 42  ? 8.634   32.104   91.760  1.00 19.21 ? 124 CYS B N   1 
ATOM   3276  C CA  . CYS B 1 42  ? 8.856   33.281   90.904  1.00 20.35 ? 124 CYS B CA  1 
ATOM   3277  C C   . CYS B 1 42  ? 8.136   33.251   89.565  1.00 20.59 ? 124 CYS B C   1 
ATOM   3278  O O   . CYS B 1 42  ? 7.915   32.186   88.995  1.00 21.52 ? 124 CYS B O   1 
ATOM   3279  C CB  . CYS B 1 42  ? 10.351  33.467   90.600  1.00 20.37 ? 124 CYS B CB  1 
ATOM   3280  S SG  . CYS B 1 42  ? 11.516  33.513   92.004  1.00 24.59 ? 124 CYS B SG  1 
ATOM   3281  N N   . SER B 1 43  ? 7.789   34.430   89.058  1.00 20.58 ? 125 SER B N   1 
ATOM   3282  C CA  . SER B 1 43  ? 7.132   34.539   87.761  1.00 21.02 ? 125 SER B CA  1 
ATOM   3283  C C   . SER B 1 43  ? 8.241   34.823   86.754  1.00 21.76 ? 125 SER B C   1 
ATOM   3284  O O   . SER B 1 43  ? 9.401   34.464   86.977  1.00 20.67 ? 125 SER B O   1 
ATOM   3285  C CB  . SER B 1 43  ? 6.138   35.699   87.751  1.00 20.22 ? 125 SER B CB  1 
ATOM   3286  O OG  . SER B 1 43  ? 6.814   36.942   87.831  1.00 19.66 ? 125 SER B OG  1 
ATOM   3287  N N   . HIS B 1 44  ? 7.890   35.474   85.648  1.00 22.46 ? 126 HIS B N   1 
ATOM   3288  C CA  . HIS B 1 44  ? 8.890   35.814   84.642  1.00 22.53 ? 126 HIS B CA  1 
ATOM   3289  C C   . HIS B 1 44  ? 9.350   37.256   84.863  1.00 22.46 ? 126 HIS B C   1 
ATOM   3290  O O   . HIS B 1 44  ? 10.173  37.775   84.107  1.00 21.38 ? 126 HIS B O   1 
ATOM   3291  C CB  . HIS B 1 44  ? 8.306   35.671   83.240  1.00 22.59 ? 126 HIS B CB  1 
ATOM   3292  C CG  . HIS B 1 44  ? 7.153   36.585   82.975  1.00 23.24 ? 126 HIS B CG  1 
ATOM   3293  N ND1 . HIS B 1 44  ? 5.960   36.494   83.659  1.00 23.89 ? 126 HIS B ND1 1 
ATOM   3294  C CD2 . HIS B 1 44  ? 7.006   37.603   82.095  1.00 22.39 ? 126 HIS B CD2 1 
ATOM   3295  C CE1 . HIS B 1 44  ? 5.126   37.414   83.210  1.00 24.01 ? 126 HIS B CE1 1 
ATOM   3296  N NE2 . HIS B 1 44  ? 5.737   38.101   82.260  1.00 23.52 ? 126 HIS B NE2 1 
ATOM   3297  N N   . LEU B 1 45  ? 8.809   37.891   85.905  1.00 22.09 ? 127 LEU B N   1 
ATOM   3298  C CA  . LEU B 1 45  ? 9.154   39.276   86.239  1.00 22.32 ? 127 LEU B CA  1 
ATOM   3299  C C   . LEU B 1 45  ? 9.573   39.481   87.703  1.00 23.33 ? 127 LEU B C   1 
ATOM   3300  O O   . LEU B 1 45  ? 10.468  40.276   87.990  1.00 23.46 ? 127 LEU B O   1 
ATOM   3301  C CB  . LEU B 1 45  ? 7.969   40.200   85.957  1.00 19.40 ? 127 LEU B CB  1 
ATOM   3302  C CG  . LEU B 1 45  ? 7.401   40.277   84.541  1.00 18.69 ? 127 LEU B CG  1 
ATOM   3303  C CD1 . LEU B 1 45  ? 6.045   41.002   84.575  1.00 15.90 ? 127 LEU B CD1 1 
ATOM   3304  C CD2 . LEU B 1 45  ? 8.395   40.984   83.635  1.00 14.33 ? 127 LEU B CD2 1 
ATOM   3305  N N   . GLU B 1 46  ? 8.931   38.770   88.629  1.00 23.87 ? 128 GLU B N   1 
ATOM   3306  C CA  . GLU B 1 46  ? 9.245   38.951   90.039  1.00 24.02 ? 128 GLU B CA  1 
ATOM   3307  C C   . GLU B 1 46  ? 9.167   37.671   90.844  1.00 24.14 ? 128 GLU B C   1 
ATOM   3308  O O   . GLU B 1 46  ? 8.639   36.672   90.373  1.00 24.80 ? 128 GLU B O   1 
ATOM   3309  C CB  . GLU B 1 46  ? 8.277   39.961   90.654  1.00 24.45 ? 128 GLU B CB  1 
ATOM   3310  C CG  . GLU B 1 46  ? 6.883   39.407   90.853  1.00 27.79 ? 128 GLU B CG  1 
ATOM   3311  C CD  . GLU B 1 46  ? 6.019   40.299   91.725  1.00 31.18 ? 128 GLU B CD  1 
ATOM   3312  O OE1 . GLU B 1 46  ? 6.582   41.093   92.520  1.00 32.89 ? 128 GLU B OE1 1 
ATOM   3313  O OE2 . GLU B 1 46  ? 4.772   40.195   91.631  1.00 33.04 ? 128 GLU B OE2 1 
ATOM   3314  N N   . CYS B 1 47  ? 9.681   37.724   92.071  1.00 23.99 ? 129 CYS B N   1 
ATOM   3315  C CA  . CYS B 1 47  ? 9.651   36.589   92.985  1.00 23.46 ? 129 CYS B CA  1 
ATOM   3316  C C   . CYS B 1 47  ? 8.822   36.967   94.215  1.00 23.25 ? 129 CYS B C   1 
ATOM   3317  O O   . CYS B 1 47  ? 9.038   38.024   94.820  1.00 23.06 ? 129 CYS B O   1 
ATOM   3318  C CB  . CYS B 1 47  ? 11.063  36.212   93.435  1.00 24.14 ? 129 CYS B CB  1 
ATOM   3319  S SG  . CYS B 1 47  ? 12.149  35.465   92.164  1.00 27.68 ? 129 CYS B SG  1 
ATOM   3320  N N   . ARG B 1 48  ? 7.878   36.099   94.583  1.00 22.12 ? 130 ARG B N   1 
ATOM   3321  C CA  . ARG B 1 48  ? 7.017   36.347   95.734  1.00 19.63 ? 130 ARG B CA  1 
ATOM   3322  C C   . ARG B 1 48  ? 7.157   35.306   96.824  1.00 18.60 ? 130 ARG B C   1 
ATOM   3323  O O   . ARG B 1 48  ? 7.723   34.232   96.624  1.00 17.56 ? 130 ARG B O   1 
ATOM   3324  C CB  . ARG B 1 48  ? 5.545   36.392   95.311  1.00 19.14 ? 130 ARG B CB  1 
ATOM   3325  C CG  . ARG B 1 48  ? 5.177   37.558   94.417  1.00 17.76 ? 130 ARG B CG  1 
ATOM   3326  C CD  . ARG B 1 48  ? 3.714   37.497   93.995  1.00 17.95 ? 130 ARG B CD  1 
ATOM   3327  N NE  . ARG B 1 48  ? 2.773   37.930   95.032  1.00 18.04 ? 130 ARG B NE  1 
ATOM   3328  C CZ  . ARG B 1 48  ? 2.823   39.107   95.655  1.00 18.47 ? 130 ARG B CZ  1 
ATOM   3329  N NH1 . ARG B 1 48  ? 1.915   39.411   96.570  1.00 17.19 ? 130 ARG B NH1 1 
ATOM   3330  N NH2 . ARG B 1 48  ? 3.789   39.974   95.377  1.00 16.80 ? 130 ARG B NH2 1 
ATOM   3331  N N   . THR B 1 49  ? 6.613   35.643   97.982  1.00 17.56 ? 131 THR B N   1 
ATOM   3332  C CA  . THR B 1 49  ? 6.619   34.758   99.128  1.00 16.79 ? 131 THR B CA  1 
ATOM   3333  C C   . THR B 1 49  ? 5.168   34.432   99.473  1.00 16.28 ? 131 THR B C   1 
ATOM   3334  O O   . THR B 1 49  ? 4.370   35.331   99.744  1.00 15.51 ? 131 THR B O   1 
ATOM   3335  C CB  . THR B 1 49  ? 7.271   35.438   100.344 1.00 18.03 ? 131 THR B CB  1 
ATOM   3336  O OG1 . THR B 1 49  ? 8.597   35.850   100.001 1.00 20.48 ? 131 THR B OG1 1 
ATOM   3337  C CG2 . THR B 1 49  ? 7.338   34.476   101.539 1.00 17.23 ? 131 THR B CG2 1 
ATOM   3338  N N   . PHE B 1 50  ? 4.820   33.152   99.435  1.00 15.15 ? 132 PHE B N   1 
ATOM   3339  C CA  . PHE B 1 50  ? 3.467   32.731   99.790  1.00 14.83 ? 132 PHE B CA  1 
ATOM   3340  C C   . PHE B 1 50  ? 3.551   32.146   101.195 1.00 15.68 ? 132 PHE B C   1 
ATOM   3341  O O   . PHE B 1 50  ? 4.608   31.673   101.628 1.00 16.32 ? 132 PHE B O   1 
ATOM   3342  C CB  . PHE B 1 50  ? 2.923   31.671   98.816  1.00 12.43 ? 132 PHE B CB  1 
ATOM   3343  C CG  . PHE B 1 50  ? 2.689   32.183   97.424  1.00 10.24 ? 132 PHE B CG  1 
ATOM   3344  C CD1 . PHE B 1 50  ? 3.756   32.442   96.576  1.00 10.97 ? 132 PHE B CD1 1 
ATOM   3345  C CD2 . PHE B 1 50  ? 1.403   32.431   96.971  1.00 9.85  ? 132 PHE B CD2 1 
ATOM   3346  C CE1 . PHE B 1 50  ? 3.542   32.945   95.295  1.00 12.04 ? 132 PHE B CE1 1 
ATOM   3347  C CE2 . PHE B 1 50  ? 1.177   32.933   95.697  1.00 9.79  ? 132 PHE B CE2 1 
ATOM   3348  C CZ  . PHE B 1 50  ? 2.246   33.191   94.857  1.00 10.99 ? 132 PHE B CZ  1 
ATOM   3349  N N   . PHE B 1 51  ? 2.440   32.182   101.913 1.00 15.12 ? 133 PHE B N   1 
ATOM   3350  C CA  . PHE B 1 51  ? 2.422   31.652   103.264 1.00 13.88 ? 133 PHE B CA  1 
ATOM   3351  C C   . PHE B 1 51  ? 0.996   31.414   103.699 1.00 13.73 ? 133 PHE B C   1 
ATOM   3352  O O   . PHE B 1 51  ? 0.056   31.891   103.070 1.00 13.17 ? 133 PHE B O   1 
ATOM   3353  C CB  . PHE B 1 51  ? 3.092   32.644   104.206 1.00 12.60 ? 133 PHE B CB  1 
ATOM   3354  C CG  . PHE B 1 51  ? 2.671   34.060   103.969 1.00 14.28 ? 133 PHE B CG  1 
ATOM   3355  C CD1 . PHE B 1 51  ? 1.470   34.543   104.484 1.00 14.29 ? 133 PHE B CD1 1 
ATOM   3356  C CD2 . PHE B 1 51  ? 3.454   34.905   103.188 1.00 13.15 ? 133 PHE B CD2 1 
ATOM   3357  C CE1 . PHE B 1 51  ? 1.057   35.846   104.221 1.00 14.86 ? 133 PHE B CE1 1 
ATOM   3358  C CE2 . PHE B 1 51  ? 3.048   36.211   102.920 1.00 13.38 ? 133 PHE B CE2 1 
ATOM   3359  C CZ  . PHE B 1 51  ? 1.847   36.682   103.436 1.00 13.39 ? 133 PHE B CZ  1 
ATOM   3360  N N   . LEU B 1 52  ? 0.852   30.645   104.769 1.00 13.22 ? 134 LEU B N   1 
ATOM   3361  C CA  . LEU B 1 52  ? -0.443  30.351   105.337 1.00 12.65 ? 134 LEU B CA  1 
ATOM   3362  C C   . LEU B 1 52  ? -0.500  31.110   106.658 1.00 13.50 ? 134 LEU B C   1 
ATOM   3363  O O   . LEU B 1 52  ? 0.245   30.809   107.582 1.00 15.64 ? 134 LEU B O   1 
ATOM   3364  C CB  . LEU B 1 52  ? -0.583  28.853   105.581 1.00 12.40 ? 134 LEU B CB  1 
ATOM   3365  C CG  . LEU B 1 52  ? -0.611  27.948   104.341 1.00 13.63 ? 134 LEU B CG  1 
ATOM   3366  C CD1 . LEU B 1 52  ? -0.746  26.504   104.791 1.00 12.33 ? 134 LEU B CD1 1 
ATOM   3367  C CD2 . LEU B 1 52  ? -1.774  28.318   103.429 1.00 12.37 ? 134 LEU B CD2 1 
ATOM   3368  N N   . THR B 1 53  ? -1.365  32.111   106.730 1.00 12.56 ? 135 THR B N   1 
ATOM   3369  C CA  . THR B 1 53  ? -1.518  32.907   107.935 1.00 13.82 ? 135 THR B CA  1 
ATOM   3370  C C   . THR B 1 53  ? -2.406  32.171   108.940 1.00 15.77 ? 135 THR B C   1 
ATOM   3371  O O   . THR B 1 53  ? -2.993  31.132   108.634 1.00 16.72 ? 135 THR B O   1 
ATOM   3372  C CB  . THR B 1 53  ? -2.223  34.247   107.633 1.00 13.33 ? 135 THR B CB  1 
ATOM   3373  O OG1 . THR B 1 53  ? -3.568  33.982   107.222 1.00 11.50 ? 135 THR B OG1 1 
ATOM   3374  C CG2 . THR B 1 53  ? -1.513  35.013   106.531 1.00 13.55 ? 135 THR B CG2 1 
ATOM   3375  N N   . GLN B 1 54  ? -2.502  32.726   110.142 1.00 15.95 ? 136 GLN B N   1 
ATOM   3376  C CA  . GLN B 1 54  ? -3.365  32.178   111.180 1.00 16.73 ? 136 GLN B CA  1 
ATOM   3377  C C   . GLN B 1 54  ? -4.519  33.173   111.382 1.00 17.06 ? 136 GLN B C   1 
ATOM   3378  O O   . GLN B 1 54  ? -5.262  33.092   112.357 1.00 18.91 ? 136 GLN B O   1 
ATOM   3379  C CB  . GLN B 1 54  ? -2.599  31.998   112.498 1.00 14.86 ? 136 GLN B CB  1 
ATOM   3380  C CG  . GLN B 1 54  ? -1.705  30.758   112.564 1.00 14.97 ? 136 GLN B CG  1 
ATOM   3381  C CD  . GLN B 1 54  ? -2.487  29.459   112.439 1.00 14.16 ? 136 GLN B CD  1 
ATOM   3382  O OE1 . GLN B 1 54  ? -3.705  29.436   112.607 1.00 16.14 ? 136 GLN B OE1 1 
ATOM   3383  N NE2 . GLN B 1 54  ? -1.785  28.369   112.159 1.00 11.43 ? 136 GLN B NE2 1 
ATOM   3384  N N   . GLY B 1 55  ? -4.667  34.111   110.451 1.00 16.64 ? 137 GLY B N   1 
ATOM   3385  C CA  . GLY B 1 55  ? -5.723  35.098   110.572 1.00 15.80 ? 137 GLY B CA  1 
ATOM   3386  C C   . GLY B 1 55  ? -5.569  35.890   111.855 1.00 15.29 ? 137 GLY B C   1 
ATOM   3387  O O   . GLY B 1 55  ? -6.560  36.234   112.500 1.00 15.40 ? 137 GLY B O   1 
ATOM   3388  N N   . ALA B 1 56  ? -4.317  36.165   112.223 1.00 14.70 ? 138 ALA B N   1 
ATOM   3389  C CA  . ALA B 1 56  ? -3.980  36.922   113.435 1.00 14.70 ? 138 ALA B CA  1 
ATOM   3390  C C   . ALA B 1 56  ? -2.574  37.516   113.328 1.00 13.81 ? 138 ALA B C   1 
ATOM   3391  O O   . ALA B 1 56  ? -1.775  37.112   112.492 1.00 15.19 ? 138 ALA B O   1 
ATOM   3392  C CB  . ALA B 1 56  ? -4.067  36.015   114.676 1.00 11.64 ? 138 ALA B CB  1 
ATOM   3393  N N   . LEU B 1 57  ? -2.276  38.475   114.190 1.00 13.80 ? 139 LEU B N   1 
ATOM   3394  C CA  . LEU B 1 57  ? -0.970  39.112   114.187 1.00 12.77 ? 139 LEU B CA  1 
ATOM   3395  C C   . LEU B 1 57  ? -0.152  38.655   115.389 1.00 13.01 ? 139 LEU B C   1 
ATOM   3396  O O   . LEU B 1 57  ? -0.700  38.182   116.387 1.00 10.40 ? 139 LEU B O   1 
ATOM   3397  C CB  . LEU B 1 57  ? -1.140  40.629   114.212 1.00 11.70 ? 139 LEU B CB  1 
ATOM   3398  C CG  . LEU B 1 57  ? -2.054  41.177   113.111 1.00 13.14 ? 139 LEU B CG  1 
ATOM   3399  C CD1 . LEU B 1 57  ? -2.216  42.678   113.300 1.00 11.92 ? 139 LEU B CD1 1 
ATOM   3400  C CD2 . LEU B 1 57  ? -1.477  40.859   111.727 1.00 11.65 ? 139 LEU B CD2 1 
ATOM   3401  N N   . LEU B 1 58  ? 1.167   38.771   115.274 1.00 12.97 ? 140 LEU B N   1 
ATOM   3402  C CA  . LEU B 1 58  ? 2.053   38.391   116.364 1.00 14.70 ? 140 LEU B CA  1 
ATOM   3403  C C   . LEU B 1 58  ? 1.815   39.343   117.528 1.00 16.53 ? 140 LEU B C   1 
ATOM   3404  O O   . LEU B 1 58  ? 1.411   40.499   117.340 1.00 17.67 ? 140 LEU B O   1 
ATOM   3405  C CB  . LEU B 1 58  ? 3.519   38.473   115.930 1.00 16.49 ? 140 LEU B CB  1 
ATOM   3406  C CG  . LEU B 1 58  ? 4.086   37.381   115.010 1.00 15.50 ? 140 LEU B CG  1 
ATOM   3407  C CD1 . LEU B 1 58  ? 5.426   37.815   114.426 1.00 15.52 ? 140 LEU B CD1 1 
ATOM   3408  C CD2 . LEU B 1 58  ? 4.254   36.108   115.809 1.00 14.61 ? 140 LEU B CD2 1 
ATOM   3409  N N   . ASN B 1 59  ? 2.058   38.841   118.728 1.00 15.50 ? 141 ASN B N   1 
ATOM   3410  C CA  . ASN B 1 59  ? 1.881   39.609   119.943 1.00 15.31 ? 141 ASN B CA  1 
ATOM   3411  C C   . ASN B 1 59  ? 0.449   40.037   120.253 1.00 14.53 ? 141 ASN B C   1 
ATOM   3412  O O   . ASN B 1 59  ? 0.235   40.884   121.111 1.00 14.55 ? 141 ASN B O   1 
ATOM   3413  C CB  . ASN B 1 59  ? 2.801   40.825   119.947 1.00 15.31 ? 141 ASN B CB  1 
ATOM   3414  C CG  . ASN B 1 59  ? 3.754   40.816   121.119 1.00 16.55 ? 141 ASN B CG  1 
ATOM   3415  O OD1 . ASN B 1 59  ? 3.556   40.069   122.078 1.00 16.84 ? 141 ASN B OD1 1 
ATOM   3416  N ND2 . ASN B 1 59  ? 4.793   41.652   121.059 1.00 18.62 ? 141 ASN B ND2 1 
ATOM   3417  N N   . ASP B 1 60  ? -0.526  39.447   119.570 1.00 15.07 ? 142 ASP B N   1 
ATOM   3418  C CA  . ASP B 1 60  ? -1.939  39.735   119.845 1.00 15.68 ? 142 ASP B CA  1 
ATOM   3419  C C   . ASP B 1 60  ? -2.600  38.475   120.420 1.00 16.31 ? 142 ASP B C   1 
ATOM   3420  O O   . ASP B 1 60  ? -2.193  37.367   120.098 1.00 15.92 ? 142 ASP B O   1 
ATOM   3421  C CB  . ASP B 1 60  ? -2.692  40.142   118.577 1.00 14.61 ? 142 ASP B CB  1 
ATOM   3422  C CG  . ASP B 1 60  ? -4.145  40.461   118.864 1.00 14.88 ? 142 ASP B CG  1 
ATOM   3423  O OD1 . ASP B 1 60  ? -4.415  41.531   119.448 1.00 13.12 ? 142 ASP B OD1 1 
ATOM   3424  O OD2 . ASP B 1 60  ? -5.012  39.627   118.540 1.00 13.68 ? 142 ASP B OD2 1 
ATOM   3425  N N   . LYS B 1 61  ? -3.623  38.627   121.256 1.00 17.66 ? 143 LYS B N   1 
ATOM   3426  C CA  . LYS B 1 61  ? -4.259  37.444   121.835 1.00 17.99 ? 143 LYS B CA  1 
ATOM   3427  C C   . LYS B 1 61  ? -4.755  36.442   120.817 1.00 18.86 ? 143 LYS B C   1 
ATOM   3428  O O   . LYS B 1 61  ? -4.758  35.250   121.069 1.00 19.70 ? 143 LYS B O   1 
ATOM   3429  C CB  . LYS B 1 61  ? -5.421  37.817   122.760 1.00 19.07 ? 143 LYS B CB  1 
ATOM   3430  C CG  . LYS B 1 61  ? -6.559  38.568   122.111 1.00 18.43 ? 143 LYS B CG  1 
ATOM   3431  C CD  . LYS B 1 61  ? -7.667  38.717   123.139 1.00 18.96 ? 143 LYS B CD  1 
ATOM   3432  C CE  . LYS B 1 61  ? -8.919  39.245   122.468 1.00 21.90 ? 143 LYS B CE  1 
ATOM   3433  N NZ  . LYS B 1 61  ? -10.119 39.284   123.353 1.00 21.91 ? 143 LYS B NZ  1 
ATOM   3434  N N   . HIS B 1 62  ? -5.192  36.905   119.663 1.00 19.35 ? 144 HIS B N   1 
ATOM   3435  C CA  . HIS B 1 62  ? -5.686  35.959   118.673 1.00 20.69 ? 144 HIS B CA  1 
ATOM   3436  C C   . HIS B 1 62  ? -4.632  35.045   118.109 1.00 20.68 ? 144 HIS B C   1 
ATOM   3437  O O   . HIS B 1 62  ? -4.911  34.186   117.284 1.00 18.69 ? 144 HIS B O   1 
ATOM   3438  C CB  . HIS B 1 62  ? -6.335  36.708   117.549 1.00 20.81 ? 144 HIS B CB  1 
ATOM   3439  C CG  . HIS B 1 62  ? -7.551  37.443   117.983 1.00 22.49 ? 144 HIS B CG  1 
ATOM   3440  N ND1 . HIS B 1 62  ? -8.756  36.818   118.165 1.00 22.61 ? 144 HIS B ND1 1 
ATOM   3441  C CD2 . HIS B 1 62  ? -7.728  38.738   118.328 1.00 22.13 ? 144 HIS B CD2 1 
ATOM   3442  C CE1 . HIS B 1 62  ? -9.642  37.700   118.603 1.00 23.31 ? 144 HIS B CE1 1 
ATOM   3443  N NE2 . HIS B 1 62  ? -9.042  38.867   118.708 1.00 25.15 ? 144 HIS B NE2 1 
ATOM   3444  N N   . SER B 1 63  ? -3.418  35.233   118.577 1.00 20.42 ? 145 SER B N   1 
ATOM   3445  C CA  . SER B 1 63  ? -2.300  34.455   118.120 1.00 22.13 ? 145 SER B CA  1 
ATOM   3446  C C   . SER B 1 63  ? -2.203  33.211   118.981 1.00 23.35 ? 145 SER B C   1 
ATOM   3447  O O   . SER B 1 63  ? -1.432  32.312   118.682 1.00 22.28 ? 145 SER B O   1 
ATOM   3448  C CB  . SER B 1 63  ? -1.049  35.307   118.263 1.00 22.63 ? 145 SER B CB  1 
ATOM   3449  O OG  . SER B 1 63  ? 0.097   34.617   117.853 1.00 26.61 ? 145 SER B OG  1 
ATOM   3450  N N   . ASN B 1 64  ? -3.021  33.171   120.032 1.00 25.09 ? 146 ASN B N   1 
ATOM   3451  C CA  . ASN B 1 64  ? -3.035  32.071   120.986 1.00 27.64 ? 146 ASN B CA  1 
ATOM   3452  C C   . ASN B 1 64  ? -2.648  30.697   120.435 1.00 29.28 ? 146 ASN B C   1 
ATOM   3453  O O   . ASN B 1 64  ? -1.566  30.551   119.887 1.00 34.02 ? 146 ASN B O   1 
ATOM   3454  C CB  . ASN B 1 64  ? -4.381  31.996   121.716 1.00 27.26 ? 146 ASN B CB  1 
ATOM   3455  C CG  . ASN B 1 64  ? -4.224  31.525   123.167 1.00 27.57 ? 146 ASN B CG  1 
ATOM   3456  O OD1 . ASN B 1 64  ? -5.176  31.504   123.947 1.00 29.02 ? 146 ASN B OD1 1 
ATOM   3457  N ND2 . ASN B 1 64  ? -3.008  31.146   123.526 1.00 27.87 ? 146 ASN B ND2 1 
ATOM   3458  N N   . GLY B 1 65  ? -3.498  29.688   120.574 1.00 27.61 ? 147 GLY B N   1 
ATOM   3459  C CA  . GLY B 1 65  ? -3.120  28.361   120.100 1.00 27.13 ? 147 GLY B CA  1 
ATOM   3460  C C   . GLY B 1 65  ? -2.850  28.126   118.618 1.00 27.37 ? 147 GLY B C   1 
ATOM   3461  O O   . GLY B 1 65  ? -3.306  27.126   118.065 1.00 27.05 ? 147 GLY B O   1 
ATOM   3462  N N   . THR B 1 66  ? -2.090  29.013   117.979 1.00 27.41 ? 148 THR B N   1 
ATOM   3463  C CA  . THR B 1 66  ? -1.791  28.889   116.554 1.00 29.11 ? 148 THR B CA  1 
ATOM   3464  C C   . THR B 1 66  ? -0.829  27.760   116.217 1.00 29.75 ? 148 THR B C   1 
ATOM   3465  O O   . THR B 1 66  ? -0.014  27.873   115.307 1.00 30.36 ? 148 THR B O   1 
ATOM   3466  C CB  . THR B 1 66  ? -1.216  30.190   115.995 1.00 28.52 ? 148 THR B CB  1 
ATOM   3467  O OG1 . THR B 1 66  ? -0.078  30.574   116.771 1.00 28.40 ? 148 THR B OG1 1 
ATOM   3468  C CG2 . THR B 1 66  ? -2.258  31.287   116.036 1.00 27.71 ? 148 THR B CG2 1 
ATOM   3469  N N   . VAL B 1 67  ? -0.937  26.667   116.957 1.00 31.51 ? 149 VAL B N   1 
ATOM   3470  C CA  . VAL B 1 67  ? -0.101  25.500   116.738 1.00 31.88 ? 149 VAL B CA  1 
ATOM   3471  C C   . VAL B 1 67  ? -0.999  24.416   116.141 1.00 32.23 ? 149 VAL B C   1 
ATOM   3472  O O   . VAL B 1 67  ? -0.509  23.443   115.578 1.00 31.44 ? 149 VAL B O   1 
ATOM   3473  C CB  . VAL B 1 67  ? 0.477   24.980   118.071 1.00 33.47 ? 149 VAL B CB  1 
ATOM   3474  C CG1 . VAL B 1 67  ? 1.610   23.999   117.813 1.00 33.30 ? 149 VAL B CG1 1 
ATOM   3475  C CG2 . VAL B 1 67  ? 0.950   26.146   118.912 1.00 36.02 ? 149 VAL B CG2 1 
ATOM   3476  N N   . LYS B 1 68  ? -2.314  24.626   116.249 1.00 33.08 ? 150 LYS B N   1 
ATOM   3477  C CA  . LYS B 1 68  ? -3.340  23.684   115.789 1.00 35.33 ? 150 LYS B CA  1 
ATOM   3478  C C   . LYS B 1 68  ? -3.319  23.147   114.355 1.00 34.50 ? 150 LYS B C   1 
ATOM   3479  O O   . LYS B 1 68  ? -3.944  22.116   114.084 1.00 37.76 ? 150 LYS B O   1 
ATOM   3480  C CB  . LYS B 1 68  ? -4.738  24.246   116.077 1.00 37.45 ? 150 LYS B CB  1 
ATOM   3481  C CG  . LYS B 1 68  ? -5.059  25.542   115.357 1.00 42.75 ? 150 LYS B CG  1 
ATOM   3482  C CD  . LYS B 1 68  ? -6.481  26.001   115.675 1.00 45.66 ? 150 LYS B CD  1 
ATOM   3483  C CE  . LYS B 1 68  ? -6.744  27.431   115.207 1.00 45.82 ? 150 LYS B CE  1 
ATOM   3484  N NZ  . LYS B 1 68  ? -8.147  27.841   115.508 1.00 47.16 ? 150 LYS B NZ  1 
ATOM   3485  N N   . ASP B 1 69  ? -2.643  23.831   113.438 1.00 30.19 ? 151 ASP B N   1 
ATOM   3486  C CA  . ASP B 1 69  ? -2.552  23.364   112.048 1.00 27.04 ? 151 ASP B CA  1 
ATOM   3487  C C   . ASP B 1 69  ? -3.655  23.747   111.074 1.00 23.43 ? 151 ASP B C   1 
ATOM   3488  O O   . ASP B 1 69  ? -3.432  24.513   110.144 1.00 22.94 ? 151 ASP B O   1 
ATOM   3489  C CB  . ASP B 1 69  ? -2.417  21.843   111.980 1.00 27.93 ? 151 ASP B CB  1 
ATOM   3490  C CG  . ASP B 1 69  ? -1.028  21.361   112.311 1.00 30.21 ? 151 ASP B CG  1 
ATOM   3491  O OD1 . ASP B 1 69  ? -0.072  21.831   111.663 1.00 31.76 ? 151 ASP B OD1 1 
ATOM   3492  O OD2 . ASP B 1 69  ? -0.891  20.499   113.204 1.00 31.88 ? 151 ASP B OD2 1 
ATOM   3493  N N   . ARG B 1 70  ? -4.840  23.184   111.258 1.00 22.17 ? 152 ARG B N   1 
ATOM   3494  C CA  . ARG B 1 70  ? -5.952  23.463   110.349 1.00 20.16 ? 152 ARG B CA  1 
ATOM   3495  C C   . ARG B 1 70  ? -7.113  24.186   111.032 1.00 20.09 ? 152 ARG B C   1 
ATOM   3496  O O   . ARG B 1 70  ? -7.611  23.736   112.064 1.00 21.83 ? 152 ARG B O   1 
ATOM   3497  C CB  . ARG B 1 70  ? -6.452  22.149   109.735 1.00 16.76 ? 152 ARG B CB  1 
ATOM   3498  C CG  . ARG B 1 70  ? -5.387  21.352   108.975 1.00 16.67 ? 152 ARG B CG  1 
ATOM   3499  C CD  . ARG B 1 70  ? -5.914  19.990   108.491 1.00 15.17 ? 152 ARG B CD  1 
ATOM   3500  N NE  . ARG B 1 70  ? -6.314  19.097   109.583 1.00 11.91 ? 152 ARG B NE  1 
ATOM   3501  C CZ  . ARG B 1 70  ? -5.484  18.553   110.470 1.00 9.78  ? 152 ARG B CZ  1 
ATOM   3502  N NH1 . ARG B 1 70  ? -5.968  17.758   111.412 1.00 8.04  ? 152 ARG B NH1 1 
ATOM   3503  N NH2 . ARG B 1 70  ? -4.181  18.797   110.419 1.00 4.77  ? 152 ARG B NH2 1 
ATOM   3504  N N   . SER B 1 71  ? -7.528  25.316   110.467 1.00 17.79 ? 153 SER B N   1 
ATOM   3505  C CA  . SER B 1 71  ? -8.646  26.068   111.019 1.00 16.93 ? 153 SER B CA  1 
ATOM   3506  C C   . SER B 1 71  ? -9.345  26.810   109.894 1.00 16.88 ? 153 SER B C   1 
ATOM   3507  O O   . SER B 1 71  ? -8.815  26.918   108.791 1.00 18.11 ? 153 SER B O   1 
ATOM   3508  C CB  . SER B 1 71  ? -8.180  27.055   112.092 1.00 16.24 ? 153 SER B CB  1 
ATOM   3509  O OG  . SER B 1 71  ? -7.721  28.267   111.532 1.00 18.89 ? 153 SER B OG  1 
ATOM   3510  N N   . PRO B 1 72  ? -10.552 27.333   110.158 1.00 17.48 ? 154 PRO B N   1 
ATOM   3511  C CA  . PRO B 1 72  ? -11.326 28.066   109.151 1.00 15.27 ? 154 PRO B CA  1 
ATOM   3512  C C   . PRO B 1 72  ? -10.737 29.433   108.798 1.00 15.70 ? 154 PRO B C   1 
ATOM   3513  O O   . PRO B 1 72  ? -11.032 29.978   107.735 1.00 15.42 ? 154 PRO B O   1 
ATOM   3514  C CB  . PRO B 1 72  ? -12.704 28.214   109.806 1.00 14.99 ? 154 PRO B CB  1 
ATOM   3515  C CG  . PRO B 1 72  ? -12.738 27.151   110.869 1.00 16.53 ? 154 PRO B CG  1 
ATOM   3516  C CD  . PRO B 1 72  ? -11.333 27.178   111.399 1.00 16.70 ? 154 PRO B CD  1 
ATOM   3517  N N   . HIS B 1 73  ? -9.909  29.976   109.690 1.00 16.11 ? 155 HIS B N   1 
ATOM   3518  C CA  . HIS B 1 73  ? -9.308  31.302   109.514 1.00 17.18 ? 155 HIS B CA  1 
ATOM   3519  C C   . HIS B 1 73  ? -7.980  31.288   108.784 1.00 19.04 ? 155 HIS B C   1 
ATOM   3520  O O   . HIS B 1 73  ? -7.421  32.337   108.454 1.00 20.49 ? 155 HIS B O   1 
ATOM   3521  C CB  . HIS B 1 73  ? -9.118  31.954   110.875 1.00 16.20 ? 155 HIS B CB  1 
ATOM   3522  C CG  . HIS B 1 73  ? -10.287 31.771   111.782 1.00 15.92 ? 155 HIS B CG  1 
ATOM   3523  N ND1 . HIS B 1 73  ? -10.213 31.046   112.953 1.00 16.22 ? 155 HIS B ND1 1 
ATOM   3524  C CD2 . HIS B 1 73  ? -11.580 32.148   111.651 1.00 14.31 ? 155 HIS B CD2 1 
ATOM   3525  C CE1 . HIS B 1 73  ? -11.413 30.982   113.501 1.00 16.22 ? 155 HIS B CE1 1 
ATOM   3526  N NE2 . HIS B 1 73  ? -12.260 31.642   112.730 1.00 16.47 ? 155 HIS B NE2 1 
ATOM   3527  N N   . ARG B 1 74  ? -7.472  30.090   108.544 1.00 19.69 ? 156 ARG B N   1 
ATOM   3528  C CA  . ARG B 1 74  ? -6.208  29.921   107.852 1.00 20.21 ? 156 ARG B CA  1 
ATOM   3529  C C   . ARG B 1 74  ? -6.383  30.439   106.421 1.00 18.89 ? 156 ARG B C   1 
ATOM   3530  O O   . ARG B 1 74  ? -7.358  30.101   105.763 1.00 18.55 ? 156 ARG B O   1 
ATOM   3531  C CB  . ARG B 1 74  ? -5.862  28.429   107.828 1.00 22.66 ? 156 ARG B CB  1 
ATOM   3532  C CG  . ARG B 1 74  ? -4.393  28.099   107.901 1.00 24.09 ? 156 ARG B CG  1 
ATOM   3533  C CD  . ARG B 1 74  ? -3.907  28.017   109.342 1.00 23.20 ? 156 ARG B CD  1 
ATOM   3534  N NE  . ARG B 1 74  ? -2.500  28.408   109.423 1.00 24.17 ? 156 ARG B NE  1 
ATOM   3535  C CZ  . ARG B 1 74  ? -1.472  27.618   109.149 1.00 22.52 ? 156 ARG B CZ  1 
ATOM   3536  N NH1 . ARG B 1 74  ? -0.234  28.088   109.243 1.00 23.07 ? 156 ARG B NH1 1 
ATOM   3537  N NH2 . ARG B 1 74  ? -1.675  26.358   108.807 1.00 25.57 ? 156 ARG B NH2 1 
ATOM   3538  N N   . THR B 1 75  ? -5.456  31.264   105.945 1.00 18.75 ? 157 THR B N   1 
ATOM   3539  C CA  . THR B 1 75  ? -5.534  31.777   104.572 1.00 17.80 ? 157 THR B CA  1 
ATOM   3540  C C   . THR B 1 75  ? -4.171  31.874   103.893 1.00 17.08 ? 157 THR B C   1 
ATOM   3541  O O   . THR B 1 75  ? -3.150  32.086   104.544 1.00 16.20 ? 157 THR B O   1 
ATOM   3542  C CB  . THR B 1 75  ? -6.205  33.179   104.490 1.00 17.21 ? 157 THR B CB  1 
ATOM   3543  O OG1 . THR B 1 75  ? -5.555  34.086   105.390 1.00 18.07 ? 157 THR B OG1 1 
ATOM   3544  C CG2 . THR B 1 75  ? -7.677  33.088   104.821 1.00 17.16 ? 157 THR B CG2 1 
ATOM   3545  N N   . LEU B 1 76  ? -4.177  31.709   102.575 1.00 15.93 ? 158 LEU B N   1 
ATOM   3546  C CA  . LEU B 1 76  ? -2.965  31.789   101.773 1.00 14.63 ? 158 LEU B CA  1 
ATOM   3547  C C   . LEU B 1 76  ? -2.843  33.193   101.213 1.00 14.41 ? 158 LEU B C   1 
ATOM   3548  O O   . LEU B 1 76  ? -3.743  33.672   100.514 1.00 11.92 ? 158 LEU B O   1 
ATOM   3549  C CB  . LEU B 1 76  ? -3.017  30.796   100.609 1.00 13.34 ? 158 LEU B CB  1 
ATOM   3550  C CG  . LEU B 1 76  ? -1.976  31.001   99.501  1.00 12.83 ? 158 LEU B CG  1 
ATOM   3551  C CD1 . LEU B 1 76  ? -0.625  30.466   99.939  1.00 12.36 ? 158 LEU B CD1 1 
ATOM   3552  C CD2 . LEU B 1 76  ? -2.446  30.307   98.239  1.00 13.15 ? 158 LEU B CD2 1 
ATOM   3553  N N   . MET B 1 77  ? -1.727  33.841   101.525 1.00 13.27 ? 159 MET B N   1 
ATOM   3554  C CA  . MET B 1 77  ? -1.461  35.196   101.060 1.00 13.86 ? 159 MET B CA  1 
ATOM   3555  C C   . MET B 1 77  ? -0.013  35.300   100.571 1.00 14.12 ? 159 MET B C   1 
ATOM   3556  O O   . MET B 1 77  ? 0.804   34.412   100.820 1.00 14.47 ? 159 MET B O   1 
ATOM   3557  C CB  . MET B 1 77  ? -1.726  36.202   102.186 1.00 12.16 ? 159 MET B CB  1 
ATOM   3558  C CG  . MET B 1 77  ? -3.152  36.164   102.713 1.00 13.28 ? 159 MET B CG  1 
ATOM   3559  S SD  . MET B 1 77  ? -3.512  37.500   103.873 1.00 17.44 ? 159 MET B SD  1 
ATOM   3560  C CE  . MET B 1 77  ? -4.122  38.724   102.788 1.00 16.16 ? 159 MET B CE  1 
ATOM   3561  N N   . SER B 1 78  ? 0.304   36.378   99.863  1.00 14.09 ? 160 SER B N   1 
ATOM   3562  C CA  . SER B 1 78  ? 1.655   36.548   99.353  1.00 12.75 ? 160 SER B CA  1 
ATOM   3563  C C   . SER B 1 78  ? 2.121   37.999   99.420  1.00 12.08 ? 160 SER B C   1 
ATOM   3564  O O   . SER B 1 78  ? 1.312   38.914   99.519  1.00 10.34 ? 160 SER B O   1 
ATOM   3565  C CB  . SER B 1 78  ? 1.729   36.038   97.908  1.00 12.52 ? 160 SER B CB  1 
ATOM   3566  O OG  . SER B 1 78  ? 0.917   36.806   97.040  1.00 12.74 ? 160 SER B OG  1 
ATOM   3567  N N   . CYS B 1 79  ? 3.433   38.195   99.379  1.00 12.21 ? 161 CYS B N   1 
ATOM   3568  C CA  . CYS B 1 79  ? 4.027   39.522   99.406  1.00 12.71 ? 161 CYS B CA  1 
ATOM   3569  C C   . CYS B 1 79  ? 5.372   39.359   98.727  1.00 13.46 ? 161 CYS B C   1 
ATOM   3570  O O   . CYS B 1 79  ? 5.821   38.245   98.537  1.00 13.91 ? 161 CYS B O   1 
ATOM   3571  C CB  . CYS B 1 79  ? 4.206   40.004   100.850 1.00 15.96 ? 161 CYS B CB  1 
ATOM   3572  S SG  . CYS B 1 79  ? 5.372   39.036   101.870 1.00 16.74 ? 161 CYS B SG  1 
ATOM   3573  N N   . PRO B 1 80  ? 6.022   40.458   98.317  1.00 17.02 ? 162 PRO B N   1 
ATOM   3574  C CA  . PRO B 1 80  ? 7.327   40.261   97.665  1.00 14.81 ? 162 PRO B CA  1 
ATOM   3575  C C   . PRO B 1 80  ? 8.381   39.659   98.597  1.00 15.81 ? 162 PRO B C   1 
ATOM   3576  O O   . PRO B 1 80  ? 8.309   39.835   99.809  1.00 16.93 ? 162 PRO B O   1 
ATOM   3577  C CB  . PRO B 1 80  ? 7.686   41.664   97.159  1.00 15.93 ? 162 PRO B CB  1 
ATOM   3578  C CG  . PRO B 1 80  ? 6.830   42.591   97.979  1.00 15.42 ? 162 PRO B CG  1 
ATOM   3579  C CD  . PRO B 1 80  ? 5.545   41.844   98.152  1.00 15.20 ? 162 PRO B CD  1 
ATOM   3580  N N   . VAL B 1 81  ? 9.348   38.940   98.027  1.00 16.92 ? 163 VAL B N   1 
ATOM   3581  C CA  . VAL B 1 81  ? 10.406  38.294   98.820  1.00 17.44 ? 163 VAL B CA  1 
ATOM   3582  C C   . VAL B 1 81  ? 11.221  39.232   99.689  1.00 17.23 ? 163 VAL B C   1 
ATOM   3583  O O   . VAL B 1 81  ? 11.555  40.343   99.279  1.00 18.53 ? 163 VAL B O   1 
ATOM   3584  C CB  . VAL B 1 81  ? 11.416  37.517   97.938  1.00 17.27 ? 163 VAL B CB  1 
ATOM   3585  C CG1 . VAL B 1 81  ? 10.792  36.235   97.436  1.00 20.14 ? 163 VAL B CG1 1 
ATOM   3586  C CG2 . VAL B 1 81  ? 11.864  38.376   96.778  1.00 17.56 ? 163 VAL B CG2 1 
ATOM   3587  N N   . GLY B 1 82  ? 11.544  38.769   100.890 1.00 16.15 ? 164 GLY B N   1 
ATOM   3588  C CA  . GLY B 1 82  ? 12.337  39.567   101.804 1.00 16.11 ? 164 GLY B CA  1 
ATOM   3589  C C   . GLY B 1 82  ? 11.535  40.494   102.693 1.00 16.59 ? 164 GLY B C   1 
ATOM   3590  O O   . GLY B 1 82  ? 12.059  41.003   103.682 1.00 17.70 ? 164 GLY B O   1 
ATOM   3591  N N   . GLU B 1 83  ? 10.271  40.723   102.349 1.00 15.89 ? 165 GLU B N   1 
ATOM   3592  C CA  . GLU B 1 83  ? 9.427   41.605   103.144 1.00 16.18 ? 165 GLU B CA  1 
ATOM   3593  C C   . GLU B 1 83  ? 8.688   40.847   104.250 1.00 16.09 ? 165 GLU B C   1 
ATOM   3594  O O   . GLU B 1 83  ? 8.433   39.651   104.130 1.00 15.47 ? 165 GLU B O   1 
ATOM   3595  C CB  . GLU B 1 83  ? 8.407   42.313   102.243 1.00 17.11 ? 165 GLU B CB  1 
ATOM   3596  C CG  . GLU B 1 83  ? 9.013   43.331   101.283 1.00 18.90 ? 165 GLU B CG  1 
ATOM   3597  C CD  . GLU B 1 83  ? 7.976   44.048   100.420 1.00 18.74 ? 165 GLU B CD  1 
ATOM   3598  O OE1 . GLU B 1 83  ? 6.793   44.068   100.792 1.00 19.90 ? 165 GLU B OE1 1 
ATOM   3599  O OE2 . GLU B 1 83  ? 8.345   44.609   99.370  1.00 20.48 ? 165 GLU B OE2 1 
ATOM   3600  N N   . ALA B 1 84  ? 8.359   41.539   105.335 1.00 14.89 ? 166 ALA B N   1 
ATOM   3601  C CA  . ALA B 1 84  ? 7.618   40.905   106.423 1.00 15.84 ? 166 ALA B CA  1 
ATOM   3602  C C   . ALA B 1 84  ? 6.143   40.798   106.005 1.00 14.45 ? 166 ALA B C   1 
ATOM   3603  O O   . ALA B 1 84  ? 5.570   41.746   105.488 1.00 15.56 ? 166 ALA B O   1 
ATOM   3604  C CB  . ALA B 1 84  ? 7.747   41.732   107.710 1.00 13.47 ? 166 ALA B CB  1 
ATOM   3605  N N   . PRO B 1 85  ? 5.518   39.632   106.203 1.00 15.04 ? 167 PRO B N   1 
ATOM   3606  C CA  . PRO B 1 85  ? 4.111   39.515   105.812 1.00 15.19 ? 167 PRO B CA  1 
ATOM   3607  C C   . PRO B 1 85  ? 3.172   40.305   106.725 1.00 15.36 ? 167 PRO B C   1 
ATOM   3608  O O   . PRO B 1 85  ? 2.988   39.988   107.907 1.00 14.99 ? 167 PRO B O   1 
ATOM   3609  C CB  . PRO B 1 85  ? 3.868   38.008   105.846 1.00 15.05 ? 167 PRO B CB  1 
ATOM   3610  C CG  . PRO B 1 85  ? 4.790   37.547   106.915 1.00 14.73 ? 167 PRO B CG  1 
ATOM   3611  C CD  . PRO B 1 85  ? 6.055   38.333   106.637 1.00 15.57 ? 167 PRO B CD  1 
ATOM   3612  N N   . SER B 1 86  ? 2.590   41.349   106.156 1.00 14.53 ? 168 SER B N   1 
ATOM   3613  C CA  . SER B 1 86  ? 1.676   42.219   106.873 1.00 16.60 ? 168 SER B CA  1 
ATOM   3614  C C   . SER B 1 86  ? 0.369   42.427   106.102 1.00 17.52 ? 168 SER B C   1 
ATOM   3615  O O   . SER B 1 86  ? 0.297   42.176   104.897 1.00 19.03 ? 168 SER B O   1 
ATOM   3616  C CB  . SER B 1 86  ? 2.351   43.568   107.097 1.00 17.04 ? 168 SER B CB  1 
ATOM   3617  O OG  . SER B 1 86  ? 1.409   44.548   107.473 1.00 19.65 ? 168 SER B OG  1 
ATOM   3618  N N   . PRO B 1 87  ? -0.690  42.877   106.792 1.00 17.13 ? 169 PRO B N   1 
ATOM   3619  C CA  . PRO B 1 87  ? -1.953  43.096   106.084 1.00 16.64 ? 169 PRO B CA  1 
ATOM   3620  C C   . PRO B 1 87  ? -1.832  44.308   105.177 1.00 16.16 ? 169 PRO B C   1 
ATOM   3621  O O   . PRO B 1 87  ? -2.668  44.540   104.312 1.00 17.79 ? 169 PRO B O   1 
ATOM   3622  C CB  . PRO B 1 87  ? -2.947  43.318   107.216 1.00 17.15 ? 169 PRO B CB  1 
ATOM   3623  C CG  . PRO B 1 87  ? -2.090  43.925   108.302 1.00 16.99 ? 169 PRO B CG  1 
ATOM   3624  C CD  . PRO B 1 87  ? -0.859  43.062   108.244 1.00 16.45 ? 169 PRO B CD  1 
ATOM   3625  N N   . TYR B 1 88  A -0.761  45.062   105.385 1.00 16.61 ? 169 TYR B N   1 
ATOM   3626  C CA  . TYR B 1 88  A -0.483  46.276   104.633 1.00 14.41 ? 169 TYR B CA  1 
ATOM   3627  C C   . TYR B 1 88  A 0.335   46.012   103.375 1.00 14.22 ? 169 TYR B C   1 
ATOM   3628  O O   . TYR B 1 88  A 0.482   46.900   102.533 1.00 12.23 ? 169 TYR B O   1 
ATOM   3629  C CB  . TYR B 1 88  A 0.254   47.267   105.540 1.00 13.64 ? 169 TYR B CB  1 
ATOM   3630  C CG  . TYR B 1 88  A -0.371  47.386   106.921 1.00 13.82 ? 169 TYR B CG  1 
ATOM   3631  C CD1 . TYR B 1 88  A 0.418   47.624   108.049 1.00 12.89 ? 169 TYR B CD1 1 
ATOM   3632  C CD2 . TYR B 1 88  A -1.756  47.259   107.096 1.00 11.64 ? 169 TYR B CD2 1 
ATOM   3633  C CE1 . TYR B 1 88  A -0.151  47.729   109.314 1.00 12.70 ? 169 TYR B CE1 1 
ATOM   3634  C CE2 . TYR B 1 88  A -2.334  47.365   108.348 1.00 11.91 ? 169 TYR B CE2 1 
ATOM   3635  C CZ  . TYR B 1 88  A -1.527  47.598   109.456 1.00 12.56 ? 169 TYR B CZ  1 
ATOM   3636  O OH  . TYR B 1 88  A -2.093  47.685   110.702 1.00 12.65 ? 169 TYR B OH  1 
ATOM   3637  N N   . ASN B 1 89  ? 0.862   44.798   103.230 1.00 14.17 ? 170 ASN B N   1 
ATOM   3638  C CA  . ASN B 1 89  ? 1.654   44.492   102.039 1.00 13.85 ? 170 ASN B CA  1 
ATOM   3639  C C   . ASN B 1 89  ? 1.352   43.133   101.430 1.00 13.47 ? 170 ASN B C   1 
ATOM   3640  O O   . ASN B 1 89  ? 1.937   42.776   100.411 1.00 13.08 ? 170 ASN B O   1 
ATOM   3641  C CB  . ASN B 1 89  ? 3.145   44.567   102.356 1.00 13.62 ? 170 ASN B CB  1 
ATOM   3642  C CG  . ASN B 1 89  ? 3.617   43.387   103.176 1.00 15.82 ? 170 ASN B CG  1 
ATOM   3643  O OD1 . ASN B 1 89  ? 2.852   42.814   103.953 1.00 14.57 ? 170 ASN B OD1 1 
ATOM   3644  N ND2 . ASN B 1 89  ? 4.883   43.023   103.019 1.00 15.60 ? 170 ASN B ND2 1 
ATOM   3645  N N   . SER B 1 90  ? 0.442   42.379   102.039 1.00 13.14 ? 171 SER B N   1 
ATOM   3646  C CA  . SER B 1 90  ? 0.106   41.055   101.521 1.00 13.34 ? 171 SER B CA  1 
ATOM   3647  C C   . SER B 1 90  ? -1.114  40.999   100.610 1.00 13.68 ? 171 SER B C   1 
ATOM   3648  O O   . SER B 1 90  ? -2.137  41.618   100.876 1.00 13.77 ? 171 SER B O   1 
ATOM   3649  C CB  . SER B 1 90  ? -0.100  40.066   102.667 1.00 12.96 ? 171 SER B CB  1 
ATOM   3650  O OG  . SER B 1 90  ? 1.083   39.896   103.422 1.00 12.80 ? 171 SER B OG  1 
ATOM   3651  N N   . ARG B 1 91  ? -0.985  40.247   99.525  1.00 13.56 ? 172 ARG B N   1 
ATOM   3652  C CA  . ARG B 1 91  ? -2.072  40.072   98.580  1.00 13.59 ? 172 ARG B CA  1 
ATOM   3653  C C   . ARG B 1 91  ? -2.836  38.820   98.991  1.00 12.17 ? 172 ARG B C   1 
ATOM   3654  O O   . ARG B 1 91  ? -2.222  37.807   99.321  1.00 14.20 ? 172 ARG B O   1 
ATOM   3655  C CB  . ARG B 1 91  ? -1.523  39.879   97.169  1.00 15.47 ? 172 ARG B CB  1 
ATOM   3656  C CG  . ARG B 1 91  ? -2.594  39.539   96.168  1.00 20.28 ? 172 ARG B CG  1 
ATOM   3657  C CD  . ARG B 1 91  ? -2.020  38.817   94.978  1.00 26.63 ? 172 ARG B CD  1 
ATOM   3658  N NE  . ARG B 1 91  ? -1.091  39.651   94.223  1.00 29.87 ? 172 ARG B NE  1 
ATOM   3659  C CZ  . ARG B 1 91  ? -0.293  39.178   93.269  1.00 32.49 ? 172 ARG B CZ  1 
ATOM   3660  N NH1 . ARG B 1 91  ? 0.528   40.007   92.624  1.00 32.95 ? 172 ARG B NH1 1 
ATOM   3661  N NH2 . ARG B 1 91  ? -0.310  37.875   92.973  1.00 30.66 ? 172 ARG B NH2 1 
ATOM   3662  N N   . PHE B 1 92  ? -4.162  38.886   98.985  1.00 9.50  ? 173 PHE B N   1 
ATOM   3663  C CA  . PHE B 1 92  ? -4.951  37.726   99.352  1.00 10.49 ? 173 PHE B CA  1 
ATOM   3664  C C   . PHE B 1 92  ? -4.967  36.750   98.183  1.00 11.69 ? 173 PHE B C   1 
ATOM   3665  O O   . PHE B 1 92  ? -5.128  37.157   97.039  1.00 12.67 ? 173 PHE B O   1 
ATOM   3666  C CB  . PHE B 1 92  ? -6.388  38.116   99.690  1.00 11.53 ? 173 PHE B CB  1 
ATOM   3667  C CG  . PHE B 1 92  ? -7.240  36.945   100.060 1.00 11.35 ? 173 PHE B CG  1 
ATOM   3668  C CD1 . PHE B 1 92  ? -7.157  36.384   101.329 1.00 11.30 ? 173 PHE B CD1 1 
ATOM   3669  C CD2 . PHE B 1 92  ? -8.058  36.344   99.119  1.00 9.40  ? 173 PHE B CD2 1 
ATOM   3670  C CE1 . PHE B 1 92  ? -7.876  35.235   101.646 1.00 11.20 ? 173 PHE B CE1 1 
ATOM   3671  C CE2 . PHE B 1 92  ? -8.773  35.203   99.431  1.00 10.36 ? 173 PHE B CE2 1 
ATOM   3672  C CZ  . PHE B 1 92  ? -8.682  34.645   100.697 1.00 8.25  ? 173 PHE B CZ  1 
ATOM   3673  N N   . GLU B 1 93  ? -4.813  35.462   98.473  1.00 12.81 ? 174 GLU B N   1 
ATOM   3674  C CA  . GLU B 1 93  ? -4.793  34.441   97.432  1.00 13.94 ? 174 GLU B CA  1 
ATOM   3675  C C   . GLU B 1 93  ? -5.952  33.454   97.558  1.00 15.40 ? 174 GLU B C   1 
ATOM   3676  O O   . GLU B 1 93  ? -6.697  33.227   96.601  1.00 16.60 ? 174 GLU B O   1 
ATOM   3677  C CB  . GLU B 1 93  ? -3.469  33.669   97.474  1.00 13.65 ? 174 GLU B CB  1 
ATOM   3678  C CG  . GLU B 1 93  ? -2.213  34.537   97.377  1.00 14.14 ? 174 GLU B CG  1 
ATOM   3679  C CD  . GLU B 1 93  ? -1.962  35.059   95.976  1.00 15.16 ? 174 GLU B CD  1 
ATOM   3680  O OE1 . GLU B 1 93  ? -1.073  35.921   95.805  1.00 14.26 ? 174 GLU B OE1 1 
ATOM   3681  O OE2 . GLU B 1 93  ? -2.654  34.597   95.040  1.00 17.23 ? 174 GLU B OE2 1 
ATOM   3682  N N   . SER B 1 94  ? -6.118  32.873   98.742  1.00 16.07 ? 175 SER B N   1 
ATOM   3683  C CA  . SER B 1 94  ? -7.178  31.899   98.923  1.00 16.26 ? 175 SER B CA  1 
ATOM   3684  C C   . SER B 1 94  ? -7.335  31.455   100.372 1.00 16.21 ? 175 SER B C   1 
ATOM   3685  O O   . SER B 1 94  ? -6.430  31.642   101.186 1.00 17.31 ? 175 SER B O   1 
ATOM   3686  C CB  . SER B 1 94  ? -6.861  30.689   98.048  1.00 17.44 ? 175 SER B CB  1 
ATOM   3687  O OG  . SER B 1 94  ? -7.925  29.764   98.043  1.00 24.16 ? 175 SER B OG  1 
ATOM   3688  N N   . VAL B 1 95  ? -8.488  30.875   100.699 1.00 14.42 ? 176 VAL B N   1 
ATOM   3689  C CA  . VAL B 1 95  ? -8.706  30.372   102.045 1.00 14.33 ? 176 VAL B CA  1 
ATOM   3690  C C   . VAL B 1 95  ? -8.065  28.986   102.058 1.00 15.06 ? 176 VAL B C   1 
ATOM   3691  O O   . VAL B 1 95  ? -8.401  28.142   101.224 1.00 14.59 ? 176 VAL B O   1 
ATOM   3692  C CB  . VAL B 1 95  ? -10.188 30.256   102.358 1.00 13.81 ? 176 VAL B CB  1 
ATOM   3693  C CG1 . VAL B 1 95  ? -10.378 29.608   103.711 1.00 13.11 ? 176 VAL B CG1 1 
ATOM   3694  C CG2 . VAL B 1 95  ? -10.816 31.633   102.337 1.00 13.91 ? 176 VAL B CG2 1 
ATOM   3695  N N   . ALA B 1 96  ? -7.147  28.737   102.991 1.00 13.99 ? 177 ALA B N   1 
ATOM   3696  C CA  . ALA B 1 96  ? -6.479  27.447   102.990 1.00 13.34 ? 177 ALA B CA  1 
ATOM   3697  C C   . ALA B 1 96  ? -5.613  27.129   104.206 1.00 14.22 ? 177 ALA B C   1 
ATOM   3698  O O   . ALA B 1 96  ? -5.084  28.030   104.861 1.00 12.52 ? 177 ALA B O   1 
ATOM   3699  C CB  . ALA B 1 96  ? -5.630  27.346   101.736 1.00 11.78 ? 177 ALA B CB  1 
ATOM   3700  N N   . TRP B 1 97  ? -5.480  25.834   104.498 1.00 14.16 ? 178 TRP B N   1 
ATOM   3701  C CA  . TRP B 1 97  ? -4.637  25.378   105.596 1.00 15.11 ? 178 TRP B CA  1 
ATOM   3702  C C   . TRP B 1 97  ? -3.552  24.445   105.050 1.00 17.36 ? 178 TRP B C   1 
ATOM   3703  O O   . TRP B 1 97  ? -2.846  23.764   105.802 1.00 19.13 ? 178 TRP B O   1 
ATOM   3704  C CB  . TRP B 1 97  ? -5.447  24.701   106.723 1.00 15.07 ? 178 TRP B CB  1 
ATOM   3705  C CG  . TRP B 1 97  ? -6.601  23.792   106.345 1.00 15.42 ? 178 TRP B CG  1 
ATOM   3706  C CD1 . TRP B 1 97  ? -7.931  24.045   106.531 1.00 15.02 ? 178 TRP B CD1 1 
ATOM   3707  C CD2 . TRP B 1 97  ? -6.521  22.456   105.820 1.00 15.80 ? 178 TRP B CD2 1 
ATOM   3708  N NE1 . TRP B 1 97  ? -8.685  22.952   106.165 1.00 16.44 ? 178 TRP B NE1 1 
ATOM   3709  C CE2 . TRP B 1 97  ? -7.846  21.963   105.724 1.00 16.54 ? 178 TRP B CE2 1 
ATOM   3710  C CE3 . TRP B 1 97  ? -5.461  21.629   105.424 1.00 15.83 ? 178 TRP B CE3 1 
ATOM   3711  C CZ2 . TRP B 1 97  ? -8.137  20.678   105.249 1.00 14.53 ? 178 TRP B CZ2 1 
ATOM   3712  C CZ3 . TRP B 1 97  ? -5.754  20.348   104.950 1.00 16.69 ? 178 TRP B CZ3 1 
ATOM   3713  C CH2 . TRP B 1 97  ? -7.084  19.890   104.868 1.00 15.02 ? 178 TRP B CH2 1 
ATOM   3714  N N   . SER B 1 98  ? -3.433  24.444   103.722 1.00 17.14 ? 179 SER B N   1 
ATOM   3715  C CA  . SER B 1 98  ? -2.436  23.669   102.975 1.00 17.48 ? 179 SER B CA  1 
ATOM   3716  C C   . SER B 1 98  ? -2.501  24.224   101.548 1.00 16.86 ? 179 SER B C   1 
ATOM   3717  O O   . SER B 1 98  ? -3.584  24.349   100.985 1.00 17.17 ? 179 SER B O   1 
ATOM   3718  C CB  . SER B 1 98  ? -2.772  22.171   102.978 1.00 17.85 ? 179 SER B CB  1 
ATOM   3719  O OG  . SER B 1 98  ? -1.752  21.424   102.330 1.00 17.03 ? 179 SER B OG  1 
ATOM   3720  N N   . ALA B 1 99  ? -1.361  24.567   100.957 1.00 16.28 ? 180 ALA B N   1 
ATOM   3721  C CA  . ALA B 1 99  ? -1.394  25.146   99.616  1.00 16.56 ? 180 ALA B CA  1 
ATOM   3722  C C   . ALA B 1 99  ? -0.176  24.921   98.735  1.00 16.99 ? 180 ALA B C   1 
ATOM   3723  O O   . ALA B 1 99  ? 0.819   24.320   99.150  1.00 17.66 ? 180 ALA B O   1 
ATOM   3724  C CB  . ALA B 1 99  ? -1.665  26.645   99.714  1.00 14.08 ? 180 ALA B CB  1 
ATOM   3725  N N   . SER B 1 100 ? -0.292  25.412   97.503  1.00 17.60 ? 181 SER B N   1 
ATOM   3726  C CA  . SER B 1 100 ? 0.765   25.347   96.498  1.00 18.08 ? 181 SER B CA  1 
ATOM   3727  C C   . SER B 1 100 ? 0.506   26.486   95.515  1.00 18.00 ? 181 SER B C   1 
ATOM   3728  O O   . SER B 1 100 ? -0.561  27.094   95.551  1.00 17.75 ? 181 SER B O   1 
ATOM   3729  C CB  . SER B 1 100 ? 0.728   24.006   95.754  1.00 19.19 ? 181 SER B CB  1 
ATOM   3730  O OG  . SER B 1 100 ? 1.795   23.918   94.822  1.00 18.61 ? 181 SER B OG  1 
ATOM   3731  N N   . ALA B 1 101 ? 1.473   26.779   94.647  1.00 18.40 ? 182 ALA B N   1 
ATOM   3732  C CA  . ALA B 1 101 ? 1.310   27.847   93.655  1.00 17.31 ? 182 ALA B CA  1 
ATOM   3733  C C   . ALA B 1 101 ? 2.491   27.940   92.694  1.00 16.25 ? 182 ALA B C   1 
ATOM   3734  O O   . ALA B 1 101 ? 3.616   27.611   93.056  1.00 16.25 ? 182 ALA B O   1 
ATOM   3735  C CB  . ALA B 1 101 ? 1.110   29.195   94.358  1.00 17.80 ? 182 ALA B CB  1 
ATOM   3736  N N   . CYS B 1 102 ? 2.215   28.385   91.472  1.00 14.72 ? 183 CYS B N   1 
ATOM   3737  C CA  . CYS B 1 102 ? 3.230   28.555   90.438  1.00 15.05 ? 183 CYS B CA  1 
ATOM   3738  C C   . CYS B 1 102 ? 2.755   29.493   89.316  1.00 15.51 ? 183 CYS B C   1 
ATOM   3739  O O   . CYS B 1 102 ? 1.555   29.730   89.156  1.00 15.47 ? 183 CYS B O   1 
ATOM   3740  C CB  . CYS B 1 102 ? 3.640   27.197   89.855  1.00 15.41 ? 183 CYS B CB  1 
ATOM   3741  S SG  . CYS B 1 102 ? 2.264   26.040   89.596  1.00 18.84 ? 183 CYS B SG  1 
ATOM   3742  N N   . HIS B 1 103 ? 3.714   30.028   88.559  1.00 15.69 ? 184 HIS B N   1 
ATOM   3743  C CA  . HIS B 1 103 ? 3.460   30.941   87.435  1.00 16.53 ? 184 HIS B CA  1 
ATOM   3744  C C   . HIS B 1 103 ? 3.905   30.247   86.128  1.00 16.14 ? 184 HIS B C   1 
ATOM   3745  O O   . HIS B 1 103 ? 5.058   29.821   86.015  1.00 16.70 ? 184 HIS B O   1 
ATOM   3746  C CB  . HIS B 1 103 ? 4.262   32.242   87.641  1.00 16.41 ? 184 HIS B CB  1 
ATOM   3747  C CG  . HIS B 1 103 ? 3.815   33.379   86.776  1.00 16.75 ? 184 HIS B CG  1 
ATOM   3748  N ND1 . HIS B 1 103 ? 2.912   34.337   87.205  1.00 15.75 ? 184 HIS B ND1 1 
ATOM   3749  C CD2 . HIS B 1 103 ? 4.119   33.706   85.498  1.00 14.89 ? 184 HIS B CD2 1 
ATOM   3750  C CE1 . HIS B 1 103 ? 2.688   35.194   86.231  1.00 15.43 ? 184 HIS B CE1 1 
ATOM   3751  N NE2 . HIS B 1 103 ? 3.409   34.834   85.180  1.00 14.51 ? 184 HIS B NE2 1 
ATOM   3752  N N   . ASP B 1 104 ? 3.003   30.135   85.150  1.00 16.10 ? 185 ASP B N   1 
ATOM   3753  C CA  . ASP B 1 104 ? 3.328   29.469   83.880  1.00 14.57 ? 185 ASP B CA  1 
ATOM   3754  C C   . ASP B 1 104 ? 3.905   30.383   82.802  1.00 15.59 ? 185 ASP B C   1 
ATOM   3755  O O   . ASP B 1 104 ? 4.122   29.948   81.662  1.00 17.64 ? 185 ASP B O   1 
ATOM   3756  C CB  . ASP B 1 104 ? 2.101   28.727   83.309  1.00 12.29 ? 185 ASP B CB  1 
ATOM   3757  C CG  . ASP B 1 104 ? 0.947   29.658   82.939  1.00 14.16 ? 185 ASP B CG  1 
ATOM   3758  O OD1 . ASP B 1 104 ? 1.089   30.892   83.021  1.00 13.49 ? 185 ASP B OD1 1 
ATOM   3759  O OD2 . ASP B 1 104 ? -0.122  29.152   82.551  1.00 13.79 ? 185 ASP B OD2 1 
ATOM   3760  N N   . GLY B 1 105 ? 4.174   31.636   83.160  1.00 15.03 ? 186 GLY B N   1 
ATOM   3761  C CA  . GLY B 1 105 ? 4.718   32.578   82.198  1.00 14.13 ? 186 GLY B CA  1 
ATOM   3762  C C   . GLY B 1 105 ? 3.671   33.615   81.863  1.00 15.60 ? 186 GLY B C   1 
ATOM   3763  O O   . GLY B 1 105 ? 3.989   34.751   81.515  1.00 17.90 ? 186 GLY B O   1 
ATOM   3764  N N   . THR B 1 106 ? 2.408   33.220   81.976  1.00 15.68 ? 187 THR B N   1 
ATOM   3765  C CA  . THR B 1 106 ? 1.298   34.111   81.691  1.00 15.38 ? 187 THR B CA  1 
ATOM   3766  C C   . THR B 1 106 ? 0.665   34.596   82.987  1.00 16.76 ? 187 THR B C   1 
ATOM   3767  O O   . THR B 1 106 ? 0.732   35.779   83.310  1.00 18.22 ? 187 THR B O   1 
ATOM   3768  C CB  . THR B 1 106 ? 0.214   33.403   80.821  1.00 15.99 ? 187 THR B CB  1 
ATOM   3769  O OG1 . THR B 1 106 ? 0.748   33.126   79.520  1.00 15.94 ? 187 THR B OG1 1 
ATOM   3770  C CG2 . THR B 1 106 ? -1.026  34.278   80.674  1.00 14.60 ? 187 THR B CG2 1 
ATOM   3771  N N   . SER B 1 107 ? 0.064   33.678   83.737  1.00 16.73 ? 188 SER B N   1 
ATOM   3772  C CA  . SER B 1 107 ? -0.598  34.039   84.983  1.00 16.17 ? 188 SER B CA  1 
ATOM   3773  C C   . SER B 1 107 ? -0.258  33.103   86.124  1.00 14.89 ? 188 SER B C   1 
ATOM   3774  O O   . SER B 1 107 ? 0.263   32.010   85.903  1.00 16.17 ? 188 SER B O   1 
ATOM   3775  C CB  . SER B 1 107 ? -2.117  34.056   84.798  1.00 16.04 ? 188 SER B CB  1 
ATOM   3776  O OG  . SER B 1 107 ? -2.604  32.767   84.464  1.00 20.00 ? 188 SER B OG  1 
ATOM   3777  N N   . TRP B 1 108 ? -0.567  33.541   87.343  1.00 14.47 ? 189 TRP B N   1 
ATOM   3778  C CA  . TRP B 1 108 ? -0.331  32.754   88.558  1.00 14.02 ? 189 TRP B CA  1 
ATOM   3779  C C   . TRP B 1 108 ? -1.392  31.680   88.787  1.00 13.63 ? 189 TRP B C   1 
ATOM   3780  O O   . TRP B 1 108 ? -2.571  31.906   88.554  1.00 14.02 ? 189 TRP B O   1 
ATOM   3781  C CB  . TRP B 1 108 ? -0.342  33.649   89.799  1.00 13.12 ? 189 TRP B CB  1 
ATOM   3782  C CG  . TRP B 1 108 ? 0.941   34.349   90.104  1.00 14.28 ? 189 TRP B CG  1 
ATOM   3783  C CD1 . TRP B 1 108 ? 1.206   35.676   89.935  1.00 13.13 ? 189 TRP B CD1 1 
ATOM   3784  C CD2 . TRP B 1 108 ? 2.127   33.768   90.658  1.00 13.54 ? 189 TRP B CD2 1 
ATOM   3785  N NE1 . TRP B 1 108 ? 2.479   35.960   90.352  1.00 15.20 ? 189 TRP B NE1 1 
ATOM   3786  C CE2 . TRP B 1 108 ? 3.070   34.810   90.802  1.00 14.89 ? 189 TRP B CE2 1 
ATOM   3787  C CE3 . TRP B 1 108 ? 2.483   32.472   91.050  1.00 13.85 ? 189 TRP B CE3 1 
ATOM   3788  C CZ2 . TRP B 1 108 ? 4.357   34.595   91.318  1.00 15.16 ? 189 TRP B CZ2 1 
ATOM   3789  C CZ3 . TRP B 1 108 ? 3.764   32.255   91.565  1.00 15.00 ? 189 TRP B CZ3 1 
ATOM   3790  C CH2 . TRP B 1 108 ? 4.683   33.313   91.695  1.00 15.62 ? 189 TRP B CH2 1 
ATOM   3791  N N   . LEU B 1 109 ? -0.968  30.514   89.255  1.00 13.64 ? 190 LEU B N   1 
ATOM   3792  C CA  . LEU B 1 109 ? -1.894  29.437   89.575  1.00 13.47 ? 190 LEU B CA  1 
ATOM   3793  C C   . LEU B 1 109 ? -1.727  29.194   91.068  1.00 13.35 ? 190 LEU B C   1 
ATOM   3794  O O   . LEU B 1 109 ? -0.626  28.905   91.522  1.00 14.15 ? 190 LEU B O   1 
ATOM   3795  C CB  . LEU B 1 109 ? -1.541  28.154   88.814  1.00 14.37 ? 190 LEU B CB  1 
ATOM   3796  C CG  . LEU B 1 109 ? -2.126  26.864   89.429  1.00 15.40 ? 190 LEU B CG  1 
ATOM   3797  C CD1 . LEU B 1 109 ? -3.633  26.801   89.163  1.00 12.20 ? 190 LEU B CD1 1 
ATOM   3798  C CD2 . LEU B 1 109 ? -1.421  25.634   88.862  1.00 10.50 ? 190 LEU B CD2 1 
ATOM   3799  N N   . THR B 1 110 ? -2.798  29.331   91.838  1.00 12.73 ? 191 THR B N   1 
ATOM   3800  C CA  . THR B 1 110 ? -2.705  29.099   93.279  1.00 11.88 ? 191 THR B CA  1 
ATOM   3801  C C   . THR B 1 110 ? -3.608  27.949   93.685  1.00 12.18 ? 191 THR B C   1 
ATOM   3802  O O   . THR B 1 110 ? -4.734  27.820   93.196  1.00 11.62 ? 191 THR B O   1 
ATOM   3803  C CB  . THR B 1 110 ? -3.106  30.348   94.098  1.00 11.09 ? 191 THR B CB  1 
ATOM   3804  O OG1 . THR B 1 110 ? -4.422  30.770   93.719  1.00 12.20 ? 191 THR B OG1 1 
ATOM   3805  C CG2 . THR B 1 110 ? -2.117  31.481   93.869  1.00 9.03  ? 191 THR B CG2 1 
ATOM   3806  N N   . ILE B 1 111 ? -3.111  27.104   94.574  1.00 12.72 ? 192 ILE B N   1 
ATOM   3807  C CA  . ILE B 1 111 ? -3.899  25.971   95.036  1.00 13.13 ? 192 ILE B CA  1 
ATOM   3808  C C   . ILE B 1 111 ? -4.079  26.059   96.546  1.00 13.37 ? 192 ILE B C   1 
ATOM   3809  O O   . ILE B 1 111 ? -3.115  25.949   97.302  1.00 13.33 ? 192 ILE B O   1 
ATOM   3810  C CB  . ILE B 1 111 ? -3.223  24.627   94.675  1.00 13.02 ? 192 ILE B CB  1 
ATOM   3811  C CG1 . ILE B 1 111 ? -2.953  24.558   93.168  1.00 13.23 ? 192 ILE B CG1 1 
ATOM   3812  C CG2 . ILE B 1 111 ? -4.124  23.478   95.076  1.00 12.41 ? 192 ILE B CG2 1 
ATOM   3813  C CD1 . ILE B 1 111 ? -2.135  23.352   92.746  1.00 11.75 ? 192 ILE B CD1 1 
ATOM   3814  N N   . GLY B 1 112 ? -5.321  26.277   96.972  1.00 13.73 ? 193 GLY B N   1 
ATOM   3815  C CA  . GLY B 1 112 ? -5.624  26.375   98.390  1.00 12.52 ? 193 GLY B CA  1 
ATOM   3816  C C   . GLY B 1 112 ? -6.636  25.334   98.820  1.00 12.88 ? 193 GLY B C   1 
ATOM   3817  O O   . GLY B 1 112 ? -7.669  25.143   98.174  1.00 12.51 ? 193 GLY B O   1 
ATOM   3818  N N   . ILE B 1 113 ? -6.340  24.660   99.923  1.00 13.70 ? 194 ILE B N   1 
ATOM   3819  C CA  . ILE B 1 113 ? -7.209  23.616   100.440 1.00 13.91 ? 194 ILE B CA  1 
ATOM   3820  C C   . ILE B 1 113 ? -7.853  24.030   101.749 1.00 14.60 ? 194 ILE B C   1 
ATOM   3821  O O   . ILE B 1 113 ? -7.170  24.461   102.674 1.00 15.86 ? 194 ILE B O   1 
ATOM   3822  C CB  . ILE B 1 113 ? -6.423  22.326   100.714 1.00 14.72 ? 194 ILE B CB  1 
ATOM   3823  C CG1 . ILE B 1 113 ? -5.711  21.855   99.451  1.00 13.45 ? 194 ILE B CG1 1 
ATOM   3824  C CG2 . ILE B 1 113 ? -7.370  21.242   101.247 1.00 14.89 ? 194 ILE B CG2 1 
ATOM   3825  C CD1 . ILE B 1 113 ? -4.811  20.642   99.705  1.00 14.88 ? 194 ILE B CD1 1 
ATOM   3826  N N   . SER B 1 114 ? -9.169  23.869   101.832 1.00 14.75 ? 195 SER B N   1 
ATOM   3827  C CA  . SER B 1 114 ? -9.906  24.213   103.038 1.00 13.63 ? 195 SER B CA  1 
ATOM   3828  C C   . SER B 1 114 ? -11.013 23.180   103.268 1.00 13.88 ? 195 SER B C   1 
ATOM   3829  O O   . SER B 1 114 ? -11.176 22.249   102.477 1.00 13.79 ? 195 SER B O   1 
ATOM   3830  C CB  . SER B 1 114 ? -10.501 25.616   102.896 1.00 11.90 ? 195 SER B CB  1 
ATOM   3831  O OG  . SER B 1 114 ? -10.939 26.112   104.148 1.00 13.03 ? 195 SER B OG  1 
ATOM   3832  N N   . GLY B 1 115 ? -11.773 23.342   104.346 1.00 14.08 ? 196 GLY B N   1 
ATOM   3833  C CA  . GLY B 1 115 ? -12.840 22.401   104.625 1.00 13.71 ? 196 GLY B CA  1 
ATOM   3834  C C   . GLY B 1 115 ? -12.483 21.484   105.774 1.00 14.36 ? 196 GLY B C   1 
ATOM   3835  O O   . GLY B 1 115 ? -11.401 21.608   106.348 1.00 15.95 ? 196 GLY B O   1 
ATOM   3836  N N   . PRO B 1 116 ? -13.369 20.542   106.127 1.00 13.84 ? 197 PRO B N   1 
ATOM   3837  C CA  . PRO B 1 116 ? -13.153 19.594   107.223 1.00 13.77 ? 197 PRO B CA  1 
ATOM   3838  C C   . PRO B 1 116 ? -12.225 18.451   106.833 1.00 15.40 ? 197 PRO B C   1 
ATOM   3839  O O   . PRO B 1 116 ? -12.031 18.169   105.647 1.00 15.09 ? 197 PRO B O   1 
ATOM   3840  C CB  . PRO B 1 116 ? -14.562 19.116   107.533 1.00 12.83 ? 197 PRO B CB  1 
ATOM   3841  C CG  . PRO B 1 116 ? -15.151 19.018   106.153 1.00 13.81 ? 197 PRO B CG  1 
ATOM   3842  C CD  . PRO B 1 116 ? -14.656 20.283   105.453 1.00 13.21 ? 197 PRO B CD  1 
ATOM   3843  N N   . ASP B 1 117 ? -11.676 17.773   107.834 1.00 16.50 ? 198 ASP B N   1 
ATOM   3844  C CA  . ASP B 1 117 ? -10.754 16.676   107.568 1.00 18.16 ? 198 ASP B CA  1 
ATOM   3845  C C   . ASP B 1 117 ? -11.332 15.497   106.792 1.00 18.53 ? 198 ASP B C   1 
ATOM   3846  O O   . ASP B 1 117 ? -10.590 14.780   106.128 1.00 19.04 ? 198 ASP B O   1 
ATOM   3847  C CB  . ASP B 1 117 ? -10.134 16.176   108.875 1.00 17.40 ? 198 ASP B CB  1 
ATOM   3848  C CG  . ASP B 1 117 ? -9.242  17.214   109.525 1.00 19.84 ? 198 ASP B CG  1 
ATOM   3849  O OD1 . ASP B 1 117 ? -8.776  18.127   108.816 1.00 18.60 ? 198 ASP B OD1 1 
ATOM   3850  O OD2 . ASP B 1 117 ? -8.993  17.123   110.745 1.00 22.95 ? 198 ASP B OD2 1 
ATOM   3851  N N   . ASN B 1 118 ? -12.646 15.299   106.853 1.00 19.03 ? 199 ASN B N   1 
ATOM   3852  C CA  . ASN B 1 118 ? -13.251 14.176   106.147 1.00 20.47 ? 199 ASN B CA  1 
ATOM   3853  C C   . ASN B 1 118 ? -13.744 14.480   104.728 1.00 21.28 ? 199 ASN B C   1 
ATOM   3854  O O   . ASN B 1 118 ? -14.312 13.610   104.067 1.00 21.25 ? 199 ASN B O   1 
ATOM   3855  C CB  . ASN B 1 118 ? -14.399 13.595   106.970 1.00 20.39 ? 199 ASN B CB  1 
ATOM   3856  C CG  . ASN B 1 118 ? -15.435 14.625   107.318 1.00 21.10 ? 199 ASN B CG  1 
ATOM   3857  O OD1 . ASN B 1 118 ? -15.876 15.380   106.460 1.00 22.43 ? 199 ASN B OD1 1 
ATOM   3858  N ND2 . ASN B 1 118 ? -15.834 14.665   108.580 1.00 22.66 ? 199 ASN B ND2 1 
ATOM   3859  N N   . GLY B 1 119 ? -13.524 15.706   104.258 1.00 22.53 ? 200 GLY B N   1 
ATOM   3860  C CA  . GLY B 1 119 ? -13.955 16.060   102.913 1.00 21.01 ? 200 GLY B CA  1 
ATOM   3861  C C   . GLY B 1 119 ? -13.374 17.356   102.367 1.00 20.76 ? 200 GLY B C   1 
ATOM   3862  O O   . GLY B 1 119 ? -14.049 18.068   101.630 1.00 19.72 ? 200 GLY B O   1 
ATOM   3863  N N   . ALA B 1 120 ? -12.124 17.661   102.713 1.00 20.95 ? 201 ALA B N   1 
ATOM   3864  C CA  . ALA B 1 120 ? -11.465 18.888   102.257 1.00 20.35 ? 201 ALA B CA  1 
ATOM   3865  C C   . ALA B 1 120 ? -11.481 19.050   100.737 1.00 21.05 ? 201 ALA B C   1 
ATOM   3866  O O   . ALA B 1 120 ? -11.458 18.071   99.994  1.00 20.56 ? 201 ALA B O   1 
ATOM   3867  C CB  . ALA B 1 120 ? -10.031 18.924   102.763 1.00 18.42 ? 201 ALA B CB  1 
ATOM   3868  N N   . VAL B 1 121 ? -11.517 20.299   100.279 1.00 21.33 ? 202 VAL B N   1 
ATOM   3869  C CA  . VAL B 1 121 ? -11.534 20.578   98.849  1.00 21.00 ? 202 VAL B CA  1 
ATOM   3870  C C   . VAL B 1 121 ? -10.447 21.558   98.420  1.00 20.06 ? 202 VAL B C   1 
ATOM   3871  O O   . VAL B 1 121 ? -10.181 22.555   99.096  1.00 18.40 ? 202 VAL B O   1 
ATOM   3872  C CB  . VAL B 1 121 ? -12.904 21.138   98.404  1.00 21.88 ? 202 VAL B CB  1 
ATOM   3873  C CG1 . VAL B 1 121 ? -13.388 22.151   99.409  1.00 25.04 ? 202 VAL B CG1 1 
ATOM   3874  C CG2 . VAL B 1 121 ? -12.782 21.807   97.025  1.00 20.99 ? 202 VAL B CG2 1 
ATOM   3875  N N   . ALA B 1 122 ? -9.825  21.248   97.285  1.00 18.31 ? 203 ALA B N   1 
ATOM   3876  C CA  . ALA B 1 122 ? -8.785  22.079   96.718  1.00 17.80 ? 203 ALA B CA  1 
ATOM   3877  C C   . ALA B 1 122 ? -9.417  23.009   95.697  1.00 18.21 ? 203 ALA B C   1 
ATOM   3878  O O   . ALA B 1 122 ? -10.034 22.568   94.723  1.00 19.24 ? 203 ALA B O   1 
ATOM   3879  C CB  . ALA B 1 122 ? -7.721  21.219   96.056  1.00 15.86 ? 203 ALA B CB  1 
ATOM   3880  N N   . VAL B 1 123 ? -9.281  24.303   95.946  1.00 18.63 ? 204 VAL B N   1 
ATOM   3881  C CA  . VAL B 1 123 ? -9.803  25.319   95.050  1.00 18.83 ? 204 VAL B CA  1 
ATOM   3882  C C   . VAL B 1 123 ? -8.627  25.804   94.207  1.00 19.08 ? 204 VAL B C   1 
ATOM   3883  O O   . VAL B 1 123 ? -7.630  26.266   94.753  1.00 18.23 ? 204 VAL B O   1 
ATOM   3884  C CB  . VAL B 1 123 ? -10.374 26.508   95.849  1.00 19.25 ? 204 VAL B CB  1 
ATOM   3885  C CG1 . VAL B 1 123 ? -10.817 27.615   94.909  1.00 17.10 ? 204 VAL B CG1 1 
ATOM   3886  C CG2 . VAL B 1 123 ? -11.531 26.033   96.724  1.00 18.34 ? 204 VAL B CG2 1 
ATOM   3887  N N   . LEU B 1 124 ? -8.730  25.670   92.887  1.00 18.97 ? 205 LEU B N   1 
ATOM   3888  C CA  . LEU B 1 124 ? -7.669  26.125   91.999  1.00 17.23 ? 205 LEU B CA  1 
ATOM   3889  C C   . LEU B 1 124 ? -8.055  27.468   91.418  1.00 16.61 ? 205 LEU B C   1 
ATOM   3890  O O   . LEU B 1 124 ? -9.194  27.666   90.995  1.00 16.08 ? 205 LEU B O   1 
ATOM   3891  C CB  . LEU B 1 124 ? -7.433  25.137   90.849  1.00 17.52 ? 205 LEU B CB  1 
ATOM   3892  C CG  . LEU B 1 124 ? -7.111  23.675   91.179  1.00 19.26 ? 205 LEU B CG  1 
ATOM   3893  C CD1 . LEU B 1 124 ? -6.423  23.050   89.975  1.00 19.41 ? 205 LEU B CD1 1 
ATOM   3894  C CD2 . LEU B 1 124 ? -6.207  23.571   92.388  1.00 18.91 ? 205 LEU B CD2 1 
ATOM   3895  N N   . LYS B 1 125 ? -7.101  28.392   91.406  1.00 16.40 ? 206 LYS B N   1 
ATOM   3896  C CA  . LYS B 1 125 ? -7.324  29.727   90.858  1.00 16.37 ? 206 LYS B CA  1 
ATOM   3897  C C   . LYS B 1 125 ? -6.274  30.082   89.810  1.00 16.13 ? 206 LYS B C   1 
ATOM   3898  O O   . LYS B 1 125 ? -5.105  29.730   89.933  1.00 16.57 ? 206 LYS B O   1 
ATOM   3899  C CB  . LYS B 1 125 ? -7.306  30.789   91.968  1.00 15.29 ? 206 LYS B CB  1 
ATOM   3900  C CG  . LYS B 1 125 ? -8.495  30.742   92.919  1.00 15.90 ? 206 LYS B CG  1 
ATOM   3901  C CD  . LYS B 1 125 ? -8.385  31.809   94.008  1.00 14.27 ? 206 LYS B CD  1 
ATOM   3902  C CE  . LYS B 1 125 ? -9.599  31.798   94.918  1.00 13.80 ? 206 LYS B CE  1 
ATOM   3903  N NZ  . LYS B 1 125 ? -9.458  32.791   96.008  1.00 13.88 ? 206 LYS B NZ  1 
ATOM   3904  N N   . TYR B 1 126 ? -6.710  30.774   88.767  1.00 15.77 ? 207 TYR B N   1 
ATOM   3905  C CA  . TYR B 1 126 ? -5.816  31.208   87.708  1.00 15.27 ? 207 TYR B CA  1 
ATOM   3906  C C   . TYR B 1 126 ? -6.025  32.720   87.578  1.00 15.65 ? 207 TYR B C   1 
ATOM   3907  O O   . TYR B 1 126 ? -7.098  33.181   87.204  1.00 16.15 ? 207 TYR B O   1 
ATOM   3908  C CB  . TYR B 1 126 ? -6.157  30.477   86.405  1.00 13.37 ? 207 TYR B CB  1 
ATOM   3909  C CG  . TYR B 1 126 ? -5.098  30.609   85.343  1.00 11.69 ? 207 TYR B CG  1 
ATOM   3910  C CD1 . TYR B 1 126 ? -5.297  31.422   84.227  1.00 9.84  ? 207 TYR B CD1 1 
ATOM   3911  C CD2 . TYR B 1 126 ? -3.885  29.927   85.457  1.00 10.95 ? 207 TYR B CD2 1 
ATOM   3912  C CE1 . TYR B 1 126 ? -4.317  31.551   83.247  1.00 7.99  ? 207 TYR B CE1 1 
ATOM   3913  C CE2 . TYR B 1 126 ? -2.896  30.052   84.488  1.00 8.36  ? 207 TYR B CE2 1 
ATOM   3914  C CZ  . TYR B 1 126 ? -3.116  30.865   83.387  1.00 9.10  ? 207 TYR B CZ  1 
ATOM   3915  O OH  . TYR B 1 126 ? -2.127  31.015   82.443  1.00 9.58  ? 207 TYR B OH  1 
ATOM   3916  N N   . ASN B 1 127 ? -4.996  33.486   87.916  1.00 17.03 ? 208 ASN B N   1 
ATOM   3917  C CA  . ASN B 1 127 ? -5.060  34.942   87.877  1.00 17.43 ? 208 ASN B CA  1 
ATOM   3918  C C   . ASN B 1 127 ? -6.152  35.443   88.820  1.00 16.10 ? 208 ASN B C   1 
ATOM   3919  O O   . ASN B 1 127 ? -6.870  36.373   88.493  1.00 15.33 ? 208 ASN B O   1 
ATOM   3920  C CB  . ASN B 1 127 ? -5.351  35.453   86.461  1.00 18.90 ? 208 ASN B CB  1 
ATOM   3921  C CG  . ASN B 1 127 ? -4.908  36.906   86.261  1.00 21.39 ? 208 ASN B CG  1 
ATOM   3922  O OD1 . ASN B 1 127 ? -5.011  37.735   87.167  1.00 20.28 ? 208 ASN B OD1 1 
ATOM   3923  N ND2 . ASN B 1 127 ? -4.414  37.214   85.066  1.00 23.91 ? 208 ASN B ND2 1 
ATOM   3924  N N   . GLY B 1 128 ? -6.293  34.808   89.979  1.00 17.16 ? 209 GLY B N   1 
ATOM   3925  C CA  . GLY B 1 128 ? -7.297  35.243   90.939  1.00 18.63 ? 209 GLY B CA  1 
ATOM   3926  C C   . GLY B 1 128 ? -8.703  34.666   90.827  1.00 19.15 ? 209 GLY B C   1 
ATOM   3927  O O   . GLY B 1 128 ? -9.469  34.718   91.792  1.00 20.42 ? 209 GLY B O   1 
ATOM   3928  N N   . ILE B 1 129 ? -9.056  34.118   89.670  1.00 18.57 ? 210 ILE B N   1 
ATOM   3929  C CA  . ILE B 1 129 ? -10.385 33.552   89.486  1.00 19.45 ? 210 ILE B CA  1 
ATOM   3930  C C   . ILE B 1 129 ? -10.398 32.013   89.530  1.00 17.40 ? 210 ILE B C   1 
ATOM   3931  O O   . ILE B 1 129 ? -9.627  31.350   88.842  1.00 17.25 ? 210 ILE B O   1 
ATOM   3932  C CB  . ILE B 1 129 ? -11.002 34.058   88.150  1.00 21.34 ? 210 ILE B CB  1 
ATOM   3933  C CG1 . ILE B 1 129 ? -10.205 33.504   86.973  1.00 25.14 ? 210 ILE B CG1 1 
ATOM   3934  C CG2 . ILE B 1 129 ? -10.969 35.598   88.113  1.00 20.86 ? 210 ILE B CG2 1 
ATOM   3935  C CD1 . ILE B 1 129 ? -10.245 34.371   85.715  1.00 30.48 ? 210 ILE B CD1 1 
ATOM   3936  N N   . ILE B 1 130 ? -11.279 31.458   90.358  1.00 16.25 ? 211 ILE B N   1 
ATOM   3937  C CA  . ILE B 1 130 ? -11.416 30.011   90.508  1.00 15.10 ? 211 ILE B CA  1 
ATOM   3938  C C   . ILE B 1 130 ? -11.622 29.313   89.160  1.00 15.20 ? 211 ILE B C   1 
ATOM   3939  O O   . ILE B 1 130 ? -12.596 29.593   88.463  1.00 14.67 ? 211 ILE B O   1 
ATOM   3940  C CB  . ILE B 1 130 ? -12.604 29.669   91.438  1.00 12.41 ? 211 ILE B CB  1 
ATOM   3941  C CG1 . ILE B 1 130 ? -12.267 30.082   92.870  1.00 10.30 ? 211 ILE B CG1 1 
ATOM   3942  C CG2 . ILE B 1 130 ? -12.932 28.187   91.349  1.00 11.00 ? 211 ILE B CG2 1 
ATOM   3943  C CD1 . ILE B 1 130 ? -13.348 29.786   93.877  1.00 8.95  ? 211 ILE B CD1 1 
ATOM   3944  N N   . THR B 1 131 ? -10.709 28.400   88.809  1.00 15.37 ? 212 THR B N   1 
ATOM   3945  C CA  . THR B 1 131 ? -10.780 27.658   87.541  1.00 13.57 ? 212 THR B CA  1 
ATOM   3946  C C   . THR B 1 131 ? -11.071 26.157   87.650  1.00 13.78 ? 212 THR B C   1 
ATOM   3947  O O   . THR B 1 131 ? -11.339 25.512   86.632  1.00 14.24 ? 212 THR B O   1 
ATOM   3948  C CB  . THR B 1 131 ? -9.485  27.804   86.731  1.00 12.74 ? 212 THR B CB  1 
ATOM   3949  O OG1 . THR B 1 131 ? -8.361  27.725   87.617  1.00 13.38 ? 212 THR B OG1 1 
ATOM   3950  C CG2 . THR B 1 131 ? -9.475  29.104   85.964  1.00 7.78  ? 212 THR B CG2 1 
ATOM   3951  N N   . ASP B 1 132 ? -10.996 25.597   88.856  1.00 13.49 ? 213 ASP B N   1 
ATOM   3952  C CA  . ASP B 1 132 ? -11.290 24.179   89.058  1.00 15.66 ? 213 ASP B CA  1 
ATOM   3953  C C   . ASP B 1 132 ? -11.386 23.832   90.532  1.00 15.68 ? 213 ASP B C   1 
ATOM   3954  O O   . ASP B 1 132 ? -11.158 24.674   91.391  1.00 16.07 ? 213 ASP B O   1 
ATOM   3955  C CB  . ASP B 1 132 ? -10.226 23.282   88.410  1.00 18.84 ? 213 ASP B CB  1 
ATOM   3956  C CG  . ASP B 1 132 ? -10.759 21.892   88.064  1.00 18.93 ? 213 ASP B CG  1 
ATOM   3957  O OD1 . ASP B 1 132 ? -11.848 21.527   88.542  1.00 19.42 ? 213 ASP B OD1 1 
ATOM   3958  O OD2 . ASP B 1 132 ? -10.089 21.160   87.312  1.00 20.27 ? 213 ASP B OD2 1 
ATOM   3959  N N   . THR B 1 133 ? -11.703 22.572   90.811  1.00 16.27 ? 214 THR B N   1 
ATOM   3960  C CA  . THR B 1 133 ? -11.861 22.079   92.174  1.00 16.54 ? 214 THR B CA  1 
ATOM   3961  C C   . THR B 1 133 ? -11.527 20.597   92.261  1.00 16.02 ? 214 THR B C   1 
ATOM   3962  O O   . THR B 1 133 ? -11.780 19.850   91.322  1.00 16.30 ? 214 THR B O   1 
ATOM   3963  C CB  . THR B 1 133 ? -13.305 22.272   92.642  1.00 17.61 ? 214 THR B CB  1 
ATOM   3964  O OG1 . THR B 1 133 ? -13.493 23.626   93.069  1.00 18.59 ? 214 THR B OG1 1 
ATOM   3965  C CG2 . THR B 1 133 ? -13.635 21.320   93.756  1.00 18.08 ? 214 THR B CG2 1 
ATOM   3966  N N   . ILE B 1 134 ? -10.968 20.177   93.393  1.00 15.57 ? 215 ILE B N   1 
ATOM   3967  C CA  . ILE B 1 134 ? -10.610 18.776   93.605  1.00 16.25 ? 215 ILE B CA  1 
ATOM   3968  C C   . ILE B 1 134 ? -11.005 18.356   95.020  1.00 16.74 ? 215 ILE B C   1 
ATOM   3969  O O   . ILE B 1 134 ? -10.425 18.842   95.995  1.00 16.53 ? 215 ILE B O   1 
ATOM   3970  C CB  . ILE B 1 134 ? -9.086  18.558   93.456  1.00 17.50 ? 215 ILE B CB  1 
ATOM   3971  C CG1 . ILE B 1 134 ? -8.586  19.146   92.139  1.00 14.84 ? 215 ILE B CG1 1 
ATOM   3972  C CG2 . ILE B 1 134 ? -8.767  17.071   93.498  1.00 16.79 ? 215 ILE B CG2 1 
ATOM   3973  C CD1 . ILE B 1 134 ? -7.080  19.152   92.041  1.00 15.69 ? 215 ILE B CD1 1 
ATOM   3974  N N   . LYS B 1 135 ? -11.982 17.459   95.137  1.00 17.21 ? 216 LYS B N   1 
ATOM   3975  C CA  . LYS B 1 135 ? -12.438 17.003   96.453  1.00 17.85 ? 216 LYS B CA  1 
ATOM   3976  C C   . LYS B 1 135 ? -11.673 15.782   96.933  1.00 15.92 ? 216 LYS B C   1 
ATOM   3977  O O   . LYS B 1 135 ? -11.245 14.956   96.140  1.00 15.00 ? 216 LYS B O   1 
ATOM   3978  C CB  . LYS B 1 135 ? -13.943 16.696   96.436  1.00 19.70 ? 216 LYS B CB  1 
ATOM   3979  C CG  . LYS B 1 135 ? -14.382 15.716   95.334  1.00 25.57 ? 216 LYS B CG  1 
ATOM   3980  C CD  . LYS B 1 135 ? -15.906 15.494   95.342  1.00 27.47 ? 216 LYS B CD  1 
ATOM   3981  C CE  . LYS B 1 135 ? -16.451 15.141   93.940  1.00 28.20 ? 216 LYS B CE  1 
ATOM   3982  N NZ  . LYS B 1 135 ? -16.366 16.268   92.952  1.00 23.70 ? 216 LYS B NZ  1 
ATOM   3983  N N   . SER B 1 136 ? -11.495 15.691   98.244  1.00 15.51 ? 217 SER B N   1 
ATOM   3984  C CA  . SER B 1 136 ? -10.787 14.578   98.861  1.00 15.88 ? 217 SER B CA  1 
ATOM   3985  C C   . SER B 1 136 ? -11.350 13.246   98.367  1.00 16.93 ? 217 SER B C   1 
ATOM   3986  O O   . SER B 1 136 ? -12.565 13.054   98.354  1.00 18.09 ? 217 SER B O   1 
ATOM   3987  C CB  . SER B 1 136 ? -10.921 14.670   100.381 1.00 13.48 ? 217 SER B CB  1 
ATOM   3988  O OG  . SER B 1 136 ? -10.403 13.518   101.011 1.00 15.13 ? 217 SER B OG  1 
ATOM   3989  N N   . TRP B 1 137 ? -10.466 12.332   97.967  1.00 16.89 ? 218 TRP B N   1 
ATOM   3990  C CA  . TRP B 1 137 ? -10.890 11.030   97.470  1.00 17.68 ? 218 TRP B CA  1 
ATOM   3991  C C   . TRP B 1 137 ? -10.756 9.887    98.485  1.00 18.70 ? 218 TRP B C   1 
ATOM   3992  O O   . TRP B 1 137 ? -11.242 8.777    98.249  1.00 16.84 ? 218 TRP B O   1 
ATOM   3993  C CB  . TRP B 1 137 ? -10.139 10.699   96.175  1.00 18.30 ? 218 TRP B CB  1 
ATOM   3994  C CG  . TRP B 1 137 ? -8.644  10.538   96.298  1.00 20.10 ? 218 TRP B CG  1 
ATOM   3995  C CD1 . TRP B 1 137 ? -7.960  9.367    96.503  1.00 20.92 ? 218 TRP B CD1 1 
ATOM   3996  C CD2 . TRP B 1 137 ? -7.650  11.568   96.187  1.00 19.79 ? 218 TRP B CD2 1 
ATOM   3997  N NE1 . TRP B 1 137 ? -6.600  9.604    96.516  1.00 20.65 ? 218 TRP B NE1 1 
ATOM   3998  C CE2 . TRP B 1 137 ? -6.381  10.945   96.327  1.00 20.78 ? 218 TRP B CE2 1 
ATOM   3999  C CE3 . TRP B 1 137 ? -7.703  12.956   95.980  1.00 20.68 ? 218 TRP B CE3 1 
ATOM   4000  C CZ2 . TRP B 1 137 ? -5.175  11.664   96.272  1.00 18.91 ? 218 TRP B CZ2 1 
ATOM   4001  C CZ3 . TRP B 1 137 ? -6.500  13.673   95.924  1.00 21.34 ? 218 TRP B CZ3 1 
ATOM   4002  C CH2 . TRP B 1 137 ? -5.252  13.018   96.069  1.00 19.92 ? 218 TRP B CH2 1 
ATOM   4003  N N   . ARG B 1 138 ? -10.109 10.168   99.616  1.00 20.16 ? 219 ARG B N   1 
ATOM   4004  C CA  . ARG B 1 138 ? -9.933  9.183    100.689 1.00 21.44 ? 219 ARG B CA  1 
ATOM   4005  C C   . ARG B 1 138 ? -10.512 9.701    101.998 1.00 21.05 ? 219 ARG B C   1 
ATOM   4006  O O   . ARG B 1 138 ? -10.429 9.032    103.024 1.00 22.81 ? 219 ARG B O   1 
ATOM   4007  C CB  . ARG B 1 138 ? -8.450  8.865    100.903 1.00 22.87 ? 219 ARG B CB  1 
ATOM   4008  C CG  . ARG B 1 138 ? -7.852  7.956    99.868  1.00 27.65 ? 219 ARG B CG  1 
ATOM   4009  C CD  . ARG B 1 138 ? -8.403  6.553    100.004 1.00 32.03 ? 219 ARG B CD  1 
ATOM   4010  N NE  . ARG B 1 138 ? -8.145  5.769    98.802  1.00 37.56 ? 219 ARG B NE  1 
ATOM   4011  C CZ  . ARG B 1 138 ? -8.845  4.691    98.462  1.00 41.98 ? 219 ARG B CZ  1 
ATOM   4012  N NH1 . ARG B 1 138 ? -9.841  4.274    99.246  1.00 42.91 ? 219 ARG B NH1 1 
ATOM   4013  N NH2 . ARG B 1 138 ? -8.571  4.044    97.331  1.00 42.26 ? 219 ARG B NH2 1 
ATOM   4014  N N   . ASN B 1 139 ? -11.084 10.899   101.955 1.00 20.83 ? 220 ASN B N   1 
ATOM   4015  C CA  . ASN B 1 139 ? -11.675 11.545   103.125 1.00 21.09 ? 220 ASN B CA  1 
ATOM   4016  C C   . ASN B 1 139 ? -10.804 11.572   104.370 1.00 20.38 ? 220 ASN B C   1 
ATOM   4017  O O   . ASN B 1 139 ? -11.310 11.403   105.477 1.00 20.56 ? 220 ASN B O   1 
ATOM   4018  C CB  . ASN B 1 139 ? -13.004 10.892   103.506 1.00 22.33 ? 220 ASN B CB  1 
ATOM   4019  C CG  . ASN B 1 139 ? -14.016 10.936   102.390 1.00 21.72 ? 220 ASN B CG  1 
ATOM   4020  O OD1 . ASN B 1 139 ? -14.072 11.887   101.615 1.00 20.87 ? 220 ASN B OD1 1 
ATOM   4021  N ND2 . ASN B 1 139 ? -14.837 9.904    102.313 1.00 24.63 ? 220 ASN B ND2 1 
ATOM   4022  N N   . ASN B 1 140 ? -9.504  11.775   104.202 1.00 19.58 ? 221 ASN B N   1 
ATOM   4023  C CA  . ASN B 1 140 ? -8.611  11.844   105.348 1.00 18.06 ? 221 ASN B CA  1 
ATOM   4024  C C   . ASN B 1 140 ? -7.509  12.867   105.110 1.00 17.49 ? 221 ASN B C   1 
ATOM   4025  O O   . ASN B 1 140 ? -6.357  12.529   104.802 1.00 16.13 ? 221 ASN B O   1 
ATOM   4026  C CB  . ASN B 1 140 ? -8.013  10.477   105.657 1.00 18.88 ? 221 ASN B CB  1 
ATOM   4027  C CG  . ASN B 1 140 ? -7.168  10.482   106.920 1.00 18.59 ? 221 ASN B CG  1 
ATOM   4028  O OD1 . ASN B 1 140 ? -7.137  11.461   107.656 1.00 19.09 ? 221 ASN B OD1 1 
ATOM   4029  N ND2 . ASN B 1 140 ? -6.481  9.375    107.174 1.00 20.67 ? 221 ASN B ND2 1 
ATOM   4030  N N   . ILE B 1 141 ? -7.908  14.125   105.252 1.00 15.71 ? 222 ILE B N   1 
ATOM   4031  C CA  . ILE B 1 141 ? -7.046  15.287   105.098 1.00 14.66 ? 222 ILE B CA  1 
ATOM   4032  C C   . ILE B 1 141 ? -6.339  15.440   103.750 1.00 14.99 ? 222 ILE B C   1 
ATOM   4033  O O   . ILE B 1 141 ? -5.137  15.213   103.649 1.00 15.68 ? 222 ILE B O   1 
ATOM   4034  C CB  . ILE B 1 141 ? -5.968  15.351   106.227 1.00 13.46 ? 222 ILE B CB  1 
ATOM   4035  C CG1 . ILE B 1 141 ? -6.585  15.009   107.591 1.00 13.39 ? 222 ILE B CG1 1 
ATOM   4036  C CG2 . ILE B 1 141 ? -5.382  16.753   106.304 1.00 11.99 ? 222 ILE B CG2 1 
ATOM   4037  C CD1 . ILE B 1 141 ? -5.577  15.008   108.731 1.00 9.52  ? 222 ILE B CD1 1 
ATOM   4038  N N   . LEU B 1 142 ? -7.078  15.831   102.715 1.00 15.27 ? 223 LEU B N   1 
ATOM   4039  C CA  . LEU B 1 142 ? -6.466  16.068   101.411 1.00 13.90 ? 223 LEU B CA  1 
ATOM   4040  C C   . LEU B 1 142 ? -5.471  17.199   101.659 1.00 14.29 ? 223 LEU B C   1 
ATOM   4041  O O   . LEU B 1 142 ? -5.839  18.247   102.172 1.00 16.02 ? 223 LEU B O   1 
ATOM   4042  C CB  . LEU B 1 142 ? -7.515  16.506   100.390 1.00 12.58 ? 223 LEU B CB  1 
ATOM   4043  C CG  . LEU B 1 142 ? -7.020  17.008   99.023  1.00 12.75 ? 223 LEU B CG  1 
ATOM   4044  C CD1 . LEU B 1 142 ? -6.186  15.952   98.317  1.00 10.11 ? 223 LEU B CD1 1 
ATOM   4045  C CD2 . LEU B 1 142 ? -8.218  17.373   98.176  1.00 11.43 ? 223 LEU B CD2 1 
ATOM   4046  N N   . ARG B 1 143 ? -4.211  16.982   101.307 1.00 13.87 ? 224 ARG B N   1 
ATOM   4047  C CA  . ARG B 1 143 ? -3.170  17.971   101.539 1.00 13.61 ? 224 ARG B CA  1 
ATOM   4048  C C   . ARG B 1 143 ? -2.217  18.062   100.343 1.00 13.87 ? 224 ARG B C   1 
ATOM   4049  O O   . ARG B 1 143 ? -2.228  17.191   99.468  1.00 14.31 ? 224 ARG B O   1 
ATOM   4050  C CB  . ARG B 1 143 ? -2.421  17.608   102.831 1.00 15.69 ? 224 ARG B CB  1 
ATOM   4051  C CG  . ARG B 1 143 ? -2.135  16.100   102.983 1.00 17.20 ? 224 ARG B CG  1 
ATOM   4052  C CD  . ARG B 1 143 ? -1.596  15.733   104.365 1.00 17.94 ? 224 ARG B CD  1 
ATOM   4053  N NE  . ARG B 1 143 ? -1.257  14.310   104.463 1.00 17.84 ? 224 ARG B NE  1 
ATOM   4054  C CZ  . ARG B 1 143 ? -2.141  13.329   104.621 1.00 17.51 ? 224 ARG B CZ  1 
ATOM   4055  N NH1 . ARG B 1 143 ? -1.734  12.072   104.690 1.00 18.66 ? 224 ARG B NH1 1 
ATOM   4056  N NH2 . ARG B 1 143 ? -3.431  13.601   104.732 1.00 17.70 ? 224 ARG B NH2 1 
ATOM   4057  N N   . THR B 1 144 ? -1.384  19.102   100.310 1.00 13.29 ? 225 THR B N   1 
ATOM   4058  C CA  . THR B 1 144 ? -0.490  19.293   99.177  1.00 11.80 ? 225 THR B CA  1 
ATOM   4059  C C   . THR B 1 144 ? 0.947   19.740   99.527  1.00 11.61 ? 225 THR B C   1 
ATOM   4060  O O   . THR B 1 144 ? 1.368   19.639   100.671 1.00 13.42 ? 225 THR B O   1 
ATOM   4061  C CB  . THR B 1 144 ? -1.181  20.261   98.160  1.00 13.08 ? 225 THR B CB  1 
ATOM   4062  O OG1 . THR B 1 144 ? -0.534  20.184   96.882  1.00 14.82 ? 225 THR B OG1 1 
ATOM   4063  C CG2 . THR B 1 144 ? -1.176  21.690   98.679  1.00 11.89 ? 225 THR B CG2 1 
ATOM   4064  N N   . GLN B 1 145 ? 1.682   20.231   98.531  1.00 12.06 ? 226 GLN B N   1 
ATOM   4065  C CA  . GLN B 1 145 ? 3.090   20.642   98.641  1.00 12.01 ? 226 GLN B CA  1 
ATOM   4066  C C   . GLN B 1 145 ? 3.636   21.579   99.716  1.00 13.85 ? 226 GLN B C   1 
ATOM   4067  O O   . GLN B 1 145 ? 4.675   21.291   100.314 1.00 14.48 ? 226 GLN B O   1 
ATOM   4068  C CB  . GLN B 1 145 ? 3.562   21.215   97.309  1.00 11.55 ? 226 GLN B CB  1 
ATOM   4069  C CG  . GLN B 1 145 ? 3.527   20.280   96.135  1.00 11.46 ? 226 GLN B CG  1 
ATOM   4070  C CD  . GLN B 1 145 ? 4.233   20.882   94.931  1.00 13.57 ? 226 GLN B CD  1 
ATOM   4071  O OE1 . GLN B 1 145 ? 5.444   21.086   94.951  1.00 13.97 ? 226 GLN B OE1 1 
ATOM   4072  N NE2 . GLN B 1 145 ? 3.478   21.180   93.886  1.00 14.78 ? 226 GLN B NE2 1 
ATOM   4073  N N   . GLU B 1 146 ? 2.976   22.715   99.929  1.00 15.46 ? 227 GLU B N   1 
ATOM   4074  C CA  . GLU B 1 146 ? 3.454   23.712   100.889 1.00 15.84 ? 227 GLU B CA  1 
ATOM   4075  C C   . GLU B 1 146 ? 4.784   24.271   100.346 1.00 15.32 ? 227 GLU B C   1 
ATOM   4076  O O   . GLU B 1 146 ? 5.643   24.747   101.092 1.00 14.40 ? 227 GLU B O   1 
ATOM   4077  C CB  . GLU B 1 146 ? 3.642   23.094   102.281 1.00 19.23 ? 227 GLU B CB  1 
ATOM   4078  C CG  . GLU B 1 146 ? 2.499   22.173   102.719 1.00 22.78 ? 227 GLU B CG  1 
ATOM   4079  C CD  . GLU B 1 146 ? 1.215   22.899   103.095 1.00 25.37 ? 227 GLU B CD  1 
ATOM   4080  O OE1 . GLU B 1 146 ? 0.852   23.907   102.447 1.00 25.98 ? 227 GLU B OE1 1 
ATOM   4081  O OE2 . GLU B 1 146 ? 0.547   22.440   104.051 1.00 31.41 ? 227 GLU B OE2 1 
ATOM   4082  N N   . SER B 1 147 ? 4.923   24.177   99.023  1.00 15.60 ? 228 SER B N   1 
ATOM   4083  C CA  . SER B 1 147 ? 6.065   24.675   98.254  1.00 15.35 ? 228 SER B CA  1 
ATOM   4084  C C   . SER B 1 147 ? 5.514   24.840   96.841  1.00 15.98 ? 228 SER B C   1 
ATOM   4085  O O   . SER B 1 147 ? 4.444   24.311   96.525  1.00 18.01 ? 228 SER B O   1 
ATOM   4086  C CB  . SER B 1 147 ? 7.234   23.686   98.248  1.00 16.01 ? 228 SER B CB  1 
ATOM   4087  O OG  . SER B 1 147 ? 7.018   22.625   97.345  1.00 16.61 ? 228 SER B OG  1 
ATOM   4088  N N   . GLU B 1 148 ? 6.235   25.555   95.991  1.00 15.09 ? 229 GLU B N   1 
ATOM   4089  C CA  . GLU B 1 148 ? 5.776   25.820   94.631  1.00 16.37 ? 229 GLU B CA  1 
ATOM   4090  C C   . GLU B 1 148 ? 5.613   24.603   93.715  1.00 17.47 ? 229 GLU B C   1 
ATOM   4091  O O   . GLU B 1 148 ? 6.315   23.599   93.847  1.00 17.39 ? 229 GLU B O   1 
ATOM   4092  C CB  . GLU B 1 148 ? 6.727   26.802   93.940  1.00 16.58 ? 229 GLU B CB  1 
ATOM   4093  C CG  . GLU B 1 148 ? 8.000   26.123   93.436  1.00 18.45 ? 229 GLU B CG  1 
ATOM   4094  C CD  . GLU B 1 148 ? 8.899   27.025   92.615  1.00 20.61 ? 229 GLU B CD  1 
ATOM   4095  O OE1 . GLU B 1 148 ? 9.974   26.536   92.202  1.00 23.48 ? 229 GLU B OE1 1 
ATOM   4096  O OE2 . GLU B 1 148 ? 8.545   28.205   92.377  1.00 19.71 ? 229 GLU B OE2 1 
ATOM   4097  N N   . CYS B 1 149 ? 4.684   24.719   92.771  1.00 17.89 ? 230 CYS B N   1 
ATOM   4098  C CA  . CYS B 1 149 ? 4.464   23.664   91.796  1.00 18.47 ? 230 CYS B CA  1 
ATOM   4099  C C   . CYS B 1 149 ? 5.394   23.938   90.606  1.00 18.12 ? 230 CYS B C   1 
ATOM   4100  O O   . CYS B 1 149 ? 6.116   24.931   90.602  1.00 18.09 ? 230 CYS B O   1 
ATOM   4101  C CB  . CYS B 1 149 ? 2.998   23.622   91.351  1.00 18.54 ? 230 CYS B CB  1 
ATOM   4102  S SG  . CYS B 1 149 ? 2.048   25.180   91.424  1.00 20.62 ? 230 CYS B SG  1 
ATOM   4103  N N   . ALA B 1 150 ? 5.381   23.065   89.605  1.00 17.39 ? 231 ALA B N   1 
ATOM   4104  C CA  . ALA B 1 150 ? 6.266   23.231   88.458  1.00 16.75 ? 231 ALA B CA  1 
ATOM   4105  C C   . ALA B 1 150 ? 5.519   23.382   87.143  1.00 17.22 ? 231 ALA B C   1 
ATOM   4106  O O   . ALA B 1 150 ? 4.571   22.654   86.860  1.00 16.45 ? 231 ALA B O   1 
ATOM   4107  C CB  . ALA B 1 150 ? 7.241   22.041   88.381  1.00 14.78 ? 231 ALA B CB  1 
ATOM   4108  N N   . CYS B 1 151 ? 5.936   24.342   86.335  1.00 18.00 ? 232 CYS B N   1 
ATOM   4109  C CA  . CYS B 1 151 ? 5.288   24.527   85.047  1.00 21.44 ? 232 CYS B CA  1 
ATOM   4110  C C   . CYS B 1 151 ? 6.305   24.242   83.939  1.00 21.84 ? 232 CYS B C   1 
ATOM   4111  O O   . CYS B 1 151 ? 7.507   24.462   84.112  1.00 22.03 ? 232 CYS B O   1 
ATOM   4112  C CB  . CYS B 1 151 ? 4.736   25.954   84.914  1.00 22.51 ? 232 CYS B CB  1 
ATOM   4113  S SG  . CYS B 1 151 ? 3.598   26.497   86.249  1.00 27.56 ? 232 CYS B SG  1 
ATOM   4114  N N   . VAL B 1 152 ? 5.818   23.729   82.815  1.00 22.02 ? 233 VAL B N   1 
ATOM   4115  C CA  . VAL B 1 152 ? 6.662   23.411   81.672  1.00 22.41 ? 233 VAL B CA  1 
ATOM   4116  C C   . VAL B 1 152 ? 5.828   23.529   80.413  1.00 22.98 ? 233 VAL B C   1 
ATOM   4117  O O   . VAL B 1 152 ? 4.731   22.975   80.347  1.00 23.09 ? 233 VAL B O   1 
ATOM   4118  C CB  . VAL B 1 152 ? 7.180   21.958   81.729  1.00 23.16 ? 233 VAL B CB  1 
ATOM   4119  C CG1 . VAL B 1 152 ? 7.759   21.560   80.366  1.00 23.88 ? 233 VAL B CG1 1 
ATOM   4120  C CG2 . VAL B 1 152 ? 8.230   21.814   82.804  1.00 20.61 ? 233 VAL B CG2 1 
ATOM   4121  N N   . ASN B 1 153 ? 6.331   24.260   79.423  1.00 22.89 ? 234 ASN B N   1 
ATOM   4122  C CA  . ASN B 1 153 ? 5.623   24.387   78.154  1.00 22.40 ? 234 ASN B CA  1 
ATOM   4123  C C   . ASN B 1 153 ? 4.123   24.676   78.361  1.00 22.13 ? 234 ASN B C   1 
ATOM   4124  O O   . ASN B 1 153 ? 3.274   24.139   77.652  1.00 22.52 ? 234 ASN B O   1 
ATOM   4125  C CB  . ASN B 1 153 ? 5.849   23.082   77.349  1.00 22.74 ? 234 ASN B CB  1 
ATOM   4126  C CG  . ASN B 1 153 ? 5.215   23.100   75.963  1.00 23.40 ? 234 ASN B CG  1 
ATOM   4127  O OD1 . ASN B 1 153 ? 5.197   24.124   75.289  1.00 23.61 ? 234 ASN B OD1 1 
ATOM   4128  N ND2 . ASN B 1 153 ? 4.703   21.943   75.526  1.00 23.28 ? 234 ASN B ND2 1 
ATOM   4129  N N   . GLY B 1 154 ? 3.796   25.511   79.345  1.00 20.81 ? 235 GLY B N   1 
ATOM   4130  C CA  . GLY B 1 154 ? 2.401   25.863   79.581  1.00 18.38 ? 235 GLY B CA  1 
ATOM   4131  C C   . GLY B 1 154 ? 1.528   24.908   80.381  1.00 18.38 ? 235 GLY B C   1 
ATOM   4132  O O   . GLY B 1 154 ? 0.303   24.993   80.339  1.00 17.79 ? 235 GLY B O   1 
ATOM   4133  N N   . SER B 1 155 ? 2.146   23.991   81.110  1.00 18.62 ? 236 SER B N   1 
ATOM   4134  C CA  . SER B 1 155 ? 1.392   23.039   81.918  1.00 18.64 ? 236 SER B CA  1 
ATOM   4135  C C   . SER B 1 155 ? 2.048   23.050   83.291  1.00 20.39 ? 236 SER B C   1 
ATOM   4136  O O   . SER B 1 155 ? 3.275   23.069   83.388  1.00 22.89 ? 236 SER B O   1 
ATOM   4137  C CB  . SER B 1 155 ? 1.477   21.633   81.313  1.00 16.53 ? 236 SER B CB  1 
ATOM   4138  O OG  . SER B 1 155 ? 0.972   21.583   79.988  1.00 15.30 ? 236 SER B OG  1 
ATOM   4139  N N   . CYS B 1 156 ? 1.258   23.062   84.356  1.00 20.34 ? 237 CYS B N   1 
ATOM   4140  C CA  . CYS B 1 156 ? 1.863   23.056   85.676  1.00 21.08 ? 237 CYS B CA  1 
ATOM   4141  C C   . CYS B 1 156 ? 1.508   21.754   86.381  1.00 19.68 ? 237 CYS B C   1 
ATOM   4142  O O   . CYS B 1 156 ? 0.421   21.213   86.189  1.00 19.99 ? 237 CYS B O   1 
ATOM   4143  C CB  . CYS B 1 156 ? 1.411   24.276   86.484  1.00 22.67 ? 237 CYS B CB  1 
ATOM   4144  S SG  . CYS B 1 156 ? 1.730   25.885   85.668  1.00 26.26 ? 237 CYS B SG  1 
ATOM   4145  N N   . PHE B 1 157 ? 2.433   21.250   87.193  1.00 17.68 ? 238 PHE B N   1 
ATOM   4146  C CA  . PHE B 1 157 ? 2.217   19.987   87.876  1.00 16.82 ? 238 PHE B CA  1 
ATOM   4147  C C   . PHE B 1 157 ? 2.384   20.079   89.382  1.00 16.78 ? 238 PHE B C   1 
ATOM   4148  O O   . PHE B 1 157 ? 3.200   20.848   89.894  1.00 16.24 ? 238 PHE B O   1 
ATOM   4149  C CB  . PHE B 1 157 ? 3.173   18.929   87.312  1.00 17.58 ? 238 PHE B CB  1 
ATOM   4150  C CG  . PHE B 1 157 ? 3.181   18.861   85.805  1.00 17.39 ? 238 PHE B CG  1 
ATOM   4151  C CD1 . PHE B 1 157 ? 3.700   19.908   85.050  1.00 17.19 ? 238 PHE B CD1 1 
ATOM   4152  C CD2 . PHE B 1 157 ? 2.653   17.763   85.143  1.00 18.06 ? 238 PHE B CD2 1 
ATOM   4153  C CE1 . PHE B 1 157 ? 3.691   19.864   83.663  1.00 17.29 ? 238 PHE B CE1 1 
ATOM   4154  C CE2 . PHE B 1 157 ? 2.640   17.706   83.747  1.00 18.17 ? 238 PHE B CE2 1 
ATOM   4155  C CZ  . PHE B 1 157 ? 3.159   18.758   83.008  1.00 17.61 ? 238 PHE B CZ  1 
ATOM   4156  N N   . THR B 1 158 ? 1.597   19.288   90.094  1.00 15.77 ? 239 THR B N   1 
ATOM   4157  C CA  . THR B 1 158 ? 1.679   19.282   91.541  1.00 15.77 ? 239 THR B CA  1 
ATOM   4158  C C   . THR B 1 158 ? 1.415   17.878   92.080  1.00 16.07 ? 239 THR B C   1 
ATOM   4159  O O   . THR B 1 158 ? 1.088   16.956   91.332  1.00 16.36 ? 239 THR B O   1 
ATOM   4160  C CB  . THR B 1 158 ? 0.674   20.276   92.146  1.00 15.13 ? 239 THR B CB  1 
ATOM   4161  O OG1 . THR B 1 158 ? 1.009   20.515   93.519  1.00 14.19 ? 239 THR B OG1 1 
ATOM   4162  C CG2 . THR B 1 158 ? -0.750  19.725   92.045  1.00 12.76 ? 239 THR B CG2 1 
ATOM   4163  N N   . VAL B 1 159 ? 1.564   17.713   93.383  1.00 16.84 ? 240 VAL B N   1 
ATOM   4164  C CA  . VAL B 1 159 ? 1.337   16.414   93.991  1.00 16.80 ? 240 VAL B CA  1 
ATOM   4165  C C   . VAL B 1 159 ? 0.445   16.551   95.216  1.00 15.95 ? 240 VAL B C   1 
ATOM   4166  O O   . VAL B 1 159 ? 0.573   17.506   95.979  1.00 16.04 ? 240 VAL B O   1 
ATOM   4167  C CB  . VAL B 1 159 ? 2.673   15.763   94.402  1.00 16.29 ? 240 VAL B CB  1 
ATOM   4168  C CG1 . VAL B 1 159 ? 2.415   14.436   95.098  1.00 15.81 ? 240 VAL B CG1 1 
ATOM   4169  C CG2 . VAL B 1 159 ? 3.548   15.556   93.171  1.00 17.68 ? 240 VAL B CG2 1 
ATOM   4170  N N   . MET B 1 160 ? -0.468  15.606   95.392  1.00 15.68 ? 241 MET B N   1 
ATOM   4171  C CA  . MET B 1 160 ? -1.353  15.634   96.548  1.00 17.79 ? 241 MET B CA  1 
ATOM   4172  C C   . MET B 1 160 ? -1.421  14.259   97.209  1.00 17.35 ? 241 MET B C   1 
ATOM   4173  O O   . MET B 1 160 ? -1.161  13.228   96.574  1.00 16.18 ? 241 MET B O   1 
ATOM   4174  C CB  . MET B 1 160 ? -2.761  16.106   96.159  1.00 18.43 ? 241 MET B CB  1 
ATOM   4175  C CG  . MET B 1 160 ? -2.797  17.477   95.504  1.00 20.10 ? 241 MET B CG  1 
ATOM   4176  S SD  . MET B 1 160 ? -4.449  18.213   95.529  1.00 23.24 ? 241 MET B SD  1 
ATOM   4177  C CE  . MET B 1 160 ? -4.035  19.901   95.894  1.00 25.47 ? 241 MET B CE  1 
ATOM   4178  N N   . THR B 1 161 ? -1.774  14.262   98.490  1.00 16.06 ? 242 THR B N   1 
ATOM   4179  C CA  . THR B 1 161 ? -1.862  13.046   99.276  1.00 15.61 ? 242 THR B CA  1 
ATOM   4180  C C   . THR B 1 161 ? -3.191  13.017   100.004 1.00 16.70 ? 242 THR B C   1 
ATOM   4181  O O   . THR B 1 161 ? -3.748  14.052   100.354 1.00 16.78 ? 242 THR B O   1 
ATOM   4182  C CB  . THR B 1 161 ? -0.728  12.997   100.325 1.00 15.46 ? 242 THR B CB  1 
ATOM   4183  O OG1 . THR B 1 161 ? 0.532   13.050   99.655  1.00 16.26 ? 242 THR B OG1 1 
ATOM   4184  C CG2 . THR B 1 161 ? -0.800  11.734   101.169 1.00 14.36 ? 242 THR B CG2 1 
ATOM   4185  N N   . ASP B 1 162 ? -3.709  11.820   100.220 1.00 18.42 ? 243 ASP B N   1 
ATOM   4186  C CA  . ASP B 1 162 ? -4.955  11.675   100.945 1.00 19.37 ? 243 ASP B CA  1 
ATOM   4187  C C   . ASP B 1 162 ? -4.824  10.366   101.698 1.00 19.53 ? 243 ASP B C   1 
ATOM   4188  O O   . ASP B 1 162 ? -4.374  9.358    101.143 1.00 20.68 ? 243 ASP B O   1 
ATOM   4189  C CB  . ASP B 1 162 ? -6.146  11.660   99.979  1.00 18.43 ? 243 ASP B CB  1 
ATOM   4190  C CG  . ASP B 1 162 ? -7.443  12.101   100.645 1.00 19.39 ? 243 ASP B CG  1 
ATOM   4191  O OD1 . ASP B 1 162 ? -8.361  12.547   99.924  1.00 20.14 ? 243 ASP B OD1 1 
ATOM   4192  O OD2 . ASP B 1 162 ? -7.548  11.998   101.885 1.00 17.49 ? 243 ASP B OD2 1 
ATOM   4193  N N   . GLY B 1 163 ? -5.182  10.388   102.972 1.00 19.57 ? 244 GLY B N   1 
ATOM   4194  C CA  . GLY B 1 163 ? -5.074  9.188    103.768 1.00 20.60 ? 244 GLY B CA  1 
ATOM   4195  C C   . GLY B 1 163 ? -4.294  9.465    105.027 1.00 20.64 ? 244 GLY B C   1 
ATOM   4196  O O   . GLY B 1 163 ? -4.172  10.615   105.436 1.00 22.23 ? 244 GLY B O   1 
ATOM   4197  N N   . PRO B 1 164 ? -3.752  8.427    105.670 1.00 21.31 ? 245 PRO B N   1 
ATOM   4198  C CA  . PRO B 1 164 ? -2.977  8.587    106.905 1.00 21.05 ? 245 PRO B CA  1 
ATOM   4199  C C   . PRO B 1 164 ? -1.585  9.189    106.720 1.00 20.72 ? 245 PRO B C   1 
ATOM   4200  O O   . PRO B 1 164 ? -0.902  8.925    105.737 1.00 19.86 ? 245 PRO B O   1 
ATOM   4201  C CB  . PRO B 1 164 ? -2.895  7.160    107.449 1.00 21.45 ? 245 PRO B CB  1 
ATOM   4202  C CG  . PRO B 1 164 ? -4.101  6.473    106.833 1.00 21.29 ? 245 PRO B CG  1 
ATOM   4203  C CD  . PRO B 1 164 ? -4.050  7.005    105.428 1.00 21.14 ? 245 PRO B CD  1 
ATOM   4204  N N   . SER B 1 165 ? -1.176  10.009   107.680 1.00 21.31 ? 246 SER B N   1 
ATOM   4205  C CA  . SER B 1 165 ? 0.152   10.608   107.661 1.00 21.81 ? 246 SER B CA  1 
ATOM   4206  C C   . SER B 1 165 ? 0.931   9.632    108.520 1.00 22.32 ? 246 SER B C   1 
ATOM   4207  O O   . SER B 1 165 ? 2.105   9.821    108.815 1.00 22.36 ? 246 SER B O   1 
ATOM   4208  C CB  . SER B 1 165 ? 0.123   11.981   108.329 1.00 22.44 ? 246 SER B CB  1 
ATOM   4209  O OG  . SER B 1 165 ? -0.338  11.898   109.671 1.00 20.65 ? 246 SER B OG  1 
ATOM   4210  N N   . ASN B 1 166 ? 0.213   8.569    108.868 1.00 24.17 ? 247 ASN B N   1 
ATOM   4211  C CA  . ASN B 1 166 ? 0.618   7.464    109.730 1.00 25.09 ? 247 ASN B CA  1 
ATOM   4212  C C   . ASN B 1 166 ? 1.083   6.169    109.053 1.00 24.13 ? 247 ASN B C   1 
ATOM   4213  O O   . ASN B 1 166 ? 1.809   5.388    109.652 1.00 24.98 ? 247 ASN B O   1 
ATOM   4214  C CB  . ASN B 1 166 ? -0.581  7.098    110.608 1.00 26.48 ? 247 ASN B CB  1 
ATOM   4215  C CG  . ASN B 1 166 ? -0.268  7.184    112.048 1.00 27.07 ? 247 ASN B CG  1 
ATOM   4216  O OD1 . ASN B 1 166 ? 0.888   7.378    112.411 1.00 30.99 ? 247 ASN B OD1 1 
ATOM   4217  N ND2 . ASN B 1 166 ? -1.280  7.038    112.897 1.00 25.34 ? 247 ASN B ND2 1 
ATOM   4218  N N   . GLY B 1 167 ? 0.601   5.913    107.843 1.00 23.53 ? 248 GLY B N   1 
ATOM   4219  C CA  . GLY B 1 167 ? 0.951   4.695    107.130 1.00 21.70 ? 248 GLY B CA  1 
ATOM   4220  C C   . GLY B 1 167 ? 0.444   4.797    105.706 1.00 20.85 ? 248 GLY B C   1 
ATOM   4221  O O   . GLY B 1 167 ? -0.024  5.852    105.306 1.00 19.95 ? 248 GLY B O   1 
ATOM   4222  N N   . GLN B 1 168 ? 0.526   3.716    104.941 1.00 21.26 ? 249 GLN B N   1 
