data_2HUE
# 
_entry.id   2HUE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2HUE         pdb_00002hue 10.2210/pdb2hue/pdb 
RCSB  RCSB038772   ?            ?                   
WWPDB D_1000038772 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KX5 'X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution' unspecified 
PDB 1ROC 'Crystal structure of the histone deposition protein Asf1'                     unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HUE 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'English, C.M.'     1 
'Churchill, M.E.A.' 2 
'Tyler, J.K.'       3 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for the histone chaperone activity of asf1.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            127 
_citation.page_first                495 
_citation.page_last                 508 
_citation.year                      2006 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17081973 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2006.08.047 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'English, C.M.'   1 ? 
primary 'Adkins, M.W.'    2 ? 
primary 'Carson, J.J.'    3 ? 
primary 'Churchill, M.E.' 4 ? 
primary 'Tyler, J.K.'     5 ? 
# 
_cell.entry_id           2HUE 
_cell.length_a           95.749 
_cell.length_b           95.749 
_cell.length_c           110.676 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HUE 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Anti-silencing protein 1' 19663.973 1   ? ?     'residues 2-169'  ? 
2 polymer     man 'Histone H3'               8888.460  1   ? G103A 'residues 62-136' ? 
3 polymer     man 'Histone H4'               9540.251  1   ? ?     'residues 20-102' ? 
4 non-polymer syn 'ZINC ION'                 65.409    1   ? ?     ?                 ? 
5 non-polymer syn GLYCEROL                   92.094    2   ? ?     ?                 ? 
6 non-polymer syn 'SULFATE ION'              96.063    2   ? ?     ?                 ? 
7 water       nat water                      18.015    367 ? ?     ?                 ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;PLGSPNSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVF
SADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
NENEGDLYPPEQPGV
;
;PLGSPNSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVF
SADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
NENEGDLYPPEQPGV
;
A ? 
2 'polypeptide(L)' no no MALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 
MALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA B ? 
3 'polypeptide(L)' no no 
;MKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY
GFGG
;
;MKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY
GFGG
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   LEU n 
1 3   GLY n 
1 4   SER n 
1 5   PRO n 
1 6   ASN n 
1 7   SER n 
1 8   SER n 
1 9   ILE n 
1 10  VAL n 
1 11  SER n 
1 12  LEU n 
1 13  LEU n 
1 14  GLY n 
1 15  ILE n 
1 16  LYS n 
1 17  VAL n 
1 18  LEU n 
1 19  ASN n 
1 20  ASN n 
1 21  PRO n 
1 22  ALA n 
1 23  LYS n 
1 24  PHE n 
1 25  THR n 
1 26  ASP n 
1 27  PRO n 
1 28  TYR n 
1 29  GLU n 
1 30  PHE n 
1 31  GLU n 
1 32  ILE n 
1 33  THR n 
1 34  PHE n 
1 35  GLU n 
1 36  CYS n 
1 37  LEU n 
1 38  GLU n 
1 39  SER n 
1 40  LEU n 
1 41  LYS n 
1 42  HIS n 
1 43  ASP n 
1 44  LEU n 
1 45  GLU n 
1 46  TRP n 
1 47  LYS n 
1 48  LEU n 
1 49  THR n 
1 50  TYR n 
1 51  VAL n 
1 52  GLY n 
1 53  SER n 
1 54  SER n 
1 55  ARG n 
1 56  SER n 
1 57  LEU n 
1 58  ASP n 
1 59  HIS n 
1 60  ASP n 
1 61  GLN n 
1 62  GLU n 
1 63  LEU n 
1 64  ASP n 
1 65  SER n 
1 66  ILE n 
1 67  LEU n 
1 68  VAL n 
1 69  GLY n 
1 70  PRO n 
1 71  VAL n 
1 72  PRO n 
1 73  VAL n 
1 74  GLY n 
1 75  VAL n 
1 76  ASN n 
1 77  LYS n 
1 78  PHE n 
1 79  VAL n 
1 80  PHE n 
1 81  SER n 
1 82  ALA n 
1 83  ASP n 
1 84  PRO n 
1 85  PRO n 
1 86  SER n 
1 87  ALA n 
1 88  GLU n 
1 89  LEU n 
1 90  ILE n 
1 91  PRO n 
1 92  ALA n 
1 93  SER n 
1 94  GLU n 
1 95  LEU n 
1 96  VAL n 
1 97  SER n 
1 98  VAL n 
1 99  THR n 
1 100 VAL n 
1 101 ILE n 
1 102 LEU n 
1 103 LEU n 
1 104 SER n 
1 105 CYS n 
1 106 SER n 
1 107 TYR n 
1 108 ASP n 
1 109 GLY n 
1 110 ARG n 
1 111 GLU n 
1 112 PHE n 
1 113 VAL n 
1 114 ARG n 
1 115 VAL n 
1 116 GLY n 
1 117 TYR n 
1 118 TYR n 
1 119 VAL n 
1 120 ASN n 
1 121 ASN n 
1 122 GLU n 
1 123 TYR n 
1 124 ASP n 
1 125 GLU n 
1 126 GLU n 
1 127 GLU n 
1 128 LEU n 
1 129 ARG n 
1 130 GLU n 
1 131 ASN n 
1 132 PRO n 
1 133 PRO n 
1 134 ALA n 
1 135 LYS n 
1 136 VAL n 
1 137 GLN n 
1 138 VAL n 
1 139 ASP n 
1 140 HIS n 
1 141 ILE n 
1 142 VAL n 
1 143 ARG n 
1 144 ASN n 
1 145 ILE n 
1 146 LEU n 
1 147 ALA n 
1 148 GLU n 
1 149 LYS n 
1 150 PRO n 
1 151 ARG n 
1 152 VAL n 
1 153 THR n 
1 154 ARG n 
1 155 PHE n 
1 156 ASN n 
1 157 ILE n 
1 158 VAL n 
1 159 TRP n 
1 160 ASP n 
1 161 ASN n 
1 162 GLU n 
1 163 ASN n 
1 164 GLU n 
1 165 GLY n 
1 166 ASP n 
1 167 LEU n 
1 168 TYR n 
1 169 PRO n 
1 170 PRO n 
1 171 GLU n 
1 172 GLN n 
1 173 PRO n 
1 174 GLY n 
1 175 VAL n 
2 1   MET n 
2 2   ALA n 
2 3   LEU n 
2 4   ILE n 
2 5   ARG n 
2 6   LYS n 
2 7   LEU n 
2 8   PRO n 
2 9   PHE n 
2 10  GLN n 
2 11  ARG n 
2 12  LEU n 
2 13  VAL n 
2 14  ARG n 
2 15  GLU n 
2 16  ILE n 
2 17  ALA n 
2 18  GLN n 
2 19  ASP n 
2 20  PHE n 
2 21  LYS n 
2 22  THR n 
2 23  ASP n 
2 24  LEU n 
2 25  ARG n 
2 26  PHE n 
2 27  GLN n 
2 28  SER n 
2 29  SER n 
2 30  ALA n 
2 31  VAL n 
2 32  MET n 
2 33  ALA n 
2 34  LEU n 
2 35  GLN n 
2 36  GLU n 
2 37  ALA n 
2 38  SER n 
2 39  GLU n 
2 40  ALA n 
2 41  TYR n 
2 42  LEU n 
2 43  VAL n 
2 44  ALA n 
2 45  LEU n 
2 46  PHE n 
2 47  GLU n 
2 48  ASP n 
2 49  THR n 
2 50  ASN n 
2 51  LEU n 
2 52  CYS n 
2 53  ALA n 
2 54  ILE n 
2 55  HIS n 
2 56  ALA n 
2 57  LYS n 
2 58  ARG n 
2 59  VAL n 
2 60  THR n 
2 61  ILE n 
2 62  MET n 
2 63  PRO n 
2 64  LYS n 
2 65  ASP n 
2 66  ILE n 
2 67  GLN n 
2 68  LEU n 
2 69  ALA n 
2 70  ARG n 
2 71  ARG n 
2 72  ILE n 
2 73  ARG n 
2 74  GLY n 
2 75  GLU n 
2 76  ARG n 
2 77  ALA n 
3 1   MET n 
3 2   LYS n 
3 3   VAL n 
3 4   LEU n 
3 5   ARG n 
3 6   ASP n 
3 7   ASN n 
3 8   ILE n 
3 9   GLN n 
3 10  GLY n 
3 11  ILE n 
3 12  THR n 
3 13  LYS n 
3 14  PRO n 
3 15  ALA n 
3 16  ILE n 
3 17  ARG n 
3 18  ARG n 
3 19  LEU n 
3 20  ALA n 
3 21  ARG n 
3 22  ARG n 
3 23  GLY n 
3 24  GLY n 
3 25  VAL n 
3 26  LYS n 
3 27  ARG n 
3 28  ILE n 
3 29  SER n 
3 30  GLY n 
3 31  LEU n 
3 32  ILE n 
3 33  TYR n 
3 34  GLU n 
3 35  GLU n 
3 36  THR n 
3 37  ARG n 
3 38  GLY n 
3 39  VAL n 
3 40  LEU n 
3 41  LYS n 
3 42  VAL n 
3 43  PHE n 
3 44  LEU n 
3 45  GLU n 
3 46  ASN n 
3 47  VAL n 
3 48  ILE n 
3 49  ARG n 
3 50  ASP n 
3 51  ALA n 
3 52  VAL n 
3 53  THR n 
3 54  TYR n 
3 55  THR n 
3 56  GLU n 
3 57  HIS n 
3 58  ALA n 
3 59  LYS n 
3 60  ARG n 
3 61  LYS n 
3 62  THR n 
3 63  VAL n 
3 64  THR n 
3 65  ALA n 
3 66  MET n 
3 67  ASP n 
3 68  VAL n 
3 69  VAL n 
3 70  TYR n 
3 71  ALA n 
3 72  LEU n 
3 73  LYS n 
3 74  ARG n 
3 75  GLN n 
3 76  GLY n 
3 77  ARG n 
3 78  THR n 
3 79  LEU n 
3 80  TYR n 
3 81  GLY n 
3 82  PHE n 
3 83  GLY n 
3 84  GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 
;baker's yeast
;
Saccharomyces ASF1 ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
'Rosetta DE3 PLys S' ? ? ? ? ? ? ? plasmid ? ? ? PST39 ? ? 
2 1 sample ? ? ? 'African clawed frog' Xenopus       H3l  ? ? ? ? ? ? 'Xenopus laevis'           8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? 'Rosetta DE3 Plys S' ? ? ? ? ? ? ? plasmid ? ? ? PST39 ? ? 
3 1 sample ? ? ? 'African clawed frog' Xenopus       ?    ? ? ? ? ? ? 'Xenopus laevis'           8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? 'Rosetta DE3 Plys S' ? ? ? ? ? ? ? plasmid ? ? ? PST39 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ASF1_YEAST   P32447 1 
;SIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSA
ELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGDL
YPPEQPGV
;
2  ? 
2 UNP Q92133_XENLA Q92133 2 LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA 62 ? 
3 UNP H4_XENLA     P62799 3 
;KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
FGG
;
20 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HUE A 8 ? 175 ? P32447 2  ? 169 ? 2  169 
2 2 2HUE B 3 ? 77  ? Q92133 62 ? 136 ? 61 135 
3 3 2HUE C 2 ? 84  ? P62799 20 ? 102 ? 20 102 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HUE PRO A 1  ? UNP P32447 ?   ?   'cloning artifact'      -5  1  
1 2HUE LEU A 2  ? UNP P32447 ?   ?   'cloning artifact'      -4  2  
1 2HUE GLY A 3  ? UNP P32447 ?   ?   'cloning artifact'      -3  3  
1 2HUE SER A 4  ? UNP P32447 ?   ?   'cloning artifact'      -2  4  
1 2HUE PRO A 5  ? UNP P32447 ?   ?   'cloning artifact'      -1  5  
1 2HUE ASN A 6  ? UNP P32447 ?   ?   'cloning artifact'      0   6  
1 2HUE SER A 7  ? UNP P32447 ?   ?   'cloning artifact'      1   7  
2 2HUE MET B 1  ? UNP Q92133 ?   ?   'initiating methionine' 59  8  
2 2HUE ALA B 2  ? UNP Q92133 ?   ?   'cloning artifact'      60  9  
2 2HUE ALA B 44 ? UNP Q92133 GLY 103 'engineered mutation'   102 10 
2 2HUE ALA B 53 ? UNP Q92133 GLY 112 'SEE REMARK 999'        111 11 
3 2HUE MET C 1  ? UNP P62799 ?   ?   'initiating methionine' 19  12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                               'Zn 2'           65.409  
# 
_exptl.entry_id          2HUE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.90 
_exptl_crystal.density_percent_sol   68.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.1M potassium sulfate, 0.1M Tris-HCl, 14.5% PEG 4K, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           295 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   NOIR-1 
_diffrn_detector.pdbx_collection_date   2005-09-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.000 1.0 
2 1.23  1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 4.2.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   4.2.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '1.000, 1.23' 
# 
_reflns.entry_id                     2HUE 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.7 
_reflns.d_resolution_low             12 
_reflns.number_all                   ? 
_reflns.number_obs                   61200 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2HUE 
_refine.ls_d_res_high                            1.7 
_refine.ls_d_res_low                             11.98 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     61200 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2560 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             367 
_refine_hist.number_atoms_total               2950 
_refine_hist.d_res_high                       1.7 
_refine_hist.d_res_low                        11.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d    .015  ? ? ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg 1.556 ? ? ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr      .113  ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined       .259  ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined     .317  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2HUE 
_struct.title                     'Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HUE 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'mini beta sheet, elongated Beta sandwhich, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 5 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 56  ? ASP A 58  ? SER A 50  ASP A 52  5 ? 3  
HELX_P HELX_P2  2  SER A 86  ? ILE A 90  ? SER A 80  ILE A 84  5 ? 5  
HELX_P HELX_P3  3  PRO A 91  ? VAL A 96  ? PRO A 85  VAL A 90  1 ? 6  
HELX_P HELX_P4  4  GLU A 125 ? ASN A 131 ? GLU A 119 ASN A 125 1 ? 7  
HELX_P HELX_P5  5  GLN A 137 ? ASP A 139 ? GLN A 131 ASP A 133 5 ? 3  
HELX_P HELX_P6  6  ARG B 5   ? ASP B 19  ? ARG B 63  ASP B 77  1 ? 15 
HELX_P HELX_P7  7  GLN B 27  ? ALA B 56  ? GLN B 85  ALA B 114 1 ? 30 
HELX_P HELX_P8  8  MET B 62  ? ARG B 73  ? MET B 120 ARG B 131 1 ? 12 
HELX_P HELX_P9  9  VAL C 3   ? ILE C 8   ? VAL C 21  ILE C 26  5 ? 6  
HELX_P HELX_P10 10 THR C 12  ? GLY C 23  ? THR C 30  GLY C 41  1 ? 12 
HELX_P HELX_P11 11 LEU C 31  ? ALA C 58  ? LEU C 49  ALA C 76  1 ? 28 
HELX_P HELX_P12 12 THR C 64  ? LEU C 72  ? THR C 82  LEU C 90  1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A HIS 140 NE2 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 134 A ZN  403 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc2 metalc ? ? A HIS 140 NE2 ? ? ? 5_554 D ZN  . ZN ? ? A HIS 134 A ZN  403 1_555 ? ? ? ? ? ? ? 2.362 ? ? 
metalc3 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 I HOH . O  ? ? A ZN  403 A HOH 558 1_555 ? ? ? ? ? ? ? 2.198 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 20 A . ? ASN 14 A PRO 21 A ? PRO 15 A 1 -2.62 
2 GLY 69 A . ? GLY 63 A PRO 70 A ? PRO 64 A 1 -4.30 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 6 ? 
C ? 5 ? 
D ? 2 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? parallel      
E 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 10  ? VAL A 17  ? VAL A 4   VAL A 11  
A 2 TYR A 28  ? CYS A 36  ? TYR A 22  CYS A 30  
A 3 GLY A 74  ? ALA A 82  ? GLY A 68  ALA A 76  
B 1 ALA A 22  ? LYS A 23  ? ALA A 16  LYS A 17  
B 2 ILE A 141 ? ILE A 145 ? ILE A 135 ILE A 139 
B 3 ARG A 110 ? TYR A 123 ? ARG A 104 TYR A 117 
B 4 THR A 99  ? TYR A 107 ? THR A 93  TYR A 101 
B 5 LEU A 44  ? VAL A 51  ? LEU A 38  VAL A 45  
B 6 ASP A 60  ? VAL A 68  ? ASP A 54  VAL A 62  
C 1 ALA A 22  ? LYS A 23  ? ALA A 16  LYS A 17  
C 2 ILE A 141 ? ILE A 145 ? ILE A 135 ILE A 139 
C 3 ARG A 110 ? TYR A 123 ? ARG A 104 TYR A 117 
C 4 ARG A 151 ? ARG A 154 ? ARG A 145 ARG A 148 
C 5 ARG C 77  ? TYR C 80  ? ARG C 95  TYR C 98  
D 1 ARG B 25  ? PHE B 26  ? ARG B 83  PHE B 84  
D 2 THR C 62  ? VAL C 63  ? THR C 80  VAL C 81  
E 1 THR B 60  ? ILE B 61  ? THR B 118 ILE B 119 
E 2 ARG C 27  ? ILE C 28  ? ARG C 45  ILE C 46  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 11  ? N SER A 5   O GLU A 35  ? O GLU A 29  
A 2 3 N PHE A 34  ? N PHE A 28  O ASN A 76  ? O ASN A 70  
B 1 2 N ALA A 22  ? N ALA A 16  O ARG A 143 ? O ARG A 137 
B 2 3 O VAL A 142 ? O VAL A 136 N GLU A 122 ? N GLU A 116 
B 3 4 O VAL A 115 ? O VAL A 109 N LEU A 103 ? N LEU A 97  
B 4 5 O LEU A 102 ? O LEU A 96  N THR A 49  ? N THR A 43  
B 5 6 N LEU A 44  ? N LEU A 38  O VAL A 68  ? O VAL A 62  
C 1 2 N ALA A 22  ? N ALA A 16  O ARG A 143 ? O ARG A 137 
C 2 3 O VAL A 142 ? O VAL A 136 N GLU A 122 ? N GLU A 116 
C 3 4 N GLY A 116 ? N GLY A 110 O ARG A 151 ? O ARG A 145 
C 4 5 N VAL A 152 ? N VAL A 146 O LEU C 79  ? O LEU C 97  
D 1 2 N ARG B 25  ? N ARG B 83  O VAL C 63  ? O VAL C 81  
E 1 2 N ILE B 61  ? N ILE B 119 O ARG C 27  ? O ARG C 45  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B SO4 401 ? 9  'BINDING SITE FOR RESIDUE SO4 B 401' 
AC2 Software B SO4 402 ? 8  'BINDING SITE FOR RESIDUE SO4 B 402' 
AC3 Software A ZN  403 ? 4  'BINDING SITE FOR RESIDUE ZN A 403'  
AC4 Software A GOL 501 ? 10 'BINDING SITE FOR RESIDUE GOL A 501' 
AC5 Software C GOL 502 ? 6  'BINDING SITE FOR RESIDUE GOL C 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  ARG B 5   ? ARG B 63  . ? 1_555 ? 
2  AC1 9  HOH J .   ? HOH B 426 . ? 1_555 ? 
3  AC1 9  HOH J .   ? HOH B 434 . ? 1_555 ? 
4  AC1 9  HOH J .   ? HOH B 455 . ? 1_555 ? 
5  AC1 9  HOH J .   ? HOH B 467 . ? 1_555 ? 
6  AC1 9  HOH J .   ? HOH B 472 . ? 1_555 ? 
7  AC1 9  THR C 12  ? THR C 30  . ? 1_555 ? 
8  AC1 9  PRO C 14  ? PRO C 32  . ? 1_555 ? 
9  AC1 9  ARG C 18  ? ARG C 36  . ? 1_555 ? 
10 AC2 8  SER A 97  ? SER A 91  . ? 1_555 ? 
11 AC2 8  VAL A 98  ? VAL A 92  . ? 1_555 ? 
12 AC2 8  GOL E .   ? GOL A 501 . ? 1_555 ? 
13 AC2 8  HOH I .   ? HOH A 568 . ? 1_555 ? 
14 AC2 8  ARG B 58  ? ARG B 116 . ? 1_555 ? 
15 AC2 8  LYS B 64  ? LYS B 122 . ? 1_555 ? 
16 AC2 8  HOH J .   ? HOH B 439 . ? 1_555 ? 
17 AC2 8  HOH J .   ? HOH B 474 . ? 1_555 ? 
18 AC3 4  ASP A 139 ? ASP A 133 . ? 5_554 ? 
19 AC3 4  HIS A 140 ? HIS A 134 . ? 1_555 ? 
20 AC3 4  HIS A 140 ? HIS A 134 . ? 5_554 ? 
21 AC3 4  HOH I .   ? HOH A 558 . ? 1_555 ? 
22 AC4 10 VAL A 96  ? VAL A 90  . ? 1_555 ? 
23 AC4 10 SER A 97  ? SER A 91  . ? 1_555 ? 
24 AC4 10 ASN A 120 ? ASN A 114 . ? 1_555 ? 
25 AC4 10 ASN A 121 ? ASN A 115 . ? 1_555 ? 
26 AC4 10 GLU A 122 ? GLU A 116 . ? 1_555 ? 
27 AC4 10 HOH I .   ? HOH A 568 . ? 1_555 ? 
28 AC4 10 ALA B 56  ? ALA B 114 . ? 1_555 ? 
29 AC4 10 LYS B 57  ? LYS B 115 . ? 1_555 ? 
30 AC4 10 SO4 G .   ? SO4 B 402 . ? 1_555 ? 
31 AC4 10 HOH J .   ? HOH B 439 . ? 1_555 ? 
32 AC5 6  GLU B 15  ? GLU B 73  . ? 1_555 ? 
33 AC5 6  ASP B 19  ? ASP B 77  . ? 1_555 ? 
34 AC5 6  ARG C 5   ? ARG C 23  . ? 1_555 ? 
35 AC5 6  ILE C 8   ? ILE C 26  . ? 1_555 ? 
36 AC5 6  LYS C 41  ? LYS C 59  . ? 1_555 ? 
37 AC5 6  HOH K .   ? HOH C 512 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2HUE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HUE 
_atom_sites.fract_transf_matrix[1][1]   0.010444 
_atom_sites.fract_transf_matrix[1][2]   0.006030 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012060 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009035 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 7   ? -33.244 16.864 24.811  1.00 52.75 ? 1   SER A N   1 
ATOM   2    C  CA  . SER A 1 7   ? -33.498 15.953 25.967  1.00 52.40 ? 1   SER A CA  1 
ATOM   3    C  C   . SER A 1 7   ? -33.955 14.545 25.526  1.00 50.44 ? 1   SER A C   1 
ATOM   4    O  O   . SER A 1 7   ? -33.976 13.593 26.332  1.00 50.27 ? 1   SER A O   1 
ATOM   5    C  CB  . SER A 1 7   ? -34.563 16.554 26.878  1.00 53.48 ? 1   SER A CB  1 
ATOM   6    O  OG  . SER A 1 7   ? -34.696 15.797 28.062  1.00 57.85 ? 1   SER A OG  1 
ATOM   7    N  N   . SER A 1 8   ? -34.353 14.433 24.263  1.00 46.18 ? 2   SER A N   1 
ATOM   8    C  CA  . SER A 1 8   ? -34.795 13.156 23.715  1.00 42.56 ? 2   SER A CA  1 
ATOM   9    C  C   . SER A 1 8   ? -33.595 12.243 23.457  1.00 42.01 ? 2   SER A C   1 
ATOM   10   O  O   . SER A 1 8   ? -32.650 12.638 22.780  1.00 42.53 ? 2   SER A O   1 
ATOM   11   C  CB  . SER A 1 8   ? -35.552 13.387 22.418  1.00 43.23 ? 2   SER A CB  1 
ATOM   12   O  OG  . SER A 1 8   ? -36.805 13.979 22.703  1.00 49.21 ? 2   SER A OG  1 
ATOM   13   N  N   . ILE A 1 9   ? -33.635 11.023 23.985  1.00 38.17 ? 3   ILE A N   1 
ATOM   14   C  CA  . ILE A 1 9   ? -32.525 10.092 23.783  1.00 36.63 ? 3   ILE A CA  1 
ATOM   15   C  C   . ILE A 1 9   ? -32.454 9.592  22.345  1.00 36.19 ? 3   ILE A C   1 
ATOM   16   O  O   . ILE A 1 9   ? -31.373 9.374  21.802  1.00 37.86 ? 3   ILE A O   1 
ATOM   17   C  CB  . ILE A 1 9   ? -32.583 8.895  24.737  1.00 36.97 ? 3   ILE A CB  1 
ATOM   18   C  CG1 . ILE A 1 9   ? -32.620 9.375  26.191  1.00 42.26 ? 3   ILE A CG1 1 
ATOM   19   C  CG2 . ILE A 1 9   ? -31.406 7.980  24.479  1.00 38.64 ? 3   ILE A CG2 1 
ATOM   20   C  CD1 . ILE A 1 9   ? -31.427 10.240 26.575  1.00 42.90 ? 3   ILE A CD1 1 
ATOM   21   N  N   . VAL A 1 10  ? -33.611 9.387  21.729  1.00 32.52 ? 4   VAL A N   1 
ATOM   22   C  CA  . VAL A 1 10  ? -33.623 9.031  20.318  1.00 32.18 ? 4   VAL A CA  1 
ATOM   23   C  C   . VAL A 1 10  ? -34.281 10.172 19.553  1.00 32.95 ? 4   VAL A C   1 
ATOM   24   O  O   . VAL A 1 10  ? -35.340 10.687 19.972  1.00 33.81 ? 4   VAL A O   1 
ATOM   25   C  CB  . VAL A 1 10  ? -34.423 7.718  20.032  1.00 32.27 ? 4   VAL A CB  1 
ATOM   26   C  CG1 . VAL A 1 10  ? -34.571 7.503  18.511  1.00 30.64 ? 4   VAL A CG1 1 
ATOM   27   C  CG2 . VAL A 1 10  ? -33.766 6.526  20.721  1.00 33.90 ? 4   VAL A CG2 1 
ATOM   28   N  N   A SER A 1 11  ? -33.644 10.570 18.450  0.50 32.57 ? 5   SER A N   1 
ATOM   29   N  N   B SER A 1 11  ? -33.668 10.574 18.446  0.50 33.42 ? 5   SER A N   1 
ATOM   30   C  CA  A SER A 1 11  ? -34.150 11.624 17.570  0.50 34.49 ? 5   SER A CA  1 
ATOM   31   C  CA  B SER A 1 11  ? -34.265 11.586 17.588  0.50 35.89 ? 5   SER A CA  1 
ATOM   32   C  C   A SER A 1 11  ? -34.110 11.199 16.108  0.50 35.04 ? 5   SER A C   1 
ATOM   33   C  C   B SER A 1 11  ? -34.111 11.238 16.120  0.50 35.87 ? 5   SER A C   1 
ATOM   34   O  O   A SER A 1 11  ? -33.157 10.560 15.653  0.50 35.27 ? 5   SER A O   1 
ATOM   35   O  O   B SER A 1 11  ? -33.092 10.697 15.679  0.50 36.12 ? 5   SER A O   1 
ATOM   36   C  CB  A SER A 1 11  ? -33.330 12.917 17.712  0.50 34.85 ? 5   SER A CB  1 
ATOM   37   C  CB  B SER A 1 11  ? -33.686 12.977 17.853  0.50 37.25 ? 5   SER A CB  1 
ATOM   38   O  OG  A SER A 1 11  ? -33.464 13.496 19.001  0.50 35.26 ? 5   SER A OG  1 
ATOM   39   O  OG  B SER A 1 11  ? -32.294 12.988 17.628  0.50 40.84 ? 5   SER A OG  1 
ATOM   40   N  N   . LEU A 1 12  ? -35.137 11.578 15.358  1.00 35.23 ? 6   LEU A N   1 
ATOM   41   C  CA  . LEU A 1 12  ? -35.150 11.314 13.943  1.00 36.37 ? 6   LEU A CA  1 
ATOM   42   C  C   . LEU A 1 12  ? -34.271 12.356 13.285  1.00 37.36 ? 6   LEU A C   1 
ATOM   43   O  O   . LEU A 1 12  ? -34.357 13.550 13.606  1.00 39.32 ? 6   LEU A O   1 
ATOM   44   C  CB  . LEU A 1 12  ? -36.579 11.436 13.425  1.00 39.82 ? 6   LEU A CB  1 
ATOM   45   C  CG  . LEU A 1 12  ? -36.819 11.160 11.950  1.00 42.11 ? 6   LEU A CG  1 
ATOM   46   C  CD1 . LEU A 1 12  ? -36.496 9.701  11.616  1.00 39.47 ? 6   LEU A CD1 1 
ATOM   47   C  CD2 . LEU A 1 12  ? -38.272 11.469 11.640  1.00 40.52 ? 6   LEU A CD2 1 
ATOM   48   N  N   . LEU A 1 13  ? -33.402 11.917 12.392  1.00 34.64 ? 7   LEU A N   1 
ATOM   49   C  CA  . LEU A 1 13  ? -32.515 12.848 11.709  1.00 36.88 ? 7   LEU A CA  1 
ATOM   50   C  C   . LEU A 1 13  ? -32.977 13.174 10.292  1.00 35.16 ? 7   LEU A C   1 
ATOM   51   O  O   . LEU A 1 13  ? -32.729 14.277 9.792   1.00 39.16 ? 7   LEU A O   1 
ATOM   52   C  CB  . LEU A 1 13  ? -31.094 12.319 11.651  1.00 36.72 ? 7   LEU A CB  1 
ATOM   53   C  CG  . LEU A 1 13  ? -30.367 12.155 12.980  1.00 39.23 ? 7   LEU A CG  1 
ATOM   54   C  CD1 . LEU A 1 13  ? -28.907 11.863 12.677  1.00 38.56 ? 7   LEU A CD1 1 
ATOM   55   C  CD2 . LEU A 1 13  ? -30.502 13.402 13.845  1.00 40.42 ? 7   LEU A CD2 1 
ATOM   56   N  N   . GLY A 1 14  ? -33.597 12.203 9.638   1.00 33.12 ? 8   GLY A N   1 
ATOM   57   C  CA  . GLY A 1 14  ? -34.106 12.386 8.289   1.00 31.76 ? 8   GLY A CA  1 
ATOM   58   C  C   . GLY A 1 14  ? -34.839 11.185 7.731   1.00 33.80 ? 8   GLY A C   1 
ATOM   59   O  O   . GLY A 1 14  ? -34.706 10.068 8.240   1.00 32.74 ? 8   GLY A O   1 
ATOM   60   N  N   . ILE A 1 15  ? -35.660 11.429 6.717   1.00 31.13 ? 9   ILE A N   1 
ATOM   61   C  CA  . ILE A 1 15  ? -36.321 10.358 5.999   1.00 33.09 ? 9   ILE A CA  1 
ATOM   62   C  C   . ILE A 1 15  ? -36.238 10.624 4.526   1.00 33.83 ? 9   ILE A C   1 
ATOM   63   O  O   . ILE A 1 15  ? -36.479 11.754 4.076   1.00 35.58 ? 9   ILE A O   1 
ATOM   64   C  CB  . ILE A 1 15  ? -37.831 10.234 6.330   1.00 33.46 ? 9   ILE A CB  1 
ATOM   65   C  CG1 . ILE A 1 15  ? -38.053 9.929  7.807   1.00 35.88 ? 9   ILE A CG1 1 
ATOM   66   C  CG2 . ILE A 1 15  ? -38.474 9.175  5.446   1.00 35.11 ? 9   ILE A CG2 1 
ATOM   67   C  CD1 . ILE A 1 15  ? -39.549 9.838  8.176   1.00 36.13 ? 9   ILE A CD1 1 
ATOM   68   N  N   . LYS A 1 16  ? -35.915 9.591  3.761   1.00 31.48 ? 10  LYS A N   1 
ATOM   69   C  CA  . LYS A 1 16  ? -35.920 9.725  2.316   1.00 34.33 ? 10  LYS A CA  1 
ATOM   70   C  C   . LYS A 1 16  ? -37.047 8.886  1.752   1.00 32.81 ? 10  LYS A C   1 
ATOM   71   O  O   . LYS A 1 16  ? -37.120 7.687  2.015   1.00 31.51 ? 10  LYS A O   1 
ATOM   72   C  CB  . LYS A 1 16  ? -34.613 9.225  1.689   1.00 35.60 ? 10  LYS A CB  1 
ATOM   73   C  CG  . LYS A 1 16  ? -33.354 9.952  2.139   1.00 41.00 ? 10  LYS A CG  1 
ATOM   74   C  CD  . LYS A 1 16  ? -32.154 9.436  1.319   1.00 43.50 ? 10  LYS A CD  1 
ATOM   75   C  CE  . LYS A 1 16  ? -30.824 10.061 1.776   1.00 49.38 ? 10  LYS A CE  1 
ATOM   76   N  NZ  . LYS A 1 16  ? -29.659 9.418  1.076   1.00 50.46 ? 10  LYS A NZ  1 
ATOM   77   N  N   . VAL A 1 17  ? -37.895 9.510  0.944   1.00 29.72 ? 11  VAL A N   1 
ATOM   78   C  CA  . VAL A 1 17  ? -38.925 8.822  0.202   1.00 29.27 ? 11  VAL A CA  1 
ATOM   79   C  C   . VAL A 1 17  ? -38.274 8.435  -1.104  1.00 31.14 ? 11  VAL A C   1 
ATOM   80   O  O   . VAL A 1 17  ? -37.901 9.301  -1.903  1.00 30.40 ? 11  VAL A O   1 
ATOM   81   C  CB  . VAL A 1 17  ? -40.109 9.790  -0.079  1.00 26.75 ? 11  VAL A CB  1 
ATOM   82   C  CG1 . VAL A 1 17  ? -41.103 9.129  -0.979  1.00 26.83 ? 11  VAL A CG1 1 
ATOM   83   C  CG2 . VAL A 1 17  ? -40.738 10.197 1.262   1.00 30.35 ? 11  VAL A CG2 1 
ATOM   84   N  N   . LEU A 1 18  ? -38.114 7.137  -1.309  1.00 30.34 ? 12  LEU A N   1 
ATOM   85   C  CA  . LEU A 1 18  ? -37.203 6.659  -2.367  1.00 36.30 ? 12  LEU A CA  1 
ATOM   86   C  C   . LEU A 1 18  ? -37.782 6.473  -3.745  1.00 36.46 ? 12  LEU A C   1 
ATOM   87   O  O   . LEU A 1 18  ? -37.059 6.642  -4.742  1.00 41.45 ? 12  LEU A O   1 
ATOM   88   C  CB  . LEU A 1 18  ? -36.521 5.358  -1.942  1.00 36.61 ? 12  LEU A CB  1 
ATOM   89   C  CG  . LEU A 1 18  ? -35.700 5.497  -0.675  1.00 36.03 ? 12  LEU A CG  1 
ATOM   90   C  CD1 . LEU A 1 18  ? -35.116 4.151  -0.254  1.00 39.89 ? 12  LEU A CD1 1 
ATOM   91   C  CD2 . LEU A 1 18  ? -34.625 6.522  -0.870  1.00 39.90 ? 12  LEU A CD2 1 
ATOM   92   N  N   . ASN A 1 19  ? -39.041 6.079  -3.830  1.00 32.49 ? 13  ASN A N   1 
ATOM   93   C  CA  . ASN A 1 19  ? -39.639 5.796  -5.135  1.00 31.06 ? 13  ASN A CA  1 
ATOM   94   C  C   . ASN A 1 19  ? -40.930 6.584  -5.268  1.00 32.38 ? 13  ASN A C   1 
ATOM   95   O  O   . ASN A 1 19  ? -41.950 6.189  -4.706  1.00 34.49 ? 13  ASN A O   1 
ATOM   96   C  CB  . ASN A 1 19  ? -39.955 4.291  -5.334  1.00 32.51 ? 13  ASN A CB  1 
ATOM   97   C  CG  . ASN A 1 19  ? -40.880 3.707  -4.250  1.00 32.82 ? 13  ASN A CG  1 
ATOM   98   O  OD1 . ASN A 1 19  ? -40.761 4.033  -3.066  1.00 35.02 ? 13  ASN A OD1 1 
ATOM   99   N  ND2 . ASN A 1 19  ? -41.768 2.786  -4.659  1.00 35.55 ? 13  ASN A ND2 1 
ATOM   100  N  N   . ASN A 1 20  ? -40.885 7.706  -5.981  1.00 28.03 ? 14  ASN A N   1 
ATOM   101  C  CA  . ASN A 1 20  ? -42.027 8.613  -5.975  1.00 26.16 ? 14  ASN A CA  1 
ATOM   102  C  C   . ASN A 1 20  ? -41.929 9.565  -7.173  1.00 26.80 ? 14  ASN A C   1 
ATOM   103  O  O   . ASN A 1 20  ? -40.860 10.126 -7.414  1.00 29.15 ? 14  ASN A O   1 
ATOM   104  C  CB  . ASN A 1 20  ? -41.959 9.430  -4.684  1.00 26.63 ? 14  ASN A CB  1 
ATOM   105  C  CG  . ASN A 1 20  ? -43.182 10.297 -4.473  1.00 23.89 ? 14  ASN A CG  1 
ATOM   106  O  OD1 . ASN A 1 20  ? -44.307 9.800  -4.514  1.00 25.89 ? 14  ASN A OD1 1 
ATOM   107  N  ND2 . ASN A 1 20  ? -42.955 11.597 -4.175  1.00 27.84 ? 14  ASN A ND2 1 
ATOM   108  N  N   . PRO A 1 21  ? -43.024 9.720  -7.912  1.00 26.83 ? 15  PRO A N   1 
ATOM   109  C  CA  . PRO A 1 21  ? -44.314 9.054  -7.762  1.00 26.05 ? 15  PRO A CA  1 
ATOM   110  C  C   . PRO A 1 21  ? -44.233 7.555  -8.091  1.00 26.21 ? 15  PRO A C   1 
ATOM   111  O  O   . PRO A 1 21  ? -43.157 7.062  -8.505  1.00 28.80 ? 15  PRO A O   1 
ATOM   112  C  CB  . PRO A 1 21  ? -45.197 9.701  -8.805  1.00 28.77 ? 15  PRO A CB  1 
ATOM   113  C  CG  . PRO A 1 21  ? -44.293 10.456 -9.677  1.00 32.94 ? 15  PRO A CG  1 
ATOM   114  C  CD  . PRO A 1 21  ? -43.017 10.697 -9.016  1.00 31.74 ? 15  PRO A CD  1 
ATOM   115  N  N   . ALA A 1 22  ? -45.344 6.873  -7.889  1.00 25.71 ? 16  ALA A N   1 
ATOM   116  C  CA  . ALA A 1 22  ? -45.382 5.425  -8.092  1.00 28.35 ? 16  ALA A CA  1 
ATOM   117  C  C   . ALA A 1 22  ? -46.773 4.911  -8.380  1.00 29.74 ? 16  ALA A C   1 
ATOM   118  O  O   . ALA A 1 22  ? -47.747 5.618  -8.241  1.00 28.83 ? 16  ALA A O   1 
ATOM   119  C  CB  . ALA A 1 22  ? -44.781 4.720  -6.856  1.00 29.79 ? 16  ALA A CB  1 
ATOM   120  N  N   . LYS A 1 23  ? -46.888 3.650  -8.802  1.00 26.17 ? 17  LYS A N   1 
ATOM   121  C  CA  . LYS A 1 23  ? -48.184 3.066  -8.943  1.00 26.14 ? 17  LYS A CA  1 
ATOM   122  C  C   . LYS A 1 23  ? -48.770 2.847  -7.541  1.00 23.98 ? 17  LYS A C   1 
ATOM   123  O  O   . LYS A 1 23  ? -48.010 2.658  -6.570  1.00 27.03 ? 17  LYS A O   1 
ATOM   124  C  CB  . LYS A 1 23  ? -48.092 1.710  -9.656  1.00 31.65 ? 17  LYS A CB  1 
ATOM   125  C  CG  . LYS A 1 23  ? -47.436 1.820  -11.048 1.00 34.10 ? 17  LYS A CG  1 
ATOM   126  C  CD  . LYS A 1 23  ? -47.282 0.425  -11.662 1.00 40.96 ? 17  LYS A CD  1 
ATOM   127  C  CE  . LYS A 1 23  ? -46.636 0.493  -13.052 1.00 47.32 ? 17  LYS A CE  1 
ATOM   128  N  NZ  . LYS A 1 23  ? -47.540 1.122  -14.081 1.00 51.87 ? 17  LYS A NZ  1 
ATOM   129  N  N   . PHE A 1 24  ? -50.086 2.876  -7.460  1.00 26.51 ? 18  PHE A N   1 
ATOM   130  C  CA  . PHE A 1 24  ? -50.790 2.579  -6.207  1.00 26.38 ? 18  PHE A CA  1 
ATOM   131  C  C   . PHE A 1 24  ? -50.308 1.235  -5.614  1.00 28.97 ? 18  PHE A C   1 
ATOM   132  O  O   . PHE A 1 24  ? -50.098 1.115  -4.398  1.00 26.87 ? 18  PHE A O   1 
ATOM   133  C  CB  . PHE A 1 24  ? -52.285 2.566  -6.403  1.00 28.42 ? 18  PHE A CB  1 
ATOM   134  C  CG  . PHE A 1 24  ? -53.048 2.314  -5.139  1.00 28.75 ? 18  PHE A CG  1 
ATOM   135  C  CD1 . PHE A 1 24  ? -53.496 3.396  -4.363  1.00 32.20 ? 18  PHE A CD1 1 
ATOM   136  C  CD2 . PHE A 1 24  ? -53.316 1.013  -4.705  1.00 29.72 ? 18  PHE A CD2 1 