ATOM   4223  C CA  . GLN B 1 168 ? 0.072   3.740    103.555 1.00 20.32 ? 249 GLN B CA  1 
ATOM   4224  C C   . GLN B 1 168 ? -1.035  4.755    103.330 1.00 20.07 ? 249 GLN B C   1 
ATOM   4225  O O   . GLN B 1 168 ? -2.058  4.722    104.016 1.00 20.57 ? 249 GLN B O   1 
ATOM   4226  C CB  . GLN B 1 168 ? -0.455  2.369    103.136 1.00 20.17 ? 249 GLN B CB  1 
ATOM   4227  C CG  . GLN B 1 168 ? 0.444   1.590    102.204 1.00 22.02 ? 249 GLN B CG  1 
ATOM   4228  C CD  . GLN B 1 168 ? 0.934   2.405    101.030 1.00 21.73 ? 249 GLN B CD  1 
ATOM   4229  O OE1 . GLN B 1 168 ? 0.239   3.285    100.520 1.00 22.41 ? 249 GLN B OE1 1 
ATOM   4230  N NE2 . GLN B 1 168 ? 2.137   2.102    100.583 1.00 23.62 ? 249 GLN B NE2 1 
ATOM   4231  N N   . ALA B 1 169 ? -0.826  5.654    102.374 1.00 18.60 ? 250 ALA B N   1 
ATOM   4232  C CA  . ALA B 1 169 ? -1.820  6.661    102.035 1.00 18.09 ? 250 ALA B CA  1 
ATOM   4233  C C   . ALA B 1 169 ? -1.923  6.688    100.517 1.00 19.08 ? 250 ALA B C   1 
ATOM   4234  O O   . ALA B 1 169 ? -1.205  5.954    99.831  1.00 19.67 ? 250 ALA B O   1 
ATOM   4235  C CB  . ALA B 1 169 ? -1.405  8.025    102.571 1.00 16.86 ? 250 ALA B CB  1 
ATOM   4236  N N   . SER B 1 170 ? -2.818  7.512    99.981  1.00 18.59 ? 251 SER B N   1 
ATOM   4237  C CA  . SER B 1 170 ? -2.970  7.587    98.531  1.00 17.58 ? 251 SER B CA  1 
ATOM   4238  C C   . SER B 1 170 ? -2.196  8.784    97.997  1.00 17.74 ? 251 SER B C   1 
ATOM   4239  O O   . SER B 1 170 ? -2.156  9.838    98.632  1.00 18.07 ? 251 SER B O   1 
ATOM   4240  C CB  . SER B 1 170 ? -4.445  7.703    98.149  1.00 17.34 ? 251 SER B CB  1 
ATOM   4241  O OG  . SER B 1 170 ? -4.588  7.746    96.742  1.00 17.37 ? 251 SER B OG  1 
ATOM   4242  N N   . TYR B 1 171 ? -1.594  8.622    96.824  1.00 17.26 ? 252 TYR B N   1 
ATOM   4243  C CA  . TYR B 1 171 ? -0.791  9.681    96.227  1.00 16.96 ? 252 TYR B CA  1 
ATOM   4244  C C   . TYR B 1 171 ? -1.170  9.952    94.775  1.00 17.87 ? 252 TYR B C   1 
ATOM   4245  O O   . TYR B 1 171 ? -1.294  9.012    93.978  1.00 18.22 ? 252 TYR B O   1 
ATOM   4246  C CB  . TYR B 1 171 ? 0.685   9.286    96.304  1.00 15.42 ? 252 TYR B CB  1 
ATOM   4247  C CG  . TYR B 1 171 ? 1.044   8.624    97.607  1.00 16.28 ? 252 TYR B CG  1 
ATOM   4248  C CD1 . TYR B 1 171 ? 1.683   7.387    97.633  1.00 14.45 ? 252 TYR B CD1 1 
ATOM   4249  C CD2 . TYR B 1 171 ? 0.697   9.214    98.827  1.00 15.89 ? 252 TYR B CD2 1 
ATOM   4250  C CE1 . TYR B 1 171 ? 1.963   6.753    98.847  1.00 15.30 ? 252 TYR B CE1 1 
ATOM   4251  C CE2 . TYR B 1 171 ? 0.968   8.591    100.030 1.00 14.66 ? 252 TYR B CE2 1 
ATOM   4252  C CZ  . TYR B 1 171 ? 1.597   7.363    100.040 1.00 14.85 ? 252 TYR B CZ  1 
ATOM   4253  O OH  . TYR B 1 171 ? 1.837   6.750    101.249 1.00 16.08 ? 252 TYR B OH  1 
ATOM   4254  N N   . LYS B 1 172 ? -1.332  11.233   94.427  1.00 17.12 ? 253 LYS B N   1 
ATOM   4255  C CA  . LYS B 1 172 ? -1.692  11.613   93.066  1.00 17.11 ? 253 LYS B CA  1 
ATOM   4256  C C   . LYS B 1 172 ? -0.919  12.792   92.478  1.00 18.20 ? 253 LYS B C   1 
ATOM   4257  O O   . LYS B 1 172 ? -0.575  13.752   93.173  1.00 16.07 ? 253 LYS B O   1 
ATOM   4258  C CB  . LYS B 1 172 ? -3.180  11.941   92.974  1.00 17.30 ? 253 LYS B CB  1 
ATOM   4259  C CG  . LYS B 1 172 ? -4.103  10.765   93.106  1.00 18.48 ? 253 LYS B CG  1 
ATOM   4260  C CD  . LYS B 1 172 ? -5.521  11.195   92.800  1.00 19.95 ? 253 LYS B CD  1 
ATOM   4261  C CE  . LYS B 1 172 ? -6.477  10.033   92.883  1.00 21.35 ? 253 LYS B CE  1 
ATOM   4262  N NZ  . LYS B 1 172 ? -7.825  10.432   92.410  1.00 24.10 ? 253 LYS B NZ  1 
ATOM   4263  N N   . ILE B 1 173 ? -0.668  12.705   91.175  1.00 19.08 ? 254 ILE B N   1 
ATOM   4264  C CA  . ILE B 1 173 ? 0.020   13.757   90.440  1.00 20.77 ? 254 ILE B CA  1 
ATOM   4265  C C   . ILE B 1 173 ? -1.044  14.394   89.562  1.00 21.56 ? 254 ILE B C   1 
ATOM   4266  O O   . ILE B 1 173 ? -1.841  13.676   88.949  1.00 23.04 ? 254 ILE B O   1 
ATOM   4267  C CB  . ILE B 1 173 ? 1.079   13.201   89.491  1.00 21.40 ? 254 ILE B CB  1 
ATOM   4268  C CG1 . ILE B 1 173 ? 2.054   12.304   90.236  1.00 22.25 ? 254 ILE B CG1 1 
ATOM   4269  C CG2 . ILE B 1 173 ? 1.822   14.348   88.840  1.00 22.68 ? 254 ILE B CG2 1 
ATOM   4270  C CD1 . ILE B 1 173 ? 3.044   11.645   89.310  1.00 23.98 ? 254 ILE B CD1 1 
ATOM   4271  N N   . PHE B 1 174 ? -1.070  15.724   89.493  1.00 21.60 ? 255 PHE B N   1 
ATOM   4272  C CA  . PHE B 1 174 ? -2.058  16.406   88.653  1.00 21.12 ? 255 PHE B CA  1 
ATOM   4273  C C   . PHE B 1 174 ? -1.393  17.331   87.643  1.00 21.29 ? 255 PHE B C   1 
ATOM   4274  O O   . PHE B 1 174 ? -0.413  18.008   87.954  1.00 22.98 ? 255 PHE B O   1 
ATOM   4275  C CB  . PHE B 1 174 ? -3.031  17.248   89.484  1.00 19.74 ? 255 PHE B CB  1 
ATOM   4276  C CG  . PHE B 1 174 ? -3.822  16.472   90.494  1.00 19.39 ? 255 PHE B CG  1 
ATOM   4277  C CD1 . PHE B 1 174 ? -3.229  16.028   91.673  1.00 18.25 ? 255 PHE B CD1 1 
ATOM   4278  C CD2 . PHE B 1 174 ? -5.182  16.232   90.294  1.00 18.75 ? 255 PHE B CD2 1 
ATOM   4279  C CE1 . PHE B 1 174 ? -3.980  15.362   92.637  1.00 18.46 ? 255 PHE B CE1 1 
ATOM   4280  C CE2 . PHE B 1 174 ? -5.936  15.567   91.253  1.00 17.38 ? 255 PHE B CE2 1 
ATOM   4281  C CZ  . PHE B 1 174 ? -5.339  15.134   92.423  1.00 18.37 ? 255 PHE B CZ  1 
ATOM   4282  N N   . LYS B 1 175 ? -1.933  17.355   86.433  1.00 20.73 ? 256 LYS B N   1 
ATOM   4283  C CA  . LYS B 1 175 ? -1.425  18.220   85.378  1.00 21.50 ? 256 LYS B CA  1 
ATOM   4284  C C   . LYS B 1 175 ? -2.516  19.250   85.120  1.00 21.67 ? 256 LYS B C   1 
ATOM   4285  O O   . LYS B 1 175 ? -3.702  18.912   85.084  1.00 21.86 ? 256 LYS B O   1 
ATOM   4286  C CB  . LYS B 1 175 ? -1.163  17.422   84.105  1.00 20.99 ? 256 LYS B CB  1 
ATOM   4287  C CG  . LYS B 1 175 ? -0.721  18.265   82.920  1.00 21.11 ? 256 LYS B CG  1 
ATOM   4288  C CD  . LYS B 1 175 ? -0.541  17.369   81.700  1.00 21.89 ? 256 LYS B CD  1 
ATOM   4289  C CE  . LYS B 1 175 ? -0.318  18.159   80.422  1.00 21.99 ? 256 LYS B CE  1 
ATOM   4290  N NZ  . LYS B 1 175 ? -0.097  17.226   79.285  1.00 21.63 ? 256 LYS B NZ  1 
ATOM   4291  N N   . MET B 1 176 ? -2.128  20.502   84.930  1.00 20.82 ? 257 MET B N   1 
ATOM   4292  C CA  . MET B 1 176 ? -3.125  21.538   84.716  1.00 21.41 ? 257 MET B CA  1 
ATOM   4293  C C   . MET B 1 176 ? -2.721  22.607   83.712  1.00 20.57 ? 257 MET B C   1 
ATOM   4294  O O   . MET B 1 176 ? -1.540  22.934   83.575  1.00 18.65 ? 257 MET B O   1 
ATOM   4295  C CB  . MET B 1 176 ? -3.461  22.161   86.071  1.00 21.86 ? 257 MET B CB  1 
ATOM   4296  C CG  . MET B 1 176 ? -2.487  21.710   87.140  1.00 24.18 ? 257 MET B CG  1 
ATOM   4297  S SD  . MET B 1 176 ? -3.093  21.700   88.845  1.00 24.20 ? 257 MET B SD  1 
ATOM   4298  C CE  . MET B 1 176 ? -1.623  22.318   89.665  1.00 22.65 ? 257 MET B CE  1 
ATOM   4299  N N   . GLU B 1 177 ? -3.722  23.135   83.010  1.00 20.07 ? 258 GLU B N   1 
ATOM   4300  C CA  . GLU B 1 177 ? -3.520  24.175   82.007  1.00 21.14 ? 258 GLU B CA  1 
ATOM   4301  C C   . GLU B 1 177 ? -4.592  25.226   82.238  1.00 21.84 ? 258 GLU B C   1 
ATOM   4302  O O   . GLU B 1 177 ? -5.782  24.918   82.189  1.00 23.10 ? 258 GLU B O   1 
ATOM   4303  C CB  . GLU B 1 177 ? -3.615  23.553   80.620  1.00 20.40 ? 258 GLU B CB  1 
ATOM   4304  C CG  . GLU B 1 177 ? -2.553  22.472   80.455  1.00 23.04 ? 258 GLU B CG  1 
ATOM   4305  C CD  . GLU B 1 177 ? -2.698  21.613   79.207  1.00 24.54 ? 258 GLU B CD  1 
ATOM   4306  O OE1 . GLU B 1 177 ? -1.830  20.730   79.038  1.00 25.98 ? 258 GLU B OE1 1 
ATOM   4307  O OE2 . GLU B 1 177 ? -3.651  21.805   78.407  1.00 23.95 ? 258 GLU B OE2 1 
ATOM   4308  N N   . LYS B 1 178 ? -4.157  26.460   82.502  1.00 22.47 ? 259 LYS B N   1 
ATOM   4309  C CA  . LYS B 1 178 ? -5.047  27.580   82.819  1.00 24.12 ? 259 LYS B CA  1 
ATOM   4310  C C   . LYS B 1 178 ? -5.783  27.289   84.118  1.00 23.58 ? 259 LYS B C   1 
ATOM   4311  O O   . LYS B 1 178 ? -6.929  27.687   84.291  1.00 22.75 ? 259 LYS B O   1 
ATOM   4312  C CB  . LYS B 1 178 ? -6.068  27.836   81.709  1.00 26.04 ? 259 LYS B CB  1 
ATOM   4313  C CG  . LYS B 1 178 ? -5.486  28.545   80.519  1.00 31.25 ? 259 LYS B CG  1 
ATOM   4314  C CD  . LYS B 1 178 ? -6.529  28.782   79.438  1.00 34.19 ? 259 LYS B CD  1 
ATOM   4315  C CE  . LYS B 1 178 ? -5.879  29.408   78.203  1.00 37.03 ? 259 LYS B CE  1 
ATOM   4316  N NZ  . LYS B 1 178 ? -6.785  29.382   77.009  1.00 39.05 ? 259 LYS B NZ  1 
ATOM   4317  N N   . GLY B 1 179 ? -5.117  26.569   85.016  1.00 23.79 ? 260 GLY B N   1 
ATOM   4318  C CA  . GLY B 1 179 ? -5.706  26.245   86.304  1.00 23.66 ? 260 GLY B CA  1 
ATOM   4319  C C   . GLY B 1 179 ? -6.794  25.184   86.304  1.00 23.76 ? 260 GLY B C   1 
ATOM   4320  O O   . GLY B 1 179 ? -7.530  25.044   87.289  1.00 23.59 ? 260 GLY B O   1 
ATOM   4321  N N   . LYS B 1 180 ? -6.907  24.445   85.205  1.00 23.28 ? 261 LYS B N   1 
ATOM   4322  C CA  . LYS B 1 180 ? -7.897  23.375   85.098  1.00 23.40 ? 261 LYS B CA  1 
ATOM   4323  C C   . LYS B 1 180 ? -7.179  22.026   85.039  1.00 21.45 ? 261 LYS B C   1 
ATOM   4324  O O   . LYS B 1 180 ? -6.162  21.892   84.354  1.00 21.21 ? 261 LYS B O   1 
ATOM   4325  C CB  . LYS B 1 180 ? -8.748  23.561   83.838  1.00 24.90 ? 261 LYS B CB  1 
ATOM   4326  C CG  . LYS B 1 180 ? -9.752  22.451   83.591  1.00 28.66 ? 261 LYS B CG  1 
ATOM   4327  C CD  . LYS B 1 180 ? -10.685 22.806   82.439  1.00 31.84 ? 261 LYS B CD  1 
ATOM   4328  C CE  . LYS B 1 180 ? -11.748 23.834   82.869  1.00 35.62 ? 261 LYS B CE  1 
ATOM   4329  N NZ  . LYS B 1 180 ? -11.190 25.100   83.505  1.00 36.71 ? 261 LYS B NZ  1 
ATOM   4330  N N   . VAL B 1 181 ? -7.694  21.035   85.761  1.00 19.37 ? 262 VAL B N   1 
ATOM   4331  C CA  . VAL B 1 181 ? -7.074  19.719   85.747  1.00 18.74 ? 262 VAL B CA  1 
ATOM   4332  C C   . VAL B 1 181 ? -7.376  19.056   84.407  1.00 18.58 ? 262 VAL B C   1 
ATOM   4333  O O   . VAL B 1 181 ? -8.537  18.843   84.060  1.00 19.62 ? 262 VAL B O   1 
ATOM   4334  C CB  . VAL B 1 181 ? -7.613  18.805   86.871  1.00 18.07 ? 262 VAL B CB  1 
ATOM   4335  C CG1 . VAL B 1 181 ? -6.956  17.450   86.769  1.00 18.08 ? 262 VAL B CG1 1 
ATOM   4336  C CG2 . VAL B 1 181 ? -7.340  19.411   88.233  1.00 16.92 ? 262 VAL B CG2 1 
ATOM   4337  N N   . VAL B 1 182 ? -6.330  18.754   83.647  1.00 18.01 ? 263 VAL B N   1 
ATOM   4338  C CA  . VAL B 1 182 ? -6.490  18.110   82.348  1.00 18.35 ? 263 VAL B CA  1 
ATOM   4339  C C   . VAL B 1 182 ? -6.140  16.637   82.434  1.00 19.04 ? 263 VAL B C   1 
ATOM   4340  O O   . VAL B 1 182 ? -6.474  15.871   81.539  1.00 19.87 ? 263 VAL B O   1 
ATOM   4341  C CB  . VAL B 1 182 ? -5.610  18.758   81.245  1.00 17.03 ? 263 VAL B CB  1 
ATOM   4342  C CG1 . VAL B 1 182 ? -6.211  20.076   80.811  1.00 15.52 ? 263 VAL B CG1 1 
ATOM   4343  C CG2 . VAL B 1 182 ? -4.189  18.958   81.751  1.00 16.69 ? 263 VAL B CG2 1 
ATOM   4344  N N   . LYS B 1 183 ? -5.460  16.246   83.506  1.00 19.28 ? 264 LYS B N   1 
ATOM   4345  C CA  . LYS B 1 183 ? -5.097  14.846   83.706  1.00 19.44 ? 264 LYS B CA  1 
ATOM   4346  C C   . LYS B 1 183 ? -4.563  14.611   85.121  1.00 18.73 ? 264 LYS B C   1 
ATOM   4347  O O   . LYS B 1 183 ? -4.000  15.503   85.738  1.00 18.75 ? 264 LYS B O   1 
ATOM   4348  C CB  . LYS B 1 183 ? -4.053  14.409   82.668  1.00 20.01 ? 264 LYS B CB  1 
ATOM   4349  C CG  . LYS B 1 183 ? -3.678  12.941   82.770  1.00 20.97 ? 264 LYS B CG  1 
ATOM   4350  C CD  . LYS B 1 183 ? -2.841  12.465   81.594  1.00 21.87 ? 264 LYS B CD  1 
ATOM   4351  C CE  . LYS B 1 183 ? -2.537  10.973   81.735  1.00 23.31 ? 264 LYS B CE  1 
ATOM   4352  N NZ  . LYS B 1 183 ? -1.823  10.409   80.552  1.00 25.12 ? 264 LYS B NZ  1 
ATOM   4353  N N   . SER B 1 184 ? -4.759  13.408   85.636  1.00 19.02 ? 265 SER B N   1 
ATOM   4354  C CA  . SER B 1 184 ? -4.278  13.061   86.969  1.00 18.52 ? 265 SER B CA  1 
ATOM   4355  C C   . SER B 1 184 ? -3.995  11.564   86.982  1.00 19.33 ? 265 SER B C   1 
ATOM   4356  O O   . SER B 1 184 ? -4.610  10.795   86.237  1.00 18.05 ? 265 SER B O   1 
ATOM   4357  C CB  . SER B 1 184 ? -5.329  13.388   88.027  1.00 18.14 ? 265 SER B CB  1 
ATOM   4358  O OG  . SER B 1 184 ? -6.450  12.526   87.922  1.00 17.47 ? 265 SER B OG  1 
ATOM   4359  N N   . VAL B 1 185 ? -3.063  11.155   87.829  1.00 19.27 ? 266 VAL B N   1 
ATOM   4360  C CA  . VAL B 1 185 ? -2.704  9.757    87.926  1.00 19.22 ? 266 VAL B CA  1 
ATOM   4361  C C   . VAL B 1 185 ? -2.379  9.414    89.357  1.00 19.58 ? 266 VAL B C   1 
ATOM   4362  O O   . VAL B 1 185 ? -1.695  10.175   90.038  1.00 20.05 ? 266 VAL B O   1 
ATOM   4363  C CB  . VAL B 1 185 ? -1.477  9.447    87.048  1.00 20.58 ? 266 VAL B CB  1 
ATOM   4364  C CG1 . VAL B 1 185 ? -0.863  8.118    87.455  1.00 20.60 ? 266 VAL B CG1 1 
ATOM   4365  C CG2 . VAL B 1 185 ? -1.887  9.413    85.576  1.00 20.25 ? 266 VAL B CG2 1 
ATOM   4366  N N   . GLU B 1 186 ? -2.886  8.282    89.831  1.00 19.59 ? 267 GLU B N   1 
ATOM   4367  C CA  . GLU B 1 186 ? -2.571  7.886    91.187  1.00 20.46 ? 267 GLU B CA  1 
ATOM   4368  C C   . GLU B 1 186 ? -1.305  7.056    91.094  1.00 21.29 ? 267 GLU B C   1 
ATOM   4369  O O   . GLU B 1 186 ? -1.166  6.218    90.197  1.00 21.78 ? 267 GLU B O   1 
ATOM   4370  C CB  . GLU B 1 186 ? -3.683  7.053    91.833  1.00 19.45 ? 267 GLU B CB  1 
ATOM   4371  C CG  . GLU B 1 186 ? -3.395  6.797    93.322  1.00 18.62 ? 267 GLU B CG  1 
ATOM   4372  C CD  . GLU B 1 186 ? -4.504  6.077    94.061  1.00 19.35 ? 267 GLU B CD  1 
ATOM   4373  O OE1 . GLU B 1 186 ? -5.631  5.997    93.528  1.00 22.17 ? 267 GLU B OE1 1 
ATOM   4374  O OE2 . GLU B 1 186 ? -4.249  5.603    95.190  1.00 18.48 ? 267 GLU B OE2 1 
ATOM   4375  N N   . LEU B 1 187 ? -0.370  7.306    92.001  1.00 20.30 ? 268 LEU B N   1 
ATOM   4376  C CA  . LEU B 1 187 ? 0.863   6.546    91.992  1.00 21.28 ? 268 LEU B CA  1 
ATOM   4377  C C   . LEU B 1 187 ? 0.621   5.207    92.650  1.00 21.93 ? 268 LEU B C   1 
ATOM   4378  O O   . LEU B 1 187 ? -0.051  5.110    93.686  1.00 21.70 ? 268 LEU B O   1 
ATOM   4379  C CB  . LEU B 1 187 ? 1.972   7.260    92.762  1.00 20.20 ? 268 LEU B CB  1 
ATOM   4380  C CG  . LEU B 1 187 ? 2.427   8.627    92.258  1.00 20.51 ? 268 LEU B CG  1 
ATOM   4381  C CD1 . LEU B 1 187 ? 3.605   9.084    93.100  1.00 19.12 ? 268 LEU B CD1 1 
ATOM   4382  C CD2 . LEU B 1 187 ? 2.814   8.549    90.776  1.00 19.80 ? 268 LEU B CD2 1 
ATOM   4383  N N   . ASP B 1 188 ? 1.170   4.181    92.016  1.00 21.79 ? 269 ASP B N   1 
ATOM   4384  C CA  . ASP B 1 188 ? 1.114   2.819    92.510  1.00 21.58 ? 269 ASP B CA  1 
ATOM   4385  C C   . ASP B 1 188 ? 2.426   2.710    93.291  1.00 20.82 ? 269 ASP B C   1 
ATOM   4386  O O   . ASP B 1 188 ? 3.426   2.185    92.782  1.00 18.63 ? 269 ASP B O   1 
ATOM   4387  C CB  . ASP B 1 188 ? 1.100   1.854    91.322  1.00 23.08 ? 269 ASP B CB  1 
ATOM   4388  C CG  . ASP B 1 188 ? 1.075   0.408    91.748  1.00 24.49 ? 269 ASP B CG  1 
ATOM   4389  O OD1 . ASP B 1 188 ? 0.705   0.147    92.916  1.00 24.67 ? 269 ASP B OD1 1 
ATOM   4390  O OD2 . ASP B 1 188 ? 1.407   -0.460   90.906  1.00 26.00 ? 269 ASP B OD2 1 
ATOM   4391  N N   . ALA B 1 189 ? 2.412   3.236    94.516  1.00 19.49 ? 270 ALA B N   1 
ATOM   4392  C CA  . ALA B 1 189 ? 3.592   3.259    95.374  1.00 18.11 ? 270 ALA B CA  1 
ATOM   4393  C C   . ALA B 1 189 ? 3.454   2.520    96.703  1.00 17.15 ? 270 ALA B C   1 
ATOM   4394  O O   . ALA B 1 189 ? 3.618   3.109    97.775  1.00 17.19 ? 270 ALA B O   1 
ATOM   4395  C CB  . ALA B 1 189 ? 3.997   4.699    95.636  1.00 17.97 ? 270 ALA B CB  1 
ATOM   4396  N N   . PRO B 1 190 ? 3.152   1.218    96.655  1.00 16.42 ? 271 PRO B N   1 
ATOM   4397  C CA  . PRO B 1 190 ? 3.021   0.480    97.919  1.00 16.50 ? 271 PRO B CA  1 
ATOM   4398  C C   . PRO B 1 190 ? 4.312   0.549    98.740  1.00 15.37 ? 271 PRO B C   1 
ATOM   4399  O O   . PRO B 1 190 ? 5.410   0.404    98.212  1.00 15.04 ? 271 PRO B O   1 
ATOM   4400  C CB  . PRO B 1 190 ? 2.678   -0.940   97.462  1.00 15.96 ? 271 PRO B CB  1 
ATOM   4401  C CG  . PRO B 1 190 ? 3.248   -1.012   96.054  1.00 15.66 ? 271 PRO B CG  1 
ATOM   4402  C CD  . PRO B 1 190 ? 2.913   0.344    95.493  1.00 15.53 ? 271 PRO B CD  1 
ATOM   4403  N N   . ASN B 1 191 ? 4.149   0.787    100.032 1.00 15.75 ? 272 ASN B N   1 
ATOM   4404  C CA  . ASN B 1 191 ? 5.236   0.915    101.008 1.00 16.48 ? 272 ASN B CA  1 
ATOM   4405  C C   . ASN B 1 191 ? 5.924   2.277    101.028 1.00 16.46 ? 272 ASN B C   1 
ATOM   4406  O O   . ASN B 1 191 ? 6.747   2.545    101.894 1.00 16.17 ? 272 ASN B O   1 
ATOM   4407  C CB  . ASN B 1 191 ? 6.298   -0.171   100.836 1.00 15.12 ? 272 ASN B CB  1 
ATOM   4408  C CG  . ASN B 1 191 ? 7.185   -0.295   102.065 1.00 14.75 ? 272 ASN B CG  1 
ATOM   4409  O OD1 . ASN B 1 191 ? 6.689   -0.502   103.169 1.00 13.50 ? 272 ASN B OD1 1 
ATOM   4410  N ND2 . ASN B 1 191 ? 8.493   -0.159   101.882 1.00 15.33 ? 272 ASN B ND2 1 
ATOM   4411  N N   . TYR B 1 192 ? 5.591   3.131    100.070 1.00 17.92 ? 273 TYR B N   1 
ATOM   4412  C CA  . TYR B 1 192 ? 6.170   4.466    100.011 1.00 18.43 ? 273 TYR B CA  1 
ATOM   4413  C C   . TYR B 1 192 ? 5.247   5.405    100.776 1.00 19.00 ? 273 TYR B C   1 
ATOM   4414  O O   . TYR B 1 192 ? 4.095   5.072    101.052 1.00 18.81 ? 273 TYR B O   1 
ATOM   4415  C CB  . TYR B 1 192 ? 6.244   4.969    98.570  1.00 19.49 ? 273 TYR B CB  1 
ATOM   4416  C CG  . TYR B 1 192 ? 7.348   4.409    97.699  1.00 20.48 ? 273 TYR B CG  1 
ATOM   4417  C CD1 . TYR B 1 192 ? 7.365   3.068    97.321  1.00 19.13 ? 273 TYR B CD1 1 
ATOM   4418  C CD2 . TYR B 1 192 ? 8.338   5.255    97.179  1.00 20.41 ? 273 TYR B CD2 1 
ATOM   4419  C CE1 . TYR B 1 192 ? 8.336   2.587    96.440  1.00 19.91 ? 273 TYR B CE1 1 
ATOM   4420  C CE2 . TYR B 1 192 ? 9.307   4.786    96.303  1.00 19.12 ? 273 TYR B CE2 1 
ATOM   4421  C CZ  . TYR B 1 192 ? 9.304   3.458    95.937  1.00 19.40 ? 273 TYR B CZ  1 
ATOM   4422  O OH  . TYR B 1 192 ? 10.273  3.002    95.080  1.00 18.38 ? 273 TYR B OH  1 
ATOM   4423  N N   . HIS B 1 193 ? 5.748   6.585    101.111 1.00 18.04 ? 274 HIS B N   1 
ATOM   4424  C CA  . HIS B 1 193 ? 4.923   7.573    101.790 1.00 17.27 ? 274 HIS B CA  1 
ATOM   4425  C C   . HIS B 1 193 ? 5.335   8.933    101.265 1.00 15.84 ? 274 HIS B C   1 
ATOM   4426  O O   . HIS B 1 193 ? 6.489   9.334    101.402 1.00 15.56 ? 274 HIS B O   1 
ATOM   4427  C CB  . HIS B 1 193 ? 5.114   7.502    103.302 1.00 16.70 ? 274 HIS B CB  1 
ATOM   4428  C CG  . HIS B 1 193 ? 4.028   8.177    104.071 1.00 16.06 ? 274 HIS B CG  1 
ATOM   4429  N ND1 . HIS B 1 193 ? 4.233   9.335    104.794 1.00 17.58 ? 274 HIS B ND1 1 
ATOM   4430  C CD2 . HIS B 1 193 ? 2.728   7.847    104.256 1.00 17.39 ? 274 HIS B CD2 1 
ATOM   4431  C CE1 . HIS B 1 193 ? 3.109   9.684    105.392 1.00 17.71 ? 274 HIS B CE1 1 
ATOM   4432  N NE2 . HIS B 1 193 ? 2.177   8.796    105.084 1.00 16.85 ? 274 HIS B NE2 1 
ATOM   4433  N N   . TYR B 1 194 ? 4.391   9.625    100.637 1.00 15.82 ? 275 TYR B N   1 
ATOM   4434  C CA  . TYR B 1 194 ? 4.657   10.941   100.063 1.00 16.07 ? 275 TYR B CA  1 
ATOM   4435  C C   . TYR B 1 194 ? 3.913   12.095   100.714 1.00 16.81 ? 275 TYR B C   1 
ATOM   4436  O O   . TYR B 1 194 ? 2.683   12.087   100.789 1.00 14.83 ? 275 TYR B O   1 
ATOM   4437  C CB  . TYR B 1 194 ? 4.317   10.965   98.570  1.00 14.51 ? 275 TYR B CB  1 
ATOM   4438  C CG  . TYR B 1 194 ? 5.248   10.164   97.708  1.00 14.95 ? 275 TYR B CG  1 
ATOM   4439  C CD1 . TYR B 1 194 ? 4.901   8.890    97.275  1.00 14.67 ? 275 TYR B CD1 1 
ATOM   4440  C CD2 . TYR B 1 194 ? 6.481   10.681   97.326  1.00 14.72 ? 275 TYR B CD2 1 
ATOM   4441  C CE1 . TYR B 1 194 ? 5.754   8.149    96.474  1.00 15.09 ? 275 TYR B CE1 1 
ATOM   4442  C CE2 . TYR B 1 194 ? 7.349   9.951    96.535  1.00 14.58 ? 275 TYR B CE2 1 
ATOM   4443  C CZ  . TYR B 1 194 ? 6.981   8.686    96.106  1.00 15.47 ? 275 TYR B CZ  1 
ATOM   4444  O OH  . TYR B 1 194 ? 7.832   7.968    95.301  1.00 14.40 ? 275 TYR B OH  1 
ATOM   4445  N N   . GLU B 1 195 ? 4.673   13.095   101.160 1.00 18.58 ? 276 GLU B N   1 
ATOM   4446  C CA  . GLU B 1 195 ? 4.098   14.292   101.762 1.00 18.63 ? 276 GLU B CA  1 
ATOM   4447  C C   . GLU B 1 195 ? 4.927   15.557   101.559 1.00 17.85 ? 276 GLU B C   1 
ATOM   4448  O O   . GLU B 1 195 ? 6.162   15.519   101.553 1.00 18.40 ? 276 GLU B O   1 
ATOM   4449  C CB  . GLU B 1 195 ? 3.806   14.062   103.249 1.00 18.02 ? 276 GLU B CB  1 
ATOM   4450  C CG  . GLU B 1 195 ? 2.306   14.013   103.505 1.00 19.98 ? 276 GLU B CG  1 
ATOM   4451  C CD  . GLU B 1 195 ? 1.933   13.280   104.765 1.00 21.97 ? 276 GLU B CD  1 
ATOM   4452  O OE1 . GLU B 1 195 ? 0.727   13.049   104.988 1.00 23.91 ? 276 GLU B OE1 1 
ATOM   4453  O OE2 . GLU B 1 195 ? 2.835   12.935   105.545 1.00 24.27 ? 276 GLU B OE2 1 
ATOM   4454  N N   . GLU B 1 196 ? 4.222   16.670   101.359 1.00 17.08 ? 277 GLU B N   1 
ATOM   4455  C CA  . GLU B 1 196 ? 4.826   17.989   101.158 1.00 16.29 ? 277 GLU B CA  1 
ATOM   4456  C C   . GLU B 1 196 ? 6.004   17.999   100.178 1.00 17.04 ? 277 GLU B C   1 
ATOM   4457  O O   . GLU B 1 196 ? 7.099   18.461   100.508 1.00 19.43 ? 277 GLU B O   1 
ATOM   4458  C CB  . GLU B 1 196 ? 5.263   18.553   102.515 1.00 14.44 ? 277 GLU B CB  1 
ATOM   4459  C CG  . GLU B 1 196 ? 4.185   18.429   103.578 1.00 14.63 ? 277 GLU B CG  1 
ATOM   4460  C CD  . GLU B 1 196 ? 4.656   18.847   104.956 1.00 16.20 ? 277 GLU B CD  1 
ATOM   4461  O OE1 . GLU B 1 196 ? 5.785   18.486   105.337 1.00 19.53 ? 277 GLU B OE1 1 
ATOM   4462  O OE2 . GLU B 1 196 ? 3.895   19.522   105.673 1.00 17.36 ? 277 GLU B OE2 1 
ATOM   4463  N N   . CYS B 1 197 ? 5.774   17.511   98.965  1.00 16.84 ? 278 CYS B N   1 
ATOM   4464  C CA  . CYS B 1 197 ? 6.816   17.458   97.944  1.00 17.56 ? 278 CYS B CA  1 
ATOM   4465  C C   . CYS B 1 197 ? 7.339   18.801   97.428  1.00 17.43 ? 278 CYS B C   1 
ATOM   4466  O O   . CYS B 1 197 ? 6.575   19.749   97.243  1.00 16.21 ? 278 CYS B O   1 
ATOM   4467  C CB  . CYS B 1 197 ? 6.321   16.681   96.728  1.00 19.14 ? 278 CYS B CB  1 
ATOM   4468  S SG  . CYS B 1 197 ? 5.951   14.924   96.983  1.00 23.03 ? 278 CYS B SG  1 
ATOM   4469  N N   . SER B 1 198 ? 8.649   18.855   97.180  1.00 17.98 ? 279 SER B N   1 
ATOM   4470  C CA  . SER B 1 198 ? 9.312   20.036   96.616  1.00 18.31 ? 279 SER B CA  1 
ATOM   4471  C C   . SER B 1 198 ? 9.636   19.619   95.182  1.00 18.31 ? 279 SER B C   1 
ATOM   4472  O O   . SER B 1 198 ? 10.530  18.811   94.953  1.00 19.05 ? 279 SER B O   1 
ATOM   4473  C CB  . SER B 1 198 ? 10.597  20.362   97.378  1.00 17.21 ? 279 SER B CB  1 
ATOM   4474  O OG  . SER B 1 198 ? 10.307  20.662   98.731  1.00 17.11 ? 279 SER B OG  1 
ATOM   4475  N N   . CYS B 1 199 ? 8.885   20.156   94.229  1.00 18.47 ? 280 CYS B N   1 
ATOM   4476  C CA  . CYS B 1 199 ? 9.052   19.808   92.825  1.00 18.78 ? 280 CYS B CA  1 
ATOM   4477  C C   . CYS B 1 199 ? 9.643   20.902   91.947  1.00 18.31 ? 280 CYS B C   1 
ATOM   4478  O O   . CYS B 1 199 ? 9.288   22.068   92.053  1.00 18.60 ? 280 CYS B O   1 
ATOM   4479  C CB  . CYS B 1 199 ? 7.708   19.410   92.227  1.00 19.76 ? 280 CYS B CB  1 
ATOM   4480  S SG  . CYS B 1 199 ? 6.732   18.128   93.081  1.00 22.98 ? 280 CYS B SG  1 
ATOM   4481  N N   . TYR B 1 200 ? 10.533  20.511   91.051  1.00 17.37 ? 281 TYR B N   1 
ATOM   4482  C CA  . TYR B 1 200 ? 11.145  21.463   90.153  1.00 17.20 ? 281 TYR B CA  1 
ATOM   4483  C C   . TYR B 1 200 ? 11.164  20.911   88.740  1.00 17.44 ? 281 TYR B C   1 
ATOM   4484  O O   . TYR B 1 200 ? 11.068  19.702   88.534  1.00 17.69 ? 281 TYR B O   1 
ATOM   4485  C CB  . TYR B 1 200 ? 12.575  21.792   90.600  1.00 18.28 ? 281 TYR B CB  1 
ATOM   4486  C CG  . TYR B 1 200 ? 13.530  20.614   90.656  1.00 18.64 ? 281 TYR B CG  1 
ATOM   4487  C CD1 . TYR B 1 200 ? 13.683  19.868   91.828  1.00 18.82 ? 281 TYR B CD1 1 
ATOM   4488  C CD2 . TYR B 1 200 ? 14.309  20.266   89.546  1.00 17.68 ? 281 TYR B CD2 1 
ATOM   4489  C CE1 . TYR B 1 200 ? 14.594  18.809   91.894  1.00 17.97 ? 281 TYR B CE1 1 
ATOM   4490  C CE2 . TYR B 1 200 ? 15.219  19.209   89.601  1.00 17.39 ? 281 TYR B CE2 1 
ATOM   4491  C CZ  . TYR B 1 200 ? 15.358  18.489   90.778  1.00 18.00 ? 281 TYR B CZ  1 
ATOM   4492  O OH  . TYR B 1 200 ? 16.280  17.469   90.847  1.00 18.23 ? 281 TYR B OH  1 
ATOM   4493  N N   . PRO B 1 201 ? 11.244  21.800   87.741  1.00 17.31 ? 282 PRO B N   1 
ATOM   4494  C CA  . PRO B 1 201 ? 11.278  21.345   86.353  1.00 17.58 ? 282 PRO B CA  1 
ATOM   4495  C C   . PRO B 1 201 ? 12.722  21.265   85.858  1.00 19.06 ? 282 PRO B C   1 
ATOM   4496  O O   . PRO B 1 201 ? 13.536  22.143   86.149  1.00 19.15 ? 282 PRO B O   1 
ATOM   4497  C CB  . PRO B 1 201 ? 10.480  22.421   85.632  1.00 16.70 ? 282 PRO B CB  1 
ATOM   4498  C CG  . PRO B 1 201 ? 10.900  23.645   86.363  1.00 16.05 ? 282 PRO B CG  1 
ATOM   4499  C CD  . PRO B 1 201 ? 10.845  23.216   87.809  1.00 15.33 ? 282 PRO B CD  1 
ATOM   4500  N N   . ASN B 1 202 ? 13.039  20.197   85.131  1.00 20.06 ? 283 ASN B N   1 
ATOM   4501  C CA  . ASN B 1 202 ? 14.372  20.021   84.569  1.00 20.72 ? 283 ASN B CA  1 
ATOM   4502  C C   . ASN B 1 202 ? 14.272  19.293   83.236  1.00 20.02 ? 283 ASN B C   1 
ATOM   4503  O O   . ASN B 1 202 ? 13.726  18.193   83.149  1.00 18.97 ? 283 ASN B O   1 
ATOM   4504  C CB  . ASN B 1 202 ? 15.281  19.243   85.532  1.00 24.27 ? 283 ASN B CB  1 
ATOM   4505  C CG  . ASN B 1 202 ? 16.707  19.062   84.978  1.00 27.63 ? 283 ASN B CG  1 
ATOM   4506  O OD1 . ASN B 1 202 ? 16.977  18.141   84.199  1.00 30.26 ? 283 ASN B OD1 1 
ATOM   4507  N ND2 . ASN B 1 202 ? 17.614  19.956   85.363  1.00 28.53 ? 283 ASN B ND2 1 
ATOM   4508  N N   . ALA B 1 203 ? 14.780  19.931   82.188  1.00 20.27 ? 284 ALA B N   1 
ATOM   4509  C CA  . ALA B 1 203 ? 14.768  19.347   80.851  1.00 19.77 ? 284 ALA B CA  1 
ATOM   4510  C C   . ALA B 1 203 ? 13.398  18.826   80.442  1.00 19.70 ? 284 ALA B C   1 
ATOM   4511  O O   . ALA B 1 203 ? 13.267  17.703   79.966  1.00 20.11 ? 284 ALA B O   1 
ATOM   4512  C CB  . ALA B 1 203 ? 15.796  18.220   80.768  1.00 18.89 ? 284 ALA B CB  1 
ATOM   4513  N N   . GLY B 1 204 ? 12.374  19.640   80.645  1.00 20.28 ? 285 GLY B N   1 
ATOM   4514  C CA  . GLY B 1 204 ? 11.036  19.246   80.255  1.00 20.73 ? 285 GLY B CA  1 
ATOM   4515  C C   . GLY B 1 204 ? 10.348  18.218   81.127  1.00 21.47 ? 285 GLY B C   1 
ATOM   4516  O O   . GLY B 1 204 ? 9.262   17.765   80.773  1.00 22.05 ? 285 GLY B O   1 
ATOM   4517  N N   . GLU B 1 205 ? 10.953  17.847   82.255  1.00 21.92 ? 286 GLU B N   1 
ATOM   4518  C CA  . GLU B 1 205 ? 10.341  16.864   83.153  1.00 21.93 ? 286 GLU B CA  1 
ATOM   4519  C C   . GLU B 1 205 ? 10.371  17.349   84.596  1.00 20.73 ? 286 GLU B C   1 
ATOM   4520  O O   . GLU B 1 205 ? 11.216  18.155   84.954  1.00 22.02 ? 286 GLU B O   1 
ATOM   4521  C CB  . GLU B 1 205 ? 11.069  15.526   83.053  1.00 23.64 ? 286 GLU B CB  1 
ATOM   4522  C CG  . GLU B 1 205 ? 10.988  14.866   81.687  1.00 27.14 ? 286 GLU B CG  1 
ATOM   4523  C CD  . GLU B 1 205 ? 11.436  13.410   81.726  1.00 29.58 ? 286 GLU B CD  1 
ATOM   4524  O OE1 . GLU B 1 205 ? 11.078  12.712   82.695  1.00 31.71 ? 286 GLU B OE1 1 
ATOM   4525  O OE2 . GLU B 1 205 ? 12.130  12.952   80.791  1.00 32.86 ? 286 GLU B OE2 1 
ATOM   4526  N N   . ILE B 1 206 ? 9.458   16.856   85.425  1.00 19.78 ? 287 ILE B N   1 
ATOM   4527  C CA  . ILE B 1 206 ? 9.406   17.272   86.822  1.00 19.28 ? 287 ILE B CA  1 
ATOM   4528  C C   . ILE B 1 206 ? 10.072  16.266   87.750  1.00 19.94 ? 287 ILE B C   1 
ATOM   4529  O O   . ILE B 1 206 ? 10.008  15.060   87.525  1.00 21.56 ? 287 ILE B O   1 
ATOM   4530  C CB  . ILE B 1 206 ? 7.952   17.446   87.319  1.00 19.02 ? 287 ILE B CB  1 
ATOM   4531  C CG1 . ILE B 1 206 ? 7.221   18.482   86.472  1.00 18.21 ? 287 ILE B CG1 1 
ATOM   4532  C CG2 . ILE B 1 206 ? 7.951   17.894   88.780  1.00 18.85 ? 287 ILE B CG2 1 
ATOM   4533  C CD1 . ILE B 1 206 ? 7.043   18.081   85.049  1.00 19.57 ? 287 ILE B CD1 1 
ATOM   4534  N N   . THR B 1 207 ? 10.702  16.769   88.803  1.00 19.64 ? 288 THR B N   1 
ATOM   4535  C CA  . THR B 1 207 ? 11.342  15.914   89.789  1.00 19.89 ? 288 THR B CA  1 
ATOM   4536  C C   . THR B 1 207 ? 10.905  16.420   91.155  1.00 20.99 ? 288 THR B C   1 
ATOM   4537  O O   . THR B 1 207 ? 10.988  17.619   91.435  1.00 20.36 ? 288 THR B O   1 
ATOM   4538  C CB  . THR B 1 207 ? 12.886  15.983   89.697  1.00 20.85 ? 288 THR B CB  1 
ATOM   4539  O OG1 . THR B 1 207 ? 13.310  15.412   88.454  1.00 22.10 ? 288 THR B OG1 1 
ATOM   4540  C CG2 . THR B 1 207 ? 13.539  15.221   90.854  1.00 17.71 ? 288 THR B CG2 1 
ATOM   4541  N N   . CYS B 1 208 ? 10.433  15.514   92.003  1.00 20.47 ? 289 CYS B N   1 
ATOM   4542  C CA  . CYS B 1 208 ? 9.998   15.910   93.332  1.00 19.83 ? 289 CYS B CA  1 
ATOM   4543  C C   . CYS B 1 208 ? 10.670  15.103   94.426  1.00 19.76 ? 289 CYS B C   1 
ATOM   4544  O O   . CYS B 1 208 ? 10.717  13.877   94.359  1.00 20.86 ? 289 CYS B O   1 
ATOM   4545  C CB  . CYS B 1 208 ? 8.499   15.709   93.498  1.00 20.96 ? 289 CYS B CB  1 
ATOM   4546  S SG  . CYS B 1 208 ? 7.377   16.391   92.254  1.00 20.33 ? 289 CYS B SG  1 
ATOM   4547  N N   . VAL B 1 209 ? 11.167  15.793   95.445  1.00 17.57 ? 290 VAL B N   1 
ATOM   4548  C CA  . VAL B 1 209 ? 11.784  15.143   96.589  1.00 16.02 ? 290 VAL B CA  1 
ATOM   4549  C C   . VAL B 1 209 ? 10.807  15.485   97.706  1.00 16.62 ? 290 VAL B C   1 
ATOM   4550  O O   . VAL B 1 209 ? 10.431  16.646   97.867  1.00 16.77 ? 290 VAL B O   1 
ATOM   4551  C CB  . VAL B 1 209 ? 13.170  15.721   96.858  1.00 16.48 ? 290 VAL B CB  1 
ATOM   4552  C CG1 . VAL B 1 209 ? 13.766  15.103   98.101  1.00 16.37 ? 290 VAL B CG1 1 
ATOM   4553  C CG2 . VAL B 1 209 ? 14.059  15.454   95.659  1.00 15.57 ? 290 VAL B CG2 1 
ATOM   4554  N N   . CYS B 1 210 ? 10.389  14.481   98.473  1.00 17.79 ? 291 CYS B N   1 
ATOM   4555  C CA  . CYS B 1 210 ? 9.374   14.693   99.501  1.00 17.34 ? 291 CYS B CA  1 
ATOM   4556  C C   . CYS B 1 210 ? 9.679   14.211   100.925 1.00 17.02 ? 291 CYS B C   1 
ATOM   4557  O O   . CYS B 1 210 ? 10.821  13.942   101.285 1.00 16.37 ? 291 CYS B O   1 
ATOM   4558  C CB  . CYS B 1 210 ? 8.069   14.052   99.016  1.00 19.02 ? 291 CYS B CB  1 
ATOM   4559  S SG  . CYS B 1 210 ? 7.802   14.081   97.194  1.00 21.19 ? 291 CYS B SG  1 
ATOM   4560  N N   . ARG B 1 211 ? 8.630   14.097   101.733 1.00 16.98 ? 292 ARG B N   1 
ATOM   4561  C CA  . ARG B 1 211 ? 8.762   13.683   103.127 1.00 15.97 ? 292 ARG B CA  1 
ATOM   4562  C C   . ARG B 1 211 ? 8.012   12.401   103.498 1.00 16.42 ? 292 ARG B C   1 
ATOM   4563  O O   . ARG B 1 211 ? 6.810   12.303   103.289 1.00 17.50 ? 292 ARG B O   1 
ATOM   4564  C CB  . ARG B 1 211 ? 8.282   14.832   104.022 1.00 14.09 ? 292 ARG B CB  1 
ATOM   4565  C CG  . ARG B 1 211 ? 7.909   14.478   105.453 1.00 14.90 ? 292 ARG B CG  1 
ATOM   4566  C CD  . ARG B 1 211 ? 7.345   15.711   106.147 1.00 15.02 ? 292 ARG B CD  1 
ATOM   4567  N NE  . ARG B 1 211 ? 6.887   15.471   107.515 1.00 17.44 ? 292 ARG B NE  1 
ATOM   4568  C CZ  . ARG B 1 211 ? 6.399   16.420   108.319 1.00 17.40 ? 292 ARG B CZ  1 
ATOM   4569  N NH1 . ARG B 1 211 ? 6.001   16.118   109.549 1.00 17.50 ? 292 ARG B NH1 1 
ATOM   4570  N NH2 . ARG B 1 211 ? 6.313   17.674   107.901 1.00 14.00 ? 292 ARG B NH2 1 
ATOM   4571  N N   . ASP B 1 212 ? 8.728   11.417   104.038 1.00 17.18 ? 293 ASP B N   1 
ATOM   4572  C CA  . ASP B 1 212 ? 8.099   10.177   104.497 1.00 17.27 ? 293 ASP B CA  1 
ATOM   4573  C C   . ASP B 1 212 ? 7.921   10.330   106.014 1.00 16.44 ? 293 ASP B C   1 
ATOM   4574  O O   . ASP B 1 212 ? 8.870   10.211   106.795 1.00 17.74 ? 293 ASP B O   1 
ATOM   4575  C CB  . ASP B 1 212 ? 8.968   8.956    104.173 1.00 18.32 ? 293 ASP B CB  1 
ATOM   4576  C CG  . ASP B 1 212 ? 8.387   7.659    104.734 1.00 19.92 ? 293 ASP B CG  1 
ATOM   4577  O OD1 . ASP B 1 212 ? 8.721   6.575    104.199 1.00 20.33 ? 293 ASP B OD1 1 
ATOM   4578  O OD2 . ASP B 1 212 ? 7.611   7.722    105.715 1.00 19.57 ? 293 ASP B OD2 1 
ATOM   4579  N N   . ASN B 1 213 ? 6.687   10.612   106.406 1.00 16.35 ? 294 ASN B N   1 
ATOM   4580  C CA  . ASN B 1 213 ? 6.305   10.840   107.796 1.00 17.07 ? 294 ASN B CA  1 
ATOM   4581  C C   . ASN B 1 213 ? 5.900   9.535    108.478 1.00 17.54 ? 294 ASN B C   1 
ATOM   4582  O O   . ASN B 1 213 ? 5.710   9.482    109.687 1.00 15.59 ? 294 ASN B O   1 
ATOM   4583  C CB  . ASN B 1 213 ? 5.125   11.821   107.819 1.00 16.91 ? 294 ASN B CB  1 
ATOM   4584  C CG  . ASN B 1 213 ? 4.972   12.549   109.148 1.00 17.76 ? 294 ASN B CG  1 
ATOM   4585  O OD1 . ASN B 1 213 ? 5.851   13.296   109.566 1.00 16.62 ? 294 ASN B OD1 1 
ATOM   4586  N ND2 . ASN B 1 213 ? 3.836   12.346   109.807 1.00 20.01 ? 294 ASN B ND2 1 
ATOM   4587  N N   . TRP B 1 214 ? 5.773   8.486    107.678 1.00 18.18 ? 295 TRP B N   1 
ATOM   4588  C CA  . TRP B 1 214 ? 5.363   7.176    108.162 1.00 18.41 ? 295 TRP B CA  1 
ATOM   4589  C C   . TRP B 1 214 ? 6.504   6.315    108.730 1.00 19.31 ? 295 TRP B C   1 
ATOM   4590  O O   . TRP B 1 214 ? 6.496   5.985    109.922 1.00 18.67 ? 295 TRP B O   1 
ATOM   4591  C CB  . TRP B 1 214 ? 4.632   6.476    107.019 1.00 16.44 ? 295 TRP B CB  1 
ATOM   4592  C CG  . TRP B 1 214 ? 4.361   5.036    107.160 1.00 15.43 ? 295 TRP B CG  1 
ATOM   4593  C CD1 . TRP B 1 214 ? 4.254   4.312    108.314 1.00 13.97 ? 295 TRP B CD1 1 
ATOM   4594  C CD2 . TRP B 1 214 ? 4.058   4.140    106.091 1.00 15.62 ? 295 TRP B CD2 1 
ATOM   4595  N NE1 . TRP B 1 214 ? 3.898   3.015    108.024 1.00 14.85 ? 295 TRP B NE1 1 
ATOM   4596  C CE2 . TRP B 1 214 ? 3.771   2.883    106.662 1.00 15.61 ? 295 TRP B CE2 1 
ATOM   4597  C CE3 . TRP B 1 214 ? 3.998   4.279    104.698 1.00 15.46 ? 295 TRP B CE3 1 
ATOM   4598  C CZ2 . TRP B 1 214 ? 3.430   1.771    105.890 1.00 16.43 ? 295 TRP B CZ2 1 
ATOM   4599  C CZ3 . TRP B 1 214 ? 3.657   3.173    103.928 1.00 17.56 ? 295 TRP B CZ3 1 
ATOM   4600  C CH2 . TRP B 1 214 ? 3.379   1.935    104.525 1.00 17.88 ? 295 TRP B CH2 1 
ATOM   4601  N N   . HIS B 1 215 ? 7.490   5.977    107.896 1.00 19.15 ? 296 HIS B N   1 
ATOM   4602  C CA  . HIS B 1 215 ? 8.604   5.138    108.343 1.00 18.01 ? 296 HIS B CA  1 
ATOM   4603  C C   . HIS B 1 215 ? 9.937   5.366    107.618 1.00 19.03 ? 296 HIS B C   1 
ATOM   4604  O O   . HIS B 1 215 ? 10.735  4.430    107.470 1.00 18.14 ? 296 HIS B O   1 
ATOM   4605  C CB  . HIS B 1 215 ? 8.208   3.666    108.206 1.00 16.99 ? 296 HIS B CB  1 
ATOM   4606  C CG  . HIS B 1 215 ? 7.706   3.303    106.839 1.00 14.31 ? 296 HIS B CG  1 
ATOM   4607  N ND1 . HIS B 1 215 ? 8.017   4.030    105.720 1.00 14.19 ? 296 HIS B ND1 1 
ATOM   4608  C CD2 . HIS B 1 215 ? 6.947   2.263    106.421 1.00 13.51 ? 296 HIS B CD2 1 
ATOM   4609  C CE1 . HIS B 1 215 ? 7.470   3.454    104.656 1.00 12.16 ? 296 HIS B CE1 1 
ATOM   4610  N NE2 . HIS B 1 215 ? 6.819   2.386    105.057 1.00 11.91 ? 296 HIS B NE2 1 
ATOM   4611  N N   . GLY B 1 216 ? 10.185  6.602    107.182 1.00 19.73 ? 297 GLY B N   1 
ATOM   4612  C CA  . GLY B 1 216 ? 11.418  6.906    106.471 1.00 20.25 ? 297 GLY B CA  1 
ATOM   4613  C C   . GLY B 1 216 ? 12.245  8.066    107.007 1.00 20.86 ? 297 GLY B C   1 
ATOM   4614  O O   . GLY B 1 216 ? 11.711  9.127    107.360 1.00 23.44 ? 297 GLY B O   1 
ATOM   4615  N N   . SER B 1 217 ? 13.558  7.849    107.062 1.00 21.54 ? 298 SER B N   1 
ATOM   4616  C CA  . SER B 1 217 ? 14.531  8.837    107.536 1.00 21.07 ? 298 SER B CA  1 
ATOM   4617  C C   . SER B 1 217 ? 15.217  9.456    106.338 1.00 19.84 ? 298 SER B C   1 
ATOM   4618  O O   . SER B 1 217 ? 15.918  10.464   106.458 1.00 19.22 ? 298 SER B O   1 
ATOM   4619  C CB  . SER B 1 217 ? 15.608  8.183    108.397 1.00 20.54 ? 298 SER B CB  1 
ATOM   4620  O OG  . SER B 1 217 ? 15.084  7.773    109.633 1.00 26.02 ? 298 SER B OG  1 
ATOM   4621  N N   . ASN B 1 218 ? 15.061  8.804    105.193 1.00 18.10 ? 299 ASN B N   1 
ATOM   4622  C CA  . ASN B 1 218 ? 15.631  9.301    103.954 1.00 17.12 ? 299 ASN B CA  1 
ATOM   4623  C C   . ASN B 1 218 ? 14.425  9.801    103.181 1.00 16.71 ? 299 ASN B C   1 
ATOM   4624  O O   . ASN B 1 218 ? 13.293  9.449    103.503 1.00 16.07 ? 299 ASN B O   1 
ATOM   4625  C CB  . ASN B 1 218 ? 16.359  8.182    103.200 1.00 17.17 ? 299 ASN B CB  1 
ATOM   4626  C CG  . ASN B 1 218 ? 15.480  6.966    102.963 1.00 17.45 ? 299 ASN B CG  1 
ATOM   4627  O OD1 . ASN B 1 218 ? 14.755  6.532    103.853 1.00 17.54 ? 299 ASN B OD1 1 
ATOM   4628  N ND2 . ASN B 1 218 ? 15.555  6.405    101.768 1.00 17.91 ? 299 ASN B ND2 1 
ATOM   4629  N N   . ARG B 1 219 ? 14.653  10.609   102.160 1.00 16.12 ? 300 ARG B N   1 
ATOM   4630  C CA  . ARG B 1 219 ? 13.542  11.163   101.419 1.00 16.70 ? 300 ARG B CA  1 
ATOM   4631  C C   . ARG B 1 219 ? 13.144  10.443   100.143 1.00 17.05 ? 300 ARG B C   1 
ATOM   4632  O O   . ARG B 1 219 ? 13.996  10.013   99.364  1.00 18.28 ? 300 ARG B O   1 
ATOM   4633  C CB  . ARG B 1 219 ? 13.831  12.634   101.112 1.00 15.83 ? 300 ARG B CB  1 
ATOM   4634  C CG  . ARG B 1 219 ? 14.002  13.473   102.363 1.00 15.24 ? 300 ARG B CG  1 
ATOM   4635  C CD  . ARG B 1 219 ? 14.237  14.929   102.030 1.00 16.62 ? 300 ARG B CD  1 
ATOM   4636  N NE  . ARG B 1 219 ? 14.177  15.764   103.230 1.00 17.66 ? 300 ARG B NE  1 
ATOM   4637  C CZ  . ARG B 1 219 ? 13.063  16.031   103.911 1.00 15.63 ? 300 ARG B CZ  1 
ATOM   4638  N NH1 . ARG B 1 219 ? 13.115  16.797   104.990 1.00 13.71 ? 300 ARG B NH1 1 
ATOM   4639  N NH2 . ARG B 1 219 ? 11.897  15.542   103.508 1.00 13.54 ? 300 ARG B NH2 1 
ATOM   4640  N N   . PRO B 1 220 ? 11.829  10.284   99.924  1.00 16.41 ? 301 PRO B N   1 
ATOM   4641  C CA  . PRO B 1 220 ? 11.318  9.620    98.722  1.00 16.75 ? 301 PRO B CA  1 
ATOM   4642  C C   . PRO B 1 220 ? 11.177  10.638   97.580  1.00 16.74 ? 301 PRO B C   1 
ATOM   4643  O O   . PRO B 1 220 ? 11.018  11.835   97.833  1.00 16.89 ? 301 PRO B O   1 
ATOM   4644  C CB  . PRO B 1 220 ? 9.971   9.088    99.181  1.00 15.58 ? 301 PRO B CB  1 
ATOM   4645  C CG  . PRO B 1 220 ? 9.519   10.158   100.109 1.00 15.88 ? 301 PRO B CG  1 
ATOM   4646  C CD  . PRO B 1 220 ? 10.760  10.440   100.923 1.00 14.89 ? 301 PRO B CD  1 
ATOM   4647  N N   . TRP B 1 221 ? 11.233  10.163   96.336  1.00 16.32 ? 302 TRP B N   1 
ATOM   4648  C CA  . TRP B 1 221 ? 11.093  11.039   95.176  1.00 17.34 ? 302 TRP B CA  1 
ATOM   4649  C C   . TRP B 1 221 ? 10.154  10.478   94.116  1.00 18.24 ? 302 TRP B C   1 
ATOM   4650  O O   . TRP B 1 221 ? 9.802   9.301    94.145  1.00 20.69 ? 302 TRP B O   1 
ATOM   4651  C CB  . TRP B 1 221 ? 12.455  11.311   94.527  1.00 17.54 ? 302 TRP B CB  1 
ATOM   4652  C CG  . TRP B 1 221 ? 13.206  10.073   94.118  1.00 17.32 ? 302 TRP B CG  1 
ATOM   4653  C CD1 . TRP B 1 221 ? 14.073  9.352    94.886  1.00 17.57 ? 302 TRP B CD1 1 
ATOM   4654  C CD2 . TRP B 1 221 ? 13.153  9.413    92.850  1.00 15.94 ? 302 TRP B CD2 1 
ATOM   4655  N NE1 . TRP B 1 221 ? 14.568  8.288    94.175  1.00 18.58 ? 302 TRP B NE1 1 
ATOM   4656  C CE2 . TRP B 1 221 ? 14.016  8.301    92.914  1.00 16.06 ? 302 TRP B CE2 1 
ATOM   4657  C CE3 . TRP B 1 221 ? 12.460  9.657    91.654  1.00 17.40 ? 302 TRP B CE3 1 
ATOM   4658  C CZ2 . TRP B 1 221 ? 14.211  7.430    91.845  1.00 16.16 ? 302 TRP B CZ2 1 
ATOM   4659  C CZ3 . TRP B 1 221 ? 12.650  8.794    90.582  1.00 18.05 ? 302 TRP B CZ3 1 
ATOM   4660  C CH2 . TRP B 1 221 ? 13.522  7.691    90.686  1.00 17.58 ? 302 TRP B CH2 1 
ATOM   4661  N N   . VAL B 1 222 ? 9.759   11.339   93.183  1.00 18.24 ? 303 VAL B N   1 
ATOM   4662  C CA  . VAL B 1 222 ? 8.872   10.989   92.077  1.00 18.45 ? 303 VAL B CA  1 
ATOM   4663  C C   . VAL B 1 222 ? 9.221   11.924   90.944  1.00 18.62 ? 303 VAL B C   1 
ATOM   4664  O O   . VAL B 1 222 ? 9.327   13.138   91.146  1.00 17.16 ? 303 VAL B O   1 
ATOM   4665  C CB  . VAL B 1 222 ? 7.380   11.265   92.376  1.00 19.17 ? 303 VAL B CB  1 
ATOM   4666  C CG1 . VAL B 1 222 ? 6.511   10.689   91.272  1.00 20.03 ? 303 VAL B CG1 1 
ATOM   4667  C CG2 . VAL B 1 222 ? 6.991   10.681   93.673  1.00 22.92 ? 303 VAL B CG2 1 
ATOM   4668  N N   . SER B 1 223 ? 9.401   11.371   89.754  1.00 19.06 ? 304 SER B N   1 
ATOM   4669  C CA  . SER B 1 223 ? 9.695   12.202   88.597  1.00 20.47 ? 304 SER B CA  1 
ATOM   4670  C C   . SER B 1 223 ? 8.744   11.766   87.501  1.00 21.16 ? 304 SER B C   1 
ATOM   4671  O O   . SER B 1 223 ? 8.286   10.618   87.488  1.00 21.97 ? 304 SER B O   1 
ATOM   4672  C CB  . SER B 1 223 ? 11.155  12.049   88.156  1.00 19.34 ? 304 SER B CB  1 
ATOM   4673  O OG  . SER B 1 223 ? 11.479  10.709   87.856  1.00 21.51 ? 304 SER B OG  1 
ATOM   4674  N N   . PHE B 1 224 ? 8.429   12.673   86.588  1.00 21.16 ? 305 PHE B N   1 
ATOM   4675  C CA  . PHE B 1 224 ? 7.508   12.319   85.529  1.00 21.54 ? 305 PHE B CA  1 
ATOM   4676  C C   . PHE B 1 224 ? 7.549   13.193   84.290  1.00 22.43 ? 305 PHE B C   1 
ATOM   4677  O O   . PHE B 1 224 ? 8.071   14.313   84.311  1.00 24.48 ? 305 PHE B O   1 
ATOM   4678  C CB  . PHE B 1 224 ? 6.090   12.275   86.096  1.00 19.37 ? 305 PHE B CB  1 
ATOM   4679  C CG  . PHE B 1 224 ? 5.749   13.443   86.964  1.00 17.88 ? 305 PHE B CG  1 
ATOM   4680  C CD1 . PHE B 1 224 ? 5.191   14.589   86.421  1.00 17.02 ? 305 PHE B CD1 1 
ATOM   4681  C CD2 . PHE B 1 224 ? 5.965   13.388   88.333  1.00 17.19 ? 305 PHE B CD2 1 
ATOM   4682  C CE1 . PHE B 1 224 ? 4.848   15.670   87.231  1.00 16.76 ? 305 PHE B CE1 1 
ATOM   4683  C CE2 . PHE B 1 224 ? 5.627   14.464   89.154  1.00 17.88 ? 305 PHE B CE2 1 
ATOM   4684  C CZ  . PHE B 1 224 ? 5.065   15.606   88.600  1.00 17.47 ? 305 PHE B CZ  1 
ATOM   4685  N N   . ASN B 1 225 ? 7.002   12.652   83.209  1.00 23.24 ? 306 ASN B N   1 
ATOM   4686  C CA  . ASN B 1 225 ? 6.931   13.333   81.926  1.00 25.77 ? 306 ASN B CA  1 
ATOM   4687  C C   . ASN B 1 225 ? 5.665   14.189   81.905  1.00 25.32 ? 306 ASN B C   1 
ATOM   4688  O O   . ASN B 1 225 ? 4.880   14.162   82.852  1.00 26.16 ? 306 ASN B O   1 
ATOM   4689  C CB  . ASN B 1 225 ? 6.887   12.298   80.791  1.00 30.33 ? 306 ASN B CB  1 
ATOM   4690  C CG  . ASN B 1 225 ? 6.777   12.945   79.423  1.00 37.38 ? 306 ASN B CG  1 
ATOM   4691  O OD1 . ASN B 1 225 ? 7.424   13.974   79.154  1.00 41.37 ? 306 ASN B OD1 1 
ATOM   4692  N ND2 . ASN B 1 225 ? 5.962   12.354   78.542  1.00 39.97 ? 306 ASN B ND2 1 
ATOM   4693  N N   . GLN B 1 226 ? 5.463   14.942   80.831  1.00 24.58 ? 308 GLN B N   1 
ATOM   4694  C CA  . GLN B 1 226 ? 4.287   15.793   80.709  1.00 25.30 ? 308 GLN B CA  1 
ATOM   4695  C C   . GLN B 1 226 ? 3.010   14.984   80.533  1.00 25.78 ? 308 GLN B C   1 
ATOM   4696  O O   . GLN B 1 226 ? 1.916   15.546   80.476  1.00 25.75 ? 308 GLN B O   1 
ATOM   4697  C CB  . GLN B 1 226 ? 4.457   16.783   79.547  1.00 25.29 ? 308 GLN B CB  1 
ATOM   4698  C CG  . GLN B 1 226 ? 5.389   17.938   79.897  1.00 25.75 ? 308 GLN B CG  1 
ATOM   4699  C CD  . GLN B 1 226 ? 5.835   18.730   78.686  1.00 27.51 ? 308 GLN B CD  1 
ATOM   4700  O OE1 . GLN B 1 226 ? 5.013   19.297   77.968  1.00 28.07 ? 308 GLN B OE1 1 
ATOM   4701  N NE2 . GLN B 1 226 ? 7.152   18.775   78.452  1.00 27.23 ? 308 GLN B NE2 1 
ATOM   4702  N N   . ASN B 1 227 ? 3.150   13.665   80.441  1.00 26.03 ? 309 ASN B N   1 
ATOM   4703  C CA  . ASN B 1 227 ? 1.993   12.788   80.316  1.00 25.99 ? 309 ASN B CA  1 
ATOM   4704  C C   . ASN B 1 227 ? 1.740   12.050   81.615  1.00 24.57 ? 309 ASN B C   1 
ATOM   4705  O O   . ASN B 1 227 ? 0.880   11.169   81.676  1.00 23.65 ? 309 ASN B O   1 
ATOM   4706  C CB  . ASN B 1 227 ? 2.208   11.773   79.216  1.00 29.09 ? 309 ASN B CB  1 
ATOM   4707  C CG  . ASN B 1 227 ? 1.788   12.292   77.891  1.00 33.50 ? 309 ASN B CG  1 
ATOM   4708  O OD1 . ASN B 1 227 ? 0.596   12.568   77.675  1.00 35.43 ? 309 ASN B OD1 1 
ATOM   4709  N ND2 . ASN B 1 227 ? 2.758   12.454   76.976  1.00 36.38 ? 309 ASN B ND2 1 
ATOM   4710  N N   . LEU B 1 228 ? 2.499   12.413   82.645  1.00 22.51 ? 310 LEU B N   1 
ATOM   4711  C CA  . LEU B 1 228 ? 2.378   11.784   83.951  1.00 21.09 ? 310 LEU B CA  1 
ATOM   4712  C C   . LEU B 1 228 ? 2.907   10.353   83.970  1.00 20.66 ? 310 LEU B C   1 
ATOM   4713  O O   . LEU B 1 228 ? 2.527   9.565    84.825  1.00 20.74 ? 310 LEU B O   1 
ATOM   4714  C CB  . LEU B 1 228 ? 0.924   11.814   84.437  1.00 19.29 ? 310 LEU B CB  1 
ATOM   4715  C CG  . LEU B 1 228 ? 0.456   13.093   85.138  1.00 18.47 ? 310 LEU B CG  1 
ATOM   4716  C CD1 . LEU B 1 228 ? 1.118   14.313   84.534  1.00 17.44 ? 310 LEU B CD1 1 
ATOM   4717  C CD2 . LEU B 1 228 ? -1.048  13.197   85.033  1.00 18.88 ? 310 LEU B CD2 1 
ATOM   4718  N N   . GLU B 1 229 ? 3.754   10.000   83.009  1.00 20.64 ? 311 GLU B N   1 
ATOM   4719  C CA  . GLU B 1 229 ? 4.358   8.672    83.029  1.00 20.31 ? 311 GLU B CA  1 
ATOM   4720  C C   . GLU B 1 229 ? 5.442   8.966    84.066  1.00 20.03 ? 311 GLU B C   1 
ATOM   4721  O O   . GLU B 1 229 ? 6.165   9.949    83.932  1.00 19.21 ? 311 GLU B O   1 
ATOM   4722  C CB  . GLU B 1 229 ? 4.938   8.323    81.660  1.00 20.13 ? 311 GLU B CB  1 
ATOM   4723  C CG  . GLU B 1 229 ? 3.879   8.379    80.553  1.00 24.28 ? 311 GLU B CG  1 
ATOM   4724  C CD  . GLU B 1 229 ? 4.453   8.216    79.147  1.00 27.34 ? 311 GLU B CD  1 
ATOM   4725  O OE1 . GLU B 1 229 ? 5.468   8.872    78.816  1.00 29.33 ? 311 GLU B OE1 1 
ATOM   4726  O OE2 . GLU B 1 229 ? 3.881   7.435    78.359  1.00 30.24 ? 311 GLU B OE2 1 
ATOM   4727  N N   . TYR B 1 230 ? 5.548   8.134    85.098  1.00 18.38 ? 312 TYR B N   1 
ATOM   4728  C CA  . TYR B 1 230 ? 6.474   8.408    86.190  1.00 18.22 ? 312 TYR B CA  1 
ATOM   4729  C C   . TYR B 1 230 ? 7.405   7.290    86.663  1.00 18.98 ? 312 TYR B C   1 
ATOM   4730  O O   . TYR B 1 230 ? 7.376   6.167    86.164  1.00 19.12 ? 312 TYR B O   1 
ATOM   4731  C CB  . TYR B 1 230 ? 5.643   8.862    87.390  1.00 17.38 ? 312 TYR B CB  1 
ATOM   4732  C CG  . TYR B 1 230 ? 4.747   7.752    87.915  1.00 16.59 ? 312 TYR B CG  1 
ATOM   4733  C CD1 . TYR B 1 230 ? 5.205   6.852    88.879  1.00 16.20 ? 312 TYR B CD1 1 
ATOM   4734  C CD2 . TYR B 1 230 ? 3.467   7.549    87.387  1.00 17.16 ? 312 TYR B CD2 1 
ATOM   4735  C CE1 . TYR B 1 230 ? 4.414   5.777    89.298  1.00 15.08 ? 312 TYR B CE1 1 
ATOM   4736  C CE2 . TYR B 1 230 ? 2.670   6.475    87.798  1.00 14.22 ? 312 TYR B CE2 1 
ATOM   4737  C CZ  . TYR B 1 230 ? 3.153   5.596    88.752  1.00 15.34 ? 312 TYR B CZ  1 
ATOM   4738  O OH  . TYR B 1 230 ? 2.381   4.531    89.159  1.00 14.98 ? 312 TYR B OH  1 
ATOM   4739  N N   . GLN B 1 231 ? 8.211   7.631    87.667  1.00 18.87 ? 313 GLN B N   1 
ATOM   4740  C CA  . GLN B 1 231 ? 9.147   6.710    88.301  1.00 20.39 ? 313 GLN B CA  1 
ATOM   4741  C C   . GLN B 1 231 ? 9.243   7.091    89.772  1.00 19.51 ? 313 GLN B C   1 
ATOM   4742  O O   . GLN B 1 231 ? 9.091   8.256    90.123  1.00 19.74 ? 313 GLN B O   1 
ATOM   4743  C CB  . GLN B 1 231 ? 10.526  6.802    87.655  1.00 21.82 ? 313 GLN B CB  1 
ATOM   4744  C CG  . GLN B 1 231 ? 10.574  6.299    86.226  1.00 26.22 ? 313 GLN B CG  1 
ATOM   4745  C CD  . GLN B 1 231 ? 11.933  6.522    85.562  1.00 29.37 ? 313 GLN B CD  1 
ATOM   4746  O OE1 . GLN B 1 231 ? 12.145  6.107    84.421  1.00 32.19 ? 313 GLN B OE1 1 
ATOM   4747  N NE2 . GLN B 1 231 ? 12.855  7.178    86.272  1.00 29.06 ? 313 GLN B NE2 1 
ATOM   4748  N N   . ILE B 1 232 ? 9.491   6.119    90.639  1.00 19.33 ? 314 ILE B N   1 
ATOM   4749  C CA  . ILE B 1 232 ? 9.580   6.425    92.059  1.00 18.81 ? 314 ILE B CA  1 
ATOM   4750  C C   . ILE B 1 232 ? 10.791  5.806    92.730  1.00 18.59 ? 314 ILE B C   1 
ATOM   4751  O O   . ILE B 1 232 ? 11.430  4.921    92.172  1.00 19.33 ? 314 ILE B O   1 
ATOM   4752  C CB  . ILE B 1 232 ? 8.304   5.978    92.801  1.00 18.14 ? 314 ILE B CB  1 
ATOM   4753  C CG1 . ILE B 1 232 ? 8.029   4.505    92.542  1.00 17.18 ? 314 ILE B CG1 1 
ATOM   4754  C CG2 . ILE B 1 232 ? 7.117   6.797    92.328  1.00 17.79 ? 314 ILE B CG2 1 
ATOM   4755  C CD1 . ILE B 1 232 ? 6.773   4.023    93.239  1.00 18.30 ? 314 ILE B CD1 1 
ATOM   4756  N N   . GLY B 1 233 ? 11.109  6.294    93.927  1.00 18.74 ? 315 GLY B N   1 
ATOM   4757  C CA  . GLY B 1 233 ? 12.252  5.780    94.661  1.00 19.25 ? 315 GLY B CA  1 
ATOM   4758  C C   . GLY B 1 233 ? 12.581  6.555    95.925  1.00 20.45 ? 315 GLY B C   1 
ATOM   4759  O O   . GLY B 1 233 ? 11.790  7.357    96.415  1.00 21.18 ? 315 GLY B O   1 
ATOM   4760  N N   . TYR B 1 234 ? 13.761  6.297    96.468  1.00 20.77 ? 316 TYR B N   1 
ATOM   4761  C CA  . TYR B 1 234 ? 14.226  6.979    97.663  1.00 20.39 ? 316 TYR B CA  1 
ATOM   4762  C C   . TYR B 1 234 ? 15.694  7.319    97.430  1.00 20.35 ? 316 TYR B C   1 
ATOM   4763  O O   . TYR B 1 234 ? 16.407  6.584    96.749  1.00 20.28 ? 316 TYR B O   1 
ATOM   4764  C CB  . TYR B 1 234 ? 14.110  6.071    98.903  1.00 21.04 ? 316 TYR B CB  1 
ATOM   4765  C CG  . TYR B 1 234 ? 12.774  6.103    99.632  1.00 21.40 ? 316 TYR B CG  1 
ATOM   4766  C CD1 . TYR B 1 234 ? 11.678  5.373    99.167  1.00 21.16 ? 316 TYR B CD1 1 
ATOM   4767  C CD2 . TYR B 1 234 ? 12.607  6.867    100.794 1.00 20.20 ? 316 TYR B CD2 1 
ATOM   4768  C CE1 . TYR B 1 234 ? 10.448  5.402    99.842  1.00 19.84 ? 316 TYR B CE1 1 
ATOM   4769  C CE2 . TYR B 1 234 ? 11.387  6.901    101.470 1.00 20.46 ? 316 TYR B CE2 1 
ATOM   4770  C CZ  . TYR B 1 234 ? 10.310  6.167    100.993 1.00 20.42 ? 316 TYR B CZ  1 
ATOM   4771  O OH  . TYR B 1 234 ? 9.111   6.192    101.683 1.00 18.44 ? 316 TYR B OH  1 
ATOM   4772  N N   . ILE B 1 235 ? 16.138  8.443    97.975  1.00 20.32 ? 317 ILE B N   1 
ATOM   4773  C CA  . ILE B 1 235 ? 17.532  8.836    97.842  1.00 20.03 ? 317 ILE B CA  1 
ATOM   4774  C C   . ILE B 1 235 ? 18.334  7.796    98.638  1.00 20.43 ? 317 ILE B C   1 
ATOM   4775  O O   . ILE B 1 235 ? 18.102  7.591    99.833  1.00 21.44 ? 317 ILE B O   1 
ATOM   4776  C CB  . ILE B 1 235 ? 17.737  10.251   98.407  1.00 18.10 ? 317 ILE B CB  1 
ATOM   4777  C CG1 . ILE B 1 235 ? 16.840  11.234   97.647  1.00 18.37 ? 317 ILE B CG1 1 
ATOM   4778  C CG2 . ILE B 1 235 ? 19.197  10.656   98.295  1.00 16.85 ? 317 ILE B CG2 1 
ATOM   4779  C CD1 . ILE B 1 235 ? 16.848  12.657   98.208  1.00 17.69 ? 317 ILE B CD1 1 
ATOM   4780  N N   . CYS B 1 236 ? 19.273  7.144    97.963  1.00 21.22 ? 318 CYS B N   1 
ATOM   4781  C CA  . CYS B 1 236 ? 20.074  6.086    98.562  1.00 21.91 ? 318 CYS B CA  1 
ATOM   4782  C C   . CYS B 1 236 ? 21.232  6.552    99.465  1.00 21.75 ? 318 CYS B C   1 
ATOM   4783  O O   . CYS B 1 236 ? 21.789  5.756    100.231 1.00 21.77 ? 318 CYS B O   1 
ATOM   4784  C CB  . CYS B 1 236 ? 20.606  5.177    97.439  1.00 23.83 ? 318 CYS B CB  1 
ATOM   4785  S SG  . CYS B 1 236 ? 19.494  4.873    96.007  1.00 25.37 ? 318 CYS B SG  1 
ATOM   4786  N N   . SER B 1 237 ? 21.577  7.837    99.391  1.00 21.07 ? 319 SER B N   1 
ATOM   4787  C CA  . SER B 1 237 ? 22.677  8.375    100.175 1.00 19.86 ? 319 SER B CA  1 
ATOM   4788  C C   . SER B 1 237 ? 22.602  8.084    101.667 1.00 20.49 ? 319 SER B C   1 
ATOM   4789  O O   . SER B 1 237 ? 21.528  8.080    102.269 1.00 20.29 ? 319 SER B O   1 
ATOM   4790  C CB  . SER B 1 237 ? 22.797  9.887    99.960  1.00 19.59 ? 319 SER B CB  1 
ATOM   4791  O OG  . SER B 1 237 ? 23.702  10.458   100.890 1.00 18.92 ? 319 SER B OG  1 
ATOM   4792  N N   . GLY B 1 238 ? 23.774  7.839    102.247 1.00 20.98 ? 320 GLY B N   1 
ATOM   4793  C CA  . GLY B 1 238 ? 23.886  7.561    103.665 1.00 20.59 ? 320 GLY B CA  1 
ATOM   4794  C C   . GLY B 1 238 ? 23.835  8.850    104.461 1.00 20.82 ? 320 GLY B C   1 
ATOM   4795  O O   . GLY B 1 238 ? 23.884  8.818    105.691 1.00 21.67 ? 320 GLY B O   1 
ATOM   4796  N N   . VAL B 1 239 ? 23.755  9.985    103.764 1.00 20.72 ? 321 VAL B N   1 
ATOM   4797  C CA  . VAL B 1 239 ? 23.660  11.287   104.430 1.00 20.46 ? 321 VAL B CA  1 
ATOM   4798  C C   . VAL B 1 239 ? 22.168  11.585   104.496 1.00 20.56 ? 321 VAL B C   1 
ATOM   4799  O O   . VAL B 1 239 ? 21.645  12.378   103.710 1.00 20.56 ? 321 VAL B O   1 
ATOM   4800  C CB  . VAL B 1 239 ? 24.378  12.418   103.629 1.00 20.77 ? 321 VAL B CB  1 
ATOM   4801  C CG1 . VAL B 1 239 ? 24.234  13.750   104.358 1.00 19.89 ? 321 VAL B CG1 1 
ATOM   4802  C CG2 . VAL B 1 239 ? 25.852  12.087   103.457 1.00 19.72 ? 321 VAL B CG2 1 
ATOM   4803  N N   . PHE B 1 240 ? 21.501  10.916   105.436 1.00 20.53 ? 322 PHE B N   1 
ATOM   4804  C CA  . PHE B 1 240 ? 20.055  11.013   105.644 1.00 20.51 ? 322 PHE B CA  1 
ATOM   4805  C C   . PHE B 1 240 ? 19.505  12.439   105.645 1.00 19.62 ? 322 PHE B C   1 
ATOM   4806  O O   . PHE B 1 240 ? 20.056  13.326   106.298 1.00 19.61 ? 322 PHE B O   1 
ATOM   4807  C CB  . PHE B 1 240 ? 19.697  10.284   106.938 1.00 21.50 ? 322 PHE B CB  1 
ATOM   4808  C CG  . PHE B 1 240 ? 20.195  8.862    106.983 1.00 22.45 ? 322 PHE B CG  1 
ATOM   4809  C CD1 . PHE B 1 240 ? 21.119  8.465    107.947 1.00 23.90 ? 322 PHE B CD1 1 
ATOM   4810  C CD2 . PHE B 1 240 ? 19.749  7.920    106.056 1.00 22.22 ? 322 PHE B CD2 1 
ATOM   4811  C CE1 . PHE B 1 240 ? 21.593  7.145    107.990 1.00 23.81 ? 322 PHE B CE1 1 
ATOM   4812  C CE2 . PHE B 1 240 ? 20.215  6.604    106.091 1.00 22.47 ? 322 PHE B CE2 1 
ATOM   4813  C CZ  . PHE B 1 240 ? 21.140  6.217    107.060 1.00 22.46 ? 322 PHE B CZ  1 
ATOM   4814  N N   . GLY B 1 241 ? 18.399  12.644   104.931 1.00 18.65 ? 323 GLY B N   1 
ATOM   4815  C CA  . GLY B 1 241 ? 17.831  13.976   104.818 1.00 19.13 ? 323 GLY B CA  1 
ATOM   4816  C C   . GLY B 1 241 ? 16.645  14.415   105.660 1.00 20.27 ? 323 GLY B C   1 
ATOM   4817  O O   . GLY B 1 241 ? 16.412  15.621   105.766 1.00 22.02 ? 323 GLY B O   1 
ATOM   4818  N N   . ASP B 1 242 ? 15.900  13.475   106.246 1.00 19.65 ? 324 ASP B N   1 
ATOM   4819  C CA  . ASP B 1 242 ? 14.714  13.784   107.077 1.00 17.81 ? 324 ASP B CA  1 
ATOM   4820  C C   . ASP B 1 242 ? 15.176  14.173   108.484 1.00 17.39 ? 324 ASP B C   1 
ATOM   4821  O O   . ASP B 1 242 ? 16.353  14.048   108.837 1.00 15.11 ? 324 ASP B O   1 
ATOM   4822  C CB  . ASP B 1 242 ? 13.804  12.525   107.174 1.00 18.29 ? 324 ASP B CB  1 
ATOM   4823  C CG  . ASP B 1 242 ? 12.314  12.837   107.493 1.00 20.36 ? 324 ASP B CG  1 
ATOM   4824  O OD1 . ASP B 1 242 ? 11.537  11.858   107.751 1.00 22.31 ? 324 ASP B OD1 1 
ATOM   4825  O OD2 . ASP B 1 242 ? 11.908  14.026   107.475 1.00 17.71 ? 324 ASP B OD2 1 
ATOM   4826  N N   . ASN B 1 243 ? 14.229  14.665   109.269 1.00 17.88 ? 325 ASN B N   1 
ATOM   4827  C CA  . ASN B 1 243 ? 14.451  15.014   110.660 1.00 18.25 ? 325 ASN B CA  1 
ATOM   4828  C C   . ASN B 1 243 ? 13.120  14.781   111.359 1.00 17.90 ? 325 ASN B C   1 
ATOM   4829  O O   . ASN B 1 243 ? 12.109  15.366   110.986 1.00 17.45 ? 325 ASN B O   1 
ATOM   4830  C CB  . ASN B 1 243 ? 14.884  16.473   110.843 1.00 17.64 ? 325 ASN B CB  1 
ATOM   4831  C CG  . ASN B 1 243 ? 14.973  16.864   112.311 1.00 20.53 ? 325 ASN B CG  1 
ATOM   4832  O OD1 . ASN B 1 243 ? 14.032  17.422   112.870 1.00 20.42 ? 325 ASN B OD1 1 
ATOM   4833  N ND2 . ASN B 1 243 ? 16.099  16.543   112.951 1.00 20.47 ? 325 ASN B ND2 1 
ATOM   4834  N N   . PRO B 1 244 ? 13.094  13.877   112.351 1.00 18.87 ? 326 PRO B N   1 
ATOM   4835  C CA  . PRO B 1 244 ? 14.233  13.105   112.858 1.00 17.61 ? 326 PRO B CA  1 
ATOM   4836  C C   . PRO B 1 244 ? 14.885  12.175   111.837 1.00 18.42 ? 326 PRO B C   1 
ATOM   4837  O O   . PRO B 1 244 ? 14.380  11.989   110.723 1.00 17.97 ? 326 PRO B O   1 
ATOM   4838  C CB  . PRO B 1 244 ? 13.628  12.328   114.025 1.00 18.17 ? 326 PRO B CB  1 
ATOM   4839  C CG  . PRO B 1 244 ? 12.228  12.106   113.585 1.00 18.33 ? 326 PRO B CG  1 
ATOM   4840  C CD  . PRO B 1 244 ? 11.850  13.463   113.029 1.00 18.49 ? 326 PRO B CD  1 
ATOM   4841  N N   . ARG B 1 245 ? 16.014  11.600   112.250 1.00 18.96 ? 327 ARG B N   1 
ATOM   4842  C CA  . ARG B 1 245 ? 16.801  10.666   111.445 1.00 19.36 ? 327 ARG B CA  1 
ATOM   4843  C C   . ARG B 1 245 ? 17.918  10.104   112.332 1.00 18.75 ? 327 ARG B C   1 
ATOM   4844  O O   . ARG B 1 245 ? 18.190  10.631   113.407 1.00 19.63 ? 327 ARG B O   1 
ATOM   4845  C CB  . ARG B 1 245 ? 17.436  11.396   110.257 1.00 19.35 ? 327 ARG B CB  1 
ATOM   4846  C CG  . ARG B 1 245 ? 18.426  12.505   110.677 1.00 20.86 ? 327 ARG B CG  1 
ATOM   4847  C CD  . ARG B 1 245 ? 19.293  12.941   109.509 1.00 19.97 ? 327 ARG B CD  1 
ATOM   4848  N NE  . ARG B 1 245 ? 20.332  13.890   109.897 1.00 20.96 ? 327 ARG B NE  1 
ATOM   4849  C CZ  . ARG B 1 245 ? 20.143  15.196   110.073 1.00 21.37 ? 327 ARG B CZ  1 
ATOM   4850  N NH1 . ARG B 1 245 ? 21.164  15.965   110.423 1.00 21.78 ? 327 ARG B NH1 1 
ATOM   4851  N NH2 . ARG B 1 245 ? 18.944  15.740   109.896 1.00 22.07 ? 327 ARG B NH2 1 
ATOM   4852  N N   . PRO B 1 246 ? 18.578  9.024    111.895 1.00 18.32 ? 328 PRO B N   1 
ATOM   4853  C CA  . PRO B 1 246 ? 19.664  8.438    112.684 1.00 17.68 ? 328 PRO B CA  1 
ATOM   4854  C C   . PRO B 1 246 ? 20.974  9.115    112.294 1.00 17.58 ? 328 PRO B C   1 
ATOM   4855  O O   . PRO B 1 246 ? 20.985  9.987    111.429 1.00 18.17 ? 328 PRO B O   1 
ATOM   4856  C CB  . PRO B 1 246 ? 19.642  6.992    112.241 1.00 18.10 ? 328 PRO B CB  1 
ATOM   4857  C CG  . PRO B 1 246 ? 19.371  7.142    110.780 1.00 18.36 ? 328 PRO B CG  1 
ATOM   4858  C CD  . PRO B 1 246 ? 18.246  8.152    110.753 1.00 18.08 ? 328 PRO B CD  1 
ATOM   4859  N N   . ASN B 1 247 ? 22.069  8.724    112.933 1.00 17.22 ? 329 ASN B N   1 
ATOM   4860  C CA  . ASN B 1 247 ? 23.369  9.280    112.588 1.00 18.27 ? 329 ASN B CA  1 
ATOM   4861  C C   . ASN B 1 247 ? 23.720  8.759    111.197 1.00 19.49 ? 329 ASN B C   1 
ATOM   4862  O O   . ASN B 1 247 ? 23.283  7.669    110.807 1.00 18.53 ? 329 ASN B O   1 
ATOM   4863  C CB  . ASN B 1 247 ? 24.436  8.830    113.578 1.00 19.08 ? 329 ASN B CB  1 
ATOM   4864  C CG  . ASN B 1 247 ? 24.311  9.514    114.921 1.00 21.29 ? 329 ASN B CG  1 
ATOM   4865  O OD1 . ASN B 1 247 ? 24.252  10.740   115.000 1.00 22.04 ? 329 ASN B OD1 1 
ATOM   4866  N ND2 . ASN B 1 247 ? 24.282  8.726    115.989 1.00 20.79 ? 329 ASN B ND2 1 
ATOM   4867  N N   . ASP B 1 248 ? 24.496  9.532    110.442 1.00 19.92 ? 330 ASP B N   1 
ATOM   4868  C CA  . ASP B 1 248 ? 24.854  9.100    109.098 1.00 22.95 ? 330 ASP B CA  1 
ATOM   4869  C C   . ASP B 1 248 ? 25.556  7.751    109.074 1.00 23.51 ? 330 ASP B C   1 
ATOM   4870  O O   . ASP B 1 248 ? 26.342  7.408    109.966 1.00 21.84 ? 330 ASP B O   1 
ATOM   4871  C CB  . ASP B 1 248 ? 25.719  10.145   108.390 1.00 23.42 ? 330 ASP B CB  1 
ATOM   4872  C CG  . ASP B 1 248 ? 24.946  11.399   108.057 1.00 23.82 ? 330 ASP B CG  1 
ATOM   4873  O OD1 . ASP B 1 248 ? 23.716  11.308   107.872 1.00 25.42 ? 330 ASP B OD1 1 
ATOM   4874  O OD2 . ASP B 1 248 ? 25.563  12.473   107.966 1.00 25.50 ? 330 ASP B OD2 1 
ATOM   4875  N N   . GLY B 1 249 ? 25.242  6.984    108.040 1.00 24.07 ? 331 GLY B N   1 
ATOM   4876  C CA  . GLY B 1 249 ? 25.823  5.670    107.891 1.00 24.66 ? 331 GLY B CA  1 
ATOM   4877  C C   . GLY B 1 249 ? 25.552  5.110    106.511 1.00 25.17 ? 331 GLY B C   1 
ATOM   4878  O O   . GLY B 1 249 ? 25.837  5.758    105.491 1.00 25.84 ? 331 GLY B O   1 
ATOM   4879  N N   . THR B 1 250 ? 24.998  3.901    106.486 1.00 24.60 ? 332 THR B N   1 
ATOM   4880  C CA  . THR B 1 250 ? 24.683  3.211    105.246 1.00 24.38 ? 332 THR B CA  1 
ATOM   4881  C C   . THR B 1 250 ? 23.214  3.430    104.907 1.00 24.17 ? 332 THR B C   1 
ATOM   4882  O O   . THR B 1 250 ? 22.321  2.972    105.624 1.00 23.26 ? 332 THR B O   1 
ATOM   4883  C CB  . THR B 1 250 ? 24.966  1.695    105.381 1.00 25.79 ? 332 THR B CB  1 
ATOM   4884  O OG1 . THR B 1 250 ? 26.363  1.478    105.628 1.00 26.55 ? 332 THR B OG1 1 
ATOM   4885  C CG2 . THR B 1 250 ? 24.573  0.965    104.117 1.00 26.60 ? 332 THR B CG2 1 
ATOM   4886  N N   . GLY B 1 251 ? 22.971  4.145    103.814 1.00 24.40 ? 333 GLY B N   1 
ATOM   4887  C CA  . GLY B 1 251 ? 21.610  4.428    103.408 1.00 22.97 ? 333 GLY B CA  1 
ATOM   4888  C C   . GLY B 1 251 ? 21.010  3.301    102.596 1.00 21.66 ? 333 GLY B C   1 
ATOM   4889  O O   . GLY B 1 251 ? 21.528  2.185    102.556 1.00 21.62 ? 333 GLY B O   1 
ATOM   4890  N N   . SER B 1 252 ? 19.898  3.580    101.943 1.00 21.39 ? 335 SER B N   1 
ATOM   4891  C CA  . SER B 1 252 ? 19.248  2.559    101.145 1.00 20.74 ? 335 SER B CA  1 
ATOM   4892  C C   . SER B 1 252 ? 18.371  3.188    100.098 1.00 20.96 ? 335 SER B C   1 
ATOM   4893  O O   . SER B 1 252 ? 17.834  4.260    100.288 1.00 20.79 ? 335 SER B O   1 
ATOM   4894  C CB  . SER B 1 252 ? 18.382  1.677    102.020 1.00 19.36 ? 335 SER B CB  1 
ATOM   4895  O OG  . SER B 1 252 ? 17.313  1.135    101.260 1.00 18.07 ? 335 SER B OG  1 
ATOM   4896  N N   . CYS B 1 253 ? 18.213  2.508    98.980  1.00 22.20 ? 336 CYS B N   1 
ATOM   4897  C CA  . CYS B 1 253 ? 17.371  3.050    97.950  1.00 24.83 ? 336 CYS B CA  1 
ATOM   4898  C C   . CYS B 1 253 ? 15.899  2.852    98.354  1.00 24.23 ? 336 CYS B C   1 
ATOM   4899  O O   . CYS B 1 253 ? 14.981  3.098    97.554  1.00 25.22 ? 336 CYS B O   1 
ATOM   4900  C CB  . CYS B 1 253 ? 17.668  2.390    96.621  1.00 26.69 ? 336 CYS B CB  1 
ATOM   4901  S SG  . CYS B 1 253 ? 19.261  2.841    95.890  1.00 33.81 ? 336 CYS B SG  1 
ATOM   4902  N N   . GLY B 1 254 ? 15.661  2.457    99.605  1.00 23.93 ? 339 GLY B N   1 
ATOM   4903  C CA  . GLY B 1 254 ? 14.283  2.271    100.042 1.00 23.20 ? 339 GLY B CA  1 
ATOM   4904  C C   . GLY B 1 254 ? 14.060  3.014    101.341 1.00 22.78 ? 339 GLY B C   1 
ATOM   4905  O O   . GLY B 1 254 ? 14.942  3.739    101.797 1.00 22.60 ? 339 GLY B O   1 
ATOM   4906  N N   . PRO B 1 255 ? 12.887  2.871    101.952 1.00 22.45 ? 340 PRO B N   1 
ATOM   4907  C CA  . PRO B 1 255 ? 12.607  3.560    103.215 1.00 22.10 ? 340 PRO B CA  1 
ATOM   4908  C C   . PRO B 1 255 ? 13.550  3.141    104.337 1.00 21.37 ? 340 PRO B C   1 
ATOM   4909  O O   . PRO B 1 255 ? 13.680  1.956    104.593 1.00 22.53 ? 340 PRO B O   1 
ATOM   4910  C CB  . PRO B 1 255 ? 11.180  3.115    103.551 1.00 22.06 ? 340 PRO B CB  1 
ATOM   4911  C CG  . PRO B 1 255 ? 10.577  2.791    102.221 1.00 24.08 ? 340 PRO B CG  1 
ATOM   4912  C CD  . PRO B 1 255 ? 11.711  2.117    101.482 1.00 23.45 ? 340 PRO B CD  1 
ATOM   4913  N N   . VAL B 1 256 ? 14.191  4.091    105.004 1.00 21.05 ? 341 VAL B N   1 
ATOM   4914  C CA  . VAL B 1 256 ? 15.066  3.768    106.119 1.00 21.59 ? 341 VAL B CA  1 
ATOM   4915  C C   . VAL B 1 256 ? 14.150  3.852    107.346 1.00 23.36 ? 341 VAL B C   1 
ATOM   4916  O O   . VAL B 1 256 ? 13.617  4.921    107.678 1.00 22.20 ? 341 VAL B O   1 
ATOM   4917  C CB  . VAL B 1 256 ? 16.205  4.799    106.273 1.00 22.16 ? 341 VAL B CB  1 
ATOM   4918  C CG1 . VAL B 1 256 ? 16.968  4.507    107.533 1.00 19.92 ? 341 VAL B CG1 1 
ATOM   4919  C CG2 . VAL B 1 256 ? 17.138  4.793    105.054 1.00 20.00 ? 341 VAL B CG2 1 
ATOM   4920  N N   . SER B 1 257 ? 13.947  2.709    107.987 1.00 22.91 ? 342 SER B N   1 
ATOM   4921  C CA  . SER B 1 257 ? 13.076  2.619    109.135 1.00 23.71 ? 342 SER B CA  1 
ATOM   4922  C C   . SER B 1 257 ? 13.528  3.369    110.409 1.00 24.41 ? 342 SER B C   1 
ATOM   4923  O O   . SER B 1 257 ? 12.704  4.045    111.043 1.00 25.40 ? 342 SER B O   1 
ATOM   4924  C CB  . SER B 1 257 ? 12.839  1.143    109.441 1.00 22.68 ? 342 SER B CB  1 
ATOM   4925  O OG  . SER B 1 257 ? 14.017  0.556    109.947 1.00 23.97 ? 342 SER B OG  1 
ATOM   4926  N N   . SER B 1 258 ? 14.798  3.232    110.797 1.00 25.56 ? 344 SER B N   1 
ATOM   4927  C CA  . SER B 1 258 ? 15.298  3.867    112.020 1.00 28.58 ? 344 SER B CA  1 
ATOM   4928  C C   . SER B 1 258 ? 15.019  5.343    112.145 1.00 28.62 ? 344 SER B C   1 
ATOM   4929  O O   . SER B 1 258 ? 15.593  6.154    111.427 1.00 26.33 ? 344 SER B O   1 
ATOM   4930  C CB  . SER B 1 258 ? 16.808  3.605    112.241 1.00 27.96 ? 344 SER B CB  1 
ATOM   4931  O OG  . SER B 1 258 ? 17.612  4.283    111.297 1.00 34.53 ? 344 SER B OG  1 
ATOM   4932  N N   . ASN B 1 259 ? 14.118  5.671    113.065 1.00 29.15 ? 345 ASN B N   1 
ATOM   4933  C CA  . ASN B 1 259 ? 13.745  7.044    113.336 1.00 30.57 ? 345 ASN B CA  1 
ATOM   4934  C C   . ASN B 1 259 ? 12.973  7.837    112.330 1.00 29.96 ? 345 ASN B C   1 
ATOM   4935  O O   . ASN B 1 259 ? 12.640  8.959    112.637 1.00 29.84 ? 345 ASN B O   1 
ATOM   4936  C CB  . ASN B 1 259 ? 14.964  7.859    113.736 1.00 33.03 ? 345 ASN B CB  1 
ATOM   4937  C CG  . ASN B 1 259 ? 14.770  8.488    115.073 1.00 36.30 ? 345 ASN B CG  1 
ATOM   4938  O OD1 . ASN B 1 259 ? 13.629  8.763    115.458 1.00 37.76 ? 345 ASN B OD1 1 
ATOM   4939  N ND2 . ASN B 1 259 ? 15.849  8.699    115.810 1.00 35.95 ? 345 ASN B ND2 1 
ATOM   4940  N N   . GLY B 1 260 A 12.649  7.282    111.169 1.00 29.66 ? 345 GLY B N   1 
ATOM   4941  C CA  . GLY B 1 260 A 11.909  8.077    110.217 1.00 30.56 ? 345 GLY B CA  1 
ATOM   4942  C C   . GLY B 1 260 A 10.417  8.054    110.443 1.00 30.04 ? 345 GLY B C   1 
ATOM   4943  O O   . GLY B 1 260 A 9.682   8.307    109.504 1.00 30.25 ? 345 GLY B O   1 
ATOM   4944  N N   . ALA B 1 261 ? 9.967   7.767    111.664 1.00 30.23 ? 346 ALA B N   1 
ATOM   4945  C CA  . ALA B 1 261 ? 8.526   7.711    111.948 1.00 30.17 ? 346 ALA B CA  1 
ATOM   4946  C C   . ALA B 1 261 ? 7.798   9.049    112.034 1.00 28.85 ? 346 ALA B C   1 
ATOM   4947  O O   . ALA B 1 261 ? 6.628   9.078    112.409 1.00 31.34 ? 346 ALA B O   1 
ATOM   4948  C CB  . ALA B 1 261 ? 8.258   6.925    113.217 1.00 31.55 ? 346 ALA B CB  1 
ATOM   4949  N N   . TYR B 1 262 ? 8.489   10.145   111.724 1.00 25.34 ? 347 TYR B N   1 
ATOM   4950  C CA  . TYR B 1 262 ? 7.901   11.492   111.716 1.00 22.11 ? 347 TYR B CA  1 
ATOM   4951  C C   . TYR B 1 262 ? 8.624   12.236   110.584 1.00 19.91 ? 347 TYR B C   1 
ATOM   4952  O O   . TYR B 1 262 ? 8.869   11.651   109.532 1.00 21.43 ? 347 TYR B O   1 
ATOM   4953  C CB  . TYR B 1 262 ? 8.083   12.177   113.093 1.00 23.07 ? 347 TYR B CB  1 
ATOM   4954  C CG  . TYR B 1 262 ? 7.500   13.586   113.241 1.00 25.19 ? 347 TYR B CG  1 
ATOM   4955  C CD1 . TYR B 1 262 ? 6.190   13.891   112.848 1.00 27.00 ? 347 TYR B CD1 1 
ATOM   4956  C CD2 . TYR B 1 262 ? 8.280   14.620   113.753 1.00 25.86 ? 347 TYR B CD2 1 
ATOM   4957  C CE1 . TYR B 1 262 ? 5.687   15.210   112.957 1.00 26.77 ? 347 TYR B CE1 1 
ATOM   4958  C CE2 . TYR B 1 262 ? 7.794   15.918   113.870 1.00 25.77 ? 347 TYR B CE2 1 
ATOM   4959  C CZ  . TYR B 1 262 ? 6.513   16.217   113.472 1.00 27.88 ? 347 TYR B CZ  1 
ATOM   4960  O OH  . TYR B 1 262 ? 6.105   17.537   113.581 1.00 27.67 ? 347 TYR B OH  1 
ATOM   4961  N N   . GLY B 1 263 ? 8.973   13.500   110.762 1.00 18.42 ? 348 GLY B N   1 
ATOM   4962  C CA  . GLY B 1 263 ? 9.666   14.176   109.684 1.00 17.10 ? 348 GLY B CA  1 
ATOM   4963  C C   . GLY B 1 263 ? 9.614   15.689   109.682 1.00 15.69 ? 348 GLY B C   1 
ATOM   4964  O O   . GLY B 1 263 ? 9.379   16.332   110.704 1.00 14.62 ? 348 GLY B O   1 
ATOM   4965  N N   . VAL B 1 264 ? 9.863   16.238   108.502 1.00 14.22 ? 349 VAL B N   1 
ATOM   4966  C CA  . VAL B 1 264 ? 9.865   17.658   108.265 1.00 13.43 ? 349 VAL B CA  1 
ATOM   4967  C C   . VAL B 1 264 ? 10.030  17.803   106.753 1.00 13.51 ? 349 VAL B C   1 
ATOM   4968  O O   . VAL B 1 264 ? 10.699  16.994   106.122 1.00 13.08 ? 349 VAL B O   1 
ATOM   4969  C CB  . VAL B 1 264 ? 11.029  18.353   109.020 1.00 13.48 ? 349 VAL B CB  1 
ATOM   4970  C CG1 . VAL B 1 264 ? 12.377  17.894   108.487 1.00 9.58  ? 349 VAL B CG1 1 
ATOM   4971  C CG2 . VAL B 1 264 ? 10.880  19.859   108.905 1.00 13.37 ? 349 VAL B CG2 1 
ATOM   4972  N N   . LYS B 1 265 ? 9.391   18.816   106.176 1.00 13.37 ? 350 LYS B N   1 
ATOM   4973  C CA  . LYS B 1 265 ? 9.460   19.048   104.740 1.00 13.97 ? 350 LYS B CA  1 
ATOM   4974  C C   . LYS B 1 265 ? 10.863  19.432   104.321 1.00 14.37 ? 350 LYS B C   1 
ATOM   4975  O O   . LYS B 1 265 ? 11.547  20.163   105.032 1.00 15.83 ? 350 LYS B O   1 
ATOM   4976  C CB  . LYS B 1 265 ? 8.496   20.160   104.330 1.00 13.23 ? 350 LYS B CB  1 
ATOM   4977  C CG  . LYS B 1 265 ? 8.585   20.549   102.858 1.00 13.34 ? 350 LYS B CG  1 
ATOM   4978  C CD  . LYS B 1 265 ? 7.615   21.668   102.548 1.00 13.24 ? 350 LYS B CD  1 
ATOM   4979  C CE  . LYS B 1 265 ? 7.801   22.215   101.141 1.00 14.85 ? 350 LYS B CE  1 
ATOM   4980  N NZ  . LYS B 1 265 ? 7.393   21.266   100.066 1.00 12.38 ? 350 LYS B NZ  1 
ATOM   4981  N N   . GLY B 1 266 ? 11.283  18.944   103.163 1.00 13.45 ? 351 GLY B N   1 
ATOM   4982  C CA  . GLY B 1 266 ? 12.612  19.257   102.682 1.00 13.74 ? 351 GLY B CA  1 
ATOM   4983  C C   . GLY B 1 266 ? 12.661  19.249   101.173 1.00 15.31 ? 351 GLY B C   1 
ATOM   4984  O O   . GLY B 1 266 ? 11.627  19.316   100.518 1.00 15.37 ? 351 GLY B O   1 
ATOM   4985  N N   . PHE B 1 267 ? 13.867  19.174   100.622 1.00 15.54 ? 352 PHE B N   1 
ATOM   4986  C CA  . PHE B 1 267 ? 14.063  19.157   99.174  1.00 14.60 ? 352 PHE B CA  1 
ATOM   4987  C C   . PHE B 1 267 ? 15.473  18.647   98.856  1.00 15.06 ? 352 PHE B C   1 
ATOM   4988  O O   . PHE B 1 267 ? 16.288  18.432   99.755  1.00 12.52 ? 352 PHE B O   1 
ATOM   4989  C CB  . PHE B 1 267 ? 13.923  20.570   98.596  1.00 13.93 ? 352 PHE B CB  1 
ATOM   4990  C CG  . PHE B 1 267 ? 15.036  21.488   99.006  1.00 15.66 ? 352 PHE B CG  1 
ATOM   4991  C CD1 . PHE B 1 267 ? 14.996  22.145   100.238 1.00 15.46 ? 352 PHE B CD1 1 
ATOM   4992  C CD2 . PHE B 1 267 ? 16.180  21.605   98.219  1.00 14.15 ? 352 PHE B CD2 1 
ATOM   4993  C CE1 . PHE B 1 267 ? 16.085  22.895   100.681 1.00 15.44 ? 352 PHE B CE1 1 
ATOM   4994  C CE2 . PHE B 1 267 ? 17.272  22.350   98.657  1.00 15.57 ? 352 PHE B CE2 1 
ATOM   4995  C CZ  . PHE B 1 267 ? 17.225  22.994   99.893  1.00 14.92 ? 352 PHE B CZ  1 
ATOM   4996  N N   . SER B 1 268 ? 15.751  18.465   97.568  1.00 16.41 ? 353 SER B N   1 
ATOM   4997  C CA  . SER B 1 268 ? 17.070  18.030   97.109  1.00 17.76 ? 353 SER B CA  1 
ATOM   4998  C C   . SER B 1 268 ? 17.153  18.184   95.613  1.00 18.46 ? 353 SER B C   1 
ATOM   4999  O O   . SER B 1 268 ? 16.158  18.000   94.914  1.00 19.86 ? 353 SER B O   1 
ATOM   5000  C CB  . SER B 1 268 ? 17.351  16.574   97.479  1.00 16.75 ? 353 SER B CB  1 
ATOM   5001  O OG  . SER B 1 268 ? 17.523  16.432   98.878  1.00 17.46 ? 353 SER B OG  1 
ATOM   5002  N N   . PHE B 1 269 ? 18.339  18.543   95.127  1.00 18.92 ? 354 PHE B N   1 
ATOM   5003  C CA  . PHE B 1 269 ? 18.561  18.710   93.699  1.00 18.26 ? 354 PHE B CA  1 
ATOM   5004  C C   . PHE B 1 269 ? 19.452  17.589   93.154  1.00 19.62 ? 354 PHE B C   1 
ATOM   5005  O O   . PHE B 1 269 ? 20.560  17.338   93.649  1.00 19.72 ? 354 PHE B O   1 
ATOM   5006  C CB  . PHE B 1 269 ? 19.196  20.075   93.406  1.00 18.10 ? 354 PHE B CB  1 
ATOM   5007  C CG  . PHE B 1 269 ? 18.267  21.238   93.618  1.00 17.40 ? 354 PHE B CG  1 
ATOM   5008  C CD1 . PHE B 1 269 ? 18.426  22.090   94.712  1.00 17.60 ? 354 PHE B CD1 1 
ATOM   5009  C CD2 . PHE B 1 269 ? 17.224  21.481   92.726  1.00 15.95 ? 354 PHE B CD2 1 
ATOM   5010  C CE1 . PHE B 1 269 ? 17.552  23.174   94.911  1.00 17.13 ? 354 PHE B CE1 1 
ATOM   5011  C CE2 . PHE B 1 269 ? 16.352  22.556   92.918  1.00 16.16 ? 354 PHE B CE2 1 
ATOM   5012  C CZ  . PHE B 1 269 ? 16.517  23.402   94.010  1.00 15.77 ? 354 PHE B CZ  1 
ATOM   5013  N N   . LYS B 1 270 ? 18.950  16.911   92.132  1.00 20.13 ? 355 LYS B N   1 
ATOM   5014  C CA  . LYS B 1 270 ? 19.674  15.819   91.504  1.00 20.55 ? 355 LYS B CA  1 
ATOM   5015  C C   . LYS B 1 270 ? 20.457  16.277   90.267  1.00 20.94 ? 355 LYS B C   1 
ATOM   5016  O O   . LYS B 1 270 ? 19.904  16.913   89.366  1.00 20.34 ? 355 LYS B O   1 
ATOM   5017  C CB  . LYS B 1 270 ? 18.685  14.707   91.121  1.00 20.59 ? 355 LYS B CB  1 
ATOM   5018  C CG  . LYS B 1 270 ? 19.192  13.723   90.071  1.00 21.05 ? 355 LYS B CG  1 
ATOM   5019  C CD  . LYS B 1 270 ? 18.124  12.684   89.728  1.00 20.07 ? 355 LYS B CD  1 
ATOM   5020  C CE  . LYS B 1 270 ? 18.321  12.106   88.330  1.00 19.43 ? 355 LYS B CE  1 
ATOM   5021  N NZ  . LYS B 1 270 ? 19.657  11.479   88.129  1.00 15.96 ? 355 LYS B NZ  1 
ATOM   5022  N N   . TYR B 1 271 ? 21.752  15.969   90.259  1.00 20.95 ? 356 TYR B N   1 
ATOM   5023  C CA  . TYR B 1 271 ? 22.651  16.274   89.141  1.00 21.97 ? 356 TYR B CA  1 
ATOM   5024  C C   . TYR B 1 271 ? 23.348  14.950   88.791  1.00 22.18 ? 356 TYR B C   1 
ATOM   5025  O O   . TYR B 1 271 ? 24.228  14.489   89.528  1.00 21.55 ? 356 TYR B O   1 
ATOM   5026  C CB  . TYR B 1 271 ? 23.713  17.314   89.533  1.00 22.38 ? 356 TYR B CB  1 
ATOM   5027  C CG  . TYR B 1 271 ? 23.231  18.747   89.624  1.00 21.80 ? 356 TYR B CG  1 
ATOM   5028  C CD1 . TYR B 1 271 ? 22.591  19.218   90.770  1.00 20.37 ? 356 TYR B CD1 1 
ATOM   5029  C CD2 . TYR B 1 271 ? 23.437  19.641   88.565  1.00 21.40 ? 356 TYR B CD2 1 
ATOM   5030  C CE1 . TYR B 1 271 ? 22.175  20.542   90.866  1.00 20.63 ? 356 TYR B CE1 1 
ATOM   5031  C CE2 . TYR B 1 271 ? 23.020  20.971   88.651  1.00 20.49 ? 356 TYR B CE2 1 
ATOM   5032  C CZ  . TYR B 1 271 ? 22.393  21.415   89.804  1.00 21.57 ? 356 TYR B CZ  1 
ATOM   5033  O OH  . TYR B 1 271 ? 21.999  22.732   89.907  1.00 21.75 ? 356 TYR B OH  1 
ATOM   5034  N N   . GLY B 1 272 ? 22.946  14.342   87.676  1.00 22.68 ? 357 GLY B N   1 
ATOM   5035  C CA  . GLY B 1 272 ? 23.521  13.068   87.284  1.00 22.50 ? 357 GLY B CA  1 
ATOM   5036  C C   . GLY B 1 272 ? 23.159  12.101   88.384  1.00 23.01 ? 357 GLY B C   1 
ATOM   5037  O O   . GLY B 1 272 ? 21.980  11.871   88.637  1.00 23.93 ? 357 GLY B O   1 
ATOM   5038  N N   . ASN B 1 273 ? 24.158  11.541   89.052  1.00 22.99 ? 358 ASN B N   1 
ATOM   5039  C CA  . ASN B 1 273 ? 23.889  10.638   90.156  1.00 24.54 ? 358 ASN B CA  1 
ATOM   5040  C C   . ASN B 1 273 ? 24.155  11.369   91.454  1.00 24.27 ? 358 ASN B C   1 
ATOM   5041  O O   . ASN B 1 273 ? 24.083  10.776   92.529  1.00 24.05 ? 358 ASN B O   1 
ATOM   5042  C CB  . ASN B 1 273 ? 24.783  9.406    90.090  1.00 26.31 ? 358 ASN B CB  1 
ATOM   5043  C CG  . ASN B 1 273 ? 24.413  8.490    88.951  1.00 28.80 ? 358 ASN B CG  1 
ATOM   5044  O OD1 . ASN B 1 273 ? 23.227  8.201    88.733  1.00 31.23 ? 358 ASN B OD1 1 
ATOM   5045  N ND2 . ASN B 1 273 ? 25.419  8.015    88.218  1.00 28.49 ? 358 ASN B ND2 1 
ATOM   5046  N N   . GLY B 1 274 ? 24.470  12.655   91.348  1.00 22.46 ? 359 GLY B N   1 
ATOM   5047  C CA  . GLY B 1 274 ? 24.761  13.433   92.535  1.00 23.03 ? 359 GLY B CA  1 
ATOM   5048  C C   . GLY B 1 274 ? 23.574  14.210   93.088  1.00 22.75 ? 359 GLY B C   1 
ATOM   5049  O O   . GLY B 1 274 ? 22.622  14.515   92.367  1.00 21.87 ? 359 GLY B O   1 
ATOM   5050  N N   . VAL B 1 275 ? 23.633  14.543   94.373  1.00 20.70 ? 360 VAL B N   1 
ATOM   5051  C CA  . VAL B 1 275 ? 22.550  15.279   94.987  1.00 20.33 ? 360 VAL B CA  1 
ATOM   5052  C C   . VAL B 1 275 ? 22.972  16.324   95.998  1.00 20.23 ? 360 VAL B C   1 
ATOM   5053  O O   . VAL B 1 275 ? 23.820  16.080   96.857  1.00 19.96 ? 360 VAL B O   1 
ATOM   5054  C CB  . VAL B 1 275 ? 21.551  14.339   95.715  1.00 20.21 ? 360 VAL B CB  1 
ATOM   5055  C CG1 . VAL B 1 275 ? 20.867  13.472   94.727  1.00 22.39 ? 360 VAL B CG1 1 
ATOM   5056  C CG2 . VAL B 1 275 ? 22.280  13.479   96.751  1.00 19.69 ? 360 VAL B CG2 1 
ATOM   5057  N N   . TRP B 1 276 ? 22.370  17.499   95.883  1.00 18.79 ? 361 TRP B N   1 
ATOM   5058  C CA  . TRP B 1 276 ? 22.612  18.543   96.847  1.00 17.82 ? 361 TRP B CA  1 
ATOM   5059  C C   . TRP B 1 276 ? 21.524  18.266   97.868  1.00 17.56 ? 361 TRP B C   1 
ATOM   5060  O O   . TRP B 1 276 ? 20.354  18.147   97.514  1.00 17.96 ? 361 TRP B O   1 
ATOM   5061  C CB  . TRP B 1 276 ? 22.411  19.919   96.234  1.00 18.17 ? 361 TRP B CB  1 
ATOM   5062  C CG  . TRP B 1 276 ? 23.673  20.524   95.759  1.00 18.33 ? 361 TRP B CG  1 
ATOM   5063  C CD1 . TRP B 1 276 ? 24.101  20.618   94.471  1.00 17.10 ? 361 TRP B CD1 1 
ATOM   5064  C CD2 . TRP B 1 276 ? 24.688  21.121   96.568  1.00 18.31 ? 361 TRP B CD2 1 
ATOM   5065  N NE1 . TRP B 1 276 ? 25.321  21.240   94.423  1.00 18.58 ? 361 TRP B NE1 1 
ATOM   5066  C CE2 . TRP B 1 276 ? 25.707  21.562   95.701  1.00 19.26 ? 361 TRP B CE2 1 
ATOM   5067  C CE3 . TRP B 1 276 ? 24.835  21.327   97.947  1.00 20.13 ? 361 TRP B CE3 1 
ATOM   5068  C CZ2 . TRP B 1 276 ? 26.864  22.199   96.161  1.00 19.46 ? 361 TRP B CZ2 1 
ATOM   5069  C CZ3 . TRP B 1 276 ? 25.983  21.956   98.410  1.00 20.74 ? 361 TRP B CZ3 1 
ATOM   5070  C CH2 . TRP B 1 276 ? 26.985  22.390   97.515  1.00 20.98 ? 361 TRP B CH2 1 
ATOM   5071  N N   . ILE B 1 277 ? 21.911  18.151   99.129  1.00 17.33 ? 362 ILE B N   1 
ATOM   5072  C CA  . ILE B 1 277 ? 20.965  17.859   100.192 1.00 17.64 ? 362 ILE B CA  1 
ATOM   5073  C C   . ILE B 1 277 ? 20.844  18.998   101.187 1.00 17.54 ? 362 ILE B C   1 
ATOM   5074  O O   . ILE B 1 277 ? 21.847  19.484   101.716 1.00 18.06 ? 362 ILE B O   1 
ATOM   5075  C CB  . ILE B 1 277 ? 21.396  16.583   100.962 1.00 18.41 ? 362 ILE B CB  1 
ATOM   5076  C CG1 . ILE B 1 277 ? 21.385  15.387   100.004 1.00 17.92 ? 362 ILE B CG1 1 
ATOM   5077  C CG2 . ILE B 1 277 ? 20.483  16.352   102.162 1.00 17.80 ? 362 ILE B CG2 1 
ATOM   5078  C CD1 . ILE B 1 277 ? 22.070  14.170   100.534 1.00 18.25 ? 362 ILE B CD1 1 
ATOM   5079  N N   . GLY B 1 278 ? 19.613  19.429   101.427 1.00 15.82 ? 363 GLY B N   1 
ATOM   5080  C CA  . GLY B 1 278 ? 19.385  20.469   102.403 1.00 14.77 ? 363 GLY B CA  1 
ATOM   5081  C C   . GLY B 1 278 ? 18.796  19.723   103.580 1.00 14.68 ? 363 GLY B C   1 
ATOM   5082  O O   . GLY B 1 278 ? 17.865  18.949   103.401 1.00 16.48 ? 363 GLY B O   1 
ATOM   5083  N N   . ARG B 1 279 ? 19.341  19.917   104.773 1.00 14.52 ? 364 ARG B N   1 
ATOM   5084  C CA  . ARG B 1 279 ? 18.821  19.227   105.948 1.00 15.12 ? 364 ARG B CA  1 
ATOM   5085  C C   . ARG B 1 279 ? 19.116  19.985   107.233 1.00 15.89 ? 364 ARG B C   1 
ATOM   5086  O O   . ARG B 1 279 ? 19.924  20.922   107.251 1.00 16.67 ? 364 ARG B O   1 
ATOM   5087  C CB  . ARG B 1 279 ? 19.414  17.817   106.059 1.00 14.69 ? 364 ARG B CB  1 
ATOM   5088  C CG  . ARG B 1 279 ? 20.841  17.777   106.589 1.00 16.34 ? 364 ARG B CG  1 
ATOM   5089  C CD  . ARG B 1 279 ? 21.345  16.342   106.710 1.00 17.79 ? 364 ARG B CD  1 
ATOM   5090  N NE  . ARG B 1 279 ? 22.677  16.262   107.307 1.00 17.77 ? 364 ARG B NE  1 
ATOM   5091  C CZ  . ARG B 1 279 ? 23.362  15.130   107.452 1.00 17.92 ? 364 ARG B CZ  1 
ATOM   5092  N NH1 . ARG B 1 279 ? 24.567  15.148   108.010 1.00 17.74 ? 364 ARG B NH1 1 
ATOM   5093  N NH2 . ARG B 1 279 ? 22.847  13.981   107.035 1.00 15.76 ? 364 ARG B NH2 1 
ATOM   5094  N N   . THR B 1 280 ? 18.455  19.574   108.308 1.00 16.12 ? 365 THR B N   1 
ATOM   5095  C CA  . THR B 1 280 ? 18.654  20.212   109.597 1.00 16.37 ? 365 THR B CA  1 
ATOM   5096  C C   . THR B 1 280 ? 19.995  19.729   110.111 1.00 17.78 ? 365 THR B C   1 
ATOM   5097  O O   . THR B 1 280 ? 20.532  18.742   109.611 1.00 18.31 ? 365 THR B O   1 
ATOM   5098  C CB  . THR B 1 280 ? 17.563  19.810   110.600 1.00 15.11 ? 365 THR B CB  1 
ATOM   5099  O OG1 . THR B 1 280 ? 17.732  18.436   110.960 1.00 15.35 ? 365 THR B OG1 1 
ATOM   5100  C CG2 . THR B 1 280 ? 16.184  20.002   109.985 1.00 12.65 ? 365 THR B CG2 1 
ATOM   5101  N N   . LYS B 1 281 ? 20.550  20.421   111.095 1.00 18.91 ? 366 LYS B N   1 
ATOM   5102  C CA  . LYS B 1 281 ? 21.827  19.994   111.633 1.00 21.31 ? 366 LYS B CA  1 
ATOM   5103  C C   . LYS B 1 281 ? 21.627  18.956   112.738 1.00 21.81 ? 366 LYS B C   1 
ATOM   5104  O O   . LYS B 1 281 ? 22.450  18.058   112.905 1.00 20.89 ? 366 LYS B O   1 
ATOM   5105  C CB  . LYS B 1 281 ? 22.630  21.202   112.132 1.00 22.96 ? 366 LYS B CB  1 
ATOM   5106  C CG  . LYS B 1 281 ? 23.115  22.098   110.991 1.00 25.36 ? 366 LYS B CG  1 
ATOM   5107  C CD  . LYS B 1 281 ? 24.069  23.167   111.489 1.00 26.20 ? 366 LYS B CD  1 
ATOM   5108  C CE  . LYS B 1 281 ? 25.502  22.693   111.411 1.00 28.99 ? 366 LYS B CE  1 
ATOM   5109  N NZ  . LYS B 1 281 ? 26.005  22.698   110.002 1.00 29.00 ? 366 LYS B NZ  1 
ATOM   5110  N N   . SER B 1 282 ? 20.531  19.068   113.481 1.00 22.39 ? 367 SER B N   1 
ATOM   5111  C CA  . SER B 1 282 ? 20.250  18.104   114.540 1.00 24.64 ? 367 SER B CA  1 
ATOM   5112  C C   . SER B 1 282 ? 19.580  16.860   113.938 1.00 25.96 ? 367 SER B C   1 
ATOM   5113  O O   . SER B 1 282 ? 19.107  16.891   112.800 1.00 26.70 ? 367 SER B O   1 
ATOM   5114  C CB  . SER B 1 282 ? 19.340  18.726   115.601 1.00 24.24 ? 367 SER B CB  1 
ATOM   5115  O OG  . SER B 1 282 ? 18.936  17.763   116.559 1.00 23.17 ? 367 SER B OG  1 
ATOM   5116  N N   . THR B 1 283 ? 19.546  15.768   114.696 1.00 26.16 ? 368 THR B N   1 
ATOM   5117  C CA  . THR B 1 283 ? 18.934  14.535   114.216 1.00 25.11 ? 368 THR B CA  1 
ATOM   5118  C C   . THR B 1 283 ? 17.602  14.341   114.920 1.00 23.66 ? 368 THR B C   1 
ATOM   5119  O O   . THR B 1 283 ? 16.825  13.466   114.549 1.00 22.95 ? 368 THR B O   1 
ATOM   5120  C CB  . THR B 1 283 ? 19.853  13.331   114.433 1.00 26.71 ? 368 THR B CB  1 
ATOM   5121  O OG1 . THR B 1 283 ? 21.083  13.532   113.724 1.00 20.00 ? 368 THR B OG1 1 
ATOM   5122  C CG2 . THR B 1 283 ? 19.194  12.059   113.924 1.00 20.00 ? 368 THR B CG2 1 
ATOM   5123  N N   . ASN B 1 284 ? 17.333  15.164   115.930 1.00 22.77 ? 369 ASN B N   1 
ATOM   5124  C CA  . ASN B 1 284 ? 16.094  15.029   116.698 1.00 24.41 ? 369 ASN B CA  1 
ATOM   5125  C C   . ASN B 1 284 ? 15.129  16.202   116.615 1.00 21.75 ? 369 ASN B C   1 
ATOM   5126  O O   . ASN B 1 284 ? 13.922  16.010   116.514 1.00 21.73 ? 369 ASN B O   1 
ATOM   5127  C CB  . ASN B 1 284 ? 16.438  14.762   118.158 1.00 26.98 ? 369 ASN B CB  1 
ATOM   5128  C CG  . ASN B 1 284 ? 17.583  13.798   118.293 1.00 31.55 ? 369 ASN B CG  1 
ATOM   5129  O OD1 . ASN B 1 284 ? 17.514  12.670   117.797 1.00 32.65 ? 369 ASN B OD1 1 
ATOM   5130  N ND2 . ASN B 1 284 ? 18.660  14.235   118.948 1.00 34.51 ? 369 ASN B ND2 1 
ATOM   5131  N N   . SER B 1 285 ? 15.652  17.414   116.670 1.00 19.36 ? 370 SER B N   1 
ATOM   5132  C CA  . SER B 1 285 ? 14.787  18.572   116.588 1.00 18.11 ? 370 SER B CA  1 
ATOM   5133  C C   . SER B 1 285 ? 15.045  19.333   115.293 1.00 17.91 ? 370 SER B C   1 
ATOM   5134  O O   . SER B 1 285 ? 15.996  19.042   114.563 1.00 16.50 ? 370 SER B O   1 
ATOM   5135  C CB  . SER B 1 285 ? 15.021  19.486   117.796 1.00 17.79 ? 370 SER B CB  1 
ATOM   5136  O OG  . SER B 1 285 ? 16.337  20.002   117.806 1.00 17.73 ? 370 SER B OG  1 
ATOM   5137  N N   . ARG B 1 286 ? 14.179  20.301   115.015 1.00 18.70 ? 371 ARG B N   1 
ATOM   5138  C CA  . ARG B 1 286 ? 14.299  21.148   113.834 1.00 19.42 ? 371 ARG B CA  1 
ATOM   5139  C C   . ARG B 1 286 ? 15.235  22.296   114.188 1.00 20.07 ? 371 ARG B C   1 
ATOM   5140  O O   . ARG B 1 286 ? 14.826  23.452   114.269 1.00 21.11 ? 371 ARG B O   1 
ATOM   5141  C CB  . ARG B 1 286 ? 12.915  21.659   113.430 1.00 18.56 ? 371 ARG B CB  1 
ATOM   5142  C CG  . ARG B 1 286 ? 12.011  20.513   112.985 1.00 18.50 ? 371 ARG B CG  1 
ATOM   5143  C CD  . ARG B 1 286 ? 10.551  20.871   112.790 1.00 16.38 ? 371 ARG B CD  1 
ATOM   5144  N NE  . ARG B 1 286 ? 9.836   19.714   112.247 1.00 18.08 ? 371 ARG B NE  1 
ATOM   5145  C CZ  . ARG B 1 286 ? 8.576   19.725   111.819 1.00 17.61 ? 371 ARG B CZ  1 
ATOM   5146  N NH1 . ARG B 1 286 ? 8.029   18.611   111.340 1.00 15.29 ? 371 ARG B NH1 1 
ATOM   5147  N NH2 . ARG B 1 286 ? 7.862   20.846   111.872 1.00 16.61 ? 371 ARG B NH2 1 
ATOM   5148  N N   . SER B 1 287 ? 16.501  21.947   114.409 1.00 20.36 ? 372 SER B N   1 
ATOM   5149  C CA  . SER B 1 287 ? 17.529  22.908   114.775 1.00 21.36 ? 372 SER B CA  1 
ATOM   5150  C C   . SER B 1 287 ? 18.657  22.896   113.742 1.00 20.91 ? 372 SER B C   1 
ATOM   5151  O O   . SER B 1 287 ? 19.179  21.838   113.399 1.00 21.80 ? 372 SER B O   1 
ATOM   5152  C CB  . SER B 1 287 ? 18.109  22.556   116.153 1.00 22.20 ? 372 SER B CB  1 
ATOM   5153  O OG  . SER B 1 287 ? 17.088  22.233   117.083 1.00 22.77 ? 372 SER B OG  1 
ATOM   5154  N N   . GLY B 1 288 ? 19.035  24.075   113.260 1.00 20.12 ? 373 GLY B N   1 
ATOM   5155  C CA  . GLY B 1 288 ? 20.100  24.173   112.278 1.00 18.47 ? 373 GLY B CA  1 
ATOM   5156  C C   . GLY B 1 288 ? 19.695  23.775   110.870 1.00 17.01 ? 373 GLY B C   1 
ATOM   5157  O O   . GLY B 1 288 ? 18.607  23.244   110.647 1.00 15.85 ? 373 GLY B O   1 
ATOM   5158  N N   . PHE B 1 289 ? 20.579  24.050   109.918 1.00 15.26 ? 374 PHE B N   1 
ATOM   5159  C CA  . PHE B 1 289 ? 20.348  23.712   108.520 1.00 13.97 ? 374 PHE B CA  1 
ATOM   5160  C C   . PHE B 1 289 ? 21.680  23.784   107.801 1.00 12.44 ? 374 PHE B C   1 
ATOM   5161  O O   . PHE B 1 289 ? 22.536  24.583   108.161 1.00 11.16 ? 374 PHE B O   1 
ATOM   5162  C CB  . PHE B 1 289 ? 19.370  24.683   107.868 1.00 12.28 ? 374 PHE B CB  1 
ATOM   5163  C CG  . PHE B 1 289 ? 18.708  24.131   106.633 1.00 13.20 ? 374 PHE B CG  1 
ATOM   5164  C CD1 . PHE B 1 289 ? 17.582  23.310   106.737 1.00 11.54 ? 374 PHE B CD1 1 
ATOM   5165  C CD2 . PHE B 1 289 ? 19.226  24.400   105.367 1.00 11.01 ? 374 PHE B CD2 1 
ATOM   5166  C CE1 . PHE B 1 289 ? 16.986  22.766   105.598 1.00 9.81  ? 374 PHE B CE1 1 
ATOM   5167  C CE2 . PHE B 1 289 ? 18.641  23.864   104.227 1.00 9.91  ? 374 PHE B CE2 1 
ATOM   5168  C CZ  . PHE B 1 289 ? 17.518  23.045   104.339 1.00 10.57 ? 374 PHE B CZ  1 
ATOM   5169  N N   . GLU B 1 290 ? 21.849  22.947   106.785 1.00 12.64 ? 375 GLU B N   1 
ATOM   5170  C CA  . GLU B 1 290 ? 23.095  22.900   106.029 1.00 12.58 ? 375 GLU B CA  1 