ATOM   137  C  CE1 . PHE A 1 24  ? -54.199 3.160  -3.172  1.00 29.78 ? 18  PHE A CE1 1 
ATOM   138  C  CE2 . PHE A 1 24  ? -54.011 0.764  -3.511  1.00 30.38 ? 18  PHE A CE2 1 
ATOM   139  C  CZ  . PHE A 1 24  ? -54.470 1.853  -2.760  1.00 31.04 ? 18  PHE A CZ  1 
ATOM   140  N  N   . THR A 1 25  ? -50.120 0.233  -6.481  1.00 27.71 ? 19  THR A N   1 
ATOM   141  C  CA  . THR A 1 25  ? -49.716 -1.100 -6.003  1.00 28.78 ? 19  THR A CA  1 
ATOM   142  C  C   . THR A 1 25  ? -48.214 -1.272 -5.770  1.00 29.53 ? 19  THR A C   1 
ATOM   143  O  O   . THR A 1 25  ? -47.768 -2.367 -5.363  1.00 29.40 ? 19  THR A O   1 
ATOM   144  C  CB  . THR A 1 25  ? -50.137 -2.162 -7.032  1.00 28.04 ? 19  THR A CB  1 
ATOM   145  O  OG1 . THR A 1 25  ? -49.601 -1.761 -8.291  1.00 29.48 ? 19  THR A OG1 1 
ATOM   146  C  CG2 . THR A 1 25  ? -51.661 -2.232 -7.141  1.00 32.17 ? 19  THR A CG2 1 
ATOM   147  N  N   . ASP A 1 26  ? -47.405 -0.248 -6.018  1.00 26.56 ? 20  ASP A N   1 
ATOM   148  C  CA  . ASP A 1 26  ? -45.962 -0.352 -5.747  1.00 26.60 ? 20  ASP A CA  1 
ATOM   149  C  C   . ASP A 1 26  ? -45.673 -0.316 -4.243  1.00 28.25 ? 20  ASP A C   1 
ATOM   150  O  O   . ASP A 1 26  ? -46.377 0.373  -3.478  1.00 28.31 ? 20  ASP A O   1 
ATOM   151  C  CB  . ASP A 1 26  ? -45.166 0.785  -6.401  1.00 28.02 ? 20  ASP A CB  1 
ATOM   152  C  CG  . ASP A 1 26  ? -45.034 0.633  -7.930  1.00 32.82 ? 20  ASP A CG  1 
ATOM   153  O  OD1 . ASP A 1 26  ? -45.362 -0.453 -8.473  1.00 33.82 ? 20  ASP A OD1 1 
ATOM   154  O  OD2 . ASP A 1 26  ? -44.599 1.614  -8.581  1.00 32.43 ? 20  ASP A OD2 1 
ATOM   155  N  N   . PRO A 1 27  ? -44.619 -0.996 -3.795  1.00 28.46 ? 21  PRO A N   1 
ATOM   156  C  CA  . PRO A 1 27  ? -44.301 -0.931 -2.369  1.00 28.54 ? 21  PRO A CA  1 
ATOM   157  C  C   . PRO A 1 27  ? -43.783 0.459  -2.003  1.00 29.61 ? 21  PRO A C   1 
ATOM   158  O  O   . PRO A 1 27  ? -43.343 1.208  -2.897  1.00 30.00 ? 21  PRO A O   1 
ATOM   159  C  CB  . PRO A 1 27  ? -43.174 -1.952 -2.211  1.00 32.69 ? 21  PRO A CB  1 
ATOM   160  C  CG  . PRO A 1 27  ? -42.562 -2.059 -3.559  1.00 34.15 ? 21  PRO A CG  1 
ATOM   161  C  CD  . PRO A 1 27  ? -43.676 -1.866 -4.544  1.00 33.68 ? 21  PRO A CD  1 
ATOM   162  N  N   . TYR A 1 28  ? -43.846 0.812  -0.720  1.00 26.57 ? 22  TYR A N   1 
ATOM   163  C  CA  . TYR A 1 28  ? -43.259 2.067  -0.243  1.00 28.58 ? 22  TYR A CA  1 
ATOM   164  C  C   . TYR A 1 28  ? -41.820 1.904  0.234   1.00 32.75 ? 22  TYR A C   1 
ATOM   165  O  O   . TYR A 1 28  ? -41.558 1.224  1.232   1.00 33.27 ? 22  TYR A O   1 
ATOM   166  C  CB  . TYR A 1 28  ? -44.056 2.595  0.955   1.00 27.48 ? 22  TYR A CB  1 
ATOM   167  C  CG  . TYR A 1 28  ? -45.420 3.076  0.617   1.00 27.54 ? 22  TYR A CG  1 
ATOM   168  C  CD1 . TYR A 1 28  ? -45.704 4.443  0.611   1.00 28.14 ? 22  TYR A CD1 1 
ATOM   169  C  CD2 . TYR A 1 28  ? -46.434 2.195  0.292   1.00 27.81 ? 22  TYR A CD2 1 
ATOM   170  C  CE1 . TYR A 1 28  ? -46.972 4.910  0.292   1.00 25.34 ? 22  TYR A CE1 1 
ATOM   171  C  CE2 . TYR A 1 28  ? -47.707 2.646  -0.050  1.00 26.75 ? 22  TYR A CE2 1 
ATOM   172  C  CZ  . TYR A 1 28  ? -47.968 4.003  -0.019  1.00 27.83 ? 22  TYR A CZ  1 
ATOM   173  O  OH  . TYR A 1 28  ? -49.211 4.421  -0.361  1.00 28.16 ? 22  TYR A OH  1 
ATOM   174  N  N   . GLU A 1 29  ? -40.898 2.592  -0.425  1.00 29.94 ? 23  GLU A N   1 
ATOM   175  C  CA  . GLU A 1 29  ? -39.495 2.549  -0.070  1.00 32.32 ? 23  GLU A CA  1 
ATOM   176  C  C   . GLU A 1 29  ? -39.104 3.815  0.681   1.00 34.79 ? 23  GLU A C   1 
ATOM   177  O  O   . GLU A 1 29  ? -39.261 4.940  0.185   1.00 32.05 ? 23  GLU A O   1 
ATOM   178  C  CB  . GLU A 1 29  ? -38.636 2.356  -1.332  1.00 33.31 ? 23  GLU A CB  1 
ATOM   179  C  CG  . GLU A 1 29  ? -39.077 1.147  -2.141  1.00 37.10 ? 23  GLU A CG  1 
ATOM   180  C  CD  . GLU A 1 29  ? -38.349 0.938  -3.472  1.00 40.82 ? 23  GLU A CD  1 
ATOM   181  O  OE1 . GLU A 1 29  ? -37.550 1.805  -3.905  1.00 43.64 ? 23  GLU A OE1 1 
ATOM   182  O  OE2 . GLU A 1 29  ? -38.613 -0.116 -4.088  1.00 48.12 ? 23  GLU A OE2 1 
ATOM   183  N  N   . PHE A 1 30  ? -38.596 3.618  1.888   1.00 32.39 ? 24  PHE A N   1 
ATOM   184  C  CA  . PHE A 1 30  ? -38.140 4.714  2.728   1.00 31.47 ? 24  PHE A CA  1 
ATOM   185  C  C   . PHE A 1 30  ? -36.766 4.376  3.253   1.00 34.10 ? 24  PHE A C   1 
ATOM   186  O  O   . PHE A 1 30  ? -36.442 3.200  3.446   1.00 35.88 ? 24  PHE A O   1 
ATOM   187  C  CB  . PHE A 1 30  ? -39.047 4.856  3.972   1.00 32.57 ? 24  PHE A CB  1 
ATOM   188  C  CG  . PHE A 1 30  ? -40.390 5.450  3.706   1.00 30.93 ? 24  PHE A CG  1 
ATOM   189  C  CD1 . PHE A 1 30  ? -40.543 6.825  3.633   1.00 34.92 ? 24  PHE A CD1 1 
ATOM   190  C  CD2 . PHE A 1 30  ? -41.513 4.646  3.610   1.00 36.80 ? 24  PHE A CD2 1 
ATOM   191  C  CE1 . PHE A 1 30  ? -41.781 7.403  3.403   1.00 35.54 ? 24  PHE A CE1 1 
ATOM   192  C  CE2 . PHE A 1 30  ? -42.750 5.197  3.377   1.00 34.17 ? 24  PHE A CE2 1 
ATOM   193  C  CZ  . PHE A 1 30  ? -42.896 6.589  3.273   1.00 36.78 ? 24  PHE A CZ  1 
ATOM   194  N  N   . GLU A 1 31  ? -35.948 5.395  3.470   1.00 31.03 ? 25  GLU A N   1 
ATOM   195  C  CA  . GLU A 1 31  ? -34.725 5.205  4.230   1.00 32.84 ? 25  GLU A CA  1 
ATOM   196  C  C   . GLU A 1 31  ? -34.873 6.108  5.432   1.00 35.09 ? 25  GLU A C   1 
ATOM   197  O  O   . GLU A 1 31  ? -35.124 7.292  5.269   1.00 31.97 ? 25  GLU A O   1 
ATOM   198  C  CB  . GLU A 1 31  ? -33.499 5.642  3.444   1.00 36.99 ? 25  GLU A CB  1 
ATOM   199  C  CG  . GLU A 1 31  ? -32.229 5.537  4.271   1.00 43.54 ? 25  GLU A CG  1 
ATOM   200  C  CD  . GLU A 1 31  ? -31.096 6.382  3.717   1.00 47.30 ? 25  GLU A CD  1 
ATOM   201  O  OE1 . GLU A 1 31  ? -31.050 7.605  3.971   1.00 50.42 ? 25  GLU A OE1 1 
ATOM   202  O  OE2 . GLU A 1 31  ? -30.232 5.807  3.039   1.00 52.75 ? 25  GLU A OE2 1 
ATOM   203  N  N   . ILE A 1 32  ? -34.762 5.548  6.630   1.00 32.82 ? 26  ILE A N   1 
ATOM   204  C  CA  . ILE A 1 32  ? -34.886 6.330  7.834   1.00 34.15 ? 26  ILE A CA  1 
ATOM   205  C  C   . ILE A 1 32  ? -33.563 6.392  8.570   1.00 34.50 ? 26  ILE A C   1 
ATOM   206  O  O   . ILE A 1 32  ? -32.864 5.381  8.713   1.00 33.97 ? 26  ILE A O   1 
ATOM   207  C  CB  . ILE A 1 32  ? -35.973 5.738  8.753   1.00 34.40 ? 26  ILE A CB  1 
ATOM   208  C  CG1 . ILE A 1 32  ? -37.338 5.857  8.072   1.00 36.79 ? 26  ILE A CG1 1 
ATOM   209  C  CG2 . ILE A 1 32  ? -35.939 6.422  10.136  1.00 34.93 ? 26  ILE A CG2 1 
ATOM   210  C  CD1 . ILE A 1 32  ? -38.406 5.022  8.733   1.00 46.36 ? 26  ILE A CD1 1 
ATOM   211  N  N   . THR A 1 33  ? -33.190 7.598  8.993   1.00 31.49 ? 27  THR A N   1 
ATOM   212  C  CA  . THR A 1 33  ? -31.973 7.798  9.749   1.00 33.33 ? 27  THR A CA  1 
ATOM   213  C  C   . THR A 1 33  ? -32.304 8.423  11.095  1.00 33.83 ? 27  THR A C   1 
ATOM   214  O  O   . THR A 1 33  ? -32.998 9.445  11.156  1.00 32.85 ? 27  THR A O   1 
ATOM   215  C  CB  . THR A 1 33  ? -31.015 8.734  8.979   1.00 36.32 ? 27  THR A CB  1 
ATOM   216  O  OG1 . THR A 1 33  ? -30.696 8.137  7.711   1.00 38.30 ? 27  THR A OG1 1 
ATOM   217  C  CG2 . THR A 1 33  ? -29.749 8.980  9.787   1.00 36.54 ? 27  THR A CG2 1 
ATOM   218  N  N   . PHE A 1 34  ? -31.816 7.825  12.176  1.00 29.96 ? 28  PHE A N   1 
ATOM   219  C  CA  . PHE A 1 34  ? -32.049 8.385  13.487  1.00 31.20 ? 28  PHE A CA  1 
ATOM   220  C  C   . PHE A 1 34  ? -30.814 8.287  14.386  1.00 33.45 ? 28  PHE A C   1 
ATOM   221  O  O   . PHE A 1 34  ? -29.854 7.577  14.053  1.00 36.56 ? 28  PHE A O   1 
ATOM   222  C  CB  . PHE A 1 34  ? -33.273 7.744  14.149  1.00 30.02 ? 28  PHE A CB  1 
ATOM   223  C  CG  . PHE A 1 34  ? -33.096 6.281  14.512  1.00 31.63 ? 28  PHE A CG  1 
ATOM   224  C  CD1 . PHE A 1 34  ? -32.533 5.913  15.723  1.00 31.26 ? 28  PHE A CD1 1 
ATOM   225  C  CD2 . PHE A 1 34  ? -33.519 5.280  13.639  1.00 33.38 ? 28  PHE A CD2 1 
ATOM   226  C  CE1 . PHE A 1 34  ? -32.375 4.564  16.070  1.00 33.74 ? 28  PHE A CE1 1 
ATOM   227  C  CE2 . PHE A 1 34  ? -33.371 3.927  13.979  1.00 33.43 ? 28  PHE A CE2 1 
ATOM   228  C  CZ  . PHE A 1 34  ? -32.817 3.571  15.193  1.00 35.14 ? 28  PHE A CZ  1 
ATOM   229  N  N   . GLU A 1 35  ? -30.849 8.997  15.506  1.00 31.97 ? 29  GLU A N   1 
ATOM   230  C  CA  . GLU A 1 35  ? -29.724 9.031  16.443  1.00 34.14 ? 29  GLU A CA  1 
ATOM   231  C  C   . GLU A 1 35  ? -30.138 8.565  17.815  1.00 33.80 ? 29  GLU A C   1 
ATOM   232  O  O   . GLU A 1 35  ? -31.200 8.948  18.304  1.00 34.77 ? 29  GLU A O   1 
ATOM   233  C  CB  . GLU A 1 35  ? -29.195 10.457 16.547  1.00 38.66 ? 29  GLU A CB  1 
ATOM   234  C  CG  . GLU A 1 35  ? -27.835 10.576 17.181  1.00 49.99 ? 29  GLU A CG  1 
ATOM   235  C  CD  . GLU A 1 35  ? -27.233 11.937 16.897  1.00 52.75 ? 29  GLU A CD  1 
ATOM   236  O  OE1 . GLU A 1 35  ? -27.965 12.943 17.051  1.00 54.75 ? 29  GLU A OE1 1 
ATOM   237  O  OE2 . GLU A 1 35  ? -26.049 11.988 16.500  1.00 58.65 ? 29  GLU A OE2 1 
ATOM   238  N  N   . CYS A 1 36  ? -29.306 7.725  18.439  1.00 33.71 ? 30  CYS A N   1 
ATOM   239  C  CA  . CYS A 1 36  ? -29.574 7.275  19.799  1.00 32.80 ? 30  CYS A CA  1 
ATOM   240  C  C   . CYS A 1 36  ? -28.417 7.715  20.692  1.00 35.47 ? 30  CYS A C   1 
ATOM   241  O  O   . CYS A 1 36  ? -27.289 7.302  20.474  1.00 34.84 ? 30  CYS A O   1 
ATOM   242  C  CB  . CYS A 1 36  ? -29.731 5.757  19.851  1.00 32.42 ? 30  CYS A CB  1 
ATOM   243  S  SG  . CYS A 1 36  ? -30.115 5.141  21.508  1.00 37.78 ? 30  CYS A SG  1 
ATOM   244  N  N   . LEU A 1 37  ? -28.697 8.569  21.670  1.00 38.78 ? 31  LEU A N   1 
ATOM   245  C  CA  . LEU A 1 37  ? -27.634 9.181  22.466  1.00 42.37 ? 31  LEU A CA  1 
ATOM   246  C  C   . LEU A 1 37  ? -26.995 8.279  23.494  1.00 45.01 ? 31  LEU A C   1 
ATOM   247  O  O   . LEU A 1 37  ? -25.823 8.456  23.833  1.00 46.81 ? 31  LEU A O   1 
ATOM   248  C  CB  . LEU A 1 37  ? -28.138 10.455 23.144  1.00 42.54 ? 31  LEU A CB  1 
ATOM   249  C  CG  . LEU A 1 37  ? -28.519 11.546 22.149  1.00 43.30 ? 31  LEU A CG  1 
ATOM   250  C  CD1 . LEU A 1 37  ? -29.043 12.785 22.877  1.00 43.32 ? 31  LEU A CD1 1 
ATOM   251  C  CD2 . LEU A 1 37  ? -27.314 11.867 21.275  1.00 45.51 ? 31  LEU A CD2 1 
ATOM   252  N  N   . GLU A 1 38  ? -27.753 7.320  24.007  1.00 46.04 ? 32  GLU A N   1 
ATOM   253  C  CA  . GLU A 1 38  ? -27.207 6.411  24.993  1.00 50.46 ? 32  GLU A CA  1 
ATOM   254  C  C   . GLU A 1 38  ? -27.977 5.115  25.093  1.00 50.87 ? 32  GLU A C   1 
ATOM   255  O  O   . GLU A 1 38  ? -29.117 5.015  24.626  1.00 50.05 ? 32  GLU A O   1 
ATOM   256  C  CB  . GLU A 1 38  ? -27.140 7.071  26.366  1.00 53.62 ? 32  GLU A CB  1 
ATOM   257  C  CG  . GLU A 1 38  ? -28.395 7.791  26.781  1.00 58.14 ? 32  GLU A CG  1 
ATOM   258  C  CD  . GLU A 1 38  ? -28.353 8.202  28.237  1.00 62.78 ? 32  GLU A CD  1 
ATOM   259  O  OE1 . GLU A 1 38  ? -28.023 7.337  29.079  1.00 68.12 ? 32  GLU A OE1 1 
ATOM   260  O  OE2 . GLU A 1 38  ? -28.658 9.374  28.544  1.00 64.60 ? 32  GLU A OE2 1 
ATOM   261  N  N   A SER A 1 39  ? -27.345 4.118  25.706  0.33 50.32 ? 33  SER A N   1 
ATOM   262  N  N   B SER A 1 39  ? -27.344 4.117  25.706  0.33 50.45 ? 33  SER A N   1 
ATOM   263  N  N   C SER A 1 39  ? -27.344 4.117  25.701  0.33 50.31 ? 33  SER A N   1 
ATOM   264  C  CA  A SER A 1 39  ? -27.953 2.809  25.895  0.33 49.61 ? 33  SER A CA  1 
ATOM   265  C  CA  B SER A 1 39  ? -27.957 2.810  25.908  0.33 49.87 ? 33  SER A CA  1 
ATOM   266  C  CA  C SER A 1 39  ? -27.952 2.810  25.891  0.33 49.58 ? 33  SER A CA  1 
ATOM   267  C  C   A SER A 1 39  ? -29.344 2.920  26.511  0.33 49.20 ? 33  SER A C   1 
ATOM   268  C  C   B SER A 1 39  ? -29.351 2.932  26.508  0.33 49.34 ? 33  SER A C   1 
ATOM   269  C  C   C SER A 1 39  ? -29.346 2.934  26.498  0.33 49.17 ? 33  SER A C   1 
ATOM   270  O  O   A SER A 1 39  ? -29.550 3.639  27.494  0.33 49.51 ? 33  SER A O   1 
ATOM   271  O  O   B SER A 1 39  ? -29.567 3.667  27.476  0.33 49.61 ? 33  SER A O   1 
ATOM   272  O  O   C SER A 1 39  ? -29.556 3.673  27.464  0.33 49.47 ? 33  SER A O   1 
ATOM   273  C  CB  A SER A 1 39  ? -27.059 1.930  26.776  0.33 49.76 ? 33  SER A CB  1 
ATOM   274  C  CB  B SER A 1 39  ? -27.082 1.933  26.812  0.33 50.15 ? 33  SER A CB  1 
ATOM   275  C  CB  C SER A 1 39  ? -27.072 1.957  26.807  0.33 49.72 ? 33  SER A CB  1 
ATOM   276  O  OG  A SER A 1 39  ? -25.795 1.732  26.174  0.33 47.40 ? 33  SER A OG  1 
ATOM   277  O  OG  B SER A 1 39  ? -27.778 0.758  27.207  0.33 48.56 ? 33  SER A OG  1 
ATOM   278  O  OG  C SER A 1 39  ? -27.036 2.515  28.108  0.33 47.28 ? 33  SER A OG  1 
ATOM   279  N  N   . LEU A 1 40  ? -30.295 2.202  25.922  1.00 48.70 ? 34  LEU A N   1 
ATOM   280  C  CA  . LEU A 1 40  ? -31.666 2.207  26.387  1.00 47.22 ? 34  LEU A CA  1 
ATOM   281  C  C   . LEU A 1 40  ? -32.048 0.766  26.744  1.00 46.27 ? 34  LEU A C   1 
ATOM   282  O  O   . LEU A 1 40  ? -31.599 -0.172 26.102  1.00 44.49 ? 34  LEU A O   1 
ATOM   283  C  CB  . LEU A 1 40  ? -32.579 2.747  25.274  1.00 45.53 ? 34  LEU A CB  1 
ATOM   284  C  CG  . LEU A 1 40  ? -32.484 4.265  25.050  1.00 41.43 ? 34  LEU A CG  1 
ATOM   285  C  CD1 . LEU A 1 40  ? -33.211 4.675  23.777  1.00 37.89 ? 34  LEU A CD1 1 
ATOM   286  C  CD2 . LEU A 1 40  ? -33.059 4.987  26.264  1.00 43.02 ? 34  LEU A CD2 1 
ATOM   287  N  N   . LYS A 1 41  ? -32.897 0.604  27.746  1.00 46.26 ? 35  LYS A N   1 
ATOM   288  C  CA  . LYS A 1 41  ? -33.280 -0.723 28.187  1.00 50.50 ? 35  LYS A CA  1 
ATOM   289  C  C   . LYS A 1 41  ? -34.234 -1.393 27.182  1.00 48.68 ? 35  LYS A C   1 
ATOM   290  O  O   . LYS A 1 41  ? -34.133 -2.588 26.912  1.00 48.54 ? 35  LYS A O   1 
ATOM   291  C  CB  . LYS A 1 41  ? -33.958 -0.625 29.555  1.00 50.95 ? 35  LYS A CB  1 
ATOM   292  C  CG  . LYS A 1 41  ? -33.790 -1.858 30.434  1.00 55.46 ? 35  LYS A CG  1 
ATOM   293  C  CD  . LYS A 1 41  ? -34.646 -1.750 31.699  1.00 55.56 ? 35  LYS A CD  1 
ATOM   294  C  CE  . LYS A 1 41  ? -34.535 -3.010 32.573  1.00 57.59 ? 35  LYS A CE  1 
ATOM   295  N  NZ  . LYS A 1 41  ? -35.622 -3.050 33.592  1.00 57.81 ? 35  LYS A NZ  1 
ATOM   296  N  N   . HIS A 1 42  ? -35.146 -0.608 26.615  1.00 44.86 ? 36  HIS A N   1 
ATOM   297  C  CA  . HIS A 1 42  ? -36.244 -1.186 25.860  1.00 39.48 ? 36  HIS A CA  1 
ATOM   298  C  C   . HIS A 1 42  ? -36.216 -1.021 24.344  1.00 34.34 ? 36  HIS A C   1 
ATOM   299  O  O   . HIS A 1 42  ? -35.236 -0.566 23.750  1.00 34.55 ? 36  HIS A O   1 
ATOM   300  C  CB  . HIS A 1 42  ? -37.559 -0.687 26.427  1.00 41.33 ? 36  HIS A CB  1 
ATOM   301  C  CG  . HIS A 1 42  ? -37.726 -0.960 27.890  1.00 49.14 ? 36  HIS A CG  1 
ATOM   302  N  ND1 . HIS A 1 42  ? -37.290 -0.087 28.867  1.00 51.15 ? 36  HIS A ND1 1 
ATOM   303  C  CD2 . HIS A 1 42  ? -38.282 -2.011 28.543  1.00 51.37 ? 36  HIS A CD2 1 
ATOM   304  C  CE1 . HIS A 1 42  ? -37.576 -0.587 30.059  1.00 54.45 ? 36  HIS A CE1 1 
ATOM   305  N  NE2 . HIS A 1 42  ? -38.181 -1.751 29.890  1.00 54.85 ? 36  HIS A NE2 1 
ATOM   306  N  N   . ASP A 1 43  ? -37.307 -1.429 23.729  1.00 30.80 ? 37  ASP A N   1 
ATOM   307  C  CA  . ASP A 1 43  ? -37.371 -1.456 22.261  1.00 30.06 ? 37  ASP A CA  1 
ATOM   308  C  C   . ASP A 1 43  ? -37.938 -0.198 21.627  1.00 28.46 ? 37  ASP A C   1 
ATOM   309  O  O   . ASP A 1 43  ? -38.825 0.438  22.195  1.00 28.95 ? 37  ASP A O   1 
ATOM   310  C  CB  . ASP A 1 43  ? -38.298 -2.573 21.781  1.00 28.33 ? 37  ASP A CB  1 
ATOM   311  C  CG  . ASP A 1 43  ? -37.951 -3.938 22.356  1.00 32.46 ? 37  ASP A CG  1 
ATOM   312  O  OD1 . ASP A 1 43  ? -36.755 -4.220 22.558  1.00 30.51 ? 37  ASP A OD1 1 
ATOM   313  O  OD2 . ASP A 1 43  ? -38.929 -4.701 22.578  1.00 32.24 ? 37  ASP A OD2 1 
ATOM   314  N  N   . LEU A 1 44  ? -37.477 0.059  20.408  1.00 26.55 ? 38  LEU A N   1 
ATOM   315  C  CA  . LEU A 1 44  ? -38.047 1.104  19.539  1.00 26.40 ? 38  LEU A CA  1 
ATOM   316  C  C   . LEU A 1 44  ? -38.878 0.400  18.513  1.00 27.60 ? 38  LEU A C   1 
ATOM   317  O  O   . LEU A 1 44  ? -38.483 -0.663 18.019  1.00 27.53 ? 38  LEU A O   1 
ATOM   318  C  CB  . LEU A 1 44  ? -36.960 1.801  18.719  1.00 30.87 ? 38  LEU A CB  1 
ATOM   319  C  CG  . LEU A 1 44  ? -36.032 2.859  19.237  1.00 37.46 ? 38  LEU A CG  1 
ATOM   320  C  CD1 . LEU A 1 44  ? -35.194 3.326  18.048  1.00 38.58 ? 38  LEU A CD1 1 
ATOM   321  C  CD2 . LEU A 1 44  ? -36.809 3.997  19.906  1.00 37.78 ? 38  LEU A CD2 1 
ATOM   322  N  N   . GLU A 1 45  ? -39.988 0.999  18.114  1.00 25.62 ? 39  GLU A N   1 
ATOM   323  C  CA  . GLU A 1 45  ? -40.750 0.398  17.038  1.00 26.69 ? 39  GLU A CA  1 
ATOM   324  C  C   . GLU A 1 45  ? -41.171 1.506  16.085  1.00 27.69 ? 39  GLU A C   1 
ATOM   325  O  O   . GLU A 1 45  ? -41.822 2.476  16.514  1.00 27.37 ? 39  GLU A O   1 
ATOM   326  C  CB  . GLU A 1 45  ? -42.001 -0.321 17.544  1.00 26.28 ? 39  GLU A CB  1 
ATOM   327  C  CG  . GLU A 1 45  ? -42.809 -0.947 16.377  1.00 27.97 ? 39  GLU A CG  1 
ATOM   328  C  CD  . GLU A 1 45  ? -43.937 -1.846 16.810  1.00 32.94 ? 39  GLU A CD  1 
ATOM   329  O  OE1 . GLU A 1 45  ? -44.183 -1.996 18.030  1.00 34.95 ? 39  GLU A OE1 1 
ATOM   330  O  OE2 . GLU A 1 45  ? -44.623 -2.394 15.924  1.00 33.19 ? 39  GLU A OE2 1 
ATOM   331  N  N   . TRP A 1 46  ? -40.804 1.341  14.816  1.00 23.31 ? 40  TRP A N   1 
ATOM   332  C  CA  . TRP A 1 46  ? -41.216 2.277  13.752  1.00 23.51 ? 40  TRP A CA  1 
ATOM   333  C  C   . TRP A 1 46  ? -42.412 1.645  13.046  1.00 25.45 ? 40  TRP A C   1 
ATOM   334  O  O   . TRP A 1 46  ? -42.347 0.469  12.686  1.00 26.90 ? 40  TRP A O   1 
ATOM   335  C  CB  . TRP A 1 46  ? -40.068 2.469  12.735  1.00 27.83 ? 40  TRP A CB  1 
ATOM   336  C  CG  . TRP A 1 46  ? -38.839 3.089  13.342  1.00 33.46 ? 40  TRP A CG  1 
ATOM   337  C  CD1 . TRP A 1 46  ? -37.818 2.445  14.005  1.00 37.54 ? 40  TRP A CD1 1 
ATOM   338  C  CD2 . TRP A 1 46  ? -38.535 4.476  13.387  1.00 36.54 ? 40  TRP A CD2 1 
ATOM   339  N  NE1 . TRP A 1 46  ? -36.894 3.361  14.445  1.00 38.34 ? 40  TRP A NE1 1 
ATOM   340  C  CE2 . TRP A 1 46  ? -37.303 4.616  14.076  1.00 36.72 ? 40  TRP A CE2 1 
ATOM   341  C  CE3 . TRP A 1 46  ? -39.176 5.614  12.905  1.00 36.28 ? 40  TRP A CE3 1 
ATOM   342  C  CZ2 . TRP A 1 46  ? -36.698 5.853  14.295  1.00 38.88 ? 40  TRP A CZ2 1 
ATOM   343  C  CZ3 . TRP A 1 46  ? -38.553 6.874  13.122  1.00 35.88 ? 40  TRP A CZ3 1 
ATOM   344  C  CH2 . TRP A 1 46  ? -37.344 6.966  13.825  1.00 35.96 ? 40  TRP A CH2 1 
ATOM   345  N  N   . LYS A 1 47  ? -43.497 2.390  12.850  1.00 22.34 ? 41  LYS A N   1 
ATOM   346  C  CA  . LYS A 1 47  ? -44.659 1.858  12.160  1.00 23.95 ? 41  LYS A CA  1 
ATOM   347  C  C   . LYS A 1 47  ? -44.945 2.757  10.970  1.00 28.34 ? 41  LYS A C   1 
ATOM   348  O  O   . LYS A 1 47  ? -44.717 3.964  11.024  1.00 28.19 ? 41  LYS A O   1 
ATOM   349  C  CB  . LYS A 1 47  ? -45.872 1.834  13.067  1.00 26.57 ? 41  LYS A CB  1 
ATOM   350  C  CG  . LYS A 1 47  ? -45.797 0.930  14.314  1.00 32.97 ? 41  LYS A CG  1 
ATOM   351  C  CD  . LYS A 1 47  ? -47.041 1.194  15.137  1.00 38.56 ? 41  LYS A CD  1 
ATOM   352  C  CE  . LYS A 1 47  ? -47.175 0.253  16.298  1.00 45.08 ? 41  LYS A CE  1 
ATOM   353  N  NZ  . LYS A 1 47  ? -47.674 -1.032 15.746  1.00 45.91 ? 41  LYS A NZ  1 
ATOM   354  N  N   . LEU A 1 48  ? -45.451 2.156  9.907   1.00 23.70 ? 42  LEU A N   1 
ATOM   355  C  CA  . LEU A 1 48  ? -45.915 2.908  8.738   1.00 23.37 ? 42  LEU A CA  1 
ATOM   356  C  C   . LEU A 1 48  ? -47.413 2.603  8.592   1.00 25.67 ? 42  LEU A C   1 
ATOM   357  O  O   . LEU A 1 48  ? -47.828 1.408  8.546   1.00 23.65 ? 42  LEU A O   1 
ATOM   358  C  CB  . LEU A 1 48  ? -45.141 2.454  7.503   1.00 21.87 ? 42  LEU A CB  1 
ATOM   359  C  CG  . LEU A 1 48  ? -45.662 3.113  6.213   1.00 25.76 ? 42  LEU A CG  1 
ATOM   360  C  CD1 . LEU A 1 48  ? -45.357 4.636  6.243   1.00 27.36 ? 42  LEU A CD1 1 
ATOM   361  C  CD2 . LEU A 1 48  ? -44.942 2.467  5.031   1.00 26.86 ? 42  LEU A CD2 1 
ATOM   362  N  N   . THR A 1 49  ? -48.268 3.638  8.552   1.00 21.90 ? 43  THR A N   1 
ATOM   363  C  CA  . THR A 1 49  ? -49.702 3.446  8.548   1.00 20.32 ? 43  THR A CA  1 
ATOM   364  C  C   . THR A 1 49  ? -50.307 4.248  7.387   1.00 22.91 ? 43  THR A C   1 
ATOM   365  O  O   . THR A 1 49  ? -49.934 5.422  7.205   1.00 23.05 ? 43  THR A O   1 
ATOM   366  C  CB  . THR A 1 49  ? -50.314 4.053  9.847   1.00 27.96 ? 43  THR A CB  1 
ATOM   367  O  OG1 . THR A 1 49  ? -49.790 3.355  10.996  1.00 29.97 ? 43  THR A OG1 1 
ATOM   368  C  CG2 . THR A 1 49  ? -51.805 3.938  9.809   1.00 26.71 ? 43  THR A CG2 1 
ATOM   369  N  N   . TYR A 1 50  ? -51.206 3.635  6.639   1.00 21.83 ? 44  TYR A N   1 
ATOM   370  C  CA  . TYR A 1 50  ? -51.898 4.296  5.527   1.00 21.37 ? 44  TYR A CA  1 
ATOM   371  C  C   . TYR A 1 50  ? -53.311 4.652  5.975   1.00 25.44 ? 44  TYR A C   1 
ATOM   372  O  O   . TYR A 1 50  ? -54.085 3.773  6.440   1.00 23.44 ? 44  TYR A O   1 
ATOM   373  C  CB  . TYR A 1 50  ? -52.018 3.325  4.350   1.00 22.47 ? 44  TYR A CB  1 
ATOM   374  C  CG  . TYR A 1 50  ? -52.559 3.966  3.095   1.00 24.17 ? 44  TYR A CG  1 
ATOM   375  C  CD1 . TYR A 1 50  ? -53.929 3.944  2.792   1.00 22.44 ? 44  TYR A CD1 1 
ATOM   376  C  CD2 . TYR A 1 50  ? -51.677 4.560  2.190   1.00 25.41 ? 44  TYR A CD2 1 
ATOM   377  C  CE1 . TYR A 1 50  ? -54.414 4.559  1.582   1.00 22.49 ? 44  TYR A CE1 1 
ATOM   378  C  CE2 . TYR A 1 50  ? -52.134 5.138  1.000   1.00 23.72 ? 44  TYR A CE2 1 
ATOM   379  C  CZ  . TYR A 1 50  ? -53.481 5.150  0.720   1.00 23.40 ? 44  TYR A CZ  1 
ATOM   380  O  OH  . TYR A 1 50  ? -53.879 5.754  -0.468  1.00 23.83 ? 44  TYR A OH  1 
ATOM   381  N  N   . VAL A 1 51  ? -53.701 5.915  5.790   1.00 21.93 ? 45  VAL A N   1 
ATOM   382  C  CA  . VAL A 1 51  ? -55.038 6.316  6.190   1.00 23.95 ? 45  VAL A CA  1 
ATOM   383  C  C   . VAL A 1 51  ? -56.054 6.011  5.091   1.00 24.10 ? 45  VAL A C   1 
ATOM   384  O  O   . VAL A 1 51  ? -56.066 6.646  4.014   1.00 25.31 ? 45  VAL A O   1 
ATOM   385  C  CB  . VAL A 1 51  ? -55.070 7.821  6.614   1.00 22.16 ? 45  VAL A CB  1 
ATOM   386  C  CG1 . VAL A 1 51  ? -56.525 8.266  6.857   1.00 24.54 ? 45  VAL A CG1 1 
ATOM   387  C  CG2 . VAL A 1 51  ? -54.163 8.029  7.851   1.00 23.12 ? 45  VAL A CG2 1 
ATOM   388  N  N   . GLY A 1 52  ? -56.886 4.994  5.323   1.00 22.91 ? 46  GLY A N   1 
ATOM   389  C  CA  . GLY A 1 52  ? -57.822 4.587  4.278   1.00 23.50 ? 46  GLY A CA  1 
ATOM   390  C  C   . GLY A 1 52  ? -58.981 5.570  4.148   1.00 24.74 ? 46  GLY A C   1 
ATOM   391  O  O   . GLY A 1 52  ? -59.550 5.732  3.070   1.00 25.86 ? 46  GLY A O   1 
ATOM   392  N  N   . SER A 1 53  ? -59.354 6.209  5.247   1.00 26.83 ? 47  SER A N   1 
ATOM   393  C  CA  . SER A 1 53  ? -60.470 7.170  5.146   1.00 27.34 ? 47  SER A CA  1 
ATOM   394  C  C   . SER A 1 53  ? -60.269 8.319  6.093   1.00 25.73 ? 47  SER A C   1 
ATOM   395  O  O   . SER A 1 53  ? -59.943 8.107  7.257   1.00 27.10 ? 47  SER A O   1 
ATOM   396  C  CB  . SER A 1 53  ? -61.815 6.506  5.478   1.00 28.96 ? 47  SER A CB  1 
ATOM   397  O  OG  . SER A 1 53  ? -62.870 7.481  5.585   1.00 31.05 ? 47  SER A OG  1 
ATOM   398  N  N   . SER A 1 54  ? -60.558 9.539  5.632   1.00 25.90 ? 48  SER A N   1 
ATOM   399  C  CA  . SER A 1 54  ? -60.449 10.670 6.552   1.00 27.66 ? 48  SER A CA  1 
ATOM   400  C  C   . SER A 1 54  ? -61.577 10.667 7.573   1.00 30.47 ? 48  SER A C   1 
ATOM   401  O  O   . SER A 1 54  ? -61.522 11.411 8.545   1.00 32.49 ? 48  SER A O   1 
ATOM   402  C  CB  . SER A 1 54  ? -60.502 11.986 5.786   1.00 27.57 ? 48  SER A CB  1 
ATOM   403  O  OG  . SER A 1 54  ? -61.780 12.150 5.213   1.00 27.20 ? 48  SER A OG  1 
ATOM   404  N  N   . ARG A 1 55  ? -62.608 9.865  7.344   1.00 31.73 ? 49  ARG A N   1 
ATOM   405  C  CA  . ARG A 1 55  ? -63.787 9.906  8.223   1.00 34.61 ? 49  ARG A CA  1 
ATOM   406  C  C   . ARG A 1 55  ? -63.639 9.086  9.502   1.00 38.31 ? 49  ARG A C   1 
ATOM   407  O  O   . ARG A 1 55  ? -64.410 9.273  10.434  1.00 40.47 ? 49  ARG A O   1 
ATOM   408  C  CB  . ARG A 1 55  ? -65.023 9.436  7.461   1.00 35.55 ? 49  ARG A CB  1 
ATOM   409  C  CG  . ARG A 1 55  ? -65.359 10.280 6.229   1.00 44.61 ? 49  ARG A CG  1 
ATOM   410  C  CD  . ARG A 1 55  ? -66.385 9.561  5.351   1.00 51.59 ? 49  ARG A CD  1 
ATOM   411  N  NE  . ARG A 1 55  ? -66.734 10.360 4.177   1.00 62.60 ? 49  ARG A NE  1 
ATOM   412  C  CZ  . ARG A 1 55  ? -67.649 10.015 3.271   1.00 66.18 ? 49  ARG A CZ  1 
ATOM   413  N  NH1 . ARG A 1 55  ? -68.319 8.874  3.399   1.00 67.11 ? 49  ARG A NH1 1 
ATOM   414  N  NH2 . ARG A 1 55  ? -67.903 10.816 2.238   1.00 67.76 ? 49  ARG A NH2 1 
ATOM   415  N  N   . SER A 1 56  ? -62.658 8.187  9.551   1.00 37.61 ? 50  SER A N   1 
ATOM   416  C  CA  . SER A 1 56  ? -62.569 7.239  10.658  1.00 39.43 ? 50  SER A CA  1 
ATOM   417  C  C   . SER A 1 56  ? -61.236 6.501  10.697  1.00 39.32 ? 50  SER A C   1 
ATOM   418  O  O   . SER A 1 56  ? -60.734 6.091  9.658   1.00 38.98 ? 50  SER A O   1 
ATOM   419  C  CB  . SER A 1 56  ? -63.641 6.165  10.461  1.00 38.35 ? 50  SER A CB  1 
ATOM   420  O  OG  . SER A 1 56  ? -63.440 5.125  11.398  1.00 47.24 ? 50  SER A OG  1 
ATOM   421  N  N   . LEU A 1 57  ? -60.695 6.298  11.894  1.00 38.19 ? 51  LEU A N   1 
ATOM   422  C  CA  . LEU A 1 57  ? -59.503 5.462  12.072  1.00 41.07 ? 51  LEU A CA  1 
ATOM   423  C  C   . LEU A 1 57  ? -59.769 3.994  11.732  1.00 41.03 ? 51  LEU A C   1 
ATOM   424  O  O   . LEU A 1 57  ? -58.824 3.197  11.583  1.00 40.97 ? 51  LEU A O   1 
ATOM   425  C  CB  . LEU A 1 57  ? -59.006 5.540  13.508  1.00 42.77 ? 51  LEU A CB  1 
ATOM   426  C  CG  . LEU A 1 57  ? -58.085 6.712  13.795  1.00 47.43 ? 51  LEU A CG  1 
ATOM   427  C  CD1 . LEU A 1 57  ? -58.820 8.041  13.623  1.00 47.64 ? 51  LEU A CD1 1 
ATOM   428  C  CD2 . LEU A 1 57  ? -57.496 6.568  15.202  1.00 48.35 ? 51  LEU A CD2 1 
ATOM   429  N  N   . ASP A 1 58  ? -61.043 3.629  11.609  1.00 41.30 ? 52  ASP A N   1 
ATOM   430  C  CA  . ASP A 1 58  ? -61.423 2.238  11.338  1.00 43.10 ? 52  ASP A CA  1 
ATOM   431  C  C   . ASP A 1 58  ? -60.817 1.749  10.043  1.00 40.84 ? 52  ASP A C   1 
ATOM   432  O  O   . ASP A 1 58  ? -60.649 0.545  9.847   1.00 40.68 ? 52  ASP A O   1 
ATOM   433  C  CB  . ASP A 1 58  ? -62.937 2.093  11.183  1.00 46.18 ? 52  ASP A CB  1 
ATOM   434  C  CG  . ASP A 1 58  ? -63.684 2.200  12.489  1.00 50.87 ? 52  ASP A CG  1 
ATOM   435  O  OD1 . ASP A 1 58  ? -63.051 2.388  13.547  1.00 52.23 ? 52  ASP A OD1 1 
ATOM   436  O  OD2 . ASP A 1 58  ? -64.930 2.098  12.433  1.00 56.49 ? 52  ASP A OD2 1 
ATOM   437  N  N   . HIS A 1 59  ? -60.509 2.680  9.138   1.00 35.01 ? 53  HIS A N   1 
ATOM   438  C  CA  . HIS A 1 59  ? -60.019 2.297  7.842   1.00 30.73 ? 53  HIS A CA  1 
ATOM   439  C  C   . HIS A 1 59  ? -58.513 2.430  7.702   1.00 28.19 ? 53  HIS A C   1 
ATOM   440  O  O   . HIS A 1 59  ? -57.991 2.360  6.589   1.00 28.88 ? 53  HIS A O   1 
ATOM   441  C  CB  . HIS A 1 59  ? -60.796 3.032  6.745   1.00 33.93 ? 53  HIS A CB  1 
ATOM   442  C  CG  . HIS A 1 59  ? -62.251 2.664  6.720   1.00 39.07 ? 53  HIS A CG  1 
ATOM   443  N  ND1 . HIS A 1 59  ? -62.705 1.450  6.245   1.00 41.36 ? 53  HIS A ND1 1 
ATOM   444  C  CD2 . HIS A 1 59  ? -63.343 3.334  7.149   1.00 43.06 ? 53  HIS A CD2 1 
ATOM   445  C  CE1 . HIS A 1 59  ? -64.021 1.402  6.362   1.00 45.55 ? 53  HIS A CE1 1 
ATOM   446  N  NE2 . HIS A 1 59  ? -64.432 2.530  6.914   1.00 44.07 ? 53  HIS A NE2 1 
ATOM   447  N  N   . ASP A 1 60  ? -57.823 2.617  8.822   1.00 25.49 ? 54  ASP A N   1 
ATOM   448  C  CA  . ASP A 1 60  ? -56.342 2.693  8.791   1.00 26.46 ? 54  ASP A CA  1 
ATOM   449  C  C   . ASP A 1 60  ? -55.821 1.309  8.425   1.00 29.35 ? 54  ASP A C   1 
ATOM   450  O  O   . ASP A 1 60  ? -56.386 0.295  8.870   1.00 30.01 ? 54  ASP A O   1 
ATOM   451  C  CB  . ASP A 1 60  ? -55.764 3.065  10.158  1.00 29.26 ? 54  ASP A CB  1 
ATOM   452  C  CG  . ASP A 1 60  ? -55.850 4.552  10.467  1.00 32.28 ? 54  ASP A CG  1 