ATOM   5171  C C   . GLU B 1 290 ? 22.861  22.330   104.648 1.00 13.83 ? 375 GLU B C   1 
ATOM   5172  O O   . GLU B 1 290 ? 21.841  21.680   104.402 1.00 16.24 ? 375 GLU B O   1 
ATOM   5173  C CB  . GLU B 1 290 ? 24.115  22.029   106.767 1.00 12.32 ? 375 GLU B CB  1 
ATOM   5174  C CG  . GLU B 1 290 ? 23.553  20.690   107.259 1.00 12.26 ? 375 GLU B CG  1 
ATOM   5175  C CD  . GLU B 1 290 ? 24.611  19.796   107.909 1.00 13.03 ? 375 GLU B CD  1 
ATOM   5176  O OE1 . GLU B 1 290 ? 25.439  20.324   108.685 1.00 13.25 ? 375 GLU B OE1 1 
ATOM   5177  O OE2 . GLU B 1 290 ? 24.605  18.568   107.656 1.00 11.85 ? 375 GLU B OE2 1 
ATOM   5178  N N   . MET B 1 291 ? 23.797  22.586   103.743 1.00 14.48 ? 376 MET B N   1 
ATOM   5179  C CA  . MET B 1 291 ? 23.704  22.063   102.387 1.00 15.01 ? 376 MET B CA  1 
ATOM   5180  C C   . MET B 1 291 ? 24.865  21.103   102.191 1.00 17.04 ? 376 MET B C   1 
ATOM   5181  O O   . MET B 1 291 ? 26.012  21.425   102.505 1.00 18.19 ? 376 MET B O   1 
ATOM   5182  C CB  . MET B 1 291 ? 23.790  23.180   101.350 1.00 14.05 ? 376 MET B CB  1 
ATOM   5183  C CG  . MET B 1 291 ? 22.599  24.123   101.315 1.00 14.14 ? 376 MET B CG  1 
ATOM   5184  S SD  . MET B 1 291 ? 21.017  23.286   101.105 1.00 15.63 ? 376 MET B SD  1 
ATOM   5185  C CE  . MET B 1 291 ? 21.146  22.597   99.447  1.00 14.83 ? 376 MET B CE  1 
ATOM   5186  N N   . ILE B 1 292 ? 24.573  19.918   101.675 1.00 17.62 ? 377 ILE B N   1 
ATOM   5187  C CA  . ILE B 1 292 ? 25.621  18.943   101.461 1.00 17.96 ? 377 ILE B CA  1 
ATOM   5188  C C   . ILE B 1 292 ? 25.620  18.416   100.035 1.00 19.07 ? 377 ILE B C   1 
ATOM   5189  O O   . ILE B 1 292 ? 24.582  18.035   99.499  1.00 17.69 ? 377 ILE B O   1 
ATOM   5190  C CB  . ILE B 1 292 ? 25.483  17.786   102.467 1.00 18.03 ? 377 ILE B CB  1 
ATOM   5191  C CG1 . ILE B 1 292 ? 25.819  18.308   103.870 1.00 18.32 ? 377 ILE B CG1 1 
ATOM   5192  C CG2 . ILE B 1 292 ? 26.373  16.621   102.064 1.00 16.49 ? 377 ILE B CG2 1 
ATOM   5193  C CD1 . ILE B 1 292 ? 25.675  17.289   104.980 1.00 17.66 ? 377 ILE B CD1 1 
ATOM   5194  N N   . TRP B 1 293 ? 26.793  18.423   99.415  1.00 20.45 ? 378 TRP B N   1 
ATOM   5195  C CA  . TRP B 1 293 ? 26.923  17.929   98.053  1.00 21.11 ? 378 TRP B CA  1 
ATOM   5196  C C   . TRP B 1 293 ? 27.525  16.536   98.066  1.00 22.45 ? 378 TRP B C   1 
ATOM   5197  O O   . TRP B 1 293 ? 28.711  16.363   98.337  1.00 23.55 ? 378 TRP B O   1 
ATOM   5198  C CB  . TRP B 1 293 ? 27.801  18.857   97.217  1.00 18.41 ? 378 TRP B CB  1 
ATOM   5199  C CG  . TRP B 1 293 ? 28.233  18.244   95.931  1.00 18.83 ? 378 TRP B CG  1 
ATOM   5200  C CD1 . TRP B 1 293 ? 29.511  17.932   95.561  1.00 18.88 ? 378 TRP B CD1 1 
ATOM   5201  C CD2 . TRP B 1 293 ? 27.391  17.833   94.844  1.00 17.96 ? 378 TRP B CD2 1 
ATOM   5202  N NE1 . TRP B 1 293 ? 29.516  17.353   94.314  1.00 18.38 ? 378 TRP B NE1 1 
ATOM   5203  C CE2 . TRP B 1 293 ? 28.228  17.279   93.850  1.00 16.24 ? 378 TRP B CE2 1 
ATOM   5204  C CE3 . TRP B 1 293 ? 26.009  17.878   94.613  1.00 15.28 ? 378 TRP B CE3 1 
ATOM   5205  C CZ2 . TRP B 1 293 ? 27.732  16.773   92.646  1.00 15.17 ? 378 TRP B CZ2 1 
ATOM   5206  C CZ3 . TRP B 1 293 ? 25.516  17.377   93.417  1.00 15.29 ? 378 TRP B CZ3 1 
ATOM   5207  C CH2 . TRP B 1 293 ? 26.376  16.830   92.447  1.00 14.55 ? 378 TRP B CH2 1 
ATOM   5208  N N   . ASP B 1 294 ? 26.692  15.547   97.781  1.00 23.73 ? 379 ASP B N   1 
ATOM   5209  C CA  . ASP B 1 294 ? 27.133  14.168   97.737  1.00 26.10 ? 379 ASP B CA  1 
ATOM   5210  C C   . ASP B 1 294 ? 27.160  13.742   96.273  1.00 27.46 ? 379 ASP B C   1 
ATOM   5211  O O   . ASP B 1 294 ? 26.118  13.439   95.687  1.00 28.08 ? 379 ASP B O   1 
ATOM   5212  C CB  . ASP B 1 294 ? 26.160  13.268   98.511  1.00 25.61 ? 379 ASP B CB  1 
ATOM   5213  C CG  . ASP B 1 294 ? 26.644  11.832   98.610  1.00 24.36 ? 379 ASP B CG  1 
ATOM   5214  O OD1 . ASP B 1 294 ? 27.421  11.396   97.736  1.00 24.72 ? 379 ASP B OD1 1 
ATOM   5215  O OD2 . ASP B 1 294 ? 26.238  11.131   99.558  1.00 24.89 ? 379 ASP B OD2 1 
ATOM   5216  N N   . PRO B 1 295 ? 28.343  13.753   95.644  1.00 29.68 ? 380 PRO B N   1 
ATOM   5217  C CA  . PRO B 1 295 ? 28.305  13.323   94.243  1.00 31.53 ? 380 PRO B CA  1 
ATOM   5218  C C   . PRO B 1 295 ? 27.917  11.854   94.297  1.00 33.35 ? 380 PRO B C   1 
ATOM   5219  O O   . PRO B 1 295 ? 28.149  11.197   95.310  1.00 35.58 ? 380 PRO B O   1 
ATOM   5220  C CB  . PRO B 1 295 ? 29.737  13.565   93.763  1.00 30.02 ? 380 PRO B CB  1 
ATOM   5221  C CG  . PRO B 1 295 ? 30.560  13.432   95.022  1.00 29.70 ? 380 PRO B CG  1 
ATOM   5222  C CD  . PRO B 1 295 ? 29.710  14.109   96.071  1.00 30.27 ? 380 PRO B CD  1 
ATOM   5223  N N   . ASN B 1 296 ? 27.290  11.336   93.253  1.00 34.72 ? 381 ASN B N   1 
ATOM   5224  C CA  . ASN B 1 296 ? 26.899  9.927    93.286  1.00 36.29 ? 381 ASN B CA  1 
ATOM   5225  C C   . ASN B 1 296 ? 26.260  9.549    94.642  1.00 33.77 ? 381 ASN B C   1 
ATOM   5226  O O   . ASN B 1 296 ? 26.640  8.555    95.266  1.00 34.56 ? 381 ASN B O   1 
ATOM   5227  C CB  . ASN B 1 296 ? 28.129  9.033    93.027  1.00 40.94 ? 381 ASN B CB  1 
ATOM   5228  C CG  . ASN B 1 296 ? 28.958  9.487    91.797  1.00 45.20 ? 381 ASN B CG  1 
ATOM   5229  O OD1 . ASN B 1 296 ? 28.447  9.553    90.665  1.00 46.01 ? 381 ASN B OD1 1 
ATOM   5230  N ND2 . ASN B 1 296 ? 30.244  9.797    92.026  1.00 44.90 ? 381 ASN B ND2 1 
ATOM   5231  N N   . GLY B 1 297 ? 25.308  10.363   95.095  1.00 31.12 ? 382 GLY B N   1 
ATOM   5232  C CA  . GLY B 1 297 ? 24.618  10.105   96.350  1.00 27.77 ? 382 GLY B CA  1 
ATOM   5233  C C   . GLY B 1 297 ? 23.149  9.779    96.102  1.00 26.61 ? 382 GLY B C   1 
ATOM   5234  O O   . GLY B 1 297 ? 22.425  9.317    96.989  1.00 24.28 ? 382 GLY B O   1 
ATOM   5235  N N   . TRP B 1 298 ? 22.705  10.016   94.874  1.00 25.50 ? 383 TRP B N   1 
ATOM   5236  C CA  . TRP B 1 298 ? 21.330  9.744    94.490  1.00 24.28 ? 383 TRP B CA  1 
ATOM   5237  C C   . TRP B 1 298 ? 21.135  8.262    94.205  1.00 23.69 ? 383 TRP B C   1 
ATOM   5238  O O   . TRP B 1 298 ? 20.027  7.738    94.344  1.00 24.29 ? 383 TRP B O   1 
ATOM   5239  C CB  . TRP B 1 298 ? 20.970  10.557   93.246  1.00 24.02 ? 383 TRP B CB  1 
ATOM   5240  C CG  . TRP B 1 298 ? 19.570  10.343   92.745  1.00 24.32 ? 383 TRP B CG  1 
ATOM   5241  C CD1 . TRP B 1 298 ? 19.110  9.290    92.004  1.00 23.96 ? 383 TRP B CD1 1 
ATOM   5242  C CD2 . TRP B 1 298 ? 18.445  11.209   92.948  1.00 23.18 ? 383 TRP B CD2 1 
ATOM   5243  N NE1 . TRP B 1 298 ? 17.772  9.450    91.732  1.00 23.52 ? 383 TRP B NE1 1 
ATOM   5244  C CE2 . TRP B 1 298 ? 17.340  10.622   92.299  1.00 22.47 ? 383 TRP B CE2 1 
ATOM   5245  C CE3 . TRP B 1 298 ? 18.264  12.427   93.617  1.00 23.85 ? 383 TRP B CE3 1 
ATOM   5246  C CZ2 . TRP B 1 298 ? 16.069  11.213   92.294  1.00 23.06 ? 383 TRP B CZ2 1 
ATOM   5247  C CZ3 . TRP B 1 298 ? 16.995  13.017   93.613  1.00 23.86 ? 383 TRP B CZ3 1 
ATOM   5248  C CH2 . TRP B 1 298 ? 15.917  12.406   92.953  1.00 21.20 ? 383 TRP B CH2 1 
ATOM   5249  N N   . THR B 1 299 ? 22.214  7.586    93.818  1.00 22.42 ? 384 THR B N   1 
ATOM   5250  C CA  . THR B 1 299 ? 22.135  6.171    93.499  1.00 22.31 ? 384 THR B CA  1 
ATOM   5251  C C   . THR B 1 299 ? 22.983  5.253    94.365  1.00 23.91 ? 384 THR B C   1 
ATOM   5252  O O   . THR B 1 299 ? 22.789  4.045    94.338  1.00 25.67 ? 384 THR B O   1 
ATOM   5253  C CB  . THR B 1 299 ? 22.531  5.921    92.047  1.00 21.80 ? 384 THR B CB  1 
ATOM   5254  O OG1 . THR B 1 299 ? 23.812  6.518    91.796  1.00 20.80 ? 384 THR B OG1 1 
ATOM   5255  C CG2 . THR B 1 299 ? 21.502  6.515    91.105  1.00 19.62 ? 384 THR B CG2 1 
ATOM   5256  N N   . GLU B 1 300 ? 23.918  5.805    95.132  1.00 25.29 ? 385 GLU B N   1 
ATOM   5257  C CA  . GLU B 1 300 ? 24.780  4.971    95.969  1.00 25.75 ? 385 GLU B CA  1 
ATOM   5258  C C   . GLU B 1 300 ? 24.436  5.062    97.444  1.00 26.82 ? 385 GLU B C   1 
ATOM   5259  O O   . GLU B 1 300 ? 23.733  5.975    97.866  1.00 26.52 ? 385 GLU B O   1 
ATOM   5260  C CB  . GLU B 1 300 ? 26.249  5.361    95.780  1.00 26.37 ? 385 GLU B CB  1 
ATOM   5261  C CG  . GLU B 1 300 ? 26.762  5.203    94.367  1.00 25.44 ? 385 GLU B CG  1 
ATOM   5262  C CD  . GLU B 1 300 ? 26.468  3.831    93.810  1.00 27.41 ? 385 GLU B CD  1 
ATOM   5263  O OE1 . GLU B 1 300 ? 26.797  2.832    94.487  1.00 27.81 ? 385 GLU B OE1 1 
ATOM   5264  O OE2 . GLU B 1 300 ? 25.906  3.755    92.700  1.00 26.18 ? 385 GLU B OE2 1 
ATOM   5265  N N   . THR B 1 301 ? 24.949  4.116    98.225  1.00 28.51 ? 386 THR B N   1 
ATOM   5266  C CA  . THR B 1 301 ? 24.706  4.083    99.663  1.00 31.05 ? 386 THR B CA  1 
ATOM   5267  C C   . THR B 1 301 ? 25.987  4.229    100.483 1.00 32.53 ? 386 THR B C   1 
ATOM   5268  O O   . THR B 1 301 ? 26.716  3.258    100.698 1.00 36.66 ? 386 THR B O   1 
ATOM   5269  C CB  . THR B 1 301 ? 24.046  2.765    100.098 1.00 30.48 ? 386 THR B CB  1 
ATOM   5270  O OG1 . THR B 1 301 ? 22.690  2.721    99.645  1.00 31.47 ? 386 THR B OG1 1 
ATOM   5271  C CG2 . THR B 1 301 ? 24.051  2.667    101.599 1.00 31.06 ? 386 THR B CG2 1 
ATOM   5272  N N   . ASP B 1 302 ? 26.274  5.431    100.946 1.00 31.77 ? 387 ASP B N   1 
ATOM   5273  C CA  . ASP B 1 302 ? 27.459  5.636    101.757 1.00 30.46 ? 387 ASP B CA  1 
ATOM   5274  C C   . ASP B 1 302 ? 27.349  7.023    102.324 1.00 28.66 ? 387 ASP B C   1 
ATOM   5275  O O   . ASP B 1 302 ? 26.706  7.884    101.732 1.00 28.54 ? 387 ASP B O   1 
ATOM   5276  C CB  . ASP B 1 302 ? 28.744  5.480    100.933 1.00 30.68 ? 387 ASP B CB  1 
ATOM   5277  C CG  . ASP B 1 302 ? 28.836  6.470    99.794  1.00 33.00 ? 387 ASP B CG  1 
ATOM   5278  O OD1 . ASP B 1 302 ? 28.466  6.100    98.660  1.00 36.29 ? 387 ASP B OD1 1 
ATOM   5279  O OD2 . ASP B 1 302 ? 29.269  7.623    100.025 1.00 33.56 ? 387 ASP B OD2 1 
ATOM   5280  N N   . SER B 1 303 ? 27.963  7.233    103.479 1.00 27.40 ? 388 SER B N   1 
ATOM   5281  C CA  . SER B 1 303 ? 27.895  8.523    104.139 1.00 26.51 ? 388 SER B CA  1 
ATOM   5282  C C   . SER B 1 303 ? 29.046  9.466    103.818 1.00 26.82 ? 388 SER B C   1 
ATOM   5283  O O   . SER B 1 303 ? 29.334  10.384   104.593 1.00 25.87 ? 388 SER B O   1 
ATOM   5284  C CB  . SER B 1 303 ? 27.812  8.303    105.643 1.00 26.78 ? 388 SER B CB  1 
ATOM   5285  O OG  . SER B 1 303 ? 28.632  7.217    106.025 1.00 27.72 ? 388 SER B OG  1 
ATOM   5286  N N   . SER B 1 304 ? 29.710  9.260    102.684 1.00 25.73 ? 389 SER B N   1 
ATOM   5287  C CA  . SER B 1 304 ? 30.812  10.146   102.347 1.00 25.93 ? 389 SER B CA  1 
ATOM   5288  C C   . SER B 1 304 ? 30.296  11.207   101.387 1.00 25.63 ? 389 SER B C   1 
ATOM   5289  O O   . SER B 1 304 ? 29.450  10.924   100.534 1.00 25.13 ? 389 SER B O   1 
ATOM   5290  C CB  . SER B 1 304 ? 31.970  9.373    101.720 1.00 23.95 ? 389 SER B CB  1 
ATOM   5291  O OG  . SER B 1 304 ? 31.736  9.142    100.356 1.00 24.87 ? 389 SER B OG  1 
ATOM   5292  N N   . PHE B 1 305 ? 30.794  12.431   101.546 1.00 25.83 ? 390 PHE B N   1 
ATOM   5293  C CA  . PHE B 1 305 ? 30.373  13.551   100.701 1.00 26.17 ? 390 PHE B CA  1 
ATOM   5294  C C   . PHE B 1 305 ? 31.501  14.522   100.455 1.00 25.90 ? 390 PHE B C   1 
ATOM   5295  O O   . PHE B 1 305 ? 32.497  14.538   101.184 1.00 26.13 ? 390 PHE B O   1 
ATOM   5296  C CB  . PHE B 1 305 ? 29.182  14.299   101.322 1.00 24.29 ? 390 PHE B CB  1 
ATOM   5297  C CG  . PHE B 1 305 ? 29.432  14.822   102.711 1.00 22.79 ? 390 PHE B CG  1 
ATOM   5298  C CD1 . PHE B 1 305 ? 29.986  16.081   102.913 1.00 21.90 ? 390 PHE B CD1 1 
ATOM   5299  C CD2 . PHE B 1 305 ? 29.050  14.073   103.821 1.00 23.67 ? 390 PHE B CD2 1 
ATOM   5300  C CE1 . PHE B 1 305 ? 30.150  16.601   104.199 1.00 20.74 ? 390 PHE B CE1 1 
ATOM   5301  C CE2 . PHE B 1 305 ? 29.210  14.583   105.118 1.00 24.79 ? 390 PHE B CE2 1 
ATOM   5302  C CZ  . PHE B 1 305 ? 29.763  15.857   105.301 1.00 22.64 ? 390 PHE B CZ  1 
ATOM   5303  N N   . SER B 1 306 ? 31.321  15.350   99.436  1.00 26.14 ? 391 SER B N   1 
ATOM   5304  C CA  . SER B 1 306 ? 32.335  16.318   99.056  1.00 27.14 ? 391 SER B CA  1 
ATOM   5305  C C   . SER B 1 306 ? 32.304  17.648   99.811  1.00 26.84 ? 391 SER B C   1 
ATOM   5306  O O   . SER B 1 306 ? 33.284  18.031   100.471 1.00 27.00 ? 391 SER B O   1 
ATOM   5307  C CB  . SER B 1 306 ? 32.228  16.587   97.554  1.00 27.38 ? 391 SER B CB  1 
ATOM   5308  O OG  . SER B 1 306 ? 32.382  15.384   96.816  1.00 29.95 ? 391 SER B OG  1 
ATOM   5309  N N   . VAL B 1 307 ? 31.170  18.335   99.719  1.00 25.45 ? 392 VAL B N   1 
ATOM   5310  C CA  . VAL B 1 307 ? 31.018  19.646   100.323 1.00 23.76 ? 392 VAL B CA  1 
ATOM   5311  C C   . VAL B 1 307 ? 29.859  19.784   101.297 1.00 23.99 ? 392 VAL B C   1 
ATOM   5312  O O   . VAL B 1 307 ? 28.861  19.063   101.220 1.00 23.39 ? 392 VAL B O   1 
ATOM   5313  C CB  . VAL B 1 307 ? 30.852  20.695   99.217  1.00 23.89 ? 392 VAL B CB  1 
ATOM   5314  C CG1 . VAL B 1 307 ? 30.845  22.097   99.805  1.00 23.32 ? 392 VAL B CG1 1 
ATOM   5315  C CG2 . VAL B 1 307 ? 31.966  20.524   98.194  1.00 21.45 ? 392 VAL B CG2 1 
ATOM   5316  N N   . LYS B 1 308 ? 30.008  20.747   102.201 1.00 22.51 ? 394 LYS B N   1 
ATOM   5317  C CA  . LYS B 1 308 ? 29.018  21.038   103.214 1.00 21.49 ? 394 LYS B CA  1 
ATOM   5318  C C   . LYS B 1 308 ? 29.077  22.544   103.440 1.00 20.66 ? 394 LYS B C   1 
ATOM   5319  O O   . LYS B 1 308 ? 30.160  23.117   103.541 1.00 20.19 ? 394 LYS B O   1 
ATOM   5320  C CB  . LYS B 1 308 ? 29.376  20.309   104.507 1.00 22.34 ? 394 LYS B CB  1 
ATOM   5321  C CG  . LYS B 1 308 ? 28.394  20.496   105.655 1.00 25.37 ? 394 LYS B CG  1 
ATOM   5322  C CD  . LYS B 1 308 ? 29.145  20.554   106.984 1.00 29.34 ? 394 LYS B CD  1 
ATOM   5323  C CE  . LYS B 1 308 ? 28.265  20.184   108.177 1.00 32.07 ? 394 LYS B CE  1 
ATOM   5324  N NZ  . LYS B 1 308 ? 27.855  18.739   108.160 1.00 34.17 ? 394 LYS B NZ  1 
ATOM   5325  N N   . GLN B 1 309 ? 27.913  23.182   103.510 1.00 19.65 ? 395 GLN B N   1 
ATOM   5326  C CA  . GLN B 1 309 ? 27.847  24.619   103.730 1.00 18.27 ? 395 GLN B CA  1 
ATOM   5327  C C   . GLN B 1 309 ? 26.805  24.945   104.805 1.00 18.21 ? 395 GLN B C   1 
ATOM   5328  O O   . GLN B 1 309 ? 25.628  24.591   104.679 1.00 16.93 ? 395 GLN B O   1 
ATOM   5329  C CB  . GLN B 1 309 ? 27.507  25.346   102.418 1.00 16.93 ? 395 GLN B CB  1 
ATOM   5330  C CG  . GLN B 1 309 ? 27.475  26.860   102.542 1.00 15.82 ? 395 GLN B CG  1 
ATOM   5331  C CD  . GLN B 1 309 ? 27.015  27.560   101.274 1.00 17.43 ? 395 GLN B CD  1 
ATOM   5332  O OE1 . GLN B 1 309 ? 26.781  28.767   101.278 1.00 15.78 ? 395 GLN B OE1 1 
ATOM   5333  N NE2 . GLN B 1 309 ? 26.888  26.808   100.184 1.00 14.62 ? 395 GLN B NE2 1 
ATOM   5334  N N   . ASP B 1 310 ? 27.244  25.622   105.863 1.00 17.56 ? 396 ASP B N   1 
ATOM   5335  C CA  . ASP B 1 310 ? 26.341  25.988   106.946 1.00 17.52 ? 396 ASP B CA  1 
ATOM   5336  C C   . ASP B 1 310 ? 25.383  27.098   106.544 1.00 17.03 ? 396 ASP B C   1 
ATOM   5337  O O   . ASP B 1 310 ? 25.779  28.064   105.895 1.00 15.66 ? 396 ASP B O   1 
ATOM   5338  C CB  . ASP B 1 310 ? 27.123  26.451   108.174 1.00 18.18 ? 396 ASP B CB  1 
ATOM   5339  C CG  . ASP B 1 310 ? 28.166  25.450   108.620 1.00 20.72 ? 396 ASP B CG  1 
ATOM   5340  O OD1 . ASP B 1 310 ? 27.995  24.233   108.369 1.00 22.45 ? 396 ASP B OD1 1 
ATOM   5341  O OD2 . ASP B 1 310 ? 29.158  25.883   109.244 1.00 21.19 ? 396 ASP B OD2 1 
ATOM   5342  N N   . ILE B 1 311 ? 24.120  26.942   106.932 1.00 16.36 ? 397 ILE B N   1 
ATOM   5343  C CA  . ILE B 1 311 ? 23.085  27.939   106.666 1.00 16.56 ? 397 ILE B CA  1 
ATOM   5344  C C   . ILE B 1 311 ? 22.522  28.455   108.007 1.00 17.28 ? 397 ILE B C   1 
ATOM   5345  O O   . ILE B 1 311 ? 22.204  29.645   108.144 1.00 17.67 ? 397 ILE B O   1 
ATOM   5346  C CB  . ILE B 1 311 ? 21.958  27.355   105.759 1.00 15.76 ? 397 ILE B CB  1 
ATOM   5347  C CG1 . ILE B 1 311 ? 22.300  27.598   104.285 1.00 16.12 ? 397 ILE B CG1 1 
ATOM   5348  C CG2 . ILE B 1 311 ? 20.636  28.044   106.027 1.00 14.79 ? 397 ILE B CG2 1 
ATOM   5349  C CD1 . ILE B 1 311 ? 23.628  27.056   103.854 1.00 16.12 ? 397 ILE B CD1 1 
ATOM   5350  N N   . VAL B 1 312 ? 22.423  27.560   108.991 1.00 15.73 ? 398 VAL B N   1 
ATOM   5351  C CA  . VAL B 1 312 ? 21.948  27.903   110.330 1.00 14.68 ? 398 VAL B CA  1 
ATOM   5352  C C   . VAL B 1 312 ? 22.594  26.972   111.370 1.00 15.52 ? 398 VAL B C   1 
ATOM   5353  O O   . VAL B 1 312 ? 22.654  25.755   111.176 1.00 14.75 ? 398 VAL B O   1 
ATOM   5354  C CB  . VAL B 1 312 ? 20.411  27.785   110.443 1.00 13.44 ? 398 VAL B CB  1 
ATOM   5355  C CG1 . VAL B 1 312 ? 19.965  28.195   111.837 1.00 11.56 ? 398 VAL B CG1 1 
ATOM   5356  C CG2 . VAL B 1 312 ? 19.745  28.649   109.404 1.00 9.85  ? 398 VAL B CG2 1 
ATOM   5357  N N   . ALA B 1 313 ? 23.057  27.560   112.474 1.00 14.88 ? 399 ALA B N   1 
ATOM   5358  C CA  . ALA B 1 313 ? 23.723  26.837   113.555 1.00 15.07 ? 399 ALA B CA  1 
ATOM   5359  C C   . ALA B 1 313 ? 22.829  25.880   114.355 1.00 16.45 ? 399 ALA B C   1 
ATOM   5360  O O   . ALA B 1 313 ? 21.642  26.132   114.561 1.00 17.48 ? 399 ALA B O   1 
ATOM   5361  C CB  . ALA B 1 313 ? 24.381  27.840   114.496 1.00 12.97 ? 399 ALA B CB  1 
ATOM   5362  N N   . ILE B 1 314 ? 23.424  24.784   114.819 1.00 17.88 ? 400 ILE B N   1 
ATOM   5363  C CA  . ILE B 1 314 ? 22.712  23.772   115.598 1.00 19.87 ? 400 ILE B CA  1 
ATOM   5364  C C   . ILE B 1 314 ? 21.993  24.392   116.796 1.00 19.82 ? 400 ILE B C   1 
ATOM   5365  O O   . ILE B 1 314 ? 20.985  23.869   117.251 1.00 20.62 ? 400 ILE B O   1 
ATOM   5366  C CB  . ILE B 1 314 ? 23.688  22.680   116.129 1.00 21.66 ? 400 ILE B CB  1 
ATOM   5367  C CG1 . ILE B 1 314 ? 24.773  22.398   115.081 1.00 27.24 ? 400 ILE B CG1 1 
ATOM   5368  C CG2 . ILE B 1 314 ? 22.930  21.378   116.408 1.00 21.66 ? 400 ILE B CG2 1 
ATOM   5369  C CD1 . ILE B 1 314 ? 25.859  21.373   115.526 1.00 29.21 ? 400 ILE B CD1 1 
ATOM   5370  N N   . THR B 1 315 ? 22.521  25.502   117.305 1.00 19.87 ? 401 THR B N   1 
ATOM   5371  C CA  . THR B 1 315 ? 21.922  26.171   118.451 1.00 19.81 ? 401 THR B CA  1 
ATOM   5372  C C   . THR B 1 315 ? 20.699  27.028   118.108 1.00 19.74 ? 401 THR B C   1 
ATOM   5373  O O   . THR B 1 315 ? 20.045  27.545   119.011 1.00 19.88 ? 401 THR B O   1 
ATOM   5374  C CB  . THR B 1 315 ? 22.958  27.068   119.200 1.00 20.68 ? 401 THR B CB  1 
ATOM   5375  O OG1 . THR B 1 315 ? 23.598  27.961   118.276 1.00 22.82 ? 401 THR B OG1 1 
ATOM   5376  C CG2 . THR B 1 315 ? 24.011  26.211   119.900 1.00 21.25 ? 401 THR B CG2 1 
ATOM   5377  N N   . ASP B 1 316 ? 20.387  27.187   116.822 1.00 18.35 ? 402 ASP B N   1 
ATOM   5378  C CA  . ASP B 1 316 ? 19.230  27.991   116.438 1.00 18.56 ? 402 ASP B CA  1 
ATOM   5379  C C   . ASP B 1 316 ? 18.125  27.198   115.740 1.00 17.73 ? 402 ASP B C   1 
ATOM   5380  O O   . ASP B 1 316 ? 18.386  26.256   114.987 1.00 17.83 ? 402 ASP B O   1 
ATOM   5381  C CB  . ASP B 1 316 ? 19.663  29.172   115.561 1.00 20.87 ? 402 ASP B CB  1 
ATOM   5382  C CG  . ASP B 1 316 ? 20.278  30.312   116.372 1.00 23.28 ? 402 ASP B CG  1 
ATOM   5383  O OD1 . ASP B 1 316 ? 19.589  30.851   117.270 1.00 22.74 ? 402 ASP B OD1 1 
ATOM   5384  O OD2 . ASP B 1 316 ? 21.450  30.670   116.107 1.00 25.77 ? 402 ASP B OD2 1 
ATOM   5385  N N   . TRP B 1 317 ? 16.885  27.591   115.999 1.00 16.44 ? 403 TRP B N   1 
ATOM   5386  C CA  . TRP B 1 317 ? 15.728  26.923   115.422 1.00 16.25 ? 403 TRP B CA  1 
ATOM   5387  C C   . TRP B 1 317 ? 15.587  27.092   113.919 1.00 16.83 ? 403 TRP B C   1 
ATOM   5388  O O   . TRP B 1 317 ? 15.802  28.181   113.382 1.00 17.79 ? 403 TRP B O   1 
ATOM   5389  C CB  . TRP B 1 317 ? 14.449  27.442   116.068 1.00 16.21 ? 403 TRP B CB  1 
ATOM   5390  C CG  . TRP B 1 317 ? 14.378  27.210   117.533 1.00 17.95 ? 403 TRP B CG  1 
ATOM   5391  C CD1 . TRP B 1 317 ? 14.317  28.158   118.512 1.00 17.00 ? 403 TRP B CD1 1 
ATOM   5392  C CD2 . TRP B 1 317 ? 14.348  25.944   118.194 1.00 17.89 ? 403 TRP B CD2 1 
ATOM   5393  N NE1 . TRP B 1 317 ? 14.249  27.561   119.745 1.00 17.85 ? 403 TRP B NE1 1 
ATOM   5394  C CE2 . TRP B 1 317 ? 14.266  26.202   119.581 1.00 18.01 ? 403 TRP B CE2 1 
ATOM   5395  C CE3 . TRP B 1 317 ? 14.379  24.614   117.749 1.00 19.48 ? 403 TRP B CE3 1 
ATOM   5396  C CZ2 . TRP B 1 317 ? 14.220  25.177   120.532 1.00 19.18 ? 403 TRP B CZ2 1 
ATOM   5397  C CZ3 . TRP B 1 317 ? 14.333  23.591   118.696 1.00 21.08 ? 403 TRP B CZ3 1 
ATOM   5398  C CH2 . TRP B 1 317 ? 14.253  23.880   120.073 1.00 19.41 ? 403 TRP B CH2 1 
ATOM   5399  N N   . SER B 1 318 ? 15.219  26.009   113.241 1.00 15.45 ? 404 SER B N   1 
ATOM   5400  C CA  . SER B 1 318 ? 14.982  26.061   111.802 1.00 13.97 ? 404 SER B CA  1 
ATOM   5401  C C   . SER B 1 318 ? 13.563  25.522   111.620 1.00 11.78 ? 404 SER B C   1 
ATOM   5402  O O   . SER B 1 318 ? 12.700  25.783   112.444 1.00 11.42 ? 404 SER B O   1 
ATOM   5403  C CB  . SER B 1 318 ? 15.986  25.198   111.033 1.00 14.01 ? 404 SER B CB  1 
ATOM   5404  O OG  . SER B 1 318 ? 15.665  23.823   111.142 1.00 16.74 ? 404 SER B OG  1 
ATOM   5405  N N   . GLY B 1 319 ? 13.330  24.764   110.559 1.00 10.87 ? 405 GLY B N   1 
ATOM   5406  C CA  . GLY B 1 319 ? 12.010  24.215   110.312 1.00 10.51 ? 405 GLY B CA  1 
ATOM   5407  C C   . GLY B 1 319 ? 11.920  23.724   108.879 1.00 11.07 ? 405 GLY B C   1 
ATOM   5408  O O   . GLY B 1 319 ? 12.881  23.168   108.352 1.00 12.37 ? 405 GLY B O   1 
ATOM   5409  N N   . TYR B 1 320 ? 10.775  23.930   108.244 1.00 10.03 ? 406 TYR B N   1 
ATOM   5410  C CA  . TYR B 1 320 ? 10.581  23.502   106.866 1.00 8.75  ? 406 TYR B CA  1 
ATOM   5411  C C   . TYR B 1 320 ? 11.591  24.132   105.921 1.00 8.41  ? 406 TYR B C   1 
ATOM   5412  O O   . TYR B 1 320 ? 12.208  25.135   106.230 1.00 7.42  ? 406 TYR B O   1 
ATOM   5413  C CB  . TYR B 1 320 ? 9.178   23.885   106.378 1.00 7.50  ? 406 TYR B CB  1 
ATOM   5414  C CG  . TYR B 1 320 ? 8.067   22.917   106.699 1.00 6.40  ? 406 TYR B CG  1 
ATOM   5415  C CD1 . TYR B 1 320 ? 8.084   22.148   107.864 1.00 7.38  ? 406 TYR B CD1 1 
ATOM   5416  C CD2 . TYR B 1 320 ? 6.965   22.814   105.862 1.00 5.86  ? 406 TYR B CD2 1 
ATOM   5417  C CE1 . TYR B 1 320 ? 7.032   21.307   108.180 1.00 5.63  ? 406 TYR B CE1 1 
ATOM   5418  C CE2 . TYR B 1 320 ? 5.912   21.982   106.167 1.00 7.23  ? 406 TYR B CE2 1 
ATOM   5419  C CZ  . TYR B 1 320 ? 5.950   21.230   107.322 1.00 7.74  ? 406 TYR B CZ  1 
ATOM   5420  O OH  . TYR B 1 320 ? 4.911   20.384   107.598 1.00 9.25  ? 406 TYR B OH  1 
ATOM   5421  N N   . SER B 1 321 ? 11.736  23.525   104.752 1.00 9.28  ? 407 SER B N   1 
ATOM   5422  C CA  . SER B 1 321 ? 12.617  24.037   103.720 1.00 9.02  ? 407 SER B CA  1 
ATOM   5423  C C   . SER B 1 321 ? 12.083  23.519   102.391 1.00 9.51  ? 407 SER B C   1 
ATOM   5424  O O   . SER B 1 321 ? 11.605  22.391   102.292 1.00 9.38  ? 407 SER B O   1 
ATOM   5425  C CB  . SER B 1 321 ? 14.069  23.590   103.949 1.00 9.05  ? 407 SER B CB  1 
ATOM   5426  O OG  . SER B 1 321 ? 14.272  22.226   103.660 1.00 11.60 ? 407 SER B OG  1 
ATOM   5427  N N   . GLY B 1 322 ? 12.126  24.359   101.371 1.00 10.56 ? 408 GLY B N   1 
ATOM   5428  C CA  . GLY B 1 322 ? 11.626  23.925   100.088 1.00 12.33 ? 408 GLY B CA  1 
ATOM   5429  C C   . GLY B 1 322 ? 12.469  24.441   98.955  1.00 13.80 ? 408 GLY B C   1 
ATOM   5430  O O   . GLY B 1 322 ? 13.324  25.294   99.149  1.00 14.96 ? 408 GLY B O   1 
ATOM   5431  N N   . SER B 1 323 ? 12.228  23.922   97.763  1.00 15.01 ? 409 SER B N   1 
ATOM   5432  C CA  . SER B 1 323 ? 12.976  24.350   96.598  1.00 15.41 ? 409 SER B CA  1 
ATOM   5433  C C   . SER B 1 323 ? 12.138  25.289   95.755  1.00 16.22 ? 409 SER B C   1 
ATOM   5434  O O   . SER B 1 323 ? 10.909  25.249   95.796  1.00 15.36 ? 409 SER B O   1 
ATOM   5435  C CB  . SER B 1 323 ? 13.328  23.148   95.740  1.00 14.42 ? 409 SER B CB  1 
ATOM   5436  O OG  . SER B 1 323 ? 12.138  22.587   95.217  1.00 15.12 ? 409 SER B OG  1 
ATOM   5437  N N   . PHE B 1 324 ? 12.809  26.161   95.016  1.00 17.74 ? 410 PHE B N   1 
ATOM   5438  C CA  . PHE B 1 324 ? 12.108  27.038   94.093  1.00 19.06 ? 410 PHE B CA  1 
ATOM   5439  C C   . PHE B 1 324 ? 13.021  27.406   92.946  1.00 20.03 ? 410 PHE B C   1 
ATOM   5440  O O   . PHE B 1 324 ? 14.250  27.419   93.083  1.00 19.23 ? 410 PHE B O   1 
ATOM   5441  C CB  . PHE B 1 324 ? 11.531  28.293   94.761  1.00 17.70 ? 410 PHE B CB  1 
ATOM   5442  C CG  . PHE B 1 324 ? 12.550  29.324   95.161  1.00 18.68 ? 410 PHE B CG  1 
ATOM   5443  C CD1 . PHE B 1 324 ? 13.101  29.320   96.438  1.00 18.16 ? 410 PHE B CD1 1 
ATOM   5444  C CD2 . PHE B 1 324 ? 12.877  30.360   94.292  1.00 16.22 ? 410 PHE B CD2 1 
ATOM   5445  C CE1 . PHE B 1 324 ? 13.955  30.340   96.849  1.00 19.89 ? 410 PHE B CE1 1 
ATOM   5446  C CE2 . PHE B 1 324 ? 13.727  31.383   94.682  1.00 16.26 ? 410 PHE B CE2 1 
ATOM   5447  C CZ  . PHE B 1 324 ? 14.270  31.383   95.964  1.00 17.81 ? 410 PHE B CZ  1 
ATOM   5448  N N   . VAL B 1 325 ? 12.481  27.718   91.834  1.00 21.69 ? 411 VAL B N   1 
ATOM   5449  C CA  . VAL B 1 325 ? 13.288  27.854   90.596  1.00 23.25 ? 411 VAL B CA  1 
ATOM   5450  C C   . VAL B 1 325 ? 13.220  29.275   90.089  1.00 22.75 ? 411 VAL B C   1 
ATOM   5451  O O   . VAL B 1 325 ? 12.370  29.959   90.566  1.00 24.44 ? 411 VAL B O   1 
ATOM   5452  C CB  . VAL B 1 325 ? 12.807  26.886   89.499  1.00 23.90 ? 411 VAL B CB  1 
ATOM   5453  C CG1 . VAL B 1 325 ? 13.566  27.129   88.204  1.00 27.17 ? 411 VAL B CG1 1 
ATOM   5454  C CG2 . VAL B 1 325 ? 12.964  25.444   89.956  1.00 23.13 ? 411 VAL B CG2 1 
ATOM   5455  N N   . GLN B 1 326 ? 14.056  29.577   89.104  1.00 18.67 ? 412 GLN B N   1 
ATOM   5456  C CA  . GLN B 1 326 ? 14.174  30.816   88.351  1.00 16.86 ? 412 GLN B CA  1 
ATOM   5457  C C   . GLN B 1 326 ? 14.235  30.286   86.876  1.00 16.07 ? 412 GLN B C   1 
ATOM   5458  O O   . GLN B 1 326 ? 14.945  29.274   86.683  1.00 14.98 ? 412 GLN B O   1 
ATOM   5459  C CB  . GLN B 1 326 ? 15.290  31.690   88.928  1.00 15.48 ? 412 GLN B CB  1 
ATOM   5460  C CG  . GLN B 1 326 ? 15.080  32.085   90.381  1.00 13.62 ? 412 GLN B CG  1 
ATOM   5461  C CD  . GLN B 1 326 ? 16.205  32.949   90.917  1.00 15.48 ? 412 GLN B CD  1 
ATOM   5462  O OE1 . GLN B 1 326 ? 17.156  33.261   90.201  1.00 16.32 ? 412 GLN B OE1 1 
ATOM   5463  N NE2 . GLN B 1 326 ? 16.098  33.338   92.182  1.00 14.00 ? 412 GLN B NE2 1 
ATOM   5464  N N   . HIS B 1 327 A 13.446  30.612   86.146  1.00 16.55 ? 412 HIS B N   1 
ATOM   5465  C CA  . HIS B 1 327 A 13.484  30.272   84.732  1.00 16.21 ? 412 HIS B CA  1 
ATOM   5466  C C   . HIS B 1 327 A 14.267  31.253   83.867  1.00 16.99 ? 412 HIS B C   1 
ATOM   5467  O O   . HIS B 1 327 A 14.445  32.417   84.221  1.00 16.21 ? 412 HIS B O   1 
ATOM   5468  C CB  . HIS B 1 327 A 12.062  30.162   84.198  1.00 15.35 ? 412 HIS B CB  1 
ATOM   5469  C CG  . HIS B 1 327 A 11.402  28.845   84.478  1.00 16.97 ? 412 HIS B CG  1 
ATOM   5470  N ND1 . HIS B 1 327 A 11.339  27.831   83.542  1.00 16.30 ? 412 HIS B ND1 1 
ATOM   5471  C CD2 . HIS B 1 327 A 10.747  28.381   85.569  1.00 15.54 ? 412 HIS B CD2 1 
ATOM   5472  C CE1 . HIS B 1 327 A 10.673  26.812   84.041  1.00 15.93 ? 412 HIS B CE1 1 
ATOM   5473  N NE2 . HIS B 1 327 A 10.300  27.118   85.272  1.00 16.36 ? 412 HIS B NE2 1 
ATOM   5474  N N   . PRO B 1 328 B 14.763  30.777   82.716  1.00 18.80 ? 412 PRO B N   1 
ATOM   5475  C CA  . PRO B 1 328 B 15.530  31.593   81.770  1.00 19.76 ? 412 PRO B CA  1 
ATOM   5476  C C   . PRO B 1 328 B 14.785  32.852   81.312  1.00 20.92 ? 412 PRO B C   1 
ATOM   5477  O O   . PRO B 1 328 B 15.411  33.863   80.985  1.00 21.59 ? 412 PRO B O   1 
ATOM   5478  C CB  . PRO B 1 328 B 15.775  30.630   80.607  1.00 20.07 ? 412 PRO B CB  1 
ATOM   5479  C CG  . PRO B 1 328 B 15.894  29.297   81.308  1.00 20.10 ? 412 PRO B CG  1 
ATOM   5480  C CD  . PRO B 1 328 B 14.760  29.356   82.306  1.00 18.70 ? 412 PRO B CD  1 
ATOM   5481  N N   . GLU B 1 329 C 13.456  32.800   81.276  1.00 20.69 ? 412 GLU B N   1 
ATOM   5482  C CA  . GLU B 1 329 C 12.701  33.965   80.826  1.00 22.45 ? 412 GLU B CA  1 
ATOM   5483  C C   . GLU B 1 329 C 12.641  35.085   81.866  1.00 21.34 ? 412 GLU B C   1 
ATOM   5484  O O   . GLU B 1 329 C 12.143  36.177   81.591  1.00 20.75 ? 412 GLU B O   1 
ATOM   5485  C CB  . GLU B 1 329 C 11.287  33.562   80.384  1.00 23.02 ? 412 GLU B CB  1 
ATOM   5486  C CG  . GLU B 1 329 C 10.846  32.213   80.882  1.00 26.75 ? 412 GLU B CG  1 
ATOM   5487  C CD  . GLU B 1 329 C 11.124  31.088   79.898  1.00 27.63 ? 412 GLU B CD  1 
ATOM   5488  O OE1 . GLU B 1 329 C 10.612  31.146   78.755  1.00 28.05 ? 412 GLU B OE1 1 
ATOM   5489  O OE2 . GLU B 1 329 C 11.846  30.139   80.277  1.00 28.98 ? 412 GLU B OE2 1 
ATOM   5490  N N   . LEU B 1 330 D 13.152  34.808   83.058  1.00 20.90 ? 412 LEU B N   1 
ATOM   5491  C CA  . LEU B 1 330 D 13.190  35.805   84.118  1.00 20.75 ? 412 LEU B CA  1 
ATOM   5492  C C   . LEU B 1 330 D 14.644  36.171   84.359  1.00 22.21 ? 412 LEU B C   1 
ATOM   5493  O O   . LEU B 1 330 D 14.956  37.290   84.754  1.00 24.06 ? 412 LEU B O   1 
ATOM   5494  C CB  . LEU B 1 330 D 12.603  35.249   85.421  1.00 18.83 ? 412 LEU B CB  1 
ATOM   5495  C CG  . LEU B 1 330 D 13.151  35.923   86.689  1.00 16.06 ? 412 LEU B CG  1 
ATOM   5496  C CD1 . LEU B 1 330 D 12.422  37.234   86.926  1.00 15.66 ? 412 LEU B CD1 1 
ATOM   5497  C CD2 . LEU B 1 330 D 12.984  35.011   87.894  1.00 15.05 ? 412 LEU B CD2 1 
ATOM   5498  N N   . THR B 1 331 ? 15.530  35.222   84.084  1.00 22.41 ? 413 THR B N   1 
ATOM   5499  C CA  . THR B 1 331 ? 16.951  35.395   84.331  1.00 23.30 ? 413 THR B CA  1 
ATOM   5500  C C   . THR B 1 331 ? 17.830  35.758   83.129  1.00 23.39 ? 413 THR B C   1 
ATOM   5501  O O   . THR B 1 331 ? 18.872  36.410   83.274  1.00 23.43 ? 413 THR B O   1 
ATOM   5502  C CB  . THR B 1 331 ? 17.495  34.111   85.002  1.00 23.82 ? 413 THR B CB  1 
ATOM   5503  O OG1 . THR B 1 331 ? 16.900  33.971   86.300  1.00 25.15 ? 413 THR B OG1 1 
ATOM   5504  C CG2 . THR B 1 331 ? 18.989  34.173   85.160  1.00 24.74 ? 413 THR B CG2 1 
ATOM   5505  N N   . GLY B 1 332 ? 17.411  35.351   81.940  1.00 22.95 ? 414 GLY B N   1 
ATOM   5506  C CA  . GLY B 1 332 ? 18.215  35.638   80.774  1.00 21.06 ? 414 GLY B CA  1 
ATOM   5507  C C   . GLY B 1 332 ? 19.271  34.559   80.607  1.00 21.26 ? 414 GLY B C   1 
ATOM   5508  O O   . GLY B 1 332 ? 19.987  34.544   79.612  1.00 19.82 ? 414 GLY B O   1 
ATOM   5509  N N   . LEU B 1 333 ? 19.375  33.661   81.584  1.00 21.27 ? 415 LEU B N   1 
ATOM   5510  C CA  . LEU B 1 333 ? 20.337  32.555   81.531  1.00 22.78 ? 415 LEU B CA  1 
ATOM   5511  C C   . LEU B 1 333 ? 19.862  31.471   80.547  1.00 23.60 ? 415 LEU B C   1 
ATOM   5512  O O   . LEU B 1 333 ? 18.732  31.518   80.051  1.00 24.18 ? 415 LEU B O   1 
ATOM   5513  C CB  . LEU B 1 333 ? 20.494  31.939   82.926  1.00 22.71 ? 415 LEU B CB  1 
ATOM   5514  C CG  . LEU B 1 333 ? 21.649  32.379   83.841  1.00 23.15 ? 415 LEU B CG  1 
ATOM   5515  C CD1 . LEU B 1 333 ? 22.009  33.836   83.622  1.00 22.92 ? 415 LEU B CD1 1 
ATOM   5516  C CD2 . LEU B 1 333 ? 21.253  32.113   85.294  1.00 20.56 ? 415 LEU B CD2 1 
ATOM   5517  N N   . ASP B 1 334 ? 20.713  30.493   80.262  1.00 23.99 ? 416 ASP B N   1 
ATOM   5518  C CA  . ASP B 1 334 ? 20.320  29.420   79.351  1.00 25.36 ? 416 ASP B CA  1 
ATOM   5519  C C   . ASP B 1 334 ? 20.115  28.104   80.101  1.00 24.60 ? 416 ASP B C   1 
ATOM   5520  O O   . ASP B 1 334 ? 20.286  27.024   79.543  1.00 24.95 ? 416 ASP B O   1 
ATOM   5521  C CB  . ASP B 1 334 ? 21.380  29.222   78.278  1.00 27.35 ? 416 ASP B CB  1 
ATOM   5522  C CG  . ASP B 1 334 ? 22.625  28.562   78.821  1.00 30.20 ? 416 ASP B CG  1 
ATOM   5523  O OD1 . ASP B 1 334 ? 22.761  28.462   80.068  1.00 30.49 ? 416 ASP B OD1 1 
ATOM   5524  O OD2 . ASP B 1 334 ? 23.470  28.149   77.997  1.00 32.37 ? 416 ASP B OD2 1 
ATOM   5525  N N   . CYS B 1 335 ? 19.757  28.205   81.374  1.00 24.31 ? 417 CYS B N   1 
ATOM   5526  C CA  . CYS B 1 335 ? 19.523  27.034   82.203  1.00 23.17 ? 417 CYS B CA  1 
ATOM   5527  C C   . CYS B 1 335 ? 18.574  27.413   83.340  1.00 21.46 ? 417 CYS B C   1 
ATOM   5528  O O   . CYS B 1 335 ? 18.402  28.591   83.656  1.00 21.13 ? 417 CYS B O   1 
ATOM   5529  C CB  . CYS B 1 335 ? 20.853  26.501   82.757  1.00 24.95 ? 417 CYS B CB  1 
ATOM   5530  S SG  . CYS B 1 335 ? 21.917  27.777   83.517  1.00 29.12 ? 417 CYS B SG  1 
ATOM   5531  N N   . ILE B 1 336 ? 17.944  26.408   83.933  1.00 19.55 ? 418 ILE B N   1 
ATOM   5532  C CA  . ILE B 1 336 ? 17.011  26.618   85.032  1.00 16.91 ? 418 ILE B CA  1 
ATOM   5533  C C   . ILE B 1 336 ? 17.758  26.708   86.363  1.00 15.95 ? 418 ILE B C   1 
ATOM   5534  O O   . ILE B 1 336 ? 18.274  25.714   86.847  1.00 18.50 ? 418 ILE B O   1 
ATOM   5535  C CB  . ILE B 1 336 ? 15.965  25.475   85.042  1.00 15.75 ? 418 ILE B CB  1 
ATOM   5536  C CG1 . ILE B 1 336 ? 15.004  25.691   83.860  1.00 13.69 ? 418 ILE B CG1 1 
ATOM   5537  C CG2 . ILE B 1 336 ? 15.255  25.398   86.387  1.00 11.61 ? 418 ILE B CG2 1 
ATOM   5538  C CD1 . ILE B 1 336 ? 13.991  24.596   83.637  1.00 11.73 ? 418 ILE B CD1 1 
ATOM   5539  N N   . ARG B 1 337 ? 17.813  27.902   86.947  1.00 14.33 ? 419 ARG B N   1 
ATOM   5540  C CA  . ARG B 1 337 ? 18.517  28.114   88.203  1.00 14.03 ? 419 ARG B CA  1 
ATOM   5541  C C   . ARG B 1 337 ? 17.775  27.642   89.452  1.00 14.22 ? 419 ARG B C   1 
ATOM   5542  O O   . ARG B 1 337 ? 16.591  27.921   89.635  1.00 14.49 ? 419 ARG B O   1 
ATOM   5543  C CB  . ARG B 1 337 ? 18.884  29.594   88.376  1.00 15.33 ? 419 ARG B CB  1 
ATOM   5544  C CG  . ARG B 1 337 ? 19.253  29.957   89.819  1.00 17.66 ? 419 ARG B CG  1 
ATOM   5545  C CD  . ARG B 1 337 ? 19.616  31.424   89.994  1.00 18.18 ? 419 ARG B CD  1 
ATOM   5546  N NE  . ARG B 1 337 ? 20.975  31.709   89.550  1.00 18.83 ? 419 ARG B NE  1 
ATOM   5547  C CZ  . ARG B 1 337 ? 21.559  32.896   89.668  1.00 18.94 ? 419 ARG B CZ  1 
ATOM   5548  N NH1 . ARG B 1 337 ? 20.897  33.910   90.211  1.00 17.96 ? 419 ARG B NH1 1 
ATOM   5549  N NH2 . ARG B 1 337 ? 22.809  33.067   89.262  1.00 18.69 ? 419 ARG B NH2 1 
ATOM   5550  N N   . PRO B 1 338 ? 18.480  26.916   90.334  1.00 13.20 ? 420 PRO B N   1 
ATOM   5551  C CA  . PRO B 1 338 ? 17.930  26.385   91.586  1.00 13.88 ? 420 PRO B CA  1 
ATOM   5552  C C   . PRO B 1 338 ? 18.166  27.274   92.824  1.00 13.85 ? 420 PRO B C   1 
ATOM   5553  O O   . PRO B 1 338 ? 19.244  27.845   93.010  1.00 11.94 ? 420 PRO B O   1 
ATOM   5554  C CB  . PRO B 1 338 ? 18.640  25.042   91.709  1.00 12.85 ? 420 PRO B CB  1 
ATOM   5555  C CG  . PRO B 1 338 ? 20.016  25.397   91.245  1.00 11.92 ? 420 PRO B CG  1 
ATOM   5556  C CD  . PRO B 1 338 ? 19.757  26.251   90.010  1.00 11.99 ? 420 PRO B CD  1 
ATOM   5557  N N   . CYS B 1 339 ? 17.146  27.390   93.662  1.00 14.57 ? 421 CYS B N   1 
ATOM   5558  C CA  . CYS B 1 339 ? 17.250  28.166   94.894  1.00 16.96 ? 421 CYS B CA  1 
ATOM   5559  C C   . CYS B 1 339 ? 16.441  27.394   95.932  1.00 16.50 ? 421 CYS B C   1 
ATOM   5560  O O   . CYS B 1 339 ? 15.770  26.419   95.605  1.00 17.78 ? 421 CYS B O   1 
ATOM   5561  C CB  . CYS B 1 339 ? 16.637  29.566   94.749  1.00 17.49 ? 421 CYS B CB  1 
ATOM   5562  S SG  . CYS B 1 339 ? 17.200  30.632   93.382  1.00 21.75 ? 421 CYS B SG  1 
ATOM   5563  N N   . PHE B 1 340 ? 16.512  27.809   97.186  1.00 14.76 ? 422 PHE B N   1 
ATOM   5564  C CA  . PHE B 1 340 ? 15.725  27.147   98.206  1.00 14.04 ? 422 PHE B CA  1 
ATOM   5565  C C   . PHE B 1 340 ? 15.471  28.119   99.336  1.00 14.13 ? 422 PHE B C   1 
ATOM   5566  O O   . PHE B 1 340 ? 16.213  29.084   99.513  1.00 14.77 ? 422 PHE B O   1 
ATOM   5567  C CB  . PHE B 1 340 ? 16.430  25.880   98.715  1.00 13.63 ? 422 PHE B CB  1 
ATOM   5568  C CG  . PHE B 1 340 ? 17.672  26.141   99.525  1.00 13.14 ? 422 PHE B CG  1 
ATOM   5569  C CD1 . PHE B 1 340 ? 17.584  26.457   100.882 1.00 10.86 ? 422 PHE B CD1 1 
ATOM   5570  C CD2 . PHE B 1 340 ? 18.935  26.077   98.929  1.00 12.74 ? 422 PHE B CD2 1 
ATOM   5571  C CE1 . PHE B 1 340 ? 18.725  26.710   101.638 1.00 10.65 ? 422 PHE B CE1 1 
ATOM   5572  C CE2 . PHE B 1 340 ? 20.090  26.331   99.677  1.00 12.72 ? 422 PHE B CE2 1 
ATOM   5573  C CZ  . PHE B 1 340 ? 19.981  26.649   101.039 1.00 13.04 ? 422 PHE B CZ  1 
ATOM   5574  N N   . TRP B 1 341 ? 14.404  27.877   100.082 1.00 13.25 ? 423 TRP B N   1 
ATOM   5575  C CA  . TRP B 1 341 ? 14.064  28.724   101.207 1.00 14.34 ? 423 TRP B CA  1 
ATOM   5576  C C   . TRP B 1 341 ? 14.102  27.847   102.439 1.00 13.69 ? 423 TRP B C   1 
ATOM   5577  O O   . TRP B 1 341 ? 14.148  26.626   102.324 1.00 15.05 ? 423 TRP B O   1 
ATOM   5578  C CB  . TRP B 1 341 ? 12.653  29.307   101.040 1.00 14.40 ? 423 TRP B CB  1 
ATOM   5579  C CG  . TRP B 1 341 ? 11.606  28.284   100.734 1.00 13.55 ? 423 TRP B CG  1 
ATOM   5580  C CD1 . TRP B 1 341 ? 11.165  27.909   99.500  1.00 14.92 ? 423 TRP B CD1 1 
ATOM   5581  C CD2 . TRP B 1 341 ? 10.897  27.475   101.674 1.00 13.80 ? 423 TRP B CD2 1 
ATOM   5582  N NE1 . TRP B 1 341 ? 10.223  26.917   99.610  1.00 13.84 ? 423 TRP B NE1 1 
ATOM   5583  C CE2 . TRP B 1 341 ? 10.040  26.629   100.938 1.00 13.19 ? 423 TRP B CE2 1 
ATOM   5584  C CE3 . TRP B 1 341 ? 10.903  27.379   103.071 1.00 14.39 ? 423 TRP B CE3 1 
ATOM   5585  C CZ2 . TRP B 1 341 ? 9.197   25.700   101.545 1.00 13.53 ? 423 TRP B CZ2 1 
ATOM   5586  C CZ3 . TRP B 1 341 ? 10.065  26.454   103.678 1.00 15.09 ? 423 TRP B CZ3 1 
ATOM   5587  C CH2 . TRP B 1 341 ? 9.223   25.625   102.914 1.00 14.17 ? 423 TRP B CH2 1 
ATOM   5588  N N   . VAL B 1 342 ? 14.091  28.475   103.610 1.00 13.21 ? 424 VAL B N   1 
ATOM   5589  C CA  . VAL B 1 342 ? 14.088  27.762   104.878 1.00 12.22 ? 424 VAL B CA  1 
ATOM   5590  C C   . VAL B 1 342 ? 13.147  28.484   105.825 1.00 13.38 ? 424 VAL B C   1 
ATOM   5591  O O   . VAL B 1 342 ? 13.199  29.711   105.948 1.00 14.18 ? 424 VAL B O   1 
ATOM   5592  C CB  . VAL B 1 342 ? 15.473  27.739   105.545 1.00 12.79 ? 424 VAL B CB  1 
ATOM   5593  C CG1 . VAL B 1 342 ? 15.418  26.898   106.822 1.00 10.91 ? 424 VAL B CG1 1 
ATOM   5594  C CG2 . VAL B 1 342 ? 16.513  27.202   104.587 1.00 13.45 ? 424 VAL B CG2 1 
ATOM   5595  N N   . GLU B 1 343 ? 12.281  27.726   106.485 1.00 13.05 ? 425 GLU B N   1 
ATOM   5596  C CA  . GLU B 1 343 ? 11.352  28.295   107.443 1.00 14.14 ? 425 GLU B CA  1 
ATOM   5597  C C   . GLU B 1 343 ? 12.001  28.243   108.833 1.00 15.67 ? 425 GLU B C   1 
ATOM   5598  O O   . GLU B 1 343 ? 12.531  27.201   109.236 1.00 16.49 ? 425 GLU B O   1 
ATOM   5599  C CB  . GLU B 1 343 ? 10.047  27.496   107.448 1.00 14.74 ? 425 GLU B CB  1 
ATOM   5600  C CG  . GLU B 1 343 ? 9.056   27.960   108.500 1.00 13.00 ? 425 GLU B CG  1 
ATOM   5601  C CD  . GLU B 1 343 ? 7.908   26.990   108.699 1.00 13.91 ? 425 GLU B CD  1 
ATOM   5602  O OE1 . GLU B 1 343 ? 8.161   25.783   108.882 1.00 13.15 ? 425 GLU B OE1 1 
ATOM   5603  O OE2 . GLU B 1 343 ? 6.751   27.443   108.682 1.00 14.29 ? 425 GLU B OE2 1 
ATOM   5604  N N   . LEU B 1 344 ? 11.976  29.362   109.554 1.00 13.82 ? 426 LEU B N   1 
ATOM   5605  C CA  . LEU B 1 344 ? 12.559  29.420   110.893 1.00 13.04 ? 426 LEU B CA  1 
ATOM   5606  C C   . LEU B 1 344 ? 11.416  29.484   111.914 1.00 14.01 ? 426 LEU B C   1 
ATOM   5607  O O   . LEU B 1 344 ? 10.921  30.564   112.233 1.00 14.00 ? 426 LEU B O   1 
ATOM   5608  C CB  . LEU B 1 344 ? 13.462  30.656   111.018 1.00 11.62 ? 426 LEU B CB  1 
ATOM   5609  C CG  . LEU B 1 344 ? 14.470  30.921   109.891 1.00 10.18 ? 426 LEU B CG  1 
ATOM   5610  C CD1 . LEU B 1 344 ? 15.223  32.211   110.154 1.00 7.86  ? 426 LEU B CD1 1 
ATOM   5611  C CD2 . LEU B 1 344 ? 15.442  29.763   109.781 1.00 9.94  ? 426 LEU B CD2 1 
ATOM   5612  N N   . ILE B 1 345 ? 11.015  28.320   112.423 1.00 14.89 ? 427 ILE B N   1 
ATOM   5613  C CA  . ILE B 1 345 ? 9.902   28.187   113.376 1.00 15.73 ? 427 ILE B CA  1 
ATOM   5614  C C   . ILE B 1 345 ? 10.146  28.576   114.834 1.00 16.83 ? 427 ILE B C   1 
ATOM   5615  O O   . ILE B 1 345 ? 11.022  28.015   115.496 1.00 16.88 ? 427 ILE B O   1 
ATOM   5616  C CB  . ILE B 1 345 ? 9.385   26.741   113.408 1.00 15.21 ? 427 ILE B CB  1 
ATOM   5617  C CG1 . ILE B 1 345 ? 9.082   26.255   111.992 1.00 15.14 ? 427 ILE B CG1 1 
ATOM   5618  C CG2 . ILE B 1 345 ? 8.163   26.656   114.296 1.00 15.28 ? 427 ILE B CG2 1 
ATOM   5619  C CD1 . ILE B 1 345 ? 8.635   24.817   111.940 1.00 16.32 ? 427 ILE B CD1 1 
ATOM   5620  N N   . ARG B 1 346 ? 9.337   29.507   115.341 1.00 17.33 ? 428 ARG B N   1 
ATOM   5621  C CA  . ARG B 1 346 ? 9.451   29.948   116.730 1.00 17.57 ? 428 ARG B CA  1 
ATOM   5622  C C   . ARG B 1 346 ? 8.182   29.634   117.533 1.00 18.97 ? 428 ARG B C   1 
ATOM   5623  O O   . ARG B 1 346 ? 7.095   29.493   116.972 1.00 20.06 ? 428 ARG B O   1 
ATOM   5624  C CB  . ARG B 1 346 ? 9.751   31.450   116.796 1.00 17.35 ? 428 ARG B CB  1 
ATOM   5625  C CG  . ARG B 1 346 ? 11.116  31.849   116.242 1.00 15.53 ? 428 ARG B CG  1 
ATOM   5626  C CD  . ARG B 1 346 ? 12.221  30.990   116.854 1.00 12.87 ? 428 ARG B CD  1 
ATOM   5627  N NE  . ARG B 1 346 ? 12.467  31.300   118.256 1.00 12.37 ? 428 ARG B NE  1 
ATOM   5628  C CZ  . ARG B 1 346 ? 13.150  32.361   118.680 1.00 12.41 ? 428 ARG B CZ  1 
ATOM   5629  N NH1 . ARG B 1 346 ? 13.327  32.565   119.976 1.00 14.09 ? 428 ARG B NH1 1 
ATOM   5630  N NH2 . ARG B 1 346 ? 13.661  33.219   117.813 1.00 8.98  ? 428 ARG B NH2 1 
ATOM   5631  N N   . GLY B 1 347 ? 8.328   29.510   118.848 1.00 19.27 ? 429 GLY B N   1 
ATOM   5632  C CA  . GLY B 1 347 ? 7.180   29.208   119.680 1.00 20.39 ? 429 GLY B CA  1 
ATOM   5633  C C   . GLY B 1 347 ? 7.043   27.729   119.981 1.00 20.48 ? 429 GLY B C   1 
ATOM   5634  O O   . GLY B 1 347 ? 8.045   27.017   120.072 1.00 20.55 ? 429 GLY B O   1 
ATOM   5635  N N   . ARG B 1 348 ? 5.801   27.273   120.137 1.00 21.07 ? 430 ARG B N   1 
ATOM   5636  C CA  . ARG B 1 348 ? 5.520   25.874   120.440 1.00 22.82 ? 430 ARG B CA  1 
ATOM   5637  C C   . ARG B 1 348 ? 5.788   24.973   119.244 1.00 21.97 ? 430 ARG B C   1 
ATOM   5638  O O   . ARG B 1 348 ? 5.774   25.415   118.099 1.00 21.58 ? 430 ARG B O   1 
ATOM   5639  C CB  . ARG B 1 348 ? 4.067   25.708   120.896 1.00 25.82 ? 430 ARG B CB  1 
ATOM   5640  C CG  . ARG B 1 348 ? 3.810   26.150   122.336 1.00 28.81 ? 430 ARG B CG  1 
ATOM   5641  C CD  . ARG B 1 348 ? 2.450   26.829   122.443 1.00 35.57 ? 430 ARG B CD  1 
ATOM   5642  N NE  . ARG B 1 348 ? 1.328   25.915   122.677 1.00 40.38 ? 430 ARG B NE  1 
ATOM   5643  C CZ  . ARG B 1 348 ? 0.111   26.070   122.152 1.00 43.16 ? 430 ARG B CZ  1 
ATOM   5644  N NH1 . ARG B 1 348 ? -0.148  27.100   121.342 1.00 42.98 ? 430 ARG B NH1 1 
ATOM   5645  N NH2 . ARG B 1 348 ? -0.861  25.214   122.458 1.00 43.81 ? 430 ARG B NH2 1 
ATOM   5646  N N   . PRO B 1 349 ? 6.006   23.682   119.496 1.00 21.78 ? 431 PRO B N   1 
ATOM   5647  C CA  . PRO B 1 349 ? 6.005   23.052   120.821 1.00 21.52 ? 431 PRO B CA  1 
ATOM   5648  C C   . PRO B 1 349 ? 7.299   23.221   121.611 1.00 21.49 ? 431 PRO B C   1 
ATOM   5649  O O   . PRO B 1 349 ? 7.324   23.018   122.824 1.00 22.51 ? 431 PRO B O   1 
ATOM   5650  C CB  . PRO B 1 349 ? 5.749   21.597   120.489 1.00 21.52 ? 431 PRO B CB  1 
ATOM   5651  C CG  . PRO B 1 349 ? 6.597   21.435   119.237 1.00 21.80 ? 431 PRO B CG  1 
ATOM   5652  C CD  . PRO B 1 349 ? 6.281   22.691   118.439 1.00 20.81 ? 431 PRO B CD  1 
ATOM   5653  N N   . LYS B 1 350 ? 8.370   23.597   120.927 1.00 20.83 ? 432 LYS B N   1 
ATOM   5654  C CA  . LYS B 1 350 ? 9.665   23.746   121.579 1.00 21.02 ? 432 LYS B CA  1 
ATOM   5655  C C   . LYS B 1 350 ? 9.835   24.869   122.598 1.00 20.83 ? 432 LYS B C   1 
ATOM   5656  O O   . LYS B 1 350 ? 10.565  24.713   123.578 1.00 20.55 ? 432 LYS B O   1 
ATOM   5657  C CB  . LYS B 1 350 ? 10.761  23.866   120.516 1.00 21.12 ? 432 LYS B CB  1 
ATOM   5658  C CG  . LYS B 1 350 ? 11.053  22.564   119.812 1.00 20.62 ? 432 LYS B CG  1 
ATOM   5659  C CD  . LYS B 1 350 ? 11.461  21.511   120.827 1.00 23.38 ? 432 LYS B CD  1 
ATOM   5660  C CE  . LYS B 1 350 ? 11.701  20.171   120.176 1.00 24.84 ? 432 LYS B CE  1 
ATOM   5661  N NZ  . LYS B 1 350 ? 11.901  19.107   121.206 1.00 27.17 ? 432 LYS B NZ  1 
ATOM   5662  N N   . GLU B 1 351 ? 9.182   26.001   122.373 1.00 20.29 ? 433 GLU B N   1 
ATOM   5663  C CA  . GLU B 1 351 ? 9.329   27.127   123.289 1.00 20.56 ? 433 GLU B CA  1 
ATOM   5664  C C   . GLU B 1 351 ? 8.058   27.411   124.098 1.00 20.31 ? 433 GLU B C   1 
ATOM   5665  O O   . GLU B 1 351 ? 6.945   27.199   123.629 1.00 19.09 ? 433 GLU B O   1 
ATOM   5666  C CB  . GLU B 1 351 ? 9.782   28.360   122.498 1.00 19.81 ? 433 GLU B CB  1 
ATOM   5667  C CG  . GLU B 1 351 ? 11.127  28.136   121.818 1.00 21.72 ? 433 GLU B CG  1 
ATOM   5668  C CD  . GLU B 1 351 ? 11.544  29.262   120.887 1.00 23.27 ? 433 GLU B CD  1 
ATOM   5669  O OE1 . GLU B 1 351 ? 10.927  29.409   119.814 1.00 23.58 ? 433 GLU B OE1 1 
ATOM   5670  O OE2 . GLU B 1 351 ? 12.497  30.001   121.228 1.00 24.73 ? 433 GLU B OE2 1 
ATOM   5671  N N   . SER B 1 352 ? 8.234   27.882   125.325 1.00 19.91 ? 435 SER B N   1 
ATOM   5672  C CA  . SER B 1 352 ? 7.089   28.157   126.175 1.00 20.72 ? 435 SER B CA  1 
ATOM   5673  C C   . SER B 1 352 ? 6.420   29.493   125.855 1.00 19.73 ? 435 SER B C   1 
ATOM   5674  O O   . SER B 1 352 ? 6.704   30.515   126.471 1.00 20.32 ? 435 SER B O   1 
ATOM   5675  C CB  . SER B 1 352 ? 7.511   28.123   127.642 1.00 20.59 ? 435 SER B CB  1 
ATOM   5676  O OG  . SER B 1 352 ? 8.525   29.074   127.869 1.00 22.43 ? 435 SER B OG  1 
ATOM   5677  N N   . THR B 1 353 ? 5.520   29.461   124.885 1.00 17.67 ? 436 THR B N   1 
ATOM   5678  C CA  . THR B 1 353 ? 4.791   30.639   124.462 1.00 16.18 ? 436 THR B CA  1 
ATOM   5679  C C   . THR B 1 353 ? 3.375   30.164   124.217 1.00 15.82 ? 436 THR B C   1 
ATOM   5680  O O   . THR B 1 353 ? 3.086   28.987   124.368 1.00 17.17 ? 436 THR B O   1 
ATOM   5681  C CB  . THR B 1 353 ? 5.365   31.195   123.145 1.00 16.98 ? 436 THR B CB  1 
ATOM   5682  O OG1 . THR B 1 353 ? 5.397   30.149   122.162 1.00 17.16 ? 436 THR B OG1 1 
ATOM   5683  C CG2 . THR B 1 353 ? 6.777   31.719   123.355 1.00 14.10 ? 436 THR B CG2 1 
ATOM   5684  N N   . ILE B 1 354 ? 2.480   31.063   123.852 1.00 15.64 ? 437 ILE B N   1 
ATOM   5685  C CA  . ILE B 1 354 ? 1.117   30.632   123.580 1.00 16.24 ? 437 ILE B CA  1 
ATOM   5686  C C   . ILE B 1 354 ? 0.952   30.461   122.074 1.00 17.21 ? 437 ILE B C   1 
ATOM   5687  O O   . ILE B 1 354 ? -0.085  29.989   121.611 1.00 16.30 ? 437 ILE B O   1 
ATOM   5688  C CB  . ILE B 1 354 ? 0.073   31.678   124.018 1.00 15.99 ? 437 ILE B CB  1 
ATOM   5689  C CG1 . ILE B 1 354 ? 0.281   32.973   123.224 1.00 14.40 ? 437 ILE B CG1 1 
ATOM   5690  C CG2 . ILE B 1 354 ? 0.158   31.920   125.514 1.00 15.77 ? 437 ILE B CG2 1 
ATOM   5691  C CD1 . ILE B 1 354 ? -0.817  33.982   123.422 1.00 14.46 ? 437 ILE B CD1 1 
ATOM   5692  N N   . TRP B 1 355 ? 1.988   30.830   121.321 1.00 15.83 ? 438 TRP B N   1 
ATOM   5693  C CA  . TRP B 1 355 ? 1.929   30.795   119.871 1.00 15.62 ? 438 TRP B CA  1 
ATOM   5694  C C   . TRP B 1 355 ? 3.078   30.102   119.138 1.00 16.42 ? 438 TRP B C   1 
ATOM   5695  O O   . TRP B 1 355 ? 4.107   29.749   119.728 1.00 18.32 ? 438 TRP B O   1 
ATOM   5696  C CB  . TRP B 1 355 ? 1.850   32.236   119.368 1.00 15.47 ? 438 TRP B CB  1 
ATOM   5697  C CG  . TRP B 1 355 ? 3.020   33.048   119.861 1.00 14.78 ? 438 TRP B CG  1 
ATOM   5698  C CD1 . TRP B 1 355 ? 3.147   33.645   121.079 1.00 12.44 ? 438 TRP B CD1 1 
ATOM   5699  C CD2 . TRP B 1 355 ? 4.281   33.218   119.199 1.00 14.22 ? 438 TRP B CD2 1 
ATOM   5700  N NE1 . TRP B 1 355 ? 4.405   34.166   121.224 1.00 11.64 ? 438 TRP B NE1 1 
ATOM   5701  C CE2 . TRP B 1 355 ? 5.125   33.919   120.086 1.00 13.16 ? 438 TRP B CE2 1 
ATOM   5702  C CE3 . TRP B 1 355 ? 4.780   32.838   117.945 1.00 13.61 ? 438 TRP B CE3 1 
ATOM   5703  C CZ2 . TRP B 1 355 ? 6.447   34.252   119.761 1.00 13.03 ? 438 TRP B CZ2 1 
ATOM   5704  C CZ3 . TRP B 1 355 ? 6.094   33.165   117.622 1.00 15.37 ? 438 TRP B CZ3 1 
ATOM   5705  C CH2 . TRP B 1 355 ? 6.914   33.868   118.531 1.00 14.10 ? 438 TRP B CH2 1 
ATOM   5706  N N   . THR B 1 356 ? 2.871   29.933   117.832 1.00 14.88 ? 439 THR B N   1 
ATOM   5707  C CA  . THR B 1 356 ? 3.842   29.356   116.904 1.00 14.68 ? 439 THR B CA  1 
ATOM   5708  C C   . THR B 1 356 ? 3.812   30.224   115.633 1.00 14.12 ? 439 THR B C   1 
ATOM   5709  O O   . THR B 1 356 ? 2.746   30.653   115.203 1.00 13.90 ? 439 THR B O   1 
ATOM   5710  C CB  . THR B 1 356 ? 3.469   27.910   116.498 1.00 15.67 ? 439 THR B CB  1 
ATOM   5711  O OG1 . THR B 1 356 ? 3.527   27.047   117.641 1.00 16.15 ? 439 THR B OG1 1 
ATOM   5712  C CG2 . THR B 1 356 ? 4.420   27.405   115.433 1.00 14.29 ? 439 THR B CG2 1 
ATOM   5713  N N   . SER B 1 357 ? 4.969   30.496   115.039 1.00 14.61 ? 440 SER B N   1 
ATOM   5714  C CA  . SER B 1 357 ? 5.026   31.289   113.806 1.00 14.90 ? 440 SER B CA  1 
ATOM   5715  C C   . SER B 1 357 ? 6.420   31.150   113.224 1.00 15.16 ? 440 SER B C   1 
ATOM   5716  O O   . SER B 1 357 ? 7.298   30.597   113.883 1.00 15.60 ? 440 SER B O   1 
ATOM   5717  C CB  . SER B 1 357 ? 4.714   32.766   114.087 1.00 15.60 ? 440 SER B CB  1 
ATOM   5718  O OG  . SER B 1 357 ? 4.551   33.497   112.884 1.00 13.81 ? 440 SER B OG  1 
ATOM   5719  N N   . GLY B 1 358 ? 6.641   31.643   112.007 1.00 15.26 ? 441 GLY B N   1 
ATOM   5720  C CA  . GLY B 1 358 ? 7.968   31.508   111.417 1.00 15.54 ? 441 GLY B CA  1 
ATOM   5721  C C   . GLY B 1 358 ? 8.514   32.606   110.511 1.00 16.42 ? 441 GLY B C   1 
ATOM   5722  O O   . GLY B 1 358 ? 7.765   33.390   109.934 1.00 15.95 ? 441 GLY B O   1 
ATOM   5723  N N   . SER B 1 359 ? 9.842   32.643   110.403 1.00 16.92 ? 442 SER B N   1 
ATOM   5724  C CA  . SER B 1 359 ? 10.579  33.593   109.565 1.00 18.40 ? 442 SER B CA  1 
ATOM   5725  C C   . SER B 1 359 ? 11.108  32.841   108.357 1.00 18.53 ? 442 SER B C   1 
ATOM   5726  O O   . SER B 1 359 ? 11.010  31.615   108.291 1.00 20.18 ? 442 SER B O   1 
ATOM   5727  C CB  . SER B 1 359 ? 11.777  34.170   110.325 1.00 19.83 ? 442 SER B CB  1 
ATOM   5728  O OG  . SER B 1 359 ? 11.489  35.464   110.812 1.00 25.74 ? 442 SER B OG  1 
ATOM   5729  N N   . SER B 1 360 ? 11.695  33.556   107.409 1.00 17.50 ? 443 SER B N   1 
ATOM   5730  C CA  . SER B 1 360 ? 12.225  32.883   106.238 1.00 17.69 ? 443 SER B CA  1 
ATOM   5731  C C   . SER B 1 360 ? 13.544  33.466   105.762 1.00 18.62 ? 443 SER B C   1 
ATOM   5732  O O   . SER B 1 360 ? 13.823  34.639   105.981 1.00 18.26 ? 443 SER B O   1 
ATOM   5733  C CB  . SER B 1 360 ? 11.212  32.945   105.098 1.00 16.74 ? 443 SER B CB  1 
ATOM   5734  O OG  . SER B 1 360 ? 11.130  34.253   104.575 1.00 16.12 ? 443 SER B OG  1 
ATOM   5735  N N   . ILE B 1 361 ? 14.349  32.615   105.129 1.00 18.98 ? 444 ILE B N   1 
ATOM   5736  C CA  . ILE B 1 361 ? 15.639  32.989   104.545 1.00 18.89 ? 444 ILE B CA  1 
ATOM   5737  C C   . ILE B 1 361 ? 15.745  32.191   103.256 1.00 18.56 ? 444 ILE B C   1 
ATOM   5738  O O   . ILE B 1 361 ? 15.203  31.101   103.162 1.00 20.15 ? 444 ILE B O   1 
ATOM   5739  C CB  . ILE B 1 361 ? 16.854  32.615   105.450 1.00 18.72 ? 444 ILE B CB  1 
ATOM   5740  C CG1 . ILE B 1 361 ? 16.777  31.140   105.879 1.00 19.48 ? 444 ILE B CG1 1 
ATOM   5741  C CG2 . ILE B 1 361 ? 16.929  33.559   106.627 1.00 17.22 ? 444 ILE B CG2 1 
ATOM   5742  C CD1 . ILE B 1 361 ? 18.037  30.618   106.594 1.00 18.18 ? 444 ILE B CD1 1 
ATOM   5743  N N   . SER B 1 362 ? 16.434  32.712   102.256 1.00 18.53 ? 445 SER B N   1 
ATOM   5744  C CA  . SER B 1 362 ? 16.547  31.973   101.010 1.00 18.71 ? 445 SER B CA  1 
ATOM   5745  C C   . SER B 1 362 ? 17.896  32.188   100.359 1.00 19.86 ? 445 SER B C   1 
ATOM   5746  O O   . SER B 1 362 ? 18.563  33.188   100.624 1.00 18.90 ? 445 SER B O   1 
ATOM   5747  C CB  . SER B 1 362 ? 15.440  32.392   100.050 1.00 19.32 ? 445 SER B CB  1 
ATOM   5748  O OG  . SER B 1 362 ? 15.469  33.791   99.844  1.00 20.52 ? 445 SER B OG  1 
ATOM   5749  N N   . PHE B 1 363 ? 18.288  31.237   99.509  1.00 19.78 ? 446 PHE B N   1 
ATOM   5750  C CA  . PHE B 1 363 ? 19.563  31.283   98.799  1.00 19.34 ? 446 PHE B CA  1 
ATOM   5751  C C   . PHE B 1 363 ? 19.383  30.822   97.359  1.00 20.48 ? 446 PHE B C   1 
ATOM   5752  O O   . PHE B 1 363 ? 18.360  30.239   97.011  1.00 21.19 ? 446 PHE B O   1 
ATOM   5753  C CB  . PHE B 1 363 ? 20.577  30.363   99.476  1.00 17.88 ? 446 PHE B CB  1 
ATOM   5754  C CG  . PHE B 1 363 ? 20.752  30.623   100.943 1.00 16.95 ? 446 PHE B CG  1 
ATOM   5755  C CD1 . PHE B 1 363 ? 19.747  30.295   101.852 1.00 15.23 ? 446 PHE B CD1 1 
ATOM   5756  C CD2 . PHE B 1 363 ? 21.907  31.234   101.417 1.00 14.93 ? 446 PHE B CD2 1 
ATOM   5757  C CE1 . PHE B 1 363 ? 19.891  30.578   103.207 1.00 13.60 ? 446 PHE B CE1 1 
ATOM   5758  C CE2 . PHE B 1 363 ? 22.056  31.520   102.771 1.00 14.18 ? 446 PHE B CE2 1 
ATOM   5759  C CZ  . PHE B 1 363 ? 21.046  31.193   103.666 1.00 11.45 ? 446 PHE B CZ  1 
ATOM   5760  N N   . CYS B 1 364 ? 20.384  31.082   96.522  1.00 21.79 ? 447 CYS B N   1 
ATOM   5761  C CA  . CYS B 1 364 ? 20.333  30.653   95.130  1.00 23.38 ? 447 CYS B CA  1 
ATOM   5762  C C   . CYS B 1 364 ? 21.620  29.991   94.610  1.00 24.63 ? 447 CYS B C   1 
ATOM   5763  O O   . CYS B 1 364 ? 22.701  30.127   95.198  1.00 24.20 ? 447 CYS B O   1 
ATOM   5764  C CB  . CYS B 1 364 ? 19.944  31.818   94.220  1.00 23.61 ? 447 CYS B CB  1 
ATOM   5765  S SG  . CYS B 1 364 ? 18.161  32.242   94.235  1.00 26.06 ? 447 CYS B SG  1 
ATOM   5766  N N   . GLY B 1 365 ? 21.456  29.271   93.495  1.00 26.36 ? 448 GLY B N   1 
ATOM   5767  C CA  . GLY B 1 365 ? 22.519  28.539   92.820  1.00 26.52 ? 448 GLY B CA  1 
ATOM   5768  C C   . GLY B 1 365 ? 23.908  29.125   92.833  1.00 26.91 ? 448 GLY B C   1 
ATOM   5769  O O   . GLY B 1 365 ? 24.635  28.962   93.803  1.00 29.40 ? 448 GLY B O   1 
ATOM   5770  N N   . VAL B 1 366 ? 24.312  29.751   91.738  1.00 27.12 ? 449 VAL B N   1 
ATOM   5771  C CA  . VAL B 1 366 ? 25.629  30.386   91.673  1.00 26.91 ? 449 VAL B CA  1 
ATOM   5772  C C   . VAL B 1 366 ? 26.889  29.510   91.587  1.00 26.89 ? 449 VAL B C   1 
ATOM   5773  O O   . VAL B 1 366 ? 27.022  28.507   92.286  1.00 27.26 ? 449 VAL B O   1 
ATOM   5774  C CB  . VAL B 1 366 ? 25.780  31.353   92.856  1.00 27.07 ? 449 VAL B CB  1 
ATOM   5775  C CG1 . VAL B 1 366 ? 27.238  31.657   93.126  1.00 26.12 ? 449 VAL B CG1 1 
ATOM   5776  C CG2 . VAL B 1 366 ? 24.999  32.624   92.557  1.00 25.56 ? 449 VAL B CG2 1 
ATOM   5777  N N   . ASN B 1 367 ? 27.815  29.934   90.725  1.00 27.56 ? 450 ASN B N   1 
ATOM   5778  C CA  . ASN B 1 367 ? 29.093  29.258   90.497  1.00 27.16 ? 450 ASN B CA  1 
ATOM   5779  C C   . ASN B 1 367 ? 30.228  29.962   91.213  1.00 26.29 ? 450 ASN B C   1 
ATOM   5780  O O   . ASN B 1 367 ? 31.301  29.386   91.396  1.00 24.71 ? 450 ASN B O   1 
ATOM   5781  C CB  . ASN B 1 367 ? 29.450  29.253   89.012  1.00 29.53 ? 450 ASN B CB  1 
ATOM   5782  C CG  . ASN B 1 367 ? 28.656  28.255   88.225  1.00 31.37 ? 450 ASN B CG  1 
ATOM   5783  O OD1 . ASN B 1 367 ? 28.805  27.041   88.397  1.00 30.36 ? 450 ASN B OD1 1 
ATOM   5784  N ND2 . ASN B 1 367 ? 27.799  28.760   87.338  1.00 35.82 ? 450 ASN B ND2 1 
ATOM   5785  N N   . SER B 1 368 ? 30.005  31.229   91.554  1.00 25.93 ? 451 SER B N   1 
ATOM   5786  C CA  . SER B 1 368 ? 30.998  32.044   92.250  1.00 25.21 ? 451 SER B CA  1 
ATOM   5787  C C   . SER B 1 368 ? 31.092  31.493   93.668  1.00 24.57 ? 451 SER B C   1 
ATOM   5788  O O   . SER B 1 368 ? 30.262  30.671   94.046  1.00 23.29 ? 451 SER B O   1 
ATOM   5789  C CB  . SER B 1 368 ? 30.527  33.491   92.260  1.00 26.10 ? 451 SER B CB  1 
ATOM   5790  O OG  . SER B 1 368 ? 29.318  33.594   91.535  1.00 26.12 ? 451 SER B OG  1 
ATOM   5791  N N   . ASP B 1 369 ? 32.061  31.926   94.473  1.00 25.76 ? 452 ASP B N   1 
ATOM   5792  C CA  . ASP B 1 369 ? 32.108  31.327   95.797  1.00 27.36 ? 452 ASP B CA  1 
ATOM   5793  C C   . ASP B 1 369 ? 31.141  31.882   96.801  1.00 25.87 ? 452 ASP B C   1 
ATOM   5794  O O   . ASP B 1 369 ? 30.572  32.953   96.639  1.00 25.85 ? 452 ASP B O   1 
ATOM   5795  C CB  . ASP B 1 369 ? 33.509  31.303   96.408  1.00 30.97 ? 452 ASP B CB  1 
ATOM   5796  C CG  . ASP B 1 369 ? 33.704  30.090   97.354  1.00 34.89 ? 452 ASP B CG  1 
ATOM   5797  O OD1 . ASP B 1 369 ? 33.121  29.019   97.042  1.00 35.53 ? 452 ASP B OD1 1 
ATOM   5798  O OD2 . ASP B 1 369 ? 34.432  30.188   98.382  1.00 36.53 ? 452 ASP B OD2 1 
ATOM   5799  N N   . THR B 1 370 ? 30.980  31.114   97.860  1.00 24.33 ? 453 THR B N   1 
ATOM   5800  C CA  . THR B 1 370 ? 30.050  31.432   98.902  1.00 22.83 ? 453 THR B CA  1 
ATOM   5801  C C   . THR B 1 370 ? 30.727  31.168   100.238 1.00 21.20 ? 453 THR B C   1 
ATOM   5802  O O   . THR B 1 370 ? 31.939  30.971   100.303 1.00 20.18 ? 453 THR B O   1 
ATOM   5803  C CB  . THR B 1 370 ? 28.834  30.520   98.735  1.00 23.52 ? 453 THR B CB  1 
ATOM   5804  O OG1 . THR B 1 370 ? 29.275  29.157   98.739  1.00 25.22 ? 453 THR B OG1 1 
ATOM   5805  C CG2 . THR B 1 370 ? 28.158  30.779   97.401  1.00 22.34 ? 453 THR B CG2 1 
ATOM   5806  N N   . VAL B 1 371 ? 29.937  31.180   101.300 1.00 20.11 ? 454 VAL B N   1 
ATOM   5807  C CA  . VAL B 1 371 ? 30.451  30.912   102.627 1.00 19.42 ? 454 VAL B CA  1 
ATOM   5808  C C   . VAL B 1 371 ? 29.317  30.355   103.431 1.00 17.91 ? 454 VAL B C   1 
ATOM   5809  O O   . VAL B 1 371 ? 28.155  30.628   103.149 1.00 17.66 ? 454 VAL B O   1 
ATOM   5810  C CB  . VAL B 1 371 ? 30.946  32.185   103.352 1.00 21.22 ? 454 VAL B CB  1 
ATOM   5811  C CG1 . VAL B 1 371 ? 32.101  32.793   102.592 1.00 24.64 ? 454 VAL B CG1 1 
ATOM   5812  C CG2 . VAL B 1 371 ? 29.806  33.194   103.490 1.00 19.71 ? 454 VAL B CG2 1 
ATOM   5813  N N   . GLY B 1 372 ? 29.659  29.552   104.420 1.00 16.33 ? 455 GLY B N   1 
ATOM   5814  C CA  . GLY B 1 372 ? 28.645  29.017   105.285 1.00 15.65 ? 455 GLY B CA  1 
ATOM   5815  C C   . GLY B 1 372 ? 28.662  29.977   106.455 1.00 15.70 ? 455 GLY B C   1 
ATOM   5816  O O   . GLY B 1 372 ? 29.687  30.593   106.737 1.00 14.49 ? 455 GLY B O   1 
ATOM   5817  N N   . TRP B 1 373 ? 27.525  30.137   107.114 1.00 16.25 ? 456 TRP B N   1 
ATOM   5818  C CA  . TRP B 1 373 ? 27.432  31.004   108.280 1.00 17.57 ? 456 TRP B CA  1 
ATOM   5819  C C   . TRP B 1 373 ? 26.128  30.632   108.966 1.00 17.61 ? 456 TRP B C   1 
ATOM   5820  O O   . TRP B 1 373 ? 25.631  29.522   108.796 1.00 17.87 ? 456 TRP B O   1 
ATOM   5821  C CB  . TRP B 1 373 ? 27.423  32.483   107.863 1.00 17.53 ? 456 TRP B CB  1 
ATOM   5822  C CG  . TRP B 1 373 ? 27.838  33.425   108.974 1.00 18.86 ? 456 TRP B CG  1 
ATOM   5823  C CD1 . TRP B 1 373 ? 28.756  33.178   109.962 1.00 18.72 ? 456 TRP B CD1 1 
ATOM   5824  C CD2 . TRP B 1 373 ? 27.411  34.782   109.158 1.00 18.81 ? 456 TRP B CD2 1 
ATOM   5825  N NE1 . TRP B 1 373 ? 28.929  34.299   110.743 1.00 18.88 ? 456 TRP B NE1 1 
ATOM   5826  C CE2 . TRP B 1 373 ? 28.118  35.298   110.273 1.00 18.58 ? 456 TRP B CE2 1 
ATOM   5827  C CE3 . TRP B 1 373 ? 26.507  35.614   108.489 1.00 18.60 ? 456 TRP B CE3 1 
ATOM   5828  C CZ2 . TRP B 1 373 ? 27.947  36.609   110.729 1.00 16.54 ? 456 TRP B CZ2 1 
ATOM   5829  C CZ3 . TRP B 1 373 ? 26.339  36.921   108.945 1.00 18.76 ? 456 TRP B CZ3 1 
ATOM   5830  C CH2 . TRP B 1 373 ? 27.057  37.403   110.053 1.00 17.07 ? 456 TRP B CH2 1 
ATOM   5831  N N   . SER B 1 374 ? 25.571  31.547   109.742 1.00 17.38 ? 457 SER B N   1 
ATOM   5832  C CA  . SER B 1 374 ? 24.313  31.276   110.406 1.00 18.12 ? 457 SER B CA  1 
ATOM   5833  C C   . SER B 1 374 ? 23.435  32.507   110.291 1.00 18.33 ? 457 SER B C   1 
ATOM   5834  O O   . SER B 1 374 ? 23.818  33.593   110.712 1.00 19.39 ? 457 SER B O   1 
ATOM   5835  C CB  . SER B 1 374 ? 24.541  30.933   111.878 1.00 17.45 ? 457 SER B CB  1 
ATOM   5836  O OG  . SER B 1 374 ? 23.308  30.671   112.513 1.00 18.02 ? 457 SER B OG  1 
ATOM   5837  N N   . TRP B 1 375 ? 22.269  32.331   109.687 1.00 18.15 ? 458 TRP B N   1 
ATOM   5838  C CA  . TRP B 1 375 ? 21.314  33.412   109.519 1.00 18.77 ? 458 TRP B CA  1 
ATOM   5839  C C   . TRP B 1 375 ? 20.024  32.967   110.197 1.00 19.63 ? 458 TRP B C   1 
ATOM   5840  O O   . TRP B 1 375 ? 19.061  32.600   109.520 1.00 20.26 ? 458 TRP B O   1 
ATOM   5841  C CB  . TRP B 1 375 ? 21.047  33.648   108.035 1.00 18.70 ? 458 TRP B CB  1 
ATOM   5842  C CG  . TRP B 1 375 ? 22.156  34.304   107.315 1.00 19.72 ? 458 TRP B CG  1 
ATOM   5843  C CD1 . TRP B 1 375 ? 22.420  35.648   107.251 1.00 20.89 ? 458 TRP B CD1 1 
ATOM   5844  C CD2 . TRP B 1 375 ? 23.150  33.662   106.524 1.00 20.20 ? 458 TRP B CD2 1 
ATOM   5845  N NE1 . TRP B 1 375 ? 23.518  35.879   106.456 1.00 20.48 ? 458 TRP B NE1 1 
ATOM   5846  C CE2 . TRP B 1 375 ? 23.986  34.675   105.994 1.00 20.94 ? 458 TRP B CE2 1 
ATOM   5847  C CE3 . TRP B 1 375 ? 23.420  32.327   106.205 1.00 20.31 ? 458 TRP B CE3 1 
ATOM   5848  C CZ2 . TRP B 1 375 ? 25.070  34.393   105.162 1.00 21.74 ? 458 TRP B CZ2 1 
ATOM   5849  C CZ3 . TRP B 1 375 ? 24.499  32.044   105.377 1.00 21.12 ? 458 TRP B CZ3 1 
ATOM   5850  C CH2 . TRP B 1 375 ? 25.310  33.074   104.863 1.00 22.46 ? 458 TRP B CH2 1 
ATOM   5851  N N   . PRO B 1 376 ? 19.992  32.981   111.544 1.00 19.58 ? 459 PRO B N   1 
ATOM   5852  C CA  . PRO B 1 376 ? 18.811  32.572   112.314 1.00 18.94 ? 459 PRO B CA  1 
ATOM   5853  C C   . PRO B 1 376 ? 17.695  33.619   112.450 1.00 19.23 ? 459 PRO B C   1 
ATOM   5854  O O   . PRO B 1 376 ? 17.896  34.802   112.177 1.00 18.56 ? 459 PRO B O   1 
ATOM   5855  C CB  . PRO B 1 376 ? 19.410  32.196   113.667 1.00 18.88 ? 459 PRO B CB  1 
ATOM   5856  C CG  . PRO B 1 376 ? 20.495  33.228   113.824 1.00 18.81 ? 459 PRO B CG  1 
ATOM   5857  C CD  . PRO B 1 376 ? 21.138  33.241   112.441 1.00 19.16 ? 459 PRO B CD  1 
ATOM   5858  N N   . ASP B 1 377 ? 16.521  33.158   112.881 1.00 18.84 ? 460 ASP B N   1 
ATOM   5859  C CA  . ASP B 1 377 ? 15.360  34.021   113.091 1.00 18.17 ? 460 ASP B CA  1 
ATOM   5860  C C   . ASP B 1 377 ? 15.735  35.281   113.875 1.00 17.67 ? 460 ASP B C   1 
ATOM   5861  O O   . ASP B 1 377 ? 15.558  36.392   113.388 1.00 17.57 ? 460 ASP B O   1 
ATOM   5862  C CB  . ASP B 1 377 ? 14.275  33.246   113.839 1.00 19.09 ? 460 ASP B CB  1 
ATOM   5863  C CG  . ASP B 1 377 ? 13.103  34.118   114.225 1.00 19.32 ? 460 ASP B CG  1 
ATOM   5864  O OD1 . ASP B 1 377 ? 13.004  34.499   115.410 1.00 19.52 ? 460 ASP B OD1 1 
ATOM   5865  O OD2 . ASP B 1 377 ? 12.286  34.435   113.335 1.00 21.65 ? 460 ASP B OD2 1 
ATOM   5866  N N   . GLY B 1 378 ? 16.224  35.096   115.101 1.00 17.35 ? 461 GLY B N   1 
ATOM   5867  C CA  . GLY B 1 378 ? 16.660  36.215   115.920 1.00 16.60 ? 461 GLY B CA  1 
ATOM   5868  C C   . GLY B 1 378 ? 15.721  36.816   116.947 1.00 16.95 ? 461 GLY B C   1 
ATOM   5869  O O   . GLY B 1 378 ? 16.117  37.709   117.693 1.00 17.83 ? 461 GLY B O   1 
ATOM   5870  N N   . ALA B 1 379 ? 14.479  36.363   117.002 1.00 16.41 ? 462 ALA B N   1 
ATOM   5871  C CA  . ALA B 1 379 ? 13.564  36.933   117.976 1.00 17.50 ? 462 ALA B CA  1 
ATOM   5872  C C   . ALA B 1 379 ? 13.928  36.434   119.366 1.00 19.11 ? 462 ALA B C   1 
ATOM   5873  O O   . ALA B 1 379 ? 14.425  35.319   119.508 1.00 19.92 ? 462 ALA B O   1 
ATOM   5874  C CB  . ALA B 1 379 ? 12.143  36.538   117.640 1.00 16.17 ? 462 ALA B CB  1 
ATOM   5875  N N   . GLU B 1 380 ? 13.714  37.248   120.394 1.00 19.68 ? 463 GLU B N   1 
ATOM   5876  C CA  . GLU B 1 380 ? 13.992  36.764   121.738 1.00 22.22 ? 463 GLU B CA  1 
ATOM   5877  C C   . GLU B 1 380 ? 12.656  36.472   122.396 1.00 20.30 ? 463 GLU B C   1 
ATOM   5878  O O   . GLU B 1 380 ? 11.844  37.364   122.582 1.00 20.58 ? 463 GLU B O   1 
ATOM   5879  C CB  . GLU B 1 380 ? 14.805  37.769   122.575 1.00 25.79 ? 463 GLU B CB  1 
ATOM   5880  C CG  . GLU B 1 380 ? 14.168  39.110   122.835 1.00 33.14 ? 463 GLU B CG  1 
ATOM   5881  C CD  . GLU B 1 380 ? 14.862  39.875   123.977 1.00 38.52 ? 463 GLU B CD  1 
ATOM   5882  O OE1 . GLU B 1 380 ? 14.669  39.500   125.168 1.00 37.93 ? 463 GLU B OE1 1 
ATOM   5883  O OE2 . GLU B 1 380 ? 15.609  40.846   123.673 1.00 40.99 ? 463 GLU B OE2 1 
ATOM   5884  N N   . LEU B 1 381 ? 12.416  35.209   122.724 1.00 19.74 ? 464 LEU B N   1 
ATOM   5885  C CA  . LEU B 1 381 ? 11.153  34.821   123.343 1.00 18.47 ? 464 LEU B CA  1 
ATOM   5886  C C   . LEU B 1 381 ? 11.322  34.595   124.833 1.00 18.04 ? 464 LEU B C   1 
ATOM   5887  O O   . LEU B 1 381 ? 12.438  34.431   125.319 1.00 16.95 ? 464 LEU B O   1 
ATOM   5888  C CB  . LEU B 1 381 ? 10.604  33.546   122.685 1.00 16.71 ? 464 LEU B CB  1 
ATOM   5889  C CG  . LEU B 1 381 ? 10.481  33.578   121.159 1.00 18.28 ? 464 LEU B CG  1 
ATOM   5890  C CD1 . LEU B 1 381 ? 9.880   32.279   120.667 1.00 18.64 ? 464 LEU B CD1 1 
ATOM   5891  C CD2 . LEU B 1 381 ? 9.620   34.754   120.732 1.00 19.10 ? 464 LEU B CD2 1 
ATOM   5892  N N   . PRO B 1 382 ? 10.209  34.611   125.584 1.00 18.81 ? 465 PRO B N   1 
ATOM   5893  C CA  . PRO B 1 382 ? 8.850   34.835   125.074 1.00 17.91 ? 465 PRO B CA  1 
ATOM   5894  C C   . PRO B 1 382 ? 8.599   36.315   124.781 1.00 17.75 ? 465 PRO B C   1 
ATOM   5895  O O   . PRO B 1 382 ? 9.447   37.160   125.061 1.00 17.23 ? 465 PRO B O   1 
ATOM   5896  C CB  . PRO B 1 382 ? 7.976   34.313   126.209 1.00 19.27 ? 465 PRO B CB  1 
ATOM   5897  C CG  . PRO B 1 382 ? 8.784   34.673   127.424 1.00 18.78 ? 465 PRO B CG  1 
ATOM   5898  C CD  . PRO B 1 382 ? 10.174  34.250   127.013 1.00 18.89 ? 465 PRO B CD  1 
ATOM   5899  N N   . PHE B 1 383 ? 7.438   36.613   124.204 1.00 17.41 ? 466 PHE B N   1 
ATOM   5900  C CA  . PHE B 1 383 ? 7.057   37.986   123.875 1.00 17.83 ? 466 PHE B CA  1 
ATOM   5901  C C   . PHE B 1 383 ? 6.142   38.512   124.963 1.00 19.40 ? 466 PHE B C   1 
ATOM   5902  O O   . PHE B 1 383 ? 5.807   37.802   125.920 1.00 20.40 ? 466 PHE B O   1 
ATOM   5903  C CB  . PHE B 1 383 ? 6.285   38.051   122.554 1.00 17.24 ? 466 PHE B CB  1 
ATOM   5904  C CG  . PHE B 1 383 ? 7.146   38.197   121.333 1.00 17.12 ? 466 PHE B CG  1 
ATOM   5905  C CD1 . PHE B 1 383 ? 8.535   38.177   121.419 1.00 16.94 ? 466 PHE B CD1 1 
ATOM   5906  C CD2 . PHE B 1 383 ? 6.553   38.345   120.078 1.00 16.31 ? 466 PHE B CD2 1 
ATOM   5907  C CE1 . PHE B 1 383 ? 9.319   38.302   120.275 1.00 16.81 ? 466 PHE B CE1 1 
ATOM   5908  C CE2 . PHE B 1 383 ? 7.326   38.472   118.928 1.00 14.60 ? 466 PHE B CE2 1 
ATOM   5909  C CZ  . PHE B 1 383 ? 8.709   38.450   119.025 1.00 16.12 ? 466 PHE B CZ  1 
ATOM   5910  N N   . THR B 1 384 ? 5.714   39.755   124.801 1.00 21.14 ? 467 THR B N   1 
ATOM   5911  C CA  . THR B 1 384 ? 4.822   40.368   125.765 1.00 23.44 ? 467 THR B CA  1 
ATOM   5912  C C   . THR B 1 384 ? 3.607   39.446   125.874 1.00 24.18 ? 467 THR B C   1 
ATOM   5913  O O   . THR B 1 384 ? 2.775   39.566   126.782 1.00 23.89 ? 467 THR B O   1 
ATOM   5914  C CB  . THR B 1 384 ? 4.407   41.768   125.280 1.00 24.50 ? 467 THR B CB  1 
ATOM   5915  O OG1 . THR B 1 384 ? 5.588   42.513   124.946 1.00 24.61 ? 467 THR B OG1 1 
ATOM   5916  C CG2 . THR B 1 384 ? 3.626   42.513   126.376 1.00 23.81 ? 467 THR B CG2 1 
ATOM   5917  N N   . ILE B 1 385 ? 3.551   38.504   124.935 1.00 25.44 ? 468 ILE B N   1 
ATOM   5918  C CA  . ILE B 1 385 ? 2.493   37.501   124.830 1.00 25.12 ? 468 ILE B CA  1 
ATOM   5919  C C   . ILE B 1 385 ? 1.264   38.098   124.169 1.00 26.47 ? 468 ILE B C   1 
ATOM   5920  O O   . ILE B 1 385 ? 0.976   37.732   123.002 1.00 26.54 ? 468 ILE B O   1 
ATOM   5921  C CB  . ILE B 1 385 ? 2.114   36.919   126.216 1.00 22.31 ? 468 ILE B CB  1 
ATOM   5922  C CG1 . ILE B 1 385 ? 3.145   35.853   126.630 1.00 20.32 ? 468 ILE B CG1 1 
ATOM   5923  C CG2 . ILE B 1 385 ? 0.702   36.365   126.173 1.00 18.90 ? 468 ILE B CG2 1 
ATOM   5924  C CD1 . ILE B 1 385 ? 3.159   35.535   128.142 1.00 17.75 ? 468 ILE B CD1 1 
ATOM   5925  N N   . VAL C 1 1   ? -13.523 48.396   76.554  1.00 27.40 ? 83  VAL C N   1 
ATOM   5926  C CA  . VAL C 1 1   ? -14.867 48.037   75.984  1.00 28.15 ? 83  VAL C CA  1 
ATOM   5927  C C   . VAL C 1 1   ? -15.884 47.707   77.092  1.00 27.32 ? 83  VAL C C   1 
ATOM   5928  O O   . VAL C 1 1   ? -15.537 47.114   78.119  1.00 26.74 ? 83  VAL C O   1 
ATOM   5929  C CB  . VAL C 1 1   ? -14.756 46.839   75.006  1.00 28.03 ? 83  VAL C CB  1 
ATOM   5930  C CG1 . VAL C 1 1   ? -16.143 46.351   74.609  1.00 27.98 ? 83  VAL C CG1 1 
ATOM   5931  C CG2 . VAL C 1 1   ? -13.999 47.265   73.763  1.00 28.41 ? 83  VAL C CG2 1 
ATOM   5932  N N   . LYS C 1 2   ? -17.139 48.096   76.873  1.00 26.80 ? 84  LYS C N   1 
ATOM   5933  C CA  . LYS C 1 2   ? -18.186 47.879   77.862  1.00 26.24 ? 84  LYS C CA  1 
ATOM   5934  C C   . LYS C 1 2   ? -18.523 46.434   78.103  1.00 24.89 ? 84  LYS C C   1 
ATOM   5935  O O   . LYS C 1 2   ? -18.572 45.618   77.176  1.00 25.25 ? 84  LYS C O   1 
ATOM   5936  C CB  . LYS C 1 2   ? -19.476 48.612   77.482  1.00 26.73 ? 84  LYS C CB  1 
ATOM   5937  C CG  . LYS C 1 2   ? -19.351 50.118   77.453  1.00 30.74 ? 84  LYS C CG  1 
ATOM   5938  C CD  . LYS C 1 2   ? -18.520 50.561   76.244  1.00 35.72 ? 84  LYS C CD  1 
ATOM   5939  C CE  . LYS C 1 2   ? -18.466 52.092   76.114  1.00 37.06 ? 84  LYS C CE  1 
ATOM   5940  N NZ  . LYS C 1 2   ? -17.853 52.518   74.810  1.00 37.26 ? 84  LYS C NZ  1 
ATOM   5941  N N   . LEU C 1 3   ? -18.753 46.130   79.371  1.00 23.11 ? 85  LEU C N   1 
ATOM   5942  C CA  . LEU C 1 3   ? -19.137 44.800   79.790  1.00 21.67 ? 85  LEU C CA  1 
ATOM   5943  C C   . LEU C 1 3   ? -20.437 44.487   79.061  1.00 22.03 ? 85  LEU C C   1 
ATOM   5944  O O   . LEU C 1 3   ? -21.397 45.253   79.153  1.00 23.10 ? 85  LEU C O   1 
ATOM   5945  C CB  . LEU C 1 3   ? -19.398 44.801   81.295  1.00 20.17 ? 85  LEU C CB  1 
ATOM   5946  C CG  . LEU C 1 3   ? -18.516 44.014   82.261  1.00 21.46 ? 85  LEU C CG  1 
ATOM   5947  C CD1 . LEU C 1 3   ? -17.039 44.316   82.034  1.00 22.12 ? 85  LEU C CD1 1 
ATOM   5948  C CD2 . LEU C 1 3   ? -18.935 44.361   83.685  1.00 20.35 ? 85  LEU C CD2 1 
ATOM   5949  N N   . ALA C 1 4   ? -20.470 43.395   78.306  1.00 21.94 ? 86  ALA C N   1 
ATOM   5950  C CA  . ALA C 1 4   ? -21.706 43.008   77.634  1.00 22.69 ? 86  ALA C CA  1 
ATOM   5951  C C   . ALA C 1 4   ? -22.388 42.160   78.700  1.00 24.08 ? 86  ALA C C   1 
ATOM   5952  O O   . ALA C 1 4   ? -21.712 41.481   79.494  1.00 25.11 ? 86  ALA C O   1 
ATOM   5953  C CB  . ALA C 1 4   ? -21.412 42.172   76.396  1.00 20.42 ? 86  ALA C CB  1 
ATOM   5954  N N   . GLY C 1 5   ? -23.709 42.193   78.761  1.00 23.17 ? 87  GLY C N   1 
ATOM   5955  C CA  . GLY C 1 5   ? -24.356 41.387   79.779  1.00 23.85 ? 87  GLY C CA  1 
ATOM   5956  C C   . GLY C 1 5   ? -25.437 40.548   79.157  1.00 25.54 ? 87  GLY C C   1 
ATOM   5957  O O   . GLY C 1 5   ? -26.467 40.312   79.782  1.00 27.30 ? 87  GLY C O   1 
ATOM   5958  N N   . ASN C 1 6   ? -25.203 40.089   77.930  1.00 26.29 ? 88  ASN C N   1 
ATOM   5959  C CA  . ASN C 1 6   ? -26.193 39.307   77.198  1.00 27.12 ? 88  ASN C CA  1 
ATOM   5960  C C   . ASN C 1 6   ? -26.131 37.803   77.466  1.00 26.33 ? 88  ASN C C   1 
ATOM   5961  O O   . ASN C 1 6   ? -27.020 37.055   77.052  1.00 25.93 ? 88  ASN C O   1 
ATOM   5962  C CB  . ASN C 1 6   ? -26.047 39.570   75.692  1.00 29.18 ? 88  ASN C CB  1 
ATOM   5963  C CG  . ASN C 1 6   ? -24.693 39.163   75.161  1.00 32.28 ? 88  ASN C CG  1 
ATOM   5964  O OD1 . ASN C 1 6   ? -24.443 39.189   73.944  1.00 35.03 ? 88  ASN C OD1 1 
ATOM   5965  N ND2 . ASN C 1 6   ? -23.796 38.783   76.072  1.00 33.59 ? 88  ASN C ND2 1 
ATOM   5966  N N   . SER C 1 7   ? -25.084 37.374   78.160  1.00 24.99 ? 89  SER C N   1 
ATOM   5967  C CA  . SER C 1 7   ? -24.879 35.964   78.498  1.00 24.79 ? 89  SER C CA  1 
ATOM   5968  C C   . SER C 1 7   ? -25.760 35.524   79.695  1.00 23.35 ? 89  SER C C   1 
ATOM   5969  O O   . SER C 1 7   ? -26.291 36.368   80.409  1.00 22.14 ? 89  SER C O   1 
ATOM   5970  C CB  . SER C 1 7   ? -23.391 35.760   78.812  1.00 25.15 ? 89  SER C CB  1 
ATOM   5971  O OG  . SER C 1 7   ? -23.120 34.454   79.278  1.00 28.38 ? 89  SER C OG  1 
ATOM   5972  N N   . SER C 1 8   ? -25.914 34.214   79.900  1.00 21.73 ? 90  SER C N   1 
ATOM   5973  C CA  . SER C 1 8   ? -26.725 33.677   81.005  1.00 22.88 ? 90  SER C CA  1 
ATOM   5974  C C   . SER C 1 8   ? -25.898 33.219   82.203  1.00 22.47 ? 90  SER C C   1 
ATOM   5975  O O   . SER C 1 8   ? -24.698 32.975   82.074  1.00 20.69 ? 90  SER C O   1 
ATOM   5976  C CB  . SER C 1 8   ? -27.548 32.479   80.541  1.00 23.68 ? 90  SER C CB  1 
ATOM   5977  O OG  . SER C 1 8   ? -28.533 32.856   79.602  1.00 29.02 ? 90  SER C OG  1 
ATOM   5978  N N   . LEU C 1 9   ? -26.543 33.085   83.361  1.00 21.50 ? 91  LEU C N   1 
ATOM   5979  C CA  . LEU C 1 9   ? -25.832 32.628   84.555  1.00 23.12 ? 91  LEU C CA  1 
ATOM   5980  C C   . LEU C 1 9   ? -25.216 31.254   84.285  1.00 23.73 ? 91  LEU C C   1 
ATOM   5981  O O   . LEU C 1 9   ? -25.884 30.374   83.738  1.00 25.55 ? 91  LEU C O   1 
ATOM   5982  C CB  . LEU C 1 9   ? -26.776 32.494   85.751  1.00 22.64 ? 91  LEU C CB  1 
ATOM   5983  C CG  . LEU C 1 9   ? -27.409 33.719   86.409  1.00 24.29 ? 91  LEU C CG  1 
ATOM   5984  C CD1 . LEU C 1 9   ? -28.026 33.265   87.720  1.00 22.73 ? 91  LEU C CD1 1 
ATOM   5985  C CD2 . LEU C 1 9   ? -26.367 34.814   86.659  1.00 24.02 ? 91  LEU C CD2 1 
ATOM   5986  N N   . CYS C 1 10  ? -23.953 31.073   84.665  1.00 22.49 ? 92  CYS C N   1 
ATOM   5987  C CA  . CYS C 1 10  ? -23.279 29.789   84.473  1.00 24.35 ? 92  CYS C CA  1 
ATOM   5988  C C   . CYS C 1 10  ? -23.973 28.725   85.306  1.00 23.36 ? 92  CYS C C   1 
ATOM   5989  O O   . CYS C 1 10  ? -24.357 28.979   86.439  1.00 24.04 ? 92  CYS C O   1 
ATOM   5990  C CB  . CYS C 1 10  ? -21.811 29.831   84.938  1.00 24.92 ? 92  CYS C CB  1 
ATOM   5991  S SG  . CYS C 1 10  ? -20.668 30.957   84.067  1.00 29.45 ? 92  CYS C SG  1 
ATOM   5992  N N   . PRO C 1 11  ? -24.150 27.518   84.753  1.00 22.89 ? 93  PRO C N   1 
ATOM   5993  C CA  . PRO C 1 11  ? -24.802 26.450   85.525  1.00 21.86 ? 93  PRO C CA  1 
ATOM   5994  C C   . PRO C 1 11  ? -23.848 26.024   86.655  1.00 20.60 ? 93  PRO C C   1 
ATOM   5995  O O   . PRO C 1 11  ? -22.638 26.114   86.497  1.00 20.24 ? 93  PRO C O   1 
ATOM   5996  C CB  . PRO C 1 11  ? -25.024 25.357   84.476  1.00 21.64 ? 93  PRO C CB  1 
ATOM   5997  C CG  . PRO C 1 11  ? -23.898 25.589   83.503  1.00 22.67 ? 93  PRO C CG  1 
ATOM   5998  C CD  . PRO C 1 11  ? -23.893 27.093   83.367  1.00 21.83 ? 93  PRO C CD  1 
ATOM   5999  N N   . ILE C 1 12  ? -24.379 25.572   87.790  1.00 19.72 ? 94  ILE C N   1 
ATOM   6000  C CA  . ILE C 1 12  ? -23.526 25.199   88.919  1.00 17.12 ? 94  ILE C CA  1 
ATOM   6001  C C   . ILE C 1 12  ? -24.026 24.042   89.796  1.00 17.78 ? 94  ILE C C   1 
ATOM   6002  O O   . ILE C 1 12  ? -25.201 23.662   89.752  1.00 17.41 ? 94  ILE C O   1 
ATOM   6003  C CB  . ILE C 1 12  ? -23.331 26.393   89.849  1.00 15.30 ? 94  ILE C CB  1 
ATOM   6004  C CG1 . ILE C 1 12  ? -24.691 26.839   90.377  1.00 14.78 ? 94  ILE C CG1 1 
ATOM   6005  C CG2 . ILE C 1 12  ? -22.650 27.531   89.116  1.00 14.04 ? 94  ILE C CG2 1 
ATOM   6006  C CD1 . ILE C 1 12  ? -24.617 27.877   91.475  1.00 15.41 ? 94  ILE C CD1 1 
ATOM   6007  N N   . ASN C 1 13  ? -23.124 23.498   90.612  1.00 18.20 ? 95  ASN C N   1 
ATOM   6008  C CA  . ASN C 1 13  ? -23.486 22.414   91.516  1.00 19.80 ? 95  ASN C CA  1 
ATOM   6009  C C   . ASN C 1 13  ? -23.344 22.783   92.985  1.00 19.71 ? 95  ASN C C   1 
ATOM   6010  O O   . ASN C 1 13  ? -24.084 22.268   93.830  1.00 20.37 ? 95  ASN C O   1 
ATOM   6011  C CB  . ASN C 1 13  ? -22.654 21.160   91.229  1.00 21.72 ? 95  ASN C CB  1 
ATOM   6012  C CG  . ASN C 1 13  ? -23.074 20.473   89.944  1.00 23.81 ? 95  ASN C CG  1 
ATOM   6013  O OD1 . ASN C 1 13  ? -24.264 20.216   89.723  1.00 23.92 ? 95  ASN C OD1 1 
ATOM   6014  N ND2 . ASN C 1 13  ? -22.107 20.172   89.090  1.00 23.66 ? 95  ASN C ND2 1 
ATOM   6015  N N   . GLY C 1 14  ? -22.399 23.668   93.295  1.00 18.65 ? 96  GLY C N   1 
ATOM   6016  C CA  . GLY C 1 14  ? -22.192 24.062   94.681  1.00 18.60 ? 96  GLY C CA  1 
ATOM   6017  C C   . GLY C 1 14  ? -21.360 25.318   94.809  1.00 16.46 ? 96  GLY C C   1 
ATOM   6018  O O   . GLY C 1 14  ? -21.142 25.994   93.816  1.00 16.21 ? 96  GLY C O   1 
ATOM   6019  N N   . TRP C 1 15  ? -20.875 25.625   96.008  1.00 14.47 ? 97  TRP C N   1 
ATOM   6020  C CA  . TRP C 1 15  ? -20.087 26.835   96.187  1.00 14.43 ? 97  TRP C CA  1 
ATOM   6021  C C   . TRP C 1 15  ? -18.676 26.615   96.721  1.00 15.30 ? 97  TRP C C   1 
ATOM   6022  O O   . TRP C 1 15  ? -18.466 25.914   97.712  1.00 15.75 ? 97  TRP C O   1 
ATOM   6023  C CB  . TRP C 1 15  ? -20.852 27.800   97.085  1.00 13.50 ? 97  TRP C CB  1 
ATOM   6024  C CG  . TRP C 1 15  ? -22.256 27.970   96.610  1.00 13.71 ? 97  TRP C CG  1 
ATOM   6025  C CD1 . TRP C 1 15  ? -23.315 27.157   96.886  1.00 12.66 ? 97  TRP C CD1 1 
ATOM   6026  C CD2 . TRP C 1 15  ? -22.737 28.956   95.685  1.00 12.05 ? 97  TRP C CD2 1 
ATOM   6027  N NE1 . TRP C 1 15  ? -24.423 27.571   96.187  1.00 12.91 ? 97  TRP C NE1 1 
ATOM   6028  C CE2 . TRP C 1 15  ? -24.095 28.674   95.443  1.00 11.12 ? 97  TRP C CE2 1 
ATOM   6029  C CE3 . TRP C 1 15  ? -22.149 30.050   95.038  1.00 11.64 ? 97  TRP C CE3 1 
ATOM   6030  C CZ2 . TRP C 1 15  ? -24.874 29.441   94.583  1.00 10.54 ? 97  TRP C CZ2 1 
ATOM   6031  C CZ3 . TRP C 1 15  ? -22.926 30.814   94.184  1.00 11.01 ? 97  TRP C CZ3 1 
ATOM   6032  C CH2 . TRP C 1 15  ? -24.276 30.505   93.965  1.00 9.40  ? 97  TRP C CH2 1 
ATOM   6033  N N   . ALA C 1 16  ? -17.709 27.229   96.050  1.00 14.12 ? 98  ALA C N   1 
ATOM   6034  C CA  . ALA C 1 16  ? -16.315 27.105   96.436  1.00 15.14 ? 98  ALA C CA  1 
ATOM   6035  C C   . ALA C 1 16  ? -15.860 28.369   97.151  1.00 16.36 ? 98  ALA C C   1 
ATOM   6036  O O   . ALA C 1 16  ? -16.070 29.477   96.653  1.00 18.54 ? 98  ALA C O   1 
ATOM   6037  C CB  . ALA C 1 16  ? -15.457 26.860   95.196  1.00 12.30 ? 98  ALA C CB  1 
ATOM   6038  N N   . VAL C 1 17  ? -15.229 28.205   98.309  1.00 16.63 ? 99  VAL C N   1 
ATOM   6039  C CA  . VAL C 1 17  ? -14.757 29.351   99.081  1.00 16.99 ? 99  VAL C CA  1 
ATOM   6040  C C   . VAL C 1 17  ? -13.858 30.227   98.235  1.00 16.69 ? 99  VAL C C   1 
ATOM   6041  O O   . VAL C 1 17  ? -12.929 29.746   97.594  1.00 16.80 ? 99  VAL C O   1 
ATOM   6042  C CB  . VAL C 1 17  ? -13.939 28.933   100.316 1.00 17.49 ? 99  VAL C CB  1 
ATOM   6043  C CG1 . VAL C 1 17  ? -14.369 29.770   101.510 1.00 17.98 ? 99  VAL C CG1 1 
ATOM   6044  C CG2 . VAL C 1 17  ? -14.097 27.460   100.580 1.00 18.96 ? 99  VAL C CG2 1 
ATOM   6045  N N   . TYR C 1 18  ? -14.118 31.523   98.269  1.00 16.38 ? 100 TYR C N   1 
ATOM   6046  C CA  . TYR C 1 18  ? -13.344 32.466   97.489  1.00 17.13 ? 100 TYR C CA  1 
ATOM   6047  C C   . TYR C 1 18  ? -12.430 33.334   98.367  1.00 17.35 ? 100 TYR C C   1 
ATOM   6048  O O   . TYR C 1 18  ? -11.286 33.604   97.993  1.00 17.23 ? 100 TYR C O   1 
ATOM   6049  C CB  . TYR C 1 18  ? -14.307 33.337   96.666  1.00 17.06 ? 100 TYR C CB  1 
ATOM   6050  C CG  . TYR C 1 18  ? -13.655 34.235   95.636  1.00 17.80 ? 100 TYR C CG  1 
ATOM   6051  C CD1 . TYR C 1 18  ? -12.894 33.706   94.595  1.00 16.83 ? 100 TYR C CD1 1 
ATOM   6052  C CD2 . TYR C 1 18  ? -13.823 35.620   95.687  1.00 19.50 ? 100 TYR C CD2 1 
ATOM   6053  C CE1 . TYR C 1 18  ? -12.320 34.530   93.635  1.00 17.10 ? 100 TYR C CE1 1 
ATOM   6054  C CE2 . TYR C 1 18  ? -13.254 36.452   94.730  1.00 19.09 ? 100 TYR C CE2 1 
ATOM   6055  C CZ  . TYR C 1 18  ? -12.503 35.902   93.707  1.00 18.05 ? 100 TYR C CZ  1 
ATOM   6056  O OH  . TYR C 1 18  ? -11.940 36.731   92.764  1.00 17.98 ? 100 TYR C OH  1 
ATOM   6057  N N   . SER C 1 19  ? -12.915 33.761   99.534  1.00 16.62 ? 101 SER C N   1 
ATOM   6058  C CA  . SER C 1 19  ? -12.088 34.603   100.394 1.00 14.70 ? 101 SER C CA  1 
ATOM   6059  C C   . SER C 1 19  ? -12.532 34.742   101.838 1.00 13.95 ? 101 SER C C   1 
ATOM   6060  O O   . SER C 1 19  ? -13.640 34.366   102.205 1.00 12.98 ? 101 SER C O   1 
ATOM   6061  C CB  . SER C 1 19  ? -11.979 36.003   99.795  1.00 15.53 ? 101 SER C CB  1 
ATOM   6062  O OG  . SER C 1 19  ? -13.245 36.645   99.772  1.00 14.83 ? 101 SER C OG  1 
ATOM   6063  N N   . LYS C 1 20  ? -11.635 35.302   102.645 1.00 14.03 ? 102 LYS C N   1 
ATOM   6064  C CA  . LYS C 1 20  ? -11.871 35.543   104.065 1.00 14.48 ? 102 LYS C CA  1 
ATOM   6065  C C   . LYS C 1 20  ? -10.864 36.593   104.536 1.00 15.62 ? 102 LYS C C   1 
ATOM   6066  O O   . LYS C 1 20  ? -9.660  36.333   104.564 1.00 16.76 ? 102 LYS C O   1 
ATOM   6067  C CB  . LYS C 1 20  ? -11.687 34.256   104.871 1.00 13.27 ? 102 LYS C CB  1 
ATOM   6068  C CG  . LYS C 1 20  ? -12.136 34.376   106.317 1.00 13.64 ? 102 LYS C CG  1 
ATOM   6069  C CD  . LYS C 1 20  ? -11.899 33.101   107.092 1.00 12.24 ? 102 LYS C CD  1 
ATOM   6070  C CE  . LYS C 1 20  ? -12.713 33.073   108.377 1.00 12.70 ? 102 LYS C CE  1 
ATOM   6071  N NZ  . LYS C 1 20  ? -12.422 34.211   109.297 1.00 13.50 ? 102 LYS C NZ  1 
ATOM   6072  N N   . ASP C 1 21  ? -11.352 37.774   104.913 1.00 16.66 ? 103 ASP C N   1 
ATOM   6073  C CA  . ASP C 1 21  ? -10.466 38.848   105.345 1.00 17.82 ? 103 ASP C CA  1 
ATOM   6074  C C   . ASP C 1 21  ? -9.964  38.822   106.794 1.00 16.74 ? 103 ASP C C   1 
ATOM   6075  O O   . ASP C 1 21  ? -8.920  39.408   107.081 1.00 17.60 ? 103 ASP C O   1 
ATOM   6076  C CB  . ASP C 1 21  ? -11.077 40.225   105.000 1.00 19.94 ? 103 ASP C CB  1 
ATOM   6077  C CG  . ASP C 1 21  ? -12.479 40.447   105.593 1.00 23.58 ? 103 ASP C CG  1 
ATOM   6078  O OD1 . ASP C 1 21  ? -13.250 41.214   104.977 1.00 25.33 ? 103 ASP C OD1 1 
ATOM   6079  O OD2 . ASP C 1 21  ? -12.817 39.898   106.664 1.00 24.59 ? 103 ASP C OD2 1 
ATOM   6080  N N   . ASN C 1 22  ? -10.672 38.145   107.695 1.00 14.43 ? 104 ASN C N   1 
ATOM   6081  C CA  . ASN C 1 22  ? -10.223 38.058   109.084 1.00 15.63 ? 104 ASN C CA  1 
ATOM   6082  C C   . ASN C 1 22  ? -10.011 39.426   109.750 1.00 16.53 ? 104 ASN C C   1 
ATOM   6083  O O   . ASN C 1 22  ? -9.383  39.524   110.806 1.00 15.95 ? 104 ASN C O   1 
ATOM   6084  C CB  . ASN C 1 22  ? -8.905  37.278   109.143 1.00 15.75 ? 104 ASN C CB  1 
ATOM   6085  C CG  . ASN C 1 22  ? -9.106  35.781   109.085 1.00 16.89 ? 104 ASN C CG  1 
ATOM   6086  O OD1 . ASN C 1 22  ? -8.351  35.067   108.420 1.00 17.51 ? 104 ASN C OD1 1 
ATOM   6087  N ND2 . ASN C 1 22  ? -10.116 35.291   109.797 1.00 16.10 ? 104 ASN C ND2 1 
ATOM   6088  N N   . SER C 1 23  ? -10.547 40.473   109.141 1.00 16.19 ? 105 SER C N   1 
ATOM   6089  C CA  . SER C 1 23  ? -10.367 41.820   109.656 1.00 16.77 ? 105 SER C CA  1 
ATOM   6090  C C   . SER C 1 23  ? -10.535 42.014   111.164 1.00 14.99 ? 105 SER C C   1 
ATOM   6091  O O   . SER C 1 23  ? -9.718  42.687   111.782 1.00 14.55 ? 105 SER C O   1 
ATOM   6092  C CB  . SER C 1 23  ? -11.262 42.811   108.894 1.00 15.84 ? 105 SER C CB  1 
ATOM   6093  O OG  . SER C 1 23  ? -12.625 42.621   109.187 1.00 20.25 ? 105 SER C OG  1 
ATOM   6094  N N   . ILE C 1 24  ? -11.563 41.429   111.767 1.00 14.02 ? 106 ILE C N   1 
ATOM   6095  C CA  . ILE C 1 24  ? -11.754 41.624   113.201 1.00 13.06 ? 106 ILE C CA  1 
ATOM   6096  C C   . ILE C 1 24  ? -10.674 40.977   114.059 1.00 12.55 ? 106 ILE C C   1 
ATOM   6097  O O   . ILE C 1 24  ? -10.170 41.611   114.994 1.00 13.64 ? 106 ILE C O   1 
ATOM   6098  C CB  . ILE C 1 24  ? -13.141 41.164   113.652 1.00 12.25 ? 106 ILE C CB  1 
ATOM   6099  C CG1 . ILE C 1 24  ? -14.197 41.989   112.921 1.00 14.21 ? 106 ILE C CG1 1 
ATOM   6100  C CG2 . ILE C 1 24  ? -13.306 41.387   115.148 1.00 13.52 ? 106 ILE C CG2 1 
ATOM   6101  C CD1 . ILE C 1 24  ? -15.612 41.692   113.334 1.00 15.52 ? 106 ILE C CD1 1 
ATOM   6102  N N   . ARG C 1 25  ? -10.306 39.736   113.750 1.00 11.15 ? 107 ARG C N   1 
ATOM   6103  C CA  . ARG C 1 25  ? -9.243  39.072   114.506 1.00 12.87 ? 107 ARG C CA  1 
ATOM   6104  C C   . ARG C 1 25  ? -7.942  39.868   114.315 1.00 13.35 ? 107 ARG C C   1 
ATOM   6105  O O   . ARG C 1 25  ? -7.152  40.030   115.247 1.00 14.75 ? 107 ARG C O   1 
ATOM   6106  C CB  . ARG C 1 25  ? -9.043  37.634   114.017 1.00 13.06 ? 107 ARG C CB  1 
ATOM   6107  C CG  . ARG C 1 25  ? -10.111 36.657   114.465 1.00 11.74 ? 107 ARG C CG  1 
ATOM   6108  C CD  . ARG C 1 25  ? -10.115 35.447   113.556 1.00 12.05 ? 107 ARG C CD  1 
ATOM   6109  N NE  . ARG C 1 25  ? -8.802  34.818   113.471 1.00 12.43 ? 107 ARG C NE  1 
ATOM   6110  C CZ  . ARG C 1 25  ? -8.298  33.993   114.388 1.00 12.37 ? 107 ARG C CZ  1 
ATOM   6111  N NH1 . ARG C 1 25  ? -7.092  33.476   114.210 1.00 9.79  ? 107 ARG C NH1 1 
ATOM   6112  N NH2 . ARG C 1 25  ? -8.998  33.678   115.472 1.00 7.88  ? 107 ARG C NH2 1 
ATOM   6113  N N   . ILE C 1 26  ? -7.734  40.372   113.104 1.00 12.48 ? 108 ILE C N   1 
ATOM   6114  C CA  . ILE C 1 26  ? -6.550  41.163   112.789 1.00 13.08 ? 108 ILE C CA  1 
ATOM   6115  C C   . ILE C 1 26  ? -6.590  42.528   113.482 1.00 14.04 ? 108 ILE C C   1 
ATOM   6116  O O   . ILE C 1 26  ? -5.576  43.006   113.994 1.00 13.34 ? 108 ILE C O   1 
ATOM   6117  C CB  . ILE C 1 26  ? -6.436  41.393   111.266 1.00 13.36 ? 108 ILE C CB  1 