ATOM   453  O  OD1 . ASP A 1 60  ? -56.464 5.308  9.663   1.00 29.20 ? 54  ASP A OD1 1 
ATOM   454  O  OD2 . ASP A 1 60  ? -55.299 4.950  11.520  1.00 30.61 ? 54  ASP A OD2 1 
ATOM   455  N  N   . GLN A 1 61  ? -54.751 1.263  7.642   1.00 26.24 ? 55  GLN A N   1 
ATOM   456  C  CA  . GLN A 1 61  ? -54.073 -0.030 7.370   1.00 26.21 ? 55  GLN A CA  1 
ATOM   457  C  C   . GLN A 1 61  ? -52.624 0.092  7.786   1.00 26.50 ? 55  GLN A C   1 
ATOM   458  O  O   . GLN A 1 61  ? -51.903 0.938  7.261   1.00 23.95 ? 55  GLN A O   1 
ATOM   459  C  CB  . GLN A 1 61  ? -54.154 -0.399 5.888   1.00 24.68 ? 55  GLN A CB  1 
ATOM   460  C  CG  . GLN A 1 61  ? -55.551 -0.674 5.345   1.00 28.57 ? 55  GLN A CG  1 
ATOM   461  C  CD  . GLN A 1 61  ? -55.527 -1.116 3.902   1.00 30.39 ? 55  GLN A CD  1 
ATOM   462  O  OE1 . GLN A 1 61  ? -54.734 -1.999 3.511   1.00 30.11 ? 55  GLN A OE1 1 
ATOM   463  N  NE2 . GLN A 1 61  ? -56.400 -0.518 3.090   1.00 31.51 ? 55  GLN A NE2 1 
ATOM   464  N  N   A GLU A 1 62  ? -52.160 -0.686 8.776   0.50 27.14 ? 56  GLU A N   1 
ATOM   465  N  N   B GLU A 1 62  ? -52.194 -0.774 8.692   0.50 24.81 ? 56  GLU A N   1 
ATOM   466  C  CA  A GLU A 1 62  ? -50.736 -0.612 9.112   0.50 26.63 ? 56  GLU A CA  1 
ATOM   467  C  CA  B GLU A 1 62  ? -50.821 -0.789 9.095   0.50 23.31 ? 56  GLU A CA  1 
ATOM   468  C  C   A GLU A 1 62  ? -50.024 -1.418 8.042   0.50 26.08 ? 56  GLU A C   1 
ATOM   469  C  C   B GLU A 1 62  ? -50.036 -1.470 7.978   0.50 24.56 ? 56  GLU A C   1 
ATOM   470  O  O   A GLU A 1 62  ? -50.384 -2.569 7.795   0.50 26.71 ? 56  GLU A O   1 
ATOM   471  O  O   B GLU A 1 62  ? -50.363 -2.596 7.619   0.50 26.23 ? 56  GLU A O   1 
ATOM   472  C  CB  A GLU A 1 62  ? -50.364 -1.145 10.514  0.50 27.15 ? 56  GLU A CB  1 
ATOM   473  C  CB  B GLU A 1 62  ? -50.703 -1.566 10.401  0.50 24.15 ? 56  GLU A CB  1 
ATOM   474  C  CG  A GLU A 1 62  ? -48.884 -0.828 10.926  0.50 31.24 ? 56  GLU A CG  1 
ATOM   475  C  CG  B GLU A 1 62  ? -51.523 -0.905 11.497  0.50 28.57 ? 56  GLU A CG  1 
ATOM   476  C  CD  A GLU A 1 62  ? -48.527 -1.264 12.352  0.50 32.86 ? 56  GLU A CD  1 
ATOM   477  C  CD  B GLU A 1 62  ? -51.149 0.541  11.654  0.50 32.05 ? 56  GLU A CD  1 
ATOM   478  O  OE1 A GLU A 1 62  ? -49.324 -1.016 13.292  0.50 38.44 ? 56  GLU A OE1 1 
ATOM   479  O  OE1 B GLU A 1 62  ? -49.928 0.835  11.681  0.50 35.61 ? 56  GLU A OE1 1 
ATOM   480  O  OE2 A GLU A 1 62  ? -47.448 -1.867 12.536  0.50 37.23 ? 56  GLU A OE2 1 
ATOM   481  O  OE2 B GLU A 1 62  ? -52.069 1.382  11.761  0.50 36.55 ? 56  GLU A OE2 1 
ATOM   482  N  N   . LEU A 1 63  ? -49.028 -0.800 7.418   1.00 22.99 ? 57  LEU A N   1 
ATOM   483  C  CA  . LEU A 1 63  ? -48.337 -1.369 6.269   1.00 23.28 ? 57  LEU A CA  1 
ATOM   484  C  C   . LEU A 1 63  ? -47.089 -2.103 6.680   1.00 25.36 ? 57  LEU A C   1 
ATOM   485  O  O   . LEU A 1 63  ? -46.708 -3.091 6.031   1.00 24.67 ? 57  LEU A O   1 
ATOM   486  C  CB  . LEU A 1 63  ? -47.952 -0.290 5.258   1.00 22.51 ? 57  LEU A CB  1 
ATOM   487  C  CG  . LEU A 1 63  ? -49.133 0.543  4.723   1.00 22.45 ? 57  LEU A CG  1 
ATOM   488  C  CD1 . LEU A 1 63  ? -48.585 1.429  3.581   1.00 25.19 ? 57  LEU A CD1 1 
ATOM   489  C  CD2 . LEU A 1 63  ? -50.275 -0.372 4.229   1.00 25.63 ? 57  LEU A CD2 1 
ATOM   490  N  N   . ASP A 1 64  ? -46.419 -1.619 7.727   1.00 23.49 ? 58  ASP A N   1 
ATOM   491  C  CA  . ASP A 1 64  ? -45.137 -2.235 8.132   1.00 25.67 ? 58  ASP A CA  1 
ATOM   492  C  C   . ASP A 1 64  ? -44.767 -1.836 9.534   1.00 27.63 ? 58  ASP A C   1 
ATOM   493  O  O   . ASP A 1 64  ? -45.316 -0.866 10.069  1.00 26.05 ? 58  ASP A O   1 
ATOM   494  C  CB  . ASP A 1 64  ? -44.022 -1.799 7.177   1.00 27.04 ? 58  ASP A CB  1 
ATOM   495  C  CG  . ASP A 1 64  ? -42.993 -2.922 6.905   1.00 37.89 ? 58  ASP A CG  1 
ATOM   496  O  OD1 . ASP A 1 64  ? -42.369 -2.880 5.814   1.00 41.00 ? 58  ASP A OD1 1 
ATOM   497  O  OD2 . ASP A 1 64  ? -42.827 -3.834 7.758   1.00 33.00 ? 58  ASP A OD2 1 
ATOM   498  N  N   . SER A 1 65  ? -43.851 -2.598 10.139  1.00 24.91 ? 59  SER A N   1 
ATOM   499  C  CA  . SER A 1 65  ? -43.357 -2.279 11.443  1.00 27.69 ? 59  SER A CA  1 
ATOM   500  C  C   . SER A 1 65  ? -41.960 -2.825 11.538  1.00 28.91 ? 59  SER A C   1 
ATOM   501  O  O   . SER A 1 65  ? -41.637 -3.879 10.929  1.00 31.87 ? 59  SER A O   1 
ATOM   502  C  CB  . SER A 1 65  ? -44.241 -2.847 12.548  1.00 30.82 ? 59  SER A CB  1 
ATOM   503  O  OG  . SER A 1 65  ? -43.576 -2.667 13.799  1.00 38.39 ? 59  SER A OG  1 
ATOM   504  N  N   . ILE A 1 66  ? -41.091 -2.080 12.196  1.00 23.42 ? 60  ILE A N   1 
ATOM   505  C  CA  . ILE A 1 66  ? -39.765 -2.617 12.483  1.00 26.37 ? 60  ILE A CA  1 
ATOM   506  C  C   . ILE A 1 66  ? -39.492 -2.399 13.949  1.00 24.41 ? 60  ILE A C   1 
ATOM   507  O  O   . ILE A 1 66  ? -39.543 -1.283 14.450  1.00 26.67 ? 60  ILE A O   1 
ATOM   508  C  CB  . ILE A 1 66  ? -38.594 -2.163 11.538  1.00 30.90 ? 60  ILE A CB  1 
ATOM   509  C  CG1 . ILE A 1 66  ? -37.321 -2.955 11.851  1.00 33.57 ? 60  ILE A CG1 1 
ATOM   510  C  CG2 . ILE A 1 66  ? -38.286 -0.722 11.674  1.00 31.31 ? 60  ILE A CG2 1 
ATOM   511  C  CD1 . ILE A 1 66  ? -36.105 -2.654 10.923  1.00 34.08 ? 60  ILE A CD1 1 
ATOM   512  N  N   . LEU A 1 67  ? -39.220 -3.495 14.636  1.00 23.56 ? 61  LEU A N   1 
ATOM   513  C  CA  . LEU A 1 67  ? -39.042 -3.455 16.092  1.00 23.77 ? 61  LEU A CA  1 
ATOM   514  C  C   . LEU A 1 67  ? -37.550 -3.692 16.297  1.00 23.50 ? 61  LEU A C   1 
ATOM   515  O  O   . LEU A 1 67  ? -36.969 -4.648 15.740  1.00 25.30 ? 61  LEU A O   1 
ATOM   516  C  CB  . LEU A 1 67  ? -39.897 -4.568 16.711  1.00 25.92 ? 61  LEU A CB  1 
ATOM   517  C  CG  . LEU A 1 67  ? -39.785 -4.843 18.200  1.00 26.80 ? 61  LEU A CG  1 
ATOM   518  C  CD1 . LEU A 1 67  ? -40.427 -3.668 18.949  1.00 26.02 ? 61  LEU A CD1 1 
ATOM   519  C  CD2 . LEU A 1 67  ? -40.535 -6.168 18.529  1.00 25.06 ? 61  LEU A CD2 1 
ATOM   520  N  N   . VAL A 1 68  ? -36.903 -2.806 17.070  1.00 25.15 ? 62  VAL A N   1 
ATOM   521  C  CA  . VAL A 1 68  ? -35.474 -2.874 17.258  1.00 26.49 ? 62  VAL A CA  1 
ATOM   522  C  C   . VAL A 1 68  ? -35.164 -2.845 18.750  1.00 27.26 ? 62  VAL A C   1 
ATOM   523  O  O   . VAL A 1 68  ? -35.660 -1.980 19.487  1.00 27.30 ? 62  VAL A O   1 
ATOM   524  C  CB  . VAL A 1 68  ? -34.754 -1.663 16.570  1.00 28.25 ? 62  VAL A CB  1 
ATOM   525  C  CG1 . VAL A 1 68  ? -33.246 -1.651 16.888  1.00 30.50 ? 62  VAL A CG1 1 
ATOM   526  C  CG2 . VAL A 1 68  ? -34.944 -1.726 15.061  1.00 25.57 ? 62  VAL A CG2 1 
ATOM   527  N  N   . GLY A 1 69  ? -34.323 -3.764 19.209  1.00 26.51 ? 63  GLY A N   1 
ATOM   528  C  CA  . GLY A 1 69  ? -33.946 -3.710 20.623  1.00 28.02 ? 63  GLY A CA  1 
ATOM   529  C  C   . GLY A 1 69  ? -32.837 -4.719 20.907  1.00 29.57 ? 63  GLY A C   1 
ATOM   530  O  O   . GLY A 1 69  ? -32.879 -5.821 20.392  1.00 27.88 ? 63  GLY A O   1 
ATOM   531  N  N   . PRO A 1 70  ? -31.814 -4.317 21.674  1.00 31.35 ? 64  PRO A N   1 
ATOM   532  C  CA  . PRO A 1 70  ? -31.661 -2.943 22.174  1.00 31.15 ? 64  PRO A CA  1 
ATOM   533  C  C   . PRO A 1 70  ? -31.313 -2.001 21.029  1.00 31.13 ? 64  PRO A C   1 
ATOM   534  O  O   . PRO A 1 70  ? -31.053 -2.444 19.910  1.00 31.44 ? 64  PRO A O   1 
ATOM   535  C  CB  . PRO A 1 70  ? -30.486 -3.057 23.159  1.00 34.22 ? 64  PRO A CB  1 
ATOM   536  C  CG  . PRO A 1 70  ? -29.698 -4.201 22.654  1.00 34.61 ? 64  PRO A CG  1 
ATOM   537  C  CD  . PRO A 1 70  ? -30.716 -5.195 22.117  1.00 31.86 ? 64  PRO A CD  1 
ATOM   538  N  N   . VAL A 1 71  ? -31.320 -0.701 21.302  1.00 31.41 ? 65  VAL A N   1 
ATOM   539  C  CA  . VAL A 1 71  ? -31.063 0.264  20.248  1.00 32.89 ? 65  VAL A CA  1 
ATOM   540  C  C   . VAL A 1 71  ? -29.564 0.577  20.256  1.00 32.61 ? 65  VAL A C   1 
ATOM   541  O  O   . VAL A 1 71  ? -29.020 0.929  21.294  1.00 35.18 ? 65  VAL A O   1 
ATOM   542  C  CB  . VAL A 1 71  ? -31.855 1.562  20.501  1.00 32.89 ? 65  VAL A CB  1 
ATOM   543  C  CG1 . VAL A 1 71  ? -31.665 2.517  19.310  1.00 32.13 ? 65  VAL A CG1 1 
ATOM   544  C  CG2 . VAL A 1 71  ? -33.361 1.236  20.765  1.00 33.54 ? 65  VAL A CG2 1 
ATOM   545  N  N   . PRO A 1 72  ? -28.896 0.430  19.109  1.00 32.95 ? 66  PRO A N   1 
ATOM   546  C  CA  . PRO A 1 72  ? -27.469 0.740  19.056  1.00 35.36 ? 66  PRO A CA  1 
ATOM   547  C  C   . PRO A 1 72  ? -27.238 2.241  19.215  1.00 36.19 ? 66  PRO A C   1 
ATOM   548  O  O   . PRO A 1 72  ? -28.001 3.057  18.677  1.00 36.44 ? 66  PRO A O   1 
ATOM   549  C  CB  . PRO A 1 72  ? -27.068 0.293  17.649  1.00 35.02 ? 66  PRO A CB  1 
ATOM   550  C  CG  . PRO A 1 72  ? -28.147 -0.658 17.217  1.00 37.69 ? 66  PRO A CG  1 
ATOM   551  C  CD  . PRO A 1 72  ? -29.389 -0.065 17.810  1.00 35.95 ? 66  PRO A CD  1 
ATOM   552  N  N   . VAL A 1 73  ? -26.195 2.599  19.956  1.00 36.83 ? 67  VAL A N   1 
ATOM   553  C  CA  . VAL A 1 73  ? -25.887 3.996  20.197  1.00 36.40 ? 67  VAL A CA  1 
ATOM   554  C  C   . VAL A 1 73  ? -25.294 4.582  18.933  1.00 36.25 ? 67  VAL A C   1 
ATOM   555  O  O   . VAL A 1 73  ? -24.663 3.873  18.150  1.00 39.01 ? 67  VAL A O   1 
ATOM   556  C  CB  . VAL A 1 73  ? -24.961 4.154  21.422  1.00 37.26 ? 67  VAL A CB  1 
ATOM   557  C  CG1 . VAL A 1 73  ? -24.405 5.581  21.525  1.00 39.71 ? 67  VAL A CG1 1 
ATOM   558  C  CG2 . VAL A 1 73  ? -25.707 3.728  22.681  1.00 39.44 ? 67  VAL A CG2 1 
ATOM   559  N  N   . GLY A 1 74  ? -25.545 5.866  18.690  1.00 35.67 ? 68  GLY A N   1 
ATOM   560  C  CA  . GLY A 1 74  ? -25.006 6.527  17.503  1.00 37.13 ? 68  GLY A CA  1 
ATOM   561  C  C   . GLY A 1 74  ? -26.041 6.700  16.402  1.00 38.66 ? 68  GLY A C   1 
ATOM   562  O  O   . GLY A 1 74  ? -27.253 6.618  16.638  1.00 36.59 ? 68  GLY A O   1 
ATOM   563  N  N   . VAL A 1 75  ? -25.562 6.916  15.190  1.00 37.55 ? 69  VAL A N   1 
ATOM   564  C  CA  . VAL A 1 75  ? -26.442 7.050  14.040  1.00 37.57 ? 69  VAL A CA  1 
ATOM   565  C  C   . VAL A 1 75  ? -26.838 5.676  13.504  1.00 40.00 ? 69  VAL A C   1 
ATOM   566  O  O   . VAL A 1 75  ? -25.983 4.792  13.302  1.00 39.10 ? 69  VAL A O   1 
ATOM   567  C  CB  . VAL A 1 75  ? -25.779 7.890  12.936  1.00 41.10 ? 69  VAL A CB  1 
ATOM   568  C  CG1 . VAL A 1 75  ? -26.710 8.039  11.722  1.00 42.37 ? 69  VAL A CG1 1 
ATOM   569  C  CG2 . VAL A 1 75  ? -25.401 9.248  13.496  1.00 40.66 ? 69  VAL A CG2 1 
ATOM   570  N  N   . ASN A 1 76  ? -28.142 5.494  13.308  1.00 36.84 ? 70  ASN A N   1 
ATOM   571  C  CA  . ASN A 1 76  ? -28.712 4.257  12.753  1.00 35.09 ? 70  ASN A CA  1 
ATOM   572  C  C   . ASN A 1 76  ? -29.507 4.515  11.483  1.00 36.15 ? 70  ASN A C   1 
ATOM   573  O  O   . ASN A 1 76  ? -30.187 5.532  11.383  1.00 34.87 ? 70  ASN A O   1 
ATOM   574  C  CB  . ASN A 1 76  ? -29.688 3.634  13.760  1.00 34.34 ? 70  ASN A CB  1 
ATOM   575  C  CG  . ASN A 1 76  ? -29.005 3.168  15.038  1.00 37.09 ? 70  ASN A CG  1 
ATOM   576  O  OD1 . ASN A 1 76  ? -28.641 2.009  15.147  1.00 36.51 ? 70  ASN A OD1 1 
ATOM   577  N  ND2 . ASN A 1 76  ? -28.839 4.065  16.006  1.00 36.04 ? 70  ASN A ND2 1 
ATOM   578  N  N   . LYS A 1 77  ? -29.468 3.560  10.550  1.00 39.09 ? 71  LYS A N   1 
ATOM   579  C  CA  . LYS A 1 77  ? -30.266 3.605  9.310   1.00 41.75 ? 71  LYS A CA  1 
ATOM   580  C  C   . LYS A 1 77  ? -31.028 2.300  9.043   1.00 42.67 ? 71  LYS A C   1 
ATOM   581  O  O   . LYS A 1 77  ? -30.552 1.195  9.365   1.00 41.24 ? 71  LYS A O   1 
ATOM   582  C  CB  . LYS A 1 77  ? -29.377 3.859  8.106   1.00 43.72 ? 71  LYS A CB  1 
ATOM   583  C  CG  . LYS A 1 77  ? -28.750 5.221  8.074   1.00 49.42 ? 71  LYS A CG  1 
ATOM   584  C  CD  . LYS A 1 77  ? -28.219 5.497  6.674   1.00 53.85 ? 71  LYS A CD  1 
ATOM   585  C  CE  . LYS A 1 77  ? -27.799 6.947  6.498   1.00 58.45 ? 71  LYS A CE  1 
ATOM   586  N  NZ  . LYS A 1 77  ? -27.562 7.224  5.051   1.00 62.62 ? 71  LYS A NZ  1 
ATOM   587  N  N   . PHE A 1 78  ? -32.206 2.413  8.442   1.00 39.18 ? 72  PHE A N   1 
ATOM   588  C  CA  . PHE A 1 78  ? -32.900 1.232  7.961   1.00 38.26 ? 72  PHE A CA  1 
ATOM   589  C  C   . PHE A 1 78  ? -33.804 1.638  6.806   1.00 39.35 ? 72  PHE A C   1 
ATOM   590  O  O   . PHE A 1 78  ? -34.032 2.843  6.594   1.00 34.76 ? 72  PHE A O   1 
ATOM   591  C  CB  . PHE A 1 78  ? -33.700 0.515  9.055   1.00 39.02 ? 72  PHE A CB  1 
ATOM   592  C  CG  . PHE A 1 78  ? -34.933 1.244  9.489   1.00 38.48 ? 72  PHE A CG  1 
ATOM   593  C  CD1 . PHE A 1 78  ? -34.893 2.146  10.545  1.00 38.69 ? 72  PHE A CD1 1 
ATOM   594  C  CD2 . PHE A 1 78  ? -36.133 1.020  8.857   1.00 38.51 ? 72  PHE A CD2 1 
ATOM   595  C  CE1 . PHE A 1 78  ? -36.016 2.808  10.939  1.00 40.48 ? 72  PHE A CE1 1 
ATOM   596  C  CE2 . PHE A 1 78  ? -37.281 1.686  9.255   1.00 41.83 ? 72  PHE A CE2 1 
ATOM   597  C  CZ  . PHE A 1 78  ? -37.213 2.583  10.299  1.00 41.73 ? 72  PHE A CZ  1 
ATOM   598  N  N   . VAL A 1 79  ? -34.277 0.628  6.060   1.00 38.62 ? 73  VAL A N   1 
ATOM   599  C  CA  . VAL A 1 79  ? -35.190 0.819  4.949   1.00 39.65 ? 73  VAL A CA  1 
ATOM   600  C  C   . VAL A 1 79  ? -36.498 0.071  5.147   1.00 41.65 ? 73  VAL A C   1 
ATOM   601  O  O   . VAL A 1 79  ? -36.553 -1.016 5.742   1.00 41.01 ? 73  VAL A O   1 
ATOM   602  C  CB  . VAL A 1 79  ? -34.572 0.343  3.656   1.00 42.03 ? 73  VAL A CB  1 
ATOM   603  C  CG1 . VAL A 1 79  ? -33.364 1.216  3.289   1.00 39.30 ? 73  VAL A CG1 1 
ATOM   604  C  CG2 . VAL A 1 79  ? -34.144 -1.112 3.812   1.00 45.09 ? 73  VAL A CG2 1 
ATOM   605  N  N   . PHE A 1 80  ? -37.586 0.703  4.746   1.00 43.10 ? 74  PHE A N   1 
ATOM   606  C  CA  . PHE A 1 80  ? -38.808 -0.048 4.597   1.00 41.47 ? 74  PHE A CA  1 
ATOM   607  C  C   . PHE A 1 80  ? -38.946 -0.263 3.102   1.00 40.48 ? 74  PHE A C   1 
ATOM   608  O  O   . PHE A 1 80  ? -38.609 0.629  2.313   1.00 39.76 ? 74  PHE A O   1 
ATOM   609  C  CB  . PHE A 1 80  ? -40.053 0.763  4.982   1.00 41.27 ? 74  PHE A CB  1 
ATOM   610  C  CG  . PHE A 1 80  ? -40.381 0.767  6.434   1.00 39.55 ? 74  PHE A CG  1 
ATOM   611  C  CD1 . PHE A 1 80  ? -40.425 -0.415 7.165   1.00 43.51 ? 74  PHE A CD1 1 
ATOM   612  C  CD2 . PHE A 1 80  ? -40.702 1.958  7.074   1.00 39.27 ? 74  PHE A CD2 1 
ATOM   613  C  CE1 . PHE A 1 80  ? -40.751 -0.400 8.531   1.00 44.76 ? 74  PHE A CE1 1 
ATOM   614  C  CE2 . PHE A 1 80  ? -41.044 1.981  8.445   1.00 39.22 ? 74  PHE A CE2 1 
ATOM   615  C  CZ  . PHE A 1 80  ? -41.076 0.794  9.167   1.00 40.12 ? 74  PHE A CZ  1 
ATOM   616  N  N   . SER A 1 81  ? -39.278 -1.469 2.739   1.00 34.59 ? 75  SER A N   1 
ATOM   617  C  CA  . SER A 1 81  ? -39.980 -1.630 1.503   1.00 33.96 ? 75  SER A CA  1 
ATOM   618  C  C   . SER A 1 81  ? -41.279 -2.241 2.005   1.00 36.61 ? 75  SER A C   1 
ATOM   619  O  O   . SER A 1 81  ? -41.339 -3.443 2.284   1.00 38.55 ? 75  SER A O   1 
ATOM   620  C  CB  . SER A 1 81  ? -39.262 -2.541 0.515   1.00 33.90 ? 75  SER A CB  1 
ATOM   621  O  OG  . SER A 1 81  ? -40.063 -2.648 -0.642  1.00 36.72 ? 75  SER A OG  1 
ATOM   622  N  N   . ALA A 1 82  ? -42.312 -1.433 2.211   1.00 32.62 ? 76  ALA A N   1 
ATOM   623  C  CA  . ALA A 1 82  ? -43.585 -1.843 2.744   1.00 33.19 ? 76  ALA A CA  1 
ATOM   624  C  C   . ALA A 1 82  ? -44.550 -2.164 1.650   1.00 33.44 ? 76  ALA A C   1 
ATOM   625  O  O   . ALA A 1 82  ? -44.632 -1.440 0.644   1.00 32.78 ? 76  ALA A O   1 
ATOM   626  C  CB  . ALA A 1 82  ? -44.149 -0.727 3.660   1.00 32.25 ? 76  ALA A CB  1 
ATOM   627  N  N   . ASP A 1 83  ? -45.274 -3.274 1.808   1.00 29.03 ? 77  ASP A N   1 
ATOM   628  C  CA  . ASP A 1 83  ? -46.351 -3.574 0.923   1.00 29.84 ? 77  ASP A CA  1 
ATOM   629  C  C   . ASP A 1 83  ? -47.391 -2.413 0.953   1.00 28.71 ? 77  ASP A C   1 
ATOM   630  O  O   . ASP A 1 83  ? -47.597 -1.765 1.992   1.00 28.30 ? 77  ASP A O   1 
ATOM   631  C  CB  . ASP A 1 83  ? -46.984 -4.897 1.352   1.00 34.28 ? 77  ASP A CB  1 
ATOM   632  C  CG  . ASP A 1 83  ? -45.989 -6.078 1.223   1.00 41.61 ? 77  ASP A CG  1 
ATOM   633  O  OD1 . ASP A 1 83  ? -45.045 -5.986 0.396   1.00 43.43 ? 77  ASP A OD1 1 
ATOM   634  O  OD2 . ASP A 1 83  ? -46.122 -7.065 1.969   1.00 43.32 ? 77  ASP A OD2 1 
ATOM   635  N  N   . PRO A 1 84  ? -48.038 -2.160 -0.176  1.00 28.62 ? 78  PRO A N   1 
ATOM   636  C  CA  . PRO A 1 84  ? -49.039 -1.102 -0.242  1.00 27.23 ? 78  PRO A CA  1 
ATOM   637  C  C   . PRO A 1 84  ? -50.322 -1.515 0.464   1.00 28.81 ? 78  PRO A C   1 
ATOM   638  O  O   . PRO A 1 84  ? -50.525 -2.693 0.801   1.00 28.19 ? 78  PRO A O   1 
ATOM   639  C  CB  . PRO A 1 84  ? -49.306 -0.974 -1.741  1.00 30.32 ? 78  PRO A CB  1 
ATOM   640  C  CG  . PRO A 1 84  ? -49.002 -2.384 -2.285  1.00 29.59 ? 78  PRO A CG  1 
ATOM   641  C  CD  . PRO A 1 84  ? -47.866 -2.845 -1.471  1.00 30.60 ? 78  PRO A CD  1 
ATOM   642  N  N   . PRO A 1 85  ? -51.227 -0.553 0.680   1.00 27.51 ? 79  PRO A N   1 
ATOM   643  C  CA  . PRO A 1 85  ? -52.492 -0.900 1.277   1.00 26.89 ? 79  PRO A CA  1 
ATOM   644  C  C   . PRO A 1 85  ? -53.319 -1.731 0.301   1.00 28.09 ? 79  PRO A C   1 
ATOM   645  O  O   . PRO A 1 85  ? -53.072 -1.703 -0.927  1.00 29.06 ? 79  PRO A O   1 
ATOM   646  C  CB  . PRO A 1 85  ? -53.175 0.466  1.452   1.00 25.57 ? 79  PRO A CB  1 
ATOM   647  C  CG  . PRO A 1 85  ? -52.522 1.348  0.392   1.00 25.17 ? 79  PRO A CG  1 
ATOM   648  C  CD  . PRO A 1 85  ? -51.103 0.883  0.358   1.00 27.51 ? 79  PRO A CD  1 
ATOM   649  N  N   A SER A 1 86  ? -54.315 -2.405 0.849   0.50 28.18 ? 80  SER A N   1 
ATOM   650  N  N   B SER A 1 86  ? -54.295 -2.453 0.818   0.50 28.63 ? 80  SER A N   1 
ATOM   651  C  CA  A SER A 1 86  ? -55.278 -3.174 0.077   0.50 31.47 ? 80  SER A CA  1 
ATOM   652  C  CA  B SER A 1 86  ? -55.196 -3.207 -0.046  0.50 32.14 ? 80  SER A CA  1 
ATOM   653  C  C   A SER A 1 86  ? -56.395 -2.257 -0.423  0.50 30.69 ? 80  SER A C   1 
ATOM   654  C  C   B SER A 1 86  ? -56.371 -2.317 -0.438  0.50 31.26 ? 80  SER A C   1 
ATOM   655  O  O   A SER A 1 86  ? -57.104 -1.643 0.379   0.50 31.54 ? 80  SER A O   1 
ATOM   656  O  O   B SER A 1 86  ? -57.079 -1.781 0.418   0.50 32.37 ? 80  SER A O   1 
ATOM   657  C  CB  A SER A 1 86  ? -55.884 -4.263 0.967   0.50 31.08 ? 80  SER A CB  1 
ATOM   658  C  CB  B SER A 1 86  ? -55.688 -4.475 0.651   0.50 32.17 ? 80  SER A CB  1 
ATOM   659  O  OG  A SER A 1 86  ? -56.917 -4.939 0.285   0.50 31.21 ? 80  SER A OG  1 
ATOM   660  O  OG  B SER A 1 86  ? -54.589 -5.243 1.098   0.50 35.30 ? 80  SER A OG  1 
ATOM   661  N  N   . ALA A 1 87  ? -56.560 -2.159 -1.742  1.00 32.41 ? 81  ALA A N   1 
ATOM   662  C  CA  . ALA A 1 87  ? -57.619 -1.308 -2.284  1.00 35.16 ? 81  ALA A CA  1 
ATOM   663  C  C   . ALA A 1 87  ? -58.975 -1.789 -1.831  1.00 36.16 ? 81  ALA A C   1 
ATOM   664  O  O   . ALA A 1 87  ? -59.855 -0.988 -1.570  1.00 37.12 ? 81  ALA A O   1 
ATOM   665  C  CB  . ALA A 1 87  ? -57.547 -1.245 -3.809  1.00 34.16 ? 81  ALA A CB  1 
ATOM   666  N  N   . GLU A 1 88  ? -59.132 -3.110 -1.713  1.00 38.94 ? 82  GLU A N   1 
ATOM   667  C  CA  . GLU A 1 88  ? -60.418 -3.696 -1.306  1.00 41.56 ? 82  GLU A CA  1 
ATOM   668  C  C   . GLU A 1 88  ? -60.879 -3.242 0.061   1.00 41.02 ? 82  GLU A C   1 
ATOM   669  O  O   . GLU A 1 88  ? -62.078 -3.275 0.345   1.00 43.94 ? 82  GLU A O   1 
ATOM   670  C  CB  . GLU A 1 88  ? -60.368 -5.233 -1.345  1.00 45.07 ? 82  GLU A CB  1 
ATOM   671  C  CG  . GLU A 1 88  ? -59.999 -5.795 -2.704  1.00 54.59 ? 82  GLU A CG  1 
ATOM   672  C  CD  . GLU A 1 88  ? -58.553 -5.500 -3.085  1.00 61.66 ? 82  GLU A CD  1 
ATOM   673  O  OE1 . GLU A 1 88  ? -58.293 -5.208 -4.280  1.00 66.16 ? 82  GLU A OE1 1 
ATOM   674  O  OE2 . GLU A 1 88  ? -57.678 -5.544 -2.184  1.00 63.74 ? 82  GLU A OE2 1 
ATOM   675  N  N   . LEU A 1 89  ? -59.948 -2.804 0.912   1.00 36.18 ? 83  LEU A N   1 
ATOM   676  C  CA  . LEU A 1 89  ? -60.315 -2.372 2.247   1.00 36.22 ? 83  LEU A CA  1 
ATOM   677  C  C   . LEU A 1 89  ? -60.571 -0.867 2.371   1.00 36.46 ? 83  LEU A C   1 
ATOM   678  O  O   . LEU A 1 89  ? -60.888 -0.371 3.446   1.00 36.27 ? 83  LEU A O   1 
ATOM   679  C  CB  . LEU A 1 89  ? -59.234 -2.764 3.231   1.00 35.81 ? 83  LEU A CB  1 
ATOM   680  C  CG  . LEU A 1 89  ? -59.000 -4.262 3.392   1.00 37.25 ? 83  LEU A CG  1 
ATOM   681  C  CD1 . LEU A 1 89  ? -57.912 -4.447 4.450   1.00 35.63 ? 83  LEU A CD1 1 
ATOM   682  C  CD2 . LEU A 1 89  ? -60.333 -4.883 3.798   1.00 39.43 ? 83  LEU A CD2 1 
ATOM   683  N  N   . ILE A 1 90  ? -60.407 -0.147 1.275   1.00 35.12 ? 84  ILE A N   1 
ATOM   684  C  CA  . ILE A 1 90  ? -60.602 1.296  1.297   1.00 31.89 ? 84  ILE A CA  1 
ATOM   685  C  C   . ILE A 1 90  ? -61.978 1.602  0.703   1.00 34.72 ? 84  ILE A C   1 
ATOM   686  O  O   . ILE A 1 90  ? -62.329 1.059  -0.352  1.00 35.21 ? 84  ILE A O   1 
ATOM   687  C  CB  . ILE A 1 90  ? -59.524 1.985  0.463   1.00 28.61 ? 84  ILE A CB  1 
ATOM   688  C  CG1 . ILE A 1 90  ? -58.129 1.695  1.046   1.00 28.31 ? 84  ILE A CG1 1 
ATOM   689  C  CG2 . ILE A 1 90  ? -59.769 3.504  0.409   1.00 30.55 ? 84  ILE A CG2 1 
ATOM   690  C  CD1 . ILE A 1 90  ? -56.995 2.148  0.155   1.00 28.36 ? 84  ILE A CD1 1 
ATOM   691  N  N   . PRO A 1 91  ? -62.753 2.469  1.371   1.00 35.83 ? 85  PRO A N   1 
ATOM   692  C  CA  . PRO A 1 91  ? -64.030 2.873  0.776   1.00 38.46 ? 85  PRO A CA  1 
ATOM   693  C  C   . PRO A 1 91  ? -63.790 3.360  -0.654  1.00 40.18 ? 85  PRO A C   1 
ATOM   694  O  O   . PRO A 1 91  ? -62.992 4.283  -0.878  1.00 38.15 ? 85  PRO A O   1 
ATOM   695  C  CB  . PRO A 1 91  ? -64.480 4.015  1.687   1.00 37.93 ? 85  PRO A CB  1 
ATOM   696  C  CG  . PRO A 1 91  ? -63.910 3.687  2.999   1.00 38.27 ? 85  PRO A CG  1 
ATOM   697  C  CD  . PRO A 1 91  ? -62.541 3.109  2.678   1.00 36.32 ? 85  PRO A CD  1 
ATOM   698  N  N   . ALA A 1 92  ? -64.454 2.725  -1.625  1.00 39.86 ? 86  ALA A N   1 
ATOM   699  C  CA  . ALA A 1 92  ? -64.205 3.045  -3.025  1.00 41.63 ? 86  ALA A CA  1 
ATOM   700  C  C   . ALA A 1 92  ? -64.269 4.549  -3.326  1.00 41.85 ? 86  ALA A C   1 
ATOM   701  O  O   . ALA A 1 92  ? -63.506 5.052  -4.151  1.00 42.42 ? 86  ALA A O   1 
ATOM   702  C  CB  . ALA A 1 92  ? -65.134 2.253  -3.947  1.00 43.01 ? 86  ALA A CB  1 
ATOM   703  N  N   . SER A 1 93  ? -65.144 5.270  -2.633  1.00 40.93 ? 87  SER A N   1 
ATOM   704  C  CA  . SER A 1 93  ? -65.296 6.698  -2.882  1.00 41.42 ? 87  SER A CA  1 
ATOM   705  C  C   . SER A 1 93  ? -64.114 7.543  -2.403  1.00 41.05 ? 87  SER A C   1 
ATOM   706  O  O   . SER A 1 93  ? -63.954 8.694  -2.831  1.00 42.04 ? 87  SER A O   1 
ATOM   707  C  CB  . SER A 1 93  ? -66.599 7.233  -2.280  1.00 43.61 ? 87  SER A CB  1 
ATOM   708  O  OG  . SER A 1 93  ? -66.526 7.341  -0.870  1.00 48.27 ? 87  SER A OG  1 
ATOM   709  N  N   . GLU A 1 94  ? -63.287 6.974  -1.525  1.00 34.74 ? 88  GLU A N   1 
ATOM   710  C  CA  . GLU A 1 94  ? -62.130 7.686  -0.989  1.00 35.63 ? 88  GLU A CA  1 
ATOM   711  C  C   . GLU A 1 94  ? -60.803 7.162  -1.552  1.00 33.96 ? 88  GLU A C   1 
ATOM   712  O  O   . GLU A 1 94  ? -59.736 7.698  -1.280  1.00 32.76 ? 88  GLU A O   1 
ATOM   713  C  CB  . GLU A 1 94  ? -62.160 7.620  0.541   1.00 39.01 ? 88  GLU A CB  1 
ATOM   714  C  CG  . GLU A 1 94  ? -63.456 8.222  1.091   1.00 40.78 ? 88  GLU A CG  1 
ATOM   715  C  CD  . GLU A 1 94  ? -63.591 8.042  2.584   1.00 47.23 ? 88  GLU A CD  1 
ATOM   716  O  OE1 . GLU A 1 94  ? -64.441 7.238  3.010   1.00 49.86 ? 88  GLU A OE1 1 
ATOM   717  O  OE2 . GLU A 1 94  ? -62.847 8.697  3.323   1.00 46.43 ? 88  GLU A OE2 1 
ATOM   718  N  N   . LEU A 1 95  ? -60.867 6.134  -2.388  1.00 29.54 ? 89  LEU A N   1 
ATOM   719  C  CA  . LEU A 1 95  ? -59.642 5.513  -2.874  1.00 27.77 ? 89  LEU A CA  1 
ATOM   720  C  C   . LEU A 1 95  ? -58.787 6.406  -3.772  1.00 26.84 ? 89  LEU A C   1 
ATOM   721  O  O   . LEU A 1 95  ? -57.599 6.589  -3.521  1.00 26.26 ? 89  LEU A O   1 
ATOM   722  C  CB  . LEU A 1 95  ? -59.996 4.215  -3.604  1.00 29.14 ? 89  LEU A CB  1 
ATOM   723  C  CG  . LEU A 1 95  ? -58.877 3.393  -4.200  1.00 34.30 ? 89  LEU A CG  1 
ATOM   724  C  CD1 . LEU A 1 95  ? -57.897 2.956  -3.145  1.00 31.52 ? 89  LEU A CD1 1 
ATOM   725  C  CD2 . LEU A 1 95  ? -59.580 2.182  -4.818  1.00 37.94 ? 89  LEU A CD2 1 
ATOM   726  N  N   . VAL A 1 96  ? -59.390 6.969  -4.827  1.00 26.84 ? 90  VAL A N   1 
ATOM   727  C  CA  . VAL A 1 96  ? -58.610 7.769  -5.770  1.00 27.72 ? 90  VAL A CA  1 
ATOM   728  C  C   . VAL A 1 96  ? -58.719 9.230  -5.360  1.00 29.59 ? 90  VAL A C   1 
ATOM   729  O  O   . VAL A 1 96  ? -59.264 10.053 -6.086  1.00 29.88 ? 90  VAL A O   1 
ATOM   730  C  CB  . VAL A 1 96  ? -59.117 7.573  -7.222  1.00 28.37 ? 90  VAL A CB  1 
ATOM   731  C  CG1 . VAL A 1 96  ? -58.089 8.117  -8.215  1.00 33.77 ? 90  VAL A CG1 1 
ATOM   732  C  CG2 . VAL A 1 96  ? -59.351 6.076  -7.485  1.00 31.17 ? 90  VAL A CG2 1 
ATOM   733  N  N   . SER A 1 97  ? -58.231 9.524  -4.166  1.00 26.79 ? 91  SER A N   1 
ATOM   734  C  CA  . SER A 1 97  ? -58.275 10.885 -3.642  1.00 29.41 ? 91  SER A CA  1 
ATOM   735  C  C   . SER A 1 97  ? -57.090 11.056 -2.692  1.00 27.53 ? 91  SER A C   1 
ATOM   736  O  O   . SER A 1 97  ? -56.400 10.069 -2.368  1.00 25.01 ? 91  SER A O   1 
ATOM   737  C  CB  . SER A 1 97  ? -59.606 11.123 -2.930  1.00 34.54 ? 91  SER A CB  1 
ATOM   738  O  OG  . SER A 1 97  ? -59.597 10.502 -1.677  1.00 40.96 ? 91  SER A OG  1 
ATOM   739  N  N   . VAL A 1 98  ? -56.834 12.288 -2.253  1.00 22.73 ? 92  VAL A N   1 
ATOM   740  C  CA  . VAL A 1 98  ? -55.694 12.546 -1.392  1.00 21.38 ? 92  VAL A CA  1 
ATOM   741  C  C   . VAL A 1 98  ? -55.935 11.899 -0.031  1.00 21.40 ? 92  VAL A C   1 
ATOM   742  O  O   . VAL A 1 98  ? -57.097 11.800 0.464   1.00 22.59 ? 92  VAL A O   1 
ATOM   743  C  CB  . VAL A 1 98  ? -55.478 14.091 -1.228  1.00 21.37 ? 92  VAL A CB  1 
ATOM   744  C  CG1 . VAL A 1 98  ? -56.661 14.723 -0.387  1.00 22.50 ? 92  VAL A CG1 1 
ATOM   745  C  CG2 . VAL A 1 98  ? -54.133 14.400 -0.659  1.00 22.37 ? 92  VAL A CG2 1 
ATOM   746  N  N   . THR A 1 99  ? -54.844 11.434 0.558   1.00 23.04 ? 93  THR A N   1 
ATOM   747  C  CA  . THR A 1 99  ? -54.916 10.931 1.942   1.00 21.61 ? 93  THR A CA  1 
ATOM   748  C  C   . THR A 1 99  ? -53.581 11.209 2.622   1.00 22.14 ? 93  THR A C   1 
ATOM   749  O  O   . THR A 1 99  ? -52.820 12.035 2.151   1.00 21.91 ? 93  THR A O   1 
ATOM   750  C  CB  . THR A 1 99  ? -55.368 9.433  1.984   1.00 23.74 ? 93  THR A CB  1 
ATOM   751  O  OG1 . THR A 1 99  ? -55.695 9.103  3.343   1.00 24.02 ? 93  THR A OG1 1 
ATOM   752  C  CG2 . THR A 1 99  ? -54.199 8.528  1.427   1.00 23.76 ? 93  THR A CG2 1 
ATOM   753  N  N   . VAL A 1 100 ? -53.310 10.556 3.762   1.00 19.46 ? 94  VAL A N   1 
ATOM   754  C  CA  . VAL A 1 100 ? -52.052 10.716 4.422   1.00 19.91 ? 94  VAL A CA  1 
ATOM   755  C  C   . VAL A 1 100 ? -51.467 9.350  4.770   1.00 20.74 ? 94  VAL A C   1 
ATOM   756  O  O   . VAL A 1 100 ? -52.194 8.358  4.896   1.00 23.04 ? 94  VAL A O   1 
ATOM   757  C  CB  . VAL A 1 100 ? -52.227 11.476 5.712   1.00 25.00 ? 94  VAL A CB  1 
ATOM   758  C  CG1 . VAL A 1 100 ? -52.634 12.886 5.422   1.00 25.23 ? 94  VAL A CG1 1 
ATOM   759  C  CG2 . VAL A 1 100 ? -53.274 10.829 6.526   1.00 28.22 ? 94  VAL A CG2 1 
ATOM   760  N  N   . ILE A 1 101 ? -50.157 9.336  4.814   1.00 20.10 ? 95  ILE A N   1 
ATOM   761  C  CA  . ILE A 1 101 ? -49.419 8.196  5.420   1.00 22.09 ? 95  ILE A CA  1 
ATOM   762  C  C   . ILE A 1 101 ? -48.665 8.694  6.613   1.00 24.40 ? 95  ILE A C   1 
ATOM   763  O  O   . ILE A 1 101 ? -48.249 9.871  6.659   1.00 23.42 ? 95  ILE A O   1 
ATOM   764  C  CB  . ILE A 1 101 ? -48.481 7.517  4.420   1.00 23.66 ? 95  ILE A CB  1 
ATOM   765  C  CG1 . ILE A 1 101 ? -47.431 8.500  3.865   1.00 23.82 ? 95  ILE A CG1 1 
ATOM   766  C  CG2 . ILE A 1 101 ? -49.283 6.874  3.325   1.00 28.65 ? 95  ILE A CG2 1 
ATOM   767  C  CD1 . ILE A 1 101 ? -46.218 7.861  3.198   1.00 30.25 ? 95  ILE A CD1 1 
ATOM   768  N  N   . LEU A 1 102 ? -48.458 7.816  7.599   1.00 21.27 ? 96  LEU A N   1 