ATOM   6118  C CG1 . ILE C 1 26  ? -6.370  40.043   110.545 1.00 13.48 ? 108 ILE C CG1 1 
ATOM   6119  C CG2 . ILE C 1 26  ? -5.197  42.236   110.943 1.00 14.08 ? 108 ILE C CG2 1 
ATOM   6120  C CD1 . ILE C 1 26  ? -6.331  40.147   109.027 1.00 12.77 ? 108 ILE C CD1 1 
ATOM   6121  N N   . GLY C 1 27  ? -7.771  43.143   113.501 1.00 12.91 ? 109 GLY C N   1 
ATOM   6122  C CA  . GLY C 1 27  ? -7.927  44.452   114.106 1.00 13.51 ? 109 GLY C CA  1 
ATOM   6123  C C   . GLY C 1 27  ? -7.738  44.557   115.613 1.00 14.41 ? 109 GLY C C   1 
ATOM   6124  O O   . GLY C 1 27  ? -7.747  45.657   116.163 1.00 12.40 ? 109 GLY C O   1 
ATOM   6125  N N   . SER C 1 28  ? -7.578  43.420   116.284 1.00 16.05 ? 110 SER C N   1 
ATOM   6126  C CA  . SER C 1 28  ? -7.381  43.402   117.729 1.00 16.66 ? 110 SER C CA  1 
ATOM   6127  C C   . SER C 1 28  ? -6.117  44.190   118.045 1.00 16.85 ? 110 SER C C   1 
ATOM   6128  O O   . SER C 1 28  ? -6.021  44.861   119.073 1.00 16.82 ? 110 SER C O   1 
ATOM   6129  C CB  . SER C 1 28  ? -7.243  41.956   118.211 1.00 17.17 ? 110 SER C CB  1 
ATOM   6130  O OG  . SER C 1 28  ? -7.243  41.865   119.618 1.00 17.27 ? 110 SER C OG  1 
ATOM   6131  N N   . LYS C 1 29  ? -5.154  44.106   117.134 1.00 16.88 ? 111 LYS C N   1 
ATOM   6132  C CA  . LYS C 1 29  ? -3.888  44.803   117.270 1.00 17.03 ? 111 LYS C CA  1 
ATOM   6133  C C   . LYS C 1 29  ? -3.628  45.712   116.062 1.00 17.84 ? 111 LYS C C   1 
ATOM   6134  O O   . LYS C 1 29  ? -3.026  46.771   116.203 1.00 19.29 ? 111 LYS C O   1 
ATOM   6135  C CB  . LYS C 1 29  ? -2.731  43.798   117.397 1.00 16.21 ? 111 LYS C CB  1 
ATOM   6136  C CG  . LYS C 1 29  ? -1.357  44.458   117.308 1.00 18.08 ? 111 LYS C CG  1 
ATOM   6137  C CD  . LYS C 1 29  ? -0.185  43.482   117.291 1.00 18.60 ? 111 LYS C CD  1 
ATOM   6138  C CE  . LYS C 1 29  ? 1.126   44.270   117.109 1.00 21.32 ? 111 LYS C CE  1 
ATOM   6139  N NZ  . LYS C 1 29  ? 2.372   43.465   116.899 1.00 21.29 ? 111 LYS C NZ  1 
ATOM   6140  N N   . GLY C 1 30  ? -4.080  45.301   114.881 1.00 17.34 ? 112 GLY C N   1 
ATOM   6141  C CA  . GLY C 1 30  ? -3.835  46.090   113.685 1.00 16.70 ? 112 GLY C CA  1 
ATOM   6142  C C   . GLY C 1 30  ? -4.733  47.288   113.460 1.00 16.59 ? 112 GLY C C   1 
ATOM   6143  O O   . GLY C 1 30  ? -5.844  47.355   113.979 1.00 16.46 ? 112 GLY C O   1 
ATOM   6144  N N   . ASP C 1 31  ? -4.245  48.241   112.674 1.00 16.23 ? 113 ASP C N   1 
ATOM   6145  C CA  . ASP C 1 31  ? -5.014  49.442   112.373 1.00 15.74 ? 113 ASP C CA  1 
ATOM   6146  C C   . ASP C 1 31  ? -6.033  49.149   111.278 1.00 16.10 ? 113 ASP C C   1 
ATOM   6147  O O   . ASP C 1 31  ? -5.864  49.519   110.111 1.00 16.11 ? 113 ASP C O   1 
ATOM   6148  C CB  . ASP C 1 31  ? -4.072  50.573   111.961 1.00 16.52 ? 113 ASP C CB  1 
ATOM   6149  C CG  . ASP C 1 31  ? -3.069  50.904   113.046 1.00 15.91 ? 113 ASP C CG  1 
ATOM   6150  O OD1 . ASP C 1 31  ? -3.420  50.747   114.235 1.00 16.93 ? 113 ASP C OD1 1 
ATOM   6151  O OD2 . ASP C 1 31  ? -1.942  51.321   112.716 1.00 15.53 ? 113 ASP C OD2 1 
ATOM   6152  N N   . VAL C 1 32  ? -7.098  48.472   111.693 1.00 15.78 ? 114 VAL C N   1 
ATOM   6153  C CA  . VAL C 1 32  ? -8.194  48.054   110.822 1.00 14.22 ? 114 VAL C CA  1 
ATOM   6154  C C   . VAL C 1 32  ? -9.458  48.878   111.059 1.00 14.87 ? 114 VAL C C   1 
ATOM   6155  O O   . VAL C 1 32  ? -9.832  49.151   112.200 1.00 15.94 ? 114 VAL C O   1 
ATOM   6156  C CB  . VAL C 1 32  ? -8.524  46.570   111.069 1.00 10.53 ? 114 VAL C CB  1 
ATOM   6157  C CG1 . VAL C 1 32  ? -9.792  46.184   110.351 1.00 9.94  ? 114 VAL C CG1 1 
ATOM   6158  C CG2 . VAL C 1 32  ? -7.365  45.712   110.625 1.00 7.82  ? 114 VAL C CG2 1 
ATOM   6159  N N   . PHE C 1 33  ? -10.111 49.271   109.973 1.00 13.61 ? 115 PHE C N   1 
ATOM   6160  C CA  . PHE C 1 33  ? -11.336 50.053   110.064 1.00 14.17 ? 115 PHE C CA  1 
ATOM   6161  C C   . PHE C 1 33  ? -12.477 49.303   110.740 1.00 13.62 ? 115 PHE C C   1 
ATOM   6162  O O   . PHE C 1 33  ? -12.529 48.078   110.715 1.00 13.39 ? 115 PHE C O   1 
ATOM   6163  C CB  . PHE C 1 33  ? -11.818 50.457   108.671 1.00 13.48 ? 115 PHE C CB  1 
ATOM   6164  C CG  . PHE C 1 33  ? -11.127 51.654   108.110 1.00 14.66 ? 115 PHE C CG  1 
ATOM   6165  C CD1 . PHE C 1 33  ? -10.410 51.562   106.920 1.00 14.16 ? 115 PHE C CD1 1 
ATOM   6166  C CD2 . PHE C 1 33  ? -11.236 52.893   108.738 1.00 14.33 ? 115 PHE C CD2 1 
ATOM   6167  C CE1 . PHE C 1 33  ? -9.811  52.694   106.359 1.00 15.94 ? 115 PHE C CE1 1 
ATOM   6168  C CE2 . PHE C 1 33  ? -10.636 54.036   108.181 1.00 15.82 ? 115 PHE C CE2 1 
ATOM   6169  C CZ  . PHE C 1 33  ? -9.925  53.934   106.990 1.00 14.11 ? 115 PHE C CZ  1 
ATOM   6170  N N   . VAL C 1 34  ? -13.382 50.055   111.354 1.00 13.34 ? 116 VAL C N   1 
ATOM   6171  C CA  . VAL C 1 34  ? -14.564 49.467   111.962 1.00 14.58 ? 116 VAL C CA  1 
ATOM   6172  C C   . VAL C 1 34  ? -15.583 49.648   110.846 1.00 14.85 ? 116 VAL C C   1 
ATOM   6173  O O   . VAL C 1 34  ? -15.750 50.752   110.335 1.00 15.77 ? 116 VAL C O   1 
ATOM   6174  C CB  . VAL C 1 34  ? -15.022 50.235   113.236 1.00 14.06 ? 116 VAL C CB  1 
ATOM   6175  C CG1 . VAL C 1 34  ? -14.733 51.723   113.090 1.00 14.97 ? 116 VAL C CG1 1 
ATOM   6176  C CG2 . VAL C 1 34  ? -16.523 50.022   113.453 1.00 10.09 ? 116 VAL C CG2 1 
ATOM   6177  N N   . ILE C 1 35  ? -16.253 48.577   110.443 1.00 16.44 ? 117 ILE C N   1 
ATOM   6178  C CA  . ILE C 1 35  ? -17.206 48.705   109.347 1.00 16.85 ? 117 ILE C CA  1 
ATOM   6179  C C   . ILE C 1 35  ? -18.504 47.942   109.512 1.00 16.86 ? 117 ILE C C   1 
ATOM   6180  O O   . ILE C 1 35  ? -18.782 47.352   110.552 1.00 19.83 ? 117 ILE C O   1 
ATOM   6181  C CB  . ILE C 1 35  ? -16.586 48.229   108.019 1.00 16.69 ? 117 ILE C CB  1 
ATOM   6182  C CG1 . ILE C 1 35  ? -16.417 46.706   108.057 1.00 16.70 ? 117 ILE C CG1 1 
ATOM   6183  C CG2 . ILE C 1 35  ? -15.254 48.908   107.788 1.00 13.67 ? 117 ILE C CG2 1 
ATOM   6184  C CD1 . ILE C 1 35  ? -16.033 46.104   106.733 1.00 17.13 ? 117 ILE C CD1 1 
ATOM   6185  N N   . ARG C 1 36  ? -19.285 47.972   108.442 1.00 15.15 ? 118 ARG C N   1 
ATOM   6186  C CA  . ARG C 1 36  ? -20.569 47.298   108.345 1.00 15.38 ? 118 ARG C CA  1 
ATOM   6187  C C   . ARG C 1 36  ? -20.952 47.434   106.878 1.00 15.05 ? 118 ARG C C   1 
ATOM   6188  O O   . ARG C 1 36  ? -20.336 48.206   106.141 1.00 14.76 ? 118 ARG C O   1 
ATOM   6189  C CB  . ARG C 1 36  ? -21.633 47.980   109.211 1.00 15.68 ? 118 ARG C CB  1 
ATOM   6190  C CG  . ARG C 1 36  ? -21.781 47.484   110.647 1.00 17.27 ? 118 ARG C CG  1 
ATOM   6191  C CD  . ARG C 1 36  ? -22.178 46.014   110.754 1.00 19.60 ? 118 ARG C CD  1 
ATOM   6192  N NE  . ARG C 1 36  ? -23.300 45.612   109.904 1.00 20.75 ? 118 ARG C NE  1 
ATOM   6193  C CZ  . ARG C 1 36  ? -24.589 45.804   110.178 1.00 21.53 ? 118 ARG C CZ  1 
ATOM   6194  N NH1 . ARG C 1 36  ? -25.514 45.389   109.313 1.00 19.97 ? 118 ARG C NH1 1 
ATOM   6195  N NH2 . ARG C 1 36  ? -24.960 46.399   111.303 1.00 22.11 ? 118 ARG C NH2 1 
ATOM   6196  N N   . GLU C 1 37  ? -21.952 46.679   106.447 1.00 14.37 ? 119 GLU C N   1 
ATOM   6197  C CA  . GLU C 1 37  ? -22.397 46.762   105.067 1.00 14.80 ? 119 GLU C CA  1 
ATOM   6198  C C   . GLU C 1 37  ? -21.256 46.549   104.050 1.00 15.14 ? 119 GLU C C   1 
ATOM   6199  O O   . GLU C 1 37  ? -21.001 47.387   103.185 1.00 14.40 ? 119 GLU C O   1 
ATOM   6200  C CB  . GLU C 1 37  ? -23.066 48.128   104.835 1.00 14.51 ? 119 GLU C CB  1 
ATOM   6201  C CG  . GLU C 1 37  ? -24.279 48.427   105.732 1.00 15.43 ? 119 GLU C CG  1 
ATOM   6202  C CD  . GLU C 1 37  ? -23.911 48.931   107.136 1.00 17.43 ? 119 GLU C CD  1 
ATOM   6203  O OE1 . GLU C 1 37  ? -23.013 49.798   107.244 1.00 15.82 ? 119 GLU C OE1 1 
ATOM   6204  O OE2 . GLU C 1 37  ? -24.538 48.480   108.126 1.00 15.83 ? 119 GLU C OE2 1 
ATOM   6205  N N   . PRO C 1 38  ? -20.541 45.420   104.147 1.00 15.15 ? 120 PRO C N   1 
ATOM   6206  C CA  . PRO C 1 38  ? -19.475 45.249   103.161 1.00 13.26 ? 120 PRO C CA  1 
ATOM   6207  C C   . PRO C 1 38  ? -20.023 44.465   101.973 1.00 13.57 ? 120 PRO C C   1 
ATOM   6208  O O   . PRO C 1 38  ? -20.881 43.601   102.150 1.00 16.08 ? 120 PRO C O   1 
ATOM   6209  C CB  . PRO C 1 38  ? -18.454 44.439   103.928 1.00 11.85 ? 120 PRO C CB  1 
ATOM   6210  C CG  . PRO C 1 38  ? -19.348 43.474   104.660 1.00 12.09 ? 120 PRO C CG  1 
ATOM   6211  C CD  . PRO C 1 38  ? -20.463 44.374   105.184 1.00 13.39 ? 120 PRO C CD  1 
ATOM   6212  N N   . PHE C 1 39  ? -19.547 44.760   100.770 1.00 12.53 ? 121 PHE C N   1 
ATOM   6213  C CA  . PHE C 1 39  ? -19.987 44.003   99.601  1.00 12.23 ? 121 PHE C CA  1 
ATOM   6214  C C   . PHE C 1 39  ? -18.862 43.894   98.578  1.00 12.65 ? 121 PHE C C   1 
ATOM   6215  O O   . PHE C 1 39  ? -17.908 44.677   98.587  1.00 13.38 ? 121 PHE C O   1 
ATOM   6216  C CB  . PHE C 1 39  ? -21.249 44.621   98.987  1.00 12.16 ? 121 PHE C CB  1 
ATOM   6217  C CG  . PHE C 1 39  ? -21.039 45.983   98.382  1.00 12.70 ? 121 PHE C CG  1 
ATOM   6218  C CD1 . PHE C 1 39  ? -20.639 46.117   97.054  1.00 10.41 ? 121 PHE C CD1 1 
ATOM   6219  C CD2 . PHE C 1 39  ? -21.243 47.130   99.139  1.00 9.38  ? 121 PHE C CD2 1 
ATOM   6220  C CE1 . PHE C 1 39  ? -20.448 47.380   96.493  1.00 10.95 ? 121 PHE C CE1 1 
ATOM   6221  C CE2 . PHE C 1 39  ? -21.054 48.388   98.594  1.00 9.34  ? 121 PHE C CE2 1 
ATOM   6222  C CZ  . PHE C 1 39  ? -20.657 48.521   97.268  1.00 10.29 ? 121 PHE C CZ  1 
ATOM   6223  N N   . ILE C 1 40  ? -18.965 42.896   97.712  1.00 14.32 ? 122 ILE C N   1 
ATOM   6224  C CA  . ILE C 1 40  ? -17.949 42.651   96.705  1.00 14.51 ? 122 ILE C CA  1 
ATOM   6225  C C   . ILE C 1 40  ? -18.455 43.015   95.329  1.00 16.21 ? 122 ILE C C   1 
ATOM   6226  O O   . ILE C 1 40  ? -19.641 42.868   95.040  1.00 16.15 ? 122 ILE C O   1 
ATOM   6227  C CB  . ILE C 1 40  ? -17.536 41.170   96.701  1.00 15.61 ? 122 ILE C CB  1 
ATOM   6228  C CG1 . ILE C 1 40  ? -17.020 40.784   98.088  1.00 15.03 ? 122 ILE C CG1 1 
ATOM   6229  C CG2 . ILE C 1 40  ? -16.481 40.916   95.621  1.00 13.85 ? 122 ILE C CG2 1 
ATOM   6230  C CD1 . ILE C 1 40  ? -16.461 39.363   98.174  1.00 14.27 ? 122 ILE C CD1 1 
ATOM   6231  N N   . SER C 1 41  ? -17.551 43.494   94.484  1.00 16.91 ? 123 SER C N   1 
ATOM   6232  C CA  . SER C 1 41  ? -17.902 43.872   93.122  1.00 18.45 ? 123 SER C CA  1 
ATOM   6233  C C   . SER C 1 41  ? -16.645 43.786   92.252  1.00 18.36 ? 123 SER C C   1 
ATOM   6234  O O   . SER C 1 41  ? -15.564 44.175   92.687  1.00 18.32 ? 123 SER C O   1 
ATOM   6235  C CB  . SER C 1 41  ? -18.476 45.292   93.104  1.00 19.12 ? 123 SER C CB  1 
ATOM   6236  O OG  . SER C 1 41  ? -18.930 45.639   91.807  1.00 21.66 ? 123 SER C OG  1 
ATOM   6237  N N   . CYS C 1 42  ? -16.777 43.288   91.026  1.00 17.43 ? 124 CYS C N   1 
ATOM   6238  C CA  . CYS C 1 42  ? -15.608 43.143   90.168  1.00 17.95 ? 124 CYS C CA  1 
ATOM   6239  C C   . CYS C 1 42  ? -15.667 43.941   88.874  1.00 18.42 ? 124 CYS C C   1 
ATOM   6240  O O   . CYS C 1 42  ? -16.737 44.327   88.409  1.00 18.42 ? 124 CYS C O   1 
ATOM   6241  C CB  . CYS C 1 42  ? -15.396 41.666   89.811  1.00 18.14 ? 124 CYS C CB  1 
ATOM   6242  S SG  . CYS C 1 42  ? -15.516 40.479   91.195  1.00 20.63 ? 124 CYS C SG  1 
ATOM   6243  N N   . SER C 1 43  ? -14.497 44.177   88.294  1.00 18.93 ? 125 SER C N   1 
ATOM   6244  C CA  . SER C 1 43  ? -14.392 44.884   87.022  1.00 19.23 ? 125 SER C CA  1 
ATOM   6245  C C   . SER C 1 43  ? -13.986 43.800   86.020  1.00 19.56 ? 125 SER C C   1 
ATOM   6246  O O   . SER C 1 43  ? -14.150 42.608   86.295  1.00 18.88 ? 125 SER C O   1 
ATOM   6247  C CB  . SER C 1 43  ? -13.300 45.951   87.089  1.00 19.08 ? 125 SER C CB  1 
ATOM   6248  O OG  . SER C 1 43  ? -12.021 45.351   87.133  1.00 17.88 ? 125 SER C OG  1 
ATOM   6249  N N   . HIS C 1 44  ? -13.469 44.200   84.863  1.00 19.38 ? 126 HIS C N   1 
ATOM   6250  C CA  . HIS C 1 44  ? -13.020 43.214   83.891  1.00 18.96 ? 126 HIS C CA  1 
ATOM   6251  C C   . HIS C 1 44  ? -11.587 42.821   84.225  1.00 18.30 ? 126 HIS C C   1 
ATOM   6252  O O   . HIS C 1 44  ? -11.005 41.992   83.541  1.00 18.74 ? 126 HIS C O   1 
ATOM   6253  C CB  . HIS C 1 44  ? -13.069 43.770   82.466  1.00 19.67 ? 126 HIS C CB  1 
ATOM   6254  C CG  . HIS C 1 44  ? -12.246 45.000   82.270  1.00 21.49 ? 126 HIS C CG  1 
ATOM   6255  N ND1 . HIS C 1 44  ? -12.472 46.166   82.975  1.00 21.81 ? 126 HIS C ND1 1 
ATOM   6256  C CD2 . HIS C 1 44  ? -11.208 45.258   81.441  1.00 22.24 ? 126 HIS C CD2 1 
ATOM   6257  C CE1 . HIS C 1 44  ? -11.611 47.086   82.585  1.00 22.09 ? 126 HIS C CE1 1 
ATOM   6258  N NE2 . HIS C 1 44  ? -10.831 46.562   81.654  1.00 23.40 ? 126 HIS C NE2 1 
ATOM   6259  N N   . LEU C 1 45  ? -11.026 43.408   85.279  1.00 17.96 ? 127 LEU C N   1 
ATOM   6260  C CA  . LEU C 1 45  ? -9.651  43.108   85.668  1.00 19.34 ? 127 LEU C CA  1 
ATOM   6261  C C   . LEU C 1 45  ? -9.428  42.618   87.111  1.00 20.87 ? 127 LEU C C   1 
ATOM   6262  O O   . LEU C 1 45  ? -8.580  41.748   87.350  1.00 21.93 ? 127 LEU C O   1 
ATOM   6263  C CB  . LEU C 1 45  ? -8.767  44.333   85.414  1.00 16.43 ? 127 LEU C CB  1 
ATOM   6264  C CG  . LEU C 1 45  ? -8.623  44.756   83.953  1.00 17.71 ? 127 LEU C CG  1 
ATOM   6265  C CD1 . LEU C 1 45  ? -7.904  46.102   83.848  1.00 15.39 ? 127 LEU C CD1 1 
ATOM   6266  C CD2 . LEU C 1 45  ? -7.866  43.674   83.200  1.00 15.22 ? 127 LEU C CD2 1 
ATOM   6267  N N   . GLU C 1 46  ? -10.160 43.167   88.075  1.00 21.19 ? 128 GLU C N   1 
ATOM   6268  C CA  . GLU C 1 46  ? -9.975  42.749   89.463  1.00 21.60 ? 128 GLU C CA  1 
ATOM   6269  C C   . GLU C 1 46  ? -11.291 42.724   90.233  1.00 19.41 ? 128 GLU C C   1 
ATOM   6270  O O   . GLU C 1 46  ? -12.304 43.228   89.766  1.00 17.35 ? 128 GLU C O   1 
ATOM   6271  C CB  . GLU C 1 46  ? -8.996  43.703   90.180  1.00 24.29 ? 128 GLU C CB  1 
ATOM   6272  C CG  . GLU C 1 46  ? -9.613  45.067   90.575  1.00 28.93 ? 128 GLU C CG  1 
ATOM   6273  C CD  . GLU C 1 46  ? -8.641  46.001   91.336  1.00 32.52 ? 128 GLU C CD  1 
ATOM   6274  O OE1 . GLU C 1 46  ? -7.706  45.502   92.020  1.00 33.70 ? 128 GLU C OE1 1 
ATOM   6275  O OE2 . GLU C 1 46  ? -8.831  47.243   91.262  1.00 33.30 ? 128 GLU C OE2 1 
ATOM   6276  N N   . CYS C 1 47  ? -11.261 42.125   91.415  1.00 18.74 ? 129 CYS C N   1 
ATOM   6277  C CA  . CYS C 1 47  ? -12.430 42.084   92.278  1.00 18.52 ? 129 CYS C CA  1 
ATOM   6278  C C   . CYS C 1 47  ? -12.067 42.879   93.524  1.00 16.74 ? 129 CYS C C   1 
ATOM   6279  O O   . CYS C 1 47  ? -10.955 42.766   94.041  1.00 16.32 ? 129 CYS C O   1 
ATOM   6280  C CB  . CYS C 1 47  ? -12.795 40.652   92.663  1.00 19.02 ? 129 CYS C CB  1 
ATOM   6281  S SG  . CYS C 1 47  ? -13.639 39.663   91.379  1.00 24.93 ? 129 CYS C SG  1 
ATOM   6282  N N   . ARG C 1 48  ? -12.999 43.699   93.991  1.00 14.94 ? 130 ARG C N   1 
ATOM   6283  C CA  . ARG C 1 48  ? -12.749 44.517   95.166  1.00 14.30 ? 130 ARG C CA  1 
ATOM   6284  C C   . ARG C 1 48  ? -13.854 44.393   96.189  1.00 14.01 ? 130 ARG C C   1 
ATOM   6285  O O   . ARG C 1 48  ? -14.964 43.948   95.884  1.00 14.61 ? 130 ARG C O   1 
ATOM   6286  C CB  . ARG C 1 48  ? -12.608 45.996   94.786  1.00 14.23 ? 130 ARG C CB  1 
ATOM   6287  C CG  . ARG C 1 48  ? -11.452 46.331   93.874  1.00 12.31 ? 130 ARG C CG  1 
ATOM   6288  C CD  . ARG C 1 48  ? -11.474 47.817   93.533  1.00 15.01 ? 130 ARG C CD  1 
ATOM   6289  N NE  . ARG C 1 48  ? -11.138 48.660   94.680  1.00 15.03 ? 130 ARG C NE  1 
ATOM   6290  C CZ  . ARG C 1 48  ? -9.925  48.730   95.222  1.00 15.77 ? 130 ARG C CZ  1 
ATOM   6291  N NH1 . ARG C 1 48  ? -9.715  49.519   96.263  1.00 15.67 ? 130 ARG C NH1 1 
ATOM   6292  N NH2 . ARG C 1 48  ? -8.920  48.018   94.718  1.00 13.40 ? 130 ARG C NH2 1 
ATOM   6293  N N   . THR C 1 49  ? -13.532 44.814   97.405  1.00 13.49 ? 131 THR C N   1 
ATOM   6294  C CA  . THR C 1 49  ? -14.466 44.789   98.512  1.00 13.75 ? 131 THR C CA  1 
ATOM   6295  C C   . THR C 1 49  ? -14.798 46.215   98.893  1.00 13.26 ? 131 THR C C   1 
ATOM   6296  O O   . THR C 1 49  ? -13.912 47.003   99.168  1.00 14.37 ? 131 THR C O   1 
ATOM   6297  C CB  . THR C 1 49  ? -13.851 44.102   99.739  1.00 14.91 ? 131 THR C CB  1 
ATOM   6298  O OG1 . THR C 1 49  ? -13.636 42.720   99.447  1.00 15.51 ? 131 THR C OG1 1 
ATOM   6299  C CG2 . THR C 1 49  ? -14.761 44.247   100.959 1.00 13.92 ? 131 THR C CG2 1 
ATOM   6300  N N   . PHE C 1 50  ? -16.079 46.545   98.897  1.00 14.60 ? 132 PHE C N   1 
ATOM   6301  C CA  . PHE C 1 50  ? -16.514 47.878   99.283  1.00 14.00 ? 132 PHE C CA  1 
ATOM   6302  C C   . PHE C 1 50  ? -17.124 47.741   100.658 1.00 14.30 ? 132 PHE C C   1 
ATOM   6303  O O   . PHE C 1 50  ? -17.589 46.663   101.026 1.00 14.62 ? 132 PHE C O   1 
ATOM   6304  C CB  . PHE C 1 50  ? -17.543 48.429   98.301  1.00 13.35 ? 132 PHE C CB  1 
ATOM   6305  C CG  . PHE C 1 50  ? -16.976 48.718   96.956  1.00 15.19 ? 132 PHE C CG  1 
ATOM   6306  C CD1 . PHE C 1 50  ? -16.792 47.698   96.031  1.00 16.42 ? 132 PHE C CD1 1 
ATOM   6307  C CD2 . PHE C 1 50  ? -16.558 50.003   96.631  1.00 16.36 ? 132 PHE C CD2 1 
ATOM   6308  C CE1 . PHE C 1 50  ? -16.193 47.954   94.800  1.00 18.61 ? 132 PHE C CE1 1 
ATOM   6309  C CE2 . PHE C 1 50  ? -15.957 50.276   95.404  1.00 16.15 ? 132 PHE C CE2 1 
ATOM   6310  C CZ  . PHE C 1 50  ? -15.772 49.254   94.486  1.00 18.44 ? 132 PHE C CZ  1 
ATOM   6311  N N   . PHE C 1 51  ? -17.133 48.827   101.414 1.00 13.90 ? 133 PHE C N   1 
ATOM   6312  C CA  . PHE C 1 51  ? -17.664 48.779   102.762 1.00 14.25 ? 133 PHE C CA  1 
ATOM   6313  C C   . PHE C 1 51  ? -17.863 50.178   103.338 1.00 15.04 ? 133 PHE C C   1 
ATOM   6314  O O   . PHE C 1 51  ? -17.241 51.146   102.900 1.00 14.84 ? 133 PHE C O   1 
ATOM   6315  C CB  . PHE C 1 51  ? -16.695 47.988   103.637 1.00 11.97 ? 133 PHE C CB  1 
ATOM   6316  C CG  . PHE C 1 51  ? -15.283 48.459   103.520 1.00 11.06 ? 133 PHE C CG  1 
ATOM   6317  C CD1 . PHE C 1 51  ? -14.849 49.579   104.224 1.00 11.03 ? 133 PHE C CD1 1 
ATOM   6318  C CD2 . PHE C 1 51  ? -14.403 47.833   102.644 1.00 11.08 ? 133 PHE C CD2 1 
ATOM   6319  C CE1 . PHE C 1 51  ? -13.558 50.072   104.056 1.00 10.68 ? 133 PHE C CE1 1 
ATOM   6320  C CE2 . PHE C 1 51  ? -13.111 48.316   102.465 1.00 10.86 ? 133 PHE C CE2 1 
ATOM   6321  C CZ  . PHE C 1 51  ? -12.686 49.441   103.173 1.00 11.27 ? 133 PHE C CZ  1 
ATOM   6322  N N   . LEU C 1 52  ? -18.738 50.266   104.330 1.00 15.89 ? 134 LEU C N   1 
ATOM   6323  C CA  . LEU C 1 52  ? -19.029 51.532   104.989 1.00 15.79 ? 134 LEU C CA  1 
ATOM   6324  C C   . LEU C 1 52  ? -18.306 51.599   106.327 1.00 14.15 ? 134 LEU C C   1 
ATOM   6325  O O   . LEU C 1 52  ? -18.631 50.868   107.266 1.00 15.14 ? 134 LEU C O   1 
ATOM   6326  C CB  . LEU C 1 52  ? -20.546 51.686   105.174 1.00 15.73 ? 134 LEU C CB  1 
ATOM   6327  C CG  . LEU C 1 52  ? -21.308 51.677   103.842 1.00 15.46 ? 134 LEU C CG  1 
ATOM   6328  C CD1 . LEU C 1 52  ? -22.804 51.741   104.074 1.00 16.26 ? 134 LEU C CD1 1 
ATOM   6329  C CD2 . LEU C 1 52  ? -20.861 52.870   103.009 1.00 14.70 ? 134 LEU C CD2 1 
ATOM   6330  N N   . THR C 1 53  ? -17.309 52.472   106.390 1.00 12.96 ? 135 THR C N   1 
ATOM   6331  C CA  . THR C 1 53  ? -16.515 52.668   107.593 1.00 14.34 ? 135 THR C CA  1 
ATOM   6332  C C   . THR C 1 53  ? -17.272 53.522   108.585 1.00 14.05 ? 135 THR C C   1 
ATOM   6333  O O   . THR C 1 53  ? -18.329 54.062   108.275 1.00 14.27 ? 135 THR C O   1 
ATOM   6334  C CB  . THR C 1 53  ? -15.221 53.417   107.293 1.00 15.71 ? 135 THR C CB  1 
ATOM   6335  O OG1 . THR C 1 53  ? -15.529 54.784   106.967 1.00 16.99 ? 135 THR C OG1 1 
ATOM   6336  C CG2 . THR C 1 53  ? -14.493 52.773   106.129 1.00 17.71 ? 135 THR C CG2 1 
ATOM   6337  N N   . GLN C 1 54  ? -16.704 53.649   109.777 1.00 13.64 ? 136 GLN C N   1 
ATOM   6338  C CA  . GLN C 1 54  ? -17.283 54.465   110.831 1.00 13.40 ? 136 GLN C CA  1 
ATOM   6339  C C   . GLN C 1 54  ? -16.242 55.523   111.216 1.00 14.12 ? 136 GLN C C   1 
ATOM   6340  O O   . GLN C 1 54  ? -16.254 56.049   112.329 1.00 13.33 ? 136 GLN C O   1 
ATOM   6341  C CB  . GLN C 1 54  ? -17.627 53.597   112.044 1.00 13.28 ? 136 GLN C CB  1 
ATOM   6342  C CG  . GLN C 1 54  ? -18.816 52.674   111.857 1.00 12.07 ? 136 GLN C CG  1 
ATOM   6343  C CD  . GLN C 1 54  ? -20.144 53.388   112.029 1.00 14.45 ? 136 GLN C CD  1 
ATOM   6344  O OE1 . GLN C 1 54  ? -20.198 54.618   112.156 1.00 16.92 ? 136 GLN C OE1 1 
ATOM   6345  N NE2 . GLN C 1 54  ? -21.229 52.619   112.031 1.00 13.92 ? 136 GLN C NE2 1 
ATOM   6346  N N   . GLY C 1 55  ? -15.341 55.817   110.279 1.00 14.54 ? 137 GLY C N   1 
ATOM   6347  C CA  . GLY C 1 55  ? -14.296 56.804   110.507 1.00 13.65 ? 137 GLY C CA  1 
ATOM   6348  C C   . GLY C 1 55  ? -13.543 56.569   111.800 1.00 13.06 ? 137 GLY C C   1 
ATOM   6349  O O   . GLY C 1 55  ? -13.134 57.523   112.464 1.00 12.04 ? 137 GLY C O   1 
ATOM   6350  N N   . ALA C 1 56  ? -13.367 55.297   112.151 1.00 11.56 ? 138 ALA C N   1 
ATOM   6351  C CA  . ALA C 1 56  ? -12.661 54.921   113.368 1.00 13.46 ? 138 ALA C CA  1 
ATOM   6352  C C   . ALA C 1 56  ? -11.984 53.561   113.217 1.00 14.19 ? 138 ALA C C   1 
ATOM   6353  O O   . ALA C 1 56  ? -12.236 52.837   112.259 1.00 17.09 ? 138 ALA C O   1 
ATOM   6354  C CB  . ALA C 1 56  ? -13.629 54.899   114.547 1.00 12.72 ? 138 ALA C CB  1 
ATOM   6355  N N   . LEU C 1 57  ? -11.115 53.214   114.158 1.00 13.65 ? 139 LEU C N   1 
ATOM   6356  C CA  . LEU C 1 57  ? -10.415 51.933   114.107 1.00 12.85 ? 139 LEU C CA  1 
ATOM   6357  C C   . LEU C 1 57  ? -10.850 51.018   115.245 1.00 13.86 ? 139 LEU C C   1 
ATOM   6358  O O   . LEU C 1 57  ? -11.405 51.462   116.254 1.00 15.41 ? 139 LEU C O   1 
ATOM   6359  C CB  . LEU C 1 57  ? -8.894  52.145   114.177 1.00 11.91 ? 139 LEU C CB  1 
ATOM   6360  C CG  . LEU C 1 57  ? -8.233  53.047   113.121 1.00 10.57 ? 139 LEU C CG  1 
ATOM   6361  C CD1 . LEU C 1 57  ? -6.739  53.101   113.357 1.00 11.55 ? 139 LEU C CD1 1 
ATOM   6362  C CD2 . LEU C 1 57  ? -8.515  52.520   111.723 1.00 12.12 ? 139 LEU C CD2 1 
ATOM   6363  N N   . LEU C 1 58  ? -10.609 49.727   115.072 1.00 14.07 ? 140 LEU C N   1 
ATOM   6364  C CA  . LEU C 1 58  ? -10.957 48.756   116.093 1.00 14.29 ? 140 LEU C CA  1 
ATOM   6365  C C   . LEU C 1 58  ? -10.039 48.914   117.305 1.00 16.12 ? 140 LEU C C   1 
ATOM   6366  O O   . LEU C 1 58  ? -8.856  49.233   117.169 1.00 15.68 ? 140 LEU C O   1 
ATOM   6367  C CB  . LEU C 1 58  ? -10.823 47.349   115.522 1.00 14.60 ? 140 LEU C CB  1 
ATOM   6368  C CG  . LEU C 1 58  ? -11.725 47.024   114.333 1.00 15.02 ? 140 LEU C CG  1 
ATOM   6369  C CD1 . LEU C 1 58  ? -11.242 45.755   113.621 1.00 16.54 ? 140 LEU C CD1 1 
ATOM   6370  C CD2 . LEU C 1 58  ? -13.139 46.846   114.833 1.00 11.21 ? 140 LEU C CD2 1 
ATOM   6371  N N   . ASN C 1 59  ? -10.603 48.689   118.488 1.00 18.23 ? 141 ASN C N   1 
ATOM   6372  C CA  . ASN C 1 59  ? -9.881  48.779   119.753 1.00 17.71 ? 141 ASN C CA  1 
ATOM   6373  C C   . ASN C 1 59  ? -9.390  50.195   120.088 1.00 18.41 ? 141 ASN C C   1 
ATOM   6374  O O   . ASN C 1 59  ? -8.415  50.375   120.831 1.00 17.46 ? 141 ASN C O   1 
ATOM   6375  C CB  . ASN C 1 59  ? -8.716  47.784   119.773 1.00 18.29 ? 141 ASN C CB  1 
ATOM   6376  C CG  . ASN C 1 59  ? -8.769  46.831   120.978 1.00 20.12 ? 141 ASN C CG  1 
ATOM   6377  O OD1 . ASN C 1 59  ? -9.620  46.960   121.858 1.00 19.93 ? 141 ASN C OD1 1 
ATOM   6378  N ND2 . ASN C 1 59  ? -7.846  45.873   121.017 1.00 20.15 ? 141 ASN C ND2 1 
ATOM   6379  N N   . ASP C 1 60  ? -10.076 51.192   119.527 1.00 18.21 ? 142 ASP C N   1 
ATOM   6380  C CA  . ASP C 1 60  ? -9.783  52.603   119.804 1.00 17.89 ? 142 ASP C CA  1 
ATOM   6381  C C   . ASP C 1 60  ? -11.070 53.221   120.373 1.00 17.14 ? 142 ASP C C   1 
ATOM   6382  O O   . ASP C 1 60  ? -12.158 52.728   120.101 1.00 16.56 ? 142 ASP C O   1 
ATOM   6383  C CB  . ASP C 1 60  ? -9.365  53.349   118.537 1.00 18.25 ? 142 ASP C CB  1 
ATOM   6384  C CG  . ASP C 1 60  ? -9.109  54.824   118.803 1.00 20.17 ? 142 ASP C CG  1 
ATOM   6385  O OD1 . ASP C 1 60  ? -8.286  55.126   119.692 1.00 20.96 ? 142 ASP C OD1 1 
ATOM   6386  O OD2 . ASP C 1 60  ? -9.731  55.684   118.140 1.00 20.38 ? 142 ASP C OD2 1 
ATOM   6387  N N   . LYS C 1 61  ? -10.964 54.286   121.159 1.00 16.36 ? 143 LYS C N   1 
ATOM   6388  C CA  . LYS C 1 61  ? -12.171 54.872   121.737 1.00 16.39 ? 143 LYS C CA  1 
ATOM   6389  C C   . LYS C 1 61  ? -13.180 55.396   120.735 1.00 16.90 ? 143 LYS C C   1 
ATOM   6390  O O   . LYS C 1 61  ? -14.375 55.364   120.977 1.00 15.85 ? 143 LYS C O   1 
ATOM   6391  C CB  . LYS C 1 61  ? -11.823 55.985   122.731 1.00 14.73 ? 143 LYS C CB  1 
ATOM   6392  C CG  . LYS C 1 61  ? -11.072 57.139   122.142 1.00 15.45 ? 143 LYS C CG  1 
ATOM   6393  C CD  . LYS C 1 61  ? -10.765 58.144   123.226 1.00 15.37 ? 143 LYS C CD  1 
ATOM   6394  C CE  . LYS C 1 61  ? -10.251 59.427   122.615 1.00 15.02 ? 143 LYS C CE  1 
ATOM   6395  N NZ  . LYS C 1 61  ? -9.949  60.473   123.629 1.00 16.68 ? 143 LYS C NZ  1 
ATOM   6396  N N   . HIS C 1 62  ? -12.718 55.890   119.604 1.00 19.18 ? 144 HIS C N   1 
ATOM   6397  C CA  . HIS C 1 62  ? -13.668 56.415   118.637 1.00 20.82 ? 144 HIS C CA  1 
ATOM   6398  C C   . HIS C 1 62  ? -14.537 55.344   118.057 1.00 21.80 ? 144 HIS C C   1 
ATOM   6399  O O   . HIS C 1 62  ? -15.396 55.597   117.218 1.00 21.17 ? 144 HIS C O   1 
ATOM   6400  C CB  . HIS C 1 62  ? -12.934 57.098   117.521 1.00 20.26 ? 144 HIS C CB  1 
ATOM   6401  C CG  . HIS C 1 62  ? -12.135 58.262   117.986 1.00 20.86 ? 144 HIS C CG  1 
ATOM   6402  N ND1 . HIS C 1 62  ? -12.707 59.468   118.302 1.00 20.53 ? 144 HIS C ND1 1 
ATOM   6403  C CD2 . HIS C 1 62  ? -10.808 58.396   118.208 1.00 20.11 ? 144 HIS C CD2 1 
ATOM   6404  C CE1 . HIS C 1 62  ? -11.764 60.309   118.694 1.00 20.09 ? 144 HIS C CE1 1 
ATOM   6405  N NE2 . HIS C 1 62  ? -10.606 59.681   118.644 1.00 21.60 ? 144 HIS C NE2 1 
ATOM   6406  N N   . SER C 1 63  ? -14.303 54.137   118.525 1.00 22.20 ? 145 SER C N   1 
ATOM   6407  C CA  . SER C 1 63  ? -15.032 52.989   118.062 1.00 23.76 ? 145 SER C CA  1 
ATOM   6408  C C   . SER C 1 63  ? -16.305 52.833   118.858 1.00 24.89 ? 145 SER C C   1 
ATOM   6409  O O   . SER C 1 63  ? -17.136 52.000   118.529 1.00 24.78 ? 145 SER C O   1 
ATOM   6410  C CB  . SER C 1 63  ? -14.154 51.763   118.227 1.00 24.47 ? 145 SER C CB  1 
ATOM   6411  O OG  . SER C 1 63  ? -14.928 50.627   118.524 1.00 24.47 ? 145 SER C OG  1 
ATOM   6412  N N   . ASN C 1 64  ? -16.457 53.660   119.888 1.00 26.95 ? 146 ASN C N   1 
ATOM   6413  C CA  . ASN C 1 64  ? -17.615 53.604   120.765 1.00 28.98 ? 146 ASN C CA  1 
ATOM   6414  C C   . ASN C 1 64  ? -18.956 53.233   120.124 1.00 30.52 ? 146 ASN C C   1 
ATOM   6415  O O   . ASN C 1 64  ? -19.047 52.211   119.453 1.00 34.19 ? 146 ASN C O   1 
ATOM   6416  C CB  . ASN C 1 64  ? -17.744 54.902   121.561 1.00 28.94 ? 146 ASN C CB  1 
ATOM   6417  C CG  . ASN C 1 64  ? -18.212 54.647   122.989 1.00 28.11 ? 146 ASN C CG  1 
ATOM   6418  O OD1 . ASN C 1 64  ? -18.031 55.474   123.885 1.00 29.60 ? 146 ASN C OD1 1 
ATOM   6419  N ND2 . ASN C 1 64  ? -18.818 53.484   123.203 1.00 24.91 ? 146 ASN C ND2 1 
ATOM   6420  N N   . GLY C 1 65  ? -20.000 54.028   120.331 1.00 29.19 ? 147 GLY C N   1 
ATOM   6421  C CA  . GLY C 1 65  ? -21.302 53.683   119.771 1.00 27.83 ? 147 GLY C CA  1 
ATOM   6422  C C   . GLY C 1 65  ? -21.422 53.481   118.265 1.00 27.76 ? 147 GLY C C   1 
ATOM   6423  O O   . GLY C 1 65  ? -22.313 54.044   117.634 1.00 26.96 ? 147 GLY C O   1 
ATOM   6424  N N   . THR C 1 66  ? -20.551 52.664   117.683 1.00 27.82 ? 148 THR C N   1 
ATOM   6425  C CA  . THR C 1 66  ? -20.577 52.428   116.246 1.00 28.97 ? 148 THR C CA  1 
ATOM   6426  C C   . THR C 1 66  ? -21.742 51.560   115.804 1.00 29.23 ? 148 THR C C   1 
ATOM   6427  O O   . THR C 1 66  ? -21.679 50.889   114.779 1.00 30.62 ? 148 THR C O   1 
ATOM   6428  C CB  . THR C 1 66  ? -19.263 51.795   115.767 1.00 28.24 ? 148 THR C CB  1 
ATOM   6429  O OG1 . THR C 1 66  ? -18.893 50.729   116.651 1.00 26.84 ? 148 THR C OG1 1 
ATOM   6430  C CG2 . THR C 1 66  ? -18.167 52.838   115.729 1.00 25.24 ? 148 THR C CG2 1 
ATOM   6431  N N   . VAL C 1 67  ? -22.818 51.595   116.573 1.00 29.61 ? 149 VAL C N   1 
ATOM   6432  C CA  . VAL C 1 67  ? -23.996 50.817   116.241 1.00 30.18 ? 149 VAL C CA  1 
ATOM   6433  C C   . VAL C 1 67  ? -25.075 51.729   115.675 1.00 30.61 ? 149 VAL C C   1 
ATOM   6434  O O   . VAL C 1 67  ? -26.088 51.259   115.172 1.00 28.56 ? 149 VAL C O   1 
ATOM   6435  C CB  . VAL C 1 67  ? -24.552 50.137   117.485 1.00 32.03 ? 149 VAL C CB  1 
ATOM   6436  C CG1 . VAL C 1 67  ? -25.465 48.992   117.096 1.00 31.61 ? 149 VAL C CG1 1 
ATOM   6437  C CG2 . VAL C 1 67  ? -23.415 49.652   118.336 1.00 35.27 ? 149 VAL C CG2 1 
ATOM   6438  N N   . LYS C 1 68  ? -24.825 53.035   115.742 1.00 32.79 ? 150 LYS C N   1 
ATOM   6439  C CA  . LYS C 1 68  ? -25.771 54.063   115.305 1.00 35.69 ? 150 LYS C CA  1 
ATOM   6440  C C   . LYS C 1 68  ? -26.309 54.080   113.869 1.00 35.20 ? 150 LYS C C   1 
ATOM   6441  O O   . LYS C 1 68  ? -27.362 54.687   113.621 1.00 36.69 ? 150 LYS C O   1 
ATOM   6442  C CB  . LYS C 1 68  ? -25.215 55.458   115.639 1.00 39.00 ? 150 LYS C CB  1 
ATOM   6443  C CG  . LYS C 1 68  ? -23.872 55.813   114.985 1.00 45.58 ? 150 LYS C CG  1 
ATOM   6444  C CD  . LYS C 1 68  ? -23.491 57.255   115.329 1.00 48.75 ? 150 LYS C CD  1 
ATOM   6445  C CE  . LYS C 1 68  ? -22.049 57.580   114.979 1.00 48.94 ? 150 LYS C CE  1 
ATOM   6446  N NZ  . LYS C 1 68  ? -21.746 58.990   115.362 1.00 50.64 ? 150 LYS C NZ  1 
ATOM   6447  N N   . ASP C 1 69  ? -25.609 53.448   112.933 1.00 31.20 ? 151 ASP C N   1 
ATOM   6448  C CA  . ASP C 1 69  ? -26.062 53.415   111.537 1.00 29.18 ? 151 ASP C CA  1 
ATOM   6449  C C   . ASP C 1 69  ? -25.667 54.597   110.671 1.00 25.94 ? 151 ASP C C   1 
ATOM   6450  O O   . ASP C 1 69  ? -24.890 54.452   109.730 1.00 25.97 ? 151 ASP C O   1 
ATOM   6451  C CB  . ASP C 1 69  ? -27.582 53.279   111.433 1.00 28.97 ? 151 ASP C CB  1 
ATOM   6452  C CG  . ASP C 1 69  ? -28.037 51.848   111.416 1.00 30.27 ? 151 ASP C CG  1 
ATOM   6453  O OD1 . ASP C 1 69  ? -27.450 51.056   110.649 1.00 31.21 ? 151 ASP C OD1 1 
ATOM   6454  O OD2 . ASP C 1 69  ? -28.990 51.513   112.149 1.00 30.18 ? 151 ASP C OD2 1 
ATOM   6455  N N   . ARG C 1 70  ? -26.229 55.763   110.971 1.00 23.56 ? 152 ARG C N   1 
ATOM   6456  C CA  . ARG C 1 70  ? -25.947 56.960   110.184 1.00 21.99 ? 152 ARG C CA  1 
ATOM   6457  C C   . ARG C 1 70  ? -25.266 58.087   110.968 1.00 21.48 ? 152 ARG C C   1 
ATOM   6458  O O   . ARG C 1 70  ? -25.669 58.440   112.078 1.00 21.69 ? 152 ARG C O   1 
ATOM   6459  C CB  . ARG C 1 70  ? -27.246 57.473   109.535 1.00 19.04 ? 152 ARG C CB  1 
ATOM   6460  C CG  . ARG C 1 70  ? -27.973 56.439   108.672 1.00 18.66 ? 152 ARG C CG  1 
ATOM   6461  C CD  . ARG C 1 70  ? -29.310 56.950   108.101 1.00 17.57 ? 152 ARG C CD  1 
ATOM   6462  N NE  . ARG C 1 70  ? -30.299 57.315   109.119 1.00 15.08 ? 152 ARG C NE  1 
ATOM   6463  C CZ  . ARG C 1 70  ? -30.832 56.480   110.010 1.00 15.00 ? 152 ARG C CZ  1 
ATOM   6464  N NH1 . ARG C 1 70  ? -31.723 56.929   110.880 1.00 13.78 ? 152 ARG C NH1 1 
ATOM   6465  N NH2 . ARG C 1 70  ? -30.476 55.204   110.045 1.00 12.35 ? 152 ARG C NH2 1 
ATOM   6466  N N   . SER C 1 71  ? -24.215 58.636   110.373 1.00 20.30 ? 153 SER C N   1 
ATOM   6467  C CA  . SER C 1 71  ? -23.465 59.732   110.976 1.00 18.82 ? 153 SER C CA  1 
ATOM   6468  C C   . SER C 1 71  ? -22.629 60.399   109.892 1.00 17.00 ? 153 SER C C   1 
ATOM   6469  O O   . SER C 1 71  ? -22.426 59.833   108.824 1.00 16.74 ? 153 SER C O   1 
ATOM   6470  C CB  . SER C 1 71  ? -22.540 59.224   112.066 1.00 16.06 ? 153 SER C CB  1 
ATOM   6471  O OG  . SER C 1 71  ? -21.343 58.760   111.493 1.00 19.36 ? 153 SER C OG  1 
ATOM   6472  N N   . PRO C 1 72  ? -22.128 61.614   110.157 1.00 17.07 ? 154 PRO C N   1 
ATOM   6473  C CA  . PRO C 1 72  ? -21.308 62.380   109.208 1.00 17.82 ? 154 PRO C CA  1 
ATOM   6474  C C   . PRO C 1 72  ? -19.937 61.788   108.855 1.00 17.69 ? 154 PRO C C   1 
ATOM   6475  O O   . PRO C 1 72  ? -19.362 62.145   107.829 1.00 18.42 ? 154 PRO C O   1 
ATOM   6476  C CB  . PRO C 1 72  ? -21.158 63.739   109.898 1.00 16.06 ? 154 PRO C CB  1 
ATOM   6477  C CG  . PRO C 1 72  ? -22.364 63.838   110.740 1.00 16.49 ? 154 PRO C CG  1 
ATOM   6478  C CD  . PRO C 1 72  ? -22.488 62.452   111.314 1.00 16.69 ? 154 PRO C CD  1 
ATOM   6479  N N   . HIS C 1 73  ? -19.423 60.893   109.695 1.00 17.05 ? 155 HIS C N   1 
ATOM   6480  C CA  . HIS C 1 73  ? -18.098 60.294   109.493 1.00 17.04 ? 155 HIS C CA  1 
ATOM   6481  C C   . HIS C 1 73  ? -18.076 58.989   108.708 1.00 17.45 ? 155 HIS C C   1 
ATOM   6482  O O   . HIS C 1 73  ? -17.010 58.473   108.371 1.00 18.53 ? 155 HIS C O   1 
ATOM   6483  C CB  . HIS C 1 73  ? -17.452 60.096   110.853 1.00 17.28 ? 155 HIS C CB  1 
ATOM   6484  C CG  . HIS C 1 73  ? -17.637 61.270   111.760 1.00 18.12 ? 155 HIS C CG  1 
ATOM   6485  N ND1 . HIS C 1 73  ? -18.281 61.181   112.977 1.00 16.72 ? 155 HIS C ND1 1 
ATOM   6486  C CD2 . HIS C 1 73  ? -17.330 62.579   111.593 1.00 17.69 ? 155 HIS C CD2 1 
ATOM   6487  C CE1 . HIS C 1 73  ? -18.364 62.383   113.515 1.00 18.43 ? 155 HIS C CE1 1 
ATOM   6488  N NE2 . HIS C 1 73  ? -17.796 63.251   112.696 1.00 17.94 ? 155 HIS C NE2 1 
ATOM   6489  N N   . ARG C 1 74  ? -19.257 58.459   108.424 1.00 17.07 ? 156 ARG C N   1 
ATOM   6490  C CA  . ARG C 1 74  ? -19.405 57.229   107.664 1.00 16.79 ? 156 ARG C CA  1 
ATOM   6491  C C   . ARG C 1 74  ? -18.898 57.446   106.233 1.00 16.57 ? 156 ARG C C   1 
ATOM   6492  O O   . ARG C 1 74  ? -19.362 58.357   105.541 1.00 15.91 ? 156 ARG C O   1 
ATOM   6493  C CB  . ARG C 1 74  ? -20.881 56.850   107.622 1.00 17.04 ? 156 ARG C CB  1 
ATOM   6494  C CG  . ARG C 1 74  ? -21.162 55.377   107.710 1.00 20.78 ? 156 ARG C CG  1 
ATOM   6495  C CD  . ARG C 1 74  ? -21.176 54.895   109.154 1.00 20.93 ? 156 ARG C CD  1 
ATOM   6496  N NE  . ARG C 1 74  ? -20.969 53.453   109.202 1.00 21.08 ? 156 ARG C NE  1 
ATOM   6497  C CZ  . ARG C 1 74  ? -21.894 52.551   108.910 1.00 22.38 ? 156 ARG C CZ  1 
ATOM   6498  N NH1 . ARG C 1 74  ? -21.597 51.259   108.981 1.00 22.69 ? 156 ARG C NH1 1 
ATOM   6499  N NH2 . ARG C 1 74  ? -23.117 52.937   108.568 1.00 23.14 ? 156 ARG C NH2 1 
ATOM   6500  N N   . THR C 1 75  ? -17.945 56.631   105.783 1.00 16.51 ? 157 THR C N   1 
ATOM   6501  C CA  . THR C 1 75  ? -17.442 56.780   104.418 1.00 15.17 ? 157 THR C CA  1 
ATOM   6502  C C   . THR C 1 75  ? -17.329 55.465   103.649 1.00 14.89 ? 157 THR C C   1 
ATOM   6503  O O   . THR C 1 75  ? -16.981 54.433   104.207 1.00 15.23 ? 157 THR C O   1 
ATOM   6504  C CB  . THR C 1 75  ? -16.068 57.467   104.382 1.00 13.72 ? 157 THR C CB  1 
ATOM   6505  O OG1 . THR C 1 75  ? -15.103 56.646   105.045 1.00 16.48 ? 157 THR C OG1 1 
ATOM   6506  C CG2 . THR C 1 75  ? -16.134 58.823   105.054 1.00 15.86 ? 157 THR C CG2 1 
ATOM   6507  N N   . LEU C 1 76  ? -17.624 55.520   102.354 1.00 15.00 ? 158 LEU C N   1 
ATOM   6508  C CA  . LEU C 1 76  ? -17.542 54.352   101.494 1.00 13.93 ? 158 LEU C CA  1 
ATOM   6509  C C   . LEU C 1 76  ? -16.130 54.233   100.961 1.00 14.61 ? 158 LEU C C   1 
ATOM   6510  O O   . LEU C 1 76  ? -15.665 55.119   100.258 1.00 15.59 ? 158 LEU C O   1 
ATOM   6511  C CB  . LEU C 1 76  ? -18.498 54.488   100.311 1.00 13.29 ? 158 LEU C CB  1 
ATOM   6512  C CG  . LEU C 1 76  ? -18.374 53.367   99.267  1.00 14.27 ? 158 LEU C CG  1 
ATOM   6513  C CD1 . LEU C 1 76  ? -18.870 52.028   99.838  1.00 10.89 ? 158 LEU C CD1 1 
ATOM   6514  C CD2 . LEU C 1 76  ? -19.156 53.758   98.031  1.00 12.19 ? 158 LEU C CD2 1 
ATOM   6515  N N   . MET C 1 77  ? -15.450 53.140   101.288 1.00 14.99 ? 159 MET C N   1 
ATOM   6516  C CA  . MET C 1 77  ? -14.086 52.925   100.818 1.00 14.75 ? 159 MET C CA  1 
ATOM   6517  C C   . MET C 1 77  ? -13.969 51.521   100.204 1.00 14.94 ? 159 MET C C   1 
ATOM   6518  O O   . MET C 1 77  ? -14.937 50.760   100.195 1.00 14.30 ? 159 MET C O   1 
ATOM   6519  C CB  . MET C 1 77  ? -13.105 53.082   101.981 1.00 15.47 ? 159 MET C CB  1 
ATOM   6520  C CG  . MET C 1 77  ? -13.237 54.398   102.754 1.00 16.52 ? 159 MET C CG  1 
ATOM   6521  S SD  . MET C 1 77  ? -11.820 54.683   103.869 1.00 17.44 ? 159 MET C SD  1 
ATOM   6522  C CE  . MET C 1 77  ? -10.578 55.226   102.683 1.00 15.00 ? 159 MET C CE  1 
ATOM   6523  N N   . SER C 1 78  ? -12.796 51.183   99.678  1.00 14.28 ? 160 SER C N   1 
ATOM   6524  C CA  . SER C 1 78  ? -12.604 49.863   99.086  1.00 15.45 ? 160 SER C CA  1 
ATOM   6525  C C   . SER C 1 78  ? -11.157 49.389   99.134  1.00 16.34 ? 160 SER C C   1 
ATOM   6526  O O   . SER C 1 78  ? -10.231 50.186   99.281  1.00 17.10 ? 160 SER C O   1 
ATOM   6527  C CB  . SER C 1 78  ? -13.075 49.857   97.628  1.00 15.99 ? 160 SER C CB  1 
ATOM   6528  O OG  . SER C 1 78  ? -12.235 50.644   96.801  1.00 15.65 ? 160 SER C OG  1 
ATOM   6529  N N   . CYS C 1 79  ? -10.967 48.082   99.031  1.00 15.54 ? 161 CYS C N   1 
ATOM   6530  C CA  . CYS C 1 79  ? -9.629  47.508   99.007  1.00 16.18 ? 161 CYS C CA  1 
ATOM   6531  C C   . CYS C 1 79  ? -9.738  46.191   98.259  1.00 16.54 ? 161 CYS C C   1 
ATOM   6532  O O   . CYS C 1 79  ? -10.837 45.755   97.938  1.00 16.47 ? 161 CYS C O   1 
ATOM   6533  C CB  . CYS C 1 79  ? -9.090  47.297   100.427 1.00 16.58 ? 161 CYS C CB  1 
ATOM   6534  S SG  . CYS C 1 79  ? -10.016 46.144   101.495 1.00 19.13 ? 161 CYS C SG  1 
ATOM   6535  N N   . PRO C 1 80  ? -8.607  45.556   97.927  1.00 17.95 ? 162 PRO C N   1 
ATOM   6536  C CA  . PRO C 1 80  ? -8.736  44.280   97.208  1.00 18.88 ? 162 PRO C CA  1 
ATOM   6537  C C   . PRO C 1 80  ? -9.357  43.170   98.075  1.00 19.12 ? 162 PRO C C   1 
ATOM   6538  O O   . PRO C 1 80  ? -9.164  43.142   99.297  1.00 17.99 ? 162 PRO C O   1 
ATOM   6539  C CB  . PRO C 1 80  ? -7.300  43.984   96.758  1.00 17.51 ? 162 PRO C CB  1 
ATOM   6540  C CG  . PRO C 1 80  ? -6.467  44.724   97.736  1.00 18.92 ? 162 PRO C CG  1 
ATOM   6541  C CD  . PRO C 1 80  ? -7.208  46.011   97.954  1.00 18.14 ? 162 PRO C CD  1 
ATOM   6542  N N   . VAL C 1 81  ? -10.112 42.272   97.437  1.00 19.05 ? 163 VAL C N   1 
ATOM   6543  C CA  . VAL C 1 81  ? -10.788 41.178   98.146  1.00 21.05 ? 163 VAL C CA  1 
ATOM   6544  C C   . VAL C 1 81  ? -9.928  40.294   99.048  1.00 20.80 ? 163 VAL C C   1 
ATOM   6545  O O   . VAL C 1 81  ? -8.850  39.836   98.659  1.00 20.36 ? 163 VAL C O   1 
ATOM   6546  C CB  . VAL C 1 81  ? -11.559 40.238   97.175  1.00 21.40 ? 163 VAL C CB  1 
ATOM   6547  C CG1 . VAL C 1 81  ? -12.949 40.792   96.903  1.00 22.45 ? 163 VAL C CG1 1 
ATOM   6548  C CG2 . VAL C 1 81  ? -10.805 40.093   95.873  1.00 22.61 ? 163 VAL C CG2 1 
ATOM   6549  N N   . GLY C 1 82  ? -10.431 40.059   100.258 1.00 19.91 ? 164 GLY C N   1 
ATOM   6550  C CA  . GLY C 1 82  ? -9.729  39.220   101.211 1.00 19.25 ? 164 GLY C CA  1 
ATOM   6551  C C   . GLY C 1 82  ? -8.807  39.979   102.150 1.00 18.10 ? 164 GLY C C   1 
ATOM   6552  O O   . GLY C 1 82  ? -8.387  39.454   103.180 1.00 18.95 ? 164 GLY C O   1 
ATOM   6553  N N   . GLU C 1 83  ? -8.478  41.213   101.802 1.00 15.97 ? 165 GLU C N   1 
ATOM   6554  C CA  . GLU C 1 83  ? -7.594  41.999   102.644 1.00 16.39 ? 165 GLU C CA  1 
ATOM   6555  C C   . GLU C 1 83  ? -8.385  42.735   103.703 1.00 15.88 ? 165 GLU C C   1 
ATOM   6556  O O   . GLU C 1 83  ? -9.522  43.133   103.472 1.00 16.62 ? 165 GLU C O   1 
ATOM   6557  C CB  . GLU C 1 83  ? -6.809  43.009   101.803 1.00 18.83 ? 165 GLU C CB  1 
ATOM   6558  C CG  . GLU C 1 83  ? -5.632  42.414   101.029 1.00 21.36 ? 165 GLU C CG  1 
ATOM   6559  C CD  . GLU C 1 83  ? -4.975  43.423   100.098 1.00 21.66 ? 165 GLU C CD  1 
ATOM   6560  O OE1 . GLU C 1 83  ? -4.814  44.598   100.486 1.00 22.02 ? 165 GLU C OE1 1 
ATOM   6561  O OE2 . GLU C 1 83  ? -4.607  43.041   98.975  1.00 23.93 ? 165 GLU C OE2 1 
ATOM   6562  N N   . ALA C 1 84  ? -7.786  42.914   104.873 1.00 14.13 ? 166 ALA C N   1 
ATOM   6563  C CA  . ALA C 1 84  ? -8.464  43.627   105.940 1.00 14.56 ? 166 ALA C CA  1 
ATOM   6564  C C   . ALA C 1 84  ? -8.541  45.115   105.588 1.00 15.74 ? 166 ALA C C   1 
ATOM   6565  O O   . ALA C 1 84  ? -7.546  45.721   105.176 1.00 16.29 ? 166 ALA C O   1 
ATOM   6566  C CB  . ALA C 1 84  ? -7.724  43.437   107.245 1.00 11.68 ? 166 ALA C CB  1 
ATOM   6567  N N   . PRO C 1 85  ? -9.736  45.716   105.717 1.00 15.64 ? 167 PRO C N   1 
ATOM   6568  C CA  . PRO C 1 85  ? -9.896  47.137   105.408 1.00 14.97 ? 167 PRO C CA  1 
ATOM   6569  C C   . PRO C 1 85  ? -9.129  47.999   106.407 1.00 15.43 ? 167 PRO C C   1 
ATOM   6570  O O   . PRO C 1 85  ? -9.417  48.015   107.605 1.00 15.02 ? 167 PRO C O   1 
ATOM   6571  C CB  . PRO C 1 85  ? -11.412 47.341   105.478 1.00 15.44 ? 167 PRO C CB  1 
ATOM   6572  C CG  . PRO C 1 85  ? -11.845 46.316   106.485 1.00 16.13 ? 167 PRO C CG  1 
ATOM   6573  C CD  . PRO C 1 85  ? -11.028 45.107   106.071 1.00 15.36 ? 167 PRO C CD  1 
ATOM   6574  N N   . SER C 1 86  ? -8.144  48.715   105.889 1.00 15.26 ? 168 SER C N   1 
ATOM   6575  C CA  . SER C 1 86  ? -7.300  49.566   106.697 1.00 15.76 ? 168 SER C CA  1 
ATOM   6576  C C   . SER C 1 86  ? -7.031  50.876   105.963 1.00 17.21 ? 168 SER C C   1 
ATOM   6577  O O   . SER C 1 86  ? -7.264  50.983   104.757 1.00 18.92 ? 168 SER C O   1 
ATOM   6578  C CB  . SER C 1 86  ? -5.996  48.829   106.966 1.00 16.11 ? 168 SER C CB  1 
ATOM   6579  O OG  . SER C 1 86  ? -4.892  49.692   106.842 1.00 20.09 ? 168 SER C OG  1 
ATOM   6580  N N   . PRO C 1 87  ? -6.550  51.901   106.678 1.00 17.35 ? 169 PRO C N   1 
ATOM   6581  C CA  . PRO C 1 87  ? -6.267  53.184   106.028 1.00 16.82 ? 169 PRO C CA  1 
ATOM   6582  C C   . PRO C 1 87  ? -4.994  53.168   105.174 1.00 16.21 ? 169 PRO C C   1 
ATOM   6583  O O   . PRO C 1 87  ? -4.709  54.118   104.455 1.00 17.81 ? 169 PRO C O   1 
ATOM   6584  C CB  . PRO C 1 87  ? -6.158  54.145   107.208 1.00 16.35 ? 169 PRO C CB  1 
ATOM   6585  C CG  . PRO C 1 87  ? -5.589  53.279   108.287 1.00 17.20 ? 169 PRO C CG  1 
ATOM   6586  C CD  . PRO C 1 87  ? -6.399  52.008   108.142 1.00 18.14 ? 169 PRO C CD  1 
ATOM   6587  N N   . TYR C 1 88  A -4.240  52.080   105.259 1.00 15.39 ? 169 TYR C N   1 
ATOM   6588  C CA  . TYR C 1 88  A -2.993  51.943   104.518 1.00 14.06 ? 169 TYR C CA  1 
ATOM   6589  C C   . TYR C 1 88  A -3.157  51.109   103.254 1.00 14.80 ? 169 TYR C C   1 
ATOM   6590  O O   . TYR C 1 88  A -2.200  50.938   102.507 1.00 13.46 ? 169 TYR C O   1 
ATOM   6591  C CB  . TYR C 1 88  A -1.931  51.296   105.404 1.00 12.70 ? 169 TYR C CB  1 
ATOM   6592  C CG  . TYR C 1 88  A -1.934  51.785   106.838 1.00 13.50 ? 169 TYR C CG  1 
ATOM   6593  C CD1 . TYR C 1 88  A -1.778  50.884   107.901 1.00 13.18 ? 169 TYR C CD1 1 
ATOM   6594  C CD2 . TYR C 1 88  A -2.083  53.139   107.137 1.00 10.95 ? 169 TYR C CD2 1 
ATOM   6595  C CE1 . TYR C 1 88  A -1.773  51.320   109.219 1.00 13.02 ? 169 TYR C CE1 1 
ATOM   6596  C CE2 . TYR C 1 88  A -2.080  53.585   108.445 1.00 10.78 ? 169 TYR C CE2 1 
ATOM   6597  C CZ  . TYR C 1 88  A -1.926  52.674   109.484 1.00 13.83 ? 169 TYR C CZ  1 
ATOM   6598  O OH  . TYR C 1 88  A -1.933  53.110   110.785 1.00 14.73 ? 169 TYR C OH  1 
ATOM   6599  N N   . ASN C 1 89  ? -4.359  50.584   103.021 1.00 14.64 ? 170 ASN C N   1 
ATOM   6600  C CA  . ASN C 1 89  ? -4.615  49.774   101.827 1.00 14.21 ? 170 ASN C CA  1 
ATOM   6601  C C   . ASN C 1 89  ? -5.999  50.050   101.243 1.00 14.86 ? 170 ASN C C   1 
ATOM   6602  O O   . ASN C 1 89  ? -6.426  49.371   100.314 1.00 14.97 ? 170 ASN C O   1 
ATOM   6603  C CB  . ASN C 1 89  ? -4.527  48.290   102.169 1.00 14.53 ? 170 ASN C CB  1 
ATOM   6604  C CG  . ASN C 1 89  ? -5.788  47.773   102.848 1.00 15.62 ? 170 ASN C CG  1 
ATOM   6605  O OD1 . ASN C 1 89  ? -6.447  48.495   103.599 1.00 15.24 ? 170 ASN C OD1 1 
ATOM   6606  N ND2 . ASN C 1 89  ? -6.117  46.514   102.599 1.00 17.19 ? 170 ASN C ND2 1 
ATOM   6607  N N   . SER C 1 90  ? -6.705  51.037   101.785 1.00 14.35 ? 171 SER C N   1 
ATOM   6608  C CA  . SER C 1 90  ? -8.045  51.338   101.297 1.00 15.48 ? 171 SER C CA  1 
ATOM   6609  C C   . SER C 1 90  ? -8.164  52.601   100.458 1.00 16.12 ? 171 SER C C   1 
ATOM   6610  O O   . SER C 1 90  ? -7.618  53.649   100.793 1.00 17.96 ? 171 SER C O   1 
ATOM   6611  C CB  . SER C 1 90  ? -9.031  51.418   102.467 1.00 15.17 ? 171 SER C CB  1 
ATOM   6612  O OG  . SER C 1 90  ? -9.205  50.158   103.085 1.00 13.61 ? 171 SER C OG  1 
ATOM   6613  N N   . ARG C 1 91  ? -8.883  52.487   99.353  1.00 16.13 ? 172 ARG C N   1 
ATOM   6614  C CA  . ARG C 1 91  ? -9.101  53.618   98.480  1.00 18.30 ? 172 ARG C CA  1 
ATOM   6615  C C   . ARG C 1 91  ? -10.360 54.328   98.953  1.00 18.89 ? 172 ARG C C   1 
ATOM   6616  O O   . ARG C 1 91  ? -11.359 53.678   99.243  1.00 21.74 ? 172 ARG C O   1 
ATOM   6617  C CB  . ARG C 1 91  ? -9.306  53.150   97.045  1.00 20.10 ? 172 ARG C CB  1 
ATOM   6618  C CG  . ARG C 1 91  ? -9.691  54.272   96.108  1.00 26.36 ? 172 ARG C CG  1 
ATOM   6619  C CD  . ARG C 1 91  ? -10.265 53.712   94.826  1.00 32.55 ? 172 ARG C CD  1 
ATOM   6620  N NE  . ARG C 1 91  ? -9.289  52.856   94.160  1.00 36.16 ? 172 ARG C NE  1 
ATOM   6621  C CZ  . ARG C 1 91  ? -9.585  52.002   93.189  1.00 38.44 ? 172 ARG C CZ  1 
ATOM   6622  N NH1 . ARG C 1 91  ? -8.614  51.271   92.648  1.00 38.69 ? 172 ARG C NH1 1 
ATOM   6623  N NH2 . ARG C 1 91  ? -10.847 51.870   92.770  1.00 38.01 ? 172 ARG C NH2 1 
ATOM   6624  N N   . PHE C 1 92  ? -10.314 55.653   99.048  1.00 18.33 ? 173 PHE C N   1 
ATOM   6625  C CA  . PHE C 1 92  ? -11.490 56.408   99.462  1.00 17.91 ? 173 PHE C CA  1 
ATOM   6626  C C   . PHE C 1 92  ? -12.409 56.511   98.254  1.00 18.66 ? 173 PHE C C   1 
ATOM   6627  O O   . PHE C 1 92  ? -11.958 56.858   97.159  1.00 16.54 ? 173 PHE C O   1 
ATOM   6628  C CB  . PHE C 1 92  ? -11.122 57.826   99.905  1.00 16.45 ? 173 PHE C CB  1 
ATOM   6629  C CG  . PHE C 1 92  ? -12.311 58.651   100.297 1.00 15.06 ? 173 PHE C CG  1 
ATOM   6630  C CD1 . PHE C 1 92  ? -12.828 58.570   101.584 1.00 14.33 ? 173 PHE C CD1 1 
ATOM   6631  C CD2 . PHE C 1 92  ? -12.954 59.466   99.359  1.00 14.69 ? 173 PHE C CD2 1 
ATOM   6632  C CE1 . PHE C 1 92  ? -13.973 59.284   101.942 1.00 14.63 ? 173 PHE C CE1 1 
ATOM   6633  C CE2 . PHE C 1 92  ? -14.096 60.183   99.698  1.00 13.47 ? 173 PHE C CE2 1 
ATOM   6634  C CZ  . PHE C 1 92  ? -14.610 60.091   100.998 1.00 14.38 ? 173 PHE C CZ  1 
ATOM   6635  N N   . GLU C 1 93  ? -13.695 56.230   98.456  1.00 19.10 ? 174 GLU C N   1 
ATOM   6636  C CA  . GLU C 1 93  ? -14.660 56.294   97.367  1.00 19.12 ? 174 GLU C CA  1 
ATOM   6637  C C   . GLU C 1 93  ? -15.627 57.467   97.504  1.00 19.10 ? 174 GLU C C   1 
ATOM   6638  O O   . GLU C 1 93  ? -15.750 58.293   96.586  1.00 18.28 ? 174 GLU C O   1 
ATOM   6639  C CB  . GLU C 1 93  ? -15.448 54.987   97.291  1.00 19.19 ? 174 GLU C CB  1 
ATOM   6640  C CG  . GLU C 1 93  ? -14.575 53.747   97.147  1.00 21.99 ? 174 GLU C CG  1 
ATOM   6641  C CD  . GLU C 1 93  ? -13.983 53.612   95.757  1.00 22.00 ? 174 GLU C CD  1 
ATOM   6642  O OE1 . GLU C 1 93  ? -13.151 52.697   95.531  1.00 21.90 ? 174 GLU C OE1 1 
ATOM   6643  O OE2 . GLU C 1 93  ? -14.359 54.427   94.889  1.00 22.56 ? 174 GLU C OE2 1 
ATOM   6644  N N   . SER C 1 94  ? -16.304 57.548   98.648  1.00 18.89 ? 175 SER C N   1 
ATOM   6645  C CA  . SER C 1 94  ? -17.276 58.613   98.860  1.00 17.67 ? 175 SER C CA  1 
ATOM   6646  C C   . SER C 1 94  ? -17.734 58.723   100.317 1.00 16.48 ? 175 SER C C   1 
ATOM   6647  O O   . SER C 1 94  ? -17.598 57.774   101.089 1.00 15.93 ? 175 SER C O   1 
ATOM   6648  C CB  . SER C 1 94  ? -18.485 58.347   97.964  1.00 18.56 ? 175 SER C CB  1 
ATOM   6649  O OG  . SER C 1 94  ? -19.204 59.540   97.708  1.00 22.76 ? 175 SER C OG  1 
ATOM   6650  N N   . VAL C 1 95  ? -18.263 59.885   100.699 1.00 14.87 ? 176 VAL C N   1 
ATOM   6651  C CA  . VAL C 1 95  ? -18.770 60.065   102.059 1.00 15.20 ? 176 VAL C CA  1 
ATOM   6652  C C   . VAL C 1 95  ? -20.161 59.422   102.032 1.00 15.60 ? 176 VAL C C   1 
ATOM   6653  O O   . VAL C 1 95  ? -21.016 59.846   101.252 1.00 16.43 ? 176 VAL C O   1 
ATOM   6654  C CB  . VAL C 1 95  ? -18.895 61.560   102.431 1.00 13.92 ? 176 VAL C CB  1 
ATOM   6655  C CG1 . VAL C 1 95  ? -19.545 61.706   103.786 1.00 12.62 ? 176 VAL C CG1 1 
ATOM   6656  C CG2 . VAL C 1 95  ? -17.531 62.209   102.444 1.00 11.79 ? 176 VAL C CG2 1 
ATOM   6657  N N   . ALA C 1 96  ? -20.397 58.402   102.859 1.00 14.14 ? 177 ALA C N   1 
ATOM   6658  C CA  . ALA C 1 96  ? -21.695 57.744   102.816 1.00 12.88 ? 177 ALA C CA  1 
ATOM   6659  C C   . ALA C 1 96  ? -22.046 56.838   103.983 1.00 12.04 ? 177 ALA C C   1 
ATOM   6660  O O   . ALA C 1 96  ? -21.169 56.262   104.619 1.00 12.50 ? 177 ALA C O   1 
ATOM   6661  C CB  . ALA C 1 96  ? -21.796 56.945   101.523 1.00 12.68 ? 177 ALA C CB  1 
ATOM   6662  N N   . TRP C 1 97  ? -23.343 56.733   104.264 1.00 11.24 ? 178 TRP C N   1 
ATOM   6663  C CA  . TRP C 1 97  ? -23.832 55.839   105.305 1.00 10.76 ? 178 TRP C CA  1 
ATOM   6664  C C   . TRP C 1 97  ? -24.755 54.825   104.634 1.00 11.11 ? 178 TRP C C   1 
ATOM   6665  O O   . TRP C 1 97  ? -25.463 54.059   105.288 1.00 12.59 ? 178 TRP C O   1 
ATOM   6666  C CB  . TRP C 1 97  ? -24.548 56.584   106.450 1.00 10.28 ? 178 TRP C CB  1 
ATOM   6667  C CG  . TRP C 1 97  ? -25.485 57.715   106.089 1.00 9.96  ? 178 TRP C CG  1 
ATOM   6668  C CD1 . TRP C 1 97  ? -25.261 59.047   106.284 1.00 10.46 ? 178 TRP C CD1 1 
ATOM   6669  C CD2 . TRP C 1 97  ? -26.800 57.611   105.534 1.00 9.23  ? 178 TRP C CD2 1 
ATOM   6670  N NE1 . TRP C 1 97  ? -26.349 59.776   105.891 1.00 9.23  ? 178 TRP C NE1 1 
ATOM   6671  C CE2 . TRP C 1 97  ? -27.309 58.925   105.425 1.00 9.25  ? 178 TRP C CE2 1 
ATOM   6672  C CE3 . TRP C 1 97  ? -27.595 56.540   105.117 1.00 8.62  ? 178 TRP C CE3 1 
ATOM   6673  C CZ2 . TRP C 1 97  ? -28.582 59.196   104.915 1.00 8.54  ? 178 TRP C CZ2 1 
ATOM   6674  C CZ3 . TRP C 1 97  ? -28.866 56.812   104.606 1.00 8.59  ? 178 TRP C CZ3 1 
ATOM   6675  C CH2 . TRP C 1 97  ? -29.344 58.131   104.512 1.00 8.65  ? 178 TRP C CH2 1 
ATOM   6676  N N   . SER C 1 98  ? -24.728 54.851   103.306 1.00 10.38 ? 179 SER C N   1 
ATOM   6677  C CA  . SER C 1 98  ? -25.477 53.934   102.459 1.00 11.52 ? 179 SER C CA  1 
ATOM   6678  C C   . SER C 1 98  ? -24.879 54.048   101.061 1.00 12.57 ? 179 SER C C   1 
ATOM   6679  O O   . SER C 1 98  ? -24.734 55.144   100.522 1.00 12.31 ? 179 SER C O   1 
ATOM   6680  C CB  . SER C 1 98  ? -26.956 54.275   102.422 1.00 12.69 ? 179 SER C CB  1 
ATOM   6681  O OG  . SER C 1 98  ? -27.638 53.294   101.657 1.00 16.19 ? 179 SER C OG  1 
ATOM   6682  N N   . ALA C 1 99  ? -24.538 52.912   100.467 1.00 13.59 ? 180 ALA C N   1 
ATOM   6683  C CA  . ALA C 1 99  ? -23.894 52.946   99.169  1.00 14.68 ? 180 ALA C CA  1 
ATOM   6684  C C   . ALA C 1 99  ? -24.235 51.812   98.214  1.00 15.65 ? 180 ALA C C   1 
ATOM   6685  O O   . ALA C 1 99  ? -25.073 50.960   98.503  1.00 16.07 ? 180 ALA C O   1 
ATOM   6686  C CB  . ALA C 1 99  ? -22.382 53.003   99.375  1.00 14.05 ? 180 ALA C CB  1 
ATOM   6687  N N   . SER C 1 100 ? -23.558 51.839   97.066  1.00 16.31 ? 181 SER C N   1 
ATOM   6688  C CA  . SER C 1 100 ? -23.692 50.854   95.997  1.00 17.39 ? 181 SER C CA  1 
ATOM   6689  C C   . SER C 1 100 ? -22.533 51.116   95.029  1.00 17.62 ? 181 SER C C   1 
ATOM   6690  O O   . SER C 1 100 ? -21.902 52.169   95.095  1.00 19.30 ? 181 SER C O   1 
ATOM   6691  C CB  . SER C 1 100 ? -25.027 51.025   95.276  1.00 18.25 ? 181 SER C CB  1 
ATOM   6692  O OG  . SER C 1 100 ? -25.069 50.234   94.098  1.00 22.43 ? 181 SER C OG  1 
ATOM   6693  N N   . ALA C 1 101 ? -22.241 50.169   94.144  1.00 17.48 ? 182 ALA C N   1 
ATOM   6694  C CA  . ALA C 1 101 ? -21.147 50.346   93.194  1.00 17.29 ? 182 ALA C CA  1 
ATOM   6695  C C   . ALA C 1 101 ? -21.069 49.198   92.199  1.00 17.51 ? 182 ALA C C   1 
ATOM   6696  O O   . ALA C 1 101 ? -21.468 48.073   92.502  1.00 16.98 ? 182 ALA C O   1 
ATOM   6697  C CB  . ALA C 1 101 ? -19.828 50.470   93.934  1.00 16.58 ? 182 ALA C CB  1 
ATOM   6698  N N   . CYS C 1 102 ? -20.561 49.503   91.007  1.00 17.25 ? 183 CYS C N   1 
ATOM   6699  C CA  . CYS C 1 102 ? -20.400 48.524   89.932  1.00 17.03 ? 183 CYS C CA  1 
ATOM   6700  C C   . CYS C 1 102 ? -19.528 49.110   88.833  1.00 17.59 ? 183 CYS C C   1 
ATOM   6701  O O   . CYS C 1 102 ? -19.459 50.329   88.669  1.00 18.19 ? 183 CYS C O   1 
ATOM   6702  C CB  . CYS C 1 102 ? -21.755 48.132   89.342  1.00 17.75 ? 183 CYS C CB  1 
ATOM   6703  S SG  . CYS C 1 102 ? -22.790 49.555   88.889  1.00 17.03 ? 183 CYS C SG  1 
ATOM   6704  N N   . HIS C 1 103 ? -18.869 48.234   88.081  1.00 17.67 ? 184 HIS C N   1 
ATOM   6705  C CA  . HIS C 1 103 ? -17.980 48.632   86.999  1.00 17.34 ? 184 HIS C CA  1 
ATOM   6706  C C   . HIS C 1 103 ? -18.657 48.265   85.675  1.00 17.39 ? 184 HIS C C   1 
ATOM   6707  O O   . HIS C 1 103 ? -19.122 47.142   85.518  1.00 17.45 ? 184 HIS C O   1 
ATOM   6708  C CB  . HIS C 1 103 ? -16.655 47.884   87.157  1.00 17.89 ? 184 HIS C CB  1 
ATOM   6709  C CG  . HIS C 1 103 ? -15.542 48.414   86.307  1.00 20.48 ? 184 HIS C CG  1 
ATOM   6710  N ND1 . HIS C 1 103 ? -14.487 49.141   86.829  1.00 20.80 ? 184 HIS C ND1 1 
ATOM   6711  C CD2 . HIS C 1 103 ? -15.284 48.283   84.985  1.00 17.88 ? 184 HIS C CD2 1 
ATOM   6712  C CE1 . HIS C 1 103 ? -13.632 49.422   85.867  1.00 20.18 ? 184 HIS C CE1 1 
ATOM   6713  N NE2 . HIS C 1 103 ? -14.092 48.912   84.735  1.00 18.05 ? 184 HIS C NE2 1 
ATOM   6714  N N   . ASP C 1 104 ? -18.712 49.203   84.728  1.00 17.58 ? 185 ASP C N   1 
ATOM   6715  C CA  . ASP C 1 104 ? -19.360 48.946   83.439  1.00 17.55 ? 185 ASP C CA  1 
ATOM   6716  C C   . ASP C 1 104 ? -18.417 48.456   82.338  1.00 17.49 ? 185 ASP C C   1 
ATOM   6717  O O   . ASP C 1 104 ? -18.819 48.331   81.178  1.00 17.65 ? 185 ASP C O   1 
ATOM   6718  C CB  . ASP C 1 104 ? -20.107 50.203   82.950  1.00 18.22 ? 185 ASP C CB  1 
ATOM   6719  C CG  . ASP C 1 104 ? -19.168 51.346   82.574  1.00 17.94 ? 185 ASP C CG  1 
ATOM   6720  O OD1 . ASP C 1 104 ? -17.947 51.114   82.497  1.00 19.16 ? 185 ASP C OD1 1 
ATOM   6721  O OD2 . ASP C 1 104 ? -19.650 52.477   82.343  1.00 17.18 ? 185 ASP C OD2 1 
ATOM   6722  N N   . GLY C 1 105 ? -17.170 48.176   82.705  1.00 17.95 ? 186 GLY C N   1 
ATOM   6723  C CA  . GLY C 1 105 ? -16.196 47.697   81.743  1.00 17.24 ? 186 GLY C CA  1 
ATOM   6724  C C   . GLY C 1 105 ? -15.173 48.768   81.439  1.00 18.51 ? 186 GLY C C   1 
ATOM   6725  O O   . GLY C 1 105 ? -14.059 48.482   80.991  1.00 18.31 ? 186 GLY C O   1 
ATOM   6726  N N   . THR C 1 106 ? -15.557 50.013   81.694  1.00 19.45 ? 187 THR C N   1 
ATOM   6727  C CA  . THR C 1 106 ? -14.687 51.152   81.454  1.00 20.90 ? 187 THR C CA  1 
ATOM   6728  C C   . THR C 1 106 ? -14.222 51.788   82.760  1.00 22.01 ? 187 THR C C   1 
ATOM   6729  O O   . THR C 1 106 ? -13.020 51.847   83.031  1.00 23.43 ? 187 THR C O   1 
ATOM   6730  C CB  . THR C 1 106 ? -15.397 52.226   80.595  1.00 21.30 ? 187 THR C CB  1 
ATOM   6731  O OG1 . THR C 1 106 ? -15.581 51.731   79.265  1.00 21.62 ? 187 THR C OG1 1 
ATOM   6732  C CG2 . THR C 1 106 ? -14.567 53.492   80.535  1.00 21.81 ? 187 THR C CG2 1 
ATOM   6733  N N   . SER C 1 107 ? -15.164 52.265   83.571  1.00 21.61 ? 188 SER C N   1 
ATOM   6734  C CA  . SER C 1 107 ? -14.801 52.904   84.838  1.00 20.69 ? 188 SER C CA  1 
ATOM   6735  C C   . SER C 1 107 ? -15.716 52.478   85.966  1.00 19.43 ? 188 SER C C   1 
ATOM   6736  O O   . SER C 1 107 ? -16.759 51.875   85.733  1.00 20.70 ? 188 SER C O   1 
ATOM   6737  C CB  . SER C 1 107 ? -14.819 54.427   84.694  1.00 20.10 ? 188 SER C CB  1 
ATOM   6738  O OG  . SER C 1 107 ? -16.120 54.895   84.388  1.00 20.00 ? 188 SER C OG  1 
ATOM   6739  N N   . TRP C 1 108 ? -15.320 52.779   87.195  1.00 17.86 ? 189 TRP C N   1 
ATOM   6740  C CA  . TRP C 1 108 ? -16.156 52.439   88.337  1.00 16.68 ? 189 TRP C CA  1 
ATOM   6741  C C   . TRP C 1 108 ? -17.241 53.477   88.529  1.00 15.80 ? 189 TRP C C   1 
ATOM   6742  O O   . TRP C 1 108 ? -17.016 54.660   88.308  1.00 15.61 ? 189 TRP C O   1 
ATOM   6743  C CB  . TRP C 1 108 ? -15.347 52.382   89.631  1.00 13.50 ? 189 TRP C CB  1 
ATOM   6744  C CG  . TRP C 1 108 ? -14.649 51.109   89.834  1.00 16.26 ? 189 TRP C CG  1 
ATOM   6745  C CD1 . TRP C 1 108 ? -13.326 50.869   89.650  1.00 15.28 ? 189 TRP C CD1 1 
ATOM   6746  C CD2 . TRP C 1 108 ? -15.241 49.858   90.209  1.00 16.79 ? 189 TRP C CD2 1 
ATOM   6747  N NE1 . TRP C 1 108 ? -13.051 49.549   89.880  1.00 17.08 ? 189 TRP C NE1 1 
ATOM   6748  C CE2 . TRP C 1 108 ? -14.209 48.903   90.225  1.00 16.84 ? 189 TRP C CE2 1 
ATOM   6749  C CE3 . TRP C 1 108 ? -16.544 49.456   90.530  1.00 16.08 ? 189 TRP C CE3 1 
ATOM   6750  C CZ2 . TRP C 1 108 ? -14.435 47.556   90.545  1.00 17.85 ? 189 TRP C CZ2 1 
ATOM   6751  C CZ3 . TRP C 1 108 ? -16.771 48.118   90.848  1.00 17.65 ? 189 TRP C CZ3 1 
ATOM   6752  C CH2 . TRP C 1 108 ? -15.719 47.183   90.853  1.00 17.39 ? 189 TRP C CH2 1 
ATOM   6753  N N   . LEU C 1 109 ? -18.419 53.018   88.930  1.00 15.68 ? 190 LEU C N   1 
ATOM   6754  C CA  . LEU C 1 109 ? -19.538 53.893   89.245  1.00 14.76 ? 190 LEU C CA  1 
ATOM   6755  C C   . LEU C 1 109 ? -19.769 53.702   90.749  1.00 14.28 ? 190 LEU C C   1 
ATOM   6756  O O   . LEU C 1 109 ? -19.926 52.573   91.208  1.00 14.25 ? 190 LEU C O   1 
ATOM   6757  C CB  . LEU C 1 109 ? -20.806 53.476   88.482  1.00 14.76 ? 190 LEU C CB  1 
ATOM   6758  C CG  . LEU C 1 109 ? -22.129 54.001   89.074  1.00 14.51 ? 190 LEU C CG  1 
ATOM   6759  C CD1 . LEU C 1 109 ? -22.147 55.522   89.051  1.00 13.06 ? 190 LEU C CD1 1 
ATOM   6760  C CD2 . LEU C 1 109 ? -23.315 53.440   88.304  1.00 14.88 ? 190 LEU C CD2 1 
ATOM   6761  N N   . THR C 1 110 ? -19.767 54.783   91.521  1.00 14.69 ? 191 THR C N   1 
ATOM   6762  C CA  . THR C 1 110 ? -20.018 54.665   92.958  1.00 13.96 ? 191 THR C CA  1 
ATOM   6763  C C   . THR C 1 110 ? -21.173 55.560   93.357  1.00 15.11 ? 191 THR C C   1 
ATOM   6764  O O   . THR C 1 110 ? -21.310 56.676   92.849  1.00 15.29 ? 191 THR C O   1 
ATOM   6765  C CB  . THR C 1 110 ? -18.787 55.054   93.814  1.00 13.70 ? 191 THR C CB  1 
ATOM   6766  O OG1 . THR C 1 110 ? -18.261 56.314   93.370  1.00 14.31 ? 191 THR C OG1 1 
ATOM   6767  C CG2 . THR C 1 110 ? -17.713 53.980   93.722  1.00 12.46 ? 191 THR C CG2 1 
ATOM   6768  N N   . ILE C 1 111 ? -22.001 55.061   94.268  1.00 15.00 ? 192 ILE C N   1 
ATOM   6769  C CA  . ILE C 1 111 ? -23.153 55.806   94.763  1.00 14.21 ? 192 ILE C CA  1 
ATOM   6770  C C   . ILE C 1 111 ? -23.117 55.880   96.289  1.00 13.95 ? 192 ILE C C   1 
ATOM   6771  O O   . ILE C 1 111 ? -23.267 54.874   96.974  1.00 14.86 ? 192 ILE C O   1 
ATOM   6772  C CB  . ILE C 1 111 ? -24.464 55.130   94.329  1.00 12.92 ? 192 ILE C CB  1 
ATOM   6773  C CG1 . ILE C 1 111 ? -24.477 54.961   92.811  1.00 13.33 ? 192 ILE C CG1 1 
ATOM   6774  C CG2 . ILE C 1 111 ? -25.644 55.954   94.782  1.00 12.47 ? 192 ILE C CG2 1 
ATOM   6775  C CD1 . ILE C 1 111 ? -25.606 54.114   92.295  1.00 13.65 ? 192 ILE C CD1 1 
ATOM   6776  N N   . GLY C 1 112 ? -22.926 57.081   96.813  1.00 14.10 ? 193 GLY C N   1 
ATOM   6777  C CA  . GLY C 1 112 ? -22.865 57.265   98.250  1.00 13.31 ? 193 GLY C CA  1 
ATOM   6778  C C   . GLY C 1 112 ? -23.874 58.280   98.743  1.00 13.81 ? 193 GLY C C   1 
ATOM   6779  O O   . GLY C 1 112 ? -23.968 59.391   98.216  1.00 13.89 ? 193 GLY C O   1 
ATOM   6780  N N   . ILE C 1 113 ? -24.616 57.900   99.778  1.00 13.78 ? 194 ILE C N   1 
ATOM   6781  C CA  . ILE C 1 113 ? -25.656 58.745   100.345 1.00 13.38 ? 194 ILE C CA  1 
ATOM   6782  C C   . ILE C 1 113 ? -25.281 59.359   101.689 1.00 14.31 ? 194 ILE C C   1 
ATOM   6783  O O   . ILE C 1 113 ? -24.924 58.654   102.635 1.00 15.40 ? 194 ILE C O   1 
ATOM   6784  C CB  . ILE C 1 113 ? -26.947 57.929   100.531 1.00 12.94 ? 194 ILE C CB  1 
ATOM   6785  C CG1 . ILE C 1 113 ? -27.367 57.325   99.194  1.00 14.35 ? 194 ILE C CG1 1 
ATOM   6786  C CG2 . ILE C 1 113 ? -28.062 58.804   101.080 1.00 12.15 ? 194 ILE C CG2 1 
ATOM   6787  C CD1 . ILE C 1 113 ? -28.431 56.251   99.326  1.00 16.37 ? 194 ILE C CD1 1 
ATOM   6788  N N   . SER C 1 114 ? -25.368 60.679   101.778 1.00 13.26 ? 195 SER C N   1 
ATOM   6789  C CA  . SER C 1 114 ? -25.071 61.353   103.031 1.00 12.78 ? 195 SER C CA  1 
ATOM   6790  C C   . SER C 1 114 ? -26.113 62.439   103.273 1.00 13.42 ? 195 SER C C   1 
ATOM   6791  O O   . SER C 1 114 ? -27.076 62.573   102.510 1.00 14.34 ? 195 SER C O   1 
ATOM   6792  C CB  . SER C 1 114 ? -23.665 61.943   103.000 1.00 11.97 ? 195 SER C CB  1 
ATOM   6793  O OG  . SER C 1 114 ? -23.203 62.205   104.314 1.00 11.70 ? 195 SER C OG  1 
ATOM   6794  N N   . GLY C 1 115 ? -25.935 63.214   104.330 1.00 13.44 ? 196 GLY C N   1 
ATOM   6795  C CA  . GLY C 1 115 ? -26.909 64.250   104.624 1.00 14.30 ? 196 GLY C CA  1 
ATOM   6796  C C   . GLY C 1 115 ? -27.847 63.812   105.738 1.00 13.90 ? 196 GLY C C   1 
ATOM   6797  O O   . GLY C 1 115 ? -27.722 62.698   106.256 1.00 13.95 ? 196 GLY C O   1 
ATOM   6798  N N   . PRO C 1 116 ? -28.814 64.658   106.117 1.00 13.77 ? 197 PRO C N   1 
ATOM   6799  C CA  . PRO C 1 116 ? -29.767 64.348   107.184 1.00 12.54 ? 197 PRO C CA  1 
ATOM   6800  C C   . PRO C 1 116 ? -30.830 63.363   106.725 1.00 12.43 ? 197 PRO C C   1 
ATOM   6801  O O   . PRO C 1 116 ? -31.074 63.214   105.524 1.00 12.22 ? 197 PRO C O   1 
ATOM   6802  C CB  . PRO C 1 116 ? -30.344 65.717   107.520 1.00 13.15 ? 197 PRO C CB  1 
ATOM   6803  C CG  . PRO C 1 116 ? -30.456 66.342   106.159 1.00 12.24 ? 197 PRO C CG  1 
ATOM   6804  C CD  . PRO C 1 116 ? -29.146 65.945   105.476 1.00 13.89 ? 197 PRO C CD  1 
ATOM   6805  N N   . ASP C 1 117 ? -31.467 62.703   107.684 1.00 11.93 ? 198 ASP C N   1 
ATOM   6806  C CA  . ASP C 1 117 ? -32.499 61.724   107.372 1.00 12.31 ? 198 ASP C CA  1 
ATOM   6807  C C   . ASP C 1 117 ? -33.666 62.315   106.601 1.00 12.88 ? 198 ASP C C   1 
ATOM   6808  O O   . ASP C 1 117 ? -34.310 61.615   105.825 1.00 15.52 ? 198 ASP C O   1 
ATOM   6809  C CB  . ASP C 1 117 ? -33.032 61.074   108.651 1.00 13.09 ? 198 ASP C CB  1 
ATOM   6810  C CG  . ASP C 1 117 ? -31.984 60.263   109.373 1.00 13.93 ? 198 ASP C CG  1 
ATOM   6811  O OD1 . ASP C 1 117 ? -30.981 59.885   108.735 1.00 13.87 ? 198 ASP C OD1 1 
ATOM   6812  O OD2 . ASP C 1 117 ? -32.169 59.996   110.575 1.00 13.80 ? 198 ASP C OD2 1 
ATOM   6813  N N   . ASN C 1 118 ? -33.941 63.599   106.812 1.00 13.60 ? 199 ASN C N   1 
ATOM   6814  C CA  . ASN C 1 118 ? -35.058 64.257   106.139 1.00 13.75 ? 199 ASN C CA  1 
ATOM   6815  C C   . ASN C 1 118 ? -34.712 64.979   104.840 1.00 13.34 ? 199 ASN C C   1 
ATOM   6816  O O   . ASN C 1 118 ? -35.431 65.894   104.425 1.00 12.54 ? 199 ASN C O   1 
ATOM   6817  C CB  . ASN C 1 118 ? -35.771 65.241   107.088 1.00 14.28 ? 199 ASN C CB  1 
ATOM   6818  C CG  . ASN C 1 118 ? -34.877 66.391   107.548 1.00 15.65 ? 199 ASN C CG  1 
ATOM   6819  O OD1 . ASN C 1 118 ? -33.983 66.842   106.829 1.00 18.12 ? 199 ASN C OD1 1 
ATOM   6820  N ND2 . ASN C 1 118 ? -35.141 66.887   108.745 1.00 17.20 ? 199 ASN C ND2 1 
ATOM   6821  N N   . GLY C 1 119 ? -33.626 64.564   104.200 1.00 12.94 ? 200 GLY C N   1 
ATOM   6822  C CA  . GLY C 1 119 ? -33.230 65.191   102.949 1.00 12.75 ? 200 GLY C CA  1 
ATOM   6823  C C   . GLY C 1 119 ? -31.876 64.711   102.462 1.00 12.31 ? 200 GLY C C   1 
ATOM   6824  O O   . GLY C 1 119 ? -31.044 65.503   102.038 1.00 11.91 ? 200 GLY C O   1 
ATOM   6825  N N   . ALA C 1 120 ? -31.658 63.403   102.517 1.00 11.88 ? 201 ALA C N   1 
ATOM   6826  C CA  . ALA C 1 120 ? -30.396 62.819   102.098 1.00 12.44 ? 201 ALA C CA  1 
ATOM   6827  C C   . ALA C 1 120 ? -30.124 62.963   100.599 1.00 13.64 ? 201 ALA C C   1 
ATOM   6828  O O   . ALA C 1 120 ? -31.047 63.053   99.788  1.00 13.00 ? 201 ALA C O   1 
ATOM   6829  C CB  . ALA C 1 120 ? -30.359 61.352   102.496 1.00 11.79 ? 201 ALA C CB  1 
ATOM   6830  N N   . VAL C 1 121 ? -28.847 62.991   100.233 1.00 13.64 ? 202 VAL C N   1 
ATOM   6831  C CA  . VAL C 1 121 ? -28.493 63.094   98.831  1.00 13.05 ? 202 VAL C CA  1 
ATOM   6832  C C   . VAL C 1 121 ? -27.460 62.056   98.398  1.00 13.03 ? 202 VAL C C   1 
ATOM   6833  O O   . VAL C 1 121 ? -26.399 61.897   99.015  1.00 12.89 ? 202 VAL C O   1 
ATOM   6834  C CB  . VAL C 1 121 ? -27.996 64.517   98.467  1.00 11.14 ? 202 VAL C CB  1 
ATOM   6835  C CG1 . VAL C 1 121 ? -26.961 64.971   99.450  1.00 12.19 ? 202 VAL C CG1 1 
ATOM   6836  C CG2 . VAL C 1 121 ? -27.420 64.522   97.068  1.00 9.26  ? 202 VAL C CG2 1 
ATOM   6837  N N   . ALA C 1 122 ? -27.808 61.338   97.336  1.00 13.11 ? 203 ALA C N   1 
ATOM   6838  C CA  . ALA C 1 122 ? -26.944 60.326   96.756  1.00 13.06 ? 203 ALA C CA  1 
ATOM   6839  C C   . ALA C 1 122 ? -25.996 61.022   95.793  1.00 13.93 ? 203 ALA C C   1 
ATOM   6840  O O   . ALA C 1 122 ? -26.418 61.779   94.923  1.00 13.08 ? 203 ALA C O   1 
ATOM   6841  C CB  . ALA C 1 122 ? -27.770 59.294   96.009  1.00 12.53 ? 203 ALA C CB  1 
ATOM   6842  N N   . VAL C 1 123 ? -24.708 60.778   95.964  1.00 15.34 ? 204 VAL C N   1 
ATOM   6843  C CA  . VAL C 1 123 ? -23.725 61.370   95.085  1.00 16.09 ? 204 VAL C CA  1 
ATOM   6844  C C   . VAL C 1 123 ? -23.209 60.255   94.179  1.00 17.04 ? 204 VAL C C   1 
ATOM   6845  O O   . VAL C 1 123 ? -22.745 59.223   94.661  1.00 16.87 ? 204 VAL C O   1 
ATOM   6846  C CB  . VAL C 1 123 ? -22.567 61.981   95.898  1.00 15.79 ? 204 VAL C CB  1 
ATOM   6847  C CG1 . VAL C 1 123 ? -21.532 62.592   94.965  1.00 16.20 ? 204 VAL C CG1 1 
ATOM   6848  C CG2 . VAL C 1 123 ? -23.108 63.039   96.839  1.00 16.08 ? 204 VAL C CG2 1 
ATOM   6849  N N   . LEU C 1 124 ? -23.326 60.448   92.868  1.00 18.44 ? 205 LEU C N   1 
ATOM   6850  C CA  . LEU C 1 124 ? -22.854 59.449   91.916  1.00 18.61 ? 205 LEU C CA  1 
ATOM   6851  C C   . LEU C 1 124 ? -21.512 59.877   91.360  1.00 18.73 ? 205 LEU C C   1 
ATOM   6852  O O   . LEU C 1 124 ? -21.331 61.031   90.968  1.00 18.49 ? 205 LEU C O   1 
ATOM   6853  C CB  . LEU C 1 124 ? -23.827 59.278   90.741  1.00 18.78 ? 205 LEU C CB  1 
ATOM   6854  C CG  . LEU C 1 124 ? -25.315 59.006   90.980  1.00 20.47 ? 205 LEU C CG  1 
ATOM   6855  C CD1 . LEU C 1 124 ? -25.835 58.120   89.856  1.00 19.50 ? 205 LEU C CD1 1 
ATOM   6856  C CD2 . LEU C 1 124 ? -25.537 58.338   92.325  1.00 20.73 ? 205 LEU C CD2 1 
ATOM   6857  N N   . LYS C 1 125 ? -20.571 58.942   91.329  1.00 18.70 ? 206 LYS C N   1 
ATOM   6858  C CA  . LYS C 1 125 ? -19.249 59.223   90.792  1.00 19.26 ? 206 LYS C CA  1 
ATOM   6859  C C   . LYS C 1 125 ? -18.924 58.234   89.683  1.00 18.67 ? 206 LYS C C   1 
ATOM   6860  O O   . LYS C 1 125 ? -19.381 57.093   89.699  1.00 17.92 ? 206 LYS C O   1 
ATOM   6861  C CB  . LYS C 1 125 ? -18.171 59.133   91.888  1.00 17.98 ? 206 LYS C CB  1 
ATOM   6862  C CG  . LYS C 1 125 ? -18.202 60.274   92.893  1.00 18.99 ? 206 LYS C CG  1 
ATOM   6863  C CD  . LYS C 1 125 ? -17.156 60.110   93.991  1.00 18.11 ? 206 LYS C CD  1 
ATOM   6864  C CE  . LYS C 1 125 ? -17.303 61.202   95.036  1.00 17.68 ? 206 LYS C CE  1 
ATOM   6865  N NZ  . LYS C 1 125 ? -16.226 61.204   96.054  1.00 15.71 ? 206 LYS C NZ  1 
ATOM   6866  N N   . TYR C 1 126 ? -18.153 58.698   88.707  1.00 19.27 ? 207 TYR C N   1 
ATOM   6867  C CA  . TYR C 1 126 ? -17.713 57.857   87.604  1.00 19.88 ? 207 TYR C CA  1 
ATOM   6868  C C   . TYR C 1 126 ? -16.215 58.123   87.488  1.00 20.20 ? 207 TYR C C   1 
ATOM   6869  O O   . TYR C 1 126 ? -15.790 59.226   87.144  1.00 21.08 ? 207 TYR C O   1 
ATOM   6870  C CB  . TYR C 1 126 ? -18.443 58.227   86.312  1.00 19.48 ? 207 TYR C CB  1 
ATOM   6871  C CG  . TYR C 1 126 ? -18.302 57.189   85.221  1.00 19.94 ? 207 TYR C CG  1 
ATOM   6872  C CD1 . TYR C 1 126 ? -17.485 57.422   84.114  1.00 19.47 ? 207 TYR C CD1 1 
ATOM   6873  C CD2 . TYR C 1 126 ? -18.987 55.970   85.293  1.00 19.19 ? 207 TYR C CD2 1 
ATOM   6874  C CE1 . TYR C 1 126 ? -17.353 56.475   83.100  1.00 18.83 ? 207 TYR C CE1 1 
ATOM   6875  C CE2 . TYR C 1 126 ? -18.856 55.010   84.284  1.00 19.56 ? 207 TYR C CE2 1 
ATOM   6876  C CZ  . TYR C 1 126 ? -18.036 55.278   83.188  1.00 19.97 ? 207 TYR C CZ  1 
ATOM   6877  O OH  . TYR C 1 126 ? -17.901 54.373   82.166  1.00 20.53 ? 207 TYR C OH  1 
ATOM   6878  N N   . ASN C 1 127 ? -15.427 57.103   87.800  1.00 21.00 ? 208 ASN C N   1 
ATOM   6879  C CA  . ASN C 1 127 ? -13.973 57.189   87.795  1.00 21.05 ? 208 ASN C CA  1 
ATOM   6880  C C   . ASN C 1 127 ? -13.521 58.205   88.833  1.00 19.77 ? 208 ASN C C   1 
ATOM   6881  O O   . ASN C 1 127 ? -12.571 58.951   88.614  1.00 19.39 ? 208 ASN C O   1 
ATOM   6882  C CB  . ASN C 1 127 ? -13.433 57.593   86.426  1.00 23.74 ? 208 ASN C CB  1 
ATOM   6883  C CG  . ASN C 1 127 ? -12.027 57.072   86.192  1.00 26.86 ? 208 ASN C CG  1 
ATOM   6884  O OD1 . ASN C 1 127 ? -11.332 56.691   87.132  1.00 29.13 ? 208 ASN C OD1 1 
ATOM   6885  N ND2 . ASN C 1 127 ? -11.603 57.048   84.941  1.00 30.39 ? 208 ASN C ND2 1 
ATOM   6886  N N   . GLY C 1 128 ? -14.225 58.248   89.959  1.00 19.27 ? 209 GLY C N   1 
ATOM   6887  C CA  . GLY C 1 128 ? -13.858 59.166   91.019  1.00 19.15 ? 209 GLY C CA  1 
ATOM   6888  C C   . GLY C 1 128 ? -14.351 60.601   90.930  1.00 19.72 ? 209 GLY C C   1 
ATOM   6889  O O   . GLY C 1 128 ? -14.068 61.397   91.827  1.00 20.38 ? 209 GLY C O   1 
ATOM   6890  N N   . ILE C 1 129 ? -15.077 60.952   89.873  1.00 19.77 ? 210 ILE C N   1 
ATOM   6891  C CA  . ILE C 1 129 ? -15.570 62.320   89.744  1.00 20.40 ? 210 ILE C CA  1 
ATOM   6892  C C   . ILE C 1 129 ? -17.097 62.384   89.689  1.00 18.60 ? 210 ILE C C   1 
ATOM   6893  O O   . ILE C 1 129 ? -17.740 61.642   88.951  1.00 19.03 ? 210 ILE C O   1 
ATOM   6894  C CB  . ILE C 1 129 ? -14.951 63.012   88.502  1.00 22.92 ? 210 ILE C CB  1 
ATOM   6895  C CG1 . ILE C 1 129 ? -15.321 62.251   87.239  1.00 27.01 ? 210 ILE C CG1 1 
ATOM   6896  C CG2 . ILE C 1 129 ? -13.432 63.033   88.626  1.00 21.58 ? 210 ILE C CG2 1 
ATOM   6897  C CD1 . ILE C 1 129 ? -14.313 62.426   86.094  1.00 32.87 ? 210 ILE C CD1 1 
ATOM   6898  N N   . ILE C 1 130 ? -17.671 63.267   90.498  1.00 17.45 ? 211 ILE C N   1 
ATOM   6899  C CA  . ILE C 1 130 ? -19.118 63.429   90.563  1.00 16.76 ? 211 ILE C CA  1 
ATOM   6900  C C   . ILE C 1 130 ? -19.746 63.647   89.182  1.00 16.35 ? 211 ILE C C   1 
ATOM   6901  O O   . ILE C 1 130 ? -19.329 64.527   88.436  1.00 14.28 ? 211 ILE C O   1 
ATOM   6902  C CB  . ILE C 1 130 ? -19.502 64.608   91.497  1.00 16.31 ? 211 ILE C CB  1 
ATOM   6903  C CG1 . ILE C 1 130 ? -19.005 64.329   92.919  1.00 16.13 ? 211 ILE C CG1 1 
ATOM   6904  C CG2 . ILE C 1 130 ? -21.010 64.787   91.519  1.00 15.00 ? 211 ILE C CG2 1 
ATOM   6905  C CD1 . ILE C 1 130 ? -19.345 65.428   93.937  1.00 18.33 ? 211 ILE C CD1 1 
ATOM   6906  N N   . THR C 1 131 ? -20.754 62.833   88.860  1.00 17.08 ? 212 THR C N   1 
ATOM   6907  C CA  . THR C 1 131 ? -21.458 62.901   87.580  1.00 17.37 ? 212 THR C CA  1 
ATOM   6908  C C   . THR C 1 131 ? -22.957 63.176   87.697  1.00 18.08 ? 212 THR C C   1 
ATOM   6909  O O   . THR C 1 131 ? -23.626 63.442   86.697  1.00 19.69 ? 212 THR C O   1 
ATOM   6910  C CB  . THR C 1 131 ? -21.291 61.603   86.795  1.00 16.81 ? 212 THR C CB  1 
ATOM   6911  O OG1 . THR C 1 131 ? -21.502 60.497   87.678  1.00 17.35 ? 212 THR C OG1 1 
ATOM   6912  C CG2 . THR C 1 131 ? -19.900 61.527   86.176  1.00 13.66 ? 212 THR C CG2 1 
ATOM   6913  N N   . ASP C 1 132 ? -23.491 63.090   88.909  1.00 18.41 ? 213 ASP C N   1 
ATOM   6914  C CA  . ASP C 1 132 ? -24.903 63.360   89.129  1.00 18.39 ? 213 ASP C CA  1 
ATOM   6915  C C   . ASP C 1 132 ? -25.243 63.339   90.615  1.00 18.93 ? 213 ASP C C   1 
ATOM   6916  O O   . ASP C 1 132 ? -24.409 63.029   91.472  1.00 18.82 ? 213 ASP C O   1 
ATOM   6917  C CB  . ASP C 1 132 ? -25.776 62.345   88.386  1.00 19.14 ? 213 ASP C CB  1 
ATOM   6918  C CG  . ASP C 1 132 ? -27.151 62.913   88.009  1.00 21.84 ? 213 ASP C CG  1 
ATOM   6919  O OD1 . ASP C 1 132 ? -27.524 64.000   88.511  1.00 20.11 ? 213 ASP C OD1 1 
ATOM   6920  O OD2 . ASP C 1 132 ? -27.865 62.266   87.208  1.00 23.16 ? 213 ASP C OD2 1 
ATOM   6921  N N   . THR C 1 133 ? -26.492 63.650   90.911  1.00 18.31 ? 214 THR C N   1 
ATOM   6922  C CA  . THR C 1 133 ? -26.942 63.697   92.273  1.00 17.51 ? 214 THR C CA  1 
ATOM   6923  C C   . THR C 1 133 ? -28.422 63.363   92.303  1.00 17.20 ? 214 THR C C   1 
ATOM   6924  O O   . THR C 1 133 ? -29.161 63.719   91.389  1.00 16.16 ? 214 THR C O   1 
ATOM   6925  C CB  . THR C 1 133 ? -26.677 65.102   92.845  1.00 19.02 ? 214 THR C CB  1 
ATOM   6926  O OG1 . THR C 1 133 ? -25.494 65.074   93.655  1.00 19.75 ? 214 THR C OG1 1 
ATOM   6927  C CG2 . THR C 1 133 ? -27.850 65.587   93.653  1.00 21.85 ? 214 THR C CG2 1 
ATOM   6928  N N   . ILE C 1 134 ? -28.835 62.654   93.351  1.00 15.84 ? 215 ILE C N   1 
ATOM   6929  C CA  . ILE C 1 134 ? -30.225 62.265   93.543  1.00 15.01 ? 215 ILE C CA  1 
ATOM   6930  C C   . ILE C 1 134 ? -30.614 62.580   94.977  1.00 16.12 ? 215 ILE C C   1 
ATOM   6931  O O   . ILE C 1 134 ? -30.091 61.976   95.912  1.00 15.57 ? 215 ILE C O   1 
ATOM   6932  C CB  . ILE C 1 134 ? -30.444 60.746   93.326  1.00 15.91 ? 215 ILE C CB  1 
ATOM   6933  C CG1 . ILE C 1 134 ? -30.029 60.334   91.911  1.00 13.08 ? 215 ILE C CG1 1 
ATOM   6934  C CG2 . ILE C 1 134 ? -31.920 60.408   93.551  1.00 14.90 ? 215 ILE C CG2 1 
ATOM   6935  C CD1 . ILE C 1 134 ? -30.071 58.851   91.679  1.00 9.09  ? 215 ILE C CD1 1 
ATOM   6936  N N   . LYS C 1 135 ? -31.526 63.527   95.154  1.00 17.50 ? 216 LYS C N   1 
ATOM   6937  C CA  . LYS C 1 135 ? -31.976 63.903   96.487  1.00 19.23 ? 216 LYS C CA  1 
ATOM   6938  C C   . LYS C 1 135 ? -33.272 63.191   96.847  1.00 18.32 ? 216 LYS C C   1 
ATOM   6939  O O   . LYS C 1 135 ? -34.077 62.875   95.980  1.00 18.71 ? 216 LYS C O   1 
ATOM   6940  C CB  . LYS C 1 135 ? -32.172 65.417   96.571  1.00 22.67 ? 216 LYS C CB  1 
ATOM   6941  C CG  . LYS C 1 135 ? -32.744 66.027   95.295  1.00 29.57 ? 216 LYS C CG  1 
ATOM   6942  C CD  . LYS C 1 135 ? -33.131 67.501   95.496  1.00 32.54 ? 216 LYS C CD  1 
ATOM   6943  C CE  . LYS C 1 135 ? -33.636 68.136   94.199  1.00 32.44 ? 216 LYS C CE  1 
ATOM   6944  N NZ  . LYS C 1 135 ? -32.568 68.278   93.165  1.00 29.57 ? 216 LYS C NZ  1 
ATOM   6945  N N   . SER C 1 136 ? -33.457 62.944   98.139  1.00 17.84 ? 217 SER C N   1 
ATOM   6946  C CA  . SER C 1 136 ? -34.637 62.271   98.664  1.00 18.17 ? 217 SER C CA  1 
ATOM   6947  C C   . SER C 1 136 ? -35.952 62.892   98.177  1.00 18.14 ? 217 SER C C   1 
ATOM   6948  O O   . SER C 1 136 ? -36.118 64.108   98.217  1.00 17.38 ? 217 SER C O   1 
ATOM   6949  C CB  . SER C 1 136 ? -34.585 62.295   100.192 1.00 18.05 ? 217 SER C CB  1 
ATOM   6950  O OG  . SER C 1 136 ? -35.740 61.695   100.750 1.00 19.75 ? 217 SER C OG  1 
ATOM   6951  N N   . TRP C 1 137 ? -36.890 62.055   97.732  1.00 17.63 ? 218 TRP C N   1 
ATOM   6952  C CA  . TRP C 1 137 ? -38.177 62.550   97.242  1.00 17.63 ? 218 TRP C CA  1 
ATOM   6953  C C   . TRP C 1 137 ? -39.328 62.347   98.227  1.00 19.60 ? 218 TRP C C   1 
ATOM   6954  O O   . TRP C 1 137 ? -40.419 62.888   98.035  1.00 18.69 ? 218 TRP C O   1 
ATOM   6955  C CB  . TRP C 1 137 ? -38.517 61.911   95.892  1.00 15.09 ? 218 TRP C CB  1 
ATOM   6956  C CG  . TRP C 1 137 ? -38.687 60.442   95.942  1.00 15.01 ? 218 TRP C CG  1 
ATOM   6957  C CD1 . TRP C 1 137 ? -39.843 59.765   96.132  1.00 15.20 ? 218 TRP C CD1 1 
ATOM   6958  C CD2 . TRP C 1 137 ? -37.659 59.456   95.793  1.00 15.20 ? 218 TRP C CD2 1 
ATOM   6959  N NE1 . TRP C 1 137 ? -39.610 58.412   96.107  1.00 16.48 ? 218 TRP C NE1 1 
ATOM   6960  C CE2 . TRP C 1 137 ? -38.274 58.194   95.904  1.00 15.03 ? 218 TRP C CE2 1 
ATOM   6961  C CE3 . TRP C 1 137 ? -36.274 59.518   95.580  1.00 14.05 ? 218 TRP C CE3 1 
ATOM   6962  C CZ2 . TRP C 1 137 ? -37.555 56.994   95.807  1.00 15.32 ? 218 TRP C CZ2 1 
ATOM   6963  C CZ3 . TRP C 1 137 ? -35.558 58.330   95.483  1.00 14.46 ? 218 TRP C CZ3 1 
ATOM   6964  C CH2 . TRP C 1 137 ? -36.201 57.083   95.598  1.00 15.06 ? 218 TRP C CH2 1 
ATOM   6965  N N   . ARG C 1 138 ? -39.088 61.563   99.273  1.00 20.84 ? 219 ARG C N   1 
ATOM   6966  C CA  . ARG C 1 138 ? -40.096 61.331   100.308 1.00 22.65 ? 219 ARG C CA  1 
ATOM   6967  C C   . ARG C 1 138 ? -39.594 61.878   101.646 1.00 22.06 ? 219 ARG C C   1 
ATOM   6968  O O   . ARG C 1 138 ? -40.301 61.814   102.651 1.00 22.35 ? 219 ARG C O   1 
ATOM   6969  C CB  . ARG C 1 138 ? -40.416 59.832   100.458 1.00 25.81 ? 219 ARG C CB  1 
ATOM   6970  C CG  . ARG C 1 138 ? -41.351 59.276   99.393  1.00 30.16 ? 219 ARG C CG  1 
ATOM   6971  C CD  . ARG C 1 138 ? -42.734 59.919   99.483  1.00 34.79 ? 219 ARG C CD  1 
ATOM   6972  N NE  . ARG C 1 138 ? -43.524 59.628   98.290  1.00 42.28 ? 219 ARG C NE  1 
ATOM   6973  C CZ  . ARG C 1 138 ? -44.666 60.236   97.976  1.00 46.60 ? 219 ARG C CZ  1 
ATOM   6974  N NH1 . ARG C 1 138 ? -45.171 61.174   98.776  1.00 48.93 ? 219 ARG C NH1 1 
ATOM   6975  N NH2 . ARG C 1 138 ? -45.286 59.931   96.840  1.00 47.59 ? 219 ARG C NH2 1 
ATOM   6976  N N   . ASN C 1 139 ? -38.367 62.402   101.658 1.00 20.79 ? 220 ASN C N   1 
ATOM   6977  C CA  . ASN C 1 139 ? -37.778 62.977   102.871 1.00 19.13 ? 220 ASN C CA  1 
ATOM   6978  C C   . ASN C 1 139 ? -37.649 62.025   104.066 1.00 18.40 ? 220 ASN C C   1 
ATOM   6979  O O   . ASN C 1 139 ? -37.647 62.465   105.210 1.00 18.44 ? 220 ASN C O   1 
ATOM   6980  C CB  . ASN C 1 139 ? -38.582 64.203   103.328 1.00 19.56 ? 220 ASN C CB  1 
ATOM   6981  C CG  . ASN C 1 139 ? -38.424 65.403   102.405 1.00 20.48 ? 220 ASN C CG  1 
ATOM   6982  O OD1 . ASN C 1 139 ? -37.400 65.578   101.746 1.00 20.43 ? 220 ASN C OD1 1 
ATOM   6983  N ND2 . ASN C 1 139 ? -39.439 66.257   102.382 1.00 23.01 ? 220 ASN C ND2 1 
ATOM   6984  N N   . ASN C 1 140 ? -37.527 60.729   103.825 1.00 19.04 ? 221 ASN C N   1 
ATOM   6985  C CA  . ASN C 1 140 ? -37.410 59.798   104.941 1.00 18.03 ? 221 ASN C CA  1 
ATOM   6986  C C   . ASN C 1 140 ? -36.339 58.736   104.712 1.00 17.76 ? 221 ASN C C   1 
ATOM   6987  O O   . ASN C 1 140 ? -36.628 57.614   104.299 1.00 17.04 ? 221 ASN C O   1 
ATOM   6988  C CB  . ASN C 1 140 ? -38.766 59.139   105.208 1.00 18.04 ? 221 ASN C CB  1 
ATOM   6989  C CG  . ASN C 1 140 ? -38.765 58.290   106.458 1.00 17.71 ? 221 ASN C CG  1 
ATOM   6990  O OD1 . ASN C 1 140 ? -37.849 58.370   107.274 1.00 17.70 ? 221 ASN C OD1 1 
ATOM   6991  N ND2 . ASN C 1 140 ? -39.804 57.475   106.622 1.00 18.34 ? 221 ASN C ND2 1 
ATOM   6992  N N   . ILE C 1 141 ? -35.098 59.120   104.990 1.00 16.87 ? 222 ILE C N   1 
ATOM   6993  C CA  . ILE C 1 141 ? -33.928 58.259   104.845 1.00 15.74 ? 222 ILE C CA  1 
ATOM   6994  C C   . ILE C 1 141 ? -33.744 57.630   103.465 1.00 16.20 ? 222 ILE C C   1 
ATOM   6995  O O   . ILE C 1 141 ? -33.954 56.431   103.281 1.00 16.17 ? 222 ILE C O   1 
ATOM   6996  C CB  . ILE C 1 141 ? -33.918 57.132   105.909 1.00 15.00 ? 222 ILE C CB  1 
ATOM   6997  C CG1 . ILE C 1 141 ? -34.136 57.727   107.314 1.00 16.77 ? 222 ILE C CG1 1 
ATOM   6998  C CG2 . ILE C 1 141 ? -32.590 56.393   105.854 1.00 11.39 ? 222 ILE C CG2 1 
ATOM   6999  C CD1 . ILE C 1 141 ? -34.242 56.688   108.451 1.00 16.74 ? 222 ILE C CD1 1 
ATOM   7000  N N   . LEU C 1 142 ? -33.351 58.441   102.490 1.00 15.66 ? 223 LEU C N   1 
ATOM   7001  C CA  . LEU C 1 142 ? -33.109 57.924   101.154 1.00 15.26 ? 223 LEU C CA  1 
ATOM   7002  C C   . LEU C 1 142 ? -32.005 56.879   101.295 1.00 15.36 ? 223 LEU C C   1 
ATOM   7003  O O   . LEU C 1 142 ? -30.936 57.180   101.819 1.00 16.63 ? 223 LEU C O   1 
ATOM   7004  C CB  . LEU C 1 142 ? -32.647 59.041   100.235 1.00 14.27 ? 223 LEU C CB  1 
ATOM   7005  C CG  . LEU C 1 142 ? -32.240 58.532   98.858  1.00 14.23 ? 223 LEU C CG  1 
ATOM   7006  C CD1 . LEU C 1 142 ? -33.453 57.952   98.159  1.00 15.55 ? 223 LEU C CD1 1 
ATOM   7007  C CD2 . LEU C 1 142 ? -31.635 59.666   98.052  1.00 15.99 ? 223 LEU C CD2 1 
ATOM   7008  N N   . ARG C 1 143 ? -32.257 55.660   100.828 1.00 15.18 ? 224 ARG C N   1 
ATOM   7009  C CA  . ARG C 1 143 ? -31.279 54.578   100.959 1.00 15.37 ? 224 ARG C CA  1 
ATOM   7010  C C   . ARG C 1 143 ? -31.178 53.690   99.722  1.00 16.50 ? 224 ARG C C   1 
ATOM   7011  O O   . ARG C 1 143 ? -31.995 53.810   98.798  1.00 17.51 ? 224 ARG C O   1 
ATOM   7012  C CB  . ARG C 1 143 ? -31.616 53.729   102.196 1.00 15.93 ? 224 ARG C CB  1 
ATOM   7013  C CG  . ARG C 1 143 ? -33.087 53.300   102.308 1.00 15.87 ? 224 ARG C CG  1 
ATOM   7014  C CD  . ARG C 1 143 ? -33.406 52.798   103.723 1.00 15.25 ? 224 ARG C CD  1 
ATOM   7015  N NE  . ARG C 1 143 ? -34.810 52.440   103.908 1.00 14.46 ? 224 ARG C NE  1 
ATOM   7016  C CZ  . ARG C 1 143 ? -35.822 53.300   103.860 1.00 13.09 ? 224 ARG C CZ  1 
ATOM   7017  N NH1 . ARG C 1 143 ? -37.065 52.884   104.042 1.00 13.95 ? 224 ARG C NH1 1 
ATOM   7018  N NH2 . ARG C 1 143 ? -35.592 54.581   103.628 1.00 16.92 ? 224 ARG C NH2 1 
ATOM   7019  N N   . THR C 1 144 ? -30.182 52.798   99.702  1.00 15.81 ? 225 THR C N   1 
ATOM   7020  C CA  . THR C 1 144 ? -29.986 51.927   98.551  1.00 15.84 ? 225 THR C CA  1 
ATOM   7021  C C   . THR C 1 144 ? -29.404 50.535   98.848  1.00 16.97 ? 225 THR C C   1 
ATOM   7022  O O   . THR C 1 144 ? -29.274 50.128   100.008 1.00 18.02 ? 225 THR C O   1 
ATOM   7023  C CB  . THR C 1 144 ? -29.115 52.650   97.473  1.00 16.03 ? 225 THR C CB  1 
ATOM   7024  O OG1 . THR C 1 144 ? -29.206 51.947   96.229  1.00 16.40 ? 225 THR C OG1 1 
ATOM   7025  C CG2 . THR C 1 144 ? -27.660 52.727   97.903  1.00 14.65 ? 225 THR C CG2 1 
ATOM   7026  N N   . GLN C 1 145 ? -29.047 49.830   97.773  1.00 17.05 ? 226 GLN C N   1 
ATOM   7027  C CA  . GLN C 1 145 ? -28.521 48.460   97.791  1.00 16.69 ? 226 GLN C CA  1 
ATOM   7028  C C   . GLN C 1 145 ? -27.624 47.896   98.895  1.00 16.10 ? 226 GLN C C   1 
ATOM   7029  O O   . GLN C 1 145 ? -27.955 46.880   99.492  1.00 15.52 ? 226 GLN C O   1 
ATOM   7030  C CB  . GLN C 1 145 ? -27.841 48.167   96.457  1.00 16.19 ? 226 GLN C CB  1 
ATOM   7031  C CG  . GLN C 1 145 ? -28.772 48.198   95.270  1.00 16.13 ? 226 GLN C CG  1 
ATOM   7032  C CD  . GLN C 1 145 ? -28.124 47.622   94.025  1.00 16.90 ? 226 GLN C CD  1 
ATOM   7033  O OE1 . GLN C 1 145 ? -27.910 46.410   93.929  1.00 17.16 ? 226 GLN C OE1 1 
ATOM   7034  N NE2 . GLN C 1 145 ? -27.800 48.488   93.069  1.00 15.58 ? 226 GLN C NE2 1 
ATOM   7035  N N   . GLU C 1 146 ? -26.487 48.530   99.149  1.00 16.54 ? 227 GLU C N   1 
ATOM   7036  C CA  . GLU C 1 146 ? -25.541 48.030   100.140 1.00 17.83 ? 227 GLU C CA  1 
ATOM   7037  C C   . GLU C 1 146 ? -24.909 46.778   99.513  1.00 17.81 ? 227 GLU C C   1 
ATOM   7038  O O   . GLU C 1 146 ? -24.520 45.834   100.198 1.00 17.40 ? 227 GLU C O   1 
ATOM   7039  C CB  . GLU C 1 146 ? -26.237 47.689   101.472 1.00 19.23 ? 227 GLU C CB  1 
ATOM   7040  C CG  . GLU C 1 146 ? -27.231 48.743   101.964 1.00 22.90 ? 227 GLU C CG  1 
ATOM   7041  C CD  . GLU C 1 146 ? -26.594 50.045   102.439 1.00 24.38 ? 227 GLU C CD  1 
ATOM   7042  O OE1 . GLU C 1 146 ? -25.536 50.446   101.904 1.00 25.51 ? 227 GLU C OE1 1 
ATOM   7043  O OE2 . GLU C 1 146 ? -27.172 50.683   103.348 1.00 26.59 ? 227 GLU C OE2 1 
ATOM   7044  N N   . SER C 1 147 ? -24.849 46.794   98.184  1.00 18.39 ? 228 SER C N   1 
ATOM   7045  C CA  . SER C 1 147 ? -24.244 45.742   97.365  1.00 18.55 ? 228 SER C CA  1 
ATOM   7046  C C   . SER C 1 147 ? -24.102 46.275   95.922  1.00 19.16 ? 228 SER C C   1 
ATOM   7047  O O   . SER C 1 147 ? -24.584 47.368   95.605  1.00 19.08 ? 228 SER C O   1 
ATOM   7048  C CB  . SER C 1 147 ? -25.055 44.432   97.415  1.00 18.24 ? 228 SER C CB  1 
ATOM   7049  O OG  . SER C 1 147 ? -26.331 44.532   96.818  1.00 20.92 ? 228 SER C OG  1 
ATOM   7050  N N   . GLU C 1 148 ? -23.443 45.518   95.052  1.00 18.09 ? 229 GLU C N   1 
ATOM   7051  C CA  . GLU C 1 148 ? -23.208 45.969   93.688  1.00 17.19 ? 229 GLU C CA  1 
ATOM   7052  C C   . GLU C 1 148 ? -24.416 46.197   92.766  1.00 18.22 ? 229 GLU C C   1 
ATOM   7053  O O   . GLU C 1 148 ? -25.399 45.446   92.784  1.00 17.88 ? 229 GLU C O   1 
ATOM   7054  C CB  . GLU C 1 148 ? -22.249 45.010   92.990  1.00 14.41 ? 229 GLU C CB  1 
ATOM   7055  C CG  . GLU C 1 148 ? -22.924 43.780   92.442  1.00 15.95 ? 229 GLU C CG  1 
ATOM   7056  C CD  . GLU C 1 148 ? -21.992 42.918   91.610  1.00 20.05 ? 229 GLU C CD  1 
ATOM   7057  O OE1 . GLU C 1 148 ? -22.459 41.879   91.094  1.00 21.65 ? 229 GLU C OE1 1 
ATOM   7058  O OE2 . GLU C 1 148 ? -20.796 43.274   91.467  1.00 22.06 ? 229 GLU C OE2 1 
ATOM   7059  N N   . CYS C 1 149 ? -24.318 47.248   91.951  1.00 17.77 ? 230 CYS C N   1 
ATOM   7060  C CA  . CYS C 1 149 ? -25.351 47.557   90.977  1.00 17.65 ? 230 CYS C CA  1 
ATOM   7061  C C   . CYS C 1 149 ? -25.063 46.635   89.799  1.00 17.48 ? 230 CYS C C   1 
ATOM   7062  O O   . CYS C 1 149 ? -24.061 45.924   89.802  1.00 16.87 ? 230 CYS C O   1 
ATOM   7063  C CB  . CYS C 1 149 ? -25.308 49.038   90.546  1.00 18.02 ? 230 CYS C CB  1 
ATOM   7064  S SG  . CYS C 1 149 ? -23.723 49.964   90.639  1.00 18.47 ? 230 CYS C SG  1 
ATOM   7065  N N   . ALA C 1 150 ? -25.931 46.625   88.797  1.00 17.02 ? 231 ALA C N   1 
ATOM   7066  C CA  . ALA C 1 150 ? -25.718 45.747   87.656  1.00 16.66 ? 231 ALA C CA  1 
ATOM   7067  C C   . ALA C 1 150 ? -25.541 46.548   86.384  1.00 16.91 ? 231 ALA C C   1 
ATOM   7068  O O   . ALA C 1 150 ? -26.323 47.454   86.115  1.00 16.07 ? 231 ALA C O   1 
ATOM   7069  C CB  . ALA C 1 150 ? -26.892 44.790   87.514  1.00 15.71 ? 231 ALA C CB  1 
ATOM   7070  N N   . CYS C 1 151 ? -24.514 46.225   85.601  1.00 18.43 ? 232 CYS C N   1 
ATOM   7071  C CA  . CYS C 1 151 ? -24.281 46.955   84.354  1.00 21.05 ? 232 CYS C CA  1 
ATOM   7072  C C   . CYS C 1 151 ? -24.455 46.045   83.142  1.00 21.63 ? 232 CYS C C   1 
ATOM   7073  O O   . CYS C 1 151 ? -23.936 44.926   83.108  1.00 22.55 ? 232 CYS C O   1 
ATOM   7074  C CB  . CYS C 1 151 ? -22.877 47.582   84.329  1.00 20.95 ? 232 CYS C CB  1 
ATOM   7075  S SG  . CYS C 1 151 ? -22.445 48.670   85.745  1.00 26.73 ? 232 CYS C SG  1 
ATOM   7076  N N   . VAL C 1 152 ? -25.197 46.541   82.153  1.00 21.83 ? 233 VAL C N   1 
ATOM   7077  C CA  . VAL C 1 152 ? -25.464 45.822   80.915  1.00 20.91 ? 233 VAL C CA  1 
ATOM   7078  C C   . VAL C 1 152 ? -25.287 46.757   79.719  1.00 22.12 ? 233 VAL C C   1 
ATOM   7079  O O   . VAL C 1 152 ? -25.787 47.883   79.723  1.00 21.58 ? 233 VAL C O   1 
ATOM   7080  C CB  . VAL C 1 152 ? -26.920 45.281   80.884  1.00 20.39 ? 233 VAL C CB  1 
ATOM   7081  C CG1 . VAL C 1 152 ? -27.262 44.776   79.483  1.00 20.39 ? 233 VAL C CG1 1 
ATOM   7082  C CG2 . VAL C 1 152 ? -27.082 44.162   81.890  1.00 19.68 ? 233 VAL C CG2 1 
ATOM   7083  N N   . ASN C 1 153 ? -24.567 46.294   78.703  1.00 23.15 ? 234 ASN C N   1 
ATOM   7084  C CA  . ASN C 1 153 ? -24.372 47.076   77.477  1.00 25.08 ? 234 ASN C CA  1 
ATOM   7085  C C   . ASN C 1 153 ? -24.130 48.570   77.723  1.00 24.15 ? 234 ASN C C   1 
ATOM   7086  O O   . ASN C 1 153 ? -24.766 49.418   77.096  1.00 23.85 ? 234 ASN C O   1 
ATOM   7087  C CB  . ASN C 1 153 ? -25.600 46.887   76.558  1.00 27.45 ? 234 ASN C CB  1 
ATOM   7088  C CG  . ASN C 1 153 ? -25.415 47.507   75.170  1.00 30.26 ? 234 ASN C CG  1 
ATOM   7089  O OD1 . ASN C 1 153 ? -24.347 47.378   74.563  1.00 30.08 ? 234 ASN C OD1 1 
ATOM   7090  N ND2 . ASN C 1 153 ? -26.469 48.167   74.655  1.00 30.71 ? 234 ASN C ND2 1 
ATOM   7091  N N   . GLY C 1 154 ? -23.220 48.885   78.638  1.00 22.34 ? 235 GLY C N   1 
ATOM   7092  C CA  . GLY C 1 154 ? -22.921 50.273   78.918  1.00 21.07 ? 235 GLY C CA  1 
ATOM   7093  C C   . GLY C 1 154 ? -23.824 50.966   79.918  1.00 20.90 ? 235 GLY C C   1 
ATOM   7094  O O   . GLY C 1 154 ? -23.513 52.072   80.355  1.00 21.72 ? 235 GLY C O   1 
ATOM   7095  N N   . SER C 1 155 ? -24.944 50.352   80.283  1.00 20.53 ? 236 SER C N   1 
ATOM   7096  C CA  . SER C 1 155 ? -25.845 50.972   81.258  1.00 20.45 ? 236 SER C CA  1 
ATOM   7097  C C   . SER C 1 155 ? -25.790 50.244   82.606  1.00 20.89 ? 236 SER C C   1 
ATOM   7098  O O   . SER C 1 155 ? -25.709 49.014   82.644  1.00 21.05 ? 236 SER C O   1 
ATOM   7099  C CB  . SER C 1 155 ? -27.286 50.962   80.732  1.00 20.00 ? 236 SER C CB  1 
ATOM   7100  O OG  . SER C 1 155 ? -27.431 51.717   79.541  1.00 21.85 ? 236 SER C OG  1 
ATOM   7101  N N   . CYS C 1 156 ? -25.815 50.994   83.708  1.00 20.31 ? 237 CYS C N   1 
ATOM   7102  C CA  . CYS C 1 156 ? -25.796 50.386   85.042  1.00 20.23 ? 237 CYS C CA  1 
ATOM   7103  C C   . CYS C 1 156 ? -27.112 50.739   85.727  1.00 19.30 ? 237 CYS C C   1 
ATOM   7104  O O   . CYS C 1 156 ? -27.624 51.839   85.551  1.00 20.49 ? 237 CYS C O   1 
ATOM   7105  C CB  . CYS C 1 156 ? -24.614 50.900   85.874  1.00 21.59 ? 237 CYS C CB  1 
ATOM   7106  S SG  . CYS C 1 156 ? -22.940 50.577   85.202  1.00 24.82 ? 237 CYS C SG  1 
ATOM   7107  N N   . PHE C 1 157 ? -27.666 49.811   86.502  1.00 18.27 ? 238 PHE C N   1 
ATOM   7108  C CA  . PHE C 1 157 ? -28.941 50.056   87.162  1.00 16.63 ? 238 PHE C CA  1 
ATOM   7109  C C   . PHE C 1 157 ? -28.882 49.772   88.643  1.00 16.50 ? 238 PHE C C   1 
ATOM   7110  O O   . PHE C 1 157 ? -28.110 48.930   89.083  1.00 16.98 ? 238 PHE C O   1 
ATOM   7111  C CB  . PHE C 1 157 ? -30.035 49.183   86.550  1.00 16.79 ? 238 PHE C CB  1 
ATOM   7112  C CG  . PHE C 1 157 ? -30.051 49.182   85.049  1.00 15.70 ? 238 PHE C CG  1 
ATOM   7113  C CD1 . PHE C 1 157 ? -29.012 48.600   84.333  1.00 14.91 ? 238 PHE C CD1 1 
ATOM   7114  C CD2 . PHE C 1 157 ? -31.107 49.752   84.351  1.00 14.32 ? 238 PHE C CD2 1 
ATOM   7115  C CE1 . PHE C 1 157 ? -29.021 48.582   82.944  1.00 15.17 ? 238 PHE C CE1 1 
ATOM   7116  C CE2 . PHE C 1 157 ? -31.125 49.739   82.958  1.00 16.38 ? 238 PHE C CE2 1 
ATOM   7117  C CZ  . PHE C 1 157 ? -30.079 49.151   82.252  1.00 15.01 ? 238 PHE C CZ  1 
ATOM   7118  N N   . THR C 1 158 ? -29.709 50.480   89.407  1.00 16.36 ? 239 THR C N   1 
ATOM   7119  C CA  . THR C 1 158 ? -29.771 50.303   90.851  1.00 16.17 ? 239 THR C CA  1 
ATOM   7120  C C   . THR C 1 158 ? -31.172 50.602   91.378  1.00 16.87 ? 239 THR C C   1 
ATOM   7121  O O   . THR C 1 158 ? -32.038 51.083   90.648  1.00 18.46 ? 239 THR C O   1 
ATOM   7122  C CB  . THR C 1 158 ? -28.767 51.218   91.571  1.00 16.68 ? 239 THR C CB  1 
ATOM   7123  O OG1 . THR C 1 158 ? -28.824 50.964   92.979  1.00 16.79 ? 239 THR C OG1 1 
ATOM   7124  C CG2 . THR C 1 158 ? -29.099 52.693   91.317  1.00 16.40 ? 239 THR C CG2 1 
ATOM   7125  N N   . VAL C 1 159 ? -31.390 50.314   92.655  1.00 16.82 ? 240 VAL C N   1 
ATOM   7126  C CA  . VAL C 1 159 ? -32.686 50.541   93.285  1.00 15.49 ? 240 VAL C CA  1 
ATOM   7127  C C   . VAL C 1 159 ? -32.509 51.351   94.560  1.00 16.16 ? 240 VAL C C   1 
ATOM   7128  O O   . VAL C 1 159 ? -31.558 51.136   95.314  1.00 14.28 ? 240 VAL C O   1 
ATOM   7129  C CB  . VAL C 1 159 ? -33.356 49.209   93.670  1.00 14.56 ? 240 VAL C CB  1 
ATOM   7130  C CG1 . VAL C 1 159 ? -34.732 49.470   94.245  1.00 11.38 ? 240 VAL C CG1 1 
ATOM   7131  C CG2 . VAL C 1 159 ? -33.420 48.297   92.469  1.00 13.10 ? 240 VAL C CG2 1 
ATOM   7132  N N   . MET C 1 160 ? -33.424 52.283   94.795  1.00 16.34 ? 241 MET C N   1 
ATOM   7133  C CA  . MET C 1 160 ? -33.365 53.099   95.998  1.00 17.93 ? 241 MET C CA  1 
ATOM   7134  C C   . MET C 1 160 ? -34.743 53.146   96.650  1.00 16.98 ? 241 MET C C   1 
ATOM   7135  O O   . MET C 1 160 ? -35.766 53.026   95.975  1.00 16.00 ? 241 MET C O   1 
ATOM   7136  C CB  . MET C 1 160 ? -32.893 54.526   95.682  1.00 18.93 ? 241 MET C CB  1 
ATOM   7137  C CG  . MET C 1 160 ? -31.542 54.638   94.978  1.00 21.25 ? 241 MET C CG  1 
ATOM   7138  S SD  . MET C 1 160 ? -30.898 56.342   95.063  1.00 22.58 ? 241 MET C SD  1 
ATOM   7139  C CE  . MET C 1 160 ? -29.198 56.020   95.545  1.00 25.67 ? 241 MET C CE  1 
ATOM   7140  N N   . THR C 1 161 ? -34.756 53.310   97.967  1.00 15.56 ? 242 THR C N   1 
ATOM   7141  C CA  . THR C 1 161 ? -35.995 53.383   98.723  1.00 16.28 ? 242 THR C CA  1 
ATOM   7142  C C   . THR C 1 161 ? -36.011 54.685   99.504  1.00 16.83 ? 242 THR C C   1 
ATOM   7143  O O   . THR C 1 161 ? -34.967 55.162   99.965  1.00 17.64 ? 242 THR C O   1 
ATOM   7144  C CB  . THR C 1 161 ? -36.114 52.208   99.725  1.00 16.74 ? 242 THR C CB  1 
ATOM   7145  O OG1 . THR C 1 161 ? -36.206 50.981   98.999  1.00 16.26 ? 242 THR C OG1 1 
ATOM   7146  C CG2 . THR C 1 161 ? -37.341 52.360   100.616 1.00 15.76 ? 242 THR C CG2 1 
ATOM   7147  N N   . ASP C 1 162 ? -37.198 55.264   99.634  1.00 16.09 ? 243 ASP C N   1 
ATOM   7148  C CA  . ASP C 1 162 ? -37.374 56.495   100.382 1.00 15.53 ? 243 ASP C CA  1 
ATOM   7149  C C   . ASP C 1 162 ? -38.726 56.309   101.072 1.00 16.16 ? 243 ASP C C   1 
ATOM   7150  O O   . ASP C 1 162 ? -39.696 55.879   100.450 1.00 17.72 ? 243 ASP C O   1 
ATOM   7151  C CB  . ASP C 1 162 ? -37.371 57.696   99.425  1.00 14.77 ? 243 ASP C CB  1 
ATOM   7152  C CG  . ASP C 1 162 ? -37.136 59.031   100.145 1.00 17.47 ? 243 ASP C CG  1 
ATOM   7153  O OD1 . ASP C 1 162 ? -37.011 60.068   99.442  1.00 15.08 ? 243 ASP C OD1 1 
ATOM   7154  O OD2 . ASP C 1 162 ? -37.078 59.043   101.405 1.00 13.61 ? 243 ASP C OD2 1 
ATOM   7155  N N   . GLY C 1 163 ? -38.782 56.596   102.364 1.00 17.35 ? 244 GLY C N   1 
ATOM   7156  C CA  . GLY C 1 163 ? -40.017 56.418   103.105 1.00 17.44 ? 244 GLY C CA  1 
ATOM   7157  C C   . GLY C 1 163 ? -39.780 55.533   104.320 1.00 17.68 ? 244 GLY C C   1 
ATOM   7158  O O   . GLY C 1 163 ? -38.634 55.315   104.700 1.00 17.84 ? 244 GLY C O   1 
ATOM   7159  N N   . PRO C 1 164 ? -40.840 54.994   104.946 1.00 17.69 ? 245 PRO C N   1 
ATOM   7160  C CA  . PRO C 1 164 ? -40.708 54.136   106.126 1.00 17.97 ? 245 PRO C CA  1 
ATOM   7161  C C   . PRO C 1 164 ? -40.119 52.729   105.906 1.00 19.33 ? 245 PRO C C   1 
ATOM   7162  O O   . PRO C 1 164 ? -40.390 52.058   104.901 1.00 17.89 ? 245 PRO C O   1 
ATOM   7163  C CB  . PRO C 1 164 ? -42.142 54.058   106.655 1.00 17.57 ? 245 PRO C CB  1 
ATOM   7164  C CG  . PRO C 1 164 ? -42.788 55.287   106.133 1.00 16.56 ? 245 PRO C CG  1 
ATOM   7165  C CD  . PRO C 1 164 ? -42.252 55.349   104.734 1.00 18.00 ? 245 PRO C CD  1 
ATOM   7166  N N   . SER C 1 165 ? -39.304 52.295   106.863 1.00 19.33 ? 246 SER C N   1 
ATOM   7167  C CA  . SER C 1 165 ? -38.716 50.966   106.824 1.00 21.08 ? 246 SER C CA  1 
ATOM   7168  C C   . SER C 1 165 ? -39.761 50.148   107.564 1.00 21.80 ? 246 SER C C   1 
ATOM   7169  O O   . SER C 1 165 ? -39.652 48.927   107.708 1.00 21.95 ? 246 SER C O   1 
ATOM   7170  C CB  . SER C 1 165 ? -37.399 50.945   107.591 1.00 21.01 ? 246 SER C CB  1 
ATOM   7171  O OG  . SER C 1 165 ? -37.605 51.218   108.968 1.00 20.86 ? 246 SER C OG  1 
ATOM   7172  N N   . ASN C 1 166 ? -40.782 50.889   107.994 1.00 23.17 ? 247 ASN C N   1 
ATOM   7173  C CA  . ASN C 1 166 ? -41.940 50.438   108.761 1.00 23.69 ? 247 ASN C CA  1 
ATOM   7174  C C   . ASN C 1 166 ? -43.115 49.894   107.968 1.00 23.28 ? 247 ASN C C   1 
ATOM   7175  O O   . ASN C 1 166 ? -43.705 48.895   108.352 1.00 24.58 ? 247 ASN C O   1 
ATOM   7176  C CB  . ASN C 1 166 ? -42.470 51.603   109.594 1.00 23.55 ? 247 ASN C CB  1 
ATOM   7177  C CG  . ASN C 1 166 ? -42.282 51.382   111.041 1.00 24.71 ? 247 ASN C CG  1 
ATOM   7178  O OD1 . ASN C 1 166 ? -42.222 50.248   111.481 1.00 28.82 ? 247 ASN C OD1 1 
ATOM   7179  N ND2 . ASN C 1 166 ? -42.196 52.454   111.808 1.00 27.17 ? 247 ASN C ND2 1 
ATOM   7180  N N   . GLY C 1 167 ? -43.497 50.596   106.907 1.00 23.18 ? 248 GLY C N   1 
ATOM   7181  C CA  . GLY C 1 167 ? -44.619 50.163   106.092 1.00 21.52 ? 248 GLY C CA  1 
ATOM   7182  C C   . GLY C 1 167 ? -44.424 50.595   104.654 1.00 20.75 ? 248 GLY C C   1 
ATOM   7183  O O   . GLY C 1 167 ? -43.293 50.796   104.221 1.00 19.03 ? 248 GLY C O   1 
ATOM   7184  N N   . GLN C 1 168 ? -45.525 50.738   103.919 1.00 20.69 ? 249 GLN C N   1 
ATOM   7185  C CA  . GLN C 1 168 ? -45.479 51.159   102.524 1.00 19.65 ? 249 GLN C CA  1 
ATOM   7186  C C   . GLN C 1 168 ? -44.519 52.319   102.355 1.00 19.34 ? 249 GLN C C   1 
ATOM   7187  O O   . GLN C 1 168 ? -44.637 53.329   103.047 1.00 18.60 ? 249 GLN C O   1 
ATOM   7188  C CB  . GLN C 1 168 ? -46.853 51.629   102.053 1.00 19.27 ? 249 GLN C CB  1 
ATOM   7189  C CG  . GLN C 1 168 ? -47.521 50.745   101.012 1.00 23.06 ? 249 GLN C CG  1 
ATOM   7190  C CD  . GLN C 1 168 ? -46.609 50.360   99.861  1.00 21.08 ? 249 GLN C CD  1 
ATOM   7191  O OE1 . GLN C 1 168 ? -46.012 51.205   99.213  1.00 20.28 ? 249 GLN C OE1 1 
ATOM   7192  N NE2 . GLN C 1 168 ? -46.513 49.069   99.604  1.00 22.90 ? 249 GLN C NE2 1 
ATOM   7193  N N   . ALA C 1 169 ? -43.572 52.170   101.438 1.00 17.90 ? 250 ALA C N   1 
ATOM   7194  C CA  . ALA C 1 169 ? -42.625 53.230   101.147 1.00 16.73 ? 250 ALA C CA  1 
ATOM   7195  C C   . ALA C 1 169 ? -42.491 53.303   99.621  1.00 16.76 ? 250 ALA C C   1 
ATOM   7196  O O   . ALA C 1 169 ? -43.066 52.480   98.908  1.00 15.72 ? 250 ALA C O   1 
ATOM   7197  C CB  . ALA C 1 169 ? -41.291 52.934   101.794 1.00 15.24 ? 250 ALA C CB  1 
ATOM   7198  N N   . SER C 1 170 ? -41.743 54.285   99.122  1.00 15.87 ? 251 SER C N   1 
ATOM   7199  C CA  . SER C 1 170 ? -41.554 54.442   97.686  1.00 16.64 ? 251 SER C CA  1 
ATOM   7200  C C   . SER C 1 170 ? -40.255 53.778   97.213  1.00 17.90 ? 251 SER C C   1 
ATOM   7201  O O   . SER C 1 170 ? -39.213 53.864   97.882  1.00 18.91 ? 251 SER C O   1 
ATOM   7202  C CB  . SER C 1 170 ? -41.539 55.928   97.333  1.00 18.04 ? 251 SER C CB  1 
ATOM   7203  O OG  . SER C 1 170 ? -41.381 56.113   95.940  1.00 19.88 ? 251 SER C OG  1 
ATOM   7204  N N   . TYR C 1 171 ? -40.325 53.128   96.053  1.00 16.75 ? 252 TYR C N   1 
ATOM   7205  C CA  . TYR C 1 171 ? -39.176 52.435   95.472  1.00 16.95 ? 252 TYR C CA  1 
ATOM   7206  C C   . TYR C 1 171 ? -38.924 52.884   94.029  1.00 17.94 ? 252 TYR C C   1 
ATOM   7207  O O   . TYR C 1 171 ? -39.853 52.996   93.222  1.00 17.99 ? 252 TYR C O   1 
ATOM   7208  C CB  . TYR C 1 171 ? -39.404 50.917   95.495  1.00 14.88 ? 252 TYR C CB  1 
ATOM   7209  C CG  . TYR C 1 171 ? -40.205 50.453   96.687  1.00 15.52 ? 252 TYR C CG  1 
ATOM   7210  C CD1 . TYR C 1 171 ? -41.536 50.067   96.548  1.00 14.61 ? 252 TYR C CD1 1 
ATOM   7211  C CD2 . TYR C 1 171 ? -39.664 50.490   97.969  1.00 14.03 ? 252 TYR C CD2 1 
ATOM   7212  C CE1 . TYR C 1 171 ? -42.313 49.742   97.660  1.00 15.13 ? 252 TYR C CE1 1 
ATOM   7213  C CE2 . TYR C 1 171 ? -40.430 50.166   99.084  1.00 14.12 ? 252 TYR C CE2 1 
ATOM   7214  C CZ  . TYR C 1 171 ? -41.753 49.798   98.927  1.00 14.50 ? 252 TYR C CZ  1 
ATOM   7215  O OH  . TYR C 1 171 ? -42.524 49.519   100.031 1.00 13.94 ? 252 TYR C OH  1 
ATOM   7216  N N   . LYS C 1 172 ? -37.662 53.133   93.702  1.00 18.59 ? 253 LYS C N   1 
ATOM   7217  C CA  . LYS C 1 172 ? -37.315 53.556   92.355  1.00 18.38 ? 253 LYS C CA  1 
ATOM   7218  C C   . LYS C 1 172 ? -36.123 52.812   91.766  1.00 18.06 ? 253 LYS C C   1 
ATOM   7219  O O   . LYS C 1 172 ? -35.171 52.477   92.469  1.00 17.51 ? 253 LYS C O   1 
ATOM   7220  C CB  . LYS C 1 172 ? -37.047 55.059   92.326  1.00 18.77 ? 253 LYS C CB  1 
ATOM   7221  C CG  . LYS C 1 172 ? -38.290 55.909   92.496  1.00 20.38 ? 253 LYS C CG  1 
ATOM   7222  C CD  . LYS C 1 172 ? -37.955 57.385   92.337  1.00 22.65 ? 253 LYS C CD  1 
ATOM   7223  C CE  . LYS C 1 172 ? -39.165 58.264   92.609  1.00 23.08 ? 253 LYS C CE  1 
ATOM   7224  N NZ  . LYS C 1 172 ? -38.804 59.716   92.614  1.00 23.41 ? 253 LYS C NZ  1 
ATOM   7225  N N   . ILE C 1 173 ? -36.218 52.535   90.465  1.00 18.01 ? 254 ILE C N   1 
ATOM   7226  C CA  . ILE C 1 173 ? -35.173 51.856   89.704  1.00 18.00 ? 254 ILE C CA  1 
ATOM   7227  C C   . ILE C 1 173 ? -34.533 52.960   88.886  1.00 16.81 ? 254 ILE C C   1 
ATOM   7228  O O   . ILE C 1 173 ? -35.237 53.726   88.238  1.00 17.30 ? 254 ILE C O   1 
ATOM   7229  C CB  . ILE C 1 173 ? -35.732 50.872   88.655  1.00 19.60 ? 254 ILE C CB  1 
ATOM   7230  C CG1 . ILE C 1 173 ? -36.616 49.820   89.283  1.00 20.88 ? 254 ILE C CG1 1 
ATOM   7231  C CG2 . ILE C 1 173 ? -34.594 50.151   87.962  1.00 21.79 ? 254 ILE C CG2 1 
ATOM   7232  C CD1 . ILE C 1 173 ? -37.164 48.870   88.218  1.00 22.21 ? 254 ILE C CD1 1 
ATOM   7233  N N   . PHE C 1 174 ? -33.212 53.046   88.900  1.00 16.55 ? 255 PHE C N   1 
ATOM   7234  C CA  . PHE C 1 174 ? -32.534 54.071   88.118  1.00 16.13 ? 255 PHE C CA  1 
ATOM   7235  C C   . PHE C 1 174 ? -31.644 53.421   87.059  1.00 16.63 ? 255 PHE C C   1 
ATOM   7236  O O   . PHE C 1 174 ? -31.068 52.360   87.287  1.00 16.76 ? 255 PHE C O   1 
ATOM   7237  C CB  . PHE C 1 174 ? -31.689 54.978   89.022  1.00 15.02 ? 255 PHE C CB  1 
ATOM   7238  C CG  . PHE C 1 174 ? -32.483 55.746   90.057  1.00 13.24 ? 255 PHE C CG  1 
ATOM   7239  C CD1 . PHE C 1 174 ? -32.820 55.164   91.269  1.00 14.19 ? 255 PHE C CD1 1 
ATOM   7240  C CD2 . PHE C 1 174 ? -32.843 57.074   89.835  1.00 14.06 ? 255 PHE C CD2 1 
ATOM   7241  C CE1 . PHE C 1 174 ? -33.495 55.895   92.252  1.00 15.24 ? 255 PHE C CE1 1 
ATOM   7242  C CE2 . PHE C 1 174 ? -33.516 57.811   90.808  1.00 12.26 ? 255 PHE C CE2 1 
ATOM   7243  C CZ  . PHE C 1 174 ? -33.840 57.220   92.017  1.00 14.68 ? 255 PHE C CZ  1 
ATOM   7244  N N   . LYS C 1 175 ? -31.570 54.049   85.892  1.00 17.28 ? 256 LYS C N   1 
ATOM   7245  C CA  . LYS C 1 175 ? -30.743 53.570   84.784  1.00 18.24 ? 256 LYS C CA  1 
ATOM   7246  C C   . LYS C 1 175 ? -29.684 54.635   84.525  1.00 19.56 ? 256 LYS C C   1 
ATOM   7247  O O   . LYS C 1 175 ? -30.015 55.797   84.263  1.00 19.74 ? 256 LYS C O   1 
ATOM   7248  C CB  . LYS C 1 175 ? -31.581 53.381   83.512  1.00 17.42 ? 256 LYS C CB  1 
ATOM   7249  C CG  . LYS C 1 175 ? -30.746 53.023   82.284  1.00 16.73 ? 256 LYS C CG  1 
ATOM   7250  C CD  . LYS C 1 175 ? -31.577 52.909   81.009  1.00 15.21 ? 256 LYS C CD  1 
ATOM   7251  C CE  . LYS C 1 175 ? -30.705 52.483   79.818  1.00 17.36 ? 256 LYS C CE  1 
ATOM   7252  N NZ  . LYS C 1 175 ? -31.444 52.284   78.526  1.00 14.82 ? 256 LYS C NZ  1 
ATOM   7253  N N   . MET C 1 176 ? -28.413 54.260   84.602  1.00 19.55 ? 257 MET C N   1 
ATOM   7254  C CA  . MET C 1 176 ? -27.373 55.244   84.362  1.00 20.80 ? 257 MET C CA  1 
ATOM   7255  C C   . MET C 1 176 ? -26.292 54.867   83.363  1.00 20.85 ? 257 MET C C   1 
ATOM   7256  O O   . MET C 1 176 ? -26.048 53.693   83.083  1.00 19.64 ? 257 MET C O   1 
ATOM   7257  C CB  . MET C 1 176 ? -26.735 55.686   85.683  1.00 20.50 ? 257 MET C CB  1 
ATOM   7258  C CG  . MET C 1 176 ? -26.617 54.613   86.713  1.00 22.89 ? 257 MET C CG  1 
ATOM   7259  S SD  . MET C 1 176 ? -27.185 55.166   88.362  1.00 22.58 ? 257 MET C SD  1 
ATOM   7260  C CE  . MET C 1 176 ? -27.021 53.623   89.229  1.00 20.87 ? 257 MET C CE  1 
ATOM   7261  N N   . GLU C 1 177 ? -25.681 55.910   82.811  1.00 21.09 ? 258 GLU C N   1 
ATOM   7262  C CA  . GLU C 1 177 ? -24.611 55.793   81.836  1.00 24.24 ? 258 GLU C CA  1 
ATOM   7263  C C   . GLU C 1 177 ? -23.545 56.818   82.219  1.00 24.64 ? 258 GLU C C   1 
ATOM   7264  O O   . GLU C 1 177 ? -23.848 57.990   82.442  1.00 24.53 ? 258 GLU C O   1 
ATOM   7265  C CB  . GLU C 1 177 ? -25.167 56.041   80.425  1.00 24.34 ? 258 GLU C CB  1 
ATOM   7266  C CG  . GLU C 1 177 ? -26.077 54.895   79.965  1.00 26.05 ? 258 GLU C CG  1 
ATOM   7267  C CD  . GLU C 1 177 ? -26.946 55.217   78.746  1.00 28.39 ? 258 GLU C CD  1 
ATOM   7268  O OE1 . GLU C 1 177 ? -27.803 54.359   78.422  1.00 26.62 ? 258 GLU C OE1 1 
ATOM   7269  O OE2 . GLU C 1 177 ? -26.781 56.302   78.119  1.00 29.48 ? 258 GLU C OE2 1 
ATOM   7270  N N   . LYS C 1 178 ? -22.299 56.370   82.301  1.00 25.05 ? 259 LYS C N   1 
ATOM   7271  C CA  . LYS C 1 178 ? -21.216 57.246   82.708  1.00 26.40 ? 259 LYS C CA  1 
ATOM   7272  C C   . LYS C 1 178 ? -21.718 58.024   83.910  1.00 25.55 ? 259 LYS C C   1 
ATOM   7273  O O   . LYS C 1 178 ? -21.644 59.255   83.953  1.00 25.72 ? 259 LYS C O   1 
ATOM   7274  C CB  . LYS C 1 178 ? -20.826 58.217   81.596  1.00 29.94 ? 259 LYS C CB  1 
ATOM   7275  C CG  . LYS C 1 178 ? -20.405 57.565   80.295  1.00 34.70 ? 259 LYS C CG  1 
ATOM   7276  C CD  . LYS C 1 178 ? -19.883 58.629   79.352  1.00 39.55 ? 259 LYS C CD  1 
ATOM   7277  C CE  . LYS C 1 178 ? -19.934 58.163   77.907  1.00 42.31 ? 259 LYS C CE  1 
ATOM   7278  N NZ  . LYS C 1 178 ? -19.559 59.296   77.000  1.00 45.32 ? 259 LYS C NZ  1 
ATOM   7279  N N   . GLY C 1 179 ? -22.273 57.292   84.868  1.00 24.19 ? 260 GLY C N   1 
ATOM   7280  C CA  . GLY C 1 179 ? -22.762 57.902   86.091  1.00 23.05 ? 260 GLY C CA  1 
ATOM   7281  C C   . GLY C 1 179 ? -23.884 58.930   86.057  1.00 22.81 ? 260 GLY C C   1 
ATOM   7282  O O   . GLY C 1 179 ? -24.147 59.571   87.075  1.00 22.24 ? 260 GLY C O   1 
ATOM   7283  N N   . LYS C 1 180 ? -24.548 59.116   84.920  1.00 22.52 ? 261 LYS C N   1 
ATOM   7284  C CA  . LYS C 1 180 ? -25.637 60.087   84.881  1.00 21.58 ? 261 LYS C CA  1 
ATOM   7285  C C   . LYS C 1 180 ? -26.962 59.360   84.713  1.00 19.53 ? 261 LYS C C   1 
ATOM   7286  O O   . LYS C 1 180 ? -27.092 58.473   83.862  1.00 19.65 ? 261 LYS C O   1 
ATOM   7287  C CB  . LYS C 1 180 ? -25.435 61.112   83.746  1.00 22.05 ? 261 LYS C CB  1 
ATOM   7288  C CG  . LYS C 1 180 ? -26.409 62.295   83.819  1.00 24.55 ? 261 LYS C CG  1 
ATOM   7289  C CD  . LYS C 1 180 ? -26.151 63.350   82.743  1.00 26.13 ? 261 LYS C CD  1 
ATOM   7290  C CE  . LYS C 1 180 ? -25.176 64.431   83.225  1.00 28.43 ? 261 LYS C CE  1 
ATOM   7291  N NZ  . LYS C 1 180 ? -23.866 63.870   83.741  1.00 28.74 ? 261 LYS C NZ  1 
ATOM   7292  N N   . VAL C 1 181 ? -27.932 59.728   85.544  1.00 18.14 ? 262 VAL C N   1 
ATOM   7293  C CA  . VAL C 1 181 ? -29.255 59.121   85.497  1.00 17.71 ? 262 VAL C CA  1 
ATOM   7294  C C   . VAL C 1 181 ? -29.964 59.528   84.215  1.00 17.61 ? 262 VAL C C   1 
ATOM   7295  O O   . VAL C 1 181 ? -30.419 60.655   84.098  1.00 18.03 ? 262 VAL C O   1 
ATOM   7296  C CB  . VAL C 1 181 ? -30.119 59.560   86.709  1.00 16.79 ? 262 VAL C CB  1 
ATOM   7297  C CG1 . VAL C 1 181 ? -31.563 59.117   86.530  1.00 14.47 ? 262 VAL C CG1 1 
ATOM   7298  C CG2 . VAL C 1 181 ? -29.557 58.973   87.976  1.00 16.37 ? 262 VAL C CG2 1 
ATOM   7299  N N   . VAL C 1 182 ? -30.040 58.613   83.253  1.00 17.12 ? 263 VAL C N   1 
ATOM   7300  C CA  . VAL C 1 182 ? -30.723 58.885   81.988  1.00 17.74 ? 263 VAL C CA  1 
ATOM   7301  C C   . VAL C 1 182 ? -32.213 58.519   82.041  1.00 17.34 ? 263 VAL C C   1 
ATOM   7302  O O   . VAL C 1 182 ? -32.977 58.903   81.161  1.00 17.54 ? 263 VAL C O   1 
ATOM   7303  C CB  . VAL C 1 182 ? -30.082 58.115   80.813  1.00 17.08 ? 263 VAL C CB  1 
ATOM   7304  C CG1 . VAL C 1 182 ? -28.720 58.690   80.499  1.00 17.68 ? 263 VAL C CG1 1 
ATOM   7305  C CG2 . VAL C 1 182 ? -29.974 56.643   81.155  1.00 14.68 ? 263 VAL C CG2 1 
ATOM   7306  N N   . LYS C 1 183 ? -32.617 57.771   83.066  1.00 17.39 ? 264 LYS C N   1 
ATOM   7307  C CA  . LYS C 1 183 ? -34.014 57.373   83.224  1.00 17.56 ? 264 LYS C CA  1 
ATOM   7308  C C   . LYS C 1 183 ? -34.264 56.676   84.556  1.00 16.83 ? 264 LYS C C   1 
ATOM   7309  O O   . LYS C 1 183 ? -33.360 56.083   85.137  1.00 17.48 ? 264 LYS C O   1 
ATOM   7310  C CB  . LYS C 1 183 ? -34.432 56.443   82.085  1.00 18.55 ? 264 LYS C CB  1 
ATOM   7311  C CG  . LYS C 1 183 ? -35.918 56.095   82.084  1.00 20.70 ? 264 LYS C CG  1 
ATOM   7312  C CD  . LYS C 1 183 ? -36.289 55.337   80.816  1.00 21.52 ? 264 LYS C CD  1 
ATOM   7313  C CE  . LYS C 1 183 ? -37.740 54.864   80.828  1.00 23.58 ? 264 LYS C CE  1 
ATOM   7314  N NZ  . LYS C 1 183 ? -38.087 54.104   79.573  1.00 23.65 ? 264 LYS C NZ  1 
ATOM   7315  N N   . SER C 1 184 ? -35.496 56.746   85.039  1.00 15.91 ? 265 SER C N   1 
ATOM   7316  C CA  . SER C 1 184 ? -35.855 56.098   86.301  1.00 16.76 ? 265 SER C CA  1 
ATOM   7317  C C   . SER C 1 184 ? -37.337 55.794   86.272  1.00 17.28 ? 265 SER C C   1 
ATOM   7318  O O   . SER C 1 184 ? -38.059 56.314   85.428  1.00 18.00 ? 265 SER C O   1 
ATOM   7319  C CB  . SER C 1 184 ? -35.579 57.020   87.490  1.00 14.81 ? 265 SER C CB  1 
ATOM   7320  O OG  . SER C 1 184 ? -36.486 58.111   87.479  1.00 14.46 ? 265 SER C OG  1 
ATOM   7321  N N   . VAL C 1 185 ? -37.791 54.961   87.201  1.00 18.03 ? 266 VAL C N   1 
ATOM   7322  C CA  . VAL C 1 185 ? -39.210 54.621   87.288  1.00 18.29 ? 266 VAL C CA  1 
ATOM   7323  C C   . VAL C 1 185 ? -39.569 54.297   88.725  1.00 17.79 ? 266 VAL C C   1 
ATOM   7324  O O   . VAL C 1 185 ? -38.803 53.642   89.418  1.00 17.51 ? 266 VAL C O   1 
ATOM   7325  C CB  . VAL C 1 185 ? -39.577 53.378   86.424  1.00 18.43 ? 266 VAL C CB  1 
ATOM   7326  C CG1 . VAL C 1 185 ? -41.078 53.150   86.471  1.00 16.12 ? 266 VAL C CG1 1 
ATOM   7327  C CG2 . VAL C 1 185 ? -39.126 53.577   84.982  1.00 20.18 ? 266 VAL C CG2 1 
ATOM   7328  N N   . GLU C 1 186 ? -40.717 54.772   89.191  1.00 19.32 ? 267 GLU C N   1 
ATOM   7329  C CA  . GLU C 1 186 ? -41.115 54.436   90.542  1.00 20.49 ? 267 GLU C CA  1 
ATOM   7330  C C   . GLU C 1 186 ? -41.986 53.199   90.444  1.00 20.33 ? 267 GLU C C   1 
ATOM   7331  O O   . GLU C 1 186 ? -42.955 53.179   89.693  1.00 20.64 ? 267 GLU C O   1 
ATOM   7332  C CB  . GLU C 1 186 ? -41.909 55.553   91.204  1.00 22.26 ? 267 GLU C CB  1 
ATOM   7333  C CG  . GLU C 1 186 ? -42.217 55.211   92.661  1.00 25.72 ? 267 GLU C CG  1 
ATOM   7334  C CD  . GLU C 1 186 ? -42.885 56.340   93.417  1.00 27.92 ? 267 GLU C CD  1 
ATOM   7335  O OE1 . GLU C 1 186 ? -42.396 57.488   93.333  1.00 31.57 ? 267 GLU C OE1 1 
ATOM   7336  O OE2 . GLU C 1 186 ? -43.890 56.075   94.111  1.00 28.46 ? 267 GLU C OE2 1 
ATOM   7337  N N   . LEU C 1 187 ? -41.629 52.165   91.195  1.00 20.31 ? 268 LEU C N   1 
ATOM   7338  C CA  . LEU C 1 187 ? -42.384 50.919   91.182  1.00 20.26 ? 268 LEU C CA  1 
ATOM   7339  C C   . LEU C 1 187 ? -43.790 51.072   91.747  1.00 20.55 ? 268 LEU C C   1 
ATOM   7340  O O   . LEU C 1 187 ? -43.986 51.571   92.857  1.00 20.47 ? 268 LEU C O   1 
ATOM   7341  C CB  . LEU C 1 187 ? -41.647 49.834   91.977  1.00 18.53 ? 268 LEU C CB  1 
ATOM   7342  C CG  . LEU C 1 187 ? -40.313 49.354   91.412  1.00 18.09 ? 268 LEU C CG  1 
ATOM   7343  C CD1 . LEU C 1 187 ? -39.714 48.275   92.316  1.00 17.63 ? 268 LEU C CD1 1 
ATOM   7344  C CD2 . LEU C 1 187 ? -40.538 48.812   90.014  1.00 17.42 ? 268 LEU C CD2 1 
ATOM   7345  N N   . ASP C 1 188 ? -44.769 50.652   90.962  1.00 20.62 ? 269 ASP C N   1 
ATOM   7346  C CA  . ASP C 1 188 ? -46.155 50.694   91.390  1.00 21.36 ? 269 ASP C CA  1 
ATOM   7347  C C   . ASP C 1 188 ? -46.364 49.347   92.082  1.00 21.32 ? 269 ASP C C   1 
ATOM   7348  O O   . ASP C 1 188 ? -46.987 48.435   91.536  1.00 22.10 ? 269 ASP C O   1 
ATOM   7349  C CB  . ASP C 1 188 ? -47.061 50.851   90.167  1.00 20.89 ? 269 ASP C CB  1 
ATOM   7350  C CG  . ASP C 1 188 ? -48.527 50.679   90.495  1.00 21.13 ? 269 ASP C CG  1 
ATOM   7351  O OD1 . ASP C 1 188 ? -48.947 51.009   91.625  1.00 20.65 ? 269 ASP C OD1 1 
ATOM   7352  O OD2 . ASP C 1 188 ? -49.268 50.218   89.602  1.00 23.80 ? 269 ASP C OD2 1 
ATOM   7353  N N   . ALA C 1 189 ? -45.804 49.229   93.285  1.00 21.01 ? 270 ALA C N   1 
ATOM   7354  C CA  . ALA C 1 189 ? -45.873 47.999   94.058  1.00 19.19 ? 270 ALA C CA  1 
ATOM   7355  C C   . ALA C 1 189 ? -46.591 48.165   95.390  1.00 19.03 ? 270 ALA C C   1 
ATOM   7356  O O   . ALA C 1 189 ? -45.968 48.123   96.458  1.00 19.43 ? 270 ALA C O   1 
ATOM   7357  C CB  . ALA C 1 189 ? -44.458 47.460   94.292  1.00 17.85 ? 270 ALA C CB  1 
ATOM   7358  N N   . PRO C 1 190 ? -47.916 48.360   95.350  1.00 18.31 ? 271 PRO C N   1 
ATOM   7359  C CA  . PRO C 1 190 ? -48.651 48.518   96.610  1.00 17.08 ? 271 PRO C CA  1 
ATOM   7360  C C   . PRO C 1 190 ? -48.547 47.205   97.397  1.00 16.92 ? 271 PRO C C   1 
ATOM   7361  O O   . PRO C 1 190 ? -48.602 46.118   96.810  1.00 15.32 ? 271 PRO C O   1 
ATOM   7362  C CB  . PRO C 1 190 ? -50.074 48.805   96.138  1.00 16.69 ? 271 PRO C CB  1 
ATOM   7363  C CG  . PRO C 1 190 ? -50.159 48.002   94.848  1.00 16.77 ? 271 PRO C CG  1 
ATOM   7364  C CD  . PRO C 1 190 ? -48.832 48.316   94.194  1.00 17.22 ? 271 PRO C CD  1 
ATOM   7365  N N   . ASN C 1 191 ? -48.383 47.315   98.713  1.00 17.05 ? 272 ASN C N   1 
ATOM   7366  C CA  . ASN C 1 191 ? -48.262 46.157   99.609  1.00 16.71 ? 272 ASN C CA  1 
ATOM   7367  C C   . ASN C 1 191 ? -46.935 45.403   99.500  1.00 17.05 ? 272 ASN C C   1 
ATOM   7368  O O   . ASN C 1 191 ? -46.789 44.297   100.028 1.00 15.44 ? 272 ASN C O   1 
ATOM   7369  C CB  . ASN C 1 191 ? -49.422 45.177   99.400  1.00 14.86 ? 272 ASN C CB  1 
ATOM   7370  C CG  . ASN C 1 191 ? -49.582 44.220   100.567 1.00 16.94 ? 272 ASN C CG  1 
ATOM   7371  O OD1 . ASN C 1 191 ? -49.499 44.632   101.728 1.00 18.27 ? 272 ASN C OD1 1 
ATOM   7372  N ND2 . ASN C 1 191 ? -49.822 42.947   100.275 1.00 14.97 ? 272 ASN C ND2 1 
ATOM   7373  N N   . TYR C 1 192 ? -45.973 45.992   98.802  1.00 16.09 ? 273 TYR C N   1 
ATOM   7374  C CA  . TYR C 1 192 ? -44.662 45.378   98.677  1.00 17.06 ? 273 TYR C CA  1 
ATOM   7375  C C   . TYR C 1 192 ? -43.752 46.258   99.521  1.00 18.44 ? 273 TYR C C   1 
ATOM   7376  O O   . TYR C 1 192 ? -44.142 47.356   99.915  1.00 18.13 ? 273 TYR C O   1 
ATOM   7377  C CB  . TYR C 1 192 ? -44.158 45.408   97.230  1.00 16.60 ? 273 TYR C CB  1 
ATOM   7378  C CG  . TYR C 1 192 ? -44.665 44.313   96.317  1.00 16.82 ? 273 TYR C CG  1 
ATOM   7379  C CD1 . TYR C 1 192 ? -45.986 44.303   95.858  1.00 17.34 ? 273 TYR C CD1 1 
ATOM   7380  C CD2 . TYR C 1 192 ? -43.810 43.302   95.882  1.00 16.90 ? 273 TYR C CD2 1 
ATOM   7381  C CE1 . TYR C 1 192 ? -46.439 43.314   94.987  1.00 17.35 ? 273 TYR C CE1 1 
ATOM   7382  C CE2 . TYR C 1 192 ? -44.248 42.311   95.013  1.00 18.52 ? 273 TYR C CE2 1 
ATOM   7383  C CZ  . TYR C 1 192 ? -45.561 42.320   94.571  1.00 19.07 ? 273 TYR C CZ  1 
ATOM   7384  O OH  . TYR C 1 192 ? -45.990 41.325   93.731  1.00 19.65 ? 273 TYR C OH  1 
ATOM   7385  N N   . HIS C 1 193 ? -42.552 45.772   99.812  1.00 19.34 ? 274 HIS C N   1 
ATOM   7386  C CA  . HIS C 1 193 ? -41.580 46.551   100.571 1.00 20.01 ? 274 HIS C CA  1 
ATOM   7387  C C   . HIS C 1 193 ? -40.206 46.130   100.079 1.00 19.50 ? 274 HIS C C   1 
ATOM   7388  O O   . HIS C 1 193 ? -39.864 44.950   100.143 1.00 20.40 ? 274 HIS C O   1 
ATOM   7389  C CB  . HIS C 1 193 ? -41.717 46.297   102.073 1.00 20.80 ? 274 HIS C CB  1 
ATOM   7390  C CG  . HIS C 1 193 ? -41.030 47.324   102.920 1.00 20.91 ? 274 HIS C CG  1 
ATOM   7391  N ND1 . HIS C 1 193 ? -39.772 47.133   103.455 1.00 21.71 ? 274 HIS C ND1 1 
ATOM   7392  C CD2 . HIS C 1 193 ? -41.422 48.558   103.320 1.00 20.97 ? 274 HIS C CD2 1 
ATOM   7393  C CE1 . HIS C 1 193 ? -39.424 48.201   104.151 1.00 20.43 ? 274 HIS C CE1 1 
ATOM   7394  N NE2 . HIS C 1 193 ? -40.408 49.081   104.086 1.00 19.42 ? 274 HIS C NE2 1 
ATOM   7395  N N   . TYR C 1 194 ? -39.437 47.091   99.572  1.00 18.35 ? 275 TYR C N   1 
ATOM   7396  C CA  . TYR C 1 194 ? -38.103 46.822   99.030  1.00 17.97 ? 275 TYR C CA  1 
ATOM   7397  C C   . TYR C 1 194 ? -36.938 47.506   99.727  1.00 17.99 ? 275 TYR C C   1 
ATOM   7398  O O   . TYR C 1 194 ? -36.984 48.692   100.030 1.00 17.02 ? 275 TYR C O   1 
ATOM   7399  C CB  . TYR C 1 194 ? -38.036 47.211   97.554  1.00 16.76 ? 275 TYR C CB  1 
ATOM   7400  C CG  . TYR C 1 194 ? -38.828 46.315   96.646  1.00 15.06 ? 275 TYR C CG  1 
ATOM   7401  C CD1 . TYR C 1 194 ? -40.154 46.604   96.337  1.00 13.55 ? 275 TYR C CD1 1 
ATOM   7402  C CD2 . TYR C 1 194 ? -38.254 45.165   96.106  1.00 13.88 ? 275 TYR C CD2 1 
ATOM   7403  C CE1 . TYR C 1 194 ? -40.892 45.773   95.510  1.00 14.11 ? 275 TYR C CE1 1 
ATOM   7404  C CE2 . TYR C 1 194 ? -38.983 44.325   95.283  1.00 14.51 ? 275 TYR C CE2 1 
ATOM   7405  C CZ  . TYR C 1 194 ? -40.304 44.637   94.985  1.00 14.05 ? 275 TYR C CZ  1 
ATOM   7406  O OH  . TYR C 1 194 ? -41.038 43.821   94.161  1.00 16.12 ? 275 TYR C OH  1 
ATOM   7407  N N   . GLU C 1 195 ? -35.873 46.748   99.948  1.00 19.67 ? 276 GLU C N   1 
ATOM   7408  C CA  . GLU C 1 195 ? -34.689 47.288   100.586 1.00 19.39 ? 276 GLU C CA  1 
ATOM   7409  C C   . GLU C 1 195 ? -33.474 46.421   100.380 1.00 17.89 ? 276 GLU C C   1 
ATOM   7410  O O   . GLU C 1 195 ? -33.588 45.221   100.148 1.00 17.89 ? 276 GLU C O   1 
ATOM   7411  C CB  . GLU C 1 195 ? -34.944 47.506   102.078 1.00 21.88 ? 276 GLU C CB  1 
ATOM   7412  C CG  . GLU C 1 195 ? -34.951 48.994   102.440 1.00 25.65 ? 276 GLU C CG  1 
ATOM   7413  C CD  . GLU C 1 195 ? -35.937 49.300   103.527 1.00 26.87 ? 276 GLU C CD  1 
ATOM   7414  O OE1 . GLU C 1 195 ? -36.224 50.485   103.769 1.00 28.34 ? 276 GLU C OE1 1 
ATOM   7415  O OE2 . GLU C 1 195 ? -36.434 48.344   104.142 1.00 29.89 ? 276 GLU C OE2 1 
ATOM   7416  N N   . GLU C 1 196 ? -32.312 47.065   100.452 1.00 18.43 ? 277 GLU C N   1 
ATOM   7417  C CA  . GLU C 1 196 ? -31.003 46.432   100.282 1.00 17.48 ? 277 GLU C CA  1 
ATOM   7418  C C   . GLU C 1 196 ? -30.990 45.310   99.234  1.00 17.99 ? 277 GLU C C   1 
ATOM   7419  O O   . GLU C 1 196 ? -30.537 44.185   99.483  1.00 19.39 ? 277 GLU C O   1 
ATOM   7420  C CB  . GLU C 1 196 ? -30.516 45.958   101.653 1.00 15.41 ? 277 GLU C CB  1 
ATOM   7421  C CG  . GLU C 1 196 ? -30.605 47.103   102.662 1.00 16.08 ? 277 GLU C CG  1 
ATOM   7422  C CD  . GLU C 1 196 ? -30.229 46.720   104.070 1.00 17.28 ? 277 GLU C CD  1 
ATOM   7423  O OE1 . GLU C 1 196 ? -30.409 45.544   104.442 1.00 16.01 ? 277 GLU C OE1 1 
ATOM   7424  O OE2 . GLU C 1 196 ? -29.770 47.611   104.819 1.00 19.09 ? 277 GLU C OE2 1 
ATOM   7425  N N   . CYS C 1 197 ? -31.487 45.648   98.048  1.00 16.64 ? 278 CYS C N   1 
ATOM   7426  C CA  . CYS C 1 197 ? -31.570 44.720   96.932  1.00 16.10 ? 278 CYS C CA  1 
ATOM   7427  C C   . CYS C 1 197 ? -30.235 44.183   96.421  1.00 15.82 ? 278 CYS C C   1 
ATOM   7428  O O   . CYS C 1 197 ? -29.224 44.899   96.360  1.00 14.51 ? 278 CYS C O   1 
ATOM   7429  C CB  . CYS C 1 197 ? -32.295 45.373   95.751  1.00 16.98 ? 278 CYS C CB  1 
ATOM   7430  S SG  . CYS C 1 197 ? -34.086 45.653   95.954  1.00 20.20 ? 278 CYS C SG  1 
ATOM   7431  N N   . SER C 1 198 ? -30.249 42.906   96.060  1.00 13.92 ? 279 SER C N   1 
ATOM   7432  C CA  . SER C 1 198 ? -29.086 42.260   95.487  1.00 14.29 ? 279 SER C CA  1 
ATOM   7433  C C   . SER C 1 198 ? -29.515 42.037   94.039  1.00 15.05 ? 279 SER C C   1 
ATOM   7434  O O   . SER C 1 198 ? -30.371 41.201   93.747  1.00 14.30 ? 279 SER C O   1 
ATOM   7435  C CB  . SER C 1 198 ? -28.794 40.935   96.191  1.00 14.94 ? 279 SER C CB  1 
ATOM   7436  O OG  . SER C 1 198 ? -28.274 41.159   97.492  1.00 16.09 ? 279 SER C OG  1 
ATOM   7437  N N   . CYS C 1 199 ? -28.940 42.819   93.135  1.00 15.55 ? 280 CYS C N   1 
ATOM   7438  C CA  . CYS C 1 199 ? -29.295 42.727   91.731  1.00 15.82 ? 280 CYS C CA  1 
ATOM   7439  C C   . CYS C 1 199 ? -28.170 42.118   90.907  1.00 15.13 ? 280 CYS C C   1 
ATOM   7440  O O   . CYS C 1 199 ? -26.997 42.327   91.205  1.00 13.86 ? 280 CYS C O   1 
ATOM   7441  C CB  . CYS C 1 199 ? -29.614 44.118   91.188  1.00 17.67 ? 280 CYS C CB  1 
ATOM   7442  S SG  . CYS C 1 199 ? -30.833 45.116   92.117  1.00 22.21 ? 280 CYS C SG  1 
ATOM   7443  N N   . TYR C 1 200 ? -28.533 41.374   89.867  1.00 13.94 ? 281 TYR C N   1 
ATOM   7444  C CA  . TYR C 1 200 ? -27.543 40.755   89.006  1.00 14.83 ? 281 TYR C CA  1 
ATOM   7445  C C   . TYR C 1 200 ? -27.983 40.705   87.545  1.00 15.34 ? 281 TYR C C   1 
ATOM   7446  O O   . TYR C 1 200 ? -29.152 40.510   87.241  1.00 16.15 ? 281 TYR C O   1 
ATOM   7447  C CB  . TYR C 1 200 ? -27.209 39.338   89.497  1.00 15.02 ? 281 TYR C CB  1 
ATOM   7448  C CG  . TYR C 1 200 ? -28.343 38.346   89.429  1.00 14.62 ? 281 TYR C CG  1 
ATOM   7449  C CD1 . TYR C 1 200 ? -29.136 38.090   90.543  1.00 16.03 ? 281 TYR C CD1 1 
ATOM   7450  C CD2 . TYR C 1 200 ? -28.598 37.629   88.262  1.00 13.32 ? 281 TYR C CD2 1 
ATOM   7451  C CE1 . TYR C 1 200 ? -30.147 37.134   90.499  1.00 15.32 ? 281 TYR C CE1 1 
ATOM   7452  C CE2 . TYR C 1 200 ? -29.605 36.679   88.206  1.00 12.86 ? 281 TYR C CE2 1 
ATOM   7453  C CZ  . TYR C 1 200 ? -30.372 36.432   89.326  1.00 15.06 ? 281 TYR C CZ  1 
ATOM   7454  O OH  . TYR C 1 200 ? -31.352 35.465   89.287  1.00 17.29 ? 281 TYR C OH  1 
ATOM   7455  N N   . PRO C 1 201 ? -27.038 40.889   86.619  1.00 16.28 ? 282 PRO C N   1 
ATOM   7456  C CA  . PRO C 1 201 ? -27.349 40.863   85.187  1.00 16.99 ? 282 PRO C CA  1 
ATOM   7457  C C   . PRO C 1 201 ? -27.498 39.437   84.668  1.00 18.20 ? 282 PRO C C   1 
ATOM   7458  O O   . PRO C 1 201 ? -26.771 38.540   85.087  1.00 19.96 ? 282 PRO C O   1 
ATOM   7459  C CB  . PRO C 1 201 ? -26.160 41.592   84.568  1.00 15.31 ? 282 PRO C CB  1 
ATOM   7460  C CG  . PRO C 1 201 ? -25.035 41.176   85.452  1.00 15.49 ? 282 PRO C CG  1 
ATOM   7461  C CD  . PRO C 1 201 ? -25.631 41.265   86.849  1.00 14.34 ? 282 PRO C CD  1 
ATOM   7462  N N   . ASN C 1 202 ? -28.456 39.228   83.774  1.00 19.15 ? 283 ASN C N   1 
ATOM   7463  C CA  . ASN C 1 202 ? -28.689 37.910   83.199  1.00 20.61 ? 283 ASN C CA  1 
ATOM   7464  C C   . ASN C 1 202 ? -29.461 37.989   81.879  1.00 20.56 ? 283 ASN C C   1 
ATOM   7465  O O   . ASN C 1 202 ? -30.594 38.471   81.826  1.00 20.16 ? 283 ASN C O   1 
ATOM   7466  C CB  . ASN C 1 202 ? -29.442 37.014   84.197  1.00 22.84 ? 283 ASN C CB  1 
ATOM   7467  C CG  . ASN C 1 202 ? -29.759 35.637   83.619  1.00 24.95 ? 283 ASN C CG  1 
ATOM   7468  O OD1 . ASN C 1 202 ? -30.652 35.490   82.782  1.00 27.17 ? 283 ASN C OD1 1 
ATOM   7469  N ND2 . ASN C 1 202 ? -29.015 34.628   84.051  1.00 25.77 ? 283 ASN C ND2 1 
ATOM   7470  N N   . ALA C 1 203 ? -28.837 37.512   80.812  1.00 20.35 ? 284 ALA C N   1 
ATOM   7471  C CA  . ALA C 1 203 ? -29.462 37.521   79.493  1.00 21.65 ? 284 ALA C CA  1 
ATOM   7472  C C   . ALA C 1 203 ? -29.935 38.910   79.084  1.00 21.09 ? 284 ALA C C   1 
ATOM   7473  O O   . ALA C 1 203 ? -30.982 39.051   78.462  1.00 21.01 ? 284 ALA C O   1 
ATOM   7474  C CB  . ALA C 1 203 ? -30.642 36.534   79.455  1.00 20.00 ? 284 ALA C CB  1 
ATOM   7475  N N   . GLY C 1 204 ? -29.171 39.933   79.453  1.00 22.20 ? 285 GLY C N   1 
ATOM   7476  C CA  . GLY C 1 204 ? -29.517 41.293   79.074  1.00 22.22 ? 285 GLY C CA  1 
ATOM   7477  C C   . GLY C 1 204 ? -30.528 42.002   79.950  1.00 22.99 ? 285 GLY C C   1 
ATOM   7478  O O   . GLY C 1 204 ? -31.021 43.072   79.580  1.00 23.11 ? 285 GLY C O   1 
ATOM   7479  N N   . GLU C 1 205 ? -30.838 41.424   81.107  1.00 23.14 ? 286 GLU C N   1 
ATOM   7480  C CA  . GLU C 1 205 ? -31.795 42.036   82.026  1.00 24.11 ? 286 GLU C CA  1 
ATOM   7481  C C   . GLU C 1 205 ? -31.294 41.909   83.455  1.00 22.93 ? 286 GLU C C   1 
ATOM   7482  O O   . GLU C 1 205 ? -30.383 41.134   83.728  1.00 23.25 ? 286 GLU C O   1 
ATOM   7483  C CB  . GLU C 1 205 ? -33.166 41.367   81.896  1.00 26.05 ? 286 GLU C CB  1 
ATOM   7484  C CG  . GLU C 1 205 ? -33.736 41.445   80.481  1.00 30.45 ? 286 GLU C CG  1 
ATOM   7485  C CD  . GLU C 1 205 ? -35.123 40.840   80.362  1.00 32.93 ? 286 GLU C CD  1 
ATOM   7486  O OE1 . GLU C 1 205 ? -36.063 41.361   81.007  1.00 34.58 ? 286 GLU C OE1 1 
ATOM   7487  O OE2 . GLU C 1 205 ? -35.277 39.844   79.617  1.00 34.68 ? 286 GLU C OE2 1 
ATOM   7488  N N   . ILE C 1 206 ? -31.884 42.668   84.366  1.00 20.70 ? 287 ILE C N   1 
ATOM   7489  C CA  . ILE C 1 206 ? -31.453 42.614   85.750  1.00 20.07 ? 287 ILE C CA  1 
ATOM   7490  C C   . ILE C 1 206 ? -32.478 41.917   86.642  1.00 19.31 ? 287 ILE C C   1 
ATOM   7491  O O   . ILE C 1 206 ? -33.686 41.998   86.411  1.00 18.66 ? 287 ILE C O   1 
ATOM   7492  C CB  . ILE C 1 206 ? -31.211 44.029   86.318  1.00 20.37 ? 287 ILE C CB  1 
ATOM   7493  C CG1 . ILE C 1 206 ? -30.122 44.752   85.521  1.00 20.85 ? 287 ILE C CG1 1 
ATOM   7494  C CG2 . ILE C 1 206 ? -30.799 43.929   87.774  1.00 20.26 ? 287 ILE C CG2 1 
ATOM   7495  C CD1 . ILE C 1 206 ? -30.601 45.388   84.238  1.00 21.78 ? 287 ILE C CD1 1 
ATOM   7496  N N   . THR C 1 207 ? -31.992 41.229   87.663  1.00 18.23 ? 288 THR C N   1 
ATOM   7497  C CA  . THR C 1 207 ? -32.886 40.561   88.600  1.00 18.89 ? 288 THR C CA  1 
ATOM   7498  C C   . THR C 1 207 ? -32.448 40.940   90.010  1.00 18.80 ? 288 THR C C   1 
ATOM   7499  O O   . THR C 1 207 ? -31.289 40.757   90.367  1.00 18.97 ? 288 THR C O   1 
ATOM   7500  C CB  . THR C 1 207 ? -32.840 39.014   88.436  1.00 18.76 ? 288 THR C CB  1 
ATOM   7501  O OG1 . THR C 1 207 ? -33.365 38.648   87.150  1.00 17.25 ? 288 THR C OG1 1 
ATOM   7502  C CG2 . THR C 1 207 ? -33.659 38.330   89.534  1.00 17.54 ? 288 THR C CG2 1 
ATOM   7503  N N   . CYS C 1 208 ? -33.366 41.485   90.801  1.00 19.16 ? 289 CYS C N   1 
ATOM   7504  C CA  . CYS C 1 208 ? -33.026 41.869   92.165  1.00 20.33 ? 289 CYS C CA  1 
ATOM   7505  C C   . CYS C 1 208 ? -33.834 41.102   93.193  1.00 20.41 ? 289 CYS C C   1 
ATOM   7506  O O   . CYS C 1 208 ? -35.055 40.999   93.071  1.00 21.55 ? 289 CYS C O   1 
ATOM   7507  C CB  . CYS C 1 208 ? -33.297 43.348   92.425  1.00 21.02 ? 289 CYS C CB  1 
ATOM   7508  S SG  . CYS C 1 208 ? -32.616 44.593   91.290  1.00 21.54 ? 289 CYS C SG  1 
ATOM   7509  N N   . VAL C 1 209 ? -33.150 40.578   94.207  1.00 19.37 ? 290 VAL C N   1 
ATOM   7510  C CA  . VAL C 1 209 ? -33.799 39.877   95.308  1.00 18.62 ? 290 VAL C CA  1 
ATOM   7511  C C   . VAL C 1 209 ? -33.493 40.795   96.484  1.00 17.83 ? 290 VAL C C   1 
ATOM   7512  O O   . VAL C 1 209 ? -32.344 41.156   96.711  1.00 19.45 ? 290 VAL C O   1 
ATOM   7513  C CB  . VAL C 1 209 ? -33.201 38.465   95.527  1.00 19.79 ? 290 VAL C CB  1 
ATOM   7514  C CG1 . VAL C 1 209 ? -33.863 37.792   96.731  1.00 16.61 ? 290 VAL C CG1 1 
ATOM   7515  C CG2 . VAL C 1 209 ? -33.433 37.615   94.271  1.00 19.31 ? 290 VAL C CG2 1 
ATOM   7516  N N   . CYS C 1 210 ? -34.517 41.180   97.232  1.00 17.96 ? 291 CYS C N   1 
ATOM   7517  C CA  . CYS C 1 210 ? -34.314 42.134   98.309  1.00 16.43 ? 291 CYS C CA  1 
ATOM   7518  C C   . CYS C 1 210 ? -34.798 41.733   99.701  1.00 16.14 ? 291 CYS C C   1 
ATOM   7519  O O   . CYS C 1 210 ? -34.963 40.557   100.020 1.00 15.58 ? 291 CYS C O   1 
ATOM   7520  C CB  . CYS C 1 210 ? -34.963 43.452   97.888  1.00 16.61 ? 291 CYS C CB  1 
ATOM   7521  S SG  . CYS C 1 210 ? -34.878 43.780   96.082  1.00 17.56 ? 291 CYS C SG  1 
ATOM   7522  N N   . ARG C 1 211 ? -35.019 42.739   100.536 1.00 16.02 ? 292 ARG C N   1 
ATOM   7523  C CA  . ARG C 1 211 ? -35.460 42.515   101.902 1.00 13.62 ? 292 ARG C CA  1 
ATOM   7524  C C   . ARG C 1 211 ? -36.769 43.212   102.252 1.00 14.72 ? 292 ARG C C   1 
ATOM   7525  O O   . ARG C 1 211 ? -36.937 44.410   102.009 1.00 13.67 ? 292 ARG C O   1 
ATOM   7526  C CB  . ARG C 1 211 ? -34.369 42.991   102.855 1.00 12.89 ? 292 ARG C CB  1 
ATOM   7527  C CG  . ARG C 1 211 ? -34.818 43.307   104.274 1.00 13.31 ? 292 ARG C CG  1 
ATOM   7528  C CD  . ARG C 1 211 ? -33.635 43.864   105.052 1.00 12.96 ? 292 ARG C CD  1 
ATOM   7529  N NE  . ARG C 1 211 ? -33.944 44.242   106.424 1.00 13.23 ? 292 ARG C NE  1 
ATOM   7530  C CZ  . ARG C 1 211 ? -33.042 44.698   107.288 1.00 13.95 ? 292 ARG C CZ  1 
ATOM   7531  N NH1 . ARG C 1 211 ? -33.405 45.021   108.519 1.00 15.71 ? 292 ARG C NH1 1 
ATOM   7532  N NH2 . ARG C 1 211 ? -31.772 44.824   106.929 1.00 13.76 ? 292 ARG C NH2 1 
ATOM   7533  N N   . ASP C 1 212 ? -37.700 42.447   102.816 1.00 15.00 ? 293 ASP C N   1 
ATOM   7534  C CA  . ASP C 1 212 ? -38.970 43.001   103.259 1.00 14.60 ? 293 ASP C CA  1 
ATOM   7535  C C   . ASP C 1 212 ? -38.786 43.197   104.767 1.00 14.13 ? 293 ASP C C   1 
ATOM   7536  O O   . ASP C 1 212 ? -38.691 42.235   105.543 1.00 16.04 ? 293 ASP C O   1 
ATOM   7537  C CB  . ASP C 1 212 ? -40.129 42.044   102.956 1.00 13.92 ? 293 ASP C CB  1 
ATOM   7538  C CG  . ASP C 1 212 ? -41.486 42.658   103.260 1.00 14.22 ? 293 ASP C CG  1 
ATOM   7539  O OD1 . ASP C 1 212 ? -42.490 42.250   102.636 1.00 13.90 ? 293 ASP C OD1 1 
ATOM   7540  O OD2 . ASP C 1 212 ? -41.549 43.546   104.137 1.00 16.68 ? 293 ASP C OD2 1 
ATOM   7541  N N   . ASN C 1 213 ? -38.709 44.458   105.165 1.00 14.05 ? 294 ASN C N   1 
ATOM   7542  C CA  . ASN C 1 213 ? -38.492 44.813   106.555 1.00 14.60 ? 294 ASN C CA  1 
ATOM   7543  C C   . ASN C 1 213 ? -39.798 45.203   107.235 1.00 15.20 ? 294 ASN C C   1 
ATOM   7544  O O   . ASN C 1 213 ? -39.862 45.358   108.453 1.00 14.73 ? 294 ASN C O   1 
ATOM   7545  C CB  . ASN C 1 213 ? -37.498 45.981   106.627 1.00 13.92 ? 294 ASN C CB  1 
ATOM   7546  C CG  . ASN C 1 213 ? -36.924 46.172   108.017 1.00 14.89 ? 294 ASN C CG  1 
ATOM   7547  O OD1 . ASN C 1 213 ? -36.275 45.279   108.554 1.00 11.43 ? 294 ASN C OD1 1 
ATOM   7548  N ND2 . ASN C 1 213 ? -37.165 47.339   108.607 1.00 15.72 ? 294 ASN C ND2 1 
ATOM   7549  N N   . TRP C 1 214 ? -40.838 45.338   106.427 1.00 16.73 ? 295 TRP C N   1 
ATOM   7550  C CA  . TRP C 1 214 ? -42.150 45.747   106.897 1.00 17.89 ? 295 TRP C CA  1 
ATOM   7551  C C   . TRP C 1 214 ? -43.032 44.583   107.318 1.00 18.64 ? 295 TRP C C   1 
ATOM   7552  O O   . TRP C 1 214 ? -43.474 44.532   108.463 1.00 20.57 ? 295 TRP C O   1 
ATOM   7553  C CB  . TRP C 1 214 ? -42.798 46.586   105.790 1.00 19.34 ? 295 TRP C CB  1 
ATOM   7554  C CG  . TRP C 1 214 ? -44.278 46.818   105.851 1.00 20.15 ? 295 TRP C CG  1 
ATOM   7555  C CD1 . TRP C 1 214 ? -45.061 46.927   106.966 1.00 20.66 ? 295 TRP C CD1 1 
ATOM   7556  C CD2 . TRP C 1 214 ? -45.123 47.123   104.738 1.00 19.67 ? 295 TRP C CD2 1 
ATOM   7557  N NE1 . TRP C 1 214 ? -46.339 47.296   106.613 1.00 22.24 ? 295 TRP C NE1 1 
ATOM   7558  C CE2 . TRP C 1 214 ? -46.403 47.422   105.247 1.00 20.63 ? 295 TRP C CE2 1 
ATOM   7559  C CE3 . TRP C 1 214 ? -44.918 47.175   103.351 1.00 18.98 ? 295 TRP C CE3 1 
ATOM   7560  C CZ2 . TRP C 1 214 ? -47.475 47.772   104.426 1.00 21.30 ? 295 TRP C CZ2 1 
ATOM   7561  C CZ3 . TRP C 1 214 ? -45.977 47.522   102.534 1.00 20.77 ? 295 TRP C CZ3 1 
ATOM   7562  C CH2 . TRP C 1 214 ? -47.244 47.817   103.073 1.00 21.67 ? 295 TRP C CH2 1 
ATOM   7563  N N   . HIS C 1 215 ? -43.264 43.635   106.419 1.00 18.03 ? 296 HIS C N   1 
ATOM   7564  C CA  . HIS C 1 215 ? -44.130 42.515   106.749 1.00 17.60 ? 296 HIS C CA  1 
ATOM   7565  C C   . HIS C 1 215 ? -43.895 41.214   105.983 1.00 18.43 ? 296 HIS C C   1 
ATOM   7566  O O   . HIS C 1 215 ? -44.835 40.451   105.756 1.00 18.84 ? 296 HIS C O   1 
ATOM   7567  C CB  . HIS C 1 215 ? -45.588 42.936   106.573 1.00 19.21 ? 296 HIS C CB  1 
ATOM   7568  C CG  . HIS C 1 215 ? -45.908 43.461   105.202 1.00 20.57 ? 296 HIS C CG  1 
ATOM   7569  N ND1 . HIS C 1 215 ? -45.183 43.121   104.086 1.00 20.84 ? 296 HIS C ND1 1 
ATOM   7570  C CD2 . HIS C 1 215 ? -46.907 44.274   104.775 1.00 20.12 ? 296 HIS C CD2 1 
ATOM   7571  C CE1 . HIS C 1 215 ? -45.716 43.704   103.021 1.00 20.86 ? 296 HIS C CE1 1 
ATOM   7572  N NE2 . HIS C 1 215 ? -46.760 44.406   103.414 1.00 20.84 ? 296 HIS C NE2 1 
ATOM   7573  N N   . GLY C 1 216 ? -42.653 40.939   105.599 1.00 18.65 ? 297 GLY C N   1 
ATOM   7574  C CA  . GLY C 1 216 ? -42.388 39.710   104.872 1.00 18.41 ? 297 GLY C CA  1 
ATOM   7575  C C   . GLY C 1 216 ? -41.247 38.877   105.426 1.00 19.01 ? 297 GLY C C   1 
ATOM   7576  O O   . GLY C 1 216 ? -40.242 39.415   105.891 1.00 21.74 ? 297 GLY C O   1 
ATOM   7577  N N   . SER C 1 217 ? -41.426 37.559   105.389 1.00 20.01 ? 298 SER C N   1 
ATOM   7578  C CA  . SER C 1 217 ? -40.431 36.590   105.849 1.00 18.67 ? 298 SER C CA  1 
ATOM   7579  C C   . SER C 1 217 ? -39.754 36.002   104.619 1.00 17.91 ? 298 SER C C   1 
ATOM   7580  O O   . SER C 1 217 ? -38.657 35.462   104.705 1.00 19.36 ? 298 SER C O   1 
ATOM   7581  C CB  . SER C 1 217 ? -41.089 35.451   106.623 1.00 17.83 ? 298 SER C CB  1 
ATOM   7582  O OG  . SER C 1 217 ? -41.377 35.845   107.938 1.00 22.20 ? 298 SER C OG  1 
ATOM   7583  N N   . ASN C 1 218 ? -40.442 36.062   103.483 1.00 15.63 ? 299 ASN C N   1 
ATOM   7584  C CA  . ASN C 1 218 ? -39.883 35.583   102.219 1.00 13.92 ? 299 ASN C CA  1 
ATOM   7585  C C   . ASN C 1 218 ? -39.340 36.839   101.560 1.00 12.45 ? 299 ASN C C   1 
ATOM   7586  O O   . ASN C 1 218 ? -39.687 37.934   101.972 1.00 12.15 ? 299 ASN C O   1 
ATOM   7587  C CB  . ASN C 1 218 ? -40.961 34.914   101.344 1.00 11.03 ? 299 ASN C CB  1 
ATOM   7588  C CG  . ASN C 1 218 ? -42.270 35.692   101.311 1.00 10.15 ? 299 ASN C CG  1 
ATOM   7589  O OD1 . ASN C 1 218 ? -42.637 36.355   102.277 1.00 11.26 ? 299 ASN C OD1 1 
ATOM   7590  N ND2 . ASN C 1 218 ? -42.991 35.587   100.208 1.00 7.59  ? 299 ASN C ND2 1 
ATOM   7591  N N   . ARG C 1 219 ? -38.493 36.697   100.551 1.00 12.73 ? 300 ARG C N   1 
ATOM   7592  C CA  . ARG C 1 219 ? -37.924 37.874   99.912  1.00 13.22 ? 300 ARG C CA  1 
ATOM   7593  C C   . ARG C 1 219 ? -38.646 38.354   98.668  1.00 14.05 ? 300 ARG C C   1 
ATOM   7594  O O   . ARG C 1 219 ? -39.148 37.561   97.875  1.00 14.72 ? 300 ARG C O   1 
ATOM   7595  C CB  . ARG C 1 219 ? -36.446 37.640   99.579  1.00 11.28 ? 300 ARG C CB  1 
ATOM   7596  C CG  . ARG C 1 219 ? -35.561 37.469   100.797 1.00 10.01 ? 300 ARG C CG  1 
ATOM   7597  C CD  . ARG C 1 219 ? -34.076 37.468   100.434 1.00 11.83 ? 300 ARG C CD  1 
ATOM   7598  N NE  . ARG C 1 219 ? -33.243 37.374   101.636 1.00 14.70 ? 300 ARG C NE  1 
ATOM   7599  C CZ  . ARG C 1 219 ? -33.141 38.332   102.556 1.00 13.95 ? 300 ARG C CZ  1 
ATOM   7600  N NH1 . ARG C 1 219 ? -32.374 38.154   103.620 1.00 14.04 ? 300 ARG C NH1 1 
ATOM   7601  N NH2 . ARG C 1 219 ? -33.793 39.478   102.404 1.00 14.79 ? 300 ARG C NH2 1 
ATOM   7602  N N   . PRO C 1 220 ? -38.725 39.680   98.495  1.00 14.61 ? 301 PRO C N   1 
ATOM   7603  C CA  . PRO C 1 220 ? -39.387 40.259   97.327  1.00 15.89 ? 301 PRO C CA  1 
ATOM   7604  C C   . PRO C 1 220 ? -38.365 40.355   96.189  1.00 16.06 ? 301 PRO C C   1 
ATOM   7605  O O   . PRO C 1 220 ? -37.158 40.348   96.436  1.00 14.65 ? 301 PRO C O   1 
ATOM   7606  C CB  . PRO C 1 220 ? -39.817 41.627   97.834  1.00 14.07 ? 301 PRO C CB  1 
ATOM   7607  C CG  . PRO C 1 220 ? -38.657 42.008   98.695  1.00 14.53 ? 301 PRO C CG  1 
ATOM   7608  C CD  . PRO C 1 220 ? -38.383 40.727   99.474  1.00 13.53 ? 301 PRO C CD  1 
ATOM   7609  N N   . TRP C 1 221 ? -38.849 40.441   94.953  1.00 17.16 ? 302 TRP C N   1 
ATOM   7610  C CA  . TRP C 1 221 ? -37.960 40.545   93.797  1.00 18.93 ? 302 TRP C CA  1 
ATOM   7611  C C   . TRP C 1 221 ? -38.479 41.475   92.713  1.00 18.17 ? 302 TRP C C   1 
ATOM   7612  O O   . TRP C 1 221 ? -39.675 41.742   92.627  1.00 17.82 ? 302 TRP C O   1 
ATOM   7613  C CB  . TRP C 1 221 ? -37.710 39.165   93.163  1.00 19.44 ? 302 TRP C CB  1 
ATOM   7614  C CG  . TRP C 1 221 ? -38.951 38.460   92.660  1.00 18.56 ? 302 TRP C CG  1 
ATOM   7615  C CD1 . TRP C 1 221 ? -39.714 37.560   93.341  1.00 17.90 ? 302 TRP C CD1 1 
ATOM   7616  C CD2 . TRP C 1 221 ? -39.548 38.591   91.364  1.00 18.41 ? 302 TRP C CD2 1 
ATOM   7617  N NE1 . TRP C 1 221 ? -40.747 37.115   92.551  1.00 19.28 ? 302 TRP C NE1 1 
ATOM   7618  C CE2 . TRP C 1 221 ? -40.671 37.733   91.331  1.00 17.89 ? 302 TRP C CE2 1 
ATOM   7619  C CE3 . TRP C 1 221 ? -39.244 39.349   90.225  1.00 17.72 ? 302 TRP C CE3 1 
ATOM   7620  C CZ2 . TRP C 1 221 ? -41.491 37.611   90.208  1.00 17.72 ? 302 TRP C CZ2 1 
ATOM   7621  C CZ3 . TRP C 1 221 ? -40.062 39.229   89.102  1.00 17.84 ? 302 TRP C CZ3 1 
ATOM   7622  C CH2 . TRP C 1 221 ? -41.173 38.365   89.105  1.00 17.65 ? 302 TRP C CH2 1 
ATOM   7623  N N   . VAL C 1 222 ? -37.552 41.954   91.889  1.00 18.31 ? 303 VAL C N   1 
ATOM   7624  C CA  . VAL C 1 222 ? -37.867 42.833   90.765  1.00 19.14 ? 303 VAL C CA  1 
ATOM   7625  C C   . VAL C 1 222 ? -36.886 42.525   89.655  1.00 19.74 ? 303 VAL C C   1 
ATOM   7626  O O   . VAL C 1 222 ? -35.675 42.454   89.883  1.00 20.36 ? 303 VAL C O   1 
ATOM   7627  C CB  . VAL C 1 222 ? -37.676 44.343   91.052  1.00 18.16 ? 303 VAL C CB  1 
ATOM   7628  C CG1 . VAL C 1 222 ? -38.651 45.147   90.197  1.00 19.46 ? 303 VAL C CG1 1 
ATOM   7629  C CG2 . VAL C 1 222 ? -37.838 44.644   92.497  1.00 18.62 ? 303 VAL C CG2 1 
ATOM   7630  N N   . SER C 1 223 ? -37.416 42.348   88.454  1.00 20.02 ? 304 SER C N   1 
ATOM   7631  C CA  . SER C 1 223 ? -36.593 42.088   87.292  1.00 20.17 ? 304 SER C CA  1 
ATOM   7632  C C   . SER C 1 223 ? -37.064 43.124   86.298  1.00 20.90 ? 304 SER C C   1 
ATOM   7633  O O   . SER C 1 223 ? -38.230 43.534   86.317  1.00 21.30 ? 304 SER C O   1 
ATOM   7634  C CB  . SER C 1 223 ? -36.816 40.666   86.768  1.00 20.26 ? 304 SER C CB  1 
ATOM   7635  O OG  . SER C 1 223 ? -38.193 40.386   86.570  1.00 24.25 ? 304 SER C OG  1 
ATOM   7636  N N   . PHE C 1 224 ? -36.161 43.574   85.443  1.00 21.65 ? 305 PHE C N   1 
ATOM   7637  C CA  . PHE C 1 224 ? -36.534 44.583   84.480  1.00 22.14 ? 305 PHE C CA  1 
ATOM   7638  C C   . PHE C 1 224 ? -35.610 44.645   83.289  1.00 23.33 ? 305 PHE C C   1 
ATOM   7639  O O   . PHE C 1 224 ? -34.448 44.257   83.358  1.00 24.22 ? 305 PHE C O   1 
ATOM   7640  C CB  . PHE C 1 224 ? -36.608 45.943   85.179  1.00 21.12 ? 305 PHE C CB  1 
ATOM   7641  C CG  . PHE C 1 224 ? -35.406 46.267   86.015  1.00 19.27 ? 305 PHE C CG  1 
ATOM   7642  C CD1 . PHE C 1 224 ? -34.280 46.863   85.446  1.00 19.11 ? 305 PHE C CD1 1 
ATOM   7643  C CD2 . PHE C 1 224 ? -35.403 45.998   87.381  1.00 18.53 ? 305 PHE C CD2 1 
ATOM   7644  C CE1 . PHE C 1 224 ? -33.166 47.193   86.231  1.00 17.77 ? 305 PHE C CE1 1 
ATOM   7645  C CE2 . PHE C 1 224 ? -34.294 46.324   88.176  1.00 16.82 ? 305 PHE C CE2 1 
ATOM   7646  C CZ  . PHE C 1 224 ? -33.175 46.922   87.600  1.00 16.11 ? 305 PHE C CZ  1 
ATOM   7647  N N   . ASN C 1 225 ? -36.153 45.129   82.186  1.00 25.58 ? 306 ASN C N   1 
ATOM   7648  C CA  . ASN C 1 225 ? -35.408 45.253   80.945  1.00 27.47 ? 306 ASN C CA  1 
ATOM   7649  C C   . ASN C 1 225 ? -34.650 46.581   80.922  1.00 26.95 ? 306 ASN C C   1 
ATOM   7650  O O   . ASN C 1 225 ? -34.846 47.429   81.793  1.00 26.33 ? 306 ASN C O   1 
ATOM   7651  C CB  . ASN C 1 225 ? -36.381 45.172   79.769  1.00 32.08 ? 306 ASN C CB  1 
ATOM   7652  C CG  . ASN C 1 225 ? -35.714 45.457   78.462  1.00 38.81 ? 306 ASN C CG  1 
ATOM   7653  O OD1 . ASN C 1 225 ? -34.582 45.004   78.219  1.00 42.92 ? 306 ASN C OD1 1 
ATOM   7654  N ND2 . ASN C 1 225 ? -36.395 46.212   77.596  1.00 41.74 ? 306 ASN C ND2 1 
ATOM   7655  N N   . GLN C 1 226 ? -33.796 46.771   79.921  1.00 26.60 ? 308 GLN C N   1 
ATOM   7656  C CA  . GLN C 1 226 ? -33.014 47.996   79.821  1.00 26.85 ? 308 GLN C CA  1 
ATOM   7657  C C   . GLN C 1 226 ? -33.809 49.285   79.621  1.00 26.64 ? 308 GLN C C   1 
ATOM   7658  O O   . GLN C 1 226 ? -33.233 50.369   79.606  1.00 26.74 ? 308 GLN C O   1 
ATOM   7659  C CB  . GLN C 1 226 ? -31.957 47.853   78.727  1.00 27.19 ? 308 GLN C CB  1 
ATOM   7660  C CG  . GLN C 1 226 ? -30.833 46.910   79.134  1.00 28.26 ? 308 GLN C CG  1 
ATOM   7661  C CD  . GLN C 1 226 ? -29.918 46.551   77.985  1.00 28.57 ? 308 GLN C CD  1 
ATOM   7662  O OE1 . GLN C 1 226 ? -29.337 47.426   77.349  1.00 29.41 ? 308 GLN C OE1 1 
ATOM   7663  N NE2 . GLN C 1 226 ? -29.782 45.254   77.713  1.00 28.54 ? 308 GLN C NE2 1 
ATOM   7664  N N   . ASN C 1 227 ? -35.124 49.184   79.472  1.00 26.38 ? 309 ASN C N   1 
ATOM   7665  C CA  . ASN C 1 227 ? -35.934 50.386   79.320  1.00 26.24 ? 309 ASN C CA  1 
ATOM   7666  C C   . ASN C 1 227 ? -36.730 50.624   80.576  1.00 25.31 ? 309 ASN C C   1 
ATOM   7667  O O   . ASN C 1 227 ? -37.610 51.484   80.604  1.00 25.44 ? 309 ASN C O   1 
ATOM   7668  C CB  . ASN C 1 227 ? -36.876 50.266   78.134  1.00 28.49 ? 309 ASN C CB  1 
ATOM   7669  C CG  . ASN C 1 227 ? -36.145 50.378   76.826  1.00 33.23 ? 309 ASN C CG  1 
ATOM   7670  O OD1 . ASN C 1 227 ? -35.512 51.408   76.538  1.00 33.62 ? 309 ASN C OD1 1 
ATOM   7671  N ND2 . ASN C 1 227 ? -36.200 49.313   76.023  1.00 35.94 ? 309 ASN C ND2 1 
ATOM   7672  N N   . LEU C 1 228 ? -36.408 49.842   81.603  1.00 23.75 ? 310 LEU C N   1 
ATOM   7673  C CA  . LEU C 1 228 ? -37.048 49.922   82.899  1.00 23.27 ? 310 LEU C CA  1 
ATOM   7674  C C   . LEU C 1 228 ? -38.472 49.362   82.955  1.00 23.93 ? 310 LEU C C   1 
ATOM   7675  O O   . LEU C 1 228 ? -39.283 49.760   83.797  1.00 24.50 ? 310 LEU C O   1 
ATOM   7676  C CB  . LEU C 1 228 ? -36.985 51.359   83.408  1.00 21.26 ? 310 LEU C CB  1 
ATOM   7677  C CG  . LEU C 1 228 ? -35.711 51.623   84.225  1.00 23.04 ? 310 LEU C CG  1 
ATOM   7678  C CD1 . LEU C 1 228 ? -34.478 51.005   83.560  1.00 22.18 ? 310 LEU C CD1 1 
ATOM   7679  C CD2 . LEU C 1 228 ? -35.542 53.130   84.413  1.00 22.69 ? 310 LEU C CD2 1 
ATOM   7680  N N   . GLU C 1 229 ? -38.782 48.447   82.042  1.00 23.19 ? 311 GLU C N   1 
ATOM   7681  C CA  . GLU C 1 229 ? -40.082 47.785   82.066  1.00 23.03 ? 311 GLU C CA  1 
ATOM   7682  C C   . GLU C 1 229 ? -39.793 46.647   83.049  1.00 22.08 ? 311 GLU C C   1 
ATOM   7683  O O   . GLU C 1 229 ? -38.797 45.924   82.907  1.00 19.95 ? 311 GLU C O   1 
ATOM   7684  C CB  . GLU C 1 229 ? -40.438 47.262   80.684  1.00 23.58 ? 311 GLU C CB  1 
ATOM   7685  C CG  . GLU C 1 229 ? -40.401 48.352   79.655  1.00 26.35 ? 311 GLU C CG  1 
ATOM   7686  C CD  . GLU C 1 229 ? -40.495 47.831   78.248  1.00 28.64 ? 311 GLU C CD  1 
ATOM   7687  O OE1 . GLU C 1 229 ? -39.880 46.787   77.948  1.00 30.12 ? 311 GLU C OE1 1 
ATOM   7688  O OE2 . GLU C 1 229 ? -41.174 48.481   77.429  1.00 33.15 ? 311 GLU C OE2 1 
ATOM   7689  N N   . TYR C 1 230 ? -40.663 46.484   84.037  1.00 20.58 ? 312 TYR C N   1 
ATOM   7690  C CA  . TYR C 1 230 ? -40.413 45.511   85.088  1.00 19.60 ? 312 TYR C CA  1 
ATOM   7691  C C   . TYR C 1 230 ? -41.565 44.598   85.487  1.00 20.56 ? 312 TYR C C   1 
ATOM   7692  O O   . TYR C 1 230 ? -42.706 44.753   85.048  1.00 20.47 ? 312 TYR C O   1 
ATOM   7693  C CB  . TYR C 1 230 ? -39.984 46.289   86.322  1.00 16.41 ? 312 TYR C CB  1 
ATOM   7694  C CG  . TYR C 1 230 ? -41.123 47.153   86.833  1.00 13.28 ? 312 TYR C CG  1 
ATOM   7695  C CD1 . TYR C 1 230 ? -42.097 46.624   87.683  1.00 11.12 ? 312 TYR C CD1 1 
ATOM   7696  C CD2 . TYR C 1 230 ? -41.264 48.481   86.417  1.00 13.40 ? 312 TYR C CD2 1 
ATOM   7697  C CE1 . TYR C 1 230 ? -43.179 47.386   88.107  1.00 10.27 ? 312 TYR C CE1 1 
ATOM   7698  C CE2 . TYR C 1 230 ? -42.357 49.263   86.838  1.00 11.72 ? 312 TYR C CE2 1 
ATOM   7699  C CZ  . TYR C 1 230 ? -43.307 48.704   87.687  1.00 12.59 ? 312 TYR C CZ  1 
ATOM   7700  O OH  . TYR C 1 230 ? -44.375 49.453   88.132  1.00 12.73 ? 312 TYR C OH  1 
ATOM   7701  N N   . GLN C 1 231 ? -41.236 43.667   86.376  1.00 21.83 ? 313 GLN C N   1 
ATOM   7702  C CA  . GLN C 1 231 ? -42.187 42.717   86.933  1.00 22.71 ? 313 GLN C CA  1 
ATOM   7703  C C   . GLN C 1 231 ? -41.799 42.541   88.387  1.00 22.67 ? 313 GLN C C   1 
ATOM   7704  O O   . GLN C 1 231 ? -40.614 42.561   88.724  1.00 22.70 ? 313 GLN C O   1 
ATOM   7705  C CB  . GLN C 1 231 ? -42.117 41.382   86.195  1.00 23.27 ? 313 GLN C CB  1 
ATOM   7706  C CG  . GLN C 1 231 ? -42.618 41.482   84.763  1.00 27.30 ? 313 GLN C CG  1 
ATOM   7707  C CD  . GLN C 1 231 ? -42.502 40.177   83.987  1.00 29.75 ? 313 GLN C CD  1 
ATOM   7708  O OE1 . GLN C 1 231 ? -42.972 40.078   82.846  1.00 31.71 ? 313 GLN C OE1 1 
ATOM   7709  N NE2 . GLN C 1 231 ? -41.874 39.171   84.595  1.00 30.25 ? 313 GLN C NE2 1 
ATOM   7710  N N   . ILE C 1 232 ? -42.791 42.375   89.252  1.00 23.13 ? 314 ILE C N   1 
ATOM   7711  C CA  . ILE C 1 232 ? -42.518 42.215   90.673  1.00 23.53 ? 314 ILE C CA  1 
ATOM   7712  C C   . ILE C 1 232 ? -43.192 40.997   91.284  1.00 23.45 ? 314 ILE C C   1 
ATOM   7713  O O   . ILE C 1 232 ? -44.272 40.589   90.850  1.00 23.87 ? 314 ILE C O   1 
ATOM   7714  C CB  . ILE C 1 232 ? -42.993 43.448   91.463  1.00 22.84 ? 314 ILE C CB  1 
ATOM   7715  C CG1 . ILE C 1 232 ? -44.500 43.621   91.273  1.00 22.74 ? 314 ILE C CG1 1 
ATOM   7716  C CG2 . ILE C 1 232 ? -42.255 44.693   90.987  1.00 22.98 ? 314 ILE C CG2 1 
ATOM   7717  C CD1 . ILE C 1 232 ? -45.095 44.729   92.111  1.00 21.43 ? 314 ILE C CD1 1 
ATOM   7718  N N   . GLY C 1 233 ? -42.553 40.439   92.311  1.00 23.31 ? 315 GLY C N   1 
ATOM   7719  C CA  . GLY C 1 233 ? -43.105 39.293   93.017  1.00 21.05 ? 315 GLY C CA  1 
ATOM   7720  C C   . GLY C 1 233 ? -42.362 38.967   94.306  1.00 20.43 ? 315 GLY C C   1 
ATOM   7721  O O   . GLY C 1 233 ? -41.537 39.748   94.794  1.00 20.15 ? 315 GLY C O   1 
ATOM   7722  N N   . TYR C 1 234 ? -42.674 37.805   94.868  1.00 18.73 ? 316 TYR C N   1 
ATOM   7723  C CA  . TYR C 1 234 ? -42.022 37.316   96.073  1.00 17.32 ? 316 TYR C CA  1 
ATOM   7724  C C   . TYR C 1 234 ? -41.634 35.876   95.773  1.00 17.31 ? 316 TYR C C   1 
ATOM   7725  O O   . TYR C 1 234 ? -42.309 35.196   95.004  1.00 16.49 ? 316 TYR C O   1 
ATOM   7726  C CB  . TYR C 1 234 ? -42.970 37.347   97.277  1.00 16.13 ? 316 TYR C CB  1 
ATOM   7727  C CG  . TYR C 1 234 ? -43.008 38.657   98.038  1.00 14.07 ? 316 TYR C CG  1 
ATOM   7728  C CD1 . TYR C 1 234 ? -43.794 39.728   97.603  1.00 13.48 ? 316 TYR C CD1 1 
ATOM   7729  C CD2 . TYR C 1 234 ? -42.258 38.822   99.202  1.00 12.73 ? 316 TYR C CD2 1 
ATOM   7730  C CE1 . TYR C 1 234 ? -43.830 40.936   98.318  1.00 12.75 ? 316 TYR C CE1 1 
ATOM   7731  C CE2 . TYR C 1 234 ? -42.284 40.016   99.924  1.00 13.07 ? 316 TYR C CE2 1 
ATOM   7732  C CZ  . TYR C 1 234 ? -43.070 41.069   99.479  1.00 13.44 ? 316 TYR C CZ  1 
ATOM   7733  O OH  . TYR C 1 234 ? -43.081 42.240   100.197 1.00 10.10 ? 316 TYR C OH  1 
ATOM   7734  N N   . ILE C 1 235 ? -40.534 35.413   96.354  1.00 17.82 ? 317 ILE C N   1 
ATOM   7735  C CA  . ILE C 1 235 ? -40.117 34.032   96.141  1.00 18.27 ? 317 ILE C CA  1 
ATOM   7736  C C   . ILE C 1 235 ? -41.126 33.160   96.906  1.00 18.86 ? 317 ILE C C   1 
ATOM   7737  O O   . ILE C 1 235 ? -41.245 33.247   98.125  1.00 19.99 ? 317 ILE C O   1 
ATOM   7738  C CB  . ILE C 1 235 ? -38.661 33.821   96.628  1.00 17.09 ? 317 ILE C CB  1 
ATOM   7739  C CG1 . ILE C 1 235 ? -37.717 34.710   95.806  1.00 15.55 ? 317 ILE C CG1 1 
ATOM   7740  C CG2 . ILE C 1 235 ? -38.251 32.377   96.459  1.00 15.62 ? 317 ILE C CG2 1 
ATOM   7741  C CD1 . ILE C 1 235 ? -36.263 34.530   96.131  1.00 13.22 ? 317 ILE C CD1 1 
ATOM   7742  N N   . CYS C 1 236 ? -41.856 32.330   96.167  1.00 20.70 ? 318 CYS C N   1 
ATOM   7743  C CA  . CYS C 1 236 ? -42.916 31.488   96.726  1.00 21.37 ? 318 CYS C CA  1 
ATOM   7744  C C   . CYS C 1 236 ? -42.524 30.316   97.651  1.00 20.99 ? 318 CYS C C   1 
ATOM   7745  O O   . CYS C 1 236 ? -43.355 29.834   98.427  1.00 21.17 ? 318 CYS C O   1 
ATOM   7746  C CB  . CYS C 1 236 ? -43.798 30.963   95.578  1.00 22.09 ? 318 CYS C CB  1 
ATOM   7747  S SG  . CYS C 1 236 ? -44.231 32.116   94.221  1.00 24.20 ? 318 CYS C SG  1 
ATOM   7748  N N   . SER C 1 237 ? -41.273 29.873   97.579  1.00 19.99 ? 319 SER C N   1 
ATOM   7749  C CA  . SER C 1 237 ? -40.796 28.760   98.389  1.00 19.65 ? 319 SER C CA  1 
ATOM   7750  C C   . SER C 1 237 ? -41.131 28.763   99.883  1.00 20.24 ? 319 SER C C   1 
ATOM   7751  O O   . SER C 1 237 ? -41.166 29.805   100.543 1.00 19.78 ? 319 SER C O   1 
ATOM   7752  C CB  . SER C 1 237 ? -39.283 28.631   98.240  1.00 20.59 ? 319 SER C CB  1 
ATOM   7753  O OG  . SER C 1 237 ? -38.773 27.668   99.150  1.00 22.25 ? 319 SER C OG  1 
ATOM   7754  N N   . GLY C 1 238 ? -41.353 27.559   100.401 1.00 21.30 ? 320 GLY C N   1 
ATOM   7755  C CA  . GLY C 1 238 ? -41.646 27.369   101.810 1.00 21.53 ? 320 GLY C CA  1 
ATOM   7756  C C   . GLY C 1 238 ? -40.348 27.355   102.604 1.00 21.59 ? 320 GLY C C   1 
ATOM   7757  O O   . GLY C 1 238 ? -40.359 27.116   103.813 1.00 22.93 ? 320 GLY C O   1 
ATOM   7758  N N   . VAL C 1 239 ? -39.228 27.581   101.912 1.00 21.15 ? 321 VAL C N   1 
ATOM   7759  C CA  . VAL C 1 239 ? -37.901 27.660   102.543 1.00 20.07 ? 321 VAL C CA  1 
ATOM   7760  C C   . VAL C 1 239 ? -37.660 29.170   102.657 1.00 19.18 ? 321 VAL C C   1 
ATOM   7761  O O   . VAL C 1 239 ? -36.928 29.760   101.867 1.00 17.82 ? 321 VAL C O   1 
ATOM   7762  C CB  . VAL C 1 239 ? -36.779 27.003   101.653 1.00 20.11 ? 321 VAL C CB  1 
ATOM   7763  C CG1 . VAL C 1 239 ? -35.427 27.103   102.338 1.00 19.89 ? 321 VAL C CG1 1 
ATOM   7764  C CG2 . VAL C 1 239 ? -37.093 25.534   101.399 1.00 20.83 ? 321 VAL C CG2 1 
ATOM   7765  N N   . PHE C 1 240 ? -38.322 29.779   103.637 1.00 18.80 ? 322 PHE C N   1 
ATOM   7766  C CA  . PHE C 1 240 ? -38.261 31.218   103.886 1.00 18.41 ? 322 PHE C CA  1 
ATOM   7767  C C   . PHE C 1 240 ? -36.837 31.753   103.984 1.00 18.46 ? 322 PHE C C   1 
ATOM   7768  O O   . PHE C 1 240 ? -36.012 31.190   104.705 1.00 19.68 ? 322 PHE C O   1 
ATOM   7769  C CB  . PHE C 1 240 ? -39.048 31.530   105.155 1.00 18.25 ? 322 PHE C CB  1 
ATOM   7770  C CG  . PHE C 1 240 ? -40.449 30.963   105.150 1.00 19.62 ? 322 PHE C CG  1 
ATOM   7771  C CD1 . PHE C 1 240 ? -40.808 29.960   106.042 1.00 18.43 ? 322 PHE C CD1 1 
ATOM   7772  C CD2 . PHE C 1 240 ? -41.405 31.421   104.240 1.00 18.95 ? 322 PHE C CD2 1 
ATOM   7773  C CE1 . PHE C 1 240 ? -42.098 29.416   106.031 1.00 18.95 ? 322 PHE C CE1 1 
ATOM   7774  C CE2 . PHE C 1 240 ? -42.694 30.883   104.222 1.00 18.49 ? 322 PHE C CE2 1 
ATOM   7775  C CZ  . PHE C 1 240 ? -43.039 29.874   105.124 1.00 17.78 ? 322 PHE C CZ  1 
ATOM   7776  N N   . GLY C 1 241 ? -36.566 32.851   103.277 1.00 16.44 ? 323 GLY C N   1 
ATOM   7777  C CA  . GLY C 1 241 ? -35.226 33.414   103.258 1.00 16.28 ? 323 GLY C CA  1 
ATOM   7778  C C   . GLY C 1 241 ? -34.865 34.591   104.148 1.00 16.45 ? 323 GLY C C   1 
ATOM   7779  O O   . GLY C 1 241 ? -33.675 34.847   104.360 1.00 17.88 ? 323 GLY C O   1 
ATOM   7780  N N   . ASP C 1 242 ? -35.854 35.311   104.668 1.00 14.52 ? 324 ASP C N   1 
ATOM   7781  C CA  . ASP C 1 242 ? -35.579 36.468   105.531 1.00 14.82 ? 324 ASP C CA  1 
ATOM   7782  C C   . ASP C 1 242 ? -35.204 35.990   106.948 1.00 15.04 ? 324 ASP C C   1 
ATOM   7783  O O   . ASP C 1 242 ? -35.321 34.809   107.281 1.00 15.12 ? 324 ASP C O   1 
ATOM   7784  C CB  . ASP C 1 242 ? -36.827 37.392   105.589 1.00 11.71 ? 324 ASP C CB  1 
ATOM   7785  C CG  . ASP C 1 242 ? -36.502 38.835   106.011 1.00 13.67 ? 324 ASP C CG  1 
ATOM   7786  O OD1 . ASP C 1 242 ? -37.458 39.641   106.232 1.00 14.90 ? 324 ASP C OD1 1 
ATOM   7787  O OD2 . ASP C 1 242 ? -35.301 39.171   106.120 1.00 11.13 ? 324 ASP C OD2 1 
ATOM   7788  N N   . ASN C 1 243 ? -34.730 36.919   107.764 1.00 15.12 ? 325 ASN C N   1 
ATOM   7789  C CA  . ASN C 1 243 ? -34.388 36.643   109.142 1.00 15.73 ? 325 ASN C CA  1 
ATOM   7790  C C   . ASN C 1 243 ? -34.617 37.921   109.911 1.00 15.60 ? 325 ASN C C   1 
ATOM   7791  O O   . ASN C 1 243 ? -33.989 38.928   109.636 1.00 16.17 ? 325 ASN C O   1 
ATOM   7792  C CB  . ASN C 1 243 ? -32.937 36.217   109.302 1.00 16.74 ? 325 ASN C CB  1 
ATOM   7793  C CG  . ASN C 1 243 ? -32.528 36.140   110.762 1.00 17.68 ? 325 ASN C CG  1 
ATOM   7794  O OD1 . ASN C 1 243 ? -32.121 37.139   111.357 1.00 19.22 ? 325 ASN C OD1 1 
ATOM   7795  N ND2 . ASN C 1 243 ? -32.673 34.964   111.359 1.00 16.43 ? 325 ASN C ND2 1 
ATOM   7796  N N   . PRO C 1 244 ? -35.489 37.878   110.923 1.00 15.30 ? 326 PRO C N   1 
ATOM   7797  C CA  . PRO C 1 244 ? -36.228 36.683   111.347 1.00 15.36 ? 326 PRO C CA  1 
ATOM   7798  C C   . PRO C 1 244 ? -37.193 36.122   110.308 1.00 15.81 ? 326 PRO C C   1 
ATOM   7799  O O   . PRO C 1 244 ? -37.399 36.711   109.246 1.00 18.54 ? 326 PRO C O   1 
ATOM   7800  C CB  . PRO C 1 244 ? -36.950 37.157   112.602 1.00 13.25 ? 326 PRO C CB  1 
ATOM   7801  C CG  . PRO C 1 244 ? -37.294 38.553   112.253 1.00 13.18 ? 326 PRO C CG  1 
ATOM   7802  C CD  . PRO C 1 244 ? -36.024 39.082   111.591 1.00 13.90 ? 326 PRO C CD  1 
ATOM   7803  N N   . ARG C 1 245 ? -37.770 34.974   110.639 1.00 16.41 ? 327 ARG C N   1 
ATOM   7804  C CA  . ARG C 1 245 ? -38.710 34.264   109.787 1.00 16.50 ? 327 ARG C CA  1 
ATOM   7805  C C   . ARG C 1 245 ? -39.224 33.099   110.624 1.00 17.72 ? 327 ARG C C   1 
ATOM   7806  O O   . ARG C 1 245 ? -38.734 32.864   111.720 1.00 18.90 ? 327 ARG C O   1 
ATOM   7807  C CB  . ARG C 1 245 ? -37.997 33.687   108.558 1.00 15.49 ? 327 ARG C CB  1 
ATOM   7808  C CG  . ARG C 1 245 ? -36.919 32.646   108.919 1.00 14.73 ? 327 ARG C CG  1 
ATOM   7809  C CD  . ARG C 1 245 ? -36.575 31.730   107.740 1.00 14.67 ? 327 ARG C CD  1 
ATOM   7810  N NE  . ARG C 1 245 ? -35.570 30.723   108.075 1.00 11.40 ? 327 ARG C NE  1 
ATOM   7811  C CZ  . ARG C 1 245 ? -34.285 30.986   108.307 1.00 14.51 ? 327 ARG C CZ  1 
ATOM   7812  N NH1 . ARG C 1 245 ? -33.447 30.002   108.605 1.00 13.91 ? 327 ARG C NH1 1 
ATOM   7813  N NH2 . ARG C 1 245 ? -33.828 32.230   108.232 1.00 14.92 ? 327 ARG C NH2 1 
ATOM   7814  N N   . PRO C 1 246 ? -40.235 32.369   110.124 1.00 18.70 ? 328 PRO C N   1 
ATOM   7815  C CA  . PRO C 1 246 ? -40.813 31.210   110.826 1.00 19.26 ? 328 PRO C CA  1 
ATOM   7816  C C   . PRO C 1 246 ? -40.200 29.873   110.350 1.00 19.57 ? 328 PRO C C   1 
ATOM   7817  O O   . PRO C 1 246 ? -39.571 29.827   109.291 1.00 19.25 ? 328 PRO C O   1 
ATOM   7818  C CB  . PRO C 1 246 ? -42.296 31.311   110.475 1.00 18.88 ? 328 PRO C CB  1 
ATOM   7819  C CG  . PRO C 1 246 ? -42.250 31.830   109.070 1.00 18.51 ? 328 PRO C CG  1 
ATOM   7820  C CD  . PRO C 1 246 ? -41.200 32.916   109.146 1.00 17.40 ? 328 PRO C CD  1 
ATOM   7821  N N   . ASN C 1 247 ? -40.375 28.794   111.121 1.00 20.51 ? 329 ASN C N   1 
ATOM   7822  C CA  . ASN C 1 247 ? -39.841 27.491   110.697 1.00 21.18 ? 329 ASN C CA  1 
ATOM   7823  C C   . ASN C 1 247 ? -40.383 27.233   109.292 1.00 21.50 ? 329 ASN C C   1 
ATOM   7824  O O   . ASN C 1 247 ? -41.419 27.775   108.914 1.00 23.41 ? 329 ASN C O   1 
ATOM   7825  C CB  . ASN C 1 247 ? -40.308 26.360   111.619 1.00 23.02 ? 329 ASN C CB  1 
ATOM   7826  C CG  . ASN C 1 247 ? -39.888 26.556   113.068 1.00 24.01 ? 329 ASN C CG  1 
ATOM   7827  O OD1 . ASN C 1 247 ? -38.708 26.736   113.377 1.00 23.18 ? 329 ASN C OD1 1 
ATOM   7828  N ND2 . ASN C 1 247 ? -40.863 26.510   113.968 1.00 23.03 ? 329 ASN C ND2 1 
ATOM   7829  N N   . ASP C 1 248 ? -39.704 26.413   108.507 1.00 21.32 ? 330 ASP C N   1 
ATOM   7830  C CA  . ASP C 1 248 ? -40.188 26.170   107.158 1.00 21.88 ? 330 ASP C CA  1 
ATOM   7831  C C   . ASP C 1 248 ? -41.569 25.535   107.138 1.00 22.48 ? 330 ASP C C   1 
ATOM   7832  O O   . ASP C 1 248 ? -41.919 24.743   108.020 1.00 21.32 ? 330 ASP C O   1 
ATOM   7833  C CB  . ASP C 1 248 ? -39.208 25.295   106.372 1.00 23.42 ? 330 ASP C CB  1 
ATOM   7834  C CG  . ASP C 1 248 ? -37.924 26.023   106.034 1.00 23.76 ? 330 ASP C CG  1 
ATOM   7835  O OD1 . ASP C 1 248 ? -37.986 27.239   105.717 1.00 23.41 ? 330 ASP C OD1 1 
ATOM   7836  O OD2 . ASP C 1 248 ? -36.858 25.375   106.070 1.00 23.59 ? 330 ASP C OD2 1 
ATOM   7837  N N   . GLY C 1 249 ? -42.346 25.897   106.120 1.00 23.03 ? 331 GLY C N   1 
ATOM   7838  C CA  . GLY C 1 249 ? -43.689 25.368   105.970 1.00 24.30 ? 331 GLY C CA  1 
ATOM   7839  C C   . GLY C 1 249 ? -44.257 25.657   104.593 1.00 25.62 ? 331 GLY C C   1 
ATOM   7840  O O   . GLY C 1 249 ? -43.614 25.396   103.571 1.00 27.06 ? 331 GLY C O   1 
ATOM   7841  N N   . THR C 1 250 ? -45.476 26.180   104.550 1.00 25.71 ? 332 THR C N   1 
ATOM   7842  C CA  . THR C 1 250 ? -46.090 26.512   103.272 1.00 25.61 ? 332 THR C CA  1 
ATOM   7843  C C   . THR C 1 250 ? -45.788 27.968   102.995 1.00 24.47 ? 332 THR C C   1 
ATOM   7844  O O   . THR C 1 250 ? -46.141 28.840   103.780 1.00 24.12 ? 332 THR C O   1 
ATOM   7845  C CB  . THR C 1 250 ? -47.624 26.287   103.291 1.00 27.03 ? 332 THR C CB  1 
ATOM   7846  O OG1 . THR C 1 250 ? -47.895 24.879   103.319 1.00 26.92 ? 332 THR C OG1 1 
ATOM   7847  C CG2 . THR C 1 250 ? -48.284 26.893   102.036 1.00 27.11 ? 332 THR C CG2 1 
ATOM   7848  N N   . GLY C 1 251 ? -45.113 28.214   101.881 1.00 24.41 ? 333 GLY C N   1 
ATOM   7849  C CA  . GLY C 1 251 ? -44.749 29.562   101.513 1.00 24.05 ? 333 GLY C CA  1 
ATOM   7850  C C   . GLY C 1 251 ? -45.887 30.285   100.828 1.00 24.77 ? 333 GLY C C   1 
ATOM   7851  O O   . GLY C 1 251 ? -47.045 29.857   100.863 1.00 26.13 ? 333 GLY C O   1 
ATOM   7852  N N   . SER C 1 252 ? -45.558 31.400   100.196 1.00 24.13 ? 335 SER C N   1 
ATOM   7853  C CA  . SER C 1 252 ? -46.550 32.194   99.505  1.00 23.10 ? 335 SER C CA  1 
ATOM   7854  C C   . SER C 1 252 ? -45.867 32.977   98.411  1.00 23.31 ? 335 SER C C   1 
ATOM   7855  O O   . SER C 1 252 ? -44.678 33.247   98.483  1.00 24.20 ? 335 SER C O   1 
ATOM   7856  C CB  . SER C 1 252 ? -47.191 33.179   100.468 1.00 24.62 ? 335 SER C CB  1 
ATOM   7857  O OG  . SER C 1 252 ? -47.948 34.152   99.760  1.00 25.13 ? 335 SER C OG  1 
ATOM   7858  N N   . CYS C 1 253 ? -46.613 33.338   97.384  1.00 22.71 ? 336 CYS C N   1 
ATOM   7859  C CA  . CYS C 1 253 ? -46.015 34.133   96.339  1.00 23.87 ? 336 CYS C CA  1 
ATOM   7860  C C   . CYS C 1 253 ? -46.149 35.613   96.750  1.00 22.38 ? 336 CYS C C   1 
ATOM   7861  O O   . CYS C 1 253 ? -45.592 36.504   96.085  1.00 21.75 ? 336 CYS C O   1 
ATOM   7862  C CB  . CYS C 1 253 ? -46.679 33.878   95.000  1.00 24.83 ? 336 CYS C CB  1 
ATOM   7863  S SG  . CYS C 1 253 ? -46.264 32.291   94.232  1.00 30.60 ? 336 CYS C SG  1 
ATOM   7864  N N   . GLY C 1 254 ? -46.848 35.882   97.856  1.00 22.05 ? 339 GLY C N   1 
ATOM   7865  C CA  . GLY C 1 254 ? -46.971 37.266   98.311  1.00 22.00 ? 339 GLY C CA  1 
ATOM   7866  C C   . GLY C 1 254 ? -46.274 37.350   99.651  1.00 22.33 ? 339 GLY C C   1 
ATOM   7867  O O   . GLY C 1 254 ? -45.655 36.365   100.074 1.00 23.93 ? 339 GLY C O   1 
ATOM   7868  N N   . PRO C 1 255 ? -46.346 38.486   100.354 1.00 21.51 ? 340 PRO C N   1 
ATOM   7869  C CA  . PRO C 1 255 ? -45.679 38.591   101.658 1.00 20.00 ? 340 PRO C CA  1 
ATOM   7870  C C   . PRO C 1 255 ? -46.135 37.655   102.786 1.00 20.41 ? 340 PRO C C   1 
ATOM   7871  O O   . PRO C 1 255 ? -47.297 37.708   103.192 1.00 21.42 ? 340 PRO C O   1 
ATOM   7872  C CB  . PRO C 1 255 ? -45.943 40.039   102.072 1.00 19.93 ? 340 PRO C CB  1 
ATOM   7873  C CG  . PRO C 1 255 ? -46.124 40.747   100.811 1.00 21.37 ? 340 PRO C CG  1 
ATOM   7874  C CD  . PRO C 1 255 ? -46.926 39.783   99.967  1.00 20.94 ? 340 PRO C CD  1 
ATOM   7875  N N   . VAL C 1 256 ? -45.219 36.849   103.320 1.00 19.96 ? 341 VAL C N   1 
ATOM   7876  C CA  . VAL C 1 256 ? -45.513 35.951   104.442 1.00 20.34 ? 341 VAL C CA  1 
ATOM   7877  C C   . VAL C 1 256 ? -45.336 36.782   105.732 1.00 21.89 ? 341 VAL C C   1 
ATOM   7878  O O   . VAL C 1 256 ? -44.206 37.044   106.179 1.00 22.58 ? 341 VAL C O   1 
ATOM   7879  C CB  . VAL C 1 256 ? -44.533 34.755   104.468 1.00 20.58 ? 341 VAL C CB  1 
ATOM   7880  C CG1 . VAL C 1 256 ? -44.745 33.963   105.721 1.00 19.18 ? 341 VAL C CG1 1 
ATOM   7881  C CG2 . VAL C 1 256 ? -44.713 33.857   103.223 1.00 19.15 ? 341 VAL C CG2 1 
ATOM   7882  N N   . SER C 1 257 ? -46.458 37.199   106.310 1.00 21.23 ? 342 SER C N   1 
ATOM   7883  C CA  . SER C 1 257 ? -46.460 38.046   107.490 1.00 22.26 ? 342 SER C CA  1 
ATOM   7884  C C   . SER C 1 257 ? -45.803 37.519   108.780 1.00 23.55 ? 342 SER C C   1 
ATOM   7885  O O   . SER C 1 257 ? -45.199 38.311   109.517 1.00 24.14 ? 342 SER C O   1 
ATOM   7886  C CB  . SER C 1 257 ? -47.903 38.499   107.777 1.00 21.99 ? 342 SER C CB  1 
ATOM   7887  O OG  . SER C 1 257 ? -48.758 37.420   108.102 1.00 21.14 ? 342 SER C OG  1 
ATOM   7888  N N   . SER C 1 258 ? -45.937 36.222   109.077 1.00 24.73 ? 344 SER C N   1 
ATOM   7889  C CA  . SER C 1 258 ? -45.359 35.676   110.297 1.00 27.50 ? 344 SER C CA  1 
ATOM   7890  C C   . SER C 1 258 ? -43.897 36.004   110.423 1.00 28.52 ? 344 SER C C   1 
ATOM   7891  O O   . SER C 1 258 ? -43.091 35.590   109.601 1.00 27.22 ? 344 SER C O   1 
ATOM   7892  C CB  . SER C 1 258 ? -45.568 34.156   110.410 1.00 27.63 ? 344 SER C CB  1 
ATOM   7893  O OG  . SER C 1 258 ? -45.017 33.479   109.304 1.00 34.24 ? 344 SER C OG  1 
ATOM   7894  N N   . ASN C 1 259 ? -43.572 36.766   111.463 1.00 30.11 ? 345 ASN C N   1 
ATOM   7895  C CA  . ASN C 1 259 ? -42.208 37.165   111.748 1.00 31.75 ? 345 ASN C CA  1 
ATOM   7896  C C   . ASN C 1 259 ? -41.512 38.074   110.766 1.00 31.09 ? 345 ASN C C   1 
ATOM   7897  O O   . ASN C 1 259 ? -40.406 38.480   111.058 1.00 32.60 ? 345 ASN C O   1 
ATOM   7898  C CB  . ASN C 1 259 ? -41.341 35.930   111.983 1.00 33.61 ? 345 ASN C CB  1 
ATOM   7899  C CG  . ASN C 1 259 ? -40.773 35.903   113.379 1.00 36.33 ? 345 ASN C CG  1 
ATOM   7900  O OD1 . ASN C 1 259 ? -40.547 36.958   113.984 1.00 39.02 ? 345 ASN C OD1 1 
ATOM   7901  N ND2 . ASN C 1 259 ? -40.553 34.713   113.911 1.00 35.15 ? 345 ASN C ND2 1 
ATOM   7902  N N   . GLY C 1 260 A -42.143 38.436   109.651 1.00 28.82 ? 345 GLY C N   1 
ATOM   7903  C CA  . GLY C 1 260 A -41.459 39.285   108.701 1.00 27.96 ? 345 GLY C CA  1 
ATOM   7904  C C   . GLY C 1 260 A -41.406 40.753   109.032 1.00 26.95 ? 345 GLY C C   1 
ATOM   7905  O O   . GLY C 1 260 A -41.039 41.530   108.167 1.00 27.94 ? 345 GLY C O   1 
ATOM   7906  N N   . ALA C 1 261 ? -41.755 41.145   110.254 1.00 26.75 ? 346 ALA C N   1 
ATOM   7907  C CA  . ALA C 1 261 ? -41.726 42.564   110.618 1.00 25.73 ? 346 ALA C CA  1 
ATOM   7908  C C   . ALA C 1 261 ? -40.325 43.183   110.582 1.00 26.25 ? 346 ALA C C   1 
ATOM   7909  O O   . ALA C 1 261 ? -40.186 44.407   110.602 1.00 29.35 ? 346 ALA C O   1 
ATOM   7910  C CB  . ALA C 1 261 ? -42.356 42.785   111.989 1.00 24.70 ? 346 ALA C CB  1 
ATOM   7911  N N   . TYR C 1 262 ? -39.284 42.356   110.553 1.00 23.12 ? 347 TYR C N   1 
ATOM   7912  C CA  . TYR C 1 262 ? -37.914 42.878   110.471 1.00 20.38 ? 347 TYR C CA  1 
ATOM   7913  C C   . TYR C 1 262 ? -37.212 42.109   109.333 1.00 18.66 ? 347 TYR C C   1 
ATOM   7914  O O   . TYR C 1 262 ? -37.875 41.613   108.405 1.00 19.85 ? 347 TYR C O   1 
ATOM   7915  C CB  . TYR C 1 262 ? -37.215 42.700   111.837 1.00 20.13 ? 347 TYR C CB  1 
ATOM   7916  C CG  . TYR C 1 262 ? -35.826 43.309   112.027 1.00 19.10 ? 347 TYR C CG  1 
ATOM   7917  C CD1 . TYR C 1 262 ? -35.538 44.635   111.677 1.00 19.50 ? 347 TYR C CD1 1 
ATOM   7918  C CD2 . TYR C 1 262 ? -34.811 42.556   112.611 1.00 19.89 ? 347 TYR C CD2 1 
ATOM   7919  C CE1 . TYR C 1 262 ? -34.257 45.186   111.907 1.00 17.37 ? 347 TYR C CE1 1 
ATOM   7920  C CE2 . TYR C 1 262 ? -33.549 43.089   112.845 1.00 19.17 ? 347 TYR C CE2 1 
ATOM   7921  C CZ  . TYR C 1 262 ? -33.271 44.395   112.495 1.00 19.70 ? 347 TYR C CZ  1 
ATOM   7922  O OH  . TYR C 1 262 ? -31.995 44.862   112.743 1.00 19.79 ? 347 TYR C OH  1 
ATOM   7923  N N   . GLY C 1 263 ? -35.892 42.010   109.374 1.00 16.55 ? 348 GLY C N   1 
ATOM   7924  C CA  . GLY C 1 263 ? -35.211 41.276   108.323 1.00 15.35 ? 348 GLY C CA  1 
ATOM   7925  C C   . GLY C 1 263 ? -33.712 41.452   108.341 1.00 14.32 ? 348 GLY C C   1 
ATOM   7926  O O   . GLY C 1 263 ? -33.149 41.955   109.312 1.00 14.15 ? 348 GLY C O   1 
ATOM   7927  N N   . VAL C 1 264 ? -33.076 41.004   107.267 1.00 13.76 ? 349 VAL C N   1 
ATOM   7928  C CA  . VAL C 1 264 ? -31.647 41.125   107.080 1.00 12.92 ? 349 VAL C CA  1 
ATOM   7929  C C   . VAL C 1 264 ? -31.465 41.108   105.572 1.00 14.31 ? 349 VAL C C   1 
ATOM   7930  O O   . VAL C 1 264 ? -32.176 40.391   104.868 1.00 14.04 ? 349 VAL C O   1 
ATOM   7931  C CB  . VAL C 1 264 ? -30.874 39.939   107.696 1.00 13.85 ? 349 VAL C CB  1 
ATOM   7932  C CG1 . VAL C 1 264 ? -31.239 38.628   106.990 1.00 12.08 ? 349 VAL C CG1 1 
ATOM   7933  C CG2 . VAL C 1 264 ? -29.382 40.202   107.586 1.00 12.45 ? 349 VAL C CG2 1 
ATOM   7934  N N   . LYS C 1 265 ? -30.526 41.901   105.074 1.00 13.69 ? 350 LYS C N   1 
ATOM   7935  C CA  . LYS C 1 265 ? -30.268 41.949   103.640 1.00 14.25 ? 350 LYS C CA  1 
ATOM   7936  C C   . LYS C 1 265 ? -29.843 40.570   103.161 1.00 13.56 ? 350 LYS C C   1 
ATOM   7937  O O   . LYS C 1 265 ? -29.096 39.881   103.845 1.00 14.43 ? 350 LYS C O   1 
ATOM   7938  C CB  . LYS C 1 265 ? -29.158 42.956   103.334 1.00 13.78 ? 350 LYS C CB  1 
ATOM   7939  C CG  . LYS C 1 265 ? -28.649 42.895   101.909 1.00 12.16 ? 350 LYS C CG  1 
ATOM   7940  C CD  . LYS C 1 265 ? -27.581 43.943   101.681 1.00 12.51 ? 350 LYS C CD  1 
ATOM   7941  C CE  . LYS C 1 265 ? -26.975 43.816   100.293 1.00 12.35 ? 350 LYS C CE  1 
ATOM   7942  N NZ  . LYS C 1 265 ? -28.018 43.885   99.234  1.00 8.38  ? 350 LYS C NZ  1 
ATOM   7943  N N   . GLY C 1 266 ? -30.314 40.176   101.985 1.00 12.87 ? 351 GLY C N   1 
ATOM   7944  C CA  . GLY C 1 266 ? -29.958 38.876   101.456 1.00 12.49 ? 351 GLY C CA  1 
ATOM   7945  C C   . GLY C 1 266 ? -29.984 38.841   99.946  1.00 12.89 ? 351 GLY C C   1 
ATOM   7946  O O   . GLY C 1 266 ? -30.178 39.861   99.297  1.00 13.11 ? 351 GLY C O   1 
ATOM   7947  N N   . PHE C 1 267 ? -29.795 37.653   99.386  1.00 14.42 ? 352 PHE C N   1 
ATOM   7948  C CA  . PHE C 1 267 ? -29.794 37.475   97.941  1.00 14.20 ? 352 PHE C CA  1 
ATOM   7949  C C   . PHE C 1 267 ? -30.372 36.109   97.582  1.00 14.63 ? 352 PHE C C   1 
ATOM   7950  O O   . PHE C 1 267 ? -30.793 35.361   98.457  1.00 15.10 ? 352 PHE C O   1 
ATOM   7951  C CB  . PHE C 1 267 ? -28.370 37.561   97.405  1.00 12.34 ? 352 PHE C CB  1 
ATOM   7952  C CG  . PHE C 1 267 ? -27.528 36.397   97.794  1.00 14.80 ? 352 PHE C CG  1 
ATOM   7953  C CD1 . PHE C 1 267 ? -27.053 36.273   99.096  1.00 14.59 ? 352 PHE C CD1 1 
ATOM   7954  C CD2 . PHE C 1 267 ? -27.267 35.381   96.883  1.00 14.39 ? 352 PHE C CD2 1 
ATOM   7955  C CE1 . PHE C 1 267 ? -26.337 35.153   99.486  1.00 13.64 ? 352 PHE C CE1 1 
ATOM   7956  C CE2 . PHE C 1 267 ? -26.552 34.257   97.267  1.00 15.89 ? 352 PHE C CE2 1 
ATOM   7957  C CZ  . PHE C 1 267 ? -26.087 34.144   98.575  1.00 15.27 ? 352 PHE C CZ  1 
ATOM   7958  N N   . SER C 1 268 ? -30.381 35.802   96.286  1.00 16.36 ? 353 SER C N   1 
ATOM   7959  C CA  . SER C 1 268 ? -30.872 34.530   95.749  1.00 16.37 ? 353 SER C CA  1 
ATOM   7960  C C   . SER C 1 268 ? -30.646 34.519   94.250  1.00 17.43 ? 353 SER C C   1 
ATOM   7961  O O   . SER C 1 268 ? -30.739 35.560   93.597  1.00 17.01 ? 353 SER C O   1 
ATOM   7962  C CB  . SER C 1 268 ? -32.369 34.340   96.017  1.00 16.07 ? 353 SER C CB  1 
ATOM   7963  O OG  . SER C 1 268 ? -32.611 33.849   97.324  1.00 17.19 ? 353 SER C OG  1 
ATOM   7964  N N   . PHE C 1 269 ? -30.348 33.342   93.704  1.00 18.11 ? 354 PHE C N   1 
ATOM   7965  C CA  . PHE C 1 269 ? -30.126 33.209   92.269  1.00 18.23 ? 354 PHE C CA  1 
ATOM   7966  C C   . PHE C 1 269 ? -31.193 32.340   91.632  1.00 19.13 ? 354 PHE C C   1 
ATOM   7967  O O   . PHE C 1 269 ? -31.411 31.188   92.039  1.00 18.52 ? 354 PHE C O   1 
ATOM   7968  C CB  . PHE C 1 269 ? -28.753 32.606   91.973  1.00 18.35 ? 354 PHE C CB  1 
ATOM   7969  C CG  . PHE C 1 269 ? -27.612 33.511   92.309  1.00 18.19 ? 354 PHE C CG  1 
ATOM   7970  C CD1 . PHE C 1 269 ? -27.000 33.450   93.551  1.00 18.88 ? 354 PHE C CD1 1 
ATOM   7971  C CD2 . PHE C 1 269 ? -27.153 34.440   91.379  1.00 18.89 ? 354 PHE C CD2 1 
ATOM   7972  C CE1 . PHE C 1 269 ? -25.935 34.309   93.865  1.00 19.91 ? 354 PHE C CE1 1 
ATOM   7973  C CE2 . PHE C 1 269 ? -26.098 35.299   91.681  1.00 19.14 ? 354 PHE C CE2 1 
ATOM   7974  C CZ  . PHE C 1 269 ? -25.488 35.233   92.928  1.00 18.29 ? 354 PHE C CZ  1 
ATOM   7975  N N   . LYS C 1 270 ? -31.848 32.899   90.621  1.00 18.61 ? 355 LYS C N   1 
ATOM   7976  C CA  . LYS C 1 270 ? -32.904 32.198   89.904  1.00 19.97 ? 355 LYS C CA  1 
ATOM   7977  C C   . LYS C 1 270 ? -32.397 31.457   88.671  1.00 19.34 ? 355 LYS C C   1 
ATOM   7978  O O   . LYS C 1 270 ? -31.652 32.014   87.862  1.00 19.43 ? 355 LYS C O   1 
ATOM   7979  C CB  . LYS C 1 270 ? -34.001 33.198   89.505  1.00 21.35 ? 355 LYS C CB  1 
ATOM   7980  C CG  . LYS C 1 270 ? -34.934 32.743   88.395  1.00 23.23 ? 355 LYS C CG  1 
ATOM   7981  C CD  . LYS C 1 270 ? -36.110 33.713   88.244  1.00 24.63 ? 355 LYS C CD  1 
ATOM   7982  C CE  . LYS C 1 270 ? -36.811 33.591   86.882  1.00 24.40 ? 355 LYS C CE  1 
ATOM   7983  N NZ  . LYS C 1 270 ? -37.197 32.200   86.530  1.00 23.31 ? 355 LYS C NZ  1 
ATOM   7984  N N   . TYR C 1 271 ? -32.790 30.188   88.570  1.00 18.59 ? 356 TYR C N   1 
ATOM   7985  C CA  . TYR C 1 271 ? -32.464 29.310   87.442  1.00 18.41 ? 356 TYR C CA  1 
ATOM   7986  C C   . TYR C 1 271 ? -33.791 28.648   87.058  1.00 18.08 ? 356 TYR C C   1 
ATOM   7987  O O   . TYR C 1 271 ? -34.253 27.719   87.740  1.00 16.22 ? 356 TYR C O   1 
ATOM   7988  C CB  . TYR C 1 271 ? -31.455 28.218   87.831  1.00 18.17 ? 356 TYR C CB  1 
ATOM   7989  C CG  . TYR C 1 271 ? -30.005 28.670   87.954  1.00 19.79 ? 356 TYR C CG  1 
ATOM   7990  C CD1 . TYR C 1 271 ? -29.502 29.146   89.168  1.00 18.35 ? 356 TYR C CD1 1 
ATOM   7991  C CD2 . TYR C 1 271 ? -29.132 28.604   86.860  1.00 17.12 ? 356 TYR C CD2 1 
ATOM   7992  C CE1 . TYR C 1 271 ? -28.179 29.538   89.293  1.00 16.74 ? 356 TYR C CE1 1 
ATOM   7993  C CE2 . TYR C 1 271 ? -27.806 29.001   86.979  1.00 16.48 ? 356 TYR C CE2 1 
ATOM   7994  C CZ  . TYR C 1 271 ? -27.336 29.467   88.202  1.00 16.90 ? 356 TYR C CZ  1 
ATOM   7995  O OH  . TYR C 1 271 ? -26.024 29.865   88.352  1.00 17.18 ? 356 TYR C OH  1 
ATOM   7996  N N   . GLY C 1 272 ? -34.404 29.129   85.980  1.00 17.78 ? 357 GLY C N   1 
ATOM   7997  C CA  . GLY C 1 272 ? -35.687 28.584   85.574  1.00 18.83 ? 357 GLY C CA  1 
ATOM   7998  C C   . GLY C 1 272 ? -36.649 28.841   86.716  1.00 19.27 ? 357 GLY C C   1 
ATOM   7999  O O   . GLY C 1 272 ? -36.718 29.967   87.212  1.00 19.18 ? 357 GLY C O   1 
ATOM   8000  N N   . ASN C 1 273 ? -37.375 27.813   87.145  1.00 19.47 ? 358 ASN C N   1 
ATOM   8001  C CA  . ASN C 1 273 ? -38.316 27.946   88.257  1.00 21.34 ? 358 ASN C CA  1 
ATOM   8002  C C   . ASN C 1 273 ? -37.647 27.615   89.598  1.00 20.39 ? 358 ASN C C   1 
ATOM   8003  O O   . ASN C 1 273 ? -38.296 27.587   90.645  1.00 18.00 ? 358 ASN C O   1 
ATOM   8004  C CB  . ASN C 1 273 ? -39.520 27.021   88.046  1.00 24.23 ? 358 ASN C CB  1 
ATOM   8005  C CG  . ASN C 1 273 ? -40.493 27.561   87.017  1.00 27.95 ? 358 ASN C CG  1 
ATOM   8006  O OD1 . ASN C 1 273 ? -41.044 28.655   87.181  1.00 30.14 ? 358 ASN C OD1 1 
ATOM   8007  N ND2 . ASN C 1 273 ? -40.710 26.802   85.947  1.00 29.52 ? 358 ASN C ND2 1 
ATOM   8008  N N   . GLY C 1 274 ? -36.344 27.357   89.548  1.00 19.60 ? 359 GLY C N   1 
ATOM   8009  C CA  . GLY C 1 274 ? -35.607 27.042   90.755  1.00 19.15 ? 359 GLY C CA  1 
ATOM   8010  C C   . GLY C 1 274 ? -34.820 28.243   91.258  1.00 18.22 ? 359 GLY C C   1 
ATOM   8011  O O   . GLY C 1 274 ? -34.689 29.245   90.548  1.00 16.68 ? 359 GLY C O   1 
ATOM   8012  N N   . VAL C 1 275 ? -34.300 28.128   92.481  1.00 16.58 ? 360 VAL C N   1 
ATOM   8013  C CA  . VAL C 1 275 ? -33.527 29.183   93.119  1.00 16.28 ? 360 VAL C CA  1 