ATOM   769  C  CA  . LEU A 1 102 ? -47.904 8.245  8.852   1.00 23.97 ? 96  LEU A CA  1 
ATOM   770  C  C   . LEU A 1 102 ? -46.806 7.268  9.256   1.00 26.52 ? 96  LEU A C   1 
ATOM   771  O  O   . LEU A 1 102 ? -47.037 6.032  9.239   1.00 27.05 ? 96  LEU A O   1 
ATOM   772  C  CB  . LEU A 1 102 ? -49.002 8.192  9.928   1.00 27.81 ? 96  LEU A CB  1 
ATOM   773  C  CG  . LEU A 1 102 ? -50.288 9.013  9.675   1.00 34.19 ? 96  LEU A CG  1 
ATOM   774  C  CD1 . LEU A 1 102 ? -51.493 8.569  10.486  1.00 36.98 ? 96  LEU A CD1 1 
ATOM   775  C  CD2 . LEU A 1 102 ? -49.972 10.432 9.962   1.00 37.10 ? 96  LEU A CD2 1 
ATOM   776  N  N   A LEU A 1 103 ? -45.611 7.822  9.495   0.50 24.12 ? 97  LEU A N   1 
ATOM   777  N  N   B LEU A 1 103 ? -45.660 7.804  9.625   0.50 25.57 ? 97  LEU A N   1 
ATOM   778  C  CA  A LEU A 1 103 ? -44.387 7.088  9.940   0.50 22.48 ? 97  LEU A CA  1 
ATOM   779  C  CA  B LEU A 1 103 ? -44.597 6.997  10.213  0.50 25.95 ? 97  LEU A CA  1 
ATOM   780  C  C   A LEU A 1 103 ? -44.047 7.497  11.368  0.50 22.51 ? 97  LEU A C   1 
ATOM   781  C  C   B LEU A 1 103 ? -44.654 7.403  11.681  0.50 25.77 ? 97  LEU A C   1 
ATOM   782  O  O   A LEU A 1 103 ? -43.607 8.628  11.617  0.50 20.21 ? 97  LEU A O   1 
ATOM   783  O  O   B LEU A 1 103 ? -44.775 8.586  11.977  0.50 23.00 ? 97  LEU A O   1 
ATOM   784  C  CB  A LEU A 1 103 ? -43.191 7.390  9.042   0.50 27.57 ? 97  LEU A CB  1 
ATOM   785  C  CB  B LEU A 1 103 ? -43.256 7.376  9.605   0.50 28.24 ? 97  LEU A CB  1 
ATOM   786  C  CG  A LEU A 1 103 ? -42.839 6.385  7.953   0.50 29.70 ? 97  LEU A CG  1 
ATOM   787  C  CG  B LEU A 1 103 ? -42.020 6.673  10.150  0.50 32.39 ? 97  LEU A CG  1 
ATOM   788  C  CD1 A LEU A 1 103 ? -41.625 6.860  7.159   0.50 34.84 ? 97  LEU A CD1 1 
ATOM   789  C  CD1 B LEU A 1 103 ? -41.958 5.255  9.599   0.50 31.36 ? 97  LEU A CD1 1 
ATOM   790  C  CD2 A LEU A 1 103 ? -42.543 5.037  8.571   0.50 33.16 ? 97  LEU A CD2 1 
ATOM   791  C  CD2 B LEU A 1 103 ? -40.754 7.445  9.808   0.50 34.43 ? 97  LEU A CD2 1 
ATOM   792  N  N   A SER A 1 104 ? -44.248 6.568  12.300  0.50 24.01 ? 98  SER A N   1 
ATOM   793  N  N   B SER A 1 104 ? -44.623 6.444  12.605  0.50 23.72 ? 98  SER A N   1 
ATOM   794  C  CA  A SER A 1 104 ? -44.117 6.891  13.703  0.50 23.27 ? 98  SER A CA  1 
ATOM   795  C  CA  B SER A 1 104 ? -44.625 6.783  14.028  0.50 23.43 ? 98  SER A CA  1 
ATOM   796  C  C   A SER A 1 104 ? -43.090 6.046  14.419  0.50 21.89 ? 98  SER A C   1 
ATOM   797  C  C   B SER A 1 104 ? -43.593 5.909  14.749  0.50 23.76 ? 98  SER A C   1 
ATOM   798  O  O   A SER A 1 104 ? -42.637 4.998  13.926  0.50 19.01 ? 98  SER A O   1 
ATOM   799  O  O   B SER A 1 104 ? -43.550 4.717  14.476  0.50 22.46 ? 98  SER A O   1 
ATOM   800  C  CB  A SER A 1 104 ? -45.462 6.746  14.408  0.50 24.58 ? 98  SER A CB  1 
ATOM   801  C  CB  B SER A 1 104 ? -46.016 6.527  14.600  0.50 26.53 ? 98  SER A CB  1 
ATOM   802  O  OG  A SER A 1 104 ? -45.980 5.423  14.288  0.50 28.37 ? 98  SER A OG  1 
ATOM   803  O  OG  B SER A 1 104 ? -46.050 6.781  15.981  0.50 32.01 ? 98  SER A OG  1 
ATOM   804  N  N   . CYS A 1 105 ? -42.752 6.489  15.624  1.00 24.33 ? 99  CYS A N   1 
ATOM   805  C  CA  . CYS A 1 105 ? -41.789 5.718  16.390  1.00 23.13 ? 99  CYS A CA  1 
ATOM   806  C  C   . CYS A 1 105 ? -42.142 5.806  17.844  1.00 25.06 ? 99  CYS A C   1 
ATOM   807  O  O   . CYS A 1 105 ? -42.490 6.900  18.357  1.00 22.83 ? 99  CYS A O   1 
ATOM   808  C  CB  . CYS A 1 105 ? -40.357 6.171  16.188  1.00 25.81 ? 99  CYS A CB  1 
ATOM   809  S  SG  . CYS A 1 105 ? -39.164 4.895  16.855  1.00 31.97 ? 99  CYS A SG  1 
ATOM   810  N  N   A SER A 1 106 ? -42.064 4.660  18.506  0.50 25.13 ? 100 SER A N   1 
ATOM   811  N  N   B SER A 1 106 ? -42.114 4.659  18.521  0.50 26.52 ? 100 SER A N   1 
ATOM   812  C  CA  A SER A 1 106 ? -42.290 4.607  19.933  0.50 23.88 ? 100 SER A CA  1 
ATOM   813  C  CA  B SER A 1 106 ? -42.407 4.598  19.955  0.50 26.86 ? 100 SER A CA  1 
ATOM   814  C  C   A SER A 1 106 ? -41.080 4.003  20.628  0.50 23.88 ? 100 SER A C   1 
ATOM   815  C  C   B SER A 1 106 ? -41.274 3.868  20.682  0.50 25.63 ? 100 SER A C   1 
ATOM   816  O  O   A SER A 1 106 ? -40.215 3.346  20.010  0.50 21.48 ? 100 SER A O   1 
ATOM   817  O  O   B SER A 1 106 ? -40.655 2.968  20.118  0.50 24.84 ? 100 SER A O   1 
ATOM   818  C  CB  A SER A 1 106 ? -43.552 3.809  20.281  0.50 25.08 ? 100 SER A CB  1 
ATOM   819  C  CB  B SER A 1 106 ? -43.729 3.870  20.222  0.50 29.38 ? 100 SER A CB  1 
ATOM   820  O  OG  A SER A 1 106 ? -43.456 2.446  19.879  0.50 21.95 ? 100 SER A OG  1 
ATOM   821  O  OG  B SER A 1 106 ? -44.803 4.405  19.460  0.50 35.05 ? 100 SER A OG  1 
ATOM   822  N  N   . TYR A 1 107 ? -40.995 4.276  21.922  1.00 26.90 ? 101 TYR A N   1 
ATOM   823  C  CA  . TYR A 1 107 ? -39.951 3.672  22.731  1.00 29.27 ? 101 TYR A CA  1 
ATOM   824  C  C   . TYR A 1 107 ? -40.637 3.107  23.954  1.00 32.06 ? 101 TYR A C   1 
ATOM   825  O  O   . TYR A 1 107 ? -41.407 3.804  24.634  1.00 29.69 ? 101 TYR A O   1 
ATOM   826  C  CB  . TYR A 1 107 ? -38.865 4.674  23.164  1.00 32.05 ? 101 TYR A CB  1 
ATOM   827  C  CG  . TYR A 1 107 ? -37.914 4.017  24.158  1.00 33.52 ? 101 TYR A CG  1 
ATOM   828  C  CD1 . TYR A 1 107 ? -37.004 3.058  23.737  1.00 32.26 ? 101 TYR A CD1 1 
ATOM   829  C  CD2 . TYR A 1 107 ? -37.974 4.327  25.520  1.00 39.31 ? 101 TYR A CD2 1 
ATOM   830  C  CE1 . TYR A 1 107 ? -36.143 2.432  24.648  1.00 35.34 ? 101 TYR A CE1 1 
ATOM   831  C  CE2 . TYR A 1 107 ? -37.121 3.693  26.441  1.00 37.92 ? 101 TYR A CE2 1 
ATOM   832  C  CZ  . TYR A 1 107 ? -36.223 2.757  25.986  1.00 36.87 ? 101 TYR A CZ  1 
ATOM   833  O  OH  . TYR A 1 107 ? -35.354 2.126  26.858  1.00 40.22 ? 101 TYR A OH  1 
ATOM   834  N  N   . ASP A 1 108 ? -40.407 1.814  24.207  1.00 31.41 ? 102 ASP A N   1 
ATOM   835  C  CA  . ASP A 1 108 ? -41.078 1.155  25.324  1.00 35.33 ? 102 ASP A CA  1 
ATOM   836  C  C   . ASP A 1 108 ? -42.566 1.438  25.275  1.00 35.09 ? 102 ASP A C   1 
ATOM   837  O  O   . ASP A 1 108 ? -43.205 1.660  26.294  1.00 37.72 ? 102 ASP A O   1 
ATOM   838  C  CB  . ASP A 1 108 ? -40.474 1.663  26.645  1.00 36.44 ? 102 ASP A CB  1 
ATOM   839  C  CG  . ASP A 1 108 ? -40.885 0.823  27.839  1.00 44.72 ? 102 ASP A CG  1 
ATOM   840  O  OD1 . ASP A 1 108 ? -41.036 -0.405 27.656  1.00 40.52 ? 102 ASP A OD1 1 
ATOM   841  O  OD2 . ASP A 1 108 ? -41.044 1.397  28.954  1.00 43.48 ? 102 ASP A OD2 1 
ATOM   842  N  N   . GLY A 1 109 ? -43.119 1.470  24.068  1.00 33.02 ? 103 GLY A N   1 
ATOM   843  C  CA  . GLY A 1 109 ? -44.539 1.721  23.889  1.00 32.71 ? 103 GLY A CA  1 
ATOM   844  C  C   . GLY A 1 109 ? -45.004 3.162  23.985  1.00 32.92 ? 103 GLY A C   1 
ATOM   845  O  O   . GLY A 1 109 ? -46.206 3.415  23.895  1.00 37.63 ? 103 GLY A O   1 
ATOM   846  N  N   . ARG A 1 110 ? -44.072 4.098  24.192  1.00 32.53 ? 104 ARG A N   1 
ATOM   847  C  CA  . ARG A 1 110 ? -44.419 5.536  24.309  1.00 29.89 ? 104 ARG A CA  1 
ATOM   848  C  C   . ARG A 1 110 ? -44.060 6.243  22.987  1.00 27.26 ? 104 ARG A C   1 
ATOM   849  O  O   . ARG A 1 110 ? -42.913 6.302  22.647  1.00 27.73 ? 104 ARG A O   1 
ATOM   850  C  CB  . ARG A 1 110 ? -43.636 6.145  25.477  1.00 30.92 ? 104 ARG A CB  1 
ATOM   851  C  CG  . ARG A 1 110 ? -44.092 5.607  26.846  1.00 36.37 ? 104 ARG A CG  1 
ATOM   852  C  CD  . ARG A 1 110 ? -43.423 6.338  28.056  1.00 33.45 ? 104 ARG A CD  1 
ATOM   853  N  NE  . ARG A 1 110 ? -41.988 6.089  28.182  1.00 35.48 ? 104 ARG A NE  1 
ATOM   854  C  CZ  . ARG A 1 110 ? -41.448 4.956  28.616  1.00 35.56 ? 104 ARG A CZ  1 
ATOM   855  N  NH1 . ARG A 1 110 ? -42.236 3.924  28.903  1.00 41.64 ? 104 ARG A NH1 1 
ATOM   856  N  NH2 . ARG A 1 110 ? -40.122 4.827  28.687  1.00 39.16 ? 104 ARG A NH2 1 
ATOM   857  N  N   . GLU A 1 111 ? -45.050 6.761  22.272  1.00 29.23 ? 105 GLU A N   1 
ATOM   858  C  CA  . GLU A 1 111 ? -44.807 7.445  20.992  1.00 28.77 ? 105 GLU A CA  1 
ATOM   859  C  C   . GLU A 1 111 ? -44.039 8.737  21.212  1.00 27.10 ? 105 GLU A C   1 
ATOM   860  O  O   . GLU A 1 111 ? -44.497 9.591  22.005  1.00 26.83 ? 105 GLU A O   1 
ATOM   861  C  CB  . GLU A 1 111 ? -46.131 7.771  20.302  1.00 28.96 ? 105 GLU A CB  1 
ATOM   862  C  CG  . GLU A 1 111 ? -45.943 8.483  18.962  1.00 33.53 ? 105 GLU A CG  1 
ATOM   863  C  CD  . GLU A 1 111 ? -47.229 8.911  18.244  1.00 39.93 ? 105 GLU A CD  1 
ATOM   864  O  OE1 . GLU A 1 111 ? -48.288 9.116  18.888  1.00 47.46 ? 105 GLU A OE1 1 
ATOM   865  O  OE2 . GLU A 1 111 ? -47.177 9.061  17.006  1.00 46.61 ? 105 GLU A OE2 1 
ATOM   866  N  N   . PHE A 1 112 ? -42.918 8.923  20.512  1.00 23.24 ? 106 PHE A N   1 
ATOM   867  C  CA  . PHE A 1 112 ? -42.165 10.175 20.694  1.00 24.26 ? 106 PHE A CA  1 
ATOM   868  C  C   . PHE A 1 112 ? -42.025 11.001 19.411  1.00 23.46 ? 106 PHE A C   1 
ATOM   869  O  O   . PHE A 1 112 ? -41.630 12.147 19.465  1.00 24.79 ? 106 PHE A O   1 
ATOM   870  C  CB  . PHE A 1 112 ? -40.783 9.940  21.328  1.00 23.15 ? 106 PHE A CB  1 
ATOM   871  C  CG  . PHE A 1 112 ? -39.868 9.084  20.496  1.00 23.72 ? 106 PHE A CG  1 
ATOM   872  C  CD1 . PHE A 1 112 ? -38.991 9.664  19.574  1.00 25.56 ? 106 PHE A CD1 1 
ATOM   873  C  CD2 . PHE A 1 112 ? -39.926 7.692  20.604  1.00 26.35 ? 106 PHE A CD2 1 
ATOM   874  C  CE1 . PHE A 1 112 ? -38.155 8.880  18.787  1.00 24.86 ? 106 PHE A CE1 1 
ATOM   875  C  CE2 . PHE A 1 112 ? -39.090 6.903  19.825  1.00 26.77 ? 106 PHE A CE2 1 
ATOM   876  C  CZ  . PHE A 1 112 ? -38.229 7.481  18.915  1.00 23.35 ? 106 PHE A CZ  1 
ATOM   877  N  N   . VAL A 1 113 ? -42.284 10.393 18.249  1.00 24.33 ? 107 VAL A N   1 
ATOM   878  C  CA  . VAL A 1 113 ? -42.242 11.197 17.013  1.00 23.66 ? 107 VAL A CA  1 
ATOM   879  C  C   . VAL A 1 113 ? -43.215 10.588 16.003  1.00 24.57 ? 107 VAL A C   1 
ATOM   880  O  O   . VAL A 1 113 ? -43.374 9.353  15.925  1.00 24.74 ? 107 VAL A O   1 
ATOM   881  C  CB  . VAL A 1 113 ? -40.827 11.333 16.437  1.00 25.96 ? 107 VAL A CB  1 
ATOM   882  C  CG1 . VAL A 1 113 ? -40.253 9.967  16.009  1.00 26.21 ? 107 VAL A CG1 1 
ATOM   883  C  CG2 . VAL A 1 113 ? -40.782 12.326 15.246  1.00 26.49 ? 107 VAL A CG2 1 
ATOM   884  N  N   . ARG A 1 114 ? -43.881 11.452 15.235  1.00 23.44 ? 108 ARG A N   1 
ATOM   885  C  CA  . ARG A 1 114 ? -44.793 10.982 14.170  1.00 24.03 ? 108 ARG A CA  1 
ATOM   886  C  C   . ARG A 1 114 ? -44.444 11.849 12.947  1.00 26.16 ? 108 ARG A C   1 
ATOM   887  O  O   . ARG A 1 114 ? -44.195 13.055 13.075  1.00 23.68 ? 108 ARG A O   1 
ATOM   888  C  CB  . ARG A 1 114 ? -46.233 11.210 14.642  1.00 26.95 ? 108 ARG A CB  1 
ATOM   889  C  CG  . ARG A 1 114 ? -47.315 11.211 13.597  1.00 38.48 ? 108 ARG A CG  1 
ATOM   890  C  CD  . ARG A 1 114 ? -48.734 11.149 14.246  1.00 36.96 ? 108 ARG A CD  1 
ATOM   891  N  NE  . ARG A 1 114 ? -48.838 9.877  14.983  1.00 50.43 ? 108 ARG A NE  1 
ATOM   892  C  CZ  . ARG A 1 114 ? -49.918 9.103  15.011  1.00 53.43 ? 108 ARG A CZ  1 
ATOM   893  N  NH1 . ARG A 1 114 ? -51.008 9.443  14.328  1.00 58.12 ? 108 ARG A NH1 1 
ATOM   894  N  NH2 . ARG A 1 114 ? -49.905 7.974  15.709  1.00 57.67 ? 108 ARG A NH2 1 
ATOM   895  N  N   . VAL A 1 115 ? -44.360 11.242 11.772  1.00 20.27 ? 109 VAL A N   1 
ATOM   896  C  CA  . VAL A 1 115 ? -44.127 12.030 10.538  1.00 22.82 ? 109 VAL A CA  1 
ATOM   897  C  C   . VAL A 1 115 ? -45.281 11.745 9.619   1.00 23.60 ? 109 VAL A C   1 
ATOM   898  O  O   . VAL A 1 115 ? -45.571 10.572 9.313   1.00 22.89 ? 109 VAL A O   1 
ATOM   899  C  CB  . VAL A 1 115 ? -42.818 11.626 9.856   1.00 23.39 ? 109 VAL A CB  1 
ATOM   900  C  CG1 . VAL A 1 115 ? -42.586 12.445 8.575   1.00 24.97 ? 109 VAL A CG1 1 
ATOM   901  C  CG2 . VAL A 1 115 ? -41.624 11.760 10.838  1.00 25.38 ? 109 VAL A CG2 1 
ATOM   902  N  N   . GLY A 1 116 ? -45.962 12.792 9.149   1.00 20.85 ? 110 GLY A N   1 
ATOM   903  C  CA  . GLY A 1 116 ? -47.078 12.607 8.264   1.00 20.44 ? 110 GLY A CA  1 
ATOM   904  C  C   . GLY A 1 116 ? -46.715 13.192 6.889   1.00 22.49 ? 110 GLY A C   1 
ATOM   905  O  O   . GLY A 1 116 ? -46.009 14.230 6.829   1.00 22.84 ? 110 GLY A O   1 
ATOM   906  N  N   . TYR A 1 117 ? -47.147 12.506 5.831   1.00 20.97 ? 111 TYR A N   1 
ATOM   907  C  CA  . TYR A 1 117 ? -47.023 13.017 4.455   1.00 22.17 ? 111 TYR A CA  1 
ATOM   908  C  C   . TYR A 1 117 ? -48.389 12.980 3.778   1.00 20.76 ? 111 TYR A C   1 
ATOM   909  O  O   . TYR A 1 117 ? -49.184 12.020 3.945   1.00 20.65 ? 111 TYR A O   1 
ATOM   910  C  CB  . TYR A 1 117 ? -46.156 12.066 3.604   1.00 24.02 ? 111 TYR A CB  1 
ATOM   911  C  CG  . TYR A 1 117 ? -44.704 12.045 3.995   1.00 25.12 ? 111 TYR A CG  1 
ATOM   912  C  CD1 . TYR A 1 117 ? -43.806 12.976 3.482   1.00 24.87 ? 111 TYR A CD1 1 
ATOM   913  C  CD2 . TYR A 1 117 ? -44.221 11.047 4.825   1.00 23.95 ? 111 TYR A CD2 1 
ATOM   914  C  CE1 . TYR A 1 117 ? -42.451 12.912 3.819   1.00 23.31 ? 111 TYR A CE1 1 
ATOM   915  C  CE2 . TYR A 1 117 ? -42.896 10.980 5.174   1.00 24.15 ? 111 TYR A CE2 1 
ATOM   916  C  CZ  . TYR A 1 117 ? -42.007 11.904 4.642   1.00 25.33 ? 111 TYR A CZ  1 
ATOM   917  O  OH  . TYR A 1 117 ? -40.688 11.853 4.986   1.00 30.55 ? 111 TYR A OH  1 
ATOM   918  N  N   . TYR A 1 118 ? -48.692 14.004 2.982   1.00 18.82 ? 112 TYR A N   1 
ATOM   919  C  CA  . TYR A 1 118 ? -49.851 13.892 2.110   1.00 18.32 ? 112 TYR A CA  1 
ATOM   920  C  C   . TYR A 1 118 ? -49.513 12.984 0.924   1.00 18.62 ? 112 TYR A C   1 
ATOM   921  O  O   . TYR A 1 118 ? -48.386 13.008 0.418   1.00 22.43 ? 112 TYR A O   1 
ATOM   922  C  CB  . TYR A 1 118 ? -50.253 15.291 1.608   1.00 21.58 ? 112 TYR A CB  1 
ATOM   923  C  CG  . TYR A 1 118 ? -50.844 16.109 2.741   1.00 20.88 ? 112 TYR A CG  1 
ATOM   924  C  CD1 . TYR A 1 118 ? -51.986 15.662 3.371   1.00 21.33 ? 112 TYR A CD1 1 
ATOM   925  C  CD2 . TYR A 1 118 ? -50.236 17.265 3.177   1.00 25.55 ? 112 TYR A CD2 1 
ATOM   926  C  CE1 . TYR A 1 118 ? -52.541 16.344 4.446   1.00 24.70 ? 112 TYR A CE1 1 