ATOM   8014  C C   . VAL C 1 275 ? -32.478 28.682   94.099  1.00 15.72 ? 360 VAL C C   1 
ATOM   8015  O O   . VAL C 1 275 ? -32.658 27.663   94.749  1.00 15.41 ? 360 VAL C O   1 
ATOM   8016  C CB  . VAL C 1 275 ? -34.420 30.129   93.934  1.00 17.39 ? 360 VAL C CB  1 
ATOM   8017  C CG1 . VAL C 1 275 ? -35.258 30.957   93.020  1.00 20.08 ? 360 VAL C CG1 1 
ATOM   8018  C CG2 . VAL C 1 275 ? -35.298 29.319   94.886  1.00 18.26 ? 360 VAL C CG2 1 
ATOM   8019  N N   . TRP C 1 276 ? -31.374 29.404   94.186  1.00 14.24 ? 361 TRP C N   1 
ATOM   8020  C CA  . TRP C 1 276 ? -30.361 29.073   95.155  1.00 14.80 ? 361 TRP C CA  1 
ATOM   8021  C C   . TRP C 1 276 ? -30.683 30.113   96.210  1.00 15.79 ? 361 TRP C C   1 
ATOM   8022  O O   . TRP C 1 276 ? -30.691 31.312   95.927  1.00 17.31 ? 361 TRP C O   1 
ATOM   8023  C CB  . TRP C 1 276 ? -28.951 29.289   94.604  1.00 15.33 ? 361 TRP C CB  1 
ATOM   8024  C CG  . TRP C 1 276 ? -28.318 28.029   94.100  1.00 17.43 ? 361 TRP C CG  1 
ATOM   8025  C CD1 . TRP C 1 276 ? -28.195 27.630   92.797  1.00 16.46 ? 361 TRP C CD1 1 
ATOM   8026  C CD2 . TRP C 1 276 ? -27.763 26.973   94.895  1.00 15.60 ? 361 TRP C CD2 1 
ATOM   8027  N NE1 . TRP C 1 276 ? -27.598 26.394   92.735  1.00 15.58 ? 361 TRP C NE1 1 
ATOM   8028  C CE2 . TRP C 1 276 ? -27.324 25.967   94.009  1.00 15.08 ? 361 TRP C CE2 1 
ATOM   8029  C CE3 . TRP C 1 276 ? -27.600 26.778   96.273  1.00 15.62 ? 361 TRP C CE3 1 
ATOM   8030  C CZ2 . TRP C 1 276 ? -26.733 24.780   94.455  1.00 16.50 ? 361 TRP C CZ2 1 
ATOM   8031  C CZ3 . TRP C 1 276 ? -27.014 25.600   96.718  1.00 16.16 ? 361 TRP C CZ3 1 
ATOM   8032  C CH2 . TRP C 1 276 ? -26.586 24.616   95.811  1.00 16.10 ? 361 TRP C CH2 1 
ATOM   8033  N N   . ILE C 1 277 ? -30.987 29.655   97.412  1.00 15.44 ? 362 ILE C N   1 
ATOM   8034  C CA  . ILE C 1 277 ? -31.327 30.549   98.495  1.00 14.78 ? 362 ILE C CA  1 
ATOM   8035  C C   . ILE C 1 277 ? -30.228 30.580   99.528  1.00 14.67 ? 362 ILE C C   1 
ATOM   8036  O O   . ILE C 1 277 ? -29.786 29.531   99.990  1.00 14.51 ? 362 ILE C O   1 
ATOM   8037  C CB  . ILE C 1 277 ? -32.603 30.084   99.207  1.00 16.19 ? 362 ILE C CB  1 
ATOM   8038  C CG1 . ILE C 1 277 ? -33.773 30.101   98.228  1.00 14.58 ? 362 ILE C CG1 1 
ATOM   8039  C CG2 . ILE C 1 277 ? -32.862 30.949   100.443 1.00 14.79 ? 362 ILE C CG2 1 
ATOM   8040  C CD1 . ILE C 1 277 ? -35.026 29.518   98.800  1.00 15.08 ? 362 ILE C CD1 1 
ATOM   8041  N N   . GLY C 1 278 ? -29.795 31.787   99.880  1.00 14.48 ? 363 GLY C N   1 
ATOM   8042  C CA  . GLY C 1 278 ? -28.785 31.954   100.905 1.00 14.39 ? 363 GLY C CA  1 
ATOM   8043  C C   . GLY C 1 278 ? -29.536 32.484   102.115 1.00 15.80 ? 363 GLY C C   1 
ATOM   8044  O O   . GLY C 1 278 ? -30.353 33.392   101.986 1.00 17.42 ? 363 GLY C O   1 
ATOM   8045  N N   . ARG C 1 279 ? -29.291 31.926   103.292 1.00 16.41 ? 364 ARG C N   1 
ATOM   8046  C CA  . ARG C 1 279 ? -29.995 32.394   104.480 1.00 15.57 ? 364 ARG C CA  1 
ATOM   8047  C C   . ARG C 1 279 ? -29.246 32.070   105.771 1.00 15.05 ? 364 ARG C C   1 
ATOM   8048  O O   . ARG C 1 279 ? -28.268 31.321   105.752 1.00 15.55 ? 364 ARG C O   1 
ATOM   8049  C CB  . ARG C 1 279 ? -31.395 31.773   104.522 1.00 14.29 ? 364 ARG C CB  1 
ATOM   8050  C CG  . ARG C 1 279 ? -31.438 30.257   104.798 1.00 15.61 ? 364 ARG C CG  1 
ATOM   8051  C CD  . ARG C 1 279 ? -32.895 29.780   104.924 1.00 14.77 ? 364 ARG C CD  1 
ATOM   8052  N NE  . ARG C 1 279 ? -33.039 28.421   105.445 1.00 15.71 ? 364 ARG C NE  1 
ATOM   8053  C CZ  . ARG C 1 279 ? -34.211 27.817   105.653 1.00 15.18 ? 364 ARG C CZ  1 
ATOM   8054  N NH1 . ARG C 1 279 ? -34.245 26.584   106.130 1.00 13.63 ? 364 ARG C NH1 1 
ATOM   8055  N NH2 . ARG C 1 279 ? -35.354 28.441   105.384 1.00 13.81 ? 364 ARG C NH2 1 
ATOM   8056  N N   . THR C 1 280 ? -29.687 32.650   106.884 1.00 14.34 ? 365 THR C N   1 
ATOM   8057  C CA  . THR C 1 280 ? -29.061 32.370   108.168 1.00 14.78 ? 365 THR C CA  1 
ATOM   8058  C C   . THR C 1 280 ? -29.568 31.005   108.592 1.00 16.83 ? 365 THR C C   1 
ATOM   8059  O O   . THR C 1 280 ? -30.510 30.475   107.997 1.00 17.38 ? 365 THR C O   1 
ATOM   8060  C CB  . THR C 1 280 ? -29.503 33.354   109.256 1.00 14.98 ? 365 THR C CB  1 
ATOM   8061  O OG1 . THR C 1 280 ? -30.935 33.350   109.340 1.00 14.26 ? 365 THR C OG1 1 
ATOM   8062  C CG2 . THR C 1 280 ? -28.994 34.756   108.962 1.00 13.93 ? 365 THR C CG2 1 
ATOM   8063  N N   . LYS C 1 281 ? -28.968 30.426   109.622 1.00 17.72 ? 366 LYS C N   1 
ATOM   8064  C CA  . LYS C 1 281 ? -29.442 29.133   110.084 1.00 18.79 ? 366 LYS C CA  1 
ATOM   8065  C C   . LYS C 1 281 ? -30.506 29.300   111.176 1.00 20.00 ? 366 LYS C C   1 
ATOM   8066  O O   . LYS C 1 281 ? -31.446 28.510   111.270 1.00 20.96 ? 366 LYS C O   1 
ATOM   8067  C CB  . LYS C 1 281 ? -28.269 28.283   110.559 1.00 18.96 ? 366 LYS C CB  1 
ATOM   8068  C CG  . LYS C 1 281 ? -27.456 27.728   109.400 1.00 19.74 ? 366 LYS C CG  1 
ATOM   8069  C CD  . LYS C 1 281 ? -26.190 27.069   109.893 1.00 21.34 ? 366 LYS C CD  1 
ATOM   8070  C CE  . LYS C 1 281 ? -26.210 25.576   109.657 1.00 22.15 ? 366 LYS C CE  1 
ATOM   8071  N NZ  . LYS C 1 281 ? -26.168 25.296   108.206 1.00 21.86 ? 366 LYS C NZ  1 
ATOM   8072  N N   . SER C 1 282 ? -30.373 30.349   111.976 1.00 20.66 ? 367 SER C N   1 
ATOM   8073  C CA  . SER C 1 282 ? -31.335 30.640   113.039 1.00 21.86 ? 367 SER C CA  1 
ATOM   8074  C C   . SER C 1 282 ? -32.585 31.301   112.432 1.00 22.55 ? 367 SER C C   1 
ATOM   8075  O O   . SER C 1 282 ? -32.494 31.925   111.381 1.00 23.19 ? 367 SER C O   1 
ATOM   8076  C CB  . SER C 1 282 ? -30.688 31.587   114.061 1.00 20.51 ? 367 SER C CB  1 
ATOM   8077  O OG  . SER C 1 282 ? -31.654 32.199   114.895 1.00 20.14 ? 367 SER C OG  1 
ATOM   8078  N N   . THR C 1 283 ? -33.742 31.167   113.080 1.00 22.26 ? 368 THR C N   1 
ATOM   8079  C CA  . THR C 1 283 ? -34.962 31.798   112.567 1.00 23.42 ? 368 THR C CA  1 
ATOM   8080  C C   . THR C 1 283 ? -35.210 33.125   113.279 1.00 21.91 ? 368 THR C C   1 
ATOM   8081  O O   . THR C 1 283 ? -36.115 33.870   112.906 1.00 20.56 ? 368 THR C O   1 
ATOM   8082  C CB  . THR C 1 283 ? -36.179 30.887   112.739 1.00 25.84 ? 368 THR C CB  1 
ATOM   8083  O OG1 . THR C 1 283 ? -35.969 29.663   112.025 1.00 20.00 ? 368 THR C OG1 1 
ATOM   8084  C CG2 . THR C 1 283 ? -37.431 31.563   112.200 1.00 20.00 ? 368 THR C CG2 1 
ATOM   8085  N N   . ASN C 1 284 ? -34.416 33.409   114.309 1.00 21.64 ? 369 ASN C N   1 
ATOM   8086  C CA  . ASN C 1 284 ? -34.582 34.643   115.075 1.00 22.77 ? 369 ASN C CA  1 
ATOM   8087  C C   . ASN C 1 284 ? -33.436 35.632   114.932 1.00 21.84 ? 369 ASN C C   1 
ATOM   8088  O O   . ASN C 1 284 ? -33.660 36.802   114.647 1.00 22.42 ? 369 ASN C O   1 
ATOM   8089  C CB  . ASN C 1 284 ? -34.745 34.341   116.565 1.00 23.91 ? 369 ASN C CB  1 
ATOM   8090  C CG  . ASN C 1 284 ? -35.591 33.134   116.816 1.00 27.11 ? 369 ASN C CG  1 
ATOM   8091  O OD1 . ASN C 1 284 ? -36.731 33.034   116.341 1.00 27.88 ? 369 ASN C OD1 1 
ATOM   8092  N ND2 . ASN C 1 284 ? -35.044 32.196   117.577 1.00 28.55 ? 369 ASN C ND2 1 
ATOM   8093  N N   . SER C 1 285 ? -32.214 35.161   115.156 1.00 21.36 ? 370 SER C N   1 
ATOM   8094  C CA  . SER C 1 285 ? -31.041 36.022   115.078 1.00 20.64 ? 370 SER C CA  1 
ATOM   8095  C C   . SER C 1 285 ? -30.141 35.740   113.885 1.00 20.21 ? 370 SER C C   1 
ATOM   8096  O O   . SER C 1 285 ? -30.323 34.765   113.149 1.00 20.35 ? 370 SER C O   1 
ATOM   8097  C CB  . SER C 1 285 ? -30.216 35.911   116.371 1.00 21.39 ? 370 SER C CB  1 
ATOM   8098  O OG  . SER C 1 285 ? -29.724 34.593   116.578 1.00 20.32 ? 370 SER C OG  1 
ATOM   8099  N N   . ARG C 1 286 ? -29.149 36.606   113.717 1.00 18.95 ? 371 ARG C N   1 
ATOM   8100  C CA  . ARG C 1 286 ? -28.193 36.485   112.630 1.00 17.00 ? 371 ARG C CA  1 
ATOM   8101  C C   . ARG C 1 286 ? -27.086 35.501   112.980 1.00 16.13 ? 371 ARG C C   1 
ATOM   8102  O O   . ARG C 1 286 ? -25.948 35.883   113.221 1.00 16.18 ? 371 ARG C O   1 
ATOM   8103  C CB  . ARG C 1 286 ? -27.649 37.876   112.312 1.00 15.35 ? 371 ARG C CB  1 
ATOM   8104  C CG  . ARG C 1 286 ? -28.780 38.774   111.856 1.00 13.13 ? 371 ARG C CG  1 
ATOM   8105  C CD  . ARG C 1 286 ? -28.473 40.247   111.844 1.00 11.46 ? 371 ARG C CD  1 
ATOM   8106  N NE  . ARG C 1 286 ? -29.606 40.958   111.258 1.00 12.74 ? 371 ARG C NE  1 
ATOM   8107  C CZ  . ARG C 1 286 ? -29.639 42.261   111.001 1.00 13.15 ? 371 ARG C CZ  1 
ATOM   8108  N NH1 . ARG C 1 286 ? -30.724 42.792   110.459 1.00 12.25 ? 371 ARG C NH1 1 
ATOM   8109  N NH2 . ARG C 1 286 ? -28.599 43.034   111.286 1.00 14.26 ? 371 ARG C NH2 1 
ATOM   8110  N N   . SER C 1 287 ? -27.453 34.221   112.998 1.00 15.81 ? 372 SER C N   1 
ATOM   8111  C CA  . SER C 1 287 ? -26.541 33.129   113.324 1.00 15.81 ? 372 SER C CA  1 
ATOM   8112  C C   . SER C 1 287 ? -26.472 32.080   112.219 1.00 15.20 ? 372 SER C C   1 
ATOM   8113  O O   . SER C 1 287 ? -27.499 31.612   111.724 1.00 14.27 ? 372 SER C O   1 
ATOM   8114  C CB  . SER C 1 287 ? -26.977 32.438   114.624 1.00 15.62 ? 372 SER C CB  1 
ATOM   8115  O OG  . SER C 1 287 ? -26.827 33.299   115.732 1.00 17.79 ? 372 SER C OG  1 
ATOM   8116  N N   . GLY C 1 288 ? -25.252 31.698   111.858 1.00 14.79 ? 373 GLY C N   1 
ATOM   8117  C CA  . GLY C 1 288 ? -25.059 30.706   110.821 1.00 15.04 ? 373 GLY C CA  1 
ATOM   8118  C C   . GLY C 1 288 ? -25.443 31.173   109.429 1.00 14.98 ? 373 GLY C C   1 
ATOM   8119  O O   . GLY C 1 288 ? -25.962 32.278   109.244 1.00 14.80 ? 373 GLY C O   1 
ATOM   8120  N N   . PHE C 1 289 ? -25.173 30.322   108.445 1.00 13.02 ? 374 PHE C N   1 
ATOM   8121  C CA  . PHE C 1 289 ? -25.492 30.615   107.061 1.00 12.04 ? 374 PHE C CA  1 
ATOM   8122  C C   . PHE C 1 289 ? -25.449 29.297   106.293 1.00 13.15 ? 374 PHE C C   1 
ATOM   8123  O O   . PHE C 1 289 ? -24.715 28.383   106.666 1.00 15.29 ? 374 PHE C O   1 
ATOM   8124  C CB  . PHE C 1 289 ? -24.477 31.604   106.481 1.00 11.35 ? 374 PHE C CB  1 
ATOM   8125  C CG  . PHE C 1 289 ? -25.003 32.385   105.313 1.00 10.21 ? 374 PHE C CG  1 
ATOM   8126  C CD1 . PHE C 1 289 ? -25.919 33.416   105.511 1.00 10.15 ? 374 PHE C CD1 1 
ATOM   8127  C CD2 . PHE C 1 289 ? -24.646 32.043   104.013 1.00 8.58  ? 374 PHE C CD2 1 
ATOM   8128  C CE1 . PHE C 1 289 ? -26.476 34.091   104.430 1.00 9.61  ? 374 PHE C CE1 1 
ATOM   8129  C CE2 . PHE C 1 289 ? -25.196 32.707   102.926 1.00 9.79  ? 374 PHE C CE2 1 
ATOM   8130  C CZ  . PHE C 1 289 ? -26.117 33.736   103.134 1.00 10.78 ? 374 PHE C CZ  1 
ATOM   8131  N N   . GLU C 1 290 ? -26.236 29.199   105.229 1.00 13.61 ? 375 GLU C N   1 
ATOM   8132  C CA  . GLU C 1 290 ? -26.295 27.987   104.425 1.00 13.65 ? 375 GLU C CA  1 
ATOM   8133  C C   . GLU C 1 290 ? -26.812 28.284   103.025 1.00 14.73 ? 375 GLU C C   1 
ATOM   8134  O O   . GLU C 1 290 ? -27.497 29.283   102.799 1.00 15.27 ? 375 GLU C O   1 
ATOM   8135  C CB  . GLU C 1 290 ? -27.213 26.960   105.097 1.00 14.75 ? 375 GLU C CB  1 
ATOM   8136  C CG  . GLU C 1 290 ? -28.544 27.538   105.554 1.00 14.04 ? 375 GLU C CG  1 
ATOM   8137  C CD  . GLU C 1 290 ? -29.476 26.516   106.207 1.00 16.24 ? 375 GLU C CD  1 
ATOM   8138  O OE1 . GLU C 1 290 ? -29.018 25.703   107.044 1.00 14.22 ? 375 GLU C OE1 1 
ATOM   8139  O OE2 . GLU C 1 290 ? -30.686 26.546   105.895 1.00 18.05 ? 375 GLU C OE2 1 
ATOM   8140  N N   . MET C 1 291 ? -26.466 27.420   102.079 1.00 15.06 ? 376 MET C N   1 
ATOM   8141  C CA  . MET C 1 291 ? -26.932 27.576   100.712 1.00 15.21 ? 376 MET C CA  1 
ATOM   8142  C C   . MET C 1 291 ? -27.922 26.452   100.436 1.00 15.48 ? 376 MET C C   1 
ATOM   8143  O O   . MET C 1 291 ? -27.656 25.285   100.732 1.00 16.44 ? 376 MET C O   1 
ATOM   8144  C CB  . MET C 1 291 ? -25.772 27.515   99.720  1.00 13.81 ? 376 MET C CB  1 
ATOM   8145  C CG  . MET C 1 291 ? -24.882 28.751   99.722  1.00 16.01 ? 376 MET C CG  1 
ATOM   8146  S SD  . MET C 1 291 ? -25.787 30.303   99.495  1.00 18.57 ? 376 MET C SD  1 
ATOM   8147  C CE  . MET C 1 291 ? -26.396 30.136   97.825  1.00 16.04 ? 376 MET C CE  1 
ATOM   8148  N N   . ILE C 1 292 ? -29.072 26.811   99.883  1.00 14.54 ? 377 ILE C N   1 
ATOM   8149  C CA  . ILE C 1 292 ? -30.092 25.824   99.591  1.00 14.79 ? 377 ILE C CA  1 
ATOM   8150  C C   . ILE C 1 292 ? -30.619 25.891   98.176  1.00 13.97 ? 377 ILE C C   1 
ATOM   8151  O O   . ILE C 1 292 ? -30.997 26.950   97.685  1.00 11.79 ? 377 ILE C O   1 
ATOM   8152  C CB  . ILE C 1 292 ? -31.292 25.959   100.531 1.00 13.41 ? 377 ILE C CB  1 
ATOM   8153  C CG1 . ILE C 1 292 ? -30.841 25.774   101.976 1.00 13.21 ? 377 ILE C CG1 1 
ATOM   8154  C CG2 . ILE C 1 292 ? -32.345 24.931   100.153 1.00 13.46 ? 377 ILE C CG2 1 
ATOM   8155  C CD1 . ILE C 1 292 ? -31.939 25.962   102.995 1.00 13.77 ? 377 ILE C CD1 1 
ATOM   8156  N N   . TRP C 1 293 ? -30.653 24.734   97.532  1.00 15.65 ? 378 TRP C N   1 
ATOM   8157  C CA  . TRP C 1 293 ? -31.159 24.636   96.179  1.00 16.67 ? 378 TRP C CA  1 
ATOM   8158  C C   . TRP C 1 293 ? -32.549 24.016   96.220  1.00 17.45 ? 378 TRP C C   1 
ATOM   8159  O O   . TRP C 1 293 ? -32.716 22.842   96.547  1.00 17.35 ? 378 TRP C O   1 
ATOM   8160  C CB  . TRP C 1 293 ? -30.209 23.794   95.322  1.00 16.70 ? 378 TRP C CB  1 
ATOM   8161  C CG  . TRP C 1 293 ? -30.746 23.412   93.972  1.00 17.36 ? 378 TRP C CG  1 
ATOM   8162  C CD1 . TRP C 1 293 ? -30.958 22.144   93.505  1.00 18.47 ? 378 TRP C CD1 1 
ATOM   8163  C CD2 . TRP C 1 293 ? -31.131 24.295   92.916  1.00 17.29 ? 378 TRP C CD2 1 
ATOM   8164  N NE1 . TRP C 1 293 ? -31.452 22.182   92.226  1.00 17.60 ? 378 TRP C NE1 1 
ATOM   8165  C CE2 . TRP C 1 293 ? -31.568 23.490   91.835  1.00 17.98 ? 378 TRP C CE2 1 
ATOM   8166  C CE3 . TRP C 1 293 ? -31.153 25.689   92.774  1.00 16.36 ? 378 TRP C CE3 1 
ATOM   8167  C CZ2 . TRP C 1 293 ? -32.022 24.030   90.628  1.00 16.97 ? 378 TRP C CZ2 1 
ATOM   8168  C CZ3 . TRP C 1 293 ? -31.607 26.228   91.573  1.00 17.35 ? 378 TRP C CZ3 1 
ATOM   8169  C CH2 . TRP C 1 293 ? -32.036 25.397   90.515  1.00 16.53 ? 378 TRP C CH2 1 
ATOM   8170  N N   . ASP C 1 294 ? -33.549 24.843   95.939  1.00 19.38 ? 379 ASP C N   1 
ATOM   8171  C CA  . ASP C 1 294 ? -34.937 24.407   95.887  1.00 22.38 ? 379 ASP C CA  1 
ATOM   8172  C C   . ASP C 1 294 ? -35.366 24.510   94.429  1.00 24.09 ? 379 ASP C C   1 
ATOM   8173  O O   . ASP C 1 294 ? -35.771 25.580   93.961  1.00 23.05 ? 379 ASP C O   1 
ATOM   8174  C CB  . ASP C 1 294 ? -35.836 25.314   96.721  1.00 22.38 ? 379 ASP C CB  1 
ATOM   8175  C CG  . ASP C 1 294 ? -37.295 24.873   96.705  1.00 24.77 ? 379 ASP C CG  1 
ATOM   8176  O OD1 . ASP C 1 294 ? -37.693 24.082   95.816  1.00 24.33 ? 379 ASP C OD1 1 
ATOM   8177  O OD2 . ASP C 1 294 ? -38.058 25.331   97.587  1.00 26.93 ? 379 ASP C OD2 1 
ATOM   8178  N N   . PRO C 1 295 ? -35.242 23.414   93.674  1.00 25.89 ? 380 PRO C N   1 
ATOM   8179  C CA  . PRO C 1 295 ? -35.668 23.530   92.278  1.00 28.02 ? 380 PRO C CA  1 
ATOM   8180  C C   . PRO C 1 295 ? -37.151 23.894   92.318  1.00 29.62 ? 380 PRO C C   1 
ATOM   8181  O O   . PRO C 1 295 ? -37.816 23.687   93.335  1.00 30.49 ? 380 PRO C O   1 
ATOM   8182  C CB  . PRO C 1 295 ? -35.408 22.131   91.726  1.00 26.95 ? 380 PRO C CB  1 
ATOM   8183  C CG  . PRO C 1 295 ? -35.575 21.252   92.936  1.00 25.12 ? 380 PRO C CG  1 
ATOM   8184  C CD  . PRO C 1 295 ? -34.863 22.032   94.006  1.00 26.31 ? 380 PRO C CD  1 
ATOM   8185  N N   . ASN C 1 296 ? -37.678 24.457   91.245  1.00 31.12 ? 381 ASN C N   1 
ATOM   8186  C CA  . ASN C 1 296 ? -39.091 24.821   91.257  1.00 33.98 ? 381 ASN C CA  1 
ATOM   8187  C C   . ASN C 1 296 ? -39.520 25.502   92.577  1.00 32.79 ? 381 ASN C C   1 
ATOM   8188  O O   . ASN C 1 296 ? -40.650 25.324   93.020  1.00 35.02 ? 381 ASN C O   1 
ATOM   8189  C CB  . ASN C 1 296 ? -39.955 23.564   91.024  1.00 36.79 ? 381 ASN C CB  1 
ATOM   8190  C CG  . ASN C 1 296 ? -39.529 22.764   89.769  1.00 40.11 ? 381 ASN C CG  1 
ATOM   8191  O OD1 . ASN C 1 296 ? -39.428 23.311   88.656  1.00 39.53 ? 381 ASN C OD1 1 
ATOM   8192  N ND2 . ASN C 1 296 ? -39.282 21.461   89.953  1.00 39.56 ? 381 ASN C ND2 1 
ATOM   8193  N N   . GLY C 1 297 ? -38.626 26.275   93.198  1.00 31.28 ? 382 GLY C N   1 
ATOM   8194  C CA  . GLY C 1 297 ? -38.950 26.951   94.451  1.00 28.32 ? 382 GLY C CA  1 
ATOM   8195  C C   . GLY C 1 297 ? -39.248 28.441   94.300  1.00 28.29 ? 382 GLY C C   1 
ATOM   8196  O O   . GLY C 1 297 ? -39.688 29.115   95.241  1.00 26.20 ? 382 GLY C O   1 
ATOM   8197  N N   . TRP C 1 298 ? -39.017 28.957   93.095  1.00 27.43 ? 383 TRP C N   1 
ATOM   8198  C CA  . TRP C 1 298 ? -39.249 30.360   92.790  1.00 25.47 ? 383 TRP C CA  1 
ATOM   8199  C C   . TRP C 1 298 ? -40.720 30.649   92.516  1.00 25.16 ? 383 TRP C C   1 
ATOM   8200  O O   . TRP C 1 298 ? -41.176 31.783   92.660  1.00 24.62 ? 383 TRP C O   1 
ATOM   8201  C CB  . TRP C 1 298 ? -38.396 30.747   91.582  1.00 24.18 ? 383 TRP C CB  1 
ATOM   8202  C CG  . TRP C 1 298 ? -38.601 32.132   91.078  1.00 22.49 ? 383 TRP C CG  1 
ATOM   8203  C CD1 . TRP C 1 298 ? -39.597 32.570   90.251  1.00 22.15 ? 383 TRP C CD1 1 
ATOM   8204  C CD2 . TRP C 1 298 ? -37.774 33.264   91.347  1.00 20.32 ? 383 TRP C CD2 1 
ATOM   8205  N NE1 . TRP C 1 298 ? -39.435 33.909   89.987  1.00 21.22 ? 383 TRP C NE1 1 
ATOM   8206  C CE2 . TRP C 1 298 ? -38.324 34.359   90.653  1.00 20.53 ? 383 TRP C CE2 1 
ATOM   8207  C CE3 . TRP C 1 298 ? -36.620 33.463   92.111  1.00 19.63 ? 383 TRP C CE3 1 
ATOM   8208  C CZ2 . TRP C 1 298 ? -37.756 35.633   90.700  1.00 20.78 ? 383 TRP C CZ2 1 
ATOM   8209  C CZ3 . TRP C 1 298 ? -36.054 34.728   92.158  1.00 18.01 ? 383 TRP C CZ3 1 
ATOM   8210  C CH2 . TRP C 1 298 ? -36.623 35.796   91.460  1.00 18.71 ? 383 TRP C CH2 1 
ATOM   8211  N N   . THR C 1 299 ? -41.453 29.608   92.137  1.00 25.80 ? 384 THR C N   1 
ATOM   8212  C CA  . THR C 1 299 ? -42.873 29.719   91.812  1.00 25.78 ? 384 THR C CA  1 
ATOM   8213  C C   . THR C 1 299 ? -43.752 28.750   92.615  1.00 27.31 ? 384 THR C C   1 
ATOM   8214  O O   . THR C 1 299 ? -44.974 28.890   92.639  1.00 28.13 ? 384 THR C O   1 
ATOM   8215  C CB  . THR C 1 299 ? -43.108 29.434   90.314  1.00 24.25 ? 384 THR C CB  1 
ATOM   8216  O OG1 . THR C 1 299 ? -42.492 28.186   89.969  1.00 21.64 ? 384 THR C OG1 1 
ATOM   8217  C CG2 . THR C 1 299 ? -42.512 30.538   89.450  1.00 23.48 ? 384 THR C CG2 1 
ATOM   8218  N N   . GLU C 1 300 ? -43.138 27.769   93.268  1.00 28.68 ? 385 GLU C N   1 
ATOM   8219  C CA  . GLU C 1 300 ? -43.906 26.794   94.037  1.00 29.80 ? 385 GLU C CA  1 
ATOM   8220  C C   . GLU C 1 300 ? -43.849 27.027   95.543  1.00 30.07 ? 385 GLU C C   1 
ATOM   8221  O O   . GLU C 1 300 ? -42.874 27.568   96.078  1.00 28.24 ? 385 GLU C O   1 
ATOM   8222  C CB  . GLU C 1 300 ? -43.429 25.372   93.725  1.00 30.96 ? 385 GLU C CB  1 
ATOM   8223  C CG  . GLU C 1 300 ? -43.590 24.958   92.271  1.00 32.35 ? 385 GLU C CG  1 
ATOM   8224  C CD  . GLU C 1 300 ? -45.022 25.109   91.791  1.00 35.63 ? 385 GLU C CD  1 
ATOM   8225  O OE1 . GLU C 1 300 ? -45.935 24.659   92.520  1.00 35.25 ? 385 GLU C OE1 1 
ATOM   8226  O OE2 . GLU C 1 300 ? -45.233 25.666   90.686  1.00 35.42 ? 385 GLU C OE2 1 
ATOM   8227  N N   . THR C 1 301 ? -44.908 26.586   96.215  1.00 30.67 ? 386 THR C N   1 
ATOM   8228  C CA  . THR C 1 301 ? -45.045 26.737   97.652  1.00 30.87 ? 386 THR C CA  1 
ATOM   8229  C C   . THR C 1 301 ? -44.827 25.446   98.430  1.00 31.37 ? 386 THR C C   1 
ATOM   8230  O O   . THR C 1 301 ? -45.785 24.793   98.832  1.00 35.13 ? 386 THR C O   1 
ATOM   8231  C CB  . THR C 1 301 ? -46.448 27.261   98.008  1.00 30.05 ? 386 THR C CB  1 
ATOM   8232  O OG1 . THR C 1 301 ? -46.642 28.556   97.436  1.00 30.30 ? 386 THR C OG1 1 
ATOM   8233  C CG2 . THR C 1 301 ? -46.598 27.370   99.496  1.00 31.45 ? 386 THR C CG2 1 
ATOM   8234  N N   . ASP C 1 302 ? -43.583 25.049   98.630  1.00 30.55 ? 387 ASP C N   1 
ATOM   8235  C CA  . ASP C 1 302 ? -43.322 23.849   99.416  1.00 29.95 ? 387 ASP C CA  1 
ATOM   8236  C C   . ASP C 1 302 ? -41.967 24.003   100.032 1.00 28.70 ? 387 ASP C C   1 
ATOM   8237  O O   . ASP C 1 302 ? -41.092 24.644   99.457  1.00 29.34 ? 387 ASP C O   1 
ATOM   8238  C CB  . ASP C 1 302 ? -43.366 22.562   98.580  1.00 30.08 ? 387 ASP C CB  1 
ATOM   8239  C CG  . ASP C 1 302 ? -42.390 22.572   97.428  1.00 30.63 ? 387 ASP C CG  1 
ATOM   8240  O OD1 . ASP C 1 302 ? -42.850 22.842   96.297  1.00 31.97 ? 387 ASP C OD1 1 
ATOM   8241  O OD2 . ASP C 1 302 ? -41.180 22.318   97.647  1.00 28.01 ? 387 ASP C OD2 1 
ATOM   8242  N N   . SER C 1 303 ? -41.801 23.421   101.210 1.00 26.75 ? 388 SER C N   1 
ATOM   8243  C CA  . SER C 1 303 ? -40.548 23.521   101.920 1.00 26.70 ? 388 SER C CA  1 
ATOM   8244  C C   . SER C 1 303 ? -39.587 22.402   101.554 1.00 25.61 ? 388 SER C C   1 
ATOM   8245  O O   . SER C 1 303 ? -38.614 22.148   102.269 1.00 25.20 ? 388 SER C O   1 
ATOM   8246  C CB  . SER C 1 303 ? -40.817 23.526   103.421 1.00 27.11 ? 388 SER C CB  1 
ATOM   8247  O OG  . SER C 1 303 ? -41.623 22.419   103.779 1.00 31.20 ? 388 SER C OG  1 
ATOM   8248  N N   . SER C 1 304 ? -39.849 21.730   100.442 1.00 23.94 ? 389 SER C N   1 
ATOM   8249  C CA  . SER C 1 304 ? -38.960 20.659   100.045 1.00 24.21 ? 389 SER C CA  1 
ATOM   8250  C C   . SER C 1 304 ? -37.916 21.230   99.099  1.00 24.11 ? 389 SER C C   1 
ATOM   8251  O O   . SER C 1 304 ? -38.212 22.080   98.252  1.00 23.83 ? 389 SER C O   1 
ATOM   8252  C CB  . SER C 1 304 ? -39.732 19.537   99.368  1.00 23.30 ? 389 SER C CB  1 
ATOM   8253  O OG  . SER C 1 304 ? -40.054 19.898   98.051  1.00 25.84 ? 389 SER C OG  1 
ATOM   8254  N N   . PHE C 1 305 ? -36.687 20.753   99.260  1.00 24.81 ? 390 PHE C N   1 
ATOM   8255  C CA  . PHE C 1 305 ? -35.563 21.211   98.468  1.00 25.35 ? 390 PHE C CA  1 
ATOM   8256  C C   . PHE C 1 305 ? -34.585 20.066   98.278  1.00 25.66 ? 390 PHE C C   1 
ATOM   8257  O O   . PHE C 1 305 ? -34.625 19.087   99.028  1.00 25.12 ? 390 PHE C O   1 
ATOM   8258  C CB  . PHE C 1 305 ? -34.869 22.355   99.195  1.00 26.31 ? 390 PHE C CB  1 
ATOM   8259  C CG  . PHE C 1 305 ? -34.377 21.986   100.564 1.00 26.37 ? 390 PHE C CG  1 
ATOM   8260  C CD1 . PHE C 1 305 ? -33.240 21.190   100.725 1.00 25.76 ? 390 PHE C CD1 1 
ATOM   8261  C CD2 . PHE C 1 305 ? -35.048 22.442   101.698 1.00 26.13 ? 390 PHE C CD2 1 
ATOM   8262  C CE1 . PHE C 1 305 ? -32.776 20.855   101.996 1.00 25.28 ? 390 PHE C CE1 1 
ATOM   8263  C CE2 . PHE C 1 305 ? -34.593 22.113   102.971 1.00 26.84 ? 390 PHE C CE2 1 
ATOM   8264  C CZ  . PHE C 1 305 ? -33.451 21.316   103.119 1.00 26.13 ? 390 PHE C CZ  1 
ATOM   8265  N N   . SER C 1 306 ? -33.687 20.218   97.304  1.00 25.41 ? 391 SER C N   1 
ATOM   8266  C CA  . SER C 1 306 ? -32.702 19.191   96.979  1.00 25.25 ? 391 SER C CA  1 
ATOM   8267  C C   . SER C 1 306 ? -31.406 19.187   97.784  1.00 24.90 ? 391 SER C C   1 
ATOM   8268  O O   . SER C 1 306 ? -31.138 18.254   98.529  1.00 25.26 ? 391 SER C O   1 
ATOM   8269  C CB  . SER C 1 306 ? -32.337 19.277   95.494  1.00 25.95 ? 391 SER C CB  1 
ATOM   8270  O OG  . SER C 1 306 ? -33.482 19.177   94.671  1.00 29.02 ? 391 SER C OG  1 
ATOM   8271  N N   . VAL C 1 307 ? -30.605 20.234   97.622  1.00 25.13 ? 392 VAL C N   1 
ATOM   8272  C CA  . VAL C 1 307 ? -29.307 20.329   98.275  1.00 23.70 ? 392 VAL C CA  1 
ATOM   8273  C C   . VAL C 1 307 ? -29.166 21.402   99.351  1.00 23.16 ? 392 VAL C C   1 
ATOM   8274  O O   . VAL C 1 307 ? -29.828 22.437   99.312  1.00 23.43 ? 392 VAL C O   1 
ATOM   8275  C CB  . VAL C 1 307 ? -28.215 20.583   97.218  1.00 23.90 ? 392 VAL C CB  1 
ATOM   8276  C CG1 . VAL C 1 307 ? -26.830 20.411   97.831  1.00 23.18 ? 392 VAL C CG1 1 
ATOM   8277  C CG2 . VAL C 1 307 ? -28.425 19.658   96.032  1.00 22.71 ? 392 VAL C CG2 1 
ATOM   8278  N N   . LYS C 1 308 ? -28.274 21.142   100.300 1.00 22.16 ? 394 LYS C N   1 
ATOM   8279  C CA  . LYS C 1 308 ? -27.994 22.071   101.381 1.00 21.85 ? 394 LYS C CA  1 
ATOM   8280  C C   . LYS C 1 308 ? -26.490 22.098   101.624 1.00 21.36 ? 394 LYS C C   1 
ATOM   8281  O O   . LYS C 1 308 ? -25.868 21.067   101.850 1.00 20.22 ? 394 LYS C O   1 
ATOM   8282  C CB  . LYS C 1 308 ? -28.686 21.642   102.670 1.00 22.38 ? 394 LYS C CB  1 
ATOM   8283  C CG  . LYS C 1 308 ? -28.630 22.697   103.766 1.00 22.90 ? 394 LYS C CG  1 
ATOM   8284  C CD  . LYS C 1 308 ? -28.804 22.078   105.142 1.00 25.06 ? 394 LYS C CD  1 
ATOM   8285  C CE  . LYS C 1 308 ? -29.378 23.081   106.106 1.00 26.94 ? 394 LYS C CE  1 
ATOM   8286  N NZ  . LYS C 1 308 ? -30.705 23.550   105.603 1.00 26.62 ? 394 LYS C NZ  1 
ATOM   8287  N N   . GLN C 1 309 ? -25.908 23.286   101.574 1.00 20.72 ? 395 GLN C N   1 
ATOM   8288  C CA  . GLN C 1 309 ? -24.490 23.417   101.807 1.00 20.28 ? 395 GLN C CA  1 
ATOM   8289  C C   . GLN C 1 309 ? -24.281 24.394   102.953 1.00 21.42 ? 395 GLN C C   1 
ATOM   8290  O O   . GLN C 1 309 ? -24.682 25.560   102.873 1.00 22.05 ? 395 GLN C O   1 
ATOM   8291  C CB  . GLN C 1 309 ? -23.790 23.927   100.551 1.00 19.93 ? 395 GLN C CB  1 
ATOM   8292  C CG  . GLN C 1 309 ? -22.277 23.913   100.664 1.00 18.54 ? 395 GLN C CG  1 
ATOM   8293  C CD  . GLN C 1 309 ? -21.565 24.401   99.414  1.00 18.22 ? 395 GLN C CD  1 
ATOM   8294  O OE1 . GLN C 1 309 ? -20.353 24.551   99.418  1.00 20.04 ? 395 GLN C OE1 1 
ATOM   8295  N NE2 . GLN C 1 309 ? -22.307 24.646   98.348  1.00 17.19 ? 395 GLN C NE2 1 
ATOM   8296  N N   . ASP C 1 310 ? -23.668 23.915   104.028 1.00 20.19 ? 396 ASP C N   1 
ATOM   8297  C CA  . ASP C 1 310 ? -23.402 24.770   105.168 1.00 20.93 ? 396 ASP C CA  1 
ATOM   8298  C C   . ASP C 1 310 ? -22.273 25.738   104.835 1.00 20.63 ? 396 ASP C C   1 
ATOM   8299  O O   . ASP C 1 310 ? -21.346 25.389   104.100 1.00 21.02 ? 396 ASP C O   1 
ATOM   8300  C CB  . ASP C 1 310 ? -23.016 23.928   106.378 1.00 21.94 ? 396 ASP C CB  1 
ATOM   8301  C CG  . ASP C 1 310 ? -24.092 22.944   106.755 1.00 22.93 ? 396 ASP C CG  1 
ATOM   8302  O OD1 . ASP C 1 310 ? -25.270 23.348   106.774 1.00 25.35 ? 396 ASP C OD1 1 
ATOM   8303  O OD2 . ASP C 1 310 ? -23.771 21.770   107.034 1.00 25.43 ? 396 ASP C OD2 1 
ATOM   8304  N N   . ILE C 1 311 ? -22.374 26.960   105.350 1.00 18.67 ? 397 ILE C N   1 
ATOM   8305  C CA  . ILE C 1 311 ? -21.352 27.977   105.135 1.00 17.96 ? 397 ILE C CA  1 
ATOM   8306  C C   . ILE C 1 311 ? -20.881 28.500   106.499 1.00 17.45 ? 397 ILE C C   1 
ATOM   8307  O O   . ILE C 1 311 ? -19.677 28.653   106.725 1.00 16.13 ? 397 ILE C O   1 
ATOM   8308  C CB  . ILE C 1 311 ? -21.888 29.131   104.226 1.00 17.77 ? 397 ILE C CB  1 
ATOM   8309  C CG1 . ILE C 1 311 ? -21.523 28.843   102.765 1.00 19.62 ? 397 ILE C CG1 1 
ATOM   8310  C CG2 . ILE C 1 311 ? -21.277 30.462   104.610 1.00 16.95 ? 397 ILE C CG2 1 
ATOM   8311  C CD1 . ILE C 1 311 ? -22.070 27.549   102.225 1.00 19.36 ? 397 ILE C CD1 1 
ATOM   8312  N N   . VAL C 1 312 ? -21.830 28.760   107.401 1.00 15.98 ? 398 VAL C N   1 
ATOM   8313  C CA  . VAL C 1 312 ? -21.508 29.217   108.751 1.00 16.35 ? 398 VAL C CA  1 
ATOM   8314  C C   . VAL C 1 312 ? -22.412 28.536   109.777 1.00 16.96 ? 398 VAL C C   1 
ATOM   8315  O O   . VAL C 1 312 ? -23.633 28.591   109.672 1.00 16.75 ? 398 VAL C O   1 
ATOM   8316  C CB  . VAL C 1 312 ? -21.658 30.741   108.900 1.00 17.02 ? 398 VAL C CB  1 
ATOM   8317  C CG1 . VAL C 1 312 ? -21.476 31.143   110.368 1.00 14.08 ? 398 VAL C CG1 1 
ATOM   8318  C CG2 . VAL C 1 312 ? -20.634 31.449   108.034 1.00 14.91 ? 398 VAL C CG2 1 
ATOM   8319  N N   . ALA C 1 313 ? -21.799 27.899   110.771 1.00 17.63 ? 399 ALA C N   1 
ATOM   8320  C CA  . ALA C 1 313 ? -22.527 27.187   111.820 1.00 18.11 ? 399 ALA C CA  1 
ATOM   8321  C C   . ALA C 1 313 ? -23.473 28.063   112.655 1.00 19.18 ? 399 ALA C C   1 
ATOM   8322  O O   . ALA C 1 313 ? -23.236 29.259   112.827 1.00 19.39 ? 399 ALA C O   1 
ATOM   8323  C CB  . ALA C 1 313 ? -21.531 26.483   112.729 1.00 16.24 ? 399 ALA C CB  1 
ATOM   8324  N N   . ILE C 1 314 ? -24.533 27.452   113.186 1.00 21.58 ? 400 ILE C N   1 
ATOM   8325  C CA  . ILE C 1 314 ? -25.527 28.161   114.003 1.00 22.05 ? 400 ILE C CA  1 
ATOM   8326  C C   . ILE C 1 314 ? -24.916 28.761   115.250 1.00 21.29 ? 400 ILE C C   1 
ATOM   8327  O O   . ILE C 1 314 ? -25.464 29.691   115.830 1.00 22.50 ? 400 ILE C O   1 
ATOM   8328  C CB  . ILE C 1 314 ? -26.652 27.235   114.504 1.00 24.45 ? 400 ILE C CB  1 
ATOM   8329  C CG1 . ILE C 1 314 ? -26.766 26.004   113.606 1.00 27.87 ? 400 ILE C CG1 1 
ATOM   8330  C CG2 . ILE C 1 314 ? -27.987 28.003   114.528 1.00 23.86 ? 400 ILE C CG2 1 
ATOM   8331  C CD1 . ILE C 1 314 ? -27.815 25.014   114.075 1.00 29.21 ? 400 ILE C CD1 1 
ATOM   8332  N N   . THR C 1 315 ? -23.786 28.213   115.674 1.00 20.56 ? 401 THR C N   1 
ATOM   8333  C CA  . THR C 1 315 ? -23.119 28.693   116.877 1.00 18.92 ? 401 THR C CA  1 
ATOM   8334  C C   . THR C 1 315 ? -22.331 29.985   116.660 1.00 17.88 ? 401 THR C C   1 
ATOM   8335  O O   . THR C 1 315 ? -21.823 30.574   117.616 1.00 16.44 ? 401 THR C O   1 
ATOM   8336  C CB  . THR C 1 315 ? -22.161 27.613   117.417 1.00 20.84 ? 401 THR C CB  1 
ATOM   8337  O OG1 . THR C 1 315 ? -21.313 27.159   116.347 1.00 21.45 ? 401 THR C OG1 1 
ATOM   8338  C CG2 . THR C 1 315 ? -22.948 26.438   117.991 1.00 17.47 ? 401 THR C CG2 1 
ATOM   8339  N N   . ASP C 1 316 ? -22.233 30.429   115.411 1.00 17.68 ? 402 ASP C N   1 
ATOM   8340  C CA  . ASP C 1 316 ? -21.489 31.651   115.117 1.00 18.21 ? 402 ASP C CA  1 
ATOM   8341  C C   . ASP C 1 316 ? -22.286 32.736   114.414 1.00 17.79 ? 402 ASP C C   1 
ATOM   8342  O O   . ASP C 1 316 ? -23.212 32.460   113.662 1.00 18.62 ? 402 ASP C O   1 
ATOM   8343  C CB  . ASP C 1 316 ? -20.231 31.313   114.325 1.00 19.52 ? 402 ASP C CB  1 
ATOM   8344  C CG  . ASP C 1 316 ? -19.149 30.718   115.206 1.00 22.02 ? 402 ASP C CG  1 
ATOM   8345  O OD1 . ASP C 1 316 ? -18.510 31.482   115.968 1.00 22.06 ? 402 ASP C OD1 1 
ATOM   8346  O OD2 . ASP C 1 316 ? -18.957 29.480   115.155 1.00 24.90 ? 402 ASP C OD2 1 
ATOM   8347  N N   . TRP C 1 317 ? -21.918 33.980   114.689 1.00 16.87 ? 403 TRP C N   1 
ATOM   8348  C CA  . TRP C 1 317 ? -22.592 35.135   114.122 1.00 16.53 ? 403 TRP C CA  1 
ATOM   8349  C C   . TRP C 1 317 ? -22.358 35.324   112.629 1.00 16.78 ? 403 TRP C C   1 
ATOM   8350  O O   . TRP C 1 317 ? -21.276 35.050   112.103 1.00 16.45 ? 403 TRP C O   1 
ATOM   8351  C CB  . TRP C 1 317 ? -22.136 36.400   114.847 1.00 16.03 ? 403 TRP C CB  1 
ATOM   8352  C CG  . TRP C 1 317 ? -22.374 36.373   116.324 1.00 16.23 ? 403 TRP C CG  1 
ATOM   8353  C CD1 . TRP C 1 317 ? -21.428 36.348   117.309 1.00 15.87 ? 403 TRP C CD1 1 
ATOM   8354  C CD2 . TRP C 1 317 ? -23.642 36.378   116.986 1.00 16.04 ? 403 TRP C CD2 1 
ATOM   8355  N NE1 . TRP C 1 317 ? -22.028 36.337   118.542 1.00 15.99 ? 403 TRP C NE1 1 
ATOM   8356  C CE2 . TRP C 1 317 ? -23.386 36.358   118.375 1.00 15.64 ? 403 TRP C CE2 1 
ATOM   8357  C CE3 . TRP C 1 317 ? -24.969 36.402   116.540 1.00 16.40 ? 403 TRP C CE3 1 
ATOM   8358  C CZ2 . TRP C 1 317 ? -24.409 36.356   119.325 1.00 14.77 ? 403 TRP C CZ2 1 
ATOM   8359  C CZ3 . TRP C 1 317 ? -25.986 36.399   117.486 1.00 17.74 ? 403 TRP C CZ3 1 
ATOM   8360  C CH2 . TRP C 1 317 ? -25.698 36.380   118.864 1.00 16.17 ? 403 TRP C CH2 1 
ATOM   8361  N N   . SER C 1 318 ? -23.390 35.793   111.947 1.00 16.50 ? 404 SER C N   1 
ATOM   8362  C CA  . SER C 1 318 ? -23.285 36.081   110.525 1.00 17.63 ? 404 SER C CA  1 
ATOM   8363  C C   . SER C 1 318 ? -23.873 37.477   110.368 1.00 16.97 ? 404 SER C C   1 
ATOM   8364  O O   . SER C 1 318 ? -23.598 38.358   111.180 1.00 17.09 ? 404 SER C O   1 
ATOM   8365  C CB  . SER C 1 318 ? -24.070 35.066   109.692 1.00 17.57 ? 404 SER C CB  1 
ATOM   8366  O OG  . SER C 1 318 ? -25.457 35.157   109.957 1.00 22.29 ? 404 SER C OG  1 
ATOM   8367  N N   . GLY C 1 319 ? -24.692 37.682   109.344 1.00 16.69 ? 405 GLY C N   1 
ATOM   8368  C CA  . GLY C 1 319 ? -25.276 38.994   109.143 1.00 15.15 ? 405 GLY C CA  1 
ATOM   8369  C C   . GLY C 1 319 ? -25.699 39.179   107.707 1.00 15.25 ? 405 GLY C C   1 
ATOM   8370  O O   . GLY C 1 319 ? -26.296 38.274   107.114 1.00 14.31 ? 405 GLY C O   1 
ATOM   8371  N N   . TYR C 1 320 ? -25.395 40.344   107.143 1.00 14.33 ? 406 TYR C N   1 
ATOM   8372  C CA  . TYR C 1 320 ? -25.753 40.628   105.758 1.00 14.13 ? 406 TYR C CA  1 
ATOM   8373  C C   . TYR C 1 320 ? -25.107 39.649   104.778 1.00 14.68 ? 406 TYR C C   1 
ATOM   8374  O O   . TYR C 1 320 ? -24.112 38.999   105.084 1.00 14.91 ? 406 TYR C O   1 
ATOM   8375  C CB  . TYR C 1 320 ? -25.343 42.058   105.385 1.00 13.86 ? 406 TYR C CB  1 
ATOM   8376  C CG  . TYR C 1 320 ? -26.348 43.142   105.744 1.00 14.80 ? 406 TYR C CG  1 
ATOM   8377  C CD1 . TYR C 1 320 ? -27.186 43.022   106.857 1.00 15.04 ? 406 TYR C CD1 1 
ATOM   8378  C CD2 . TYR C 1 320 ? -26.445 44.300   104.973 1.00 14.13 ? 406 TYR C CD2 1 
ATOM   8379  C CE1 . TYR C 1 320 ? -28.096 44.028   107.187 1.00 13.72 ? 406 TYR C CE1 1 
ATOM   8380  C CE2 . TYR C 1 320 ? -27.346 45.307   105.293 1.00 13.54 ? 406 TYR C CE2 1 
ATOM   8381  C CZ  . TYR C 1 320 ? -28.173 45.164   106.397 1.00 14.36 ? 406 TYR C CZ  1 
ATOM   8382  O OH  . TYR C 1 320 ? -29.103 46.141   106.671 1.00 12.85 ? 406 TYR C OH  1 
ATOM   8383  N N   . SER C 1 321 ? -25.692 39.549   103.593 1.00 15.04 ? 407 SER C N   1 
ATOM   8384  C CA  . SER C 1 321 ? -25.175 38.678   102.547 1.00 14.71 ? 407 SER C CA  1 
ATOM   8385  C C   . SER C 1 321 ? -25.674 39.213   101.203 1.00 15.82 ? 407 SER C C   1 
ATOM   8386  O O   . SER C 1 321 ? -26.825 39.635   101.072 1.00 15.80 ? 407 SER C O   1 
ATOM   8387  C CB  . SER C 1 321 ? -25.644 37.226   102.763 1.00 14.06 ? 407 SER C CB  1 
ATOM   8388  O OG  . SER C 1 321 ? -27.028 37.060   102.512 1.00 12.40 ? 407 SER C OG  1 
ATOM   8389  N N   . GLY C 1 322 ? -24.812 39.209   100.199 1.00 15.91 ? 408 GLY C N   1 
ATOM   8390  C CA  . GLY C 1 322 ? -25.242 39.720   98.918  1.00 15.76 ? 408 GLY C CA  1 
ATOM   8391  C C   . GLY C 1 322 ? -24.671 38.976   97.745  1.00 16.74 ? 408 GLY C C   1 
ATOM   8392  O O   . GLY C 1 322 ? -23.734 38.193   97.880  1.00 16.06 ? 408 GLY C O   1 
ATOM   8393  N N   . SER C 1 323 ? -25.240 39.231   96.576  1.00 17.97 ? 409 SER C N   1 
ATOM   8394  C CA  . SER C 1 323 ? -24.780 38.578   95.364  1.00 19.00 ? 409 SER C CA  1 
ATOM   8395  C C   . SER C 1 323 ? -23.837 39.486   94.597  1.00 19.72 ? 409 SER C C   1 
ATOM   8396  O O   . SER C 1 323 ? -23.982 40.706   94.620  1.00 21.92 ? 409 SER C O   1 
ATOM   8397  C CB  . SER C 1 323 ? -25.960 38.269   94.457  1.00 17.73 ? 409 SER C CB  1 
ATOM   8398  O OG  . SER C 1 323 ? -26.506 39.486   93.976  1.00 16.74 ? 409 SER C OG  1 
ATOM   8399  N N   . PHE C 1 324 ? -22.859 38.889   93.936  1.00 18.74 ? 410 PHE C N   1 
ATOM   8400  C CA  . PHE C 1 324 ? -21.967 39.651   93.094  1.00 19.16 ? 410 PHE C CA  1 
ATOM   8401  C C   . PHE C 1 324 ? -21.530 38.723   91.973  1.00 20.51 ? 410 PHE C C   1 
ATOM   8402  O O   . PHE C 1 324 ? -21.332 37.516   92.172  1.00 20.83 ? 410 PHE C O   1 
ATOM   8403  C CB  . PHE C 1 324 ? -20.769 40.215   93.859  1.00 18.48 ? 410 PHE C CB  1 
ATOM   8404  C CG  . PHE C 1 324 ? -19.712 39.208   94.199  1.00 18.41 ? 410 PHE C CG  1 
ATOM   8405  C CD1 . PHE C 1 324 ? -19.708 38.574   95.436  1.00 17.62 ? 410 PHE C CD1 1 
ATOM   8406  C CD2 . PHE C 1 324 ? -18.692 38.932   93.300  1.00 16.55 ? 410 PHE C CD2 1 
ATOM   8407  C CE1 . PHE C 1 324 ? -18.706 37.691   95.776  1.00 16.53 ? 410 PHE C CE1 1 
ATOM   8408  C CE2 . PHE C 1 324 ? -17.683 38.047   93.633  1.00 17.65 ? 410 PHE C CE2 1 
ATOM   8409  C CZ  . PHE C 1 324 ? -17.690 37.425   94.877  1.00 17.28 ? 410 PHE C CZ  1 
ATOM   8410  N N   . VAL C 1 325 ? -21.037 39.199   90.929  1.00 20.79 ? 411 VAL C N   1 
ATOM   8411  C CA  . VAL C 1 325 ? -21.007 38.511   89.591  1.00 21.43 ? 411 VAL C CA  1 
ATOM   8412  C C   . VAL C 1 325 ? -19.547 38.475   89.053  1.00 20.66 ? 411 VAL C C   1 
ATOM   8413  O O   . VAL C 1 325 ? -18.671 39.184   89.583  1.00 23.13 ? 411 VAL C O   1 
ATOM   8414  C CB  . VAL C 1 325 ? -21.923 39.217   88.574  1.00 22.67 ? 411 VAL C CB  1 
ATOM   8415  C CG1 . VAL C 1 325 ? -21.782 38.581   87.199  1.00 27.53 ? 411 VAL C CG1 1 
ATOM   8416  C CG2 . VAL C 1 325 ? -23.370 39.176   89.042  1.00 21.18 ? 411 VAL C CG2 1 
ATOM   8417  N N   . GLN C 1 326 ? -19.375 37.631   88.060  1.00 20.23 ? 412 GLN C N   1 
ATOM   8418  C CA  . GLN C 1 326 ? -18.017 37.507   87.395  1.00 21.30 ? 412 GLN C CA  1 
ATOM   8419  C C   . GLN C 1 326 ? -18.404 37.469   85.900  1.00 21.81 ? 412 GLN C C   1 
ATOM   8420  O O   . GLN C 1 326 ? -18.966 36.478   85.457  1.00 25.20 ? 412 GLN C O   1 
ATOM   8421  C CB  . GLN C 1 326 ? -17.209 36.376   88.034  1.00 20.28 ? 412 GLN C CB  1 
ATOM   8422  C CG  . GLN C 1 326 ? -16.948 36.563   89.520  1.00 20.84 ? 412 GLN C CG  1 
ATOM   8423  C CD  . GLN C 1 326 ? -16.145 35.424   90.118  1.00 20.60 ? 412 GLN C CD  1 
ATOM   8424  O OE1 . GLN C 1 326 ? -15.776 34.479   89.421  1.00 19.97 ? 412 GLN C OE1 1 
ATOM   8425  N NE2 . GLN C 1 326 ? -15.874 35.511   91.415  1.00 23.03 ? 412 GLN C NE2 1 
ATOM   8426  N N   . HIS C 1 327 A -18.373 38.571   85.239  1.00 20.94 ? 412 HIS C N   1 
ATOM   8427  C CA  . HIS C 1 327 A -18.591 38.652   83.807  1.00 20.82 ? 412 HIS C CA  1 
ATOM   8428  C C   . HIS C 1 327 A -17.567 37.928   82.922  1.00 20.12 ? 412 HIS C C   1 
ATOM   8429  O O   . HIS C 1 327 A -16.446 37.658   83.338  1.00 19.29 ? 412 HIS C O   1 
ATOM   8430  C CB  . HIS C 1 327 A -18.635 40.131   83.420  1.00 20.39 ? 412 HIS C CB  1 
ATOM   8431  C CG  . HIS C 1 327 A -19.912 40.819   83.791  1.00 22.51 ? 412 HIS C CG  1 
ATOM   8432  N ND1 . HIS C 1 327 A -20.977 40.930   82.917  1.00 22.95 ? 412 HIS C ND1 1 
ATOM   8433  C CD2 . HIS C 1 327 A -20.308 41.429   84.934  1.00 23.12 ? 412 HIS C CD2 1 
ATOM   8434  C CE1 . HIS C 1 327 A -21.964 41.578   83.501  1.00 22.31 ? 412 HIS C CE1 1 
ATOM   8435  N NE2 . HIS C 1 327 A -21.586 41.895   84.730  1.00 23.87 ? 412 HIS C NE2 1 
ATOM   8436  N N   . PRO C 1 328 B -17.969 37.579   81.690  1.00 20.53 ? 412 PRO C N   1 
ATOM   8437  C CA  . PRO C 1 328 B -17.095 36.902   80.735  1.00 21.26 ? 412 PRO C CA  1 
ATOM   8438  C C   . PRO C 1 328 B -15.794 37.664   80.471  1.00 22.10 ? 412 PRO C C   1 
ATOM   8439  O O   . PRO C 1 328 B -14.716 37.056   80.501  1.00 21.66 ? 412 PRO C O   1 
ATOM   8440  C CB  . PRO C 1 328 B -17.969 36.806   79.490  1.00 21.24 ? 412 PRO C CB  1 
ATOM   8441  C CG  . PRO C 1 328 B -19.299 36.489   80.084  1.00 21.09 ? 412 PRO C CG  1 
ATOM   8442  C CD  . PRO C 1 328 B -19.377 37.473   81.254  1.00 21.62 ? 412 PRO C CD  1 
ATOM   8443  N N   . GLU C 1 329 C -15.873 38.979   80.226  1.00 21.43 ? 412 GLU C N   1 
ATOM   8444  C CA  . GLU C 1 329 C -14.645 39.731   79.946  1.00 21.88 ? 412 GLU C CA  1 
ATOM   8445  C C   . GLU C 1 329 C -13.613 39.591   81.046  1.00 21.48 ? 412 GLU C C   1 
ATOM   8446  O O   . GLU C 1 329 C -12.415 39.752   80.796  1.00 22.49 ? 412 GLU C O   1 
ATOM   8447  C CB  . GLU C 1 329 C -14.896 41.229   79.676  1.00 21.23 ? 412 GLU C CB  1 
ATOM   8448  C CG  . GLU C 1 329 C -16.239 41.774   80.074  1.00 23.20 ? 412 GLU C CG  1 
ATOM   8449  C CD  . GLU C 1 329 C -17.357 41.301   79.169  1.00 23.60 ? 412 GLU C CD  1 
ATOM   8450  O OE1 . GLU C 1 329 C -17.325 41.593   77.947  1.00 23.76 ? 412 GLU C OE1 1 
ATOM   8451  O OE2 . GLU C 1 329 C -18.275 40.641   79.695  1.00 24.46 ? 412 GLU C OE2 1 
ATOM   8452  N N   . LEU C 1 330 D -14.063 39.286   82.260  1.00 20.81 ? 412 LEU C N   1 
ATOM   8453  C CA  . LEU C 1 330 D -13.136 39.116   83.375  1.00 19.95 ? 412 LEU C CA  1 
ATOM   8454  C C   . LEU C 1 330 D -12.713 37.663   83.481  1.00 20.29 ? 412 LEU C C   1 
ATOM   8455  O O   . LEU C 1 330 D -11.539 37.350   83.622  1.00 21.51 ? 412 LEU C O   1 
ATOM   8456  C CB  . LEU C 1 330 D -13.779 39.550   84.702  1.00 18.03 ? 412 LEU C CB  1 
ATOM   8457  C CG  . LEU C 1 330 D -13.028 39.143   85.984  1.00 17.88 ? 412 LEU C CG  1 
ATOM   8458  C CD1 . LEU C 1 330 D -11.663 39.800   86.014  1.00 15.81 ? 412 LEU C CD1 1 
ATOM   8459  C CD2 . LEU C 1 330 D -13.815 39.529   87.215  1.00 15.58 ? 412 LEU C CD2 1 
ATOM   8460  N N   . THR C 1 331 ? -13.687 36.777   83.373  1.00 21.38 ? 413 THR C N   1 
ATOM   8461  C CA  . THR C 1 331 ? -13.459 35.350   83.512  1.00 21.88 ? 413 THR C CA  1 
ATOM   8462  C C   . THR C 1 331 ? -12.942 34.543   82.330  1.00 21.95 ? 413 THR C C   1 
ATOM   8463  O O   . THR C 1 331 ? -12.124 33.641   82.510  1.00 22.26 ? 413 THR C O   1 
ATOM   8464  C CB  . THR C 1 331 ? -14.731 34.706   84.017  1.00 21.60 ? 413 THR C CB  1 
ATOM   8465  O OG1 . THR C 1 331 ? -14.959 35.151   85.358  1.00 23.89 ? 413 THR C OG1 1 
ATOM   8466  C CG2 . THR C 1 331 ? -14.614 33.225   84.016  1.00 23.33 ? 413 THR C CG2 1 
ATOM   8467  N N   . GLY C 1 332 ? -13.408 34.855   81.128  1.00 21.50 ? 414 GLY C N   1 
ATOM   8468  C CA  . GLY C 1 332 ? -12.980 34.094   79.970  1.00 19.65 ? 414 GLY C CA  1 
ATOM   8469  C C   . GLY C 1 332 ? -14.076 33.107   79.639  1.00 20.35 ? 414 GLY C C   1 
ATOM   8470  O O   . GLY C 1 332 ? -14.112 32.544   78.551  1.00 20.08 ? 414 GLY C O   1 
ATOM   8471  N N   . LEU C 1 333 ? -14.977 32.903   80.595  1.00 21.44 ? 415 LEU C N   1 
ATOM   8472  C CA  . LEU C 1 333 ? -16.110 32.002   80.424  1.00 23.11 ? 415 LEU C CA  1 
ATOM   8473  C C   . LEU C 1 333 ? -17.060 32.600   79.393  1.00 24.94 ? 415 LEU C C   1 
ATOM   8474  O O   . LEU C 1 333 ? -16.838 33.711   78.910  1.00 25.47 ? 415 LEU C O   1 
ATOM   8475  C CB  . LEU C 1 333 ? -16.839 31.818   81.755  1.00 21.74 ? 415 LEU C CB  1 
ATOM   8476  C CG  . LEU C 1 333 ? -16.396 30.697   82.707  1.00 22.79 ? 415 LEU C CG  1 
ATOM   8477  C CD1 . LEU C 1 333 ? -14.894 30.466   82.669  1.00 21.73 ? 415 LEU C CD1 1 
ATOM   8478  C CD2 . LEU C 1 333 ? -16.850 31.071   84.111  1.00 22.42 ? 415 LEU C CD2 1 
ATOM   8479  N N   . ASP C 1 334 ? -18.111 31.859   79.049  1.00 26.44 ? 416 ASP C N   1 
ATOM   8480  C CA  . ASP C 1 334 ? -19.101 32.328   78.079  1.00 26.83 ? 416 ASP C CA  1 
ATOM   8481  C C   . ASP C 1 334 ? -20.448 32.487   78.778  1.00 25.96 ? 416 ASP C C   1 
ATOM   8482  O O   . ASP C 1 334 ? -21.506 32.457   78.155  1.00 25.58 ? 416 ASP C O   1 
ATOM   8483  C CB  . ASP C 1 334 ? -19.226 31.319   76.948  1.00 27.83 ? 416 ASP C CB  1 
ATOM   8484  C CG  . ASP C 1 334 ? -19.632 29.956   77.445  1.00 29.65 ? 416 ASP C CG  1 
ATOM   8485  O OD1 . ASP C 1 334 ? -19.591 29.735   78.687  1.00 29.23 ? 416 ASP C OD1 1 
ATOM   8486  O OD2 . ASP C 1 334 ? -19.981 29.110   76.590  1.00 29.49 ? 416 ASP C OD2 1 
ATOM   8487  N N   . CYS C 1 335 ? -20.384 32.645   80.089  1.00 25.78 ? 417 CYS C N   1 
ATOM   8488  C CA  . CYS C 1 335 ? -21.571 32.799   80.904  1.00 25.11 ? 417 CYS C CA  1 
ATOM   8489  C C   . CYS C 1 335 ? -21.226 33.666   82.097  1.00 23.22 ? 417 CYS C C   1 
ATOM   8490  O O   . CYS C 1 335 ? -20.064 33.802   82.464  1.00 23.17 ? 417 CYS C O   1 
ATOM   8491  C CB  . CYS C 1 335 ? -22.069 31.430   81.377  1.00 26.15 ? 417 CYS C CB  1 
ATOM   8492  S SG  . CYS C 1 335 ? -20.764 30.392   82.108  1.00 28.51 ? 417 CYS C SG  1 
ATOM   8493  N N   . ILE C 1 336 ? -22.250 34.268   82.682  1.00 22.56 ? 418 ILE C N   1 
ATOM   8494  C CA  . ILE C 1 336 ? -22.091 35.129   83.837  1.00 19.27 ? 418 ILE C CA  1 
ATOM   8495  C C   . ILE C 1 336 ? -22.069 34.244   85.074  1.00 19.72 ? 418 ILE C C   1 
ATOM   8496  O O   . ILE C 1 336 ? -23.058 33.566   85.383  1.00 20.30 ? 418 ILE C O   1 
ATOM   8497  C CB  . ILE C 1 336 ? -23.258 36.138   83.885  1.00 19.15 ? 418 ILE C CB  1 
ATOM   8498  C CG1 . ILE C 1 336 ? -23.159 37.064   82.665  1.00 19.07 ? 418 ILE C CG1 1 
ATOM   8499  C CG2 . ILE C 1 336 ? -23.251 36.914   85.180  1.00 18.29 ? 418 ILE C CG2 1 
ATOM   8500  C CD1 . ILE C 1 336 ? -24.200 38.155   82.606  1.00 18.73 ? 418 ILE C CD1 1 
ATOM   8501  N N   . ARG C 1 337 ? -20.936 34.245   85.774  1.00 17.31 ? 419 ARG C N   1 
ATOM   8502  C CA  . ARG C 1 337 ? -20.770 33.430   86.971  1.00 16.13 ? 419 ARG C CA  1 
ATOM   8503  C C   . ARG C 1 337 ? -21.301 34.053   88.266  1.00 16.47 ? 419 ARG C C   1 
ATOM   8504  O O   . ARG C 1 337 ? -20.989 35.192   88.604  1.00 17.61 ? 419 ARG C O   1 
ATOM   8505  C CB  . ARG C 1 337 ? -19.292 33.068   87.158  1.00 16.55 ? 419 ARG C CB  1 
ATOM   8506  C CG  . ARG C 1 337 ? -18.923 32.744   88.600  1.00 18.29 ? 419 ARG C CG  1 
ATOM   8507  C CD  . ARG C 1 337 ? -17.441 32.439   88.773  1.00 19.98 ? 419 ARG C CD  1 
ATOM   8508  N NE  . ARG C 1 337 ? -17.104 31.142   88.197  1.00 21.72 ? 419 ARG C NE  1 
ATOM   8509  C CZ  . ARG C 1 337 ? -15.931 30.537   88.339  1.00 20.57 ? 419 ARG C CZ  1 
ATOM   8510  N NH1 . ARG C 1 337 ? -14.966 31.109   89.043  1.00 19.99 ? 419 ARG C NH1 1 
ATOM   8511  N NH2 . ARG C 1 337 ? -15.732 29.352   87.775  1.00 20.71 ? 419 ARG C NH2 1 
ATOM   8512  N N   . PRO C 1 338 ? -22.115 33.297   89.014  1.00 17.17 ? 420 PRO C N   1 
ATOM   8513  C CA  . PRO C 1 338 ? -22.672 33.793   90.276  1.00 15.72 ? 420 PRO C CA  1 
ATOM   8514  C C   . PRO C 1 338 ? -21.781 33.530   91.500  1.00 15.94 ? 420 PRO C C   1 
ATOM   8515  O O   . PRO C 1 338 ? -21.241 32.439   91.661  1.00 14.82 ? 420 PRO C O   1 
ATOM   8516  C CB  . PRO C 1 338 ? -23.993 33.042   90.370  1.00 14.37 ? 420 PRO C CB  1 
ATOM   8517  C CG  . PRO C 1 338 ? -23.627 31.712   89.803  1.00 14.56 ? 420 PRO C CG  1 
ATOM   8518  C CD  . PRO C 1 338 ? -22.829 32.084   88.572  1.00 14.63 ? 420 PRO C CD  1 
ATOM   8519  N N   . CYS C 1 339 ? -21.638 34.539   92.354  1.00 17.11 ? 421 CYS C N   1 
ATOM   8520  C CA  . CYS C 1 339 ? -20.854 34.428   93.588  1.00 18.27 ? 421 CYS C CA  1 
ATOM   8521  C C   . CYS C 1 339 ? -21.621 35.196   94.665  1.00 17.46 ? 421 CYS C C   1 
ATOM   8522  O O   . CYS C 1 339 ? -22.563 35.933   94.362  1.00 16.27 ? 421 CYS C O   1 
ATOM   8523  C CB  . CYS C 1 339 ? -19.470 35.086   93.458  1.00 20.04 ? 421 CYS C CB  1 
ATOM   8524  S SG  . CYS C 1 339 ? -18.324 34.548   92.139  1.00 24.95 ? 421 CYS C SG  1 
ATOM   8525  N N   . PHE C 1 340 ? -21.220 35.025   95.919  1.00 15.79 ? 422 PHE C N   1 
ATOM   8526  C CA  . PHE C 1 340 ? -21.861 35.757   97.000  1.00 16.35 ? 422 PHE C CA  1 
ATOM   8527  C C   . PHE C 1 340 ? -20.891 36.006   98.139  1.00 17.14 ? 422 PHE C C   1 
ATOM   8528  O O   . PHE C 1 340 ? -19.855 35.343   98.256  1.00 17.82 ? 422 PHE C O   1 
ATOM   8529  C CB  . PHE C 1 340 ? -23.118 35.028   97.503  1.00 17.90 ? 422 PHE C CB  1 
ATOM   8530  C CG  . PHE C 1 340 ? -22.842 33.776   98.291  1.00 18.75 ? 422 PHE C CG  1 
ATOM   8531  C CD1 . PHE C 1 340 ? -22.745 33.816   99.679  1.00 19.73 ? 422 PHE C CD1 1 
ATOM   8532  C CD2 . PHE C 1 340 ? -22.679 32.559   97.645  1.00 19.52 ? 422 PHE C CD2 1 
ATOM   8533  C CE1 . PHE C 1 340 ? -22.488 32.661   100.413 1.00 21.25 ? 422 PHE C CE1 1 
ATOM   8534  C CE2 . PHE C 1 340 ? -22.420 31.395   98.364  1.00 20.58 ? 422 PHE C CE2 1 
ATOM   8535  C CZ  . PHE C 1 340 ? -22.324 31.445   99.754  1.00 21.32 ? 422 PHE C CZ  1 
ATOM   8536  N N   . TRP C 1 341 ? -21.226 36.991   98.960  1.00 16.11 ? 423 TRP C N   1 
ATOM   8537  C CA  . TRP C 1 341 ? -20.411 37.355   100.107 1.00 15.13 ? 423 TRP C CA  1 
ATOM   8538  C C   . TRP C 1 341 ? -21.297 37.373   101.350 1.00 14.05 ? 423 TRP C C   1 
ATOM   8539  O O   . TRP C 1 341 ? -22.496 37.622   101.260 1.00 12.77 ? 423 TRP C O   1 
ATOM   8540  C CB  . TRP C 1 341 ? -19.768 38.740   99.891  1.00 13.39 ? 423 TRP C CB  1 
ATOM   8541  C CG  . TRP C 1 341 ? -20.752 39.849   99.614  1.00 12.45 ? 423 TRP C CG  1 
ATOM   8542  C CD1 . TRP C 1 341 ? -21.052 40.404   98.404  1.00 11.61 ? 423 TRP C CD1 1 
ATOM   8543  C CD2 . TRP C 1 341 ? -21.601 40.488   100.568 1.00 13.97 ? 423 TRP C CD2 1 
ATOM   8544  N NE1 . TRP C 1 341 ? -22.038 41.345   98.545  1.00 13.22 ? 423 TRP C NE1 1 
ATOM   8545  C CE2 . TRP C 1 341 ? -22.396 41.417   99.863  1.00 13.71 ? 423 TRP C CE2 1 
ATOM   8546  C CE3 . TRP C 1 341 ? -21.772 40.361   101.954 1.00 12.86 ? 423 TRP C CE3 1 
ATOM   8547  C CZ2 . TRP C 1 341 ? -23.350 42.218   100.498 1.00 15.21 ? 423 TRP C CZ2 1 
ATOM   8548  C CZ3 . TRP C 1 341 ? -22.719 41.152   102.583 1.00 14.37 ? 423 TRP C CZ3 1 
ATOM   8549  C CH2 . TRP C 1 341 ? -23.498 42.068   101.857 1.00 14.76 ? 423 TRP C CH2 1 
ATOM   8550  N N   . VAL C 1 342 ? -20.704 37.091   102.503 1.00 14.45 ? 424 VAL C N   1 
ATOM   8551  C CA  . VAL C 1 342 ? -21.442 37.095   103.758 1.00 13.59 ? 424 VAL C CA  1 
ATOM   8552  C C   . VAL C 1 342 ? -20.752 37.993   104.768 1.00 14.55 ? 424 VAL C C   1 
ATOM   8553  O O   . VAL C 1 342 ? -19.535 37.884   104.984 1.00 14.70 ? 424 VAL C O   1 
ATOM   8554  C CB  . VAL C 1 342 ? -21.528 35.694   104.379 1.00 13.19 ? 424 VAL C CB  1 
ATOM   8555  C CG1 . VAL C 1 342 ? -22.438 35.730   105.597 1.00 11.79 ? 424 VAL C CG1 1 
ATOM   8556  C CG2 . VAL C 1 342 ? -22.027 34.695   103.359 1.00 13.57 ? 424 VAL C CG2 1 
ATOM   8557  N N   . GLU C 1 343 ? -21.532 38.881   105.382 1.00 15.46 ? 425 GLU C N   1 
ATOM   8558  C CA  . GLU C 1 343 ? -21.016 39.803   106.399 1.00 15.00 ? 425 GLU C CA  1 
ATOM   8559  C C   . GLU C 1 343 ? -21.081 39.136   107.792 1.00 14.25 ? 425 GLU C C   1 
ATOM   8560  O O   . GLU C 1 343 ? -22.133 38.645   108.193 1.00 13.68 ? 425 GLU C O   1 
ATOM   8561  C CB  . GLU C 1 343 ? -21.835 41.103   106.406 1.00 14.53 ? 425 GLU C CB  1 
ATOM   8562  C CG  . GLU C 1 343 ? -21.466 42.012   107.582 1.00 16.41 ? 425 GLU C CG  1 
ATOM   8563  C CD  . GLU C 1 343 ? -22.451 43.132   107.830 1.00 17.77 ? 425 GLU C CD  1 
ATOM   8564  O OE1 . GLU C 1 343 ? -23.659 42.857   107.960 1.00 19.62 ? 425 GLU C OE1 1 
ATOM   8565  O OE2 . GLU C 1 343 ? -22.014 44.294   107.912 1.00 18.57 ? 425 GLU C OE2 1 
ATOM   8566  N N   . LEU C 1 344 ? -19.959 39.112   108.511 1.00 13.61 ? 426 LEU C N   1 
ATOM   8567  C CA  . LEU C 1 344 ? -19.903 38.498   109.846 1.00 13.89 ? 426 LEU C CA  1 
ATOM   8568  C C   . LEU C 1 344 ? -19.859 39.547   110.955 1.00 13.51 ? 426 LEU C C   1 
ATOM   8569  O O   . LEU C 1 344 ? -18.786 40.043   111.315 1.00 12.73 ? 426 LEU C O   1 
ATOM   8570  C CB  . LEU C 1 344 ? -18.679 37.589   109.951 1.00 13.96 ? 426 LEU C CB  1 
ATOM   8571  C CG  . LEU C 1 344 ? -18.591 36.519   108.866 1.00 14.92 ? 426 LEU C CG  1 
ATOM   8572  C CD1 . LEU C 1 344 ? -17.297 35.734   109.026 1.00 13.27 ? 426 LEU C CD1 1 
ATOM   8573  C CD2 . LEU C 1 344 ? -19.806 35.603   108.949 1.00 12.75 ? 426 LEU C CD2 1 
ATOM   8574  N N   . ILE C 1 345 ? -21.033 39.847   111.506 1.00 12.53 ? 427 ILE C N   1 
ATOM   8575  C CA  . ILE C 1 345 ? -21.195 40.872   112.534 1.00 11.65 ? 427 ILE C CA  1 
ATOM   8576  C C   . ILE C 1 345 ? -20.856 40.500   113.964 1.00 12.73 ? 427 ILE C C   1 
ATOM   8577  O O   . ILE C 1 345 ? -21.441 39.583   114.532 1.00 13.06 ? 427 ILE C O   1 
ATOM   8578  C CB  . ILE C 1 345 ? -22.637 41.403   112.553 1.00 10.97 ? 427 ILE C CB  1 
ATOM   8579  C CG1 . ILE C 1 345 ? -23.069 41.795   111.138 1.00 10.73 ? 427 ILE C CG1 1 
ATOM   8580  C CG2 . ILE C 1 345 ? -22.732 42.595   113.501 1.00 9.98  ? 427 ILE C CG2 1 
ATOM   8581  C CD1 . ILE C 1 345 ? -24.551 42.050   110.994 1.00 8.27  ? 427 ILE C CD1 1 
ATOM   8582  N N   . ARG C 1 346 ? -19.924 41.243   114.553 1.00 13.42 ? 428 ARG C N   1 
ATOM   8583  C CA  . ARG C 1 346 ? -19.529 41.022   115.937 1.00 13.73 ? 428 ARG C CA  1 
ATOM   8584  C C   . ARG C 1 346 ? -19.808 42.312   116.703 1.00 14.02 ? 428 ARG C C   1 
ATOM   8585  O O   . ARG C 1 346 ? -19.722 43.402   116.134 1.00 13.02 ? 428 ARG C O   1 
ATOM   8586  C CB  . ARG C 1 346 ? -18.037 40.678   116.029 1.00 15.13 ? 428 ARG C CB  1 
ATOM   8587  C CG  . ARG C 1 346 ? -17.610 39.453   115.226 1.00 15.46 ? 428 ARG C CG  1 
ATOM   8588  C CD  . ARG C 1 346 ? -18.445 38.243   115.597 1.00 15.60 ? 428 ARG C CD  1 
ATOM   8589  N NE  . ARG C 1 346 ? -18.389 37.979   117.029 1.00 17.88 ? 428 ARG C NE  1 
ATOM   8590  C CZ  . ARG C 1 346 ? -17.348 37.432   117.653 1.00 17.37 ? 428 ARG C CZ  1 
ATOM   8591  N NH1 . ARG C 1 346 ? -17.388 37.237   118.968 1.00 16.75 ? 428 ARG C NH1 1 
ATOM   8592  N NH2 . ARG C 1 346 ? -16.277 37.066   116.964 1.00 15.83 ? 428 ARG C NH2 1 
ATOM   8593  N N   . GLY C 1 347 ? -20.154 42.181   117.983 1.00 14.40 ? 429 GLY C N   1 
ATOM   8594  C CA  . GLY C 1 347 ? -20.426 43.345   118.806 1.00 16.28 ? 429 GLY C CA  1 
ATOM   8595  C C   . GLY C 1 347 ? -21.890 43.559   119.130 1.00 17.97 ? 429 GLY C C   1 
ATOM   8596  O O   . GLY C 1 347 ? -22.660 42.609   119.224 1.00 18.60 ? 429 GLY C O   1 
ATOM   8597  N N   . ARG C 1 348 ? -22.279 44.816   119.306 1.00 18.92 ? 430 ARG C N   1 
ATOM   8598  C CA  . ARG C 1 348 ? -23.661 45.148   119.624 1.00 20.77 ? 430 ARG C CA  1 
ATOM   8599  C C   . ARG C 1 348 ? -24.572 44.900   118.425 1.00 20.49 ? 430 ARG C C   1 
ATOM   8600  O O   . ARG C 1 348 ? -24.148 45.012   117.272 1.00 21.30 ? 430 ARG C O   1 
ATOM   8601  C CB  . ARG C 1 348 ? -23.736 46.602   120.099 1.00 23.38 ? 430 ARG C CB  1 
ATOM   8602  C CG  . ARG C 1 348 ? -23.062 46.814   121.463 1.00 28.80 ? 430 ARG C CG  1 
ATOM   8603  C CD  . ARG C 1 348 ? -22.486 48.223   121.608 1.00 34.57 ? 430 ARG C CD  1 
ATOM   8604  N NE  . ARG C 1 348 ? -23.504 49.221   121.953 1.00 40.18 ? 430 ARG C NE  1 
ATOM   8605  C CZ  . ARG C 1 348 ? -23.546 50.464   121.467 1.00 42.19 ? 430 ARG C CZ  1 
ATOM   8606  N NH1 . ARG C 1 348 ? -22.626 50.884   120.595 1.00 40.66 ? 430 ARG C NH1 1 
ATOM   8607  N NH2 . ARG C 1 348 ? -24.507 51.292   121.866 1.00 42.65 ? 430 ARG C NH2 1 
ATOM   8608  N N   . PRO C 1 349 ? -25.858 44.615   118.680 1.00 20.67 ? 431 PRO C N   1 
ATOM   8609  C CA  . PRO C 1 349 ? -26.478 44.518   120.007 1.00 20.61 ? 431 PRO C CA  1 
ATOM   8610  C C   . PRO C 1 349 ? -26.476 43.130   120.656 1.00 21.23 ? 431 PRO C C   1 
ATOM   8611  O O   . PRO C 1 349 ? -27.121 42.924   121.684 1.00 23.51 ? 431 PRO C O   1 
ATOM   8612  C CB  . PRO C 1 349 ? -27.893 44.996   119.732 1.00 19.65 ? 431 PRO C CB  1 
ATOM   8613  C CG  . PRO C 1 349 ? -28.177 44.303   118.411 1.00 19.17 ? 431 PRO C CG  1 
ATOM   8614  C CD  . PRO C 1 349 ? -26.871 44.443   117.620 1.00 19.16 ? 431 PRO C CD  1 
ATOM   8615  N N   . LYS C 1 350 ? -25.764 42.174   120.080 1.00 20.58 ? 432 LYS C N   1 
ATOM   8616  C CA  . LYS C 1 350 ? -25.771 40.838   120.657 1.00 19.86 ? 432 LYS C CA  1 
ATOM   8617  C C   . LYS C 1 350 ? -24.658 40.534   121.652 1.00 19.54 ? 432 LYS C C   1 
ATOM   8618  O O   . LYS C 1 350 ? -24.809 39.673   122.514 1.00 20.39 ? 432 LYS C O   1 
ATOM   8619  C CB  . LYS C 1 350 ? -25.775 39.798   119.527 1.00 20.45 ? 432 LYS C CB  1 
ATOM   8620  C CG  . LYS C 1 350 ? -27.124 39.693   118.820 1.00 20.47 ? 432 LYS C CG  1 
ATOM   8621  C CD  . LYS C 1 350 ? -28.205 39.335   119.838 1.00 22.42 ? 432 LYS C CD  1 
ATOM   8622  C CE  . LYS C 1 350 ? -29.551 39.056   119.201 1.00 23.01 ? 432 LYS C CE  1 
ATOM   8623  N NZ  . LYS C 1 350 ? -30.487 38.473   120.221 1.00 24.74 ? 432 LYS C NZ  1 
ATOM   8624  N N   . GLU C 1 351 ? -23.543 41.244   121.540 1.00 18.98 ? 433 GLU C N   1 
ATOM   8625  C CA  . GLU C 1 351 ? -22.412 41.022   122.426 1.00 18.36 ? 433 GLU C CA  1 
ATOM   8626  C C   . GLU C 1 351 ? -22.179 42.274   123.267 1.00 18.43 ? 433 GLU C C   1 
ATOM   8627  O O   . GLU C 1 351 ? -22.606 43.367   122.886 1.00 17.54 ? 433 GLU C O   1 
ATOM   8628  C CB  . GLU C 1 351 ? -21.180 40.652   121.582 1.00 17.65 ? 433 GLU C CB  1 
ATOM   8629  C CG  . GLU C 1 351 ? -21.470 39.448   120.679 1.00 18.98 ? 433 GLU C CG  1 
ATOM   8630  C CD  . GLU C 1 351 ? -20.282 38.969   119.864 1.00 20.79 ? 433 GLU C CD  1 
ATOM   8631  O OE1 . GLU C 1 351 ? -20.173 39.344   118.671 1.00 19.47 ? 433 GLU C OE1 1 
ATOM   8632  O OE2 . GLU C 1 351 ? -19.457 38.209   120.426 1.00 21.65 ? 433 GLU C OE2 1 
ATOM   8633  N N   . SER C 1 352 ? -21.520 42.117   124.413 1.00 17.52 ? 435 SER C N   1 
ATOM   8634  C CA  . SER C 1 352 ? -21.285 43.256   125.289 1.00 18.60 ? 435 SER C CA  1 
ATOM   8635  C C   . SER C 1 352 ? -19.950 43.942   125.065 1.00 18.41 ? 435 SER C C   1 
ATOM   8636  O O   . SER C 1 352 ? -18.985 43.745   125.800 1.00 20.02 ? 435 SER C O   1 
ATOM   8637  C CB  . SER C 1 352 ? -21.434 42.845   126.762 1.00 20.52 ? 435 SER C CB  1 
ATOM   8638  O OG  . SER C 1 352 ? -20.579 41.772   127.090 1.00 22.10 ? 435 SER C OG  1 
ATOM   8639  N N   . THR C 1 353 ? -19.927 44.767   124.032 1.00 16.72 ? 436 THR C N   1 
ATOM   8640  C CA  . THR C 1 353 ? -18.765 45.529   123.649 1.00 15.14 ? 436 THR C CA  1 
ATOM   8641  C C   . THR C 1 353 ? -19.322 46.935   123.507 1.00 16.99 ? 436 THR C C   1 
ATOM   8642  O O   . THR C 1 353 ? -20.539 47.147   123.632 1.00 16.83 ? 436 THR C O   1 
ATOM   8643  C CB  . THR C 1 353 ? -18.252 45.068   122.286 1.00 15.91 ? 436 THR C CB  1 
ATOM   8644  O OG1 . THR C 1 353 ? -19.345 45.045   121.360 1.00 15.90 ? 436 THR C OG1 1 
ATOM   8645  C CG2 . THR C 1 353 ? -17.660 43.687   122.374 1.00 12.28 ? 436 THR C CG2 1 
ATOM   8646  N N   . ILE C 1 354 ? -18.458 47.906   123.244 1.00 16.37 ? 437 ILE C N   1 
ATOM   8647  C CA  . ILE C 1 354 ? -18.966 49.253   123.082 1.00 17.64 ? 437 ILE C CA  1 
ATOM   8648  C C   . ILE C 1 354 ? -19.062 49.584   121.602 1.00 18.18 ? 437 ILE C C   1 
ATOM   8649  O O   . ILE C 1 354 ? -19.390 50.713   121.247 1.00 19.85 ? 437 ILE C O   1 
ATOM   8650  C CB  . ILE C 1 354 ? -18.053 50.294   123.740 1.00 18.66 ? 437 ILE C CB  1 
ATOM   8651  C CG1 . ILE C 1 354 ? -16.704 50.317   123.026 1.00 18.24 ? 437 ILE C CG1 1 
ATOM   8652  C CG2 . ILE C 1 354 ? -17.888 49.986   125.221 1.00 19.23 ? 437 ILE C CG2 1 
ATOM   8653  C CD1 . ILE C 1 354 ? -15.769 51.374   123.546 1.00 17.78 ? 437 ILE C CD1 1 
ATOM   8654  N N   . TRP C 1 355 ? -18.818 48.586   120.751 1.00 17.70 ? 438 TRP C N   1 
ATOM   8655  C CA  . TRP C 1 355 ? -18.809 48.772   119.298 1.00 16.81 ? 438 TRP C CA  1 
ATOM   8656  C C   . TRP C 1 355 ? -19.478 47.658   118.488 1.00 16.58 ? 438 TRP C C   1 
ATOM   8657  O O   . TRP C 1 355 ? -19.880 46.625   119.020 1.00 18.66 ? 438 TRP C O   1 
ATOM   8658  C CB  . TRP C 1 355 ? -17.361 48.868   118.833 1.00 15.20 ? 438 TRP C CB  1 
ATOM   8659  C CG  . TRP C 1 355 ? -16.575 47.687   119.325 1.00 16.21 ? 438 TRP C CG  1 
ATOM   8660  C CD1 . TRP C 1 355 ? -15.997 47.542   120.557 1.00 16.36 ? 438 TRP C CD1 1 
ATOM   8661  C CD2 . TRP C 1 355 ? -16.413 46.426   118.663 1.00 15.28 ? 438 TRP C CD2 1 
ATOM   8662  N NE1 . TRP C 1 355 ? -15.497 46.275   120.702 1.00 14.79 ? 438 TRP C NE1 1 
ATOM   8663  C CE2 . TRP C 1 355 ? -15.738 45.567   119.553 1.00 15.44 ? 438 TRP C CE2 1 
ATOM   8664  C CE3 . TRP C 1 355 ? -16.778 45.935   117.399 1.00 15.07 ? 438 TRP C CE3 1 
ATOM   8665  C CZ2 . TRP C 1 355 ? -15.420 44.246   119.225 1.00 14.77 ? 438 TRP C CZ2 1 
ATOM   8666  C CZ3 . TRP C 1 355 ? -16.462 44.623   117.075 1.00 14.57 ? 438 TRP C CZ3 1 
ATOM   8667  C CH2 . TRP C 1 355 ? -15.791 43.794   117.985 1.00 14.37 ? 438 TRP C CH2 1 
ATOM   8668  N N   . THR C 1 356 ? -19.556 47.883   117.180 1.00 17.27 ? 439 THR C N   1 
ATOM   8669  C CA  . THR C 1 356 ? -20.125 46.931   116.226 1.00 15.90 ? 439 THR C CA  1 
ATOM   8670  C C   . THR C 1 356 ? -19.335 46.988   114.914 1.00 15.94 ? 439 THR C C   1 
ATOM   8671  O O   . THR C 1 356 ? -19.174 48.061   114.329 1.00 17.17 ? 439 THR C O   1 
ATOM   8672  C CB  . THR C 1 356 ? -21.608 47.260   115.913 1.00 15.92 ? 439 THR C CB  1 
ATOM   8673  O OG1 . THR C 1 356 ? -22.416 46.995   117.067 1.00 17.00 ? 439 THR C OG1 1 
ATOM   8674  C CG2 . THR C 1 356 ? -22.108 46.426   114.744 1.00 14.22 ? 439 THR C CG2 1 
ATOM   8675  N N   . SER C 1 357 ? -18.835 45.843   114.452 1.00 15.71 ? 440 SER C N   1 
ATOM   8676  C CA  . SER C 1 357 ? -18.096 45.800   113.189 1.00 15.35 ? 440 SER C CA  1 
ATOM   8677  C C   . SER C 1 357 ? -18.263 44.445   112.520 1.00 16.97 ? 440 SER C C   1 
ATOM   8678  O O   . SER C 1 357 ? -18.914 43.559   113.075 1.00 18.78 ? 440 SER C O   1 
ATOM   8679  C CB  . SER C 1 357 ? -16.613 46.083   113.417 1.00 15.31 ? 440 SER C CB  1 
ATOM   8680  O OG  . SER C 1 357 ? -15.993 46.454   112.199 1.00 14.65 ? 440 SER C OG  1 
ATOM   8681  N N   . GLY C 1 358 ? -17.684 44.266   111.333 1.00 17.51 ? 441 GLY C N   1 
ATOM   8682  C CA  . GLY C 1 358 ? -17.839 42.989   110.661 1.00 17.14 ? 441 GLY C CA  1 
ATOM   8683  C C   . GLY C 1 358 ? -16.682 42.502   109.811 1.00 18.38 ? 441 GLY C C   1 
ATOM   8684  O O   . GLY C 1 358 ? -15.835 43.281   109.397 1.00 20.08 ? 441 GLY C O   1 
ATOM   8685  N N   . SER C 1 359 ? -16.645 41.193   109.578 1.00 18.55 ? 442 SER C N   1 
ATOM   8686  C CA  . SER C 1 359 ? -15.633 40.552   108.742 1.00 18.86 ? 442 SER C CA  1 
ATOM   8687  C C   . SER C 1 359 ? -16.397 39.995   107.556 1.00 17.61 ? 442 SER C C   1 
ATOM   8688  O O   . SER C 1 359 ? -17.626 39.959   107.572 1.00 17.23 ? 442 SER C O   1 
ATOM   8689  C CB  . SER C 1 359 ? -14.965 39.381   109.474 1.00 21.12 ? 442 SER C CB  1 
ATOM   8690  O OG  . SER C 1 359 ? -13.979 39.834   110.386 1.00 28.29 ? 442 SER C OG  1 
ATOM   8691  N N   . SER C 1 360 ? -15.687 39.551   106.530 1.00 16.47 ? 443 SER C N   1 
ATOM   8692  C CA  . SER C 1 360 ? -16.378 38.987   105.389 1.00 15.81 ? 443 SER C CA  1 
ATOM   8693  C C   . SER C 1 360 ? -15.758 37.710   104.868 1.00 15.11 ? 443 SER C C   1 
ATOM   8694  O O   . SER C 1 360 ? -14.594 37.406   105.134 1.00 15.47 ? 443 SER C O   1 
ATOM   8695  C CB  . SER C 1 360 ? -16.473 40.002   104.250 1.00 15.68 ? 443 SER C CB  1 
ATOM   8696  O OG  . SER C 1 360 ? -15.210 40.276   103.678 1.00 18.26 ? 443 SER C OG  1 
ATOM   8697  N N   . ILE C 1 361 ? -16.587 36.961   104.146 1.00 14.93 ? 444 ILE C N   1 
ATOM   8698  C CA  . ILE C 1 361 ? -16.219 35.715   103.500 1.00 13.93 ? 444 ILE C CA  1 
ATOM   8699  C C   . ILE C 1 361 ? -17.040 35.703   102.215 1.00 14.02 ? 444 ILE C C   1 
ATOM   8700  O O   . ILE C 1 361 ? -18.134 36.259   102.182 1.00 14.06 ? 444 ILE C O   1 
ATOM   8701  C CB  . ILE C 1 361 ? -16.594 34.470   104.352 1.00 14.33 ? 444 ILE C CB  1 
ATOM   8702  C CG1 . ILE C 1 361 ? -18.071 34.511   104.725 1.00 12.83 ? 444 ILE C CG1 1 
ATOM   8703  C CG2 . ILE C 1 361 ? -15.715 34.394   105.590 1.00 14.72 ? 444 ILE C CG2 1 
ATOM   8704  C CD1 . ILE C 1 361 ? -18.595 33.179   105.196 1.00 12.34 ? 444 ILE C CD1 1 
ATOM   8705  N N   . SER C 1 362 ? -16.517 35.081   101.163 1.00 14.90 ? 445 SER C N   1 
ATOM   8706  C CA  . SER C 1 362 ? -17.223 35.018   99.886  1.00 16.48 ? 445 SER C CA  1 
ATOM   8707  C C   . SER C 1 362 ? -17.015 33.677   99.191  1.00 17.96 ? 445 SER C C   1 
ATOM   8708  O O   . SER C 1 362 ? -16.015 32.996   99.427  1.00 17.24 ? 445 SER C O   1 
ATOM   8709  C CB  . SER C 1 362 ? -16.742 36.145   98.955  1.00 17.79 ? 445 SER C CB  1 
ATOM   8710  O OG  . SER C 1 362 ? -15.376 35.975   98.578  1.00 15.35 ? 445 SER C OG  1 
ATOM   8711  N N   . PHE C 1 363 ? -17.961 33.314   98.324  1.00 19.43 ? 446 PHE C N   1 
ATOM   8712  C CA  . PHE C 1 363 ? -17.905 32.058   97.569  1.00 19.64 ? 446 PHE C CA  1 
ATOM   8713  C C   . PHE C 1 363 ? -18.295 32.290   96.108  1.00 20.62 ? 446 PHE C C   1 
ATOM   8714  O O   . PHE C 1 363 ? -18.784 33.364   95.746  1.00 20.79 ? 446 PHE C O   1 
ATOM   8715  C CB  . PHE C 1 363 ? -18.860 31.027   98.169  1.00 18.41 ? 446 PHE C CB  1 
ATOM   8716  C CG  . PHE C 1 363 ? -18.598 30.717   99.609  1.00 17.79 ? 446 PHE C CG  1 
ATOM   8717  C CD1 . PHE C 1 363 ? -18.858 31.656   100.599 1.00 16.80 ? 446 PHE C CD1 1 
ATOM   8718  C CD2 . PHE C 1 363 ? -18.096 29.477   99.982  1.00 18.21 ? 446 PHE C CD2 1 
ATOM   8719  C CE1 . PHE C 1 363 ? -18.619 31.363   101.942 1.00 17.73 ? 446 PHE C CE1 1 
ATOM   8720  C CE2 . PHE C 1 363 ? -17.854 29.174   101.331 1.00 17.79 ? 446 PHE C CE2 1 
ATOM   8721  C CZ  . PHE C 1 363 ? -18.116 30.118   102.308 1.00 16.04 ? 446 PHE C CZ  1 
ATOM   8722  N N   . CYS C 1 364 ? -18.092 31.284   95.266  1.00 21.10 ? 447 CYS C N   1 
ATOM   8723  C CA  . CYS C 1 364 ? -18.451 31.419   93.857  1.00 22.32 ? 447 CYS C CA  1 
ATOM   8724  C C   . CYS C 1 364 ? -19.084 30.150   93.292  1.00 21.82 ? 447 CYS C C   1 
ATOM   8725  O O   . CYS C 1 364 ? -18.940 29.083   93.870  1.00 21.75 ? 447 CYS C O   1 
ATOM   8726  C CB  . CYS C 1 364 ? -17.221 31.816   93.026  1.00 22.42 ? 447 CYS C CB  1 
ATOM   8727  S SG  . CYS C 1 364 ? -16.776 33.590   93.105  1.00 26.80 ? 447 CYS C SG  1 
ATOM   8728  N N   . GLY C 1 365 ? -19.784 30.298   92.165  1.00 23.21 ? 448 GLY C N   1 
ATOM   8729  C CA  . GLY C 1 365 ? -20.460 29.201   91.480  1.00 25.37 ? 448 GLY C CA  1 
ATOM   8730  C C   . GLY C 1 365 ? -19.769 27.849   91.443  1.00 26.47 ? 448 GLY C C   1 
ATOM   8731  O O   . GLY C 1 365 ? -19.724 27.154   92.459  1.00 29.38 ? 448 GLY C O   1 
ATOM   8732  N N   . VAL C 1 366 ? -19.276 27.436   90.281  1.00 25.89 ? 449 VAL C N   1 
ATOM   8733  C CA  . VAL C 1 366 ? -18.558 26.156   90.171  1.00 25.37 ? 449 VAL C CA  1 
ATOM   8734  C C   . VAL C 1 366 ? -19.366 24.880   89.902  1.00 25.96 ? 449 VAL C C   1 
ATOM   8735  O O   . VAL C 1 366 ? -20.383 24.608   90.552  1.00 24.04 ? 449 VAL C O   1 
ATOM   8736  C CB  . VAL C 1 366 ? -17.651 25.948   91.434  1.00 24.49 ? 449 VAL C CB  1 
ATOM   8737  C CG1 . VAL C 1 366 ? -17.356 24.483   91.676  1.00 24.11 ? 449 VAL C CG1 1 
ATOM   8738  C CG2 . VAL C 1 366 ? -16.359 26.725   91.258  1.00 24.35 ? 449 VAL C CG2 1 
ATOM   8739  N N   . ASN C 1 367 ? -18.872 24.100   88.935  1.00 27.99 ? 450 ASN C N   1 
ATOM   8740  C CA  . ASN C 1 367 ? -19.471 22.823   88.523  1.00 29.19 ? 450 ASN C CA  1 
ATOM   8741  C C   . ASN C 1 367 ? -18.853 21.638   89.228  1.00 28.48 ? 450 ASN C C   1 
ATOM   8742  O O   . ASN C 1 367 ? -19.496 20.603   89.394  1.00 29.62 ? 450 ASN C O   1 
ATOM   8743  C CB  . ASN C 1 367 ? -19.295 22.597   87.032  1.00 32.68 ? 450 ASN C CB  1 
ATOM   8744  C CG  . ASN C 1 367 ? -20.378 23.256   86.220  1.00 36.63 ? 450 ASN C CG  1 
ATOM   8745  O OD1 . ASN C 1 367 ? -21.569 23.092   86.516  1.00 36.38 ? 450 ASN C OD1 1 
ATOM   8746  N ND2 . ASN C 1 367 ? -19.978 24.002   85.177  1.00 38.78 ? 450 ASN C ND2 1 
ATOM   8747  N N   . SER C 1 368 ? -17.589 21.778   89.606  1.00 27.06 ? 451 SER C N   1 
ATOM   8748  C CA  . SER C 1 368 ? -16.880 20.720   90.304  1.00 25.83 ? 451 SER C CA  1 
ATOM   8749  C C   . SER C 1 368 ? -17.556 20.508   91.666  1.00 25.20 ? 451 SER C C   1 
ATOM   8750  O O   . SER C 1 368 ? -18.541 21.187   91.981  1.00 23.95 ? 451 SER C O   1 
ATOM   8751  C CB  . SER C 1 368 ? -15.419 21.135   90.453  1.00 27.64 ? 451 SER C CB  1 
ATOM   8752  O OG  . SER C 1 368 ? -15.314 22.535   90.654  1.00 24.91 ? 451 SER C OG  1 
ATOM   8753  N N   . ASP C 1 369 ? -17.071 19.588   92.490  1.00 24.78 ? 452 ASP C N   1 
ATOM   8754  C CA  . ASP C 1 369 ? -17.780 19.440   93.747  1.00 26.23 ? 452 ASP C CA  1 
ATOM   8755  C C   . ASP C 1 369 ? -17.267 20.328   94.847  1.00 23.64 ? 452 ASP C C   1 
ATOM   8756  O O   . ASP C 1 369 ? -16.186 20.895   94.774  1.00 23.38 ? 452 ASP C O   1 
ATOM   8757  C CB  . ASP C 1 369 ? -17.838 17.990   94.221  1.00 31.61 ? 452 ASP C CB  1 
ATOM   8758  C CG  . ASP C 1 369 ? -18.930 17.770   95.294  1.00 37.13 ? 452 ASP C CG  1 
ATOM   8759  O OD1 . ASP C 1 369 ? -20.087 18.215   95.078  1.00 36.73 ? 452 ASP C OD1 1 
ATOM   8760  O OD2 . ASP C 1 369 ? -18.633 17.148   96.351  1.00 42.32 ? 452 ASP C OD2 1 
ATOM   8761  N N   . THR C 1 370 ? -18.072 20.437   95.883  1.00 20.65 ? 453 THR C N   1 
ATOM   8762  C CA  . THR C 1 370 ? -17.764 21.308   96.982  1.00 18.12 ? 453 THR C CA  1 
ATOM   8763  C C   . THR C 1 370 ? -17.993 20.577   98.305  1.00 17.21 ? 453 THR C C   1 
ATOM   8764  O O   . THR C 1 370 ? -18.189 19.361   98.326  1.00 16.78 ? 453 THR C O   1 
ATOM   8765  C CB  . THR C 1 370 ? -18.665 22.563   96.853  1.00 18.92 ? 453 THR C CB  1 
ATOM   8766  O OG1 . THR C 1 370 ? -20.046 22.167   96.792  1.00 20.01 ? 453 THR C OG1 1 
ATOM   8767  C CG2 . THR C 1 370 ? -18.349 23.302   95.557  1.00 16.67 ? 453 THR C CG2 1 
ATOM   8768  N N   . VAL C 1 371 ? -17.935 21.319   99.404  1.00 17.09 ? 454 VAL C N   1 
ATOM   8769  C CA  . VAL C 1 371 ? -18.161 20.763   100.728 1.00 17.20 ? 454 VAL C CA  1 
ATOM   8770  C C   . VAL C 1 371 ? -18.682 21.853   101.624 1.00 16.72 ? 454 VAL C C   1 
ATOM   8771  O O   . VAL C 1 371 ? -18.338 23.021   101.470 1.00 17.27 ? 454 VAL C O   1 
ATOM   8772  C CB  . VAL C 1 371 ? -16.871 20.205   101.387 1.00 18.11 ? 454 VAL C CB  1 
ATOM   8773  C CG1 . VAL C 1 371 ? -16.360 19.024   100.599 1.00 22.68 ? 454 VAL C CG1 1 
ATOM   8774  C CG2 . VAL C 1 371 ? -15.807 21.291   101.479 1.00 15.39 ? 454 VAL C CG2 1 
ATOM   8775  N N   . GLY C 1 372 ? -19.535 21.463   102.552 1.00 17.54 ? 455 GLY C N   1 
ATOM   8776  C CA  . GLY C 1 372 ? -20.055 22.417   103.496 1.00 17.52 ? 455 GLY C CA  1 
ATOM   8777  C C   . GLY C 1 372 ? -19.107 22.368   104.674 1.00 16.56 ? 455 GLY C C   1 
ATOM   8778  O O   . GLY C 1 372 ? -18.458 21.350   104.928 1.00 16.75 ? 455 GLY C O   1 
ATOM   8779  N N   . TRP C 1 373 ? -18.999 23.482   105.375 1.00 16.04 ? 456 TRP C N   1 
ATOM   8780  C CA  . TRP C 1 373 ? -18.152 23.560   106.543 1.00 15.48 ? 456 TRP C CA  1 
ATOM   8781  C C   . TRP C 1 373 ? -18.564 24.819   107.279 1.00 15.43 ? 456 TRP C C   1 
ATOM   8782  O O   . TRP C 1 373 ? -19.674 25.328   107.070 1.00 13.86 ? 456 TRP C O   1 
ATOM   8783  C CB  . TRP C 1 373 ? -16.670 23.616   106.146 1.00 16.87 ? 456 TRP C CB  1 
ATOM   8784  C CG  . TRP C 1 373 ? -15.757 23.176   107.262 1.00 17.75 ? 456 TRP C CG  1 
ATOM   8785  C CD1 . TRP C 1 373 ? -16.010 22.197   108.183 1.00 18.87 ? 456 TRP C CD1 1 
ATOM   8786  C CD2 . TRP C 1 373 ? -14.435 23.652   107.541 1.00 19.47 ? 456 TRP C CD2 1 
ATOM   8787  N NE1 . TRP C 1 373 ? -14.932 22.031   109.015 1.00 18.30 ? 456 TRP C NE1 1 
ATOM   8788  C CE2 . TRP C 1 373 ? -13.948 22.910   108.643 1.00 19.15 ? 456 TRP C CE2 1 
ATOM   8789  C CE3 . TRP C 1 373 ? -13.609 24.630   106.968 1.00 19.26 ? 456 TRP C CE3 1 
ATOM   8790  C CZ2 . TRP C 1 373 ? -12.678 23.115   109.180 1.00 17.28 ? 456 TRP C CZ2 1 
ATOM   8791  C CZ3 . TRP C 1 373 ? -12.349 24.831   107.504 1.00 18.06 ? 456 TRP C CZ3 1 
ATOM   8792  C CH2 . TRP C 1 373 ? -11.897 24.077   108.598 1.00 17.11 ? 456 TRP C CH2 1 
ATOM   8793  N N   . SER C 1 374 ? -17.687 25.316   108.143 1.00 14.18 ? 457 SER C N   1 
ATOM   8794  C CA  . SER C 1 374 ? -17.990 26.518   108.896 1.00 13.90 ? 457 SER C CA  1 
ATOM   8795  C C   . SER C 1 374 ? -16.858 27.534   108.930 1.00 13.56 ? 457 SER C C   1 
ATOM   8796  O O   . SER C 1 374 ? -15.797 27.285   109.510 1.00 13.63 ? 457 SER C O   1 
ATOM   8797  C CB  . SER C 1 374 ? -18.377 26.160   110.314 1.00 12.13 ? 457 SER C CB  1 
ATOM   8798  O OG  . SER C 1 374 ? -18.847 27.323   110.949 1.00 17.70 ? 457 SER C OG  1 
ATOM   8799  N N   . TRP C 1 375 ? -17.105 28.692   108.323 1.00 13.45 ? 458 TRP C N   1 
ATOM   8800  C CA  . TRP C 1 375 ? -16.120 29.770   108.268 1.00 14.20 ? 458 TRP C CA  1 
ATOM   8801  C C   . TRP C 1 375 ? -16.612 31.027   108.987 1.00 15.00 ? 458 TRP C C   1 
ATOM   8802  O O   . TRP C 1 375 ? -17.005 32.005   108.344 1.00 16.21 ? 458 TRP C O   1 
ATOM   8803  C CB  . TRP C 1 375 ? -15.803 30.112   106.810 1.00 12.06 ? 458 TRP C CB  1 
ATOM   8804  C CG  . TRP C 1 375 ? -15.092 29.016   106.052 1.00 13.37 ? 458 TRP C CG  1 
ATOM   8805  C CD1 . TRP C 1 375 ? -13.744 28.769   106.031 1.00 11.59 ? 458 TRP C CD1 1 
ATOM   8806  C CD2 . TRP C 1 375 ? -15.688 28.042   105.183 1.00 10.41 ? 458 TRP C CD2 1 
ATOM   8807  N NE1 . TRP C 1 375 ? -13.468 27.714   105.199 1.00 9.10  ? 458 TRP C NE1 1 
ATOM   8808  C CE2 . TRP C 1 375 ? -14.639 27.248   104.667 1.00 10.08 ? 458 TRP C CE2 1 
ATOM   8809  C CE3 . TRP C 1 375 ? -17.003 27.765   104.791 1.00 10.63 ? 458 TRP C CE3 1 
ATOM   8810  C CZ2 . TRP C 1 375 ? -14.868 26.193   103.772 1.00 10.29 ? 458 TRP C CZ2 1 
ATOM   8811  C CZ3 . TRP C 1 375 ? -17.229 26.710   103.898 1.00 9.08  ? 458 TRP C CZ3 1 
ATOM   8812  C CH2 . TRP C 1 375 ? -16.166 25.942   103.401 1.00 10.50 ? 458 TRP C CH2 1 
ATOM   8813  N N   . PRO C 1 376 ? -16.591 31.020   110.330 1.00 15.27 ? 459 PRO C N   1 
ATOM   8814  C CA  . PRO C 1 376 ? -17.030 32.147   111.162 1.00 16.55 ? 459 PRO C CA  1 
ATOM   8815  C C   . PRO C 1 376 ? -15.988 33.268   111.286 1.00 18.68 ? 459 PRO C C   1 
ATOM   8816  O O   . PRO C 1 376 ? -14.911 33.209   110.690 1.00 20.82 ? 459 PRO C O   1 
ATOM   8817  C CB  . PRO C 1 376 ? -17.308 31.482   112.506 1.00 16.14 ? 459 PRO C CB  1 
ATOM   8818  C CG  . PRO C 1 376 ? -16.199 30.467   112.571 1.00 15.26 ? 459 PRO C CG  1 
ATOM   8819  C CD  . PRO C 1 376 ? -16.235 29.863   111.172 1.00 16.22 ? 459 PRO C CD  1 
ATOM   8820  N N   . ASP C 1 377 ? -16.311 34.288   112.076 1.00 18.96 ? 460 ASP C N   1 
ATOM   8821  C CA  . ASP C 1 377 ? -15.406 35.409   112.269 1.00 17.69 ? 460 ASP C CA  1 
ATOM   8822  C C   . ASP C 1 377 ? -14.153 34.984   113.026 1.00 18.41 ? 460 ASP C C   1 
ATOM   8823  O O   . ASP C 1 377 ? -13.041 35.225   112.566 1.00 18.46 ? 460 ASP C O   1 
ATOM   8824  C CB  . ASP C 1 377 ? -16.135 36.520   113.004 1.00 18.80 ? 460 ASP C CB  1 
ATOM   8825  C CG  . ASP C 1 377 ? -15.226 37.642   113.396 1.00 20.44 ? 460 ASP C CG  1 
ATOM   8826  O OD1 . ASP C 1 377 ? -14.734 37.618   114.543 1.00 21.67 ? 460 ASP C OD1 1 
ATOM   8827  O OD2 . ASP C 1 377 ? -14.996 38.544   112.562 1.00 21.92 ? 460 ASP C OD2 1 
ATOM   8828  N N   . GLY C 1 378 ? -14.332 34.366   114.191 1.00 18.85 ? 461 GLY C N   1 
ATOM   8829  C CA  . GLY C 1 378 ? -13.193 33.893   114.964 1.00 18.27 ? 461 GLY C CA  1 
ATOM   8830  C C   . GLY C 1 378 ? -12.544 34.817   115.980 1.00 18.29 ? 461 GLY C C   1 
ATOM   8831  O O   . GLY C 1 378 ? -11.580 34.438   116.636 1.00 19.15 ? 461 GLY C O   1 
ATOM   8832  N N   . ALA C 1 379 ? -13.034 36.037   116.114 1.00 18.06 ? 462 ALA C N   1 
ATOM   8833  C CA  . ALA C 1 379 ? -12.441 36.946   117.086 1.00 18.97 ? 462 ALA C CA  1 
ATOM   8834  C C   . ALA C 1 379 ? -13.054 36.676   118.451 1.00 18.92 ? 462 ALA C C   1 
ATOM   8835  O O   . ALA C 1 379 ? -14.239 36.364   118.546 1.00 19.67 ? 462 ALA C O   1 
ATOM   8836  C CB  . ALA C 1 379 ? -12.705 38.382   116.681 1.00 17.46 ? 462 ALA C CB  1 
ATOM   8837  N N   . GLU C 1 380 ? -12.273 36.766   119.516 1.00 19.74 ? 463 GLU C N   1 
ATOM   8838  C CA  . GLU C 1 380 ? -12.889 36.543   120.810 1.00 21.72 ? 463 GLU C CA  1 
ATOM   8839  C C   . GLU C 1 380 ? -13.159 37.866   121.502 1.00 19.92 ? 463 GLU C C   1 
ATOM   8840  O O   . GLU C 1 380 ? -12.245 38.626   121.790 1.00 17.86 ? 463 GLU C O   1 
ATOM   8841  C CB  . GLU C 1 380 ? -12.048 35.617   121.702 1.00 25.95 ? 463 GLU C CB  1 
ATOM   8842  C CG  . GLU C 1 380 ? -10.680 36.121   122.119 1.00 33.16 ? 463 GLU C CG  1 
ATOM   8843  C CD  . GLU C 1 380 ? -10.019 35.204   123.162 1.00 37.61 ? 463 GLU C CD  1 
ATOM   8844  O OE1 . GLU C 1 380 ? -10.524 35.139   124.313 1.00 35.94 ? 463 GLU C OE1 1 
ATOM   8845  O OE2 . GLU C 1 380 ? -8.997  34.545   122.821 1.00 40.14 ? 463 GLU C OE2 1 
ATOM   8846  N N   . LEU C 1 381 ? -14.441 38.145   121.725 1.00 19.24 ? 464 LEU C N   1 
ATOM   8847  C CA  . LEU C 1 381 ? -14.856 39.364   122.399 1.00 19.53 ? 464 LEU C CA  1 
ATOM   8848  C C   . LEU C 1 381 ? -15.028 39.059   123.882 1.00 19.05 ? 464 LEU C C   1 
ATOM   8849  O O   . LEU C 1 381 ? -15.156 37.899   124.277 1.00 17.55 ? 464 LEU C O   1 
ATOM   8850  C CB  . LEU C 1 381 ? -16.191 39.871   121.816 1.00 19.75 ? 464 LEU C CB  1 
ATOM   8851  C CG  . LEU C 1 381 ? -16.136 40.183   120.313 1.00 21.95 ? 464 LEU C CG  1 
ATOM   8852  C CD1 . LEU C 1 381 ? -17.457 40.746   119.798 1.00 20.06 ? 464 LEU C CD1 1 
ATOM   8853  C CD2 . LEU C 1 381 ? -15.018 41.184   120.080 1.00 23.12 ? 464 LEU C CD2 1 
ATOM   8854  N N   . PRO C 1 382 ? -14.985 40.095   124.729 1.00 19.37 ? 465 PRO C N   1 
ATOM   8855  C CA  . PRO C 1 382 ? -14.827 41.506   124.354 1.00 19.15 ? 465 PRO C CA  1 
ATOM   8856  C C   . PRO C 1 382 ? -13.353 41.868   124.123 1.00 17.91 ? 465 PRO C C   1 
ATOM   8857  O O   . PRO C 1 382 ? -12.462 41.097   124.452 1.00 16.84 ? 465 PRO C O   1 
ATOM   8858  C CB  . PRO C 1 382 ? -15.430 42.243   125.542 1.00 18.84 ? 465 PRO C CB  1 
ATOM   8859  C CG  . PRO C 1 382 ? -15.009 41.348   126.707 1.00 19.91 ? 465 PRO C CG  1 
ATOM   8860  C CD  . PRO C 1 382 ? -15.324 39.963   126.163 1.00 19.96 ? 465 PRO C CD  1 
ATOM   8861  N N   . PHE C 1 383 ? -13.111 43.039   123.546 1.00 17.27 ? 466 PHE C N   1 
ATOM   8862  C CA  . PHE C 1 383 ? -11.748 43.490   123.280 1.00 17.40 ? 466 PHE C CA  1 
ATOM   8863  C C   . PHE C 1 383 ? -11.247 44.359   124.425 1.00 18.33 ? 466 PHE C C   1 
ATOM   8864  O O   . PHE C 1 383 ? -11.996 44.667   125.352 1.00 18.02 ? 466 PHE C O   1 
ATOM   8865  C CB  . PHE C 1 383 ? -11.695 44.302   121.983 1.00 15.60 ? 466 PHE C CB  1 
ATOM   8866  C CG  . PHE C 1 383 ? -11.557 43.474   120.738 1.00 15.46 ? 466 PHE C CG  1 
ATOM   8867  C CD1 . PHE C 1 383 ? -11.795 42.104   120.756 1.00 14.74 ? 466 PHE C CD1 1 
ATOM   8868  C CD2 . PHE C 1 383 ? -11.199 44.077   119.529 1.00 15.96 ? 466 PHE C CD2 1 
ATOM   8869  C CE1 . PHE C 1 383 ? -11.678 41.339   119.585 1.00 15.48 ? 466 PHE C CE1 1 
ATOM   8870  C CE2 . PHE C 1 383 ? -11.080 43.328   118.352 1.00 15.76 ? 466 PHE C CE2 1 
ATOM   8871  C CZ  . PHE C 1 383 ? -11.319 41.954   118.378 1.00 15.49 ? 466 PHE C CZ  1 
ATOM   8872  N N   . THR C 1 384 ? -9.980  44.762   124.350 1.00 18.99 ? 467 THR C N   1 
ATOM   8873  C CA  . THR C 1 384 ? -9.380  45.612   125.372 1.00 20.56 ? 467 THR C CA  1 
ATOM   8874  C C   . THR C 1 384 ? -10.306 46.811   125.596 1.00 21.78 ? 467 THR C C   1 
ATOM   8875  O O   . THR C 1 384 ? -10.244 47.491   126.628 1.00 22.21 ? 467 THR C O   1 
ATOM   8876  C CB  . THR C 1 384 ? -7.986  46.085   124.920 1.00 19.36 ? 467 THR C CB  1 
ATOM   8877  O OG1 . THR C 1 384 ? -7.268  44.965   124.395 1.00 19.41 ? 467 THR C OG1 1 
ATOM   8878  C CG2 . THR C 1 384 ? -7.198  46.651   126.092 1.00 16.27 ? 467 THR C CG2 1 
ATOM   8879  N N   . ILE C 1 385 ? -11.177 47.019   124.612 1.00 22.48 ? 468 ILE C N   1 
ATOM   8880  C CA  . ILE C 1 385 ? -12.188 48.069   124.578 1.00 22.35 ? 468 ILE C CA  1 
ATOM   8881  C C   . ILE C 1 385 ? -11.629 49.357   123.996 1.00 24.93 ? 468 ILE C C   1 
ATOM   8882  O O   . ILE C 1 385 ? -11.958 49.662   122.820 1.00 24.14 ? 468 ILE C O   1 
ATOM   8883  C CB  . ILE C 1 385 ? -12.783 48.339   125.980 1.00 19.62 ? 468 ILE C CB  1 
ATOM   8884  C CG1 . ILE C 1 385 ? -13.750 47.204   126.373 1.00 18.28 ? 468 ILE C CG1 1 
ATOM   8885  C CG2 . ILE C 1 385 ? -13.456 49.693   125.984 1.00 17.22 ? 468 ILE C CG2 1 
ATOM   8886  C CD1 . ILE C 1 385 ? -14.122 47.153   127.870 1.00 14.80 ? 468 ILE C CD1 1 
ATOM   8887  N N   . VAL D 1 1   ? 17.232  52.587   77.774  1.00 26.34 ? 83  VAL D N   1 
ATOM   8888  C CA  . VAL D 1 1   ? 18.594  52.997   77.291  1.00 28.15 ? 83  VAL D CA  1 
ATOM   8889  C C   . VAL D 1 1   ? 19.534  53.289   78.465  1.00 27.04 ? 83  VAL D C   1 
ATOM   8890  O O   . VAL D 1 1   ? 19.107  53.775   79.510  1.00 27.61 ? 83  VAL D O   1 
ATOM   8891  C CB  . VAL D 1 1   ? 18.518  54.256   76.363  1.00 28.41 ? 83  VAL D CB  1 
ATOM   8892  C CG1 . VAL D 1 1   ? 19.913  54.671   75.908  1.00 28.59 ? 83  VAL D CG1 1 
ATOM   8893  C CG2 . VAL D 1 1   ? 17.668  53.941   75.131  1.00 31.13 ? 83  VAL D CG2 1 
ATOM   8894  N N   . LYS D 1 2   ? 20.816  52.993   78.278  1.00 26.43 ? 84  LYS D N   1 
ATOM   8895  C CA  . LYS D 1 2   ? 21.810  53.199   79.322  1.00 25.53 ? 84  LYS D CA  1 
ATOM   8896  C C   . LYS D 1 2   ? 22.130  54.657   79.573  1.00 23.92 ? 84  LYS D C   1 
ATOM   8897  O O   . LYS D 1 2   ? 22.123  55.479   78.657  1.00 22.01 ? 84  LYS D O   1 
ATOM   8898  C CB  . LYS D 1 2   ? 23.115  52.452   78.999  1.00 26.70 ? 84  LYS D CB  1 
ATOM   8899  C CG  . LYS D 1 2   ? 22.975  50.937   78.974  1.00 30.04 ? 84  LYS D CG  1 
ATOM   8900  C CD  . LYS D 1 2   ? 22.203  50.494   77.742  1.00 33.33 ? 84  LYS D CD  1 
ATOM   8901  C CE  . LYS D 1 2   ? 22.059  48.973   77.661  1.00 35.58 ? 84  LYS D CE  1 
ATOM   8902  N NZ  . LYS D 1 2   ? 21.764  48.547   76.245  1.00 35.70 ? 84  LYS D NZ  1 
ATOM   8903  N N   . LEU D 1 3   ? 22.400  54.959   80.838  1.00 21.50 ? 85  LEU D N   1 
ATOM   8904  C CA  . LEU D 1 3   ? 22.755  56.302   81.261  1.00 20.66 ? 85  LEU D CA  1 
ATOM   8905  C C   . LEU D 1 3   ? 24.122  56.690   80.705  1.00 19.22 ? 85  LEU D C   1 
ATOM   8906  O O   . LEU D 1 3   ? 25.140  56.161   81.142  1.00 20.18 ? 85  LEU D O   1 
ATOM   8907  C CB  . LEU D 1 3   ? 22.824  56.360   82.791  1.00 19.65 ? 85  LEU D CB  1 
ATOM   8908  C CG  . LEU D 1 3   ? 21.731  57.038   83.608  1.00 19.55 ? 85  LEU D CG  1 
ATOM   8909  C CD1 . LEU D 1 3   ? 20.355  56.640   83.112  1.00 18.43 ? 85  LEU D CD1 1 
ATOM   8910  C CD2 . LEU D 1 3   ? 21.921  56.648   85.068  1.00 19.46 ? 85  LEU D CD2 1 
ATOM   8911  N N   . ALA D 1 4   ? 24.158  57.587   79.732  1.00 18.55 ? 86  ALA D N   1 
ATOM   8912  C CA  . ALA D 1 4   ? 25.449  58.031   79.222  1.00 17.77 ? 86  ALA D CA  1 
ATOM   8913  C C   . ALA D 1 4   ? 26.016  58.823   80.394  1.00 17.74 ? 86  ALA D C   1 
ATOM   8914  O O   . ALA D 1 4   ? 25.273  59.509   81.115  1.00 19.06 ? 86  ALA D O   1 
ATOM   8915  C CB  . ALA D 1 4   ? 25.272  58.947   78.010  1.00 14.19 ? 86  ALA D CB  1 
ATOM   8916  N N   . GLY D 1 5   ? 27.311  58.726   80.623  1.00 16.51 ? 87  GLY D N   1 
ATOM   8917  C CA  . GLY D 1 5   ? 27.865  59.495   81.724  1.00 17.17 ? 87  GLY D CA  1 
ATOM   8918  C C   . GLY D 1 5   ? 28.966  60.391   81.205  1.00 17.48 ? 87  GLY D C   1 
ATOM   8919  O O   . GLY D 1 5   ? 29.981  60.574   81.878  1.00 18.39 ? 87  GLY D O   1 
ATOM   8920  N N   . ASN D 1 6   ? 28.761  60.949   80.010  1.00 16.91 ? 88  ASN D N   1 
ATOM   8921  C CA  . ASN D 1 6   ? 29.769  61.783   79.369  1.00 16.65 ? 88  ASN D CA  1 
ATOM   8922  C C   . ASN D 1 6   ? 29.640  63.274   79.623  1.00 16.57 ? 88  ASN D C   1 
ATOM   8923  O O   . ASN D 1 6   ? 30.432  64.057   79.120  1.00 17.94 ? 88  ASN D O   1 
ATOM   8924  C CB  . ASN D 1 6   ? 29.803  61.501   77.849  1.00 16.06 ? 88  ASN D CB  1 
ATOM   8925  C CG  . ASN D 1 6   ? 28.486  61.817   77.143  1.00 16.45 ? 88  ASN D CG  1 
ATOM   8926  O OD1 . ASN D 1 6   ? 28.401  61.761   75.904  1.00 16.07 ? 88  ASN D OD1 1 
ATOM   8927  N ND2 . ASN D 1 6   ? 27.456  62.147   77.918  1.00 15.62 ? 88  ASN D ND2 1 
ATOM   8928  N N   . SER D 1 7   ? 28.655  63.656   80.424  1.00 17.75 ? 89  SER D N   1 
ATOM   8929  C CA  . SER D 1 7   ? 28.401  65.055   80.760  1.00 17.02 ? 89  SER D CA  1 
ATOM   8930  C C   . SER D 1 7   ? 29.213  65.486   82.001  1.00 17.31 ? 89  SER D C   1 
ATOM   8931  O O   . SER D 1 7   ? 29.778  64.641   82.691  1.00 17.16 ? 89  SER D O   1 
ATOM   8932  C CB  . SER D 1 7   ? 26.899  65.226   81.003  1.00 17.74 ? 89  SER D CB  1 
ATOM   8933  O OG  . SER D 1 7   ? 26.574  66.546   81.375  1.00 20.90 ? 89  SER D OG  1 
ATOM   8934  N N   . SER D 1 8   ? 29.273  66.792   82.273  1.00 17.31 ? 90  SER D N   1 
ATOM   8935  C CA  . SER D 1 8   ? 30.009  67.331   83.432  1.00 17.85 ? 90  SER D CA  1 
ATOM   8936  C C   . SER D 1 8   ? 29.120  67.758   84.592  1.00 17.31 ? 90  SER D C   1 
ATOM   8937  O O   . SER D 1 8   ? 27.922  67.986   84.417  1.00 17.73 ? 90  SER D O   1 
ATOM   8938  C CB  . SER D 1 8   ? 30.820  68.562   83.034  1.00 18.92 ? 90  SER D CB  1 
ATOM   8939  O OG  . SER D 1 8   ? 31.838  68.223   82.120  1.00 27.01 ? 90  SER D OG  1 
ATOM   8940  N N   . LEU D 1 9   ? 29.716  67.892   85.774  1.00 15.65 ? 91  LEU D N   1 
ATOM   8941  C CA  . LEU D 1 9   ? 28.961  68.345   86.930  1.00 16.04 ? 91  LEU D CA  1 
ATOM   8942  C C   . LEU D 1 9   ? 28.427  69.734   86.603  1.00 16.76 ? 91  LEU D C   1 
ATOM   8943  O O   . LEU D 1 9   ? 29.162  70.577   86.099  1.00 15.23 ? 91  LEU D O   1 
ATOM   8944  C CB  . LEU D 1 9   ? 29.847  68.446   88.176  1.00 15.86 ? 91  LEU D CB  1 
ATOM   8945  C CG  . LEU D 1 9   ? 30.382  67.178   88.843  1.00 16.65 ? 91  LEU D CG  1 
ATOM   8946  C CD1 . LEU D 1 9   ? 30.954  67.550   90.198  1.00 13.74 ? 91  LEU D CD1 1 
ATOM   8947  C CD2 . LEU D 1 9   ? 29.267  66.140   88.996  1.00 15.39 ? 91  LEU D CD2 1 
ATOM   8948  N N   . CYS D 1 10  ? 27.150  69.964   86.881  1.00 16.85 ? 92  CYS D N   1 
ATOM   8949  C CA  . CYS D 1 10  ? 26.548  71.260   86.623  1.00 18.35 ? 92  CYS D CA  1 
ATOM   8950  C C   . CYS D 1 10  ? 27.208  72.307   87.484  1.00 17.83 ? 92  CYS D C   1 
ATOM   8951  O O   . CYS D 1 10  ? 27.611  72.034   88.609  1.00 18.60 ? 92  CYS D O   1 
ATOM   8952  C CB  . CYS D 1 10  ? 25.058  71.282   86.980  1.00 19.38 ? 92  CYS D CB  1 
ATOM   8953  S SG  . CYS D 1 10  ? 23.994  70.058   86.163  1.00 27.38 ? 92  CYS D SG  1 
ATOM   8954  N N   . PRO D 1 11  ? 27.334  73.531   86.961  1.00 17.47 ? 93  PRO D N   1 
ATOM   8955  C CA  . PRO D 1 11  ? 27.946  74.600   87.751  1.00 16.08 ? 93  PRO D CA  1 
ATOM   8956  C C   . PRO D 1 11  ? 26.905  74.973   88.807  1.00 15.00 ? 93  PRO D C   1 
ATOM   8957  O O   . PRO D 1 11  ? 25.728  75.068   88.496  1.00 14.67 ? 93  PRO D O   1 
ATOM   8958  C CB  . PRO D 1 11  ? 28.175  75.698   86.714  1.00 16.17 ? 93  PRO D CB  1 
ATOM   8959  C CG  . PRO D 1 11  ? 27.081  75.452   85.722  1.00 16.55 ? 93  PRO D CG  1 
ATOM   8960  C CD  . PRO D 1 11  ? 27.073  73.968   85.580  1.00 14.64 ? 93  PRO D CD  1 
ATOM   8961  N N   . ILE D 1 12  ? 27.325  75.164   90.050  1.00 15.59 ? 94  ILE D N   1 
ATOM   8962  C CA  . ILE D 1 12  ? 26.377  75.485   91.115  1.00 14.45 ? 94  ILE D CA  1 
ATOM   8963  C C   . ILE D 1 12  ? 26.851  76.621   92.000  1.00 16.08 ? 94  ILE D C   1 
ATOM   8964  O O   . ILE D 1 12  ? 28.006  77.048   91.920  1.00 16.42 ? 94  ILE D O   1 
ATOM   8965  C CB  . ILE D 1 12  ? 26.147  74.267   92.031  1.00 14.34 ? 94  ILE D CB  1 
ATOM   8966  C CG1 . ILE D 1 12  ? 27.472  73.882   92.695  1.00 14.64 ? 94  ILE D CG1 1 
ATOM   8967  C CG2 . ILE D 1 12  ? 25.580  73.096   91.229  1.00 11.21 ? 94  ILE D CG2 1 
ATOM   8968  C CD1 . ILE D 1 12  ? 27.378  72.742   93.673  1.00 14.92 ? 94  ILE D CD1 1 
ATOM   8969  N N   . ASN D 1 13  ? 25.958  77.104   92.858  1.00 15.97 ? 95  ASN D N   1 
ATOM   8970  C CA  . ASN D 1 13  ? 26.318  78.173   93.779  1.00 17.36 ? 95  ASN D CA  1 
ATOM   8971  C C   . ASN D 1 13  ? 26.096  77.809   95.242  1.00 17.01 ? 95  ASN D C   1 
ATOM   8972  O O   . ASN D 1 13  ? 26.825  78.273   96.115  1.00 18.94 ? 95  ASN D O   1 
ATOM   8973  C CB  . ASN D 1 13  ? 25.549  79.447   93.453  1.00 18.49 ? 95  ASN D CB  1 
ATOM   8974  C CG  . ASN D 1 13  ? 26.133  80.181   92.277  1.00 20.57 ? 95  ASN D CG  1 
ATOM   8975  O OD1 . ASN D 1 13  ? 27.319  80.520   92.273  1.00 19.51 ? 95  ASN D OD1 1 
ATOM   8976  N ND2 . ASN D 1 13  ? 25.309  80.427   91.259  1.00 21.37 ? 95  ASN D ND2 1 
ATOM   8977  N N   . GLY D 1 14  ? 25.093  76.979   95.502  1.00 14.95 ? 96  GLY D N   1 
ATOM   8978  C CA  . GLY D 1 14  ? 24.790  76.581   96.863  1.00 14.06 ? 96  GLY D CA  1 
ATOM   8979  C C   . GLY D 1 14  ? 23.963  75.312   96.871  1.00 13.49 ? 96  GLY D C   1 
ATOM   8980  O O   . GLY D 1 14  ? 23.893  74.618   95.869  1.00 13.00 ? 96  GLY D O   1 
ATOM   8981  N N   . TRP D 1 15  ? 23.320  74.999   97.985  1.00 12.67 ? 97  TRP D N   1 
ATOM   8982  C CA  . TRP D 1 15  ? 22.541  73.776   98.028  1.00 11.52 ? 97  TRP D CA  1 
ATOM   8983  C C   . TRP D 1 15  ? 21.124  74.007   98.520  1.00 10.51 ? 97  TRP D C   1 
ATOM   8984  O O   . TRP D 1 15  ? 20.906  74.741   99.474  1.00 10.54 ? 97  TRP D O   1 
ATOM   8985  C CB  . TRP D 1 15  ? 23.264  72.743   98.900  1.00 11.75 ? 97  TRP D CB  1 
ATOM   8986  C CG  . TRP D 1 15  ? 24.723  72.644   98.573  1.00 13.90 ? 97  TRP D CG  1 
ATOM   8987  C CD1 . TRP D 1 15  ? 25.709  73.493   98.979  1.00 14.66 ? 97  TRP D CD1 1 
ATOM   8988  C CD2 . TRP D 1 15  ? 25.350  71.694   97.699  1.00 14.68 ? 97  TRP D CD2 1 
ATOM   8989  N NE1 . TRP D 1 15  ? 26.909  73.139   98.409  1.00 16.20 ? 97  TRP D NE1 1 
ATOM   8990  C CE2 . TRP D 1 15  ? 26.715  72.037   97.616  1.00 16.00 ? 97  TRP D CE2 1 
ATOM   8991  C CE3 . TRP D 1 15  ? 24.888  70.587   96.969  1.00 15.69 ? 97  TRP D CE3 1 
ATOM   8992  C CZ2 . TRP D 1 15  ? 27.627  71.314   96.836  1.00 16.26 ? 97  TRP D CZ2 1 
ATOM   8993  C CZ3 . TRP D 1 15  ? 25.795  69.869   96.192  1.00 15.29 ? 97  TRP D CZ3 1 
ATOM   8994  C CH2 . TRP D 1 15  ? 27.147  70.238   96.133  1.00 14.75 ? 97  TRP D CH2 1 
ATOM   8995  N N   . ALA D 1 16  ? 20.166  73.378   97.848  1.00 10.52 ? 98  ALA D N   1 
ATOM   8996  C CA  . ALA D 1 16  ? 18.757  73.506   98.197  1.00 12.00 ? 98  ALA D CA  1 
ATOM   8997  C C   . ALA D 1 16  ? 18.255  72.227   98.865  1.00 13.43 ? 98  ALA D C   1 
ATOM   8998  O O   . ALA D 1 16  ? 18.572  71.125   98.413  1.00 15.58 ? 98  ALA D O   1 
ATOM   8999  C CB  . ALA D 1 16  ? 17.947  73.798   96.944  1.00 11.22 ? 98  ALA D CB  1 
ATOM   9000  N N   . VAL D 1 17  ? 17.480  72.365   99.941  1.00 14.13 ? 99  VAL D N   1 
ATOM   9001  C CA  . VAL D 1 17  ? 16.959  71.192   100.645 1.00 14.76 ? 99  VAL D CA  1 
ATOM   9002  C C   . VAL D 1 17  ? 16.166  70.335   99.684  1.00 15.52 ? 99  VAL D C   1 
ATOM   9003  O O   . VAL D 1 17  ? 15.286  70.833   98.987  1.00 15.44 ? 99  VAL D O   1 
ATOM   9004  C CB  . VAL D 1 17  ? 16.015  71.559   101.808 1.00 15.62 ? 99  VAL D CB  1 
ATOM   9005  C CG1 . VAL D 1 17  ? 16.544  70.959   103.106 1.00 15.38 ? 99  VAL D CG1 1 
ATOM   9006  C CG2 . VAL D 1 17  ? 15.855  73.063   101.912 1.00 16.88 ? 99  VAL D CG2 1 
ATOM   9007  N N   . TYR D 1 18  ? 16.473  69.045   99.657  1.00 15.40 ? 100 TYR D N   1 
ATOM   9008  C CA  . TYR D 1 18  ? 15.789  68.124   98.769  1.00 14.83 ? 100 TYR D CA  1 
ATOM   9009  C C   . TYR D 1 18  ? 14.804  67.258   99.552  1.00 15.42 ? 100 TYR D C   1 
ATOM   9010  O O   . TYR D 1 18  ? 13.656  67.082   99.134  1.00 14.11 ? 100 TYR D O   1 
ATOM   9011  C CB  . TYR D 1 18  ? 16.810  67.237   98.053  1.00 15.40 ? 100 TYR D CB  1 
ATOM   9012  C CG  . TYR D 1 18  ? 16.237  66.445   96.902  1.00 15.88 ? 100 TYR D CG  1 
ATOM   9013  C CD1 . TYR D 1 18  ? 15.751  67.088   95.766  1.00 16.83 ? 100 TYR D CD1 1 
ATOM   9014  C CD2 . TYR D 1 18  ? 16.179  65.054   96.948  1.00 17.11 ? 100 TYR D CD2 1 
ATOM   9015  C CE1 . TYR D 1 18  ? 15.218  66.369   94.705  1.00 17.22 ? 100 TYR D CE1 1 
ATOM   9016  C CE2 . TYR D 1 18  ? 15.648  64.317   95.891  1.00 16.79 ? 100 TYR D CE2 1 
ATOM   9017  C CZ  . TYR D 1 18  ? 15.168  64.980   94.774  1.00 18.75 ? 100 TYR D CZ  1 
ATOM   9018  O OH  . TYR D 1 18  ? 14.617  64.260   93.735  1.00 20.17 ? 100 TYR D OH  1 
ATOM   9019  N N   . SER D 1 19  ? 15.246  66.717   100.688 1.00 13.68 ? 101 SER D N   1 
ATOM   9020  C CA  . SER D 1 19  ? 14.362  65.875   101.483 1.00 11.54 ? 101 SER D CA  1 
ATOM   9021  C C   . SER D 1 19  ? 14.742  65.757   102.946 1.00 10.96 ? 101 SER D C   1 
ATOM   9022  O O   . SER D 1 19  ? 15.837  66.145   103.350 1.00 10.27 ? 101 SER D O   1 
ATOM   9023  C CB  . SER D 1 19  ? 14.314  64.476   100.882 1.00 11.74 ? 101 SER D CB  1 
ATOM   9024  O OG  . SER D 1 19  ? 15.571  63.827   101.019 1.00 11.30 ? 101 SER D OG  1 
ATOM   9025  N N   . LYS D 1 20  ? 13.813  65.204   103.723 1.00 10.54 ? 102 LYS D N   1 
ATOM   9026  C CA  . LYS D 1 20  ? 13.980  64.955   105.156 1.00 11.60 ? 102 LYS D CA  1 
ATOM   9027  C C   . LYS D 1 20  ? 12.910  63.931   105.516 1.00 12.11 ? 102 LYS D C   1 
ATOM   9028  O O   . LYS D 1 20  ? 11.726  64.170   105.294 1.00 11.60 ? 102 LYS D O   1 
ATOM   9029  C CB  . LYS D 1 20  ? 13.772  66.229   105.980 1.00 11.83 ? 102 LYS D CB  1 
ATOM   9030  C CG  . LYS D 1 20  ? 14.179  66.050   107.432 1.00 10.18 ? 102 LYS D CG  1 
ATOM   9031  C CD  . LYS D 1 20  ? 13.936  67.305   108.238 1.00 10.93 ? 102 LYS D CD  1 
ATOM   9032  C CE  . LYS D 1 20  ? 14.680  67.280   109.568 1.00 10.61 ? 102 LYS D CE  1 
ATOM   9033  N NZ  . LYS D 1 20  ? 14.218  66.214   110.503 1.00 11.88 ? 102 LYS D NZ  1 
ATOM   9034  N N   . ASP D 1 21  ? 13.318  62.796   106.077 1.00 12.61 ? 103 ASP D N   1 
ATOM   9035  C CA  . ASP D 1 21  ? 12.362  61.739   106.395 1.00 13.24 ? 103 ASP D CA  1 
ATOM   9036  C C   . ASP D 1 21  ? 11.849  61.627   107.837 1.00 12.74 ? 103 ASP D C   1 
ATOM   9037  O O   . ASP D 1 21  ? 10.919  60.862   108.092 1.00 13.75 ? 103 ASP D O   1 
ATOM   9038  C CB  . ASP D 1 21  ? 12.925  60.384   105.921 1.00 15.35 ? 103 ASP D CB  1 
ATOM   9039  C CG  . ASP D 1 21  ? 14.263  60.037   106.572 1.00 18.42 ? 103 ASP D CG  1 
ATOM   9040  O OD1 . ASP D 1 21  ? 15.007  59.197   106.020 1.00 20.07 ? 103 ASP D OD1 1 
ATOM   9041  O OD2 . ASP D 1 21  ? 14.574  60.598   107.644 1.00 22.28 ? 103 ASP D OD2 1 
ATOM   9042  N N   . ASN D 1 22  ? 12.437  62.378   108.766 1.00 11.06 ? 104 ASN D N   1 
ATOM   9043  C CA  . ASN D 1 22  ? 12.012  62.359   110.170 1.00 10.90 ? 104 ASN D CA  1 
ATOM   9044  C C   . ASN D 1 22  ? 11.696  60.962   110.704 1.00 12.01 ? 104 ASN D C   1 
ATOM   9045  O O   . ASN D 1 22  ? 10.873  60.807   111.606 1.00 10.79 ? 104 ASN D O   1 
ATOM   9046  C CB  . ASN D 1 22  ? 10.762  63.220   110.350 1.00 10.33 ? 104 ASN D CB  1 
ATOM   9047  C CG  . ASN D 1 22  ? 10.996  64.675   110.025 1.00 11.15 ? 104 ASN D CG  1 
ATOM   9048  O OD1 . ASN D 1 22  ? 10.510  65.181   109.018 1.00 12.19 ? 104 ASN D OD1 1 
ATOM   9049  N ND2 . ASN D 1 22  ? 11.741  65.360   110.880 1.00 9.29  ? 104 ASN D ND2 1 
ATOM   9050  N N   . SER D 1 23  ? 12.352  59.951   110.156 1.00 13.70 ? 105 SER D N   1 
ATOM   9051  C CA  . SER D 1 23  ? 12.086  58.571   110.547 1.00 16.14 ? 105 SER D CA  1 
ATOM   9052  C C   . SER D 1 23  ? 12.123  58.281   112.046 1.00 16.03 ? 105 SER D C   1 
ATOM   9053  O O   . SER D 1 23  ? 11.319  57.492   112.557 1.00 16.41 ? 105 SER D O   1 
ATOM   9054  C CB  . SER D 1 23  ? 13.047  57.634   109.817 1.00 16.25 ? 105 SER D CB  1 
ATOM   9055  O OG  . SER D 1 23  ? 14.382  58.040   110.025 1.00 21.59 ? 105 SER D OG  1 
ATOM   9056  N N   . ILE D 1 24  ? 13.050  58.907   112.754 1.00 15.13 ? 106 ILE D N   1 
ATOM   9057  C CA  . ILE D 1 24  ? 13.148  58.675   114.183 1.00 14.81 ? 106 ILE D CA  1 
ATOM   9058  C C   . ILE D 1 24  ? 12.002  59.312   114.958 1.00 14.80 ? 106 ILE D C   1 
ATOM   9059  O O   . ILE D 1 24  ? 11.397  58.658   115.813 1.00 15.99 ? 106 ILE D O   1 
ATOM   9060  C CB  . ILE D 1 24  ? 14.512  59.152   114.716 1.00 14.74 ? 106 ILE D CB  1 
ATOM   9061  C CG1 . ILE D 1 24  ? 15.613  58.375   113.980 1.00 12.69 ? 106 ILE D CG1 1 
ATOM   9062  C CG2 . ILE D 1 24  ? 14.606  58.926   116.227 1.00 11.87 ? 106 ILE D CG2 1 
ATOM   9063  C CD1 . ILE D 1 24  ? 17.003  58.655   114.454 1.00 15.79 ? 106 ILE D CD1 1 
ATOM   9064  N N   . ARG D 1 25  ? 11.691  60.571   114.662 1.00 15.06 ? 107 ARG D N   1 
ATOM   9065  C CA  . ARG D 1 25  ? 10.592  61.255   115.349 1.00 15.39 ? 107 ARG D CA  1 
ATOM   9066  C C   . ARG D 1 25  ? 9.310   60.463   115.096 1.00 15.83 ? 107 ARG D C   1 
ATOM   9067  O O   . ARG D 1 25  ? 8.455   60.344   115.974 1.00 17.47 ? 107 ARG D O   1 
ATOM   9068  C CB  . ARG D 1 25  ? 10.413  62.683   114.815 1.00 14.97 ? 107 ARG D CB  1 
ATOM   9069  C CG  . ARG D 1 25  ? 11.491  63.691   115.218 1.00 12.74 ? 107 ARG D CG  1 
ATOM   9070  C CD  . ARG D 1 25  ? 11.385  64.969   114.381 1.00 10.44 ? 107 ARG D CD  1 
ATOM   9071  N NE  . ARG D 1 25  ? 10.032  65.512   114.378 1.00 11.11 ? 107 ARG D NE  1 
ATOM   9072  C CZ  . ARG D 1 25  ? 9.573   66.413   115.243 1.00 12.11 ? 107 ARG D CZ  1 
ATOM   9073  N NH1 . ARG D 1 25  ? 8.318   66.828   115.150 1.00 8.15  ? 107 ARG D NH1 1 
ATOM   9074  N NH2 . ARG D 1 25  ? 10.366  66.917   116.183 1.00 8.60  ? 107 ARG D NH2 1 
ATOM   9075  N N   . ILE D 1 26  ? 9.200   59.915   113.888 1.00 15.92 ? 108 ILE D N   1 
ATOM   9076  C CA  . ILE D 1 26  ? 8.042   59.138   113.463 1.00 13.92 ? 108 ILE D CA  1 
ATOM   9077  C C   . ILE D 1 26  ? 7.970   57.747   114.093 1.00 15.10 ? 108 ILE D C   1 
ATOM   9078  O O   . ILE D 1 26  ? 6.886   57.282   114.463 1.00 13.63 ? 108 ILE D O   1 
ATOM   9079  C CB  . ILE D 1 26  ? 8.039   58.988   111.917 1.00 12.82 ? 108 ILE D CB  1 
ATOM   9080  C CG1 . ILE D 1 26  ? 7.890   60.368   111.271 1.00 11.15 ? 108 ILE D CG1 1 
ATOM   9081  C CG2 . ILE D 1 26  ? 6.926   58.059   111.473 1.00 10.43 ? 108 ILE D CG2 1 
ATOM   9082  C CD1 . ILE D 1 26  ? 8.052   60.366   109.755 1.00 10.05 ? 108 ILE D CD1 1 
ATOM   9083  N N   . GLY D 1 27  ? 9.124   57.089   114.203 1.00 15.16 ? 109 GLY D N   1 
ATOM   9084  C CA  . GLY D 1 27  ? 9.179   55.751   114.770 1.00 16.79 ? 109 GLY D CA  1 
ATOM   9085  C C   . GLY D 1 27  ? 8.854   55.641   116.255 1.00 18.73 ? 109 GLY D C   1 
ATOM   9086  O O   . GLY D 1 27  ? 8.569   54.548   116.744 1.00 19.12 ? 109 GLY D O   1 
ATOM   9087  N N   . SER D 1 28  ? 8.912   56.763   116.974 1.00 18.45 ? 110 SER D N   1 
ATOM   9088  C CA  . SER D 1 28  ? 8.594   56.797   118.398 1.00 17.89 ? 110 SER D CA  1 
ATOM   9089  C C   . SER D 1 28  ? 7.251   56.084   118.595 1.00 18.15 ? 110 SER D C   1 
ATOM   9090  O O   . SER D 1 28  ? 6.990   55.476   119.649 1.00 17.13 ? 110 SER D O   1 
ATOM   9091  C CB  . SER D 1 28  ? 8.502   58.257   118.868 1.00 18.96 ? 110 SER D CB  1 
ATOM   9092  O OG  . SER D 1 28  ? 8.215   58.370   120.250 1.00 16.00 ? 110 SER D OG  1 
ATOM   9093  N N   . LYS D 1 29  ? 6.403   56.176   117.569 1.00 16.72 ? 111 LYS D N   1 
ATOM   9094  C CA  . LYS D 1 29  ? 5.097   55.524   117.577 1.00 15.63 ? 111 LYS D CA  1 
ATOM   9095  C C   . LYS D 1 29  ? 4.945   54.597   116.373 1.00 15.70 ? 111 LYS D C   1 
ATOM   9096  O O   . LYS D 1 29  ? 4.430   53.490   116.489 1.00 16.64 ? 111 LYS D O   1 
ATOM   9097  C CB  . LYS D 1 29  ? 3.963   56.550   117.538 1.00 14.98 ? 111 LYS D CB  1 
ATOM   9098  C CG  . LYS D 1 29  ? 2.600   55.893   117.312 1.00 13.33 ? 111 LYS D CG  1 
ATOM   9099  C CD  . LYS D 1 29  ? 1.441   56.866   117.374 1.00 11.86 ? 111 LYS D CD  1 
ATOM   9100  C CE  . LYS D 1 29  ? 0.132   56.147   117.049 1.00 13.31 ? 111 LYS D CE  1 
ATOM   9101  N NZ  . LYS D 1 29  ? -1.055  57.041   117.026 1.00 14.07 ? 111 LYS D NZ  1 
ATOM   9102  N N   . GLY D 1 30  ? 5.401   55.071   115.219 1.00 15.43 ? 112 GLY D N   1 
ATOM   9103  C CA  . GLY D 1 30  ? 5.291   54.307   113.990 1.00 13.55 ? 112 GLY D CA  1 
ATOM   9104  C C   . GLY D 1 30  ? 6.178   53.089   113.893 1.00 12.91 ? 112 GLY D C   1 
ATOM   9105  O O   . GLY D 1 30  ? 7.124   52.909   114.660 1.00 12.06 ? 112 GLY D O   1 
ATOM   9106  N N   . ASP D 1 31  ? 5.862   52.242   112.927 1.00 12.26 ? 113 ASP D N   1 
ATOM   9107  C CA  . ASP D 1 31  ? 6.623   51.033   112.718 1.00 13.08 ? 113 ASP D CA  1 
ATOM   9108  C C   . ASP D 1 31  ? 7.748   51.318   111.734 1.00 11.97 ? 113 ASP D C   1 
ATOM   9109  O O   . ASP D 1 31  ? 7.704   50.956   110.566 1.00 12.21 ? 113 ASP D O   1 
ATOM   9110  C CB  . ASP D 1 31  ? 5.676   49.932   112.252 1.00 13.64 ? 113 ASP D CB  1 
ATOM   9111  C CG  . ASP D 1 31  ? 4.558   49.682   113.261 1.00 15.33 ? 113 ASP D CG  1 
ATOM   9112  O OD1 . ASP D 1 31  ? 4.800   49.885   114.476 1.00 16.06 ? 113 ASP D OD1 1 
ATOM   9113  O OD2 . ASP D 1 31  ? 3.447   49.282   112.857 1.00 15.81 ? 113 ASP D OD2 1 
ATOM   9114  N N   . VAL D 1 32  ? 8.763   51.994   112.245 1.00 10.66 ? 114 VAL D N   1 
ATOM   9115  C CA  . VAL D 1 32  ? 9.909   52.377   111.453 1.00 12.55 ? 114 VAL D CA  1 
ATOM   9116  C C   . VAL D 1 32  ? 11.126  51.521   111.750 1.00 14.66 ? 114 VAL D C   1 
ATOM   9117  O O   . VAL D 1 32  ? 11.398  51.186   112.905 1.00 16.19 ? 114 VAL D O   1 
ATOM   9118  C CB  . VAL D 1 32  ? 10.275  53.840   111.714 1.00 12.15 ? 114 VAL D CB  1 
ATOM   9119  C CG1 . VAL D 1 32  ? 11.405  54.260   110.797 1.00 11.00 ? 114 VAL D CG1 1 
ATOM   9120  C CG2 . VAL D 1 32  ? 9.049   54.719   111.515 1.00 11.27 ? 114 VAL D CG2 1 
ATOM   9121  N N   . PHE D 1 33  ? 11.862  51.166   110.702 1.00 13.79 ? 115 PHE D N   1 
ATOM   9122  C CA  . PHE D 1 33  ? 13.052  50.356   110.874 1.00 14.49 ? 115 PHE D CA  1 
ATOM   9123  C C   . PHE D 1 33  ? 14.148  51.049   111.647 1.00 14.88 ? 115 PHE D C   1 
ATOM   9124  O O   . PHE D 1 33  ? 14.312  52.257   111.555 1.00 15.88 ? 115 PHE D O   1 
ATOM   9125  C CB  . PHE D 1 33  ? 13.635  49.958   109.521 1.00 14.81 ? 115 PHE D CB  1 
ATOM   9126  C CG  . PHE D 1 33  ? 12.971  48.779   108.908 1.00 16.54 ? 115 PHE D CG  1 
ATOM   9127  C CD1 . PHE D 1 33  ? 12.330  48.887   107.674 1.00 16.31 ? 115 PHE D CD1 1 
ATOM   9128  C CD2 . PHE D 1 33  ? 12.962  47.555   109.572 1.00 15.25 ? 115 PHE D CD2 1 
ATOM   9129  C CE1 . PHE D 1 33  ? 11.682  47.780   107.106 1.00 17.79 ? 115 PHE D CE1 1 
ATOM   9130  C CE2 . PHE D 1 33  ? 12.317  46.444   109.013 1.00 16.92 ? 115 PHE D CE2 1 
ATOM   9131  C CZ  . PHE D 1 33  ? 11.676  46.556   107.781 1.00 16.17 ? 115 PHE D CZ  1 
ATOM   9132  N N   . VAL D 1 34  ? 14.894  50.283   112.429 1.00 14.86 ? 116 VAL D N   1 
ATOM   9133  C CA  . VAL D 1 34  ? 16.030  50.865   113.114 1.00 14.54 ? 116 VAL D CA  1 
ATOM   9134  C C   . VAL D 1 34  ? 17.073  50.696   112.011 1.00 13.45 ? 116 VAL D C   1 
ATOM   9135  O O   . VAL D 1 34  ? 17.194  49.610   111.435 1.00 12.35 ? 116 VAL D O   1 
ATOM   9136  C CB  . VAL D 1 34  ? 16.406  50.075   114.402 1.00 14.07 ? 116 VAL D CB  1 
ATOM   9137  C CG1 . VAL D 1 34  ? 16.154  48.595   114.200 1.00 17.19 ? 116 VAL D CG1 1 
ATOM   9138  C CG2 . VAL D 1 34  ? 17.867  50.323   114.754 1.00 11.51 ? 116 VAL D CG2 1 
ATOM   9139  N N   . ILE D 1 35  ? 17.788  51.767   111.687 1.00 13.93 ? 117 ILE D N   1 
ATOM   9140  C CA  . ILE D 1 35  ? 18.779  51.719   110.605 1.00 14.20 ? 117 ILE D CA  1 
ATOM   9141  C C   . ILE D 1 35  ? 20.043  52.533   110.846 1.00 14.45 ? 117 ILE D C   1 
ATOM   9142  O O   . ILE D 1 35  ? 20.153  53.278   111.813 1.00 17.04 ? 117 ILE D O   1 
ATOM   9143  C CB  . ILE D 1 35  ? 18.204  52.291   109.287 1.00 14.97 ? 117 ILE D CB  1 
ATOM   9144  C CG1 . ILE D 1 35  ? 17.908  53.781   109.480 1.00 16.16 ? 117 ILE D CG1 1 
ATOM   9145  C CG2 . ILE D 1 35  ? 16.942  51.589   108.893 1.00 14.44 ? 117 ILE D CG2 1 
ATOM   9146  C CD1 . ILE D 1 35  ? 17.617  54.490   108.207 1.00 18.66 ? 117 ILE D CD1 1 
ATOM   9147  N N   . ARG D 1 36  ? 20.976  52.384   109.912 1.00 13.27 ? 118 ARG D N   1 
ATOM   9148  C CA  . ARG D 1 36  ? 22.247  53.104   109.867 1.00 12.77 ? 118 ARG D CA  1 
ATOM   9149  C C   . ARG D 1 36  ? 22.692  52.998   108.400 1.00 11.94 ? 118 ARG D C   1 
ATOM   9150  O O   . ARG D 1 36  ? 22.054  52.310   107.602 1.00 11.15 ? 118 ARG D O   1 
ATOM   9151  C CB  . ARG D 1 36  ? 23.319  52.461   110.764 1.00 13.67 ? 118 ARG D CB  1 
ATOM   9152  C CG  . ARG D 1 36  ? 23.358  52.845   112.260 1.00 14.93 ? 118 ARG D CG  1 
ATOM   9153  C CD  . ARG D 1 36  ? 23.836  54.258   112.575 1.00 12.31 ? 118 ARG D CD  1 
ATOM   9154  N NE  . ARG D 1 36  ? 24.926  54.748   111.735 1.00 15.97 ? 118 ARG D NE  1 
ATOM   9155  C CZ  . ARG D 1 36  ? 26.231  54.600   111.974 1.00 19.56 ? 118 ARG D CZ  1 
ATOM   9156  N NH1 . ARG D 1 36  ? 27.114  55.105   111.115 1.00 18.05 ? 118 ARG D NH1 1 
ATOM   9157  N NH2 . ARG D 1 36  ? 26.664  53.956   113.051 1.00 21.11 ? 118 ARG D NH2 1 
ATOM   9158  N N   . GLU D 1 37  ? 23.775  53.685   108.050 1.00 11.73 ? 119 GLU D N   1 
ATOM   9159  C CA  . GLU D 1 37  ? 24.323  53.648   106.699 1.00 9.79  ? 119 GLU D CA  1 
ATOM   9160  C C   . GLU D 1 37  ? 23.300  53.846   105.571 1.00 10.19 ? 119 GLU D C   1 
ATOM   9161  O O   . GLU D 1 37  ? 23.180  53.033   104.662 1.00 8.25  ? 119 GLU D O   1 
ATOM   9162  C CB  . GLU D 1 37  ? 25.071  52.329   106.488 1.00 10.46 ? 119 GLU D CB  1 
ATOM   9163  C CG  . GLU D 1 37  ? 26.243  52.082   107.441 1.00 10.98 ? 119 GLU D CG  1 
ATOM   9164  C CD  . GLU D 1 37  ? 25.813  51.605   108.830 1.00 12.78 ? 119 GLU D CD  1 
ATOM   9165  O OE1 . GLU D 1 37  ? 24.982  50.681   108.912 1.00 13.12 ? 119 GLU D OE1 1 
ATOM   9166  O OE2 . GLU D 1 37  ? 26.316  52.141   109.837 1.00 14.24 ? 119 GLU D OE2 1 
ATOM   9167  N N   . PRO D 1 38  ? 22.547  54.946   105.618 1.00 11.37 ? 120 PRO D N   1 
ATOM   9168  C CA  . PRO D 1 38  ? 21.561  55.185   104.566 1.00 9.87  ? 120 PRO D CA  1 
ATOM   9169  C C   . PRO D 1 38  ? 22.193  55.976   103.410 1.00 11.48 ? 120 PRO D C   1 
ATOM   9170  O O   . PRO D 1 38  ? 23.231  56.609   103.575 1.00 12.41 ? 120 PRO D O   1 
ATOM   9171  C CB  . PRO D 1 38  ? 20.509  55.990   105.294 1.00 9.29  ? 120 PRO D CB  1 
ATOM   9172  C CG  . PRO D 1 38  ? 21.369  56.870   106.155 1.00 8.40  ? 120 PRO D CG  1 
ATOM   9173  C CD  . PRO D 1 38  ? 22.416  55.940   106.698 1.00 8.39  ? 120 PRO D CD  1 
ATOM   9174  N N   . PHE D 1 39  ? 21.578  55.926   102.237 1.00 12.69 ? 121 PHE D N   1 
ATOM   9175  C CA  . PHE D 1 39  ? 22.090  56.674   101.094 1.00 12.54 ? 121 PHE D CA  1 
ATOM   9176  C C   . PHE D 1 39  ? 21.074  56.701   99.970  1.00 13.73 ? 121 PHE D C   1 
ATOM   9177  O O   . PHE D 1 39  ? 20.216  55.823   99.869  1.00 16.95 ? 121 PHE D O   1 
ATOM   9178  C CB  . PHE D 1 39  ? 23.428  56.096   100.610 1.00 11.10 ? 121 PHE D CB  1 
ATOM   9179  C CG  . PHE D 1 39  ? 23.333  54.723   100.012 1.00 10.02 ? 121 PHE D CG  1 
ATOM   9180  C CD1 . PHE D 1 39  ? 23.034  54.555   98.666  1.00 10.69 ? 121 PHE D CD1 1 
ATOM   9181  C CD2 . PHE D 1 39  ? 23.591  53.596   100.784 1.00 9.98  ? 121 PHE D CD2 1 
ATOM   9182  C CE1 . PHE D 1 39  ? 23.000  53.280   98.089  1.00 10.58 ? 121 PHE D CE1 1 
ATOM   9183  C CE2 . PHE D 1 39  ? 23.558  52.322   100.224 1.00 9.72  ? 121 PHE D CE2 1 
ATOM   9184  C CZ  . PHE D 1 39  ? 23.262  52.164   98.868  1.00 9.83  ? 121 PHE D CZ  1 
ATOM   9185  N N   . ILE D 1 40  ? 21.161  57.727   99.137  1.00 13.33 ? 122 ILE D N   1 
ATOM   9186  C CA  . ILE D 1 40  ? 20.246  57.879   98.025  1.00 13.53 ? 122 ILE D CA  1 
ATOM   9187  C C   . ILE D 1 40  ? 20.920  57.539   96.707  1.00 14.64 ? 122 ILE D C   1 
ATOM   9188  O O   . ILE D 1 40  ? 22.137  57.660   96.567  1.00 16.01 ? 122 ILE D O   1 
ATOM   9189  C CB  . ILE D 1 40  ? 19.729  59.324   97.959  1.00 15.10 ? 122 ILE D CB  1 
ATOM   9190  C CG1 . ILE D 1 40  ? 18.908  59.614   99.215  1.00 13.27 ? 122 ILE D CG1 1 
ATOM   9191  C CG2 . ILE D 1 40  ? 18.937  59.562   96.660  1.00 13.08 ? 122 ILE D CG2 1 
ATOM   9192  C CD1 . ILE D 1 40  ? 18.472  61.044   99.333  1.00 13.79 ? 122 ILE D CD1 1 
ATOM   9193  N N   . SER D 1 41  ? 20.121  57.092   95.748  1.00 13.98 ? 123 SER D N   1 
ATOM   9194  C CA  . SER D 1 41  ? 20.611  56.767   94.421  1.00 14.20 ? 123 SER D CA  1 
ATOM   9195  C C   . SER D 1 41  ? 19.408  56.918   93.517  1.00 15.01 ? 123 SER D C   1 
ATOM   9196  O O   . SER D 1 41  ? 18.299  56.574   93.914  1.00 15.89 ? 123 SER D O   1 
ATOM   9197  C CB  . SER D 1 41  ? 21.137  55.339   94.353  1.00 13.98 ? 123 SER D CB  1 
ATOM   9198  O OG  . SER D 1 41  ? 21.848  55.147   93.142  1.00 14.05 ? 123 SER D OG  1 
ATOM   9199  N N   . CYS D 1 42  ? 19.613  57.419   92.306  1.00 14.03 ? 124 CYS D N   1 
ATOM   9200  C CA  . CYS D 1 42  ? 18.489  57.622   91.415  1.00 14.76 ? 124 CYS D CA  1 
ATOM   9201  C C   . CYS D 1 42  ? 18.630  56.844   90.116  1.00 15.80 ? 124 CYS D C   1 
ATOM   9202  O O   . CYS D 1 42  ? 19.735  56.478   89.715  1.00 17.22 ? 124 CYS D O   1 
ATOM   9203  C CB  . CYS D 1 42  ? 18.321  59.123   91.109  1.00 15.72 ? 124 CYS D CB  1 
ATOM   9204  S SG  . CYS D 1 42  ? 18.278  60.254   92.556  1.00 18.52 ? 124 CYS D SG  1 
ATOM   9205  N N   . SER D 1 43  ? 17.495  56.567   89.481  1.00 15.12 ? 125 SER D N   1 
ATOM   9206  C CA  . SER D 1 43  ? 17.463  55.868   88.209  1.00 16.49 ? 125 SER D CA  1 
ATOM   9207  C C   . SER D 1 43  ? 17.122  56.967   87.219  1.00 17.85 ? 125 SER D C   1 
ATOM   9208  O O   . SER D 1 43  ? 17.363  58.144   87.494  1.00 16.32 ? 125 SER D O   1 
ATOM   9209  C CB  . SER D 1 43  ? 16.365  54.802   88.193  1.00 16.48 ? 125 SER D CB  1 
ATOM   9210  O OG  . SER D 1 43  ? 15.078  55.380   88.341  1.00 16.25 ? 125 SER D OG  1 
ATOM   9211  N N   . HIS D 1 44  ? 16.549  56.593   86.079  1.00 19.55 ? 126 HIS D N   1 
ATOM   9212  C CA  . HIS D 1 44  ? 16.165  57.580   85.081  1.00 20.24 ? 126 HIS D CA  1 
ATOM   9213  C C   . HIS D 1 44  ? 14.741  58.072   85.356  1.00 20.42 ? 126 HIS D C   1 
ATOM   9214  O O   . HIS D 1 44  ? 14.275  59.023   84.722  1.00 20.87 ? 126 HIS D O   1 
ATOM   9215  C CB  . HIS D 1 44  ? 16.269  56.987   83.662  1.00 21.50 ? 126 HIS D CB  1 
ATOM   9216  C CG  . HIS D 1 44  ? 15.352  55.829   83.407  1.00 23.38 ? 126 HIS D CG  1 
ATOM   9217  N ND1 . HIS D 1 44  ? 15.324  54.702   84.206  1.00 23.83 ? 126 HIS D ND1 1 
ATOM   9218  C CD2 . HIS D 1 44  ? 14.450  55.607   82.421  1.00 22.69 ? 126 HIS D CD2 1 
ATOM   9219  C CE1 . HIS D 1 44  ? 14.450  53.841   83.723  1.00 22.36 ? 126 HIS D CE1 1 
ATOM   9220  N NE2 . HIS D 1 44  ? 13.905  54.365   82.637  1.00 23.21 ? 126 HIS D NE2 1 
ATOM   9221  N N   . LEU D 1 45  ? 14.059  57.439   86.311  1.00 19.61 ? 127 LEU D N   1 
ATOM   9222  C CA  . LEU D 1 45  ? 12.687  57.840   86.645  1.00 19.57 ? 127 LEU D CA  1 
ATOM   9223  C C   . LEU D 1 45  ? 12.439  58.260   88.099  1.00 19.51 ? 127 LEU D C   1 
ATOM   9224  O O   . LEU D 1 45  ? 11.689  59.195   88.338  1.00 20.23 ? 127 LEU D O   1 
ATOM   9225  C CB  . LEU D 1 45  ? 11.705  56.720   86.290  1.00 18.80 ? 127 LEU D CB  1 
ATOM   9226  C CG  . LEU D 1 45  ? 11.732  56.182   84.853  1.00 19.45 ? 127 LEU D CG  1 
ATOM   9227  C CD1 . LEU D 1 45  ? 10.982  54.852   84.810  1.00 16.80 ? 127 LEU D CD1 1 
ATOM   9228  C CD2 . LEU D 1 45  ? 11.128  57.198   83.886  1.00 13.78 ? 127 LEU D CD2 1 
ATOM   9229  N N   . GLU D 1 46  ? 13.049  57.583   89.070  1.00 19.78 ? 128 GLU D N   1 
ATOM   9230  C CA  . GLU D 1 46  ? 12.814  57.935   90.472  1.00 19.86 ? 128 GLU D CA  1 
ATOM   9231  C C   . GLU D 1 46  ? 14.061  57.868   91.355  1.00 19.97 ? 128 GLU D C   1 
ATOM   9232  O O   . GLU D 1 46  ? 15.067  57.282   90.970  1.00 19.95 ? 128 GLU D O   1 
ATOM   9233  C CB  . GLU D 1 46  ? 11.743  57.013   91.067  1.00 19.54 ? 128 GLU D CB  1 
ATOM   9234  C CG  . GLU D 1 46  ? 12.164  55.542   91.139  1.00 20.64 ? 128 GLU D CG  1 
ATOM   9235  C CD  . GLU D 1 46  ? 11.430  54.756   92.224  1.00 21.88 ? 128 GLU D CD  1 
ATOM   9236  O OE1 . GLU D 1 46  ? 10.729  55.378   93.056  1.00 23.54 ? 128 GLU D OE1 1 
ATOM   9237  O OE2 . GLU D 1 46  ? 11.568  53.513   92.259  1.00 21.30 ? 128 GLU D OE2 1 
ATOM   9238  N N   . CYS D 1 47  ? 13.986  58.470   92.540  1.00 19.11 ? 129 CYS D N   1 
ATOM   9239  C CA  . CYS D 1 47  ? 15.101  58.442   93.487  1.00 18.73 ? 129 CYS D CA  1 
ATOM   9240  C C   . CYS D 1 47  ? 14.675  57.668   94.720  1.00 17.31 ? 129 CYS D C   1 
ATOM   9241  O O   . CYS D 1 47  ? 13.596  57.891   95.265  1.00 16.24 ? 129 CYS D O   1 
ATOM   9242  C CB  . CYS D 1 47  ? 15.517  59.846   93.935  1.00 19.57 ? 129 CYS D CB  1 
ATOM   9243  S SG  . CYS D 1 47  ? 16.336  60.926   92.709  1.00 24.63 ? 129 CYS D SG  1 
ATOM   9244  N N   . ARG D 1 48  ? 15.534  56.765   95.170  1.00 17.24 ? 130 ARG D N   1 
ATOM   9245  C CA  . ARG D 1 48  ? 15.228  55.970   96.344  1.00 17.06 ? 130 ARG D CA  1 
ATOM   9246  C C   . ARG D 1 48  ? 16.278  56.141   97.426  1.00 16.81 ? 130 ARG D C   1 
ATOM   9247  O O   . ARG D 1 48  ? 17.403  56.558   97.160  1.00 16.65 ? 130 ARG D O   1 
ATOM   9248  C CB  . ARG D 1 48  ? 15.134  54.490   95.971  1.00 15.38 ? 130 ARG D CB  1 
ATOM   9249  C CG  . ARG D 1 48  ? 14.095  54.173   94.924  1.00 15.59 ? 130 ARG D CG  1 
ATOM   9250  C CD  . ARG D 1 48  ? 14.119  52.696   94.565  1.00 16.35 ? 130 ARG D CD  1 
ATOM   9251  N NE  . ARG D 1 48  ? 13.658  51.866   95.670  1.00 17.10 ? 130 ARG D NE  1 
ATOM   9252  C CZ  . ARG D 1 48  ? 12.398  51.820   96.092  1.00 17.20 ? 130 ARG D CZ  1 
ATOM   9253  N NH1 . ARG D 1 48  ? 12.070  51.038   97.110  1.00 16.02 ? 130 ARG D NH1 1 
ATOM   9254  N NH2 . ARG D 1 48  ? 11.466  52.548   95.486  1.00 16.85 ? 130 ARG D NH2 1 
ATOM   9255  N N   . THR D 1 49  ? 15.882  55.822   98.652  1.00 17.22 ? 131 THR D N   1 
ATOM   9256  C CA  . THR D 1 49  ? 16.764  55.877   99.807  1.00 16.94 ? 131 THR D CA  1 
ATOM   9257  C C   . THR D 1 49  ? 17.025  54.421   100.155 1.00 16.46 ? 131 THR D C   1 
ATOM   9258  O O   . THR D 1 49  ? 16.082  53.673   100.413 1.00 16.89 ? 131 THR D O   1 
ATOM   9259  C CB  . THR D 1 49  ? 16.075  56.525   101.030 1.00 17.84 ? 131 THR D CB  1 
ATOM   9260  O OG1 . THR D 1 49  ? 15.593  57.833   100.689 1.00 20.81 ? 131 THR D OG1 1 
ATOM   9261  C CG2 . THR D 1 49  ? 17.049  56.629   102.190 1.00 16.72 ? 131 THR D CG2 1 
ATOM   9262  N N   . PHE D 1 50  ? 18.289  54.010   100.119 1.00 15.85 ? 132 PHE D N   1 
ATOM   9263  C CA  . PHE D 1 50  ? 18.669  52.639   100.475 1.00 14.63 ? 132 PHE D CA  1 
ATOM   9264  C C   . PHE D 1 50  ? 19.158  52.721   101.918 1.00 14.35 ? 132 PHE D C   1 
ATOM   9265  O O   . PHE D 1 50  ? 19.503  53.806   102.391 1.00 14.40 ? 132 PHE D O   1 
ATOM   9266  C CB  . PHE D 1 50  ? 19.804  52.113   99.578  1.00 13.13 ? 132 PHE D CB  1 
ATOM   9267  C CG  . PHE D 1 50  ? 19.398  51.880   98.143  1.00 13.60 ? 132 PHE D CG  1 
ATOM   9268  C CD1 . PHE D 1 50  ? 19.270  52.945   97.261  1.00 11.62 ? 132 PHE D CD1 1 
ATOM   9269  C CD2 . PHE D 1 50  ? 19.119  50.594   97.679  1.00 13.26 ? 132 PHE D CD2 1 
ATOM   9270  C CE1 . PHE D 1 50  ? 18.869  52.740   95.942  1.00 10.94 ? 132 PHE D CE1 1 
ATOM   9271  C CE2 . PHE D 1 50  ? 18.716  50.380   96.357  1.00 13.55 ? 132 PHE D CE2 1 
ATOM   9272  C CZ  . PHE D 1 50  ? 18.590  51.460   95.487  1.00 10.44 ? 132 PHE D CZ  1 
ATOM   9273  N N   . PHE D 1 51  ? 19.196  51.590   102.616 1.00 13.56 ? 133 PHE D N   1 
ATOM   9274  C CA  . PHE D 1 51  ? 19.637  51.589   104.001 1.00 12.48 ? 133 PHE D CA  1 
ATOM   9275  C C   . PHE D 1 51  ? 19.804  50.187   104.558 1.00 13.85 ? 133 PHE D C   1 
ATOM   9276  O O   . PHE D 1 51  ? 19.260  49.222   104.021 1.00 13.35 ? 133 PHE D O   1 
ATOM   9277  C CB  . PHE D 1 51  ? 18.633  52.359   104.844 1.00 9.77  ? 133 PHE D CB  1 
ATOM   9278  C CG  . PHE D 1 51  ? 17.217  51.931   104.617 1.00 8.29  ? 133 PHE D CG  1 
ATOM   9279  C CD1 . PHE D 1 51  ? 16.691  50.836   105.295 1.00 7.76  ? 133 PHE D CD1 1 
ATOM   9280  C CD2 . PHE D 1 51  ? 16.409  52.612   103.712 1.00 6.86  ? 133 PHE D CD2 1 
ATOM   9281  C CE1 . PHE D 1 51  ? 15.385  50.427   105.079 1.00 7.05  ? 133 PHE D CE1 1 
ATOM   9282  C CE2 . PHE D 1 51  ? 15.098  52.211   103.484 1.00 7.11  ? 133 PHE D CE2 1 
ATOM   9283  C CZ  . PHE D 1 51  ? 14.580  51.114   104.170 1.00 7.94  ? 133 PHE D CZ  1 
ATOM   9284  N N   . LEU D 1 52  ? 20.556  50.093   105.651 1.00 14.84 ? 134 LEU D N   1 
ATOM   9285  C CA  . LEU D 1 52  ? 20.823  48.821   106.308 1.00 13.51 ? 134 LEU D CA  1 
ATOM   9286  C C   . LEU D 1 52  ? 20.069  48.719   107.616 1.00 12.87 ? 134 LEU D C   1 
ATOM   9287  O O   . LEU D 1 52  ? 20.488  49.289   108.624 1.00 13.09 ? 134 LEU D O   1 
ATOM   9288  C CB  . LEU D 1 52  ? 22.315  48.673   106.596 1.00 14.95 ? 134 LEU D CB  1 
ATOM   9289  C CG  . LEU D 1 52  ? 23.321  48.643   105.446 1.00 16.12 ? 134 LEU D CG  1 
ATOM   9290  C CD1 . LEU D 1 52  ? 24.723  48.587   106.039 1.00 14.75 ? 134 LEU D CD1 1 
ATOM   9291  C CD2 . LEU D 1 52  ? 23.074  47.438   104.539 1.00 16.47 ? 134 LEU D CD2 1 
ATOM   9292  N N   . THR D 1 53  ? 18.963  47.980   107.593 1.00 13.44 ? 135 THR D N   1 
ATOM   9293  C CA  . THR D 1 53  ? 18.129  47.770   108.771 1.00 13.48 ? 135 THR D CA  1 
ATOM   9294  C C   . THR D 1 53  ? 18.875  46.897   109.765 1.00 14.63 ? 135 THR D C   1 
ATOM   9295  O O   . THR D 1 53  ? 19.916  46.322   109.448 1.00 16.31 ? 135 THR D O   1 
ATOM   9296  C CB  . THR D 1 53  ? 16.833  46.993   108.438 1.00 13.44 ? 135 THR D CB  1 
ATOM   9297  O OG1 . THR D 1 53  ? 17.168  45.638   108.093 1.00 13.53 ? 135 THR D OG1 1 
ATOM   9298  C CG2 . THR D 1 53  ? 16.080  47.643   107.296 1.00 14.20 ? 135 THR D CG2 1 
ATOM   9299  N N   . GLN D 1 54  ? 18.312  46.784   110.961 1.00 15.09 ? 136 GLN D N   1 
ATOM   9300  C CA  . GLN D 1 54  ? 18.866  45.948   112.010 1.00 14.85 ? 136 GLN D CA  1 
ATOM   9301  C C   . GLN D 1 54  ? 17.848  44.845   112.269 1.00 15.62 ? 136 GLN D C   1 
ATOM   9302  O O   . GLN D 1 54  ? 17.838  44.232   113.346 1.00 16.77 ? 136 GLN D O   1 
ATOM   9303  C CB  . GLN D 1 54  ? 19.081  46.761   113.281 1.00 15.20 ? 136 GLN D CB  1 
ATOM   9304  C CG  . GLN D 1 54  ? 20.326  47.618   113.266 1.00 17.97 ? 136 GLN D CG  1 
ATOM   9305  C CD  . GLN D 1 54  ? 21.586  46.802   113.453 1.00 18.84 ? 136 GLN D CD  1 
ATOM   9306  O OE1 . GLN D 1 54  ? 21.544  45.565   113.457 1.00 21.63 ? 136 GLN D OE1 1 
ATOM   9307  N NE2 . GLN D 1 54  ? 22.717  47.486   113.608 1.00 16.50 ? 136 GLN D NE2 1 
ATOM   9308  N N   . GLY D 1 55  ? 16.981  44.608   111.283 1.00 13.33 ? 137 GLY D N   1 
ATOM   9309  C CA  . GLY D 1 55  ? 15.968  43.579   111.420 1.00 12.94 ? 137 GLY D CA  1 
ATOM   9310  C C   . GLY D 1 55  ? 15.070  43.779   112.628 1.00 14.10 ? 137 GLY D C   1 
ATOM   9311  O O   . GLY D 1 55  ? 14.565  42.811   113.193 1.00 13.61 ? 137 GLY D O   1 
ATOM   9312  N N   . ALA D 1 56  ? 14.876  45.037   113.023 1.00 14.04 ? 138 ALA D N   1 
ATOM   9313  C CA  . ALA D 1 56  ? 14.026  45.384   114.161 1.00 14.80 ? 138 ALA D CA  1 
ATOM   9314  C C   . ALA D 1 56  ? 13.372  46.753   113.956 1.00 14.71 ? 138 ALA D C   1 
ATOM   9315  O O   . ALA D 1 56  ? 13.687  47.462   113.003 1.00 16.05 ? 138 ALA D O   1 
ATOM   9316  C CB  . ALA D 1 56  ? 14.843  45.387   115.452 1.00 14.87 ? 138 ALA D CB  1 
ATOM   9317  N N   . LEU D 1 57  ? 12.465  47.121   114.855 1.00 14.25 ? 139 LEU D N   1 
ATOM   9318  C CA  . LEU D 1 57  ? 11.772  48.403   114.762 1.00 13.56 ? 139 LEU D CA  1 
ATOM   9319  C C   . LEU D 1 57  ? 12.068  49.300   115.958 1.00 14.83 ? 139 LEU D C   1 
ATOM   9320  O O   . LEU D 1 57  ? 12.398  48.827   117.055 1.00 14.63 ? 139 LEU D O   1 
ATOM   9321  C CB  . LEU D 1 57  ? 10.261  48.188   114.678 1.00 12.31 ? 139 LEU D CB  1 
ATOM   9322  C CG  . LEU D 1 57  ? 9.681   47.360   113.529 1.00 13.81 ? 139 LEU D CG  1 
ATOM   9323  C CD1 . LEU D 1 57  ? 8.185   47.238   113.739 1.00 13.82 ? 139 LEU D CD1 1 
ATOM   9324  C CD2 . LEU D 1 57  ? 9.995   48.004   112.174 1.00 11.96 ? 139 LEU D CD2 1 
ATOM   9325  N N   . LEU D 1 58  ? 11.944  50.604   115.745 1.00 14.20 ? 140 LEU D N   1 
ATOM   9326  C CA  . LEU D 1 58  ? 12.179  51.553   116.820 1.00 14.63 ? 140 LEU D CA  1 
ATOM   9327  C C   . LEU D 1 58  ? 11.172  51.355   117.958 1.00 14.99 ? 140 LEU D C   1 
ATOM   9328  O O   . LEU D 1 58  ? 10.031  50.948   117.738 1.00 15.23 ? 140 LEU D O   1 
ATOM   9329  C CB  . LEU D 1 58  ? 12.102  52.987   116.283 1.00 12.67 ? 140 LEU D CB  1 
ATOM   9330  C CG  . LEU D 1 58  ? 13.240  53.376   115.331 1.00 12.49 ? 140 LEU D CG  1 
ATOM   9331  C CD1 . LEU D 1 58  ? 12.976  54.740   114.695 1.00 11.73 ? 140 LEU D CD1 1 
ATOM   9332  C CD2 . LEU D 1 58  ? 14.547  53.387   116.103 1.00 10.86 ? 140 LEU D CD2 1 
ATOM   9333  N N   . ASN D 1 59  ? 11.637  51.625   119.172 1.00 15.30 ? 141 ASN D N   1 
ATOM   9334  C CA  . ASN D 1 59  ? 10.859  51.521   120.401 1.00 14.79 ? 141 ASN D CA  1 
ATOM   9335  C C   . ASN D 1 59  ? 10.388  50.118   120.765 1.00 14.47 ? 141 ASN D C   1 
ATOM   9336  O O   . ASN D 1 59  ? 9.427   49.961   121.521 1.00 16.60 ? 141 ASN D O   1 
ATOM   9337  C CB  . ASN D 1 59  ? 9.667   52.483   120.353 1.00 14.81 ? 141 ASN D CB  1 
ATOM   9338  C CG  . ASN D 1 59  ? 9.626   53.425   121.558 1.00 15.95 ? 141 ASN D CG  1 
ATOM   9339  O OD1 . ASN D 1 59  ? 10.547  53.445   122.379 1.00 14.40 ? 141 ASN D OD1 1 
ATOM   9340  N ND2 . ASN D 1 59  ? 8.555   54.213   121.663 1.00 16.59 ? 141 ASN D ND2 1 
ATOM   9341  N N   . ASP D 1 60  ? 11.073  49.107   120.238 1.00 13.46 ? 142 ASP D N   1 
ATOM   9342  C CA  . ASP D 1 60  ? 10.763  47.701   120.523 1.00 13.52 ? 142 ASP D CA  1 
ATOM   9343  C C   . ASP D 1 60  ? 12.002  47.060   121.148 1.00 13.99 ? 142 ASP D C   1 
ATOM   9344  O O   . ASP D 1 60  ? 13.117  47.478   120.858 1.00 13.51 ? 142 ASP D O   1 
ATOM   9345  C CB  . ASP D 1 60  ? 10.403  46.957   119.234 1.00 14.48 ? 142 ASP D CB  1 
ATOM   9346  C CG  . ASP D 1 60  ? 10.356  45.446   119.426 1.00 15.60 ? 142 ASP D CG  1 
ATOM   9347  O OD1 . ASP D 1 60  ? 9.507   44.965   120.201 1.00 14.35 ? 142 ASP D OD1 1 
ATOM   9348  O OD2 . ASP D 1 60  ? 11.175  44.735   118.809 1.00 14.31 ? 142 ASP D OD2 1 
ATOM   9349  N N   . LYS D 1 61  ? 11.821  46.049   121.995 1.00 14.51 ? 143 LYS D N   1 
ATOM   9350  C CA  . LYS D 1 61  ? 12.969  45.405   122.641 1.00 15.36 ? 143 LYS D CA  1 
ATOM   9351  C C   . LYS D 1 61  ? 14.039  44.908   121.692 1.00 17.03 ? 143 LYS D C   1 
ATOM   9352  O O   . LYS D 1 61  ? 15.222  44.973   121.991 1.00 15.00 ? 143 LYS D O   1 
ATOM   9353  C CB  . LYS D 1 61  ? 12.529  44.243   123.534 1.00 15.11 ? 143 LYS D CB  1 
ATOM   9354  C CG  . LYS D 1 61  ? 11.818  43.130   122.820 1.00 15.32 ? 143 LYS D CG  1 
ATOM   9355  C CD  . LYS D 1 61  ? 11.541  42.021   123.806 1.00 14.34 ? 143 LYS D CD  1 
ATOM   9356  C CE  . LYS D 1 61  ? 10.955  40.824   123.088 1.00 15.68 ? 143 LYS D CE  1 
ATOM   9357  N NZ  . LYS D 1 61  ? 10.919  39.594   123.922 1.00 14.86 ? 143 LYS D NZ  1 
ATOM   9358  N N   . HIS D 1 62  ? 13.639  44.398   120.544 1.00 19.28 ? 144 HIS D N   1 
ATOM   9359  C CA  . HIS D 1 62  ? 14.631  43.901   119.607 1.00 21.34 ? 144 HIS D CA  1 
ATOM   9360  C C   . HIS D 1 62  ? 15.567  44.973   119.121 1.00 23.31 ? 144 HIS D C   1 
ATOM   9361  O O   . HIS D 1 62  ? 16.540  44.708   118.423 1.00 22.86 ? 144 HIS D O   1 
ATOM   9362  C CB  . HIS D 1 62  ? 13.943  43.287   118.425 1.00 20.44 ? 144 HIS D CB  1 
ATOM   9363  C CG  . HIS D 1 62  ? 13.182  42.059   118.771 1.00 22.11 ? 144 HIS D CG  1 
ATOM   9364  N ND1 . HIS D 1 62  ? 13.800  40.877   119.097 1.00 23.65 ? 144 HIS D ND1 1 
ATOM   9365  C CD2 . HIS D 1 62  ? 11.851  41.825   118.838 1.00 22.35 ? 144 HIS D CD2 1 
ATOM   9366  C CE1 . HIS D 1 62  ? 12.883  39.957   119.343 1.00 23.55 ? 144 HIS D CE1 1 
ATOM   9367  N NE2 . HIS D 1 62  ? 11.694  40.509   119.192 1.00 24.27 ? 144 HIS D NE2 1 
ATOM   9368  N N   . SER D 1 63  ? 15.263  46.195   119.503 1.00 25.03 ? 145 SER D N   1 
ATOM   9369  C CA  . SER D 1 63  ? 16.054  47.334   119.110 1.00 27.08 ? 145 SER D CA  1 
ATOM   9370  C C   . SER D 1 63  ? 17.336  47.394   119.919 1.00 27.58 ? 145 SER D C   1 
ATOM   9371  O O   . SER D 1 63  ? 18.221  48.155   119.581 1.00 28.16 ? 145 SER D O   1 
ATOM   9372  C CB  . SER D 1 63  ? 15.223  48.597   119.317 1.00 27.62 ? 145 SER D CB  1 
ATOM   9373  O OG  . SER D 1 63  ? 16.008  49.763   119.288 1.00 30.59 ? 145 SER D OG  1 
ATOM   9374  N N   . ASN D 1 64  ? 17.432  46.564   120.958 1.00 29.83 ? 146 ASN D N   1 
ATOM   9375  C CA  . ASN D 1 64  ? 18.593  46.524   121.850 1.00 31.73 ? 146 ASN D CA  1 
ATOM   9376  C C   . ASN D 1 64  ? 19.956  46.886   121.248 1.00 32.40 ? 146 ASN D C   1 
ATOM   9377  O O   . ASN D 1 64  ? 20.070  47.873   120.539 1.00 36.16 ? 146 ASN D O   1 
ATOM   9378  C CB  . ASN D 1 64  ? 18.691  45.169   122.560 1.00 32.67 ? 146 ASN D CB  1 
ATOM   9379  C CG  . ASN D 1 64  ? 19.083  45.314   124.042 1.00 35.23 ? 146 ASN D CG  1 
ATOM   9380  O OD1 . ASN D 1 64  ? 19.245  44.327   124.766 1.00 37.43 ? 146 ASN D OD1 1 
ATOM   9381  N ND2 . ASN D 1 64  ? 19.232  46.555   124.490 1.00 34.39 ? 146 ASN D ND2 1 
ATOM   9382  N N   . GLY D 1 65  ? 20.994  46.110   121.533 1.00 31.13 ? 147 GLY D N   1 
ATOM   9383  C CA  . GLY D 1 65  ? 22.327  46.436   121.034 1.00 29.97 ? 147 GLY D CA  1 
ATOM   9384  C C   . GLY D 1 65  ? 22.570  46.796   119.570 1.00 29.63 ? 147 GLY D C   1 
ATOM   9385  O O   . GLY D 1 65  ? 23.626  46.467   119.039 1.00 29.14 ? 147 GLY D O   1 
ATOM   9386  N N   . THR D 1 66  ? 21.626  47.480   118.922 1.00 29.45 ? 148 THR D N   1 
ATOM   9387  C CA  . THR D 1 66  ? 21.753  47.863   117.513 1.00 30.32 ? 148 THR D CA  1 
ATOM   9388  C C   . THR D 1 66  ? 22.928  48.788   117.238 1.00 31.33 ? 148 THR D C   1 
ATOM   9389  O O   . THR D 1 66  ? 22.902  49.598   116.319 1.00 32.58 ? 148 THR D O   1 
ATOM   9390  C CB  . THR D 1 66  ? 20.467  48.533   116.999 1.00 29.63 ? 148 THR D CB  1 
ATOM   9391  O OG1 . THR D 1 66  ? 19.985  49.454   117.982 1.00 27.61 ? 148 THR D OG1 1 
ATOM   9392  C CG2 . THR D 1 66  ? 19.401  47.491   116.713 1.00 28.98 ? 148 THR D CG2 1 
ATOM   9393  N N   . VAL D 1 67  ? 23.968  48.647   118.043 1.00 33.01 ? 149 VAL D N   1 
ATOM   9394  C CA  . VAL D 1 67  ? 25.167  49.444   117.895 1.00 33.75 ? 149 VAL D CA  1 
ATOM   9395  C C   . VAL D 1 67  ? 26.240  48.563   117.269 1.00 34.19 ? 149 VAL D C   1 
ATOM   9396  O O   . VAL D 1 67  ? 27.141  49.061   116.604 1.00 33.12 ? 149 VAL D O   1 
ATOM   9397  C CB  . VAL D 1 67  ? 25.661  49.923   119.270 1.00 35.56 ? 149 VAL D CB  1 
ATOM   9398  C CG1 . VAL D 1 67  ? 26.727  51.000   119.113 1.00 34.01 ? 149 VAL D CG1 1 
ATOM   9399  C CG2 . VAL D 1 67  ? 24.485  50.432   120.078 1.00 37.54 ? 149 VAL D CG2 1 
ATOM   9400  N N   . LYS D 1 68  ? 26.097  47.249   117.465 1.00 35.87 ? 150 LYS D N   1 
ATOM   9401  C CA  . LYS D 1 68  ? 27.045  46.225   117.004 1.00 37.53 ? 150 LYS D CA  1 
ATOM   9402  C C   . LYS D 1 68  ? 27.585  46.188   115.568 1.00 37.14 ? 150 LYS D C   1 
ATOM   9403  O O   . LYS D 1 68  ? 28.468  45.378   115.275 1.00 39.43 ? 150 LYS D O   1 
ATOM   9404  C CB  . LYS D 1 68  ? 26.507  44.832   117.352 1.00 38.42 ? 150 LYS D CB  1 
ATOM   9405  C CG  . LYS D 1 68  ? 25.175  44.500   116.701 1.00 44.72 ? 150 LYS D CG  1 
ATOM   9406  C CD  . LYS D 1 68  ? 24.757  43.057   116.980 1.00 46.20 ? 150 LYS D CD  1 
ATOM   9407  C CE  . LYS D 1 68  ? 23.353  42.770   116.458 1.00 46.22 ? 150 LYS D CE  1 
ATOM   9408  N NZ  . LYS D 1 68  ? 22.987  41.332   116.636 1.00 46.82 ? 150 LYS D NZ  1 
ATOM   9409  N N   . ASP D 1 69  ? 27.076  47.024   114.669 1.00 34.74 ? 151 ASP D N   1 
ATOM   9410  C CA  . ASP D 1 69  ? 27.581  47.047   113.286 1.00 32.44 ? 151 ASP D CA  1 
ATOM   9411  C C   . ASP D 1 69  ? 27.244  45.882   112.356 1.00 29.73 ? 151 ASP D C   1 
ATOM   9412  O O   . ASP D 1 69  ? 26.547  46.059   111.366 1.00 30.52 ? 151 ASP D O   1 
ATOM   9413  C CB  . ASP D 1 69  ? 29.103  47.199   113.259 1.00 33.42 ? 151 ASP D CB  1 
ATOM   9414  C CG  . ASP D 1 69  ? 29.565  48.589   113.620 1.00 35.04 ? 151 ASP D CG  1 
ATOM   9415  O OD1 . ASP D 1 69  ? 29.049  49.560   113.025 1.00 35.57 ? 151 ASP D OD1 1 
ATOM   9416  O OD2 . ASP D 1 69  ? 30.459  48.713   114.486 1.00 35.52 ? 151 ASP D OD2 1 
ATOM   9417  N N   . ARG D 1 70  ? 27.774  44.699   112.645 1.00 28.18 ? 152 ARG D N   1 
ATOM   9418  C CA  . ARG D 1 70  ? 27.536  43.529   111.794 1.00 25.13 ? 152 ARG D CA  1 
ATOM   9419  C C   . ARG D 1 70  ? 26.790  42.397   112.504 1.00 25.15 ? 152 ARG D C   1 
ATOM   9420  O O   . ARG D 1 70  ? 27.090  42.040   113.649 1.00 25.08 ? 152 ARG D O   1 
ATOM   9421  C CB  . ARG D 1 70  ? 28.867  42.994   111.243 1.00 21.83 ? 152 ARG D CB  1 
ATOM   9422  C CG  . ARG D 1 70  ? 29.698  44.011   110.457 1.00 21.04 ? 152 ARG D CG  1 
ATOM   9423  C CD  . ARG D 1 70  ? 30.995  43.391   109.940 1.00 18.95 ? 152 ARG D CD  1 
ATOM   9424  N NE  . ARG D 1 70  ? 31.861  42.911   111.012 1.00 17.30 ? 152 ARG D NE  1 
ATOM   9425  C CZ  . ARG D 1 70  ? 32.437  43.696   111.920 1.00 16.98 ? 152 ARG D CZ  1 
ATOM   9426  N NH1 . ARG D 1 70  ? 33.213  43.170   112.859 1.00 13.63 ? 152 ARG D NH1 1 
ATOM   9427  N NH2 . ARG D 1 70  ? 32.240  45.009   111.892 1.00 15.29 ? 152 ARG D NH2 1 
ATOM   9428  N N   . SER D 1 71  ? 25.799  41.846   111.811 1.00 24.61 ? 153 SER D N   1 
ATOM   9429  C CA  . SER D 1 71  ? 25.002  40.751   112.345 1.00 23.34 ? 153 SER D CA  1 
ATOM   9430  C C   . SER D 1 71  ? 24.298  40.040   111.192 1.00 22.89 ? 153 SER D C   1 
ATOM   9431  O O   . SER D 1 71  ? 24.217  40.569   110.079 1.00 22.51 ? 153 SER D O   1 
ATOM   9432  C CB  . SER D 1 71  ? 23.963  41.270   113.342 1.00 22.46 ? 153 SER D CB  1 
ATOM   9433  O OG  . SER D 1 71  ? 22.845  41.859   112.696 1.00 24.62 ? 153 SER D OG  1 
ATOM   9434  N N   . PRO D 1 72  ? 23.784  38.825   111.441 1.00 21.66 ? 154 PRO D N   1 
ATOM   9435  C CA  . PRO D 1 72  ? 23.086  38.050   110.410 1.00 20.13 ? 154 PRO D CA  1 
ATOM   9436  C C   . PRO D 1 72  ? 21.740  38.674   110.028 1.00 19.18 ? 154 PRO D C   1 
ATOM   9437  O O   . PRO D 1 72  ? 21.255  38.477   108.924 1.00 19.14 ? 154 PRO D O   1 
ATOM   9438  C CB  . PRO D 1 72  ? 22.899  36.682   111.070 1.00 20.62 ? 154 PRO D CB  1 
ATOM   9439  C CG  . PRO D 1 72  ? 23.988  36.608   112.084 1.00 21.37 ? 154 PRO D CG  1 
ATOM   9440  C CD  . PRO D 1 72  ? 23.983  38.012   112.653 1.00 22.33 ? 154 PRO D CD  1 
ATOM   9441  N N   . HIS D 1 73  ? 21.145  39.430   110.945 1.00 18.73 ? 155 HIS D N   1 
ATOM   9442  C CA  . HIS D 1 73  ? 19.844  40.046   110.704 1.00 18.93 ? 155 HIS D CA  1 
ATOM   9443  C C   . HIS D 1 73  ? 19.880  41.372   109.966 1.00 19.39 ? 155 HIS D C   1 
ATOM   9444  O O   . HIS D 1 73  ? 18.835  41.939   109.661 1.00 19.54 ? 155 HIS D O   1 
ATOM   9445  C CB  . HIS D 1 73  ? 19.123  40.246   112.024 1.00 18.41 ? 155 HIS D CB  1 
ATOM   9446  C CG  . HIS D 1 73  ? 19.180  39.051   112.917 1.00 18.26 ? 155 HIS D CG  1 
ATOM   9447  N ND1 . HIS D 1 73  ? 19.913  39.029   114.082 1.00 18.97 ? 155 HIS D ND1 1 
ATOM   9448  C CD2 . HIS D 1 73  ? 18.627  37.823   112.794 1.00 17.16 ? 155 HIS D CD2 1 
ATOM   9449  C CE1 . HIS D 1 73  ? 19.810  37.836   114.641 1.00 18.03 ? 155 HIS D CE1 1 
ATOM   9450  N NE2 . HIS D 1 73  ? 19.036  37.087   113.879 1.00 17.37 ? 155 HIS D NE2 1 
ATOM   9451  N N   . ARG D 1 74  ? 21.081  41.866   109.697 1.00 18.63 ? 156 ARG D N   1 
ATOM   9452  C CA  . ARG D 1 74  ? 21.279  43.127   108.993 1.00 18.37 ? 156 ARG D CA  1 
ATOM   9453  C C   . ARG D 1 74  ? 20.859  42.956   107.504 1.00 18.33 ? 156 ARG D C   1 
ATOM   9454  O O   . ARG D 1 74  ? 21.366  42.078   106.813 1.00 18.45 ? 156 ARG D O   1 
ATOM   9455  C CB  . ARG D 1 74  ? 22.768  43.496   109.103 1.00 19.11 ? 156 ARG D CB  1 
ATOM   9456  C CG  . ARG D 1 74  ? 23.102  44.973   109.268 1.00 20.95 ? 156 ARG D CG  1 
ATOM   9457  C CD  . ARG D 1 74  ? 22.950  45.463   110.704 1.00 19.27 ? 156 ARG D CD  1 
ATOM   9458  N NE  . ARG D 1 74  ? 22.526  46.864   110.715 1.00 19.64 ? 156 ARG D NE  1 
ATOM   9459  C CZ  . ARG D 1 74  ? 23.333  47.908   110.549 1.00 19.29 ? 156 ARG D CZ  1 
ATOM   9460  N NH1 . ARG D 1 74  ? 22.836  49.136   110.562 1.00 18.02 ? 156 ARG D NH1 1 
ATOM   9461  N NH2 . ARG D 1 74  ? 24.639  47.735   110.401 1.00 20.23 ? 156 ARG D NH2 1 
ATOM   9462  N N   . THR D 1 75  ? 19.934  43.778   107.010 1.00 17.42 ? 157 THR D N   1 
ATOM   9463  C CA  . THR D 1 75  ? 19.515  43.665   105.609 1.00 15.90 ? 157 THR D CA  1 
ATOM   9464  C C   . THR D 1 75  ? 19.467  44.993   104.853 1.00 14.94 ? 157 THR D C   1 
ATOM   9465  O O   . THR D 1 75  ? 19.149  46.030   105.425 1.00 14.32 ? 157 THR D O   1 
ATOM   9466  C CB  . THR D 1 75  ? 18.109  43.038   105.468 1.00 16.31 ? 157 THR D CB  1 
ATOM   9467  O OG1 . THR D 1 75  ? 17.137  43.905   106.063 1.00 14.79 ? 157 THR D OG1 1 
ATOM   9468  C CG2 . THR D 1 75  ? 18.058  41.668   106.125 1.00 18.10 ? 157 THR D CG2 1 
ATOM   9469  N N   . LEU D 1 76  ? 19.761  44.946   103.556 1.00 13.92 ? 158 LEU D N   1 
ATOM   9470  C CA  . LEU D 1 76  ? 19.712  46.145   102.720 1.00 11.85 ? 158 LEU D CA  1 
ATOM   9471  C C   . LEU D 1 76  ? 18.328  46.288   102.085 1.00 12.48 ? 158 LEU D C   1 
ATOM   9472  O O   . LEU D 1 76  ? 17.863  45.395   101.381 1.00 13.26 ? 158 LEU D O   1 
ATOM   9473  C CB  . LEU D 1 76  ? 20.757  46.082   101.606 1.00 8.77  ? 158 LEU D CB  1 
ATOM   9474  C CG  . LEU D 1 76  ? 20.708  47.242   100.605 1.00 9.29  ? 158 LEU D CG  1 
ATOM   9475  C CD1 . LEU D 1 76  ? 20.994  48.559   101.314 1.00 6.95  ? 158 LEU D CD1 1 
ATOM   9476  C CD2 . LEU D 1 76  ? 21.706  46.995   99.492  1.00 7.36  ? 158 LEU D CD2 1 
ATOM   9477  N N   . MET D 1 77  ? 17.673  47.415   102.335 1.00 11.46 ? 159 MET D N   1 
ATOM   9478  C CA  . MET D 1 77  ? 16.354  47.664   101.774 1.00 11.32 ? 159 MET D CA  1 
ATOM   9479  C C   . MET D 1 77  ? 16.284  49.088   101.216 1.00 11.02 ? 159 MET D C   1 
ATOM   9480  O O   . MET D 1 77  ? 17.261  49.826   101.282 1.00 11.81 ? 159 MET D O   1 
ATOM   9481  C CB  . MET D 1 77  ? 15.277  47.445   102.840 1.00 11.22 ? 159 MET D CB  1 
ATOM   9482  C CG  . MET D 1 77  ? 15.206  46.018   103.327 1.00 12.59 ? 159 MET D CG  1 
ATOM   9483  S SD  . MET D 1 77  ? 13.915  45.773   104.542 1.00 17.03 ? 159 MET D SD  1 
ATOM   9484  C CE  . MET D 1 77  ? 12.581  45.307   103.518 1.00 14.61 ? 159 MET D CE  1 
ATOM   9485  N N   . SER D 1 78  ? 15.139  49.460   100.652 1.00 10.31 ? 160 SER D N   1 
ATOM   9486  C CA  . SER D 1 78  ? 14.978  50.793   100.092 1.00 11.51 ? 160 SER D CA  1 
ATOM   9487  C C   . SER D 1 78  ? 13.518  51.232   100.026 1.00 13.06 ? 160 SER D C   1 
ATOM   9488  O O   . SER D 1 78  ? 12.599  50.409   100.042 1.00 11.51 ? 160 SER D O   1 
ATOM   9489  C CB  . SER D 1 78  ? 15.594  50.867   98.679  1.00 13.01 ? 160 SER D CB  1 
ATOM   9490  O OG  . SER D 1 78  ? 14.797  50.210   97.706  1.00 10.34 ? 160 SER D OG  1 
ATOM   9491  N N   . CYS D 1 79  ? 13.328  52.547   99.966  1.00 13.61 ? 161 CYS D N   1 
ATOM   9492  C CA  . CYS D 1 79  ? 12.009  53.157   99.861  1.00 14.77 ? 161 CYS D CA  1 
ATOM   9493  C C   . CYS D 1 79  ? 12.233  54.522   99.217  1.00 15.17 ? 161 CYS D C   1 
ATOM   9494  O O   . CYS D 1 79  ? 13.352  55.032   99.216  1.00 15.39 ? 161 CYS D O   1 
ATOM   9495  C CB  . CYS D 1 79  ? 11.374  53.320   101.244 1.00 14.25 ? 161 CYS D CB  1 
ATOM   9496  S SG  . CYS D 1 79  ? 12.222  54.494   102.336 1.00 19.74 ? 161 CYS D SG  1 
ATOM   9497  N N   . PRO D 1 80  ? 11.181  55.125   98.647  1.00 16.53 ? 162 PRO D N   1 
ATOM   9498  C CA  . PRO D 1 80  ? 11.328  56.443   98.009  1.00 15.28 ? 162 PRO D CA  1 
ATOM   9499  C C   . PRO D 1 80  ? 11.888  57.524   98.944  1.00 16.63 ? 162 PRO D C   1 
ATOM   9500  O O   . PRO D 1 80  ? 11.660  57.493   100.156 1.00 17.46 ? 162 PRO D O   1 
ATOM   9501  C CB  . PRO D 1 80  ? 9.914   56.753   97.510  1.00 14.47 ? 162 PRO D CB  1 
ATOM   9502  C CG  . PRO D 1 80  ? 9.031   55.899   98.353  1.00 15.69 ? 162 PRO D CG  1 
ATOM   9503  C CD  . PRO D 1 80  ? 9.796   54.632   98.550  1.00 15.33 ? 162 PRO D CD  1 
ATOM   9504  N N   . VAL D 1 81  ? 12.637  58.467   98.377  1.00 16.09 ? 163 VAL D N   1 
ATOM   9505  C CA  . VAL D 1 81  ? 13.232  59.526   99.173  1.00 15.62 ? 163 VAL D CA  1 
ATOM   9506  C C   . VAL D 1 81  ? 12.200  60.303   99.954  1.00 14.06 ? 163 VAL D C   1 
ATOM   9507  O O   . VAL D 1 81  ? 11.098  60.562   99.473  1.00 11.47 ? 163 VAL D O   1 
ATOM   9508  C CB  . VAL D 1 81  ? 14.064  60.529   98.310  1.00 17.31 ? 163 VAL D CB  1 
ATOM   9509  C CG1 . VAL D 1 81  ? 15.354  59.881   97.871  1.00 18.20 ? 163 VAL D CG1 1 
ATOM   9510  C CG2 . VAL D 1 81  ? 13.275  60.970   97.092  1.00 17.32 ? 163 VAL D CG2 1 
ATOM   9511  N N   . GLY D 1 82  ? 12.575  60.649   101.179 1.00 13.97 ? 164 GLY D N   1 
ATOM   9512  C CA  . GLY D 1 82  ? 11.703  61.416   102.045 1.00 14.73 ? 164 GLY D CA  1 
ATOM   9513  C C   . GLY D 1 82  ? 10.741  60.615   102.898 1.00 14.51 ? 164 GLY D C   1 
ATOM   9514  O O   . GLY D 1 82  ? 10.190  61.148   103.858 1.00 16.03 ? 164 GLY D O   1 
ATOM   9515  N N   . GLU D 1 83  ? 10.531  59.348   102.555 1.00 13.83 ? 165 GLU D N   1 
ATOM   9516  C CA  . GLU D 1 83  ? 9.616   58.507   103.313 1.00 14.42 ? 165 GLU D CA  1 
ATOM   9517  C C   . GLU D 1 83  ? 10.358  57.781   104.416 1.00 14.72 ? 165 GLU D C   1 
ATOM   9518  O O   . GLU D 1 83  ? 11.514  57.405   104.244 1.00 14.98 ? 165 GLU D O   1 
ATOM   9519  C CB  . GLU D 1 83  ? 8.924   57.490   102.391 1.00 15.23 ? 165 GLU D CB  1 
ATOM   9520  C CG  . GLU D 1 83  ? 7.905   58.109   101.443 1.00 15.01 ? 165 GLU D CG  1 
ATOM   9521  C CD  . GLU D 1 83  ? 7.225   57.095   100.526 1.00 16.47 ? 165 GLU D CD  1 
ATOM   9522  O OE1 . GLU D 1 83  ? 6.856   56.003   101.008 1.00 15.66 ? 165 GLU D OE1 1 
ATOM   9523  O OE2 . GLU D 1 83  ? 7.039   57.402   99.324  1.00 15.07 ? 165 GLU D OE2 1 
ATOM   9524  N N   . ALA D 1 84  ? 9.705   57.603   105.559 1.00 14.04 ? 166 ALA D N   1 
ATOM   9525  C CA  . ALA D 1 84  ? 10.331  56.898   106.669 1.00 15.92 ? 166 ALA D CA  1 
ATOM   9526  C C   . ALA D 1 84  ? 10.407  55.408   106.330 1.00 17.14 ? 166 ALA D C   1 
ATOM   9527  O O   . ALA D 1 84  ? 9.396   54.787   105.994 1.00 18.64 ? 166 ALA D O   1 
ATOM   9528  C CB  . ALA D 1 84  ? 9.532   57.106   107.945 1.00 15.58 ? 166 ALA D CB  1 
ATOM   9529  N N   . PRO D 1 85  ? 11.610  54.817   106.411 1.00 17.56 ? 167 PRO D N   1 
ATOM   9530  C CA  . PRO D 1 85  ? 11.792  53.395   106.105 1.00 16.03 ? 167 PRO D CA  1 
ATOM   9531  C C   . PRO D 1 85  ? 10.948  52.544   107.044 1.00 16.52 ? 167 PRO D C   1 
ATOM   9532  O O   . PRO D 1 85  ? 11.143  52.562   108.267 1.00 17.28 ? 167 PRO D O   1 
ATOM   9533  C CB  . PRO D 1 85  ? 13.289  53.193   106.311 1.00 15.47 ? 167 PRO D CB  1 
ATOM   9534  C CG  . PRO D 1 85  ? 13.590  54.127   107.407 1.00 16.27 ? 167 PRO D CG  1 
ATOM   9535  C CD  . PRO D 1 85  ? 12.833  55.377   107.013 1.00 17.09 ? 167 PRO D CD  1 
ATOM   9536  N N   . SER D 1 86  ? 10.009  51.803   106.466 1.00 15.12 ? 168 SER D N   1 
ATOM   9537  C CA  . SER D 1 86  ? 9.107   50.960   107.238 1.00 15.53 ? 168 SER D CA  1 
ATOM   9538  C C   . SER D 1 86  ? 8.827   49.635   106.531 1.00 15.71 ? 168 SER D C   1 
ATOM   9539  O O   . SER D 1 86  ? 8.939   49.534   105.310 1.00 16.59 ? 168 SER D O   1 
ATOM   9540  C CB  . SER D 1 86  ? 7.796   51.713   107.473 1.00 16.55 ? 168 SER D CB  1 
ATOM   9541  O OG  . SER D 1 86  ? 6.674   50.882   107.229 1.00 20.36 ? 168 SER D OG  1 
ATOM   9542  N N   . PRO D 1 87  ? 8.461   48.594   107.289 1.00 15.03 ? 169 PRO D N   1 
ATOM   9543  C CA  . PRO D 1 87  ? 8.185   47.312   106.639 1.00 14.26 ? 169 PRO D CA  1 
ATOM   9544  C C   . PRO D 1 87  ? 6.997   47.362   105.683 1.00 14.45 ? 169 PRO D C   1 
ATOM   9545  O O   . PRO D 1 87  ? 6.834   46.483   104.837 1.00 16.26 ? 169 PRO D O   1 
ATOM   9546  C CB  . PRO D 1 87  ? 7.956   46.364   107.819 1.00 14.56 ? 169 PRO D CB  1 
ATOM   9547  C CG  . PRO D 1 87  ? 7.444   47.272   108.907 1.00 15.47 ? 169 PRO D CG  1 
ATOM   9548  C CD  . PRO D 1 87  ? 8.322   48.491   108.752 1.00 15.40 ? 169 PRO D CD  1 
ATOM   9549  N N   . TYR D 1 88  A 6.183   48.403   105.802 1.00 14.47 ? 169 TYR D N   1 
ATOM   9550  C CA  . TYR D 1 88  A 5.006   48.550   104.946 1.00 14.09 ? 169 TYR D CA  1 
ATOM   9551  C C   . TYR D 1 88  A 5.285   49.361   103.678 1.00 15.21 ? 169 TYR D C   1 
ATOM   9552  O O   . TYR D 1 88  A 4.428   49.442   102.804 1.00 16.03 ? 169 TYR D O   1 
ATOM   9553  C CB  . TYR D 1 88  A 3.871   49.220   105.732 1.00 11.66 ? 169 TYR D CB  1 
ATOM   9554  C CG  . TYR D 1 88  A 3.699   48.701   107.150 1.00 10.14 ? 169 TYR D CG  1 
ATOM   9555  C CD1 . TYR D 1 88  A 3.294   49.554   108.179 1.00 8.28  ? 169 TYR D CD1 1 
ATOM   9556  C CD2 . TYR D 1 88  A 3.946   47.364   107.461 1.00 6.58  ? 169 TYR D CD2 1 
ATOM   9557  C CE1 . TYR D 1 88  A 3.138   49.091   109.476 1.00 6.21  ? 169 TYR D CE1 1 
ATOM   9558  C CE2 . TYR D 1 88  A 3.799   46.893   108.748 1.00 6.98  ? 169 TYR D CE2 1 
ATOM   9559  C CZ  . TYR D 1 88  A 3.391   47.759   109.752 1.00 7.68  ? 169 TYR D CZ  1 
ATOM   9560  O OH  . TYR D 1 88  A 3.210   47.277   111.020 1.00 10.28 ? 169 TYR D OH  1 
ATOM   9561  N N   . ASN D 1 89  ? 6.467   49.969   103.569 1.00 15.54 ? 170 ASN D N   1 
ATOM   9562  C CA  . ASN D 1 89  ? 6.788   50.766   102.378 1.00 15.86 ? 170 ASN D CA  1 
ATOM   9563  C C   . ASN D 1 89  ? 8.192   50.505   101.836 1.00 15.82 ? 170 ASN D C   1 
ATOM   9564  O O   . ASN D 1 89  ? 8.663   51.224   100.956 1.00 15.35 ? 170 ASN D O   1 
ATOM   9565  C CB  . ASN D 1 89  ? 6.651   52.264   102.680 1.00 16.47 ? 170 ASN D CB  1 
ATOM   9566  C CG  . ASN D 1 89  ? 7.896   52.847   103.343 1.00 18.42 ? 170 ASN D CG  1 
ATOM   9567  O OD1 . ASN D 1 89  ? 8.490   52.226   104.223 1.00 18.07 ? 170 ASN D OD1 1 
ATOM   9568  N ND2 . ASN D 1 89  ? 8.287   54.053   102.927 1.00 18.42 ? 170 ASN D ND2 1 
ATOM   9569  N N   . SER D 1 90  ? 8.853   49.476   102.355 1.00 14.32 ? 171 SER D N   1 
ATOM   9570  C CA  . SER D 1 90  ? 10.211  49.153   101.928 1.00 14.70 ? 171 SER D CA  1 
ATOM   9571  C C   . SER D 1 90  ? 10.357  47.923   101.044 1.00 14.59 ? 171 SER D C   1 
ATOM   9572  O O   . SER D 1 90  ? 9.770   46.873   101.300 1.00 13.53 ? 171 SER D O   1 
ATOM   9573  C CB  . SER D 1 90  ? 11.113  48.984   103.150 1.00 14.68 ? 171 SER D CB  1 
ATOM   9574  O OG  . SER D 1 90  ? 11.202  50.194   103.874 1.00 16.90 ? 171 SER D OG  1 
ATOM   9575  N N   . ARG D 1 91  ? 11.154  48.071   99.995  1.00 15.27 ? 172 ARG D N   1 
ATOM   9576  C CA  . ARG D 1 91  ? 11.420  46.976   99.085  1.00 17.42 ? 172 ARG D CA  1 
ATOM   9577  C C   . ARG D 1 91  ? 12.648  46.244   99.604  1.00 17.46 ? 172 ARG D C   1 
ATOM   9578  O O   . ARG D 1 91  ? 13.635  46.877   99.965  1.00 18.05 ? 172 ARG D O   1 
ATOM   9579  C CB  . ARG D 1 91  ? 11.720  47.498   97.684  1.00 19.46 ? 172 ARG D CB  1 
ATOM   9580  C CG  . ARG D 1 91  ? 12.342  46.441   96.790  1.00 23.44 ? 172 ARG D CG  1 
ATOM   9581  C CD  . ARG D 1 91  ? 12.996  47.061   95.580  1.00 27.47 ? 172 ARG D CD  1 
ATOM   9582  N NE  . ARG D 1 91  ? 12.077  47.883   94.793  1.00 30.76 ? 172 ARG D NE  1 
ATOM   9583  C CZ  . ARG D 1 91  ? 12.474  48.673   93.794  1.00 32.29 ? 172 ARG D CZ  1 
ATOM   9584  N NH1 . ARG D 1 91  ? 11.589  49.397   93.114  1.00 31.23 ? 172 ARG D NH1 1 
ATOM   9585  N NH2 . ARG D 1 91  ? 13.768  48.744   93.482  1.00 31.55 ? 172 ARG D NH2 1 
ATOM   9586  N N   . PHE D 1 92  ? 12.594  44.919   99.651  1.00 18.12 ? 173 PHE D N   1 
ATOM   9587  C CA  . PHE D 1 92  ? 13.748  44.159   100.116 1.00 17.22 ? 173 PHE D CA  1 
ATOM   9588  C C   . PHE D 1 92  ? 14.779  44.133   99.001  1.00 17.97 ? 173 PHE D C   1 
ATOM   9589  O O   . PHE D 1 92  ? 14.438  43.887   97.850  1.00 18.78 ? 173 PHE D O   1 
ATOM   9590  C CB  . PHE D 1 92  ? 13.374  42.723   100.452 1.00 15.64 ? 173 PHE D CB  1 
ATOM   9591  C CG  . PHE D 1 92  ? 14.541  41.900   100.869 1.00 16.39 ? 173 PHE D CG  1 
ATOM   9592  C CD1 . PHE D 1 92  ? 15.031  41.986   102.169 1.00 16.67 ? 173 PHE D CD1 1 
ATOM   9593  C CD2 . PHE D 1 92  ? 15.212  41.095   99.943  1.00 16.40 ? 173 PHE D CD2 1 
ATOM   9594  C CE1 . PHE D 1 92  ? 16.178  41.288   102.547 1.00 15.55 ? 173 PHE D CE1 1 
ATOM   9595  C CE2 . PHE D 1 92  ? 16.360  40.396   100.311 1.00 14.42 ? 173 PHE D CE2 1 
ATOM   9596  C CZ  . PHE D 1 92  ? 16.843  40.495   101.618 1.00 15.09 ? 173 PHE D CZ  1 
ATOM   9597  N N   . GLU D 1 93  ? 16.039  44.371   99.340  1.00 18.36 ? 174 GLU D N   1 
ATOM   9598  C CA  . GLU D 1 93  ? 17.081  44.366   98.330  1.00 18.51 ? 174 GLU D CA  1 
ATOM   9599  C C   . GLU D 1 93  ? 18.090  43.238   98.507  1.00 19.88 ? 174 GLU D C   1 
ATOM   9600  O O   . GLU D 1 93  ? 18.374  42.496   97.556  1.00 21.34 ? 174 GLU D O   1 
ATOM   9601  C CB  . GLU D 1 93  ? 17.820  45.699   98.333  1.00 18.52 ? 174 GLU D CB  1 
ATOM   9602  C CG  . GLU D 1 93  ? 16.921  46.919   98.135  1.00 19.28 ? 174 GLU D CG  1 
ATOM   9603  C CD  . GLU D 1 93  ? 16.436  47.100   96.698  1.00 19.30 ? 174 GLU D CD  1 
ATOM   9604  O OE1 . GLU D 1 93  ? 15.685  48.064   96.454  1.00 19.43 ? 174 GLU D OE1 1 
ATOM   9605  O OE2 . GLU D 1 93  ? 16.797  46.292   95.813  1.00 20.31 ? 174 GLU D OE2 1 
ATOM   9606  N N   . SER D 1 94  ? 18.629  43.090   99.716  1.00 19.88 ? 175 SER D N   1 
ATOM   9607  C CA  . SER D 1 94  ? 19.646  42.066   99.939  1.00 18.79 ? 175 SER D CA  1 
ATOM   9608  C C   . SER D 1 94  ? 20.021  41.912   101.421 1.00 17.70 ? 175 SER D C   1 
ATOM   9609  O O   . SER D 1 94  ? 19.811  42.826   102.226 1.00 16.78 ? 175 SER D O   1 
ATOM   9610  C CB  . SER D 1 94  ? 20.892  42.447   99.117  1.00 19.37 ? 175 SER D CB  1 
ATOM   9611  O OG  . SER D 1 94  ? 21.696  41.332   98.762  1.00 22.47 ? 175 SER D OG  1 
ATOM   9612  N N   . VAL D 1 95  ? 20.572  40.748   101.775 1.00 16.73 ? 176 VAL D N   1 
ATOM   9613  C CA  . VAL D 1 95  ? 21.014  40.482   103.144 1.00 15.71 ? 176 VAL D CA  1 
ATOM   9614  C C   . VAL D 1 95  ? 22.431  41.026   103.202 1.00 15.71 ? 176 VAL D C   1 
ATOM   9615  O O   . VAL D 1 95  ? 23.315  40.536   102.494 1.00 16.79 ? 176 VAL D O   1 
ATOM   9616  C CB  . VAL D 1 95  ? 21.042  38.969   103.459 1.00 15.20 ? 176 VAL D CB  1 
ATOM   9617  C CG1 . VAL D 1 95  ? 21.614  38.728   104.863 1.00 13.82 ? 176 VAL D CG1 1 
ATOM   9618  C CG2 . VAL D 1 95  ? 19.636  38.397   103.354 1.00 15.53 ? 176 VAL D CG2 1 
ATOM   9619  N N   . ALA D 1 96  ? 22.649  42.027   104.055 1.00 14.74 ? 177 ALA D N   1 
ATOM   9620  C CA  . ALA D 1 96  ? 23.952  42.660   104.143 1.00 12.83 ? 177 ALA D CA  1 
ATOM   9621  C C   . ALA D 1 96  ? 24.182  43.528   105.382 1.00 13.48 ? 177 ALA D C   1 
ATOM   9622  O O   . ALA D 1 96  ? 23.240  43.997   106.024 1.00 11.02 ? 177 ALA D O   1 
ATOM   9623  C CB  . ALA D 1 96  ? 24.153  43.507   102.904 1.00 13.67 ? 177 ALA D CB  1 
ATOM   9624  N N   . TRP D 1 97  ? 25.454  43.732   105.712 1.00 13.36 ? 178 TRP D N   1 
ATOM   9625  C CA  . TRP D 1 97  ? 25.820  44.600   106.819 1.00 14.47 ? 178 TRP D CA  1 
ATOM   9626  C C   . TRP D 1 97  ? 26.778  45.672   106.279 1.00 14.50 ? 178 TRP D C   1 
ATOM   9627  O O   . TRP D 1 97  ? 27.437  46.404   107.022 1.00 15.03 ? 178 TRP D O   1 
ATOM   9628  C CB  . TRP D 1 97  ? 26.428  43.813   108.001 1.00 14.53 ? 178 TRP D CB  1 
ATOM   9629  C CG  . TRP D 1 97  ? 27.341  42.656   107.682 1.00 15.32 ? 178 TRP D CG  1 
ATOM   9630  C CD1 . TRP D 1 97  ? 27.056  41.331   107.841 1.00 14.72 ? 178 TRP D CD1 1 
ATOM   9631  C CD2 . TRP D 1 97  ? 28.706  42.719   107.229 1.00 14.62 ? 178 TRP D CD2 1 
ATOM   9632  N NE1 . TRP D 1 97  ? 28.154  40.565   107.524 1.00 16.47 ? 178 TRP D NE1 1 
ATOM   9633  C CE2 . TRP D 1 97  ? 29.180  41.388   107.145 1.00 14.90 ? 178 TRP D CE2 1 
ATOM   9634  C CE3 . TRP D 1 97  ? 29.569  43.766   106.886 1.00 14.51 ? 178 TRP D CE3 1 
ATOM   9635  C CZ2 . TRP D 1 97  ? 30.478  41.077   106.736 1.00 14.18 ? 178 TRP D CZ2 1 
ATOM   9636  C CZ3 . TRP D 1 97  ? 30.870  43.452   106.475 1.00 16.13 ? 178 TRP D CZ3 1 
ATOM   9637  C CH2 . TRP D 1 97  ? 31.307  42.118   106.406 1.00 14.80 ? 178 TRP D CH2 1 
ATOM   9638  N N   . SER D 1 98  ? 26.819  45.743   104.953 1.00 14.45 ? 179 SER D N   1 
ATOM   9639  C CA  . SER D 1 98  ? 27.614  46.704   104.190 1.00 14.21 ? 179 SER D CA  1 
ATOM   9640  C C   . SER D 1 98  ? 27.094  46.591   102.754 1.00 13.60 ? 179 SER D C   1 
ATOM   9641  O O   . SER D 1 98  ? 26.963  45.486   102.219 1.00 13.53 ? 179 SER D O   1 
ATOM   9642  C CB  . SER D 1 98  ? 29.111  46.372   104.251 1.00 14.50 ? 179 SER D CB  1 
ATOM   9643  O OG  . SER D 1 98  ? 29.889  47.423   103.686 1.00 14.80 ? 179 SER D OG  1 
ATOM   9644  N N   . ALA D 1 99  ? 26.777  47.721   102.132 1.00 12.60 ? 180 ALA D N   1 
ATOM   9645  C CA  . ALA D 1 99  ? 26.233  47.667   100.783 1.00 14.47 ? 180 ALA D CA  1 
ATOM   9646  C C   . ALA D 1 99  ? 26.550  48.840   99.875  1.00 14.85 ? 180 ALA D C   1 
ATOM   9647  O O   . ALA D 1 99  ? 27.264  49.771   100.241 1.00 16.21 ? 180 ALA D O   1 
ATOM   9648  C CB  . ALA D 1 99  ? 24.719  47.471   100.846 1.00 12.13 ? 180 ALA D CB  1 
ATOM   9649  N N   . SER D 1 100 ? 25.989  48.765   98.677  1.00 14.15 ? 181 SER D N   1 
ATOM   9650  C CA  . SER D 1 100 ? 26.173  49.769   97.656  1.00 14.25 ? 181 SER D CA  1 
ATOM   9651  C C   . SER D 1 100 ? 25.089  49.509   96.623  1.00 13.70 ? 181 SER D C   1 
ATOM   9652  O O   . SER D 1 100 ? 24.538  48.415   96.580  1.00 13.74 ? 181 SER D O   1 
ATOM   9653  C CB  . SER D 1 100 ? 27.557  49.604   97.029  1.00 16.36 ? 181 SER D CB  1 
ATOM   9654  O OG  . SER D 1 100 ? 27.747  50.506   95.951  1.00 21.84 ? 181 SER D OG  1 
ATOM   9655  N N   . ALA D 1 101 ? 24.781  50.505   95.798  1.00 12.83 ? 182 ALA D N   1 
ATOM   9656  C CA  . ALA D 1 101 ? 23.757  50.338   94.773  1.00 12.96 ? 182 ALA D CA  1 
ATOM   9657  C C   . ALA D 1 101 ? 23.706  51.512   93.806  1.00 14.25 ? 182 ALA D C   1 
ATOM   9658  O O   . ALA D 1 101 ? 24.055  52.634   94.162  1.00 16.43 ? 182 ALA D O   1 
ATOM   9659  C CB  . ALA D 1 101 ? 22.392  50.139   95.419  1.00 10.15 ? 182 ALA D CB  1 
ATOM   9660  N N   . CYS D 1 102 ? 23.268  51.245   92.578  1.00 15.81 ? 183 CYS D N   1 
ATOM   9661  C CA  . CYS D 1 102 ? 23.155  52.278   91.541  1.00 16.93 ? 183 CYS D CA  1 
ATOM   9662  C C   . CYS D 1 102 ? 22.333  51.768   90.357  1.00 15.40 ? 183 CYS D C   1 
ATOM   9663  O O   . CYS D 1 102 ? 22.164  50.568   90.186  1.00 17.30 ? 183 CYS D O   1 
ATOM   9664  C CB  . CYS D 1 102 ? 24.551  52.722   91.075  1.00 17.42 ? 183 CYS D CB  1 
ATOM   9665  S SG  . CYS D 1 102 ? 25.671  51.371   90.573  1.00 20.06 ? 183 CYS D SG  1 
ATOM   9666  N N   . HIS D 1 103 ? 21.817  52.674   89.541  1.00 14.90 ? 184 HIS D N   1 
ATOM   9667  C CA  . HIS D 1 103 ? 20.995  52.276   88.398  1.00 14.72 ? 184 HIS D CA  1 
ATOM   9668  C C   . HIS D 1 103 ? 21.692  52.606   87.074  1.00 14.63 ? 184 HIS D C   1 
ATOM   9669  O O   . HIS D 1 103 ? 22.077  53.749   86.849  1.00 15.28 ? 184 HIS D O   1 
ATOM   9670  C CB  . HIS D 1 103 ? 19.643  52.985   88.477  1.00 13.28 ? 184 HIS D CB  1 
ATOM   9671  C CG  . HIS D 1 103 ? 18.606  52.410   87.567  1.00 15.11 ? 184 HIS D CG  1 
ATOM   9672  N ND1 . HIS D 1 103 ? 17.670  51.485   87.991  1.00 14.13 ? 184 HIS D ND1 1 
ATOM   9673  C CD2 . HIS D 1 103 ? 18.353  52.621   86.253  1.00 12.14 ? 184 HIS D CD2 1 
ATOM   9674  C CE1 . HIS D 1 103 ? 16.891  51.159   86.978  1.00 13.95 ? 184 HIS D CE1 1 
ATOM   9675  N NE2 . HIS D 1 103 ? 17.284  51.834   85.910  1.00 10.97 ? 184 HIS D NE2 1 
ATOM   9676  N N   . ASP D 1 104 ? 21.841  51.623   86.188  1.00 14.98 ? 185 ASP D N   1 
ATOM   9677  C CA  . ASP D 1 104 ? 22.542  51.886   84.932  1.00 16.24 ? 185 ASP D CA  1 
ATOM   9678  C C   . ASP D 1 104 ? 21.696  52.412   83.787  1.00 16.83 ? 185 ASP D C   1 
ATOM   9679  O O   . ASP D 1 104 ? 22.182  52.509   82.661  1.00 18.26 ? 185 ASP D O   1 
ATOM   9680  C CB  . ASP D 1 104 ? 23.301  50.636   84.458  1.00 15.36 ? 185 ASP D CB  1 
ATOM   9681  C CG  . ASP D 1 104 ? 22.384  49.543   83.964  1.00 14.04 ? 185 ASP D CG  1 
ATOM   9682  O OD1 . ASP D 1 104 ? 21.173  49.800   83.827  1.00 16.09 ? 185 ASP D OD1 1 
ATOM   9683  O OD2 . ASP D 1 104 ? 22.878  48.428   83.705  1.00 11.51 ? 185 ASP D OD2 1 
ATOM   9684  N N   . GLY D 1 105 ? 20.446  52.759   84.069  1.00 17.71 ? 186 GLY D N   1 
ATOM   9685  C CA  . GLY D 1 105 ? 19.565  53.261   83.028  1.00 18.42 ? 186 GLY D CA  1 
ATOM   9686  C C   . GLY D 1 105 ? 18.542  52.207   82.653  1.00 19.83 ? 186 GLY D C   1 
ATOM   9687  O O   . GLY D 1 105 ? 17.426  52.514   82.226  1.00 19.65 ? 186 GLY D O   1 
ATOM   9688  N N   . THR D 1 106 ? 18.929  50.949   82.825  1.00 20.33 ? 187 THR D N   1 
ATOM   9689  C CA  . THR D 1 106 ? 18.055  49.834   82.520  1.00 21.29 ? 187 THR D CA  1 
ATOM   9690  C C   . THR D 1 106 ? 17.493  49.184   83.790  1.00 21.81 ? 187 THR D C   1 
ATOM   9691  O O   . THR D 1 106 ? 16.280  49.093   83.946  1.00 22.46 ? 187 THR D O   1 
ATOM   9692  C CB  . THR D 1 106 ? 18.794  48.761   81.706  1.00 21.87 ? 187 THR D CB  1 
ATOM   9693  O OG1 . THR D 1 106 ? 19.257  49.330   80.479  1.00 22.70 ? 187 THR D OG1 1 
ATOM   9694  C CG2 . THR D 1 106 ? 17.867  47.594   81.408  1.00 21.39 ? 187 THR D CG2 1 
ATOM   9695  N N   . SER D 1 107 ? 18.368  48.730   84.687  1.00 20.61 ? 188 SER D N   1 
ATOM   9696  C CA  . SER D 1 107 ? 17.923  48.080   85.924  1.00 20.55 ? 188 SER D CA  1 
ATOM   9697  C C   . SER D 1 107 ? 18.782  48.464   87.126  1.00 19.43 ? 188 SER D C   1 
ATOM   9698  O O   . SER D 1 107 ? 19.836  49.088   86.986  1.00 19.79 ? 188 SER D O   1 
ATOM   9699  C CB  . SER D 1 107 ? 17.941  46.558   85.766  1.00 19.98 ? 188 SER D CB  1 
ATOM   9700  O OG  . SER D 1 107 ? 19.256  46.085   85.536  1.00 20.00 ? 188 SER D OG  1 
ATOM   9701  N N   . TRP D 1 108 ? 18.325  48.084   88.313  1.00 18.57 ? 189 TRP D N   1 
ATOM   9702  C CA  . TRP D 1 108 ? 19.056  48.391   89.539  1.00 17.35 ? 189 TRP D CA  1 
ATOM   9703  C C   . TRP D 1 108 ? 20.119  47.356   89.832  1.00 16.64 ? 189 TRP D C   1 
ATOM   9704  O O   . TRP D 1 108 ? 19.875  46.162   89.695  1.00 16.64 ? 189 TRP D O   1 
ATOM   9705  C CB  . TRP D 1 108 ? 18.112  48.437   90.741  1.00 16.81 ? 189 TRP D CB  1 
ATOM   9706  C CG  . TRP D 1 108 ? 17.374  49.726   90.920  1.00 18.67 ? 189 TRP D CG  1 
ATOM   9707  C CD1 . TRP D 1 108 ? 16.033  49.941   90.736  1.00 16.42 ? 189 TRP D CD1 1 
ATOM   9708  C CD2 . TRP D 1 108 ? 17.919  50.964   91.386  1.00 17.39 ? 189 TRP D CD2 1 
ATOM   9709  N NE1 . TRP D 1 108 ? 15.712  51.230   91.072  1.00 18.41 ? 189 TRP D NE1 1 
ATOM   9710  C CE2 . TRP D 1 108 ? 16.851  51.883   91.478  1.00 19.29 ? 189 TRP D CE2 1 
ATOM   9711  C CE3 . TRP D 1 108 ? 19.205  51.384   91.743  1.00 17.41 ? 189 TRP D CE3 1 
ATOM   9712  C CZ2 . TRP D 1 108 ? 17.032  53.206   91.906  1.00 18.39 ? 189 TRP D CZ2 1 
ATOM   9713  C CZ3 . TRP D 1 108 ? 19.388  52.696   92.169  1.00 19.70 ? 189 TRP D CZ3 1 
ATOM   9714  C CH2 . TRP D 1 108 ? 18.305  53.592   92.250  1.00 18.99 ? 189 TRP D CH2 1 
ATOM   9715  N N   . LEU D 1 109 ? 21.302  47.819   90.219  1.00 15.57 ? 190 LEU D N   1 
ATOM   9716  C CA  . LEU D 1 109 ? 22.387  46.921   90.596  1.00 14.31 ? 190 LEU D CA  1 
ATOM   9717  C C   . LEU D 1 109 ? 22.555  47.054   92.112  1.00 14.48 ? 190 LEU D C   1 
ATOM   9718  O O   . LEU D 1 109 ? 22.764  48.161   92.617  1.00 13.52 ? 190 LEU D O   1 
ATOM   9719  C CB  . LEU D 1 109 ? 23.694  47.319   89.909  1.00 14.28 ? 190 LEU D CB  1 
ATOM   9720  C CG  . LEU D 1 109 ? 24.969  46.692   90.496  1.00 14.47 ? 190 LEU D CG  1 
ATOM   9721  C CD1 . LEU D 1 109 ? 24.976  45.184   90.277  1.00 11.26 ? 190 LEU D CD1 1 
ATOM   9722  C CD2 . LEU D 1 109 ? 26.186  47.327   89.854  1.00 14.63 ? 190 LEU D CD2 1 
ATOM   9723  N N   . THR D 1 110 ? 22.444  45.949   92.842  1.00 14.04 ? 191 THR D N   1 
ATOM   9724  C CA  . THR D 1 110 ? 22.619  46.018   94.291  1.00 14.28 ? 191 THR D CA  1 
ATOM   9725  C C   . THR D 1 110 ? 23.787  45.153   94.742  1.00 15.48 ? 191 THR D C   1 
ATOM   9726  O O   . THR D 1 110 ? 24.037  44.088   94.179  1.00 15.67 ? 191 THR D O   1 
ATOM   9727  C CB  . THR D 1 110 ? 21.366  45.554   95.075  1.00 12.49 ? 191 THR D CB  1 
ATOM   9728  O OG1 . THR D 1 110 ? 21.086  44.182   94.776  1.00 11.85 ? 191 THR D OG1 1 
ATOM   9729  C CG2 . THR D 1 110 ? 20.177  46.414   94.742  1.00 10.95 ? 191 THR D CG2 1 
ATOM   9730  N N   . ILE D 1 111 ? 24.498  45.627   95.758  1.00 15.10 ? 192 ILE D N   1 
ATOM   9731  C CA  . ILE D 1 111 ? 25.632  44.909   96.305  1.00 15.67 ? 192 ILE D CA  1 
ATOM   9732  C C   . ILE D 1 111 ? 25.449  44.813   97.820  1.00 16.17 ? 192 ILE D C   1 
ATOM   9733  O O   . ILE D 1 111 ? 25.429  45.829   98.525  1.00 17.38 ? 192 ILE D O   1 
ATOM   9734  C CB  . ILE D 1 111 ? 26.964  45.634   95.989  1.00 15.67 ? 192 ILE D CB  1 
ATOM   9735  C CG1 . ILE D 1 111 ? 27.099  45.872   94.481  1.00 16.82 ? 192 ILE D CG1 1 
ATOM   9736  C CG2 . ILE D 1 111 ? 28.121  44.794   96.450  1.00 15.40 ? 192 ILE D CG2 1 
ATOM   9737  C CD1 . ILE D 1 111 ? 28.176  46.887   94.101  1.00 12.80 ? 192 ILE D CD1 1 
ATOM   9738  N N   . GLY D 1 112 ? 25.299  43.580   98.302  1.00 15.71 ? 193 GLY D N   1 
ATOM   9739  C CA  . GLY D 1 112 ? 25.106  43.323   99.717  1.00 13.97 ? 193 GLY D CA  1 
ATOM   9740  C C   . GLY D 1 112 ? 26.113  42.313   100.236 1.00 14.24 ? 193 GLY D C   1 
ATOM   9741  O O   . GLY D 1 112 ? 26.173  41.168   99.782  1.00 12.79 ? 193 GLY D O   1 
ATOM   9742  N N   . ILE D 1 113 ? 26.916  42.755   101.193 1.00 13.61 ? 194 ILE D N   1 
ATOM   9743  C CA  . ILE D 1 113 ? 27.947  41.923   101.779 1.00 13.72 ? 194 ILE D CA  1 
ATOM   9744  C C   . ILE D 1 113 ? 27.484  41.319   103.095 1.00 14.84 ? 194 ILE D C   1 
ATOM   9745  O O   . ILE D 1 113 ? 27.042  42.045   103.995 1.00 15.53 ? 194 ILE D O   1 
ATOM   9746  C CB  . ILE D 1 113 ? 29.210  42.745   102.066 1.00 12.42 ? 194 ILE D CB  1 
ATOM   9747  C CG1 . ILE D 1 113 ? 29.723  43.379   100.784 1.00 12.37 ? 194 ILE D CG1 1 
ATOM   9748  C CG2 . ILE D 1 113 ? 30.286  41.861   102.674 1.00 11.41 ? 194 ILE D CG2 1 
ATOM   9749  C CD1 . ILE D 1 113 ? 30.883  44.322   101.032 1.00 12.31 ? 194 ILE D CD1 1 
ATOM   9750  N N   . SER D 1 114 ? 27.606  39.997   103.206 1.00 13.27 ? 195 SER D N   1 
ATOM   9751  C CA  . SER D 1 114 ? 27.231  39.285   104.424 1.00 12.84 ? 195 SER D CA  1 
ATOM   9752  C C   . SER D 1 114 ? 28.224  38.155   104.697 1.00 11.79 ? 195 SER D C   1 
ATOM   9753  O O   . SER D 1 114 ? 29.176  37.961   103.941 1.00 10.44 ? 195 SER D O   1 
ATOM   9754  C CB  . SER D 1 114 ? 25.805  38.726   104.308 1.00 13.56 ? 195 SER D CB  1 
ATOM   9755  O OG  . SER D 1 114 ? 25.383  38.127   105.528 1.00 14.88 ? 195 SER D OG  1 
ATOM   9756  N N   . GLY D 1 115 ? 27.992  37.412   105.777 1.00 12.30 ? 196 GLY D N   1 
ATOM   9757  C CA  . GLY D 1 115 ? 28.884  36.326   106.147 1.00 12.31 ? 196 GLY D CA  1 
ATOM   9758  C C   . GLY D 1 115 ? 29.760  36.731   107.324 1.00 12.43 ? 196 GLY D C   1 
ATOM   9759  O O   . GLY D 1 115 ? 29.593  37.822   107.864 1.00 12.05 ? 196 GLY D O   1 
ATOM   9760  N N   . PRO D 1 116 ? 30.714  35.880   107.735 1.00 13.37 ? 197 PRO D N   1 
ATOM   9761  C CA  . PRO D 1 116 ? 31.598  36.193   108.863 1.00 12.77 ? 197 PRO D CA  1 
ATOM   9762  C C   . PRO D 1 116 ? 32.696  37.183   108.454 1.00 13.65 ? 197 PRO D C   1 
ATOM   9763  O O   . PRO D 1 116 ? 32.976  37.357   107.267 1.00 12.51 ? 197 PRO D O   1 
ATOM   9764  C CB  . PRO D 1 116 ? 32.152  34.821   109.245 1.00 11.91 ? 197 PRO D CB  1 
ATOM   9765  C CG  . PRO D 1 116 ? 32.335  34.164   107.888 1.00 12.50 ? 197 PRO D CG  1 
ATOM   9766  C CD  . PRO D 1 116 ? 31.081  34.587   107.114 1.00 13.54 ? 197 PRO D CD  1 
ATOM   9767  N N   . ASP D 1 117 ? 33.311  37.826   109.443 1.00 13.95 ? 198 ASP D N   1 
ATOM   9768  C CA  . ASP D 1 117 ? 34.368  38.796   109.178 1.00 15.03 ? 198 ASP D CA  1 
ATOM   9769  C C   . ASP D 1 117 ? 35.526  38.164   108.422 1.00 14.91 ? 198 ASP D C   1 
ATOM   9770  O O   . ASP D 1 117 ? 36.130  38.797   107.557 1.00 16.46 ? 198 ASP D O   1 
ATOM   9771  C CB  . ASP D 1 117 ? 34.919  39.395   110.481 1.00 14.61 ? 198 ASP D CB  1 
ATOM   9772  C CG  . ASP D 1 117 ? 33.844  40.031   111.347 1.00 16.00 ? 198 ASP D CG  1 
ATOM   9773  O OD1 . ASP D 1 117 ? 32.771  40.402   110.817 1.00 16.10 ? 198 ASP D OD1 1 
ATOM   9774  O OD2 . ASP D 1 117 ? 34.088  40.171   112.562 1.00 15.28 ? 198 ASP D OD2 1 
ATOM   9775  N N   . ASN D 1 118 ? 35.831  36.911   108.744 1.00 15.21 ? 199 ASN D N   1 
ATOM   9776  C CA  . ASN D 1 118 ? 36.938  36.240   108.096 1.00 16.22 ? 199 ASN D CA  1 
ATOM   9777  C C   . ASN D 1 118 ? 36.601  35.615   106.748 1.00 16.06 ? 199 ASN D C   1 
ATOM   9778  O O   . ASN D 1 118 ? 37.456  34.963   106.150 1.00 16.80 ? 199 ASN D O   1 
ATOM   9779  C CB  . ASN D 1 118 ? 37.538  35.171   109.020 1.00 17.21 ? 199 ASN D CB  1 
ATOM   9780  C CG  . ASN D 1 118 ? 36.655  33.942   109.150 1.00 19.01 ? 199 ASN D CG  1 
ATOM   9781  O OD1 . ASN D 1 118 ? 35.800  33.684   108.298 1.00 21.54 ? 199 ASN D OD1 1 
ATOM   9782  N ND2 . ASN D 1 118 ? 36.872  33.164   110.207 1.00 15.05 ? 199 ASN D ND2 1 
ATOM   9783  N N   . GLY D 1 119 ? 35.370  35.806   106.272 1.00 15.59 ? 200 GLY D N   1 
ATOM   9784  C CA  . GLY D 1 119 ? 34.985  35.249   104.983 1.00 14.99 ? 200 GLY D CA  1 
ATOM   9785  C C   . GLY D 1 119 ? 33.767  35.881   104.317 1.00 15.84 ? 200 GLY D C   1 
ATOM   9786  O O   . GLY D 1 119 ? 32.994  35.191   103.655 1.00 15.95 ? 200 GLY D O   1 
ATOM   9787  N N   . ALA D 1 120 ? 33.585  37.188   104.475 1.00 14.92 ? 201 ALA D N   1 
ATOM   9788  C CA  . ALA D 1 120 ? 32.434  37.867   103.881 1.00 14.31 ? 201 ALA D CA  1 
ATOM   9789  C C   . ALA D 1 120 ? 32.362  37.718   102.357 1.00 15.39 ? 201 ALA D C   1 
ATOM   9790  O O   . ALA D 1 120 ? 33.386  37.603   101.680 1.00 13.68 ? 201 ALA D O   1 
ATOM   9791  C CB  . ALA D 1 120 ? 32.448  39.330   104.255 1.00 12.57 ? 201 ALA D CB  1 
ATOM   9792  N N   . VAL D 1 121 ? 31.136  37.716   101.834 1.00 15.18 ? 202 VAL D N   1 
ATOM   9793  C CA  . VAL D 1 121 ? 30.889  37.588   100.398 1.00 15.23 ? 202 VAL D CA  1 
ATOM   9794  C C   . VAL D 1 121 ? 29.887  38.636   99.886  1.00 14.34 ? 202 VAL D C   1 
ATOM   9795  O O   . VAL D 1 121 ? 28.802  38.805   100.443 1.00 13.21 ? 202 VAL D O   1 
ATOM   9796  C CB  . VAL D 1 121 ? 30.367  36.167   100.034 1.00 14.33 ? 202 VAL D CB  1 
ATOM   9797  C CG1 . VAL D 1 121 ? 29.378  35.688   101.076 1.00 18.72 ? 202 VAL D CG1 1 
ATOM   9798  C CG2 . VAL D 1 121 ? 29.672  36.196   98.682  1.00 13.26 ? 202 VAL D CG2 1 
ATOM   9799  N N   . ALA D 1 122 ? 30.276  39.334   98.822  1.00 13.90 ? 203 ALA D N   1 
ATOM   9800  C CA  . ALA D 1 122 ? 29.444  40.356   98.204  1.00 13.38 ? 203 ALA D CA  1 
ATOM   9801  C C   . ALA D 1 122 ? 28.508  39.714   97.189  1.00 13.81 ? 203 ALA D C   1 
ATOM   9802  O O   . ALA D 1 122 ? 28.946  39.040   96.256  1.00 13.87 ? 203 ALA D O   1 
ATOM   9803  C CB  . ALA D 1 122 ? 30.320  41.410   97.515  1.00 11.58 ? 203 ALA D CB  1 
ATOM   9804  N N   . VAL D 1 123 ? 27.213  39.929   97.381  1.00 14.97 ? 204 VAL D N   1 
ATOM   9805  C CA  . VAL D 1 123 ? 26.206  39.390   96.486  1.00 13.72 ? 204 VAL D CA  1 
ATOM   9806  C C   . VAL D 1 123 ? 25.680  40.495   95.587  1.00 14.87 ? 204 VAL D C   1 
ATOM   9807  O O   . VAL D 1 123 ? 24.908  41.336   96.030  1.00 16.72 ? 204 VAL D O   1 
ATOM   9808  C CB  . VAL D 1 123 ? 25.042  38.824   97.275  1.00 12.71 ? 204 VAL D CB  1 
ATOM   9809  C CG1 . VAL D 1 123 ? 23.938  38.398   96.330  1.00 13.14 ? 204 VAL D CG1 1 
ATOM   9810  C CG2 . VAL D 1 123 ? 25.519  37.659   98.124  1.00 12.91 ? 204 VAL D CG2 1 
ATOM   9811  N N   . LEU D 1 124 ? 26.100  40.502   94.326  1.00 16.25 ? 205 LEU D N   1 
ATOM   9812  C CA  . LEU D 1 124 ? 25.639  41.520   93.384  1.00 16.95 ? 205 LEU D CA  1 
ATOM   9813  C C   . LEU D 1 124 ? 24.328  41.065   92.753  1.00 17.35 ? 205 LEU D C   1 
ATOM   9814  O O   . LEU D 1 124 ? 24.179  39.903   92.382  1.00 19.46 ? 205 LEU D O   1 
ATOM   9815  C CB  . LEU D 1 124 ? 26.679  41.766   92.271  1.00 16.78 ? 205 LEU D CB  1 
ATOM   9816  C CG  . LEU D 1 124 ? 28.175  41.850   92.622  1.00 18.96 ? 205 LEU D CG  1 
ATOM   9817  C CD1 . LEU D 1 124 ? 28.907  42.578   91.506  1.00 18.74 ? 205 LEU D CD1 1 
ATOM   9818  C CD2 . LEU D 1 124 ? 28.388  42.587   93.934  1.00 21.94 ? 205 LEU D CD2 1 
ATOM   9819  N N   . LYS D 1 125 ? 23.373  41.980   92.643  1.00 18.00 ? 206 LYS D N   1 
ATOM   9820  C CA  . LYS D 1 125 ? 22.086  41.669   92.031  1.00 17.42 ? 206 LYS D CA  1 
ATOM   9821  C C   . LYS D 1 125 ? 21.738  42.686   90.946  1.00 17.75 ? 206 LYS D C   1 
ATOM   9822  O O   . LYS D 1 125 ? 22.010  43.880   91.072  1.00 17.50 ? 206 LYS D O   1 
ATOM   9823  C CB  . LYS D 1 125 ? 20.961  41.658   93.076  1.00 16.59 ? 206 LYS D CB  1 
ATOM   9824  C CG  . LYS D 1 125 ? 20.905  40.426   93.974  1.00 16.93 ? 206 LYS D CG  1 
ATOM   9825  C CD  . LYS D 1 125 ? 19.705  40.513   94.900  1.00 16.67 ? 206 LYS D CD  1 
ATOM   9826  C CE  . LYS D 1 125 ? 19.700  39.408   95.944  1.00 17.08 ? 206 LYS D CE  1 
ATOM   9827  N NZ  . LYS D 1 125 ? 18.564  39.534   96.887  1.00 14.23 ? 206 LYS D NZ  1 
ATOM   9828  N N   . TYR D 1 126 ? 21.141  42.196   89.872  1.00 17.78 ? 207 TYR D N   1 
ATOM   9829  C CA  . TYR D 1 126 ? 20.726  43.053   88.782  1.00 17.70 ? 207 TYR D CA  1 
ATOM   9830  C C   . TYR D 1 126 ? 19.243  42.764   88.600  1.00 18.32 ? 207 TYR D C   1 
ATOM   9831  O O   . TYR D 1 126 ? 18.861  41.640   88.259  1.00 19.31 ? 207 TYR D O   1 
ATOM   9832  C CB  . TYR D 1 126 ? 21.510  42.709   87.514  1.00 16.44 ? 207 TYR D CB  1 
ATOM   9833  C CG  . TYR D 1 126 ? 21.399  43.737   86.405  1.00 15.36 ? 207 TYR D CG  1 
ATOM   9834  C CD1 . TYR D 1 126 ? 20.780  43.422   85.198  1.00 15.22 ? 207 TYR D CD1 1 
ATOM   9835  C CD2 . TYR D 1 126 ? 21.952  45.005   86.548  1.00 14.46 ? 207 TYR D CD2 1 
ATOM   9836  C CE1 . TYR D 1 126 ? 20.723  44.338   84.155  1.00 14.87 ? 207 TYR D CE1 1 
ATOM   9837  C CE2 . TYR D 1 126 ? 21.899  45.930   85.519  1.00 14.63 ? 207 TYR D CE2 1 
ATOM   9838  C CZ  . TYR D 1 126 ? 21.286  45.588   84.321  1.00 16.34 ? 207 TYR D CZ  1 
ATOM   9839  O OH  . TYR D 1 126 ? 21.257  46.484   83.280  1.00 16.58 ? 207 TYR D OH  1 
ATOM   9840  N N   . ASN D 1 127 ? 18.411  43.772   88.851  1.00 19.06 ? 208 ASN D N   1 
ATOM   9841  C CA  . ASN D 1 127 ? 16.960  43.634   88.736  1.00 20.02 ? 208 ASN D CA  1 
ATOM   9842  C C   . ASN D 1 127 ? 16.397  42.633   89.748  1.00 19.41 ? 208 ASN D C   1 
ATOM   9843  O O   . ASN D 1 127 ? 15.347  42.033   89.518  1.00 17.40 ? 208 ASN D O   1 
ATOM   9844  C CB  . ASN D 1 127 ? 16.566  43.180   87.329  1.00 21.68 ? 208 ASN D CB  1 
ATOM   9845  C CG  . ASN D 1 127 ? 15.112  43.488   87.004  1.00 25.17 ? 208 ASN D CG  1 
ATOM   9846  O OD1 . ASN D 1 127 ? 14.240  43.420   87.867  1.00 25.97 ? 208 ASN D OD1 1 
ATOM   9847  N ND2 . ASN D 1 127 ? 14.848  43.829   85.750  1.00 28.41 ? 208 ASN D ND2 1 
ATOM   9848  N N   . GLY D 1 128 ? 17.106  42.436   90.857  1.00 20.33 ? 209 GLY D N   1 
ATOM   9849  C CA  . GLY D 1 128 ? 16.625  41.520   91.882  1.00 21.26 ? 209 GLY D CA  1 
ATOM   9850  C C   . GLY D 1 128 ? 17.145  40.090   91.844  1.00 21.87 ? 209 GLY D C   1 
ATOM   9851  O O   . GLY D 1 128 ? 17.005  39.346   92.827  1.00 22.39 ? 209 GLY D O   1 
ATOM   9852  N N   . ILE D 1 129 ? 17.736  39.690   90.721  1.00 20.54 ? 210 ILE D N   1 
ATOM   9853  C CA  . ILE D 1 129 ? 18.266  38.340   90.609  1.00 19.24 ? 210 ILE D CA  1 
ATOM   9854  C C   . ILE D 1 129 ? 19.788  38.364   90.702  1.00 16.63 ? 210 ILE D C   1 
ATOM   9855  O O   . ILE D 1 129 ? 20.443  39.218   90.103  1.00 14.77 ? 210 ILE D O   1 
ATOM   9856  C CB  . ILE D 1 129 ? 17.808  37.678   89.282  1.00 21.18 ? 210 ILE D CB  1 
ATOM   9857  C CG1 . ILE D 1 129 ? 18.306  38.485   88.097  1.00 23.87 ? 210 ILE D CG1 1 
ATOM   9858  C CG2 . ILE D 1 129 ? 16.271  37.621   89.230  1.00 21.23 ? 210 ILE D CG2 1 
ATOM   9859  C CD1 . ILE D 1 129 ? 17.426  38.360   86.857  1.00 29.21 ? 210 ILE D CD1 1 
ATOM   9860  N N   . ILE D 1 130 ? 20.337  37.439   91.491  1.00 15.71 ? 211 ILE D N   1 
ATOM   9861  C CA  . ILE D 1 130 ? 21.784  37.307   91.690  1.00 13.63 ? 211 ILE D CA  1 
ATOM   9862  C C   . ILE D 1 130 ? 22.512  37.110   90.356  1.00 13.82 ? 211 ILE D C   1 
ATOM   9863  O O   . ILE D 1 130 ? 22.143  36.250   89.562  1.00 10.80 ? 211 ILE D O   1 
ATOM   9864  C CB  . ILE D 1 130 ? 22.089  36.121   92.626  1.00 12.16 ? 211 ILE D CB  1 
ATOM   9865  C CG1 . ILE D 1 130 ? 21.652  36.475   94.052  1.00 14.53 ? 211 ILE D CG1 1 
ATOM   9866  C CG2 . ILE D 1 130 ? 23.555  35.770   92.566  1.00 12.58 ? 211 ILE D CG2 1 
ATOM   9867  C CD1 . ILE D 1 130 ? 21.693  35.318   95.052  1.00 13.61 ? 211 ILE D CD1 1 
ATOM   9868  N N   . THR D 1 131 ? 23.547  37.916   90.125  1.00 14.80 ? 212 THR D N   1 
ATOM   9869  C CA  . THR D 1 131 ? 24.319  37.858   88.884  1.00 15.53 ? 212 THR D CA  1 
ATOM   9870  C C   . THR D 1 131 ? 25.813  37.606   89.078  1.00 16.97 ? 212 THR D C   1 
ATOM   9871  O O   . THR D 1 131 ? 26.517  37.279   88.122  1.00 17.32 ? 212 THR D O   1 
ATOM   9872  C CB  . THR D 1 131 ? 24.180  39.171   88.074  1.00 14.93 ? 212 THR D CB  1 
ATOM   9873  O OG1 . THR D 1 131 ? 24.372  40.286   88.953  1.00 13.54 ? 212 THR D OG1 1 
ATOM   9874  C CG2 . THR D 1 131 ? 22.814  39.257   87.398  1.00 12.60 ? 212 THR D CG2 1 
ATOM   9875  N N   . ASP D 1 132 ? 26.305  37.795   90.298  1.00 18.59 ? 213 ASP D N   1 
ATOM   9876  C CA  . ASP D 1 132 ? 27.716  37.569   90.573  1.00 19.30 ? 213 ASP D CA  1 
ATOM   9877  C C   . ASP D 1 132 ? 27.978  37.561   92.071  1.00 20.68 ? 213 ASP D C   1 
ATOM   9878  O O   . ASP D 1 132 ? 27.119  37.962   92.867  1.00 21.35 ? 213 ASP D O   1 
ATOM   9879  C CB  . ASP D 1 132 ? 28.581  38.642   89.905  1.00 21.45 ? 213 ASP D CB  1 
ATOM   9880  C CG  . ASP D 1 132 ? 29.978  38.121   89.528  1.00 25.07 ? 213 ASP D CG  1 
ATOM   9881  O OD1 . ASP D 1 132 ? 30.300  36.956   89.881  1.00 25.43 ? 213 ASP D OD1 1 
ATOM   9882  O OD2 . ASP D 1 132 ? 30.751  38.870   88.878  1.00 25.55 ? 213 ASP D OD2 1 
ATOM   9883  N N   . THR D 1 133 ? 29.171  37.106   92.448  1.00 20.88 ? 214 THR D N   1 
ATOM   9884  C CA  . THR D 1 133 ? 29.571  37.027   93.843  1.00 19.95 ? 214 THR D CA  1 
ATOM   9885  C C   . THR D 1 133 ? 31.036  37.387   93.986  1.00 19.15 ? 214 THR D C   1 
ATOM   9886  O O   . THR D 1 133 ? 31.829  37.126   93.088  1.00 20.65 ? 214 THR D O   1 
ATOM   9887  C CB  . THR D 1 133 ? 29.367  35.601   94.391  1.00 21.44 ? 214 THR D CB  1 
ATOM   9888  O OG1 . THR D 1 133 ? 27.985  35.390   94.686  1.00 22.16 ? 214 THR D OG1 1 
ATOM   9889  C CG2 . THR D 1 133 ? 30.165  35.398   95.638  1.00 21.85 ? 214 THR D CG2 1 
ATOM   9890  N N   . ILE D 1 134 ? 31.392  37.979   95.121  1.00 18.27 ? 215 ILE D N   1 
ATOM   9891  C CA  . ILE D 1 134 ? 32.770  38.361   95.393  1.00 16.86 ? 215 ILE D CA  1 
ATOM   9892  C C   . ILE D 1 134 ? 33.121  38.017   96.838  1.00 17.98 ? 215 ILE D C   1 
ATOM   9893  O O   . ILE D 1 134 ? 32.531  38.566   97.770  1.00 17.16 ? 215 ILE D O   1 
ATOM   9894  C CB  . ILE D 1 134 ? 32.981  39.865   95.216  1.00 17.06 ? 215 ILE D CB  1 
ATOM   9895  C CG1 . ILE D 1 134 ? 32.584  40.302   93.808  1.00 15.85 ? 215 ILE D CG1 1 
ATOM   9896  C CG2 . ILE D 1 134 ? 34.438  40.202   95.451  1.00 17.05 ? 215 ILE D CG2 1 
ATOM   9897  C CD1 . ILE D 1 134 ? 32.561  41.795   93.650  1.00 14.67 ? 215 ILE D CD1 1 
ATOM   9898  N N   . LYS D 1 135 ? 34.076  37.104   97.016  1.00 18.92 ? 216 LYS D N   1 
ATOM   9899  C CA  . LYS D 1 135 ? 34.519  36.690   98.344  1.00 20.59 ? 216 LYS D CA  1 
ATOM   9900  C C   . LYS D 1 135 ? 35.727  37.492   98.803  1.00 19.63 ? 216 LYS D C   1 
ATOM   9901  O O   . LYS D 1 135 ? 36.503  38.013   97.998  1.00 18.12 ? 216 LYS D O   1 
ATOM   9902  C CB  . LYS D 1 135 ? 34.870  35.196   98.366  1.00 24.01 ? 216 LYS D CB  1 
ATOM   9903  C CG  . LYS D 1 135 ? 35.707  34.744   97.148  1.00 31.95 ? 216 LYS D CG  1 
ATOM   9904  C CD  . LYS D 1 135 ? 36.027  33.232   97.155  1.00 34.14 ? 216 LYS D CD  1 
ATOM   9905  C CE  . LYS D 1 135 ? 36.367  32.701   95.737  1.00 36.00 ? 216 LYS D CE  1 
ATOM   9906  N NZ  . LYS D 1 135 ? 35.182  32.534   94.815  1.00 33.18 ? 216 LYS D NZ  1 
ATOM   9907  N N   . SER D 1 136 ? 35.868  37.575   100.117 1.00 19.15 ? 217 SER D N   1 
ATOM   9908  C CA  . SER D 1 136 ? 36.955  38.292   100.751 1.00 18.96 ? 217 SER D CA  1 
ATOM   9909  C C   . SER D 1 136 ? 38.307  37.717   100.323 1.00 19.04 ? 217 SER D C   1 
ATOM   9910  O O   . SER D 1 136 ? 38.520  36.508   100.377 1.00 18.67 ? 217 SER D O   1 
ATOM   9911  C CB  . SER D 1 136 ? 36.793  38.195   102.267 1.00 17.28 ? 217 SER D CB  1 
ATOM   9912  O OG  . SER D 1 136 ? 37.869  38.818   102.932 1.00 17.63 ? 217 SER D OG  1 
ATOM   9913  N N   . TRP D 1 137 ? 39.217  38.588   99.902  1.00 17.99 ? 218 TRP D N   1 
ATOM   9914  C CA  . TRP D 1 137 ? 40.540  38.147   99.476  1.00 18.87 ? 218 TRP D CA  1 
ATOM   9915  C C   . TRP D 1 137 ? 41.607  38.327   100.565 1.00 19.42 ? 218 TRP D C   1 
ATOM   9916  O O   . TRP D 1 137 ? 42.706  37.786   100.441 1.00 18.69 ? 218 TRP D O   1 
ATOM   9917  C CB  . TRP D 1 137 ? 40.946  38.875   98.184  1.00 18.09 ? 218 TRP D CB  1 
ATOM   9918  C CG  . TRP D 1 137 ? 41.058  40.363   98.324  1.00 20.63 ? 218 TRP D CG  1 
ATOM   9919  C CD1 . TRP D 1 137 ? 42.158  41.063   98.712  1.00 21.27 ? 218 TRP D CD1 1 
ATOM   9920  C CD2 . TRP D 1 137 ? 40.028  41.333   98.082  1.00 19.90 ? 218 TRP D CD2 1 
ATOM   9921  N NE1 . TRP D 1 137 ? 41.884  42.410   98.722  1.00 22.91 ? 218 TRP D NE1 1 
ATOM   9922  C CE2 . TRP D 1 137 ? 40.584  42.604   98.338  1.00 20.50 ? 218 TRP D CE2 1 
ATOM   9923  C CE3 . TRP D 1 137 ? 38.689  41.249   97.668  1.00 21.71 ? 218 TRP D CE3 1 
ATOM   9924  C CZ2 . TRP D 1 137 ? 39.850  43.790   98.197  1.00 20.20 ? 218 TRP D CZ2 1 
ATOM   9925  C CZ3 . TRP D 1 137 ? 37.956  42.428   97.525  1.00 20.13 ? 218 TRP D CZ3 1 
ATOM   9926  C CH2 . TRP D 1 137 ? 38.544  43.683   97.791  1.00 20.41 ? 218 TRP D CH2 1 
ATOM   9927  N N   . ARG D 1 138 ? 41.275  39.071   101.626 1.00 20.81 ? 219 ARG D N   1 
ATOM   9928  C CA  . ARG D 1 138 ? 42.191  39.302   102.750 1.00 22.58 ? 219 ARG D CA  1 
ATOM   9929  C C   . ARG D 1 138 ? 41.617  38.791   104.077 1.00 22.58 ? 219 ARG D C   1 
ATOM   9930  O O   . ARG D 1 138 ? 42.200  39.005   105.147 1.00 22.48 ? 219 ARG D O   1 
ATOM   9931  C CB  . ARG D 1 138 ? 42.531  40.793   102.875 1.00 25.52 ? 219 ARG D CB  1 
ATOM   9932  C CG  . ARG D 1 138 ? 43.517  41.301   101.825 1.00 29.16 ? 219 ARG D CG  1 
ATOM   9933  C CD  . ARG D 1 138 ? 44.874  40.638   101.994 1.00 33.08 ? 219 ARG D CD  1 
ATOM   9934  N NE  . ARG D 1 138 ? 45.762  40.933   100.874 1.00 40.29 ? 219 ARG D NE  1 
ATOM   9935  C CZ  . ARG D 1 138 ? 46.854  40.228   100.577 1.00 45.22 ? 219 ARG D CZ  1 
ATOM   9936  N NH1 . ARG D 1 138 ? 47.202  39.181   101.321 1.00 48.42 ? 219 ARG D NH1 1 
ATOM   9937  N NH2 . ARG D 1 138 ? 47.590  40.551   99.522  1.00 46.56 ? 219 ARG D NH2 1 
ATOM   9938  N N   . ASN D 1 139 ? 40.476  38.110   103.994 1.00 21.89 ? 220 ASN D N   1 
ATOM   9939  C CA  . ASN D 1 139 ? 39.804  37.530   105.157 1.00 22.14 ? 220 ASN D CA  1 
ATOM   9940  C C   . ASN D 1 139 ? 39.681  38.458   106.357 1.00 21.37 ? 220 ASN D C   1 
ATOM   9941  O O   . ASN D 1 139 ? 39.798  38.013   107.504 1.00 20.65 ? 220 ASN D O   1 
ATOM   9942  C CB  . ASN D 1 139 ? 40.523  36.253   105.625 1.00 23.15 ? 220 ASN D CB  1 
ATOM   9943  C CG  . ASN D 1 139 ? 40.463  35.124   104.604 1.00 24.80 ? 220 ASN D CG  1 
ATOM   9944  O OD1 . ASN D 1 139 ? 39.582  35.074   103.742 1.00 25.54 ? 220 ASN D OD1 1 
ATOM   9945  N ND2 . ASN D 1 139 ? 41.401  34.194   104.719 1.00 27.87 ? 220 ASN D ND2 1 
ATOM   9946  N N   . ASN D 1 140 ? 39.428  39.735   106.114 1.00 20.30 ? 221 ASN D N   1 
ATOM   9947  C CA  . ASN D 1 140 ? 39.321  40.664   107.223 1.00 19.32 ? 221 ASN D CA  1 
ATOM   9948  C C   . ASN D 1 140 ? 38.271  41.740   106.967 1.00 17.46 ? 221 ASN D C   1 
ATOM   9949  O O   . ASN D 1 140 ? 38.598  42.898   106.682 1.00 17.99 ? 221 ASN D O   1 
ATOM   9950  C CB  . ASN D 1 140 ? 40.695  41.293   107.495 1.00 19.61 ? 221 ASN D CB  1 
ATOM   9951  C CG  . ASN D 1 140 ? 40.709  42.143   108.746 1.00 19.87 ? 221 ASN D CG  1 
ATOM   9952  O OD1 . ASN D 1 140 ? 39.773  42.099   109.543 1.00 20.91 ? 221 ASN D OD1 1 
ATOM   9953  N ND2 . ASN D 1 140 ? 41.777  42.917   108.931 1.00 20.60 ? 221 ASN D ND2 1 
ATOM   9954  N N   . ILE D 1 141 ? 37.011  41.327   107.071 1.00 15.02 ? 222 ILE D N   1 
ATOM   9955  C CA  . ILE D 1 141 ? 35.847  42.187   106.875 1.00 13.20 ? 222 ILE D CA  1 
ATOM   9956  C C   . ILE D 1 141 ? 35.745  42.863   105.494 1.00 12.97 ? 222 ILE D C   1 
ATOM   9957  O O   . ILE D 1 141 ? 36.047  44.044   105.328 1.00 12.06 ? 222 ILE D O   1 
ATOM   9958  C CB  . ILE D 1 141 ? 35.760  43.278   107.980 1.00 12.18 ? 222 ILE D CB  1 
ATOM   9959  C CG1 . ILE D 1 141 ? 35.881  42.638   109.375 1.00 12.21 ? 222 ILE D CG1 1 
ATOM   9960  C CG2 . ILE D 1 141 ? 34.427  44.024   107.865 1.00 10.53 ? 222 ILE D CG2 1 
ATOM   9961  C CD1 . ILE D 1 141 ? 35.857  43.632   110.554 1.00 5.92  ? 222 ILE D CD1 1 
ATOM   9962  N N   . LEU D 1 142 ? 35.327  42.104   104.491 1.00 13.37 ? 223 LEU D N   1 
ATOM   9963  C CA  . LEU D 1 142 ? 35.160  42.679   103.171 1.00 13.69 ? 223 LEU D CA  1 
ATOM   9964  C C   . LEU D 1 142 ? 34.052  43.731   103.336 1.00 14.43 ? 223 LEU D C   1 
ATOM   9965  O O   . LEU D 1 142 ? 32.971  43.432   103.838 1.00 15.29 ? 223 LEU D O   1 
ATOM   9966  C CB  . LEU D 1 142 ? 34.744  41.596   102.170 1.00 13.05 ? 223 LEU D CB  1 
ATOM   9967  C CG  . LEU D 1 142 ? 34.412  42.063   100.745 1.00 14.75 ? 223 LEU D CG  1 
ATOM   9968  C CD1 . LEU D 1 142 ? 35.576  42.831   100.138 1.00 14.92 ? 223 LEU D CD1 1 
ATOM   9969  C CD2 . LEU D 1 142 ? 34.066  40.857   99.891  1.00 15.47 ? 223 LEU D CD2 1 
ATOM   9970  N N   . ARG D 1 143 ? 34.332  44.964   102.931 1.00 15.00 ? 224 ARG D N   1 
ATOM   9971  C CA  . ARG D 1 143 ? 33.365  46.051   103.063 1.00 15.56 ? 224 ARG D CA  1 
ATOM   9972  C C   . ARG D 1 143 ? 33.308  46.931   101.820 1.00 15.54 ? 224 ARG D C   1 
ATOM   9973  O O   . ARG D 1 143 ? 34.202  46.871   100.975 1.00 16.72 ? 224 ARG D O   1 
ATOM   9974  C CB  . ARG D 1 143 ? 33.716  46.901   104.287 1.00 15.80 ? 224 ARG D CB  1 
ATOM   9975  C CG  . ARG D 1 143 ? 35.216  47.147   104.499 1.00 14.21 ? 224 ARG D CG  1 
ATOM   9976  C CD  . ARG D 1 143 ? 35.441  47.761   105.882 1.00 13.39 ? 224 ARG D CD  1 
ATOM   9977  N NE  . ARG D 1 143 ? 36.836  48.069   106.156 1.00 10.89 ? 224 ARG D NE  1 
ATOM   9978  C CZ  . ARG D 1 143 ? 37.776  47.153   106.350 1.00 12.81 ? 224 ARG D CZ  1 
ATOM   9979  N NH1 . ARG D 1 143 ? 39.024  47.523   106.593 1.00 13.85 ? 224 ARG D NH1 1 
ATOM   9980  N NH2 . ARG D 1 143 ? 37.473  45.864   106.309 1.00 14.86 ? 224 ARG D NH2 1 
ATOM   9981  N N   . THR D 1 144 ? 32.270  47.758   101.716 1.00 14.68 ? 225 THR D N   1 
ATOM   9982  C CA  . THR D 1 144 ? 32.127  48.614   100.553 1.00 13.43 ? 225 THR D CA  1 
ATOM   9983  C C   . THR D 1 144 ? 31.672  50.055   100.839 1.00 12.88 ? 225 THR D C   1 
ATOM   9984  O O   . THR D 1 144 ? 31.787  50.539   101.956 1.00 12.98 ? 225 THR D O   1 
ATOM   9985  C CB  . THR D 1 144 ? 31.197  47.935   99.513  1.00 15.23 ? 225 THR D CB  1 
ATOM   9986  O OG1 . THR D 1 144 ? 31.349  48.573   98.240  1.00 16.91 ? 225 THR D OG1 1 
ATOM   9987  C CG2 . THR D 1 144 ? 29.742  48.007   99.954  1.00 15.82 ? 225 THR D CG2 1 
ATOM   9988  N N   . GLN D 1 145 ? 31.151  50.724   99.815  1.00 13.26 ? 226 GLN D N   1 
ATOM   9989  C CA  . GLN D 1 145 ? 30.750  52.130   99.879  1.00 14.72 ? 226 GLN D CA  1 
ATOM   9990  C C   . GLN D 1 145 ? 29.834  52.699   100.947 1.00 15.58 ? 226 GLN D C   1 
ATOM   9991  O O   . GLN D 1 145 ? 30.167  53.708   101.569 1.00 14.11 ? 226 GLN D O   1 
ATOM   9992  C CB  . GLN D 1 145 ? 30.186  52.564   98.521  1.00 14.81 ? 226 GLN D CB  1 
ATOM   9993  C CG  . GLN D 1 145 ? 31.220  52.624   97.411  1.00 16.25 ? 226 GLN D CG  1 
ATOM   9994  C CD  . GLN D 1 145 ? 30.651  53.173   96.111  1.00 18.59 ? 226 GLN D CD  1 
ATOM   9995  O OE1 . GLN D 1 145 ? 30.329  54.360   96.011  1.00 20.15 ? 226 GLN D OE1 1 
ATOM   9996  N NE2 . GLN D 1 145 ? 30.521  52.308   95.107  1.00 17.19 ? 226 GLN D NE2 1 
ATOM   9997  N N   . GLU D 1 146 ? 28.677  52.071   101.134 1.00 16.39 ? 227 GLU D N   1 
ATOM   9998  C CA  . GLU D 1 146 ? 27.669  52.547   102.067 1.00 16.40 ? 227 GLU D CA  1 
ATOM   9999  C C   . GLU D 1 146 ? 27.074  53.799   101.414 1.00 15.97 ? 227 GLU D C   1 
ATOM   10000 O O   . GLU D 1 146 ? 26.578  54.698   102.080 1.00 15.64 ? 227 GLU D O   1 
ATOM   10001 C CB  . GLU D 1 146 ? 28.275  52.867   103.441 1.00 17.00 ? 227 GLU D CB  1 
ATOM   10002 C CG  . GLU D 1 146 ? 29.205  51.785   103.973 1.00 18.36 ? 227 GLU D CG  1 
ATOM   10003 C CD  . GLU D 1 146 ? 28.523  50.444   104.185 1.00 18.73 ? 227 GLU D CD  1 
ATOM   10004 O OE1 . GLU D 1 146 ? 27.677  50.057   103.359 1.00 19.23 ? 227 GLU D OE1 1 
ATOM   10005 O OE2 . GLU D 1 146 ? 28.847  49.763   105.179 1.00 21.45 ? 227 GLU D OE2 1 
ATOM   10006 N N   . SER D 1 147 ? 27.169  53.838   100.089 1.00 17.26 ? 228 SER D N   1 
ATOM   10007 C CA  . SER D 1 147 ? 26.618  54.909   99.249  1.00 19.29 ? 228 SER D CA  1 
ATOM   10008 C C   . SER D 1 147 ? 26.547  54.369   97.814  1.00 19.33 ? 228 SER D C   1 
ATOM   10009 O O   . SER D 1 147 ? 27.125  53.323   97.514  1.00 20.82 ? 228 SER D O   1 
ATOM   10010 C CB  . SER D 1 147 ? 27.456  56.204   99.323  1.00 19.92 ? 228 SER D CB  1 
ATOM   10011 O OG  . SER D 1 147 ? 28.649  56.154   98.567  1.00 22.54 ? 228 SER D OG  1 
ATOM   10012 N N   . GLU D 1 148 ? 25.844  55.063   96.930  1.00 19.51 ? 229 GLU D N   1 
ATOM   10013 C CA  . GLU D 1 148 ? 25.676  54.587   95.556  1.00 19.47 ? 229 GLU D CA  1 
ATOM   10014 C C   . GLU D 1 148 ? 26.961  54.343   94.758  1.00 19.54 ? 229 GLU D C   1 
ATOM   10015 O O   . GLU D 1 148 ? 28.007  54.915   95.041  1.00 19.61 ? 229 GLU D O   1 
ATOM   10016 C CB  . GLU D 1 148 ? 24.812  55.567   94.762  1.00 18.77 ? 229 GLU D CB  1 
ATOM   10017 C CG  . GLU D 1 148 ? 25.616  56.745   94.236  1.00 19.45 ? 229 GLU D CG  1 
ATOM   10018 C CD  . GLU D 1 148 ? 24.806  57.712   93.390  1.00 21.76 ? 229 GLU D CD  1 
ATOM   10019 O OE1 . GLU D 1 148 ? 25.364  58.773   93.022  1.00 22.06 ? 229 GLU D OE1 1 
ATOM   10020 O OE2 . GLU D 1 148 ? 23.624  57.419   93.092  1.00 20.97 ? 229 GLU D OE2 1 
ATOM   10021 N N   . CYS D 1 149 ? 26.871  53.473   93.759  1.00 19.23 ? 230 CYS D N   1 
ATOM   10022 C CA  . CYS D 1 149 ? 28.007  53.237   92.897  1.00 19.07 ? 230 CYS D CA  1 
ATOM   10023 C C   . CYS D 1 149 ? 27.811  54.188   91.718  1.00 19.82 ? 230 CYS D C   1 
ATOM   10024 O O   . CYS D 1 149 ? 26.810  54.912   91.655  1.00 19.08 ? 230 CYS D O   1 
ATOM   10025 C CB  . CYS D 1 149 ? 28.089  51.774   92.429  1.00 18.64 ? 230 CYS D CB  1 
ATOM   10026 S SG  . CYS D 1 149 ? 26.558  50.787   92.318  1.00 19.62 ? 230 CYS D SG  1 
ATOM   10027 N N   . ALA D 1 150 ? 28.754  54.212   90.788  1.00 18.57 ? 231 ALA D N   1 
ATOM   10028 C CA  . ALA D 1 150 ? 28.616  55.116   89.662  1.00 18.73 ? 231 ALA D CA  1 
ATOM   10029 C C   . ALA D 1 150 ? 28.579  54.375   88.334  1.00 17.38 ? 231 ALA D C   1 
ATOM   10030 O O   . ALA D 1 150 ? 29.398  53.491   88.098  1.00 15.52 ? 231 ALA D O   1 
ATOM   10031 C CB  . ALA D 1 150 ? 29.759  56.130   89.679  1.00 20.27 ? 231 ALA D CB  1 
ATOM   10032 N N   . CYS D 1 151 ? 27.630  54.719   87.466  1.00 16.46 ? 232 CYS D N   1 
ATOM   10033 C CA  . CYS D 1 151 ? 27.571  54.033   86.180  1.00 17.95 ? 232 CYS D CA  1 
ATOM   10034 C C   . CYS D 1 151 ? 27.845  54.981   85.032  1.00 16.91 ? 232 CYS D C   1 
ATOM   10035 O O   . CYS D 1 151 ? 27.485  56.154   85.075  1.00 17.64 ? 232 CYS D O   1 
ATOM   10036 C CB  . CYS D 1 151 ? 26.216  53.349   85.968  1.00 18.36 ? 232 CYS D CB  1 
ATOM   10037 S SG  . CYS D 1 151 ? 25.641  52.278   87.336  1.00 25.17 ? 232 CYS D SG  1 
ATOM   10038 N N   . VAL D 1 152 ? 28.507  54.459   84.009  1.00 16.76 ? 233 VAL D N   1 
ATOM   10039 C CA  . VAL D 1 152 ? 28.840  55.226   82.818  1.00 16.36 ? 233 VAL D CA  1 
ATOM   10040 C C   . VAL D 1 152 ? 28.723  54.277   81.636  1.00 16.76 ? 233 VAL D C   1 
ATOM   10041 O O   . VAL D 1 152 ? 29.044  53.098   81.758  1.00 16.31 ? 233 VAL D O   1 
ATOM   10042 C CB  . VAL D 1 152 ? 30.295  55.773   82.878  1.00 16.31 ? 233 VAL D CB  1 
ATOM   10043 C CG1 . VAL D 1 152 ? 30.617  56.553   81.613  1.00 16.82 ? 233 VAL D CG1 1 
ATOM   10044 C CG2 . VAL D 1 152 ? 30.469  56.658   84.092  1.00 15.55 ? 233 VAL D CG2 1 
ATOM   10045 N N   . ASN D 1 153 ? 28.232  54.791   80.513  1.00 17.39 ? 234 ASN D N   1 
ATOM   10046 C CA  . ASN D 1 153 ? 28.092  54.031   79.275  1.00 19.15 ? 234 ASN D CA  1 
ATOM   10047 C C   . ASN D 1 153 ? 27.801  52.527   79.458  1.00 19.99 ? 234 ASN D C   1 
ATOM   10048 O O   . ASN D 1 153 ? 28.485  51.676   78.886  1.00 19.07 ? 234 ASN D O   1 
ATOM   10049 C CB  . ASN D 1 153 ? 29.363  54.239   78.426  1.00 21.18 ? 234 ASN D CB  1 
ATOM   10050 C CG  . ASN D 1 153 ? 29.210  53.737   76.986  1.00 24.95 ? 234 ASN D CG  1 
ATOM   10051 O OD1 . ASN D 1 153 ? 28.142  53.872   76.376  1.00 24.10 ? 234 ASN D OD1 1 
ATOM   10052 N ND2 . ASN D 1 153 ? 30.288  53.171   76.432  1.00 24.70 ? 234 ASN D ND2 1 
ATOM   10053 N N   . GLY D 1 154 ? 26.794  52.201   80.266  1.00 20.21 ? 235 GLY D N   1 
ATOM   10054 C CA  . GLY D 1 154 ? 26.442  50.806   80.471  1.00 19.28 ? 235 GLY D CA  1 
ATOM   10055 C C   . GLY D 1 154 ? 27.246  50.012   81.490  1.00 19.45 ? 235 GLY D C   1 
ATOM   10056 O O   . GLY D 1 154 ? 26.981  48.831   81.704  1.00 19.57 ? 235 GLY D O   1 
ATOM   10057 N N   . SER D 1 155 ? 28.227  50.638   82.125  1.00 19.08 ? 236 SER D N   1 
ATOM   10058 C CA  . SER D 1 155 ? 29.036  49.932   83.115  1.00 19.45 ? 236 SER D CA  1 
ATOM   10059 C C   . SER D 1 155 ? 28.961  50.640   84.459  1.00 19.23 ? 236 SER D C   1 
ATOM   10060 O O   . SER D 1 155 ? 28.887  51.863   84.520  1.00 19.25 ? 236 SER D O   1 
ATOM   10061 C CB  . SER D 1 155 ? 30.500  49.870   82.664  1.00 21.14 ? 236 SER D CB  1 
ATOM   10062 O OG  . SER D 1 155 ? 30.617  49.295   81.372  1.00 23.52 ? 236 SER D OG  1 
ATOM   10063 N N   . CYS D 1 156 ? 28.967  49.870   85.536  1.00 18.55 ? 237 CYS D N   1 
ATOM   10064 C CA  . CYS D 1 156 ? 28.924  50.454   86.865  1.00 18.68 ? 237 CYS D CA  1 
ATOM   10065 C C   . CYS D 1 156 ? 30.209  50.095   87.601  1.00 17.39 ? 237 CYS D C   1 
ATOM   10066 O O   . CYS D 1 156 ? 30.808  49.041   87.369  1.00 16.85 ? 237 CYS D O   1 
ATOM   10067 C CB  . CYS D 1 156 ? 27.694  49.964   87.636  1.00 20.49 ? 237 CYS D CB  1 
ATOM   10068 S SG  . CYS D 1 156 ? 26.097  50.346   86.833  1.00 24.04 ? 237 CYS D SG  1 
ATOM   10069 N N   . PHE D 1 157 ? 30.634  50.985   88.486  1.00 15.63 ? 238 PHE D N   1 
ATOM   10070 C CA  . PHE D 1 157 ? 31.863  50.781   89.217  1.00 14.93 ? 238 PHE D CA  1 
ATOM   10071 C C   . PHE D 1 157 ? 31.684  51.062   90.699  1.00 15.56 ? 238 PHE D C   1 
ATOM   10072 O O   . PHE D 1 157 ? 30.908  51.935   91.082  1.00 14.36 ? 238 PHE D O   1 
ATOM   10073 C CB  . PHE D 1 157 ? 32.949  51.695   88.650  1.00 15.25 ? 238 PHE D CB  1 
ATOM   10074 C CG  . PHE D 1 157 ? 33.037  51.692   87.142  1.00 14.32 ? 238 PHE D CG  1 
ATOM   10075 C CD1 . PHE D 1 157 ? 32.063  52.316   86.372  1.00 13.92 ? 238 PHE D CD1 1 
ATOM   10076 C CD2 . PHE D 1 157 ? 34.110  51.088   86.492  1.00 13.95 ? 238 PHE D CD2 1 
ATOM   10077 C CE1 . PHE D 1 157 ? 32.157  52.347   84.973  1.00 13.88 ? 238 PHE D CE1 1 
ATOM   10078 C CE2 . PHE D 1 157 ? 34.213  51.115   85.097  1.00 13.07 ? 238 PHE D CE2 1 
ATOM   10079 C CZ  . PHE D 1 157 ? 33.233  51.747   84.338  1.00 12.22 ? 238 PHE D CZ  1 
ATOM   10080 N N   . THR D 1 158 ? 32.422  50.321   91.524  1.00 15.58 ? 239 THR D N   1 
ATOM   10081 C CA  . THR D 1 158 ? 32.367  50.466   92.975  1.00 15.66 ? 239 THR D CA  1 
ATOM   10082 C C   . THR D 1 158 ? 33.758  50.213   93.571  1.00 16.13 ? 239 THR D C   1 
ATOM   10083 O O   . THR D 1 158 ? 34.667  49.790   92.864  1.00 15.65 ? 239 THR D O   1 
ATOM   10084 C CB  . THR D 1 158 ? 31.360  49.454   93.587  1.00 16.10 ? 239 THR D CB  1 
ATOM   10085 O OG1 . THR D 1 158 ? 31.260  49.669   94.995  1.00 18.09 ? 239 THR D OG1 1 
ATOM   10086 C CG2 . THR D 1 158 ? 31.823  48.017   93.358  1.00 15.18 ? 239 THR D CG2 1 
ATOM   10087 N N   . VAL D 1 159 ? 33.928  50.486   94.860  1.00 15.81 ? 240 VAL D N   1 
ATOM   10088 C CA  . VAL D 1 159 ? 35.208  50.245   95.514  1.00 17.03 ? 240 VAL D CA  1 
ATOM   10089 C C   . VAL D 1 159 ? 35.000  49.414   96.781  1.00 18.44 ? 240 VAL D C   1 
ATOM   10090 O O   . VAL D 1 159 ? 34.046  49.629   97.534  1.00 18.82 ? 240 VAL D O   1 
ATOM   10091 C CB  . VAL D 1 159 ? 35.909  51.550   95.941  1.00 17.46 ? 240 VAL D CB  1 
ATOM   10092 C CG1 . VAL D 1 159 ? 37.311  51.232   96.435  1.00 14.65 ? 240 VAL D CG1 1 
ATOM   10093 C CG2 . VAL D 1 159 ? 35.960  52.528   94.788  1.00 19.00 ? 240 VAL D CG2 1 
ATOM   10094 N N   . MET D 1 160 ? 35.893  48.464   97.021  1.00 18.29 ? 241 MET D N   1 
ATOM   10095 C CA  . MET D 1 160 ? 35.776  47.643   98.206  1.00 18.16 ? 241 MET D CA  1 
ATOM   10096 C C   . MET D 1 160 ? 37.105  47.590   98.925  1.00 18.86 ? 241 MET D C   1 
ATOM   10097 O O   . MET D 1 160 ? 38.161  47.857   98.342  1.00 19.34 ? 241 MET D O   1 
ATOM   10098 C CB  . MET D 1 160 ? 35.298  46.233   97.848  1.00 20.72 ? 241 MET D CB  1 
ATOM   10099 C CG  . MET D 1 160 ? 33.915  46.200   97.200  1.00 22.67 ? 241 MET D CG  1 
ATOM   10100 S SD  . MET D 1 160 ? 33.258  44.527   96.934  1.00 25.00 ? 241 MET D SD  1 
ATOM   10101 C CE  . MET D 1 160 ? 31.541  44.788   97.233  1.00 26.17 ? 241 MET D CE  1 
ATOM   10102 N N   . THR D 1 161 ? 37.039  47.245   100.202 1.00 17.74 ? 242 THR D N   1 
ATOM   10103 C CA  . THR D 1 161 ? 38.218  47.168   101.039 1.00 17.40 ? 242 THR D CA  1 
ATOM   10104 C C   . THR D 1 161 ? 38.251  45.852   101.793 1.00 17.81 ? 242 THR D C   1 
ATOM   10105 O O   . THR D 1 161 ? 37.212  45.262   102.084 1.00 20.00 ? 242 THR D O   1 
ATOM   10106 C CB  . THR D 1 161 ? 38.215  48.318   102.056 1.00 17.46 ? 242 THR D CB  1 
ATOM   10107 O OG1 . THR D 1 161 ? 38.181  49.559   101.349 1.00 16.45 ? 242 THR D OG1 1 
ATOM   10108 C CG2 . THR D 1 161 ? 39.449  48.274   102.944 1.00 16.86 ? 242 THR D CG2 1 
ATOM   10109 N N   . ASP D 1 162 ? 39.453  45.388   102.096 1.00 18.37 ? 243 ASP D N   1 
ATOM   10110 C CA  . ASP D 1 162 ? 39.633  44.157   102.844 1.00 17.96 ? 243 ASP D CA  1 
ATOM   10111 C C   . ASP D 1 162 ? 40.950  44.312   103.581 1.00 18.00 ? 243 ASP D C   1 
ATOM   10112 O O   . ASP D 1 162 ? 41.963  44.705   102.999 1.00 16.50 ? 243 ASP D O   1 
ATOM   10113 C CB  . ASP D 1 162 ? 39.670  42.949   101.896 1.00 19.83 ? 243 ASP D CB  1 
ATOM   10114 C CG  . ASP D 1 162 ? 39.281  41.639   102.589 1.00 20.80 ? 243 ASP D CG  1 
ATOM   10115 O OD1 . ASP D 1 162 ? 39.008  40.640   101.879 1.00 19.26 ? 243 ASP D OD1 1 
ATOM   10116 O OD2 . ASP D 1 162 ? 39.251  41.611   103.840 1.00 19.98 ? 243 ASP D OD2 1 
ATOM   10117 N N   . GLY D 1 163 ? 40.925  44.021   104.873 1.00 18.83 ? 244 GLY D N   1 
ATOM   10118 C CA  . GLY D 1 163 ? 42.123  44.151   105.667 1.00 18.79 ? 244 GLY D CA  1 
ATOM   10119 C C   . GLY D 1 163 ? 41.793  45.049   106.831 1.00 19.58 ? 244 GLY D C   1 
ATOM   10120 O O   . GLY D 1 163 ? 40.625  45.392   107.030 1.00 21.07 ? 244 GLY D O   1 
ATOM   10121 N N   . PRO D 1 164 ? 42.801  45.469   107.607 1.00 18.90 ? 245 PRO D N   1 
ATOM   10122 C CA  . PRO D 1 164 ? 42.676  46.335   108.783 1.00 19.06 ? 245 PRO D CA  1 
ATOM   10123 C C   . PRO D 1 164 ? 42.018  47.683   108.542 1.00 20.31 ? 245 PRO D C   1 
ATOM   10124 O O   . PRO D 1 164 ? 42.259  48.347   107.528 1.00 21.21 ? 245 PRO D O   1 
ATOM   10125 C CB  . PRO D 1 164 ? 44.122  46.528   109.236 1.00 18.44 ? 245 PRO D CB  1 
ATOM   10126 C CG  . PRO D 1 164 ? 44.839  45.345   108.673 1.00 17.68 ? 245 PRO D CG  1 
ATOM   10127 C CD  . PRO D 1 164 ? 44.216  45.198   107.317 1.00 17.85 ? 245 PRO D CD  1 
ATOM   10128 N N   . SER D 1 165 ? 41.181  48.085   109.484 1.00 20.57 ? 246 SER D N   1 
ATOM   10129 C CA  . SER D 1 165 ? 40.557  49.395   109.417 1.00 21.23 ? 246 SER D CA  1 
ATOM   10130 C C   . SER D 1 165 ? 41.535  50.163   110.302 1.00 22.03 ? 246 SER D C   1 
ATOM   10131 O O   . SER D 1 165 ? 41.335  51.326   110.643 1.00 23.52 ? 246 SER D O   1 
ATOM   10132 C CB  . SER D 1 165 ? 39.178  49.365   110.069 1.00 19.60 ? 246 SER D CB  1 
ATOM   10133 O OG  . SER D 1 165 ? 39.278  49.006   111.440 1.00 18.79 ? 246 SER D OG  1 
ATOM   10134 N N   . ASN D 1 166 ? 42.616  49.463   110.627 1.00 22.75 ? 247 ASN D N   1 
ATOM   10135 C CA  . ASN D 1 166 ? 43.674  49.921   111.515 1.00 23.12 ? 247 ASN D CA  1 
ATOM   10136 C C   . ASN D 1 166 ? 44.966  50.420   110.886 1.00 20.69 ? 247 ASN D C   1 
ATOM   10137 O O   . ASN D 1 166 ? 45.687  51.188   111.497 1.00 20.46 ? 247 ASN D O   1 
ATOM   10138 C CB  . ASN D 1 166 ? 44.026  48.776   112.471 1.00 24.23 ? 247 ASN D CB  1 
ATOM   10139 C CG  . ASN D 1 166 ? 43.999  49.214   113.886 1.00 26.77 ? 247 ASN D CG  1 
ATOM   10140 O OD1 . ASN D 1 166 ? 43.602  50.343   114.158 1.00 30.90 ? 247 ASN D OD1 1 
ATOM   10141 N ND2 . ASN D 1 166 ? 44.406  48.345   114.810 1.00 27.15 ? 247 ASN D ND2 1 
ATOM   10142 N N   . GLY D 1 167 ? 45.274  49.946   109.690 1.00 20.15 ? 248 GLY D N   1 
ATOM   10143 C CA  . GLY D 1 167 ? 46.500  50.346   109.023 1.00 19.18 ? 248 GLY D CA  1 
ATOM   10144 C C   . GLY D 1 167 ? 46.435  49.997   107.552 1.00 17.99 ? 248 GLY D C   1 
ATOM   10145 O O   . GLY D 1 167 ? 45.348  49.984   106.983 1.00 18.47 ? 248 GLY D O   1 
ATOM   10146 N N   . GLN D 1 168 ? 47.579  49.714   106.935 1.00 17.13 ? 249 GLN D N   1 
ATOM   10147 C CA  . GLN D 1 168 ? 47.614  49.377   105.508 1.00 16.25 ? 249 GLN D CA  1 
ATOM   10148 C C   . GLN D 1 168 ? 46.607  48.283   105.182 1.00 15.12 ? 249 GLN D C   1 
ATOM   10149 O O   . GLN D 1 168 ? 46.623  47.212   105.797 1.00 11.40 ? 249 GLN D O   1 
ATOM   10150 C CB  . GLN D 1 168 ? 49.003  48.882   105.095 1.00 16.20 ? 249 GLN D CB  1 
ATOM   10151 C CG  . GLN D 1 168 ? 49.687  49.686   103.990 1.00 22.17 ? 249 GLN D CG  1 
ATOM   10152 C CD  . GLN D 1 168 ? 48.777  50.030   102.815 1.00 23.82 ? 249 GLN D CD  1 
ATOM   10153 O OE1 . GLN D 1 168 ? 48.068  49.178   102.277 1.00 27.97 ? 249 GLN D OE1 1 
ATOM   10154 N NE2 . GLN D 1 168 ? 48.806  51.285   102.409 1.00 24.04 ? 249 GLN D NE2 1 
ATOM   10155 N N   . ALA D 1 169 ? 45.732  48.546   104.217 1.00 14.96 ? 250 ALA D N   1 
ATOM   10156 C CA  . ALA D 1 169 ? 44.749  47.539   103.829 1.00 14.93 ? 250 ALA D CA  1 
ATOM   10157 C C   . ALA D 1 169 ? 44.778  47.361   102.318 1.00 14.38 ? 250 ALA D C   1 
ATOM   10158 O O   . ALA D 1 169 ? 45.589  47.976   101.637 1.00 13.32 ? 250 ALA D O   1 
ATOM   10159 C CB  . ALA D 1 169 ? 43.353  47.940   104.305 1.00 14.21 ? 250 ALA D CB  1 
ATOM   10160 N N   . SER D 1 170 ? 43.895  46.513   101.802 1.00 14.97 ? 251 SER D N   1 
ATOM   10161 C CA  . SER D 1 170 ? 43.835  46.246   100.373 1.00 15.40 ? 251 SER D CA  1 
ATOM   10162 C C   . SER D 1 170 ? 42.576  46.835   99.746  1.00 16.17 ? 251 SER D C   1 
ATOM   10163 O O   . SER D 1 170 ? 41.464  46.574   100.202 1.00 15.43 ? 251 SER D O   1 
ATOM   10164 C CB  . SER D 1 170 ? 43.895  44.738   100.132 1.00 15.64 ? 251 SER D CB  1 
ATOM   10165 O OG  . SER D 1 170 ? 43.911  44.440   98.750  1.00 18.22 ? 251 SER D OG  1 
ATOM   10166 N N   . TYR D 1 171 ? 42.768  47.623   98.689  1.00 17.97 ? 252 TYR D N   1 
ATOM   10167 C CA  . TYR D 1 171 ? 41.665  48.288   97.993  1.00 18.09 ? 252 TYR D CA  1 
ATOM   10168 C C   . TYR D 1 171 ? 41.529  47.833   96.549  1.00 19.21 ? 252 TYR D C   1 
ATOM   10169 O O   . TYR D 1 171 ? 42.524  47.679   95.848  1.00 19.70 ? 252 TYR D O   1 
ATOM   10170 C CB  . TYR D 1 171 ? 41.887  49.800   98.027  1.00 16.87 ? 252 TYR D CB  1 
ATOM   10171 C CG  . TYR D 1 171 ? 42.627  50.228   99.260  1.00 16.55 ? 252 TYR D CG  1 
ATOM   10172 C CD1 . TYR D 1 171 ? 43.974  50.584   99.201  1.00 17.41 ? 252 TYR D CD1 1 
ATOM   10173 C CD2 . TYR D 1 171 ? 42.002  50.207   100.508 1.00 16.45 ? 252 TYR D CD2 1 
ATOM   10174 C CE1 . TYR D 1 171 ? 44.685  50.909   100.362 1.00 18.09 ? 252 TYR D CE1 1 
ATOM   10175 C CE2 . TYR D 1 171 ? 42.699  50.526   101.674 1.00 17.40 ? 252 TYR D CE2 1 
ATOM   10176 C CZ  . TYR D 1 171 ? 44.038  50.875   101.596 1.00 17.90 ? 252 TYR D CZ  1 
ATOM   10177 O OH  . TYR D 1 171 ? 44.719  51.182   102.752 1.00 17.10 ? 252 TYR D OH  1 
ATOM   10178 N N   . LYS D 1 172 ? 40.291  47.625   96.107  1.00 21.11 ? 253 LYS D N   1 
ATOM   10179 C CA  . LYS D 1 172 ? 40.033  47.192   94.735  1.00 21.88 ? 253 LYS D CA  1 
ATOM   10180 C C   . LYS D 1 172 ? 38.892  47.942   94.078  1.00 22.86 ? 253 LYS D C   1 
ATOM   10181 O O   . LYS D 1 172 ? 37.901  48.280   94.726  1.00 23.22 ? 253 LYS D O   1 
ATOM   10182 C CB  . LYS D 1 172 ? 39.709  45.700   94.687  1.00 21.56 ? 253 LYS D CB  1 
ATOM   10183 C CG  . LYS D 1 172 ? 40.919  44.799   94.689  1.00 22.59 ? 253 LYS D CG  1 
ATOM   10184 C CD  . LYS D 1 172 ? 40.507  43.332   94.642  1.00 22.17 ? 253 LYS D CD  1 
ATOM   10185 C CE  . LYS D 1 172 ? 41.741  42.432   94.650  1.00 21.95 ? 253 LYS D CE  1 
ATOM   10186 N NZ  . LYS D 1 172 ? 41.371  41.002   94.806  1.00 21.52 ? 253 LYS D NZ  1 
ATOM   10187 N N   . ILE D 1 173 ? 39.045  48.199   92.782  1.00 23.45 ? 254 ILE D N   1 
ATOM   10188 C CA  . ILE D 1 173 ? 38.022  48.875   91.994  1.00 23.64 ? 254 ILE D CA  1 
ATOM   10189 C C   . ILE D 1 173 ? 37.449  47.813   91.071  1.00 22.74 ? 254 ILE D C   1 
ATOM   10190 O O   . ILE D 1 173 ? 38.194  47.115   90.395  1.00 22.71 ? 254 ILE D O   1 
ATOM   10191 C CB  . ILE D 1 173 ? 38.609  49.975   91.108  1.00 26.04 ? 254 ILE D CB  1 
ATOM   10192 C CG1 . ILE D 1 173 ? 39.258  51.060   91.954  1.00 27.46 ? 254 ILE D CG1 1 
ATOM   10193 C CG2 . ILE D 1 173 ? 37.505  50.617   90.281  1.00 28.83 ? 254 ILE D CG2 1 
ATOM   10194 C CD1 . ILE D 1 173 ? 39.931  52.097   91.092  1.00 29.99 ? 254 ILE D CD1 1 
ATOM   10195 N N   . PHE D 1 174 ? 36.133  47.682   91.035  1.00 21.88 ? 255 PHE D N   1 
ATOM   10196 C CA  . PHE D 1 174 ? 35.520  46.678   90.179  1.00 20.58 ? 255 PHE D CA  1 
ATOM   10197 C C   . PHE D 1 174 ? 34.703  47.325   89.081  1.00 20.23 ? 255 PHE D C   1 
ATOM   10198 O O   . PHE D 1 174 ? 34.152  48.407   89.261  1.00 20.80 ? 255 PHE D O   1 
ATOM   10199 C CB  . PHE D 1 174 ? 34.598  45.763   90.989  1.00 20.10 ? 255 PHE D CB  1 
ATOM   10200 C CG  . PHE D 1 174 ? 35.283  45.021   92.105  1.00 19.95 ? 255 PHE D CG  1 
ATOM   10201 C CD1 . PHE D 1 174 ? 35.596  45.661   93.294  1.00 20.30 ? 255 PHE D CD1 1 
ATOM   10202 C CD2 . PHE D 1 174 ? 35.577  43.669   91.976  1.00 20.08 ? 255 PHE D CD2 1 
ATOM   10203 C CE1 . PHE D 1 174 ? 36.194  44.957   94.351  1.00 22.43 ? 255 PHE D CE1 1 
ATOM   10204 C CE2 . PHE D 1 174 ? 36.170  42.959   93.016  1.00 20.46 ? 255 PHE D CE2 1 
ATOM   10205 C CZ  . PHE D 1 174 ? 36.480  43.604   94.209  1.00 21.79 ? 255 PHE D CZ  1 
ATOM   10206 N N   . LYS D 1 175 ? 34.629  46.653   87.939  1.00 20.63 ? 256 LYS D N   1 
ATOM   10207 C CA  . LYS D 1 175 ? 33.848  47.128   86.801  1.00 19.52 ? 256 LYS D CA  1 
ATOM   10208 C C   . LYS D 1 175 ? 32.815  46.044   86.533  1.00 19.72 ? 256 LYS D C   1 
ATOM   10209 O O   . LYS D 1 175 ? 33.176  44.881   86.377  1.00 19.42 ? 256 LYS D O   1 
ATOM   10210 C CB  . LYS D 1 175 ? 34.738  47.308   85.574  1.00 18.64 ? 256 LYS D CB  1 
ATOM   10211 C CG  . LYS D 1 175 ? 33.963  47.546   84.308  1.00 18.87 ? 256 LYS D CG  1 
ATOM   10212 C CD  . LYS D 1 175 ? 34.876  47.816   83.135  1.00 20.48 ? 256 LYS D CD  1 
ATOM   10213 C CE  . LYS D 1 175 ? 34.067  48.063   81.866  1.00 22.16 ? 256 LYS D CE  1 
ATOM   10214 N NZ  . LYS D 1 175 ? 34.907  48.650   80.780  1.00 23.04 ? 256 LYS D NZ  1 
ATOM   10215 N N   . MET D 1 176 ? 31.538  46.413   86.486  1.00 19.72 ? 257 MET D N   1 
ATOM   10216 C CA  . MET D 1 176 ? 30.484  45.430   86.249  1.00 19.79 ? 257 MET D CA  1 
ATOM   10217 C C   . MET D 1 176 ? 29.464  45.829   85.196  1.00 19.98 ? 257 MET D C   1 
ATOM   10218 O O   . MET D 1 176 ? 29.149  47.004   85.024  1.00 19.40 ? 257 MET D O   1 
ATOM   10219 C CB  . MET D 1 176 ? 29.789  45.116   87.561  1.00 20.86 ? 257 MET D CB  1 
ATOM   10220 C CG  . MET D 1 176 ? 29.920  46.254   88.518  1.00 25.50 ? 257 MET D CG  1 
ATOM   10221 S SD  . MET D 1 176 ? 30.225  45.813   90.238  1.00 25.91 ? 257 MET D SD  1 
ATOM   10222 C CE  . MET D 1 176 ? 29.546  47.320   91.012  1.00 23.30 ? 257 MET D CE  1 
ATOM   10223 N N   . GLU D 1 177 ? 28.968  44.824   84.482  1.00 20.54 ? 258 GLU D N   1 
ATOM   10224 C CA  . GLU D 1 177 ? 27.984  45.016   83.427  1.00 21.38 ? 258 GLU D CA  1 
ATOM   10225 C C   . GLU D 1 177 ? 26.836  44.020   83.633  1.00 20.62 ? 258 GLU D C   1 
ATOM   10226 O O   . GLU D 1 177 ? 27.019  42.808   83.574  1.00 18.91 ? 258 GLU D O   1 
ATOM   10227 C CB  . GLU D 1 177 ? 28.675  44.839   82.071  1.00 22.18 ? 258 GLU D CB  1 
ATOM   10228 C CG  . GLU D 1 177 ? 29.830  45.828   81.901  1.00 24.63 ? 258 GLU D CG  1 
ATOM   10229 C CD  . GLU D 1 177 ? 30.627  45.655   80.607  1.00 26.75 ? 258 GLU D CD  1 
ATOM   10230 O OE1 . GLU D 1 177 ? 31.365  46.602   80.242  1.00 27.80 ? 258 GLU D OE1 1 
ATOM   10231 O OE2 . GLU D 1 177 ? 30.536  44.583   79.961  1.00 26.71 ? 258 GLU D OE2 1 
ATOM   10232 N N   . LYS D 1 178 ? 25.648  44.560   83.880  1.00 21.41 ? 259 LYS D N   1 
ATOM   10233 C CA  . LYS D 1 178 ? 24.459  43.760   84.153  1.00 21.70 ? 259 LYS D CA  1 
ATOM   10234 C C   . LYS D 1 178 ? 24.741  42.960   85.419  1.00 21.22 ? 259 LYS D C   1 
ATOM   10235 O O   . LYS D 1 178 ? 24.372  41.792   85.527  1.00 20.59 ? 259 LYS D O   1 
ATOM   10236 C CB  . LYS D 1 178 ? 24.144  42.802   83.008  1.00 23.33 ? 259 LYS D CB  1 
ATOM   10237 C CG  . LYS D 1 178 ? 23.793  43.451   81.693  1.00 25.06 ? 259 LYS D CG  1 
ATOM   10238 C CD  . LYS D 1 178 ? 23.373  42.358   80.731  1.00 29.58 ? 259 LYS D CD  1 
ATOM   10239 C CE  . LYS D 1 178 ? 23.238  42.861   79.305  1.00 32.85 ? 259 LYS D CE  1 
ATOM   10240 N NZ  . LYS D 1 178 ? 23.090  41.711   78.350  1.00 36.37 ? 259 LYS D NZ  1 
ATOM   10241 N N   . GLY D 1 179 ? 25.424  43.598   86.364  1.00 20.44 ? 260 GLY D N   1 
ATOM   10242 C CA  . GLY D 1 179 ? 25.739  42.951   87.622  1.00 19.76 ? 260 GLY D CA  1 
ATOM   10243 C C   . GLY D 1 179 ? 26.774  41.844   87.576  1.00 19.99 ? 260 GLY D C   1 
ATOM   10244 O O   . GLY D 1 179 ? 26.920  41.097   88.546  1.00 20.85 ? 260 GLY D O   1 
ATOM   10245 N N   . LYS D 1 180 ? 27.485  41.720   86.461  1.00 18.62 ? 261 LYS D N   1 
ATOM   10246 C CA  . LYS D 1 180 ? 28.514  40.698   86.343  1.00 19.22 ? 261 LYS D CA  1 
ATOM   10247 C C   . LYS D 1 180 ? 29.871  41.392   86.336  1.00 17.49 ? 261 LYS D C   1 
ATOM   10248 O O   . LYS D 1 180 ? 30.060  42.366   85.608  1.00 18.45 ? 261 LYS D O   1 
ATOM   10249 C CB  . LYS D 1 180 ? 28.329  39.882   85.053  1.00 20.43 ? 261 LYS D CB  1 
ATOM   10250 C CG  . LYS D 1 180 ? 29.514  38.973   84.758  1.00 25.56 ? 261 LYS D CG  1 
ATOM   10251 C CD  . LYS D 1 180 ? 29.284  38.058   83.568  1.00 30.35 ? 261 LYS D CD  1 
ATOM   10252 C CE  . LYS D 1 180 ? 28.331  36.920   83.919  1.00 33.85 ? 261 LYS D CE  1 
ATOM   10253 N NZ  . LYS D 1 180 ? 27.057  37.414   84.553  1.00 35.73 ? 261 LYS D NZ  1 
ATOM   10254 N N   . VAL D 1 181 ? 30.807  40.911   87.149  1.00 14.29 ? 262 VAL D N   1 
ATOM   10255 C CA  . VAL D 1 181 ? 32.124  41.529   87.194  1.00 13.17 ? 262 VAL D CA  1 
ATOM   10256 C C   . VAL D 1 181 ? 32.930  41.112   85.965  1.00 14.09 ? 262 VAL D C   1 
ATOM   10257 O O   . VAL D 1 181 ? 33.212  39.931   85.760  1.00 12.12 ? 262 VAL D O   1 
ATOM   10258 C CB  . VAL D 1 181 ? 32.903  41.145   88.479  1.00 12.99 ? 262 VAL D CB  1 
ATOM   10259 C CG1 . VAL D 1 181 ? 34.283  41.782   88.454  1.00 12.10 ? 262 VAL D CG1 1 
ATOM   10260 C CG2 . VAL D 1 181 ? 32.155  41.620   89.708  1.00 13.02 ? 262 VAL D CG2 1 
ATOM   10261 N N   . VAL D 1 182 ? 33.287  42.100   85.145  1.00 15.11 ? 263 VAL D N   1 
ATOM   10262 C CA  . VAL D 1 182 ? 34.041  41.862   83.920  1.00 16.24 ? 263 VAL D CA  1 
ATOM   10263 C C   . VAL D 1 182 ? 35.522  42.185   84.078  1.00 17.38 ? 263 VAL D C   1 
ATOM   10264 O O   . VAL D 1 182 ? 36.356  41.699   83.308  1.00 17.86 ? 263 VAL D O   1 
ATOM   10265 C CB  . VAL D 1 182 ? 33.472  42.698   82.759  1.00 16.93 ? 263 VAL D CB  1 
ATOM   10266 C CG1 . VAL D 1 182 ? 32.078  42.204   82.409  1.00 14.26 ? 263 VAL D CG1 1 
ATOM   10267 C CG2 . VAL D 1 182 ? 33.433  44.171   83.148  1.00 16.50 ? 263 VAL D CG2 1 
ATOM   10268 N N   . LYS D 1 183 ? 35.840  43.004   85.078  1.00 17.15 ? 264 LYS D N   1 
ATOM   10269 C CA  . LYS D 1 183 ? 37.218  43.386   85.356  1.00 16.84 ? 264 LYS D CA  1 
ATOM   10270 C C   . LYS D 1 183 ? 37.378  43.949   86.770  1.00 16.98 ? 264 LYS D C   1 
ATOM   10271 O O   . LYS D 1 183 ? 36.459  44.542   87.325  1.00 16.82 ? 264 LYS D O   1 
ATOM   10272 C CB  . LYS D 1 183 ? 37.689  44.421   84.333  1.00 16.53 ? 264 LYS D CB  1 
ATOM   10273 C CG  . LYS D 1 183 ? 39.097  44.900   84.568  1.00 15.20 ? 264 LYS D CG  1 
ATOM   10274 C CD  . LYS D 1 183 ? 39.550  45.773   83.433  1.00 18.58 ? 264 LYS D CD  1 
ATOM   10275 C CE  . LYS D 1 183 ? 41.010  46.150   83.559  1.00 19.40 ? 264 LYS D CE  1 
ATOM   10276 N NZ  . LYS D 1 183 ? 41.438  46.764   82.279  1.00 22.75 ? 264 LYS D NZ  1 
ATOM   10277 N N   . SER D 1 184 ? 38.551  43.755   87.354  1.00 17.64 ? 265 SER D N   1 
ATOM   10278 C CA  . SER D 1 184 ? 38.821  44.262   88.692  1.00 18.96 ? 265 SER D CA  1 
ATOM   10279 C C   . SER D 1 184 ? 40.306  44.561   88.807  1.00 19.19 ? 265 SER D C   1 
ATOM   10280 O O   . SER D 1 184 ? 41.127  43.894   88.182  1.00 19.91 ? 265 SER D O   1 
ATOM   10281 C CB  . SER D 1 184 ? 38.397  43.250   89.765  1.00 18.13 ? 265 SER D CB  1 
ATOM   10282 O OG  . SER D 1 184 ? 39.152  42.062   89.672  1.00 20.69 ? 265 SER D OG  1 
ATOM   10283 N N   . VAL D 1 185 ? 40.637  45.574   89.603  1.00 20.83 ? 266 VAL D N   1 
ATOM   10284 C CA  . VAL D 1 185 ? 42.017  46.004   89.792  1.00 21.27 ? 266 VAL D CA  1 
ATOM   10285 C C   . VAL D 1 185 ? 42.292  46.329   91.249  1.00 21.70 ? 266 VAL D C   1 
ATOM   10286 O O   . VAL D 1 185 ? 41.399  46.775   91.974  1.00 21.05 ? 266 VAL D O   1 
ATOM   10287 C CB  . VAL D 1 185 ? 42.316  47.279   88.954  1.00 21.58 ? 266 VAL D CB  1 
ATOM   10288 C CG1 . VAL D 1 185 ? 43.668  47.881   89.357  1.00 22.62 ? 266 VAL D CG1 1 
ATOM   10289 C CG2 . VAL D 1 185 ? 42.319  46.935   87.468  1.00 21.03 ? 266 VAL D CG2 1 
ATOM   10290 N N   . GLU D 1 186 ? 43.521  46.082   91.691  1.00 21.59 ? 267 GLU D N   1 
ATOM   10291 C CA  . GLU D 1 186 ? 43.869  46.424   93.054  1.00 21.87 ? 267 GLU D CA  1 
ATOM   10292 C C   . GLU D 1 186 ? 44.697  47.695   92.992  1.00 21.83 ? 267 GLU D C   1 
ATOM   10293 O O   . GLU D 1 186 ? 45.635  47.797   92.196  1.00 22.07 ? 267 GLU D O   1 
ATOM   10294 C CB  . GLU D 1 186 ? 44.682  45.335   93.742  1.00 20.45 ? 267 GLU D CB  1 
ATOM   10295 C CG  . GLU D 1 186 ? 44.908  45.697   95.187  1.00 21.78 ? 267 GLU D CG  1 
ATOM   10296 C CD  . GLU D 1 186 ? 45.358  44.543   96.044  1.00 24.40 ? 267 GLU D CD  1 
ATOM   10297 O OE1 . GLU D 1 186 ? 45.120  43.374   95.670  1.00 25.91 ? 267 GLU D OE1 1 
ATOM   10298 O OE2 . GLU D 1 186 ? 45.938  44.811   97.119  1.00 26.49 ? 267 GLU D OE2 1 
ATOM   10299 N N   . LEU D 1 187 ? 44.340  48.669   93.817  1.00 21.15 ? 268 LEU D N   1 
ATOM   10300 C CA  . LEU D 1 187 ? 45.075  49.918   93.836  1.00 21.39 ? 268 LEU D CA  1 
ATOM   10301 C C   . LEU D 1 187 ? 46.411  49.660   94.485  1.00 21.66 ? 268 LEU D C   1 
ATOM   10302 O O   . LEU D 1 187 ? 46.506  48.885   95.437  1.00 21.42 ? 268 LEU D O   1 
ATOM   10303 C CB  . LEU D 1 187 ? 44.347  50.980   94.650  1.00 20.58 ? 268 LEU D CB  1 
ATOM   10304 C CG  . LEU D 1 187 ? 42.910  51.320   94.282  1.00 19.56 ? 268 LEU D CG  1 
ATOM   10305 C CD1 . LEU D 1 187 ? 42.536  52.596   95.006  1.00 19.10 ? 268 LEU D CD1 1 
ATOM   10306 C CD2 . LEU D 1 187 ? 42.773  51.498   92.775  1.00 19.64 ? 268 LEU D CD2 1 
ATOM   10307 N N   . ASP D 1 188 ? 47.437  50.301   93.940  1.00 22.15 ? 269 ASP D N   1 
ATOM   10308 C CA  . ASP D 1 188 ? 48.787  50.209   94.459  1.00 22.31 ? 269 ASP D CA  1 
ATOM   10309 C C   . ASP D 1 188 ? 48.915  51.527   95.201  1.00 22.01 ? 269 ASP D C   1 
ATOM   10310 O O   . ASP D 1 188 ? 49.551  52.474   94.729  1.00 21.97 ? 269 ASP D O   1 
ATOM   10311 C CB  . ASP D 1 188 ? 49.795  50.122   93.306  1.00 24.66 ? 269 ASP D CB  1 
ATOM   10312 C CG  . ASP D 1 188 ? 51.236  50.242   93.783  1.00 26.81 ? 269 ASP D CG  1 
ATOM   10313 O OD1 . ASP D 1 188 ? 51.511  49.843   94.938  1.00 28.34 ? 269 ASP D OD1 1 
ATOM   10314 O OD2 . ASP D 1 188 ? 52.090  50.728   93.007  1.00 27.04 ? 269 ASP D OD2 1 
ATOM   10315 N N   . ALA D 1 189 ? 48.265  51.579   96.358  1.00 21.87 ? 270 ALA D N   1 
ATOM   10316 C CA  . ALA D 1 189 ? 48.230  52.779   97.176  1.00 19.78 ? 270 ALA D CA  1 
ATOM   10317 C C   . ALA D 1 189 ? 48.919  52.641   98.523  1.00 18.93 ? 270 ALA D C   1 
ATOM   10318 O O   . ALA D 1 189 ? 48.270  52.709   99.576  1.00 17.12 ? 270 ALA D O   1 
ATOM   10319 C CB  . ALA D 1 189 ? 46.782  53.207   97.382  1.00 20.17 ? 270 ALA D CB  1 
ATOM   10320 N N   . PRO D 1 190 ? 50.243  52.441   98.513  1.00 18.04 ? 271 PRO D N   1 
ATOM   10321 C CA  . PRO D 1 190 ? 50.952  52.313   99.784  1.00 17.80 ? 271 PRO D CA  1 
ATOM   10322 C C   . PRO D 1 190 ? 50.874  53.622   100.573 1.00 18.22 ? 271 PRO D C   1 
ATOM   10323 O O   . PRO D 1 190 ? 51.076  54.723   100.026 1.00 16.50 ? 271 PRO D O   1 
ATOM   10324 C CB  . PRO D 1 190 ? 52.379  51.949   99.355  1.00 18.20 ? 271 PRO D CB  1 
ATOM   10325 C CG  . PRO D 1 190 ? 52.499  52.556   97.979  1.00 17.77 ? 271 PRO D CG  1 
ATOM   10326 C CD  . PRO D 1 190 ? 51.153  52.226   97.376  1.00 18.77 ? 271 PRO D CD  1 
ATOM   10327 N N   . ASN D 1 191 ? 50.550  53.471   101.856 1.00 17.67 ? 272 ASN D N   1 
ATOM   10328 C CA  . ASN D 1 191 ? 50.410  54.561   102.811 1.00 17.72 ? 272 ASN D CA  1 
ATOM   10329 C C   . ASN D 1 191 ? 49.027  55.202   102.761 1.00 18.40 ? 272 ASN D C   1 
ATOM   10330 O O   . ASN D 1 191 ? 48.725  56.111   103.543 1.00 19.37 ? 272 ASN D O   1 
ATOM   10331 C CB  . ASN D 1 191 ? 51.500  55.617   102.603 1.00 18.03 ? 272 ASN D CB  1 
ATOM   10332 C CG  . ASN D 1 191 ? 51.633  56.551   103.792 1.00 19.16 ? 272 ASN D CG  1 
ATOM   10333 O OD1 . ASN D 1 191 ? 51.642  56.105   104.940 1.00 21.30 ? 272 ASN D OD1 1 
ATOM   10334 N ND2 . ASN D 1 191 ? 51.744  57.847   103.527 1.00 18.49 ? 272 ASN D ND2 1 
ATOM   10335 N N   . TYR D 1 192 ? 48.180  54.729   101.853 1.00 18.36 ? 273 TYR D N   1 
ATOM   10336 C CA  . TYR D 1 192 ? 46.815  55.260   101.746 1.00 19.01 ? 273 TYR D CA  1 
ATOM   10337 C C   . TYR D 1 192 ? 45.862  54.370   102.533 1.00 18.56 ? 273 TYR D C   1 
ATOM   10338 O O   . TYR D 1 192 ? 46.222  53.264   102.939 1.00 16.93 ? 273 TYR D O   1 
ATOM   10339 C CB  . TYR D 1 192 ? 46.326  55.276   100.291 1.00 18.99 ? 273 TYR D CB  1 
ATOM   10340 C CG  . TYR D 1 192 ? 46.929  56.338   99.401  1.00 20.12 ? 273 TYR D CG  1 
ATOM   10341 C CD1 . TYR D 1 192 ? 48.280  56.303   99.042  1.00 20.16 ? 273 TYR D CD1 1 
ATOM   10342 C CD2 . TYR D 1 192 ? 46.133  57.350   98.868  1.00 18.99 ? 273 TYR D CD2 1 
ATOM   10343 C CE1 . TYR D 1 192 ? 48.818  57.248   98.167  1.00 19.63 ? 273 TYR D CE1 1 
ATOM   10344 C CE2 . TYR D 1 192 ? 46.661  58.292   97.997  1.00 19.16 ? 273 TYR D CE2 1 
ATOM   10345 C CZ  . TYR D 1 192 ? 48.000  58.234   97.648  1.00 19.32 ? 273 TYR D CZ  1 
ATOM   10346 O OH  . TYR D 1 192 ? 48.509  59.145   96.757  1.00 19.72 ? 273 TYR D OH  1 
ATOM   10347 N N   . HIS D 1 193 ? 44.646  54.854   102.751 1.00 18.98 ? 274 HIS D N   1 
ATOM   10348 C CA  . HIS D 1 193 ? 43.638  54.048   103.435 1.00 19.51 ? 274 HIS D CA  1 
ATOM   10349 C C   . HIS D 1 193 ? 42.289  54.452   102.889 1.00 18.94 ? 274 HIS D C   1 
ATOM   10350 O O   . HIS D 1 193 ? 41.860  55.581   103.084 1.00 19.83 ? 274 HIS D O   1 
ATOM   10351 C CB  . HIS D 1 193 ? 43.672  54.258   104.949 1.00 19.44 ? 274 HIS D CB  1 
ATOM   10352 C CG  . HIS D 1 193 ? 42.997  53.165   105.715 1.00 19.18 ? 274 HIS D CG  1 
ATOM   10353 N ND1 . HIS D 1 193 ? 41.796  53.342   106.369 1.00 20.63 ? 274 HIS D ND1 1 
ATOM   10354 C CD2 . HIS D 1 193 ? 43.362  51.881   105.940 1.00 18.52 ? 274 HIS D CD2 1 
ATOM   10355 C CE1 . HIS D 1 193 ? 41.455  52.216   106.970 1.00 18.74 ? 274 HIS D CE1 1 
ATOM   10356 N NE2 . HIS D 1 193 ? 42.388  51.314   106.726 1.00 17.73 ? 274 HIS D NE2 1 
ATOM   10357 N N   . TYR D 1 194 ? 41.636  53.540   102.178 1.00 18.49 ? 275 TYR D N   1 
ATOM   10358 C CA  . TYR D 1 194 ? 40.332  53.842   101.601 1.00 18.79 ? 275 TYR D CA  1 
ATOM   10359 C C   . TYR D 1 194 ? 39.195  53.120   102.273 1.00 19.15 ? 275 TYR D C   1 
ATOM   10360 O O   . TYR D 1 194 ? 39.243  51.907   102.471 1.00 18.74 ? 275 TYR D O   1 
ATOM   10361 C CB  . TYR D 1 194 ? 40.273  53.490   100.113 1.00 17.87 ? 275 TYR D CB  1 
ATOM   10362 C CG  . TYR D 1 194 ? 41.067  54.405   99.213  1.00 16.99 ? 275 TYR D CG  1 
ATOM   10363 C CD1 . TYR D 1 194 ? 42.349  54.061   98.798  1.00 15.91 ? 275 TYR D CD1 1 
ATOM   10364 C CD2 . TYR D 1 194 ? 40.525  55.606   98.759  1.00 15.42 ? 275 TYR D CD2 1 
ATOM   10365 C CE1 . TYR D 1 194 ? 43.073  54.882   97.945  1.00 15.53 ? 275 TYR D CE1 1 
ATOM   10366 C CE2 . TYR D 1 194 ? 41.239  56.435   97.911  1.00 15.49 ? 275 TYR D CE2 1 
ATOM   10367 C CZ  . TYR D 1 194 ? 42.514  56.060   97.504  1.00 15.66 ? 275 TYR D CZ  1 
ATOM   10368 O OH  . TYR D 1 194 ? 43.214  56.844   96.628  1.00 17.15 ? 275 TYR D OH  1 
ATOM   10369 N N   . GLU D 1 195 ? 38.156  53.869   102.610 1.00 19.77 ? 276 GLU D N   1 
ATOM   10370 C CA  . GLU D 1 195 ? 36.994  53.257   103.219 1.00 20.40 ? 276 GLU D CA  1 
ATOM   10371 C C   . GLU D 1 195 ? 35.728  54.066   103.005 1.00 20.48 ? 276 GLU D C   1 
ATOM   10372 O O   . GLU D 1 195 ? 35.732  55.298   103.120 1.00 21.29 ? 276 GLU D O   1 
ATOM   10373 C CB  . GLU D 1 195 ? 37.238  53.017   104.715 1.00 20.98 ? 276 GLU D CB  1 
ATOM   10374 C CG  . GLU D 1 195 ? 37.128  51.527   105.076 1.00 24.81 ? 276 GLU D CG  1 
ATOM   10375 C CD  . GLU D 1 195 ? 38.110  51.098   106.140 1.00 25.42 ? 276 GLU D CD  1 
ATOM   10376 O OE1 . GLU D 1 195 ? 38.626  49.968   106.049 1.00 27.60 ? 276 GLU D OE1 1 
ATOM   10377 O OE2 . GLU D 1 195 ? 38.367  51.877   107.073 1.00 28.40 ? 276 GLU D OE2 1 
ATOM   10378 N N   . GLU D 1 196 ? 34.655  53.358   102.661 1.00 18.78 ? 277 GLU D N   1 
ATOM   10379 C CA  . GLU D 1 196 ? 33.351  53.970   102.460 1.00 17.26 ? 277 GLU D CA  1 
ATOM   10380 C C   . GLU D 1 196 ? 33.398  55.108   101.451 1.00 17.29 ? 277 GLU D C   1 
ATOM   10381 O O   . GLU D 1 196 ? 33.001  56.234   101.750 1.00 17.67 ? 277 GLU D O   1 
ATOM   10382 C CB  . GLU D 1 196 ? 32.829  54.478   103.807 1.00 15.59 ? 277 GLU D CB  1 
ATOM   10383 C CG  . GLU D 1 196 ? 32.968  53.454   104.935 1.00 16.54 ? 277 GLU D CG  1 
ATOM   10384 C CD  . GLU D 1 196 ? 32.354  53.913   106.249 1.00 17.78 ? 277 GLU D CD  1 
ATOM   10385 O OE1 . GLU D 1 196 ? 32.720  55.002   106.752 1.00 18.61 ? 277 GLU D OE1 1 
ATOM   10386 O OE2 . GLU D 1 196 ? 31.503  53.174   106.784 1.00 18.30 ? 277 GLU D OE2 1 
ATOM   10387 N N   . CYS D 1 197 ? 33.863  54.806   100.244 1.00 16.72 ? 278 CYS D N   1 
ATOM   10388 C CA  . CYS D 1 197 ? 33.970  55.815   99.204  1.00 16.30 ? 278 CYS D CA  1 
ATOM   10389 C C   . CYS D 1 197 ? 32.650  56.348   98.636  1.00 16.68 ? 278 CYS D C   1 
ATOM   10390 O O   . CYS D 1 197 ? 31.648  55.638   98.540  1.00 14.96 ? 278 CYS D O   1 
ATOM   10391 C CB  . CYS D 1 197 ? 34.812  55.285   98.048  1.00 15.64 ? 278 CYS D CB  1 
ATOM   10392 S SG  . CYS D 1 197 ? 36.568  54.954   98.420  1.00 18.85 ? 278 CYS D SG  1 
ATOM   10393 N N   . SER D 1 198 ? 32.671  57.624   98.272  1.00 16.33 ? 279 SER D N   1 
ATOM   10394 C CA  . SER D 1 198 ? 31.523  58.272   97.657  1.00 17.42 ? 279 SER D CA  1 
ATOM   10395 C C   . SER D 1 198 ? 32.033  58.517   96.246  1.00 17.36 ? 279 SER D C   1 
ATOM   10396 O O   . SER D 1 198 ? 32.957  59.302   96.038  1.00 18.84 ? 279 SER D O   1 
ATOM   10397 C CB  . SER D 1 198 ? 31.191  59.600   98.356  1.00 16.60 ? 279 SER D CB  1 
ATOM   10398 O OG  . SER D 1 198 ? 30.773  59.392   99.698  1.00 14.27 ? 279 SER D OG  1 
ATOM   10399 N N   . CYS D 1 199 ? 31.457  57.821   95.278  1.00 18.13 ? 280 CYS D N   1 
ATOM   10400 C CA  . CYS D 1 199 ? 31.906  57.953   93.902  1.00 16.73 ? 280 CYS D CA  1 
ATOM   10401 C C   . CYS D 1 199 ? 30.825  58.502   92.991  1.00 17.01 ? 280 CYS D C   1 
ATOM   10402 O O   . CYS D 1 199 ? 29.665  58.112   93.084  1.00 16.37 ? 280 CYS D O   1 
ATOM   10403 C CB  . CYS D 1 199 ? 32.345  56.597   93.384  1.00 16.50 ? 280 CYS D CB  1 
ATOM   10404 S SG  . CYS D 1 199 ? 33.521  55.685   94.426  1.00 16.16 ? 280 CYS D SG  1 
ATOM   10405 N N   . TYR D 1 200 ? 31.216  59.412   92.110  1.00 17.04 ? 281 TYR D N   1 
ATOM   10406 C CA  . TYR D 1 200 ? 30.280  60.003   91.175  1.00 17.46 ? 281 TYR D CA  1 
ATOM   10407 C C   . TYR D 1 200 ? 30.874  60.035   89.781  1.00 17.67 ? 281 TYR D C   1 
ATOM   10408 O O   . TYR D 1 200 ? 32.088  60.102   89.611  1.00 17.49 ? 281 TYR D O   1 
ATOM   10409 C CB  . TYR D 1 200 ? 29.890  61.425   91.602  1.00 16.83 ? 281 TYR D CB  1 
ATOM   10410 C CG  . TYR D 1 200 ? 31.036  62.405   91.732  1.00 17.24 ? 281 TYR D CG  1 
ATOM   10411 C CD1 . TYR D 1 200 ? 31.605  62.683   92.981  1.00 17.05 ? 281 TYR D CD1 1 
ATOM   10412 C CD2 . TYR D 1 200 ? 31.542  63.077   90.613  1.00 16.92 ? 281 TYR D CD2 1 
ATOM   10413 C CE1 . TYR D 1 200 ? 32.640  63.609   93.113  1.00 16.29 ? 281 TYR D CE1 1 
ATOM   10414 C CE2 . TYR D 1 200 ? 32.583  64.001   90.733  1.00 16.80 ? 281 TYR D CE2 1 
ATOM   10415 C CZ  . TYR D 1 200 ? 33.125  64.263   91.984  1.00 17.25 ? 281 TYR D CZ  1 
ATOM   10416 O OH  . TYR D 1 200 ? 34.146  65.176   92.111  1.00 16.35 ? 281 TYR D OH  1 
ATOM   10417 N N   . PRO D 1 201 ? 30.015  59.970   88.759  1.00 18.60 ? 282 PRO D N   1 
ATOM   10418 C CA  . PRO D 1 201 ? 30.475  59.995   87.369  1.00 19.34 ? 282 PRO D CA  1 
ATOM   10419 C C   . PRO D 1 201 ? 30.662  61.435   86.906  1.00 19.48 ? 282 PRO D C   1 
ATOM   10420 O O   . PRO D 1 201 ? 29.954  62.330   87.356  1.00 19.03 ? 282 PRO D O   1 
ATOM   10421 C CB  . PRO D 1 201 ? 29.342  59.288   86.626  1.00 19.26 ? 282 PRO D CB  1 
ATOM   10422 C CG  . PRO D 1 201 ? 28.127  59.773   87.379  1.00 18.14 ? 282 PRO D CG  1 
ATOM   10423 C CD  . PRO D 1 201 ? 28.565  59.707   88.837  1.00 18.21 ? 282 PRO D CD  1 
ATOM   10424 N N   . ASN D 1 202 ? 31.636  61.654   86.031  1.00 20.22 ? 283 ASN D N   1 
ATOM   10425 C CA  . ASN D 1 202 ? 31.885  62.980   85.489  1.00 20.72 ? 283 ASN D CA  1 
ATOM   10426 C C   . ASN D 1 202 ? 32.785  62.931   84.263  1.00 21.16 ? 283 ASN D C   1 
ATOM   10427 O O   . ASN D 1 202 ? 33.941  62.501   84.333  1.00 20.63 ? 283 ASN D O   1 
ATOM   10428 C CB  . ASN D 1 202 ? 32.491  63.903   86.543  1.00 23.22 ? 283 ASN D CB  1 
ATOM   10429 C CG  . ASN D 1 202 ? 32.936  65.232   85.957  1.00 26.04 ? 283 ASN D CG  1 
ATOM   10430 O OD1 . ASN D 1 202 ? 33.926  65.290   85.234  1.00 30.67 ? 283 ASN D OD1 1 
ATOM   10431 N ND2 . ASN D 1 202 ? 32.202  66.301   86.251  1.00 26.03 ? 283 ASN D ND2 1 
ATOM   10432 N N   . ALA D 1 203 ? 32.237  63.377   83.137  1.00 20.35 ? 284 ALA D N   1 
ATOM   10433 C CA  . ALA D 1 203 ? 32.955  63.398   81.873  1.00 19.90 ? 284 ALA D CA  1 
ATOM   10434 C C   . ALA D 1 203 ? 33.468  62.017   81.473  1.00 19.60 ? 284 ALA D C   1 
ATOM   10435 O O   . ALA D 1 203 ? 34.590  61.887   80.996  1.00 20.46 ? 284 ALA D O   1 
ATOM   10436 C CB  . ALA D 1 203 ? 34.117  64.389   81.945  1.00 18.45 ? 284 ALA D CB  1 
ATOM   10437 N N   . GLY D 1 204 ? 32.656  60.984   81.675  1.00 19.27 ? 285 GLY D N   1 
ATOM   10438 C CA  . GLY D 1 204 ? 33.068  59.644   81.285  1.00 18.48 ? 285 GLY D CA  1 
ATOM   10439 C C   . GLY D 1 204 ? 33.998  58.904   82.226  1.00 19.15 ? 285 GLY D C   1 
ATOM   10440 O O   . GLY D 1 204 ? 34.481  57.821   81.895  1.00 19.35 ? 285 GLY D O   1 
ATOM   10441 N N   . GLU D 1 205 ? 34.253  59.476   83.398  1.00 20.30 ? 286 GLU D N   1 
ATOM   10442 C CA  . GLU D 1 205 ? 35.132  58.846   84.378  1.00 22.18 ? 286 GLU D CA  1 
ATOM   10443 C C   . GLU D 1 205 ? 34.504  58.883   85.775  1.00 21.72 ? 286 GLU D C   1 
ATOM   10444 O O   . GLU D 1 205 ? 33.468  59.516   85.989  1.00 22.52 ? 286 GLU D O   1 
ATOM   10445 C CB  . GLU D 1 205 ? 36.505  59.540   84.386  1.00 24.38 ? 286 GLU D CB  1 
ATOM   10446 C CG  . GLU D 1 205 ? 37.302  59.333   83.093  1.00 28.28 ? 286 GLU D CG  1 
ATOM   10447 C CD  . GLU D 1 205 ? 38.710  59.935   83.129  1.00 31.10 ? 286 GLU D CD  1 
ATOM   10448 O OE1 . GLU D 1 205 ? 39.432  59.746   84.137  1.00 32.33 ? 286 GLU D OE1 1 
ATOM   10449 O OE2 . GLU D 1 205 ? 39.107  60.579   82.133  1.00 32.41 ? 286 GLU D OE2 1 
ATOM   10450 N N   . ILE D 1 206 ? 35.130  58.197   86.723  1.00 20.80 ? 287 ILE D N   1 
ATOM   10451 C CA  . ILE D 1 206 ? 34.621  58.159   88.084  1.00 18.58 ? 287 ILE D CA  1 
ATOM   10452 C C   . ILE D 1 206 ? 35.575  58.843   89.049  1.00 17.80 ? 287 ILE D C   1 
ATOM   10453 O O   . ILE D 1 206 ? 36.791  58.743   88.911  1.00 16.32 ? 287 ILE D O   1 
ATOM   10454 C CB  . ILE D 1 206 ? 34.415  56.704   88.568  1.00 18.57 ? 287 ILE D CB  1 
ATOM   10455 C CG1 . ILE D 1 206 ? 33.337  56.026   87.728  1.00 18.47 ? 287 ILE D CG1 1 
ATOM   10456 C CG2 . ILE D 1 206 ? 34.021  56.690   90.051  1.00 18.82 ? 287 ILE D CG2 1 
ATOM   10457 C CD1 . ILE D 1 206 ? 33.736  55.775   86.289  1.00 21.75 ? 287 ILE D CD1 1 
ATOM   10458 N N   . THR D 1 207 ? 35.010  59.535   90.030  1.00 17.94 ? 288 THR D N   1 
ATOM   10459 C CA  . THR D 1 207 ? 35.799  60.214   91.047  1.00 17.83 ? 288 THR D CA  1 
ATOM   10460 C C   . THR D 1 207 ? 35.242  59.833   92.412  1.00 18.41 ? 288 THR D C   1 
ATOM   10461 O O   . THR D 1 207 ? 34.038  59.945   92.646  1.00 20.07 ? 288 THR D O   1 
ATOM   10462 C CB  . THR D 1 207 ? 35.736  61.753   90.891  1.00 17.89 ? 288 THR D CB  1 
ATOM   10463 O OG1 . THR D 1 207 ? 36.409  62.136   89.689  1.00 17.85 ? 288 THR D OG1 1 
ATOM   10464 C CG2 . THR D 1 207 ? 36.409  62.444   92.074  1.00 16.36 ? 288 THR D CG2 1 
ATOM   10465 N N   . CYS D 1 208 ? 36.115  59.372   93.303  1.00 17.17 ? 289 CYS D N   1 
ATOM   10466 C CA  . CYS D 1 208 ? 35.689  58.988   94.643  1.00 17.51 ? 289 CYS D CA  1 
ATOM   10467 C C   . CYS D 1 208 ? 36.451  59.745   95.735  1.00 17.48 ? 289 CYS D C   1 
ATOM   10468 O O   . CYS D 1 208 ? 37.676  59.897   95.664  1.00 18.78 ? 289 CYS D O   1 
ATOM   10469 C CB  . CYS D 1 208 ? 35.924  57.498   94.899  1.00 16.81 ? 289 CYS D CB  1 
ATOM   10470 S SG  . CYS D 1 208 ? 35.335  56.247   93.710  1.00 16.61 ? 289 CYS D SG  1 
ATOM   10471 N N   . VAL D 1 209 ? 35.718  60.212   96.739  1.00 15.67 ? 290 VAL D N   1 
ATOM   10472 C CA  . VAL D 1 209 ? 36.308  60.881   97.889  1.00 16.45 ? 290 VAL D CA  1 
ATOM   10473 C C   . VAL D 1 209 ? 35.973  59.907   99.009  1.00 16.05 ? 290 VAL D C   1 
ATOM   10474 O O   . VAL D 1 209 ? 34.805  59.574   99.207  1.00 15.10 ? 290 VAL D O   1 
ATOM   10475 C CB  . VAL D 1 209 ? 35.647  62.240   98.170  1.00 17.69 ? 290 VAL D CB  1 
ATOM   10476 C CG1 . VAL D 1 209 ? 36.280  62.885   99.404  1.00 17.15 ? 290 VAL D CG1 1 
ATOM   10477 C CG2 . VAL D 1 209 ? 35.796  63.138   96.956  1.00 16.82 ? 290 VAL D CG2 1 
ATOM   10478 N N   . CYS D 1 210 ? 36.981  59.451   99.744  1.00 15.72 ? 291 CYS D N   1 
ATOM   10479 C CA  . CYS D 1 210 ? 36.733  58.451   100.771 1.00 15.62 ? 291 CYS D CA  1 
ATOM   10480 C C   . CYS D 1 210 ? 37.092  58.809   102.218 1.00 16.01 ? 291 CYS D C   1 
ATOM   10481 O O   . CYS D 1 210 ? 37.285  59.973   102.567 1.00 15.92 ? 291 CYS D O   1 
ATOM   10482 C CB  . CYS D 1 210 ? 37.446  57.163   100.361 1.00 15.73 ? 291 CYS D CB  1 
ATOM   10483 S SG  . CYS D 1 210 ? 37.416  56.801   98.557  1.00 17.69 ? 291 CYS D SG  1 
ATOM   10484 N N   . ARG D 1 211 ? 37.160  57.777   103.056 1.00 16.28 ? 292 ARG D N   1 
ATOM   10485 C CA  . ARG D 1 211 ? 37.467  57.911   104.474 1.00 13.49 ? 292 ARG D CA  1 
ATOM   10486 C C   . ARG D 1 211 ? 38.755  57.214   104.863 1.00 13.89 ? 292 ARG D C   1 
ATOM   10487 O O   . ARG D 1 211 ? 38.895  56.016   104.650 1.00 14.01 ? 292 ARG D O   1 
ATOM   10488 C CB  . ARG D 1 211 ? 36.328  57.316   105.308 1.00 12.57 ? 292 ARG D CB  1 
ATOM   10489 C CG  . ARG D 1 211 ? 36.648  57.104   106.793 1.00 13.47 ? 292 ARG D CG  1 
ATOM   10490 C CD  . ARG D 1 211 ? 35.440  56.518   107.547 1.00 13.86 ? 292 ARG D CD  1 
ATOM   10491 N NE  . ARG D 1 211 ? 35.777  56.097   108.905 1.00 14.05 ? 292 ARG D NE  1 
ATOM   10492 C CZ  . ARG D 1 211 ? 34.908  55.611   109.790 1.00 16.46 ? 292 ARG D CZ  1 
ATOM   10493 N NH1 . ARG D 1 211 ? 35.331  55.255   110.995 1.00 16.18 ? 292 ARG D NH1 1 
ATOM   10494 N NH2 . ARG D 1 211 ? 33.620  55.486   109.490 1.00 15.86 ? 292 ARG D NH2 1 
ATOM   10495 N N   . ASP D 1 212 ? 39.698  57.969   105.424 1.00 15.70 ? 293 ASP D N   1 
ATOM   10496 C CA  . ASP D 1 212 ? 40.955  57.402   105.900 1.00 15.50 ? 293 ASP D CA  1 
ATOM   10497 C C   . ASP D 1 212 ? 40.741  57.220   107.403 1.00 16.40 ? 293 ASP D C   1 
ATOM   10498 O O   . ASP D 1 212 ? 40.734  58.198   108.164 1.00 18.69 ? 293 ASP D O   1 
ATOM   10499 C CB  . ASP D 1 212 ? 42.128  58.349   105.632 1.00 15.54 ? 293 ASP D CB  1 
ATOM   10500 C CG  . ASP D 1 212 ? 43.437  57.847   106.234 1.00 17.11 ? 293 ASP D CG  1 
ATOM   10501 O OD1 . ASP D 1 212 ? 44.521  58.245   105.751 1.00 15.79 ? 293 ASP D OD1 1 
ATOM   10502 O OD2 . ASP D 1 212 ? 43.388  57.063   107.208 1.00 19.71 ? 293 ASP D OD2 1 
ATOM   10503 N N   . ASN D 1 213 ? 40.558  55.964   107.815 1.00 16.45 ? 294 ASN D N   1 
ATOM   10504 C CA  . ASN D 1 213 ? 40.292  55.617   109.213 1.00 16.33 ? 294 ASN D CA  1 
ATOM   10505 C C   . ASN D 1 213 ? 41.577  55.294   109.948 1.00 15.59 ? 294 ASN D C   1 
ATOM   10506 O O   . ASN D 1 213 ? 41.612  55.236   111.172 1.00 15.30 ? 294 ASN D O   1 
ATOM   10507 C CB  . ASN D 1 213 ? 39.348  54.405   109.274 1.00 16.48 ? 294 ASN D CB  1 
ATOM   10508 C CG  . ASN D 1 213 ? 38.720  54.204   110.650 1.00 17.46 ? 294 ASN D CG  1 
ATOM   10509 O OD1 . ASN D 1 213 ? 37.989  55.061   111.137 1.00 17.44 ? 294 ASN D OD1 1 
ATOM   10510 N ND2 . ASN D 1 213 ? 38.994  53.059   111.273 1.00 16.41 ? 294 ASN D ND2 1 
ATOM   10511 N N   . TRP D 1 214 ? 42.637  55.105   109.181 1.00 16.17 ? 295 TRP D N   1 
ATOM   10512 C CA  . TRP D 1 214 ? 43.935  54.752   109.721 1.00 16.11 ? 295 TRP D CA  1 
ATOM   10513 C C   . TRP D 1 214 ? 44.753  55.941   110.243 1.00 17.20 ? 295 TRP D C   1 
ATOM   10514 O O   . TRP D 1 214 ? 45.088  55.999   111.425 1.00 17.83 ? 295 TRP D O   1 
ATOM   10515 C CB  . TRP D 1 214 ? 44.689  53.971   108.632 1.00 16.05 ? 295 TRP D CB  1 
ATOM   10516 C CG  . TRP D 1 214 ? 46.177  53.740   108.811 1.00 15.15 ? 295 TRP D CG  1 
ATOM   10517 C CD1 . TRP D 1 214 ? 46.887  53.750   109.975 1.00 14.66 ? 295 TRP D CD1 1 
ATOM   10518 C CD2 . TRP D 1 214 ? 47.111  53.408   107.774 1.00 14.48 ? 295 TRP D CD2 1 
ATOM   10519 N NE1 . TRP D 1 214 ? 48.205  53.446   109.727 1.00 15.42 ? 295 TRP D NE1 1 
ATOM   10520 C CE2 . TRP D 1 214 ? 48.369  53.233   108.383 1.00 13.91 ? 295 TRP D CE2 1 
ATOM   10521 C CE3 . TRP D 1 214 ? 47.005  53.243   106.385 1.00 13.56 ? 295 TRP D CE3 1 
ATOM   10522 C CZ2 . TRP D 1 214 ? 49.516  52.902   107.654 1.00 15.30 ? 295 TRP D CZ2 1 
ATOM   10523 C CZ3 . TRP D 1 214 ? 48.149  52.913   105.659 1.00 15.27 ? 295 TRP D CZ3 1 
ATOM   10524 C CH2 . TRP D 1 214 ? 49.386  52.748   106.294 1.00 14.93 ? 295 TRP D CH2 1 
ATOM   10525 N N   . HIS D 1 215 ? 45.054  56.903   109.380 1.00 16.97 ? 296 HIS D N   1 
ATOM   10526 C CA  . HIS D 1 215 ? 45.880  58.018   109.808 1.00 15.65 ? 296 HIS D CA  1 
ATOM   10527 C C   . HIS D 1 215 ? 45.709  59.309   109.030 1.00 16.10 ? 296 HIS D C   1 
ATOM   10528 O O   . HIS D 1 215 ? 46.693  59.987   108.738 1.00 15.54 ? 296 HIS D O   1 
ATOM   10529 C CB  . HIS D 1 215 ? 47.353  57.613   109.752 1.00 16.14 ? 296 HIS D CB  1 
ATOM   10530 C CG  . HIS D 1 215 ? 47.786  57.079   108.416 1.00 18.76 ? 296 HIS D CG  1 
ATOM   10531 N ND1 . HIS D 1 215 ? 47.069  57.284   107.260 1.00 18.06 ? 296 HIS D ND1 1 
ATOM   10532 C CD2 . HIS D 1 215 ? 48.901  56.395   108.057 1.00 16.94 ? 296 HIS D CD2 1 
ATOM   10533 C CE1 . HIS D 1 215 ? 47.726  56.754   106.238 1.00 18.72 ? 296 HIS D CE1 1 
ATOM   10534 N NE2 . HIS D 1 215 ? 48.837  56.211   106.696 1.00 17.49 ? 296 HIS D NE2 1 
ATOM   10535 N N   . GLY D 1 216 ? 44.469  59.658   108.709 1.00 16.50 ? 297 GLY D N   1 
ATOM   10536 C CA  . GLY D 1 216 ? 44.232  60.882   107.975 1.00 17.42 ? 297 GLY D CA  1 
ATOM   10537 C C   . GLY D 1 216 ? 43.049  61.685   108.479 1.00 18.60 ? 297 GLY D C   1 
ATOM   10538 O O   . GLY D 1 216 ? 41.988  61.131   108.789 1.00 20.54 ? 297 GLY D O   1 
ATOM   10539 N N   . SER D 1 217 ? 43.251  62.997   108.567 1.00 19.10 ? 298 SER D N   1 
ATOM   10540 C CA  . SER D 1 217 ? 42.229  63.950   108.995 1.00 19.40 ? 298 SER D CA  1 
ATOM   10541 C C   . SER D 1 217 ? 41.654  64.583   107.729 1.00 18.13 ? 298 SER D C   1 
ATOM   10542 O O   . SER D 1 217 ? 40.624  65.255   107.751 1.00 16.57 ? 298 SER D O   1 
ATOM   10543 C CB  . SER D 1 217 ? 42.852  65.051   109.846 1.00 20.02 ? 298 SER D CB  1 
ATOM   10544 O OG  . SER D 1 217 ? 43.561  64.496   110.921 1.00 22.74 ? 298 SER D OG  1 
ATOM   10545 N N   . ASN D 1 218 ? 42.379  64.400   106.635 1.00 16.99 ? 299 ASN D N   1 
ATOM   10546 C CA  . ASN D 1 218 ? 41.963  64.892   105.335 1.00 16.84 ? 299 ASN D CA  1 
ATOM   10547 C C   . ASN D 1 218 ? 41.453  63.637   104.627 1.00 16.90 ? 299 ASN D C   1 
ATOM   10548 O O   . ASN D 1 218 ? 41.639  62.535   105.135 1.00 17.50 ? 299 ASN D O   1 
ATOM   10549 C CB  . ASN D 1 218 ? 43.149  65.548   104.604 1.00 15.23 ? 299 ASN D CB  1 
ATOM   10550 C CG  . ASN D 1 218 ? 44.396  64.665   104.567 1.00 15.49 ? 299 ASN D CG  1 
ATOM   10551 O OD1 . ASN D 1 218 ? 44.709  63.953   105.521 1.00 17.61 ? 299 ASN D OD1 1 
ATOM   10552 N ND2 . ASN D 1 218 ? 45.126  64.734   103.464 1.00 15.89 ? 299 ASN D ND2 1 
ATOM   10553 N N   . ARG D 1 219 ? 40.810  63.789   103.477 1.00 16.94 ? 300 ARG D N   1 
ATOM   10554 C CA  . ARG D 1 219 ? 40.258  62.636   102.779 1.00 17.00 ? 300 ARG D CA  1 
ATOM   10555 C C   . ARG D 1 219 ? 41.043  62.178   101.561 1.00 18.03 ? 300 ARG D C   1 
ATOM   10556 O O   . ARG D 1 219 ? 41.725  62.966   100.917 1.00 19.88 ? 300 ARG D O   1 
ATOM   10557 C CB  . ARG D 1 219 ? 38.811  62.924   102.350 1.00 15.36 ? 300 ARG D CB  1 
ATOM   10558 C CG  . ARG D 1 219 ? 37.851  63.206   103.497 1.00 13.63 ? 300 ARG D CG  1 
ATOM   10559 C CD  . ARG D 1 219 ? 36.404  63.157   103.020 1.00 14.84 ? 300 ARG D CD  1 
ATOM   10560 N NE  . ARG D 1 219 ? 35.450  63.227   104.122 1.00 15.87 ? 300 ARG D NE  1 
ATOM   10561 C CZ  . ARG D 1 219 ? 35.292  62.277   105.046 1.00 16.58 ? 300 ARG D CZ  1 
ATOM   10562 N NH1 . ARG D 1 219 ? 34.395  62.435   106.017 1.00 12.26 ? 300 ARG D NH1 1 
ATOM   10563 N NH2 . ARG D 1 219 ? 36.027  61.167   104.996 1.00 11.63 ? 300 ARG D NH2 1 
ATOM   10564 N N   . PRO D 1 220 ? 40.973  60.878   101.247 1.00 18.27 ? 301 PRO D N   1 
ATOM   10565 C CA  . PRO D 1 220 ? 41.698  60.388   100.074 1.00 17.63 ? 301 PRO D CA  1 
ATOM   10566 C C   . PRO D 1 220 ? 40.731  60.331   98.897  1.00 17.03 ? 301 PRO D C   1 
ATOM   10567 O O   . PRO D 1 220 ? 39.510  60.352   99.086  1.00 17.81 ? 301 PRO D O   1 
ATOM   10568 C CB  . PRO D 1 220 ? 42.156  59.004   100.510 1.00 17.64 ? 301 PRO D CB  1 
ATOM   10569 C CG  . PRO D 1 220 ? 40.987  58.530   101.344 1.00 18.53 ? 301 PRO D CG  1 
ATOM   10570 C CD  . PRO D 1 220 ? 40.638  59.768   102.164 1.00 18.50 ? 301 PRO D CD  1 
ATOM   10571 N N   . TRP D 1 221 ? 41.276  60.266   97.690  1.00 16.23 ? 302 TRP D N   1 
ATOM   10572 C CA  . TRP D 1 221 ? 40.448  60.199   96.502  1.00 16.72 ? 302 TRP D CA  1 
ATOM   10573 C C   . TRP D 1 221 ? 41.042  59.299   95.428  1.00 17.42 ? 302 TRP D C   1 
ATOM   10574 O O   . TRP D 1 221 ? 42.261  59.137   95.336  1.00 16.19 ? 302 TRP D O   1 
ATOM   10575 C CB  . TRP D 1 221 ? 40.215  61.607   95.915  1.00 17.23 ? 302 TRP D CB  1 
ATOM   10576 C CG  . TRP D 1 221 ? 41.469  62.360   95.476  1.00 16.62 ? 302 TRP D CG  1 
ATOM   10577 C CD1 . TRP D 1 221 ? 42.137  63.333   96.177  1.00 16.59 ? 302 TRP D CD1 1 
ATOM   10578 C CD2 . TRP D 1 221 ? 42.197  62.186   94.255  1.00 15.96 ? 302 TRP D CD2 1 
ATOM   10579 N NE1 . TRP D 1 221 ? 43.228  63.769   95.467  1.00 16.16 ? 302 TRP D NE1 1 
ATOM   10580 C CE2 . TRP D 1 221 ? 43.289  63.080   94.278  1.00 15.65 ? 302 TRP D CE2 1 
ATOM   10581 C CE3 . TRP D 1 221 ? 42.037  61.356   93.135  1.00 15.87 ? 302 TRP D CE3 1 
ATOM   10582 C CZ2 . TRP D 1 221 ? 44.211  63.172   93.236  1.00 14.57 ? 302 TRP D CZ2 1 
ATOM   10583 C CZ3 . TRP D 1 221 ? 42.959  61.446   92.095  1.00 14.07 ? 302 TRP D CZ3 1 
ATOM   10584 C CH2 . TRP D 1 221 ? 44.027  62.346   92.155  1.00 13.39 ? 302 TRP D CH2 1 
ATOM   10585 N N   . VAL D 1 222 ? 40.157  58.707   94.630  1.00 17.56 ? 303 VAL D N   1 
ATOM   10586 C CA  . VAL D 1 222 ? 40.548  57.857   93.515  1.00 17.64 ? 303 VAL D CA  1 
ATOM   10587 C C   . VAL D 1 222 ? 39.690  58.287   92.348  1.00 18.91 ? 303 VAL D C   1 
ATOM   10588 O O   . VAL D 1 222 ? 38.508  58.568   92.515  1.00 20.62 ? 303 VAL D O   1 
ATOM   10589 C CB  . VAL D 1 222 ? 40.203  56.369   93.698  1.00 17.28 ? 303 VAL D CB  1 
ATOM   10590 C CG1 . VAL D 1 222 ? 41.315  55.521   93.096  1.00 17.18 ? 303 VAL D CG1 1 
ATOM   10591 C CG2 . VAL D 1 222 ? 39.933  56.042   95.141  1.00 16.46 ? 303 VAL D CG2 1 
ATOM   10592 N N   . SER D 1 223 ? 40.275  58.328   91.164  1.00 19.50 ? 304 SER D N   1 
ATOM   10593 C CA  . SER D 1 223 ? 39.525  58.682   89.975  1.00 20.71 ? 304 SER D CA  1 
ATOM   10594 C C   . SER D 1 223 ? 40.069  57.729   88.944  1.00 21.38 ? 304 SER D C   1 
ATOM   10595 O O   . SER D 1 223 ? 41.256  57.407   88.957  1.00 23.69 ? 304 SER D O   1 
ATOM   10596 C CB  . SER D 1 223 ? 39.767  60.142   89.569  1.00 20.75 ? 304 SER D CB  1 
ATOM   10597 O OG  . SER D 1 223 ? 41.138  60.386   89.306  1.00 22.66 ? 304 SER D OG  1 
ATOM   10598 N N   . PHE D 1 224 ? 39.214  57.258   88.057  1.00 21.17 ? 305 PHE D N   1 
ATOM   10599 C CA  . PHE D 1 224 ? 39.676  56.313   87.077  1.00 21.63 ? 305 PHE D CA  1 
ATOM   10600 C C   . PHE D 1 224 ? 38.799  56.281   85.845  1.00 23.86 ? 305 PHE D C   1 
ATOM   10601 O O   . PHE D 1 224 ? 37.652  56.747   85.871  1.00 23.08 ? 305 PHE D O   1 
ATOM   10602 C CB  . PHE D 1 224 ? 39.767  54.922   87.723  1.00 19.38 ? 305 PHE D CB  1 
ATOM   10603 C CG  . PHE D 1 224 ? 38.529  54.509   88.463  1.00 15.68 ? 305 PHE D CG  1 
ATOM   10604 C CD1 . PHE D 1 224 ? 37.457  53.947   87.792  1.00 13.64 ? 305 PHE D CD1 1 
ATOM   10605 C CD2 . PHE D 1 224 ? 38.438  54.685   89.836  1.00 16.03 ? 305 PHE D CD2 1 
ATOM   10606 C CE1 . PHE D 1 224 ? 36.305  53.562   88.474  1.00 13.27 ? 305 PHE D CE1 1 
ATOM   10607 C CE2 . PHE D 1 224 ? 37.295  54.306   90.527  1.00 16.01 ? 305 PHE D CE2 1 
ATOM   10608 C CZ  . PHE D 1 224 ? 36.222  53.741   89.841  1.00 14.39 ? 305 PHE D CZ  1 
ATOM   10609 N N   . ASN D 1 225 ? 39.374  55.744   84.771  1.00 26.18 ? 306 ASN D N   1 
ATOM   10610 C CA  . ASN D 1 225 ? 38.719  55.609   83.472  1.00 29.15 ? 306 ASN D CA  1 
ATOM   10611 C C   . ASN D 1 225 ? 37.831  54.367   83.426  1.00 28.50 ? 306 ASN D C   1 
ATOM   10612 O O   . ASN D 1 225 ? 37.684  53.670   84.426  1.00 28.89 ? 306 ASN D O   1 
ATOM   10613 C CB  . ASN D 1 225 ? 39.775  55.515   82.368  1.00 33.38 ? 306 ASN D CB  1 
ATOM   10614 C CG  . ASN D 1 225 ? 39.155  55.470   80.994  1.00 40.24 ? 306 ASN D CG  1 
ATOM   10615 O OD1 . ASN D 1 225 ? 38.162  56.172   80.729  1.00 43.17 ? 306 ASN D OD1 1 
ATOM   10616 N ND2 . ASN D 1 225 ? 39.721  54.648   80.102  1.00 43.04 ? 306 ASN D ND2 1 
ATOM   10617 N N   . GLN D 1 226 ? 37.248  54.090   82.262  1.00 28.57 ? 308 GLN D N   1 
ATOM   10618 C CA  . GLN D 1 226 ? 36.372  52.932   82.087  1.00 27.81 ? 308 GLN D CA  1 
ATOM   10619 C C   . GLN D 1 226 ? 37.148  51.633   81.921  1.00 27.14 ? 308 GLN D C   1 
ATOM   10620 O O   . GLN D 1 226 ? 36.559  50.561   81.794  1.00 26.35 ? 308 GLN D O   1 
ATOM   10621 C CB  . GLN D 1 226 ? 35.430  53.150   80.895  1.00 28.45 ? 308 GLN D CB  1 
ATOM   10622 C CG  . GLN D 1 226 ? 34.302  54.129   81.219  1.00 30.79 ? 308 GLN D CG  1 
ATOM   10623 C CD  . GLN D 1 226 ? 33.557  54.631   79.990  1.00 32.23 ? 308 GLN D CD  1 
ATOM   10624 O OE1 . GLN D 1 226 ? 32.944  53.858   79.254  1.00 32.40 ? 308 GLN D OE1 1 
ATOM   10625 N NE2 . GLN D 1 226 ? 33.606  55.943   79.768  1.00 34.00 ? 308 GLN D NE2 1 
ATOM   10626 N N   . ASN D 1 227 ? 38.472  51.732   81.926  1.00 26.81 ? 309 ASN D N   1 
ATOM   10627 C CA  . ASN D 1 227 ? 39.307  50.551   81.818  1.00 25.75 ? 309 ASN D CA  1 
ATOM   10628 C C   . ASN D 1 227 ? 40.095  50.374   83.089  1.00 23.90 ? 309 ASN D C   1 
ATOM   10629 O O   . ASN D 1 227 ? 41.123  49.698   83.107  1.00 22.78 ? 309 ASN D O   1 
ATOM   10630 C CB  . ASN D 1 227 ? 40.252  50.669   80.640  1.00 29.62 ? 309 ASN D CB  1 
ATOM   10631 C CG  . ASN D 1 227 ? 39.538  50.515   79.334  1.00 32.97 ? 309 ASN D CG  1 
ATOM   10632 O OD1 . ASN D 1 227 ? 38.643  49.667   79.207  1.00 35.68 ? 309 ASN D OD1 1 
ATOM   10633 N ND2 . ASN D 1 227 ? 39.919  51.320   78.343  1.00 35.14 ? 309 ASN D ND2 1 
ATOM   10634 N N   . LEU D 1 228 ? 39.598  51.005   84.148  1.00 22.48 ? 310 LEU D N   1 
ATOM   10635 C CA  . LEU D 1 228 ? 40.206  50.946   85.470  1.00 20.29 ? 310 LEU D CA  1 
ATOM   10636 C C   . LEU D 1 228 ? 41.616  51.508   85.582  1.00 19.54 ? 310 LEU D C   1 
ATOM   10637 O O   . LEU D 1 228 ? 42.357  51.130   86.481  1.00 20.02 ? 310 LEU D O   1 
ATOM   10638 C CB  . LEU D 1 228 ? 40.146  49.512   86.008  1.00 18.38 ? 310 LEU D CB  1 
ATOM   10639 C CG  . LEU D 1 228 ? 38.808  49.159   86.685  1.00 18.49 ? 310 LEU D CG  1 
ATOM   10640 C CD1 . LEU D 1 228 ? 37.651  49.795   85.938  1.00 17.35 ? 310 LEU D CD1 1 
ATOM   10641 C CD2 . LEU D 1 228 ? 38.643  47.643   86.759  1.00 18.26 ? 310 LEU D CD2 1 
ATOM   10642 N N   . GLU D 1 229 ? 41.981  52.410   84.671  1.00 19.73 ? 311 GLU D N   1 
ATOM   10643 C CA  . GLU D 1 229 ? 43.286  53.079   84.721  1.00 20.68 ? 311 GLU D CA  1 
ATOM   10644 C C   . GLU D 1 229 ? 43.027  54.201   85.731  1.00 19.79 ? 311 GLU D C   1 
ATOM   10645 O O   . GLU D 1 229 ? 42.113  55.002   85.536  1.00 18.86 ? 311 GLU D O   1 
ATOM   10646 C CB  . GLU D 1 229 ? 43.637  53.633   83.346  1.00 21.49 ? 311 GLU D CB  1 
ATOM   10647 C CG  . GLU D 1 229 ? 43.563  52.552   82.296  1.00 25.88 ? 311 GLU D CG  1 
ATOM   10648 C CD  . GLU D 1 229 ? 43.772  53.058   80.887  1.00 29.12 ? 311 GLU D CD  1 
ATOM   10649 O OE1 . GLU D 1 229 ? 43.100  54.037   80.477  1.00 30.76 ? 311 GLU D OE1 1 
ATOM   10650 O OE2 . GLU D 1 229 ? 44.605  52.457   80.176  1.00 32.48 ? 311 GLU D OE2 1 
ATOM   10651 N N   . TYR D 1 230 ? 43.832  54.269   86.791  1.00 18.87 ? 312 TYR D N   1 
ATOM   10652 C CA  . TYR D 1 230 ? 43.586  55.227   87.871  1.00 19.10 ? 312 TYR D CA  1 
ATOM   10653 C C   . TYR D 1 230 ? 44.660  56.185   88.375  1.00 20.03 ? 312 TYR D C   1 
ATOM   10654 O O   . TYR D 1 230 ? 45.837  56.095   88.031  1.00 19.76 ? 312 TYR D O   1 
ATOM   10655 C CB  . TYR D 1 230 ? 43.098  54.438   89.080  1.00 19.49 ? 312 TYR D CB  1 
ATOM   10656 C CG  . TYR D 1 230 ? 44.176  53.533   89.657  1.00 18.26 ? 312 TYR D CG  1 
ATOM   10657 C CD1 . TYR D 1 230 ? 45.037  53.990   90.663  1.00 18.76 ? 312 TYR D CD1 1 
ATOM   10658 C CD2 . TYR D 1 230 ? 44.357  52.233   89.176  1.00 18.80 ? 312 TYR D CD2 1 
ATOM   10659 C CE1 . TYR D 1 230 ? 46.050  53.175   91.179  1.00 17.93 ? 312 TYR D CE1 1 
ATOM   10660 C CE2 . TYR D 1 230 ? 45.373  51.405   89.684  1.00 18.94 ? 312 TYR D CE2 1 
ATOM   10661 C CZ  . TYR D 1 230 ? 46.212  51.884   90.683  1.00 19.72 ? 312 TYR D CZ  1 
ATOM   10662 O OH  . TYR D 1 230 ? 47.206  51.079   91.188  1.00 20.01 ? 312 TYR D OH  1 
ATOM   10663 N N   . GLN D 1 231 ? 44.205  57.086   89.240  1.00 20.76 ? 313 GLN D N   1 
ATOM   10664 C CA  . GLN D 1 231 ? 45.044  58.080   89.900  1.00 22.67 ? 313 GLN D CA  1 
ATOM   10665 C C   . GLN D 1 231 ? 44.548  58.231   91.337  1.00 22.04 ? 313 GLN D C   1 
ATOM   10666 O O   . GLN D 1 231 ? 43.344  58.185   91.600  1.00 23.29 ? 313 GLN D O   1 
ATOM   10667 C CB  . GLN D 1 231 ? 44.968  59.429   89.190  1.00 24.09 ? 313 GLN D CB  1 
ATOM   10668 C CG  . GLN D 1 231 ? 45.512  59.410   87.774  1.00 30.32 ? 313 GLN D CG  1 
ATOM   10669 C CD  . GLN D 1 231 ? 45.560  60.798   87.131  1.00 34.52 ? 313 GLN D CD  1 
ATOM   10670 O OE1 . GLN D 1 231 ? 45.944  60.937   85.965  1.00 36.68 ? 313 GLN D OE1 1 
ATOM   10671 N NE2 . GLN D 1 231 ? 45.173  61.829   87.887  1.00 37.00 ? 313 GLN D NE2 1 
ATOM   10672 N N   . ILE D 1 232 ? 45.478  58.427   92.259  1.00 21.75 ? 314 ILE D N   1 
ATOM   10673 C CA  . ILE D 1 232 ? 45.152  58.561   93.676  1.00 20.41 ? 314 ILE D CA  1 
ATOM   10674 C C   . ILE D 1 232 ? 45.772  59.809   94.295  1.00 19.82 ? 314 ILE D C   1 
ATOM   10675 O O   . ILE D 1 232 ? 46.708  60.381   93.750  1.00 19.29 ? 314 ILE D O   1 
ATOM   10676 C CB  . ILE D 1 232 ? 45.669  57.341   94.462  1.00 19.18 ? 314 ILE D CB  1 
ATOM   10677 C CG1 . ILE D 1 232 ? 47.198  57.261   94.329  1.00 19.45 ? 314 ILE D CG1 1 
ATOM   10678 C CG2 . ILE D 1 232 ? 45.015  56.078   93.947  1.00 17.43 ? 314 ILE D CG2 1 
ATOM   10679 C CD1 . ILE D 1 232 ? 47.818  56.028   94.918  1.00 18.73 ? 314 ILE D CD1 1 
ATOM   10680 N N   . GLY D 1 233 ? 45.245  60.207   95.451  1.00 20.48 ? 315 GLY D N   1 
ATOM   10681 C CA  . GLY D 1 233 ? 45.753  61.367   96.162  1.00 19.02 ? 315 GLY D CA  1 
ATOM   10682 C C   . GLY D 1 233 ? 44.920  61.728   97.381  1.00 18.06 ? 315 GLY D C   1 
ATOM   10683 O O   . GLY D 1 233 ? 44.010  61.003   97.760  1.00 16.35 ? 315 GLY D O   1 
ATOM   10684 N N   . TYR D 1 234 ? 45.254  62.851   98.006  1.00 18.96 ? 316 TYR D N   1 
ATOM   10685 C CA  . TYR D 1 234 ? 44.521  63.347   99.164  1.00 18.43 ? 316 TYR D CA  1 
ATOM   10686 C C   . TYR D 1 234 ? 44.162  64.811   98.935  1.00 19.05 ? 316 TYR D C   1 
ATOM   10687 O O   . TYR D 1 234 ? 44.932  65.563   98.327  1.00 19.55 ? 316 TYR D O   1 
ATOM   10688 C CB  . TYR D 1 234 ? 45.361  63.243   100.450 1.00 17.93 ? 316 TYR D CB  1 
ATOM   10689 C CG  . TYR D 1 234 ? 45.260  61.919   101.202 1.00 18.66 ? 316 TYR D CG  1 
ATOM   10690 C CD1 . TYR D 1 234 ? 45.974  60.792   100.782 1.00 17.03 ? 316 TYR D CD1 1 
ATOM   10691 C CD2 . TYR D 1 234 ? 44.465  61.804   102.351 1.00 16.41 ? 316 TYR D CD2 1 
ATOM   10692 C CE1 . TYR D 1 234 ? 45.905  59.583   101.494 1.00 17.26 ? 316 TYR D CE1 1 
ATOM   10693 C CE2 . TYR D 1 234 ? 44.387  60.601   103.065 1.00 17.29 ? 316 TYR D CE2 1 
ATOM   10694 C CZ  . TYR D 1 234 ? 45.109  59.499   102.633 1.00 17.79 ? 316 TYR D CZ  1 
ATOM   10695 O OH  . TYR D 1 234 ? 45.042  58.326   103.340 1.00 17.01 ? 316 TYR D OH  1 
ATOM   10696 N N   . ILE D 1 235 ? 42.984  65.207   99.407  1.00 18.48 ? 317 ILE D N   1 
ATOM   10697 C CA  . ILE D 1 235 ? 42.548  66.593   99.297  1.00 18.21 ? 317 ILE D CA  1 
ATOM   10698 C C   . ILE D 1 235 ? 43.493  67.405   100.194 1.00 18.19 ? 317 ILE D C   1 
ATOM   10699 O O   . ILE D 1 235 ? 43.600  67.150   101.400 1.00 18.09 ? 317 ILE D O   1 
ATOM   10700 C CB  . ILE D 1 235 ? 41.091  66.743   99.760  1.00 18.04 ? 317 ILE D CB  1 
ATOM   10701 C CG1 . ILE D 1 235 ? 40.195  65.851   98.894  1.00 16.94 ? 317 ILE D CG1 1 
ATOM   10702 C CG2 . ILE D 1 235 ? 40.666  68.200   99.678  1.00 17.75 ? 317 ILE D CG2 1 
ATOM   10703 C CD1 . ILE D 1 235 ? 38.734  65.977   99.185  1.00 16.51 ? 317 ILE D CD1 1 
ATOM   10704 N N   . CYS D 1 236 ? 44.171  68.377   99.586  1.00 18.34 ? 318 CYS D N   1 
ATOM   10705 C CA  . CYS D 1 236 ? 45.182  69.191   100.259 1.00 19.23 ? 318 CYS D CA  1 
ATOM   10706 C C   . CYS D 1 236 ? 44.710  70.384   101.090 1.00 18.53 ? 318 CYS D C   1 
ATOM   10707 O O   . CYS D 1 236 ? 45.484  70.945   101.877 1.00 17.81 ? 318 CYS D O   1 
ATOM   10708 C CB  . CYS D 1 236 ? 46.203  69.685   99.226  1.00 19.96 ? 318 CYS D CB  1 
ATOM   10709 S SG  . CYS D 1 236 ? 46.523  68.642   97.756  1.00 22.89 ? 318 CYS D SG  1 
ATOM   10710 N N   . SER D 1 237 ? 43.447  70.761   100.922 1.00 18.56 ? 319 SER D N   1 
ATOM   10711 C CA  . SER D 1 237 ? 42.883  71.900   101.633 1.00 17.88 ? 319 SER D CA  1 
ATOM   10712 C C   . SER D 1 237 ? 43.050  71.873   103.146 1.00 18.53 ? 319 SER D C   1 
ATOM   10713 O O   . SER D 1 237 ? 42.785  70.871   103.816 1.00 18.28 ? 319 SER D O   1 
ATOM   10714 C CB  . SER D 1 237 ? 41.394  72.055   101.299 1.00 17.27 ? 319 SER D CB  1 
ATOM   10715 O OG  . SER D 1 237 ? 40.798  73.080   102.084 1.00 15.50 ? 319 SER D OG  1 
ATOM   10716 N N   . GLY D 1 238 ? 43.490  73.010   103.665 1.00 19.33 ? 320 GLY D N   1 
ATOM   10717 C CA  . GLY D 1 238 ? 43.667  73.173   105.091 1.00 20.75 ? 320 GLY D CA  1 
ATOM   10718 C C   . GLY D 1 238 ? 42.333  73.157   105.819 1.00 20.87 ? 320 GLY D C   1 
ATOM   10719 O O   . GLY D 1 238 ? 42.292  73.314   107.039 1.00 21.42 ? 320 GLY D O   1 
ATOM   10720 N N   . VAL D 1 239 ? 41.240  72.997   105.071 1.00 21.11 ? 321 VAL D N   1 
ATOM   10721 C CA  . VAL D 1 239 ? 39.903  72.903   105.663 1.00 20.31 ? 321 VAL D CA  1 
ATOM   10722 C C   . VAL D 1 239 ? 39.655  71.394   105.780 1.00 19.54 ? 321 VAL D C   1 
ATOM   10723 O O   . VAL D 1 239 ? 38.924  70.816   104.980 1.00 19.64 ? 321 VAL D O   1 
ATOM   10724 C CB  . VAL D 1 239 ? 38.799  73.561   104.748 1.00 20.11 ? 321 VAL D CB  1 
ATOM   10725 C CG1 . VAL D 1 239 ? 37.413  73.378   105.370 1.00 18.04 ? 321 VAL D CG1 1 
ATOM   10726 C CG2 . VAL D 1 239 ? 39.080  75.060   104.563 1.00 18.52 ? 321 VAL D CG2 1 
ATOM   10727 N N   . PHE D 1 240 ? 40.294  70.767   106.768 1.00 19.06 ? 322 PHE D N   1 
ATOM   10728 C CA  . PHE D 1 240 ? 40.190  69.321   106.996 1.00 19.26 ? 322 PHE D CA  1 
ATOM   10729 C C   . PHE D 1 240 ? 38.749  68.807   106.987 1.00 18.43 ? 322 PHE D C   1 
ATOM   10730 O O   . PHE D 1 240 ? 37.883  69.352   107.682 1.00 19.18 ? 322 PHE D O   1 
ATOM   10731 C CB  . PHE D 1 240 ? 40.860  68.955   108.326 1.00 19.90 ? 322 PHE D CB  1 
ATOM   10732 C CG  . PHE D 1 240 ? 42.273  69.444   108.441 1.00 21.72 ? 322 PHE D CG  1 
ATOM   10733 C CD1 . PHE D 1 240 ? 42.610  70.412   109.382 1.00 21.55 ? 322 PHE D CD1 1 
ATOM   10734 C CD2 . PHE D 1 240 ? 43.261  68.979   107.572 1.00 22.33 ? 322 PHE D CD2 1 
ATOM   10735 C CE1 . PHE D 1 240 ? 43.901  70.907   109.452 1.00 21.85 ? 322 PHE D CE1 1 
ATOM   10736 C CE2 . PHE D 1 240 ? 44.561  69.474   107.637 1.00 21.35 ? 322 PHE D CE2 1 
ATOM   10737 C CZ  . PHE D 1 240 ? 44.880  70.437   108.575 1.00 20.89 ? 322 PHE D CZ  1 
ATOM   10738 N N   . GLY D 1 241 ? 38.508  67.740   106.223 1.00 15.88 ? 323 GLY D N   1 
ATOM   10739 C CA  . GLY D 1 241 ? 37.164  67.189   106.115 1.00 15.98 ? 323 GLY D CA  1 
ATOM   10740 C C   . GLY D 1 241 ? 36.770  65.978   106.952 1.00 15.22 ? 323 GLY D C   1 
ATOM   10741 O O   . GLY D 1 241 ? 35.581  65.730   107.152 1.00 14.71 ? 323 GLY D O   1 
ATOM   10742 N N   . ASP D 1 242 ? 37.743  65.214   107.431 1.00 14.65 ? 324 ASP D N   1 
ATOM   10743 C CA  . ASP D 1 242 ? 37.429  64.039   108.238 1.00 16.05 ? 324 ASP D CA  1 
ATOM   10744 C C   . ASP D 1 242 ? 37.006  64.500   109.632 1.00 15.68 ? 324 ASP D C   1 
ATOM   10745 O O   . ASP D 1 242 ? 37.170  65.668   109.997 1.00 16.31 ? 324 ASP D O   1 
ATOM   10746 C CB  . ASP D 1 242 ? 38.652  63.102   108.342 1.00 13.38 ? 324 ASP D CB  1 
ATOM   10747 C CG  . ASP D 1 242 ? 38.263  61.635   108.586 1.00 14.87 ? 324 ASP D CG  1 
ATOM   10748 O OD1 . ASP D 1 242 ? 39.176  60.770   108.728 1.00 15.78 ? 324 ASP D OD1 1 
ATOM   10749 O OD2 . ASP D 1 242 ? 37.043  61.349   108.630 1.00 10.79 ? 324 ASP D OD2 1 
ATOM   10750 N N   . ASN D 1 243 ? 36.432  63.580   110.394 1.00 15.72 ? 325 ASN D N   1 
ATOM   10751 C CA  . ASN D 1 243 ? 36.022  63.859   111.758 1.00 15.97 ? 325 ASN D CA  1 
ATOM   10752 C C   . ASN D 1 243 ? 36.257  62.583   112.529 1.00 15.02 ? 325 ASN D C   1 
ATOM   10753 O O   . ASN D 1 243 ? 35.781  61.534   112.139 1.00 16.75 ? 325 ASN D O   1 
ATOM   10754 C CB  . ASN D 1 243 ? 34.542  64.251   111.822 1.00 17.50 ? 325 ASN D CB  1 
ATOM   10755 C CG  . ASN D 1 243 ? 34.002  64.278   113.246 1.00 19.80 ? 325 ASN D CG  1 
ATOM   10756 O OD1 . ASN D 1 243 ? 33.493  63.276   113.742 1.00 21.32 ? 325 ASN D OD1 1 
ATOM   10757 N ND2 . ASN D 1 243 ? 34.129  65.424   113.916 1.00 19.04 ? 325 ASN D ND2 1 
ATOM   10758 N N   . PRO D 1 244 ? 37.041  62.643   113.608 1.00 15.28 ? 326 PRO D N   1 
ATOM   10759 C CA  . PRO D 1 244 ? 37.680  63.841   114.157 1.00 15.33 ? 326 PRO D CA  1 
ATOM   10760 C C   . PRO D 1 244 ? 38.733  64.391   113.203 1.00 14.46 ? 326 PRO D C   1 
ATOM   10761 O O   . PRO D 1 244 ? 39.116  63.736   112.239 1.00 15.42 ? 326 PRO D O   1 
ATOM   10762 C CB  . PRO D 1 244 ? 38.318  63.327   115.439 1.00 14.97 ? 326 PRO D CB  1 
ATOM   10763 C CG  . PRO D 1 244 ? 38.800  61.974   115.004 1.00 13.78 ? 326 PRO D CG  1 
ATOM   10764 C CD  . PRO D 1 244 ? 37.564  61.437   114.275 1.00 15.61 ? 326 PRO D CD  1 
ATOM   10765 N N   . ARG D 1 245 ? 39.195  65.595   113.510 1.00 14.27 ? 327 ARG D N   1 
ATOM   10766 C CA  . ARG D 1 245 ? 40.196  66.287   112.728 1.00 13.81 ? 327 ARG D CA  1 
ATOM   10767 C C   . ARG D 1 245 ? 40.745  67.403   113.606 1.00 14.68 ? 327 ARG D C   1 
ATOM   10768 O O   . ARG D 1 245 ? 40.211  67.677   114.680 1.00 15.56 ? 327 ARG D O   1 
ATOM   10769 C CB  . ARG D 1 245 ? 39.548  66.900   111.489 1.00 13.97 ? 327 ARG D CB  1 
ATOM   10770 C CG  . ARG D 1 245 ? 38.394  67.853   111.812 1.00 12.37 ? 327 ARG D CG  1 
ATOM   10771 C CD  . ARG D 1 245 ? 38.063  68.737   110.610 1.00 13.46 ? 327 ARG D CD  1 
ATOM   10772 N NE  . ARG D 1 245 ? 37.119  69.809   110.925 1.00 13.48 ? 327 ARG D NE  1 
ATOM   10773 C CZ  . ARG D 1 245 ? 35.810  69.639   111.100 1.00 14.07 ? 327 ARG D CZ  1 
ATOM   10774 N NH1 . ARG D 1 245 ? 35.044  70.681   111.385 1.00 12.32 ? 327 ARG D NH1 1 
ATOM   10775 N NH2 . ARG D 1 245 ? 35.265  68.432   110.977 1.00 14.91 ? 327 ARG D NH2 1 
ATOM   10776 N N   . PRO D 1 246 ? 41.841  68.044   113.181 1.00 15.11 ? 328 PRO D N   1 
ATOM   10777 C CA  . PRO D 1 246 ? 42.373  69.131   114.007 1.00 14.63 ? 328 PRO D CA  1 
ATOM   10778 C C   . PRO D 1 246 ? 41.766  70.448   113.519 1.00 15.82 ? 328 PRO D C   1 
ATOM   10779 O O   . PRO D 1 246 ? 41.063  70.473   112.502 1.00 16.96 ? 328 PRO D O   1 
ATOM   10780 C CB  . PRO D 1 246 ? 43.867  69.048   113.744 1.00 14.50 ? 328 PRO D CB  1 
ATOM   10781 C CG  . PRO D 1 246 ? 43.918  68.649   112.300 1.00 13.80 ? 328 PRO D CG  1 
ATOM   10782 C CD  . PRO D 1 246 ? 42.851  67.581   112.208 1.00 13.87 ? 328 PRO D CD  1 
ATOM   10783 N N   . ASN D 1 247 ? 42.009  71.539   114.236 1.00 16.07 ? 329 ASN D N   1 
ATOM   10784 C CA  . ASN D 1 247 ? 41.479  72.825   113.794 1.00 17.01 ? 329 ASN D CA  1 
ATOM   10785 C C   . ASN D 1 247 ? 42.060  73.138   112.416 1.00 17.16 ? 329 ASN D C   1 
ATOM   10786 O O   . ASN D 1 247 ? 43.122  72.640   112.038 1.00 15.30 ? 329 ASN D O   1 
ATOM   10787 C CB  . ASN D 1 247 ? 41.839  73.936   114.781 1.00 17.71 ? 329 ASN D CB  1 
ATOM   10788 C CG  . ASN D 1 247 ? 41.158  73.761   116.127 1.00 22.03 ? 329 ASN D CG  1 
ATOM   10789 O OD1 . ASN D 1 247 ? 39.932  73.797   116.226 1.00 24.42 ? 329 ASN D OD1 1 
ATOM   10790 N ND2 . ASN D 1 247 ? 41.953  73.566   117.172 1.00 23.99 ? 329 ASN D ND2 1 
ATOM   10791 N N   . ASP D 1 248 ? 41.358  73.957   111.654 1.00 18.17 ? 330 ASP D N   1 
ATOM   10792 C CA  . ASP D 1 248 ? 41.842  74.278   110.326 1.00 19.47 ? 330 ASP D CA  1 
ATOM   10793 C C   . ASP D 1 248 ? 43.197  74.963   110.298 1.00 20.00 ? 330 ASP D C   1 
ATOM   10794 O O   . ASP D 1 248 ? 43.527  75.762   111.178 1.00 19.18 ? 330 ASP D O   1 
ATOM   10795 C CB  . ASP D 1 248 ? 40.813  75.124   109.596 1.00 19.76 ? 330 ASP D CB  1 
ATOM   10796 C CG  . ASP D 1 248 ? 39.565  74.354   109.297 1.00 20.44 ? 330 ASP D CG  1 
ATOM   10797 O OD1 . ASP D 1 248 ? 39.649  73.106   109.232 1.00 19.36 ? 330 ASP D OD1 1 
ATOM   10798 O OD2 . ASP D 1 248 ? 38.510  74.993   109.113 1.00 21.88 ? 330 ASP D OD2 1 
ATOM   10799 N N   . GLY D 1 249 ? 43.973  74.635   109.269 1.00 20.93 ? 331 GLY D N   1 
ATOM   10800 C CA  . GLY D 1 249 ? 45.297  75.209   109.108 1.00 22.86 ? 331 GLY D CA  1 
ATOM   10801 C C   . GLY D 1 249 ? 45.986  74.832   107.804 1.00 23.99 ? 331 GLY D C   1 
ATOM   10802 O O   . GLY D 1 249 ? 45.418  74.942   106.706 1.00 24.79 ? 331 GLY D O   1 
ATOM   10803 N N   . THR D 1 250 ? 47.233  74.399   107.915 1.00 24.18 ? 332 THR D N   1 
ATOM   10804 C CA  . THR D 1 250 ? 47.997  74.002   106.743 1.00 24.28 ? 332 THR D CA  1 
ATOM   10805 C C   . THR D 1 250 ? 47.748  72.515   106.462 1.00 24.25 ? 332 THR D C   1 
ATOM   10806 O O   . THR D 1 250 ? 48.099  71.652   107.275 1.00 23.45 ? 332 THR D O   1 
ATOM   10807 C CB  . THR D 1 250 ? 49.505  74.228   106.967 1.00 25.44 ? 332 THR D CB  1 
ATOM   10808 O OG1 . THR D 1 250 ? 49.739  75.591   107.357 1.00 24.55 ? 332 THR D OG1 1 
ATOM   10809 C CG2 . THR D 1 250 ? 50.284  73.907   105.689 1.00 24.28 ? 332 THR D CG2 1 
ATOM   10810 N N   . GLY D 1 251 ? 47.139  72.232   105.311 1.00 23.57 ? 333 GLY D N   1 
ATOM   10811 C CA  . GLY D 1 251 ? 46.833  70.865   104.942 1.00 22.50 ? 333 GLY D CA  1 
ATOM   10812 C C   . GLY D 1 251 ? 47.978  70.162   104.243 1.00 20.98 ? 333 GLY D C   1 
ATOM   10813 O O   . GLY D 1 251 ? 49.119  70.620   104.280 1.00 19.88 ? 333 GLY D O   1 
ATOM   10814 N N   . SER D 1 252 ? 47.677  69.038   103.601 1.00 19.90 ? 335 SER D N   1 
ATOM   10815 C CA  . SER D 1 252 ? 48.700  68.271   102.893 1.00 18.87 ? 335 SER D CA  1 
ATOM   10816 C C   . SER D 1 252 ? 48.085  67.499   101.738 1.00 18.95 ? 335 SER D C   1 
ATOM   10817 O O   . SER D 1 252 ? 46.904  67.198   101.740 1.00 18.08 ? 335 SER D O   1 
ATOM   10818 C CB  . SER D 1 252 ? 49.362  67.284   103.847 1.00 19.64 ? 335 SER D CB  1 
ATOM   10819 O OG  . SER D 1 252 ? 50.302  66.468   103.170 1.00 19.21 ? 335 SER D OG  1 
ATOM   10820 N N   . CYS D 1 253 ? 48.881  67.172   100.736 1.00 19.87 ? 336 CYS D N   1 
ATOM   10821 C CA  . CYS D 1 253 ? 48.324  66.410   99.627  1.00 21.60 ? 336 CYS D CA  1 
ATOM   10822 C C   . CYS D 1 253 ? 48.542  64.922   99.911  1.00 19.73 ? 336 CYS D C   1 
ATOM   10823 O O   . CYS D 1 253 ? 48.528  64.079   99.000  1.00 19.69 ? 336 CYS D O   1 
ATOM   10824 C CB  . CYS D 1 253 ? 48.969  66.780   98.313  1.00 22.61 ? 336 CYS D CB  1 
ATOM   10825 S SG  . CYS D 1 253 ? 48.549  68.428   97.707  1.00 29.84 ? 336 CYS D SG  1 
ATOM   10826 N N   . GLY D 1 254 ? 48.715  64.610   101.195 1.00 19.48 ? 339 GLY D N   1 
ATOM   10827 C CA  . GLY D 1 254 ? 48.915  63.239   101.627 1.00 17.38 ? 339 GLY D CA  1 
ATOM   10828 C C   . GLY D 1 254 ? 48.246  63.141   102.976 1.00 16.89 ? 339 GLY D C   1 
ATOM   10829 O O   . GLY D 1 254 ? 47.651  64.114   103.445 1.00 17.05 ? 339 GLY D O   1 
ATOM   10830 N N   . PRO D 1 255 ? 48.331  61.987   103.635 1.00 16.31 ? 340 PRO D N   1 
ATOM   10831 C CA  . PRO D 1 255 ? 47.691  61.846   104.944 1.00 16.08 ? 340 PRO D CA  1 
ATOM   10832 C C   . PRO D 1 255 ? 48.053  62.864   106.028 1.00 14.99 ? 340 PRO D C   1 
ATOM   10833 O O   . PRO D 1 255 ? 49.208  62.912   106.437 1.00 14.19 ? 340 PRO D O   1 
ATOM   10834 C CB  . PRO D 1 255 ? 48.120  60.444   105.397 1.00 16.40 ? 340 PRO D CB  1 
ATOM   10835 C CG  . PRO D 1 255 ? 48.402  59.721   104.137 1.00 17.24 ? 340 PRO D CG  1 
ATOM   10836 C CD  . PRO D 1 255 ? 49.070  60.762   103.276 1.00 16.24 ? 340 PRO D CD  1 
ATOM   10837 N N   . VAL D 1 256 ? 47.095  63.663   106.498 1.00 13.79 ? 341 VAL D N   1 
ATOM   10838 C CA  . VAL D 1 256 ? 47.387  64.584   107.595 1.00 15.31 ? 341 VAL D CA  1 
ATOM   10839 C C   . VAL D 1 256 ? 47.271  63.705   108.870 1.00 16.15 ? 341 VAL D C   1 
ATOM   10840 O O   . VAL D 1 256 ? 46.176  63.330   109.296 1.00 15.71 ? 341 VAL D O   1 
ATOM   10841 C CB  . VAL D 1 256 ? 46.369  65.751   107.649 1.00 16.60 ? 341 VAL D CB  1 
ATOM   10842 C CG1 . VAL D 1 256 ? 46.612  66.566   108.881 1.00 15.65 ? 341 VAL D CG1 1 
ATOM   10843 C CG2 . VAL D 1 256 ? 46.483  66.650   106.399 1.00 16.54 ? 341 VAL D CG2 1 
ATOM   10844 N N   . SER D 1 257 ? 48.416  63.350   109.438 1.00 15.55 ? 342 SER D N   1 
ATOM   10845 C CA  . SER D 1 257 ? 48.477  62.472   110.604 1.00 18.81 ? 342 SER D CA  1 
ATOM   10846 C C   . SER D 1 257 ? 47.811  62.875   111.943 1.00 19.55 ? 342 SER D C   1 
ATOM   10847 O O   . SER D 1 257 ? 47.462  61.980   112.715 1.00 19.58 ? 342 SER D O   1 
ATOM   10848 C CB  . SER D 1 257 ? 49.934  62.125   110.887 1.00 17.94 ? 342 SER D CB  1 
ATOM   10849 O OG  . SER D 1 257 ? 50.566  63.161   111.614 1.00 17.40 ? 342 SER D OG  1 
ATOM   10850 N N   . SER D 1 258 ? 47.660  64.174   112.232 1.00 20.46 ? 344 SER D N   1 
ATOM   10851 C CA  . SER D 1 258 ? 47.060  64.593   113.494 1.00 24.03 ? 344 SER D CA  1 
ATOM   10852 C C   . SER D 1 258 ? 45.571  64.371   113.597 1.00 25.83 ? 344 SER D C   1 
ATOM   10853 O O   . SER D 1 258 ? 44.793  64.950   112.850 1.00 25.35 ? 344 SER D O   1 
ATOM   10854 C CB  . SER D 1 258 ? 47.411  66.060   113.831 1.00 22.19 ? 344 SER D CB  1 
ATOM   10855 O OG  . SER D 1 258 ? 46.687  66.990   113.047 1.00 27.47 ? 344 SER D OG  1 
ATOM   10856 N N   . ASN D 1 259 ? 45.203  63.527   114.555