ATOM   927  C  CE2 . TYR A 1 118 ? -50.815 18.008 4.254   1.00 26.86 ? 112 TYR A CE2 1 
ATOM   928  C  CZ  . TYR A 1 118 ? -51.975 17.504 4.862   1.00 25.64 ? 112 TYR A CZ  1 
ATOM   929  O  OH  . TYR A 1 118 ? -52.591 18.184 5.903   1.00 31.76 ? 112 TYR A OH  1 
ATOM   930  N  N   . VAL A 1 119 ? -50.509 12.234 0.497   1.00 20.38 ? 113 VAL A N   1 
ATOM   931  C  CA  . VAL A 1 119 ? -50.393 11.344 -0.680  1.00 21.20 ? 113 VAL A CA  1 
ATOM   932  C  C   . VAL A 1 119 ? -51.563 11.605 -1.615  1.00 19.23 ? 113 VAL A C   1 
ATOM   933  O  O   . VAL A 1 119 ? -52.719 11.370 -1.267  1.00 21.54 ? 113 VAL A O   1 
ATOM   934  C  CB  . VAL A 1 119 ? -50.366 9.846  -0.235  1.00 21.02 ? 113 VAL A CB  1 
ATOM   935  C  CG1 . VAL A 1 119 ? -50.053 8.942  -1.484  1.00 23.20 ? 113 VAL A CG1 1 
ATOM   936  C  CG2 . VAL A 1 119 ? -49.315 9.635  0.871   1.00 24.96 ? 113 VAL A CG2 1 
ATOM   937  N  N   . ASN A 1 120 ? -51.299 12.131 -2.827  1.00 19.36 ? 114 ASN A N   1 
ATOM   938  C  CA  . ASN A 1 120 ? -52.391 12.274 -3.771  1.00 20.84 ? 114 ASN A CA  1 
ATOM   939  C  C   . ASN A 1 120 ? -52.473 10.988 -4.596  1.00 23.45 ? 114 ASN A C   1 
ATOM   940  O  O   . ASN A 1 120 ? -51.443 10.348 -4.830  1.00 28.62 ? 114 ASN A O   1 
ATOM   941  C  CB  . ASN A 1 120 ? -52.160 13.459 -4.710  1.00 22.74 ? 114 ASN A CB  1 
ATOM   942  C  CG  . ASN A 1 120 ? -53.405 13.832 -5.450  1.00 23.73 ? 114 ASN A CG  1 
ATOM   943  O  OD1 . ASN A 1 120 ? -54.507 13.653 -4.935  1.00 26.92 ? 114 ASN A OD1 1 
ATOM   944  N  ND2 . ASN A 1 120 ? -53.251 14.281 -6.705  1.00 27.52 ? 114 ASN A ND2 1 
ATOM   945  N  N   . ASN A 1 121 ? -53.678 10.609 -4.960  1.00 23.16 ? 115 ASN A N   1 
ATOM   946  C  CA  . ASN A 1 121 ? -53.897 9.432  -5.840  1.00 21.77 ? 115 ASN A CA  1 
ATOM   947  C  C   . ASN A 1 121 ? -54.707 9.945  -7.013  1.00 27.16 ? 115 ASN A C   1 
ATOM   948  O  O   . ASN A 1 121 ? -55.773 10.545 -6.813  1.00 26.65 ? 115 ASN A O   1 
ATOM   949  C  CB  . ASN A 1 121 ? -54.723 8.399  -5.099  1.00 23.97 ? 115 ASN A CB  1 
ATOM   950  C  CG  . ASN A 1 121 ? -53.947 7.736  -4.025  1.00 24.88 ? 115 ASN A CG  1 
ATOM   951  O  OD1 . ASN A 1 121 ? -52.943 7.053  -4.304  1.00 25.14 ? 115 ASN A OD1 1 
ATOM   952  N  ND2 . ASN A 1 121 ? -54.357 7.954  -2.756  1.00 23.35 ? 115 ASN A ND2 1 
ATOM   953  N  N   . GLU A 1 122 ? -54.231 9.678  -8.227  1.00 27.05 ? 116 GLU A N   1 
ATOM   954  C  CA  . GLU A 1 122 ? -54.876 10.239 -9.418  1.00 29.50 ? 116 GLU A CA  1 
ATOM   955  C  C   . GLU A 1 122 ? -54.788 9.226  -10.532 1.00 28.90 ? 116 GLU A C   1 
ATOM   956  O  O   . GLU A 1 122 ? -53.753 8.565  -10.652 1.00 29.12 ? 116 GLU A O   1 
ATOM   957  C  CB  . GLU A 1 122 ? -54.069 11.462 -9.869  1.00 31.91 ? 116 GLU A CB  1 
ATOM   958  C  CG  . GLU A 1 122 ? -54.705 12.232 -10.970 1.00 39.54 ? 116 GLU A CG  1 
ATOM   959  C  CD  . GLU A 1 122 ? -53.840 13.384 -11.374 1.00 42.74 ? 116 GLU A CD  1 
ATOM   960  O  OE1 . GLU A 1 122 ? -52.832 13.156 -12.089 1.00 48.35 ? 116 GLU A OE1 1 
ATOM   961  O  OE2 . GLU A 1 122 ? -54.154 14.513 -10.971 1.00 44.50 ? 116 GLU A OE2 1 
ATOM   962  N  N   . TYR A 1 123 ? -55.831 9.126  -11.347 1.00 26.63 ? 117 TYR A N   1 
ATOM   963  C  CA  . TYR A 1 123 ? -55.764 8.212  -12.514 1.00 30.87 ? 117 TYR A CA  1 
ATOM   964  C  C   . TYR A 1 123 ? -54.727 8.698  -13.527 1.00 32.26 ? 117 TYR A C   1 
ATOM   965  O  O   . TYR A 1 123 ? -54.470 9.905  -13.661 1.00 32.64 ? 117 TYR A O   1 
ATOM   966  C  CB  . TYR A 1 123 ? -57.140 8.090  -13.159 1.00 29.90 ? 117 TYR A CB  1 
ATOM   967  C  CG  . TYR A 1 123 ? -58.084 7.154  -12.481 1.00 29.02 ? 117 TYR A CG  1 
ATOM   968  C  CD1 . TYR A 1 123 ? -57.706 5.833  -12.199 1.00 29.27 ? 117 TYR A CD1 1 
ATOM   969  C  CD2 . TYR A 1 123 ? -59.354 7.549  -12.132 1.00 29.56 ? 117 TYR A CD2 1 
ATOM   970  C  CE1 . TYR A 1 123 ? -58.583 4.956  -11.622 1.00 28.88 ? 117 TYR A CE1 1 
ATOM   971  C  CE2 . TYR A 1 123 ? -60.242 6.673  -11.552 1.00 29.61 ? 117 TYR A CE2 1 
ATOM   972  C  CZ  . TYR A 1 123 ? -59.853 5.365  -11.300 1.00 29.68 ? 117 TYR A CZ  1 
ATOM   973  O  OH  . TYR A 1 123 ? -60.714 4.477  -10.690 1.00 31.11 ? 117 TYR A OH  1 
ATOM   974  N  N   . ASP A 1 124 ? -54.127 7.768  -14.272 1.00 33.57 ? 118 ASP A N   1 
ATOM   975  C  CA  . ASP A 1 124 ? -53.046 8.131  -15.177 1.00 38.38 ? 118 ASP A CA  1 
ATOM   976  C  C   . ASP A 1 124 ? -53.534 8.386  -16.602 1.00 41.00 ? 118 ASP A C   1 
ATOM   977  O  O   . ASP A 1 124 ? -52.724 8.546  -17.503 1.00 43.12 ? 118 ASP A O   1 
ATOM   978  C  CB  . ASP A 1 124 ? -51.936 7.060  -15.192 1.00 39.70 ? 118 ASP A CB  1 
ATOM   979  C  CG  . ASP A 1 124 ? -52.413 5.711  -15.753 1.00 41.26 ? 118 ASP A CG  1 
ATOM   980  O  OD1 . ASP A 1 124 ? -53.608 5.551  -16.082 1.00 39.34 ? 118 ASP A OD1 1 
ATOM   981  O  OD2 . ASP A 1 124 ? -51.577 4.790  -15.852 1.00 48.43 ? 118 ASP A OD2 1 
ATOM   982  N  N   . GLU A 1 125 ? -54.840 8.361  -16.809 1.00 43.17 ? 119 GLU A N   1 
ATOM   983  C  CA  . GLU A 1 125 ? -55.389 8.696  -18.124 1.00 48.07 ? 119 GLU A CA  1 
ATOM   984  C  C   . GLU A 1 125 ? -56.387 9.841  -18.011 1.00 48.34 ? 119 GLU A C   1 
ATOM   985  O  O   . GLU A 1 125 ? -57.196 9.882  -17.089 1.00 46.73 ? 119 GLU A O   1 
ATOM   986  C  CB  . GLU A 1 125 ? -56.045 7.482  -18.793 1.00 49.61 ? 119 GLU A CB  1 
ATOM   987  C  CG  . GLU A 1 125 ? -55.120 6.291  -19.067 1.00 57.11 ? 119 GLU A CG  1 
ATOM   988  C  CD  . GLU A 1 125 ? -53.920 6.635  -19.956 1.00 63.79 ? 119 GLU A CD  1 
ATOM   989  O  OE1 . GLU A 1 125 ? -53.943 7.691  -20.636 1.00 66.88 ? 119 GLU A OE1 1 
ATOM   990  O  OE2 . GLU A 1 125 ? -52.946 5.841  -19.973 1.00 65.16 ? 119 GLU A OE2 1 
ATOM   991  N  N   . GLU A 1 126 ? -56.326 10.764 -18.968 1.00 51.88 ? 120 GLU A N   1 
ATOM   992  C  CA  . GLU A 1 126 ? -57.245 11.900 -19.003 1.00 55.26 ? 120 GLU A CA  1 
ATOM   993  C  C   . GLU A 1 126 ? -58.692 11.446 -18.917 1.00 53.37 ? 120 GLU A C   1 
ATOM   994  O  O   . GLU A 1 126 ? -59.470 11.980 -18.127 1.00 52.73 ? 120 GLU A O   1 
ATOM   995  C  CB  . GLU A 1 126 ? -57.031 12.712 -20.284 1.00 56.85 ? 120 GLU A CB  1 
ATOM   996  C  CG  . GLU A 1 126 ? -58.039 13.839 -20.478 1.00 61.19 ? 120 GLU A CG  1 
ATOM   997  C  CD  . GLU A 1 126 ? -57.836 14.570 -21.798 1.00 62.31 ? 120 GLU A CD  1 
ATOM   998  O  OE1 . GLU A 1 126 ? -56.798 14.332 -22.462 1.00 65.05 ? 120 GLU A OE1 1 
ATOM   999  O  OE2 . GLU A 1 126 ? -58.714 15.380 -22.171 1.00 68.00 ? 120 GLU A OE2 1 
ATOM   1000 N  N   . GLU A 1 127 ? -59.047 10.446 -19.724 1.00 53.45 ? 121 GLU A N   1 
ATOM   1001 C  CA  . GLU A 1 127 ? -60.410 9.927  -19.757 1.00 54.37 ? 121 GLU A CA  1 
ATOM   1002 C  C   . GLU A 1 127 ? -60.916 9.539  -18.377 1.00 51.20 ? 121 GLU A C   1 
ATOM   1003 O  O   . GLU A 1 127 ? -62.033 9.898  -17.998 1.00 51.95 ? 121 GLU A O   1 
ATOM   1004 C  CB  . GLU A 1 127 ? -60.528 8.738  -20.732 1.00 55.73 ? 121 GLU A CB  1 
ATOM   1005 C  CG  . GLU A 1 127 ? -61.886 8.013  -20.696 1.00 60.22 ? 121 GLU A CG  1 
ATOM   1006 C  CD  . GLU A 1 127 ? -61.984 6.813  -21.668 1.00 61.23 ? 121 GLU A CD  1 
ATOM   1007 O  OE1 . GLU A 1 127 ? -61.122 6.669  -22.573 1.00 63.88 ? 121 GLU A OE1 1 
ATOM   1008 O  OE2 . GLU A 1 127 ? -62.944 6.019  -21.529 1.00 64.77 ? 121 GLU A OE2 1 
ATOM   1009 N  N   . LEU A 1 128 ? -60.095 8.809  -17.619 1.00 47.96 ? 122 LEU A N   1 
ATOM   1010 C  CA  . LEU A 1 128 ? -60.502 8.361  -16.285 1.00 45.99 ? 122 LEU A CA  1 
ATOM   1011 C  C   . LEU A 1 128 ? -60.590 9.497  -15.272 1.00 43.67 ? 122 LEU A C   1 
ATOM   1012 O  O   . LEU A 1 128 ? -61.478 9.505  -14.412 1.00 43.23 ? 122 LEU A O   1 
ATOM   1013 C  CB  . LEU A 1 128 ? -59.546 7.287  -15.760 1.00 44.00 ? 122 LEU A CB  1 
ATOM   1014 C  CG  . LEU A 1 128 ? -59.510 5.931  -16.450 1.00 42.95 ? 122 LEU A CG  1 
ATOM   1015 C  CD1 . LEU A 1 128 ? -58.295 5.170  -15.965 1.00 40.58 ? 122 LEU A CD1 1 
ATOM   1016 C  CD2 . LEU A 1 128 ? -60.809 5.141  -16.183 1.00 44.75 ? 122 LEU A CD2 1 
ATOM   1017 N  N   . ARG A 1 129 ? -59.639 10.419 -15.343 1.00 44.00 ? 123 ARG A N   1 
ATOM   1018 C  CA  . ARG A 1 129 ? -59.615 11.567 -14.439 1.00 47.31 ? 123 ARG A CA  1 
ATOM   1019 C  C   . ARG A 1 129 ? -60.866 12.401 -14.649 1.00 51.13 ? 123 ARG A C   1 
ATOM   1020 O  O   . ARG A 1 129 ? -61.456 12.900 -13.691 1.00 51.01 ? 123 ARG A O   1 
ATOM   1021 C  CB  . ARG A 1 129 ? -58.387 12.446 -14.681 1.00 45.89 ? 123 ARG A CB  1 
ATOM   1022 C  CG  . ARG A 1 129 ? -57.055 11.831 -14.315 1.00 40.73 ? 123 ARG A CG  1 
ATOM   1023 C  CD  . ARG A 1 129 ? -55.978 12.892 -14.227 1.00 46.42 ? 123 ARG A CD  1 
ATOM   1024 N  NE  . ARG A 1 129 ? -55.654 13.467 -15.528 1.00 47.52 ? 123 ARG A NE  1 
ATOM   1025 C  CZ  . ARG A 1 129 ? -54.734 12.973 -16.349 1.00 49.61 ? 123 ARG A CZ  1 
ATOM   1026 N  NH1 . ARG A 1 129 ? -54.053 11.883 -16.012 1.00 46.05 ? 123 ARG A NH1 1 
ATOM   1027 N  NH2 . ARG A 1 129 ? -54.501 13.562 -17.519 1.00 49.94 ? 123 ARG A NH2 1 
ATOM   1028 N  N   A GLU A 1 130 ? -61.272 12.535 -15.910 0.50 53.81 ? 124 GLU A N   1 
ATOM   1029 N  N   B GLU A 1 130 ? -61.260 12.556 -15.909 0.50 53.47 ? 124 GLU A N   1 
ATOM   1030 C  CA  A GLU A 1 130 ? -62.448 13.327 -16.270 0.50 57.38 ? 124 GLU A CA  1 
ATOM   1031 C  CA  B GLU A 1 130 ? -62.462 13.310 -16.238 0.50 56.53 ? 124 GLU A CA  1 
ATOM   1032 C  C   A GLU A 1 130 ? -63.758 12.615 -15.918 0.50 57.71 ? 124 GLU A C   1 
ATOM   1033 C  C   B GLU A 1 130 ? -63.697 12.571 -15.758 0.50 57.27 ? 124 GLU A C   1 
ATOM   1034 O  O   A GLU A 1 130 ? -64.706 13.246 -15.457 0.50 58.79 ? 124 GLU A O   1 
ATOM   1035 O  O   B GLU A 1 130 ? -64.526 13.132 -15.045 0.50 58.12 ? 124 GLU A O   1 
ATOM   1036 C  CB  A GLU A 1 130 ? -62.408 13.685 -17.759 0.50 57.77 ? 124 GLU A CB  1 
ATOM   1037 C  CB  B GLU A 1 130 ? -62.564 13.546 -17.746 0.50 57.21 ? 124 GLU A CB  1 
ATOM   1038 C  CG  A GLU A 1 130 ? -63.455 14.695 -18.202 0.50 59.30 ? 124 GLU A CG  1 
ATOM   1039 C  CG  B GLU A 1 130 ? -61.398 14.299 -18.351 0.50 57.73 ? 124 GLU A CG  1 
ATOM   1040 C  CD  A GLU A 1 130 ? -63.525 14.835 -19.714 0.50 59.07 ? 124 GLU A CD  1 
ATOM   1041 C  CD  B GLU A 1 130 ? -61.259 15.707 -17.815 0.50 58.99 ? 124 GLU A CD  1 
ATOM   1042 O  OE1 A GLU A 1 130 ? -63.067 13.914 -20.426 0.50 58.96 ? 124 GLU A OE1 1 
ATOM   1043 O  OE1 B GLU A 1 130 ? -61.968 16.053 -16.843 0.50 58.40 ? 124 GLU A OE1 1 
ATOM   1044 O  OE2 A GLU A 1 130 ? -64.051 15.864 -20.191 0.50 60.61 ? 124 GLU A OE2 1 
ATOM   1045 O  OE2 B GLU A 1 130 ? -60.437 16.467 -18.373 0.50 58.89 ? 124 GLU A OE2 1 
ATOM   1046 N  N   . ASN A 1 131 ? -63.805 11.303 -16.145 1.00 57.70 ? 125 ASN A N   1 
ATOM   1047 C  CA  . ASN A 1 131 ? -64.970 10.491 -15.799 1.00 58.47 ? 125 ASN A CA  1 
ATOM   1048 C  C   . ASN A 1 131 ? -64.605 9.237  -15.003 1.00 57.08 ? 125 ASN A C   1 
ATOM   1049 O  O   . ASN A 1 131 ? -64.591 8.137  -15.552 1.00 57.05 ? 125 ASN A O   1 
ATOM   1050 C  CB  . ASN A 1 131 ? -65.736 10.083 -17.064 1.00 61.00 ? 125 ASN A CB  1 
ATOM   1051 C  CG  . ASN A 1 131 ? -66.393 11.261 -17.754 1.00 65.11 ? 125 ASN A CG  1 
ATOM   1052 O  OD1 . ASN A 1 131 ? -67.578 11.527 -17.549 1.00 67.78 ? 125 ASN A OD1 1 
ATOM   1053 N  ND2 . ASN A 1 131 ? -65.620 11.990 -18.559 1.00 66.74 ? 125 ASN A ND2 1 
ATOM   1054 N  N   . PRO A 1 132 ? -64.305 9.398  -13.704 1.00 56.44 ? 126 PRO A N   1 
ATOM   1055 C  CA  . PRO A 1 132 ? -63.909 8.256  -12.886 1.00 54.92 ? 126 PRO A CA  1 
ATOM   1056 C  C   . PRO A 1 132 ? -65.036 7.238  -12.786 1.00 54.01 ? 126 PRO A C   1 
ATOM   1057 O  O   . PRO A 1 132 ? -66.143 7.599  -12.397 1.00 53.72 ? 126 PRO A O   1 
ATOM   1058 C  CB  . PRO A 1 132 ? -63.637 8.891  -11.515 1.00 54.73 ? 126 PRO A CB  1 
ATOM   1059 C  CG  . PRO A 1 132 ? -64.414 10.159 -11.523 1.00 55.34 ? 126 PRO A CG  1 
ATOM   1060 C  CD  . PRO A 1 132 ? -64.309 10.647 -12.924 1.00 55.30 ? 126 PRO A CD  1 
ATOM   1061 N  N   . PRO A 1 133 ? -64.754 5.969  -13.132 1.00 51.90 ? 127 PRO A N   1 
ATOM   1062 C  CA  . PRO A 1 133 ? -65.770 4.919  -13.130 1.00 52.15 ? 127 PRO A CA  1 
ATOM   1063 C  C   . PRO A 1 133 ? -66.174 4.515  -11.715 1.00 53.34 ? 127 PRO A C   1 
ATOM   1064 O  O   . PRO A 1 133 ? -65.363 4.602  -10.793 1.00 50.87 ? 127 PRO A O   1 
ATOM   1065 C  CB  . PRO A 1 133 ? -65.059 3.760  -13.836 1.00 52.73 ? 127 PRO A CB  1 
ATOM   1066 C  CG  . PRO A 1 133 ? -63.632 3.965  -13.542 1.00 49.35 ? 127 PRO A CG  1 
ATOM   1067 C  CD  . PRO A 1 133 ? -63.435 5.455  -13.542 1.00 50.76 ? 127 PRO A CD  1 
ATOM   1068 N  N   . ALA A 1 134 ? -67.420 4.080  -11.536 1.00 54.24 ? 128 ALA A N   1 
ATOM   1069 C  CA  . ALA A 1 134 ? -67.873 3.645  -10.219 1.00 55.12 ? 128 ALA A CA  1 
ATOM   1070 C  C   . ALA A 1 134 ? -67.007 2.475  -9.738  1.00 55.25 ? 128 ALA A C   1 
ATOM   1071 O  O   . ALA A 1 134 ? -66.676 2.368  -8.554  1.00 56.29 ? 128 ALA A O   1 
ATOM   1072 C  CB  . ALA A 1 134 ? -69.344 3.254  -10.265 1.00 56.95 ? 128 ALA A CB  1 
ATOM   1073 N  N   . LYS A 1 135 ? -66.623 1.605  -10.665 1.00 52.98 ? 129 LYS A N   1 
ATOM   1074 C  CA  . LYS A 1 135 ? -65.718 0.518  -10.323 1.00 51.03 ? 129 LYS A CA  1 
ATOM   1075 C  C   . LYS A 1 135 ? -64.289 1.040  -10.475 1.00 47.09 ? 129 LYS A C   1 
ATOM   1076 O  O   . LYS A 1 135 ? -63.835 1.300  -11.585 1.00 43.99 ? 129 LYS A O   1 
ATOM   1077 C  CB  . LYS A 1 135 ? -65.931 -0.691 -11.234 1.00 51.74 ? 129 LYS A CB  1 
ATOM   1078 C  CG  . LYS A 1 135 ? -65.217 -1.934 -10.729 1.00 57.11 ? 129 LYS A CG  1 
ATOM   1079 C  CD  . LYS A 1 135 ? -64.959 -2.967 -11.828 1.00 63.35 ? 129 LYS A CD  1 
ATOM   1080 C  CE  . LYS A 1 135 ? -64.320 -4.232 -11.238 1.00 65.22 ? 129 LYS A CE  1 
ATOM   1081 N  NZ  . LYS A 1 135 ? -63.176 -3.915 -10.322 1.00 66.96 ? 129 LYS A NZ  1 
ATOM   1082 N  N   . VAL A 1 136 ? -63.578 1.196  -9.362  1.00 45.46 ? 130 VAL A N   1 
ATOM   1083 C  CA  . VAL A 1 136 ? -62.229 1.761  -9.425  1.00 43.38 ? 130 VAL A CA  1 
ATOM   1084 C  C   . VAL A 1 136 ? -61.278 0.882  -10.220 1.00 40.26 ? 130 VAL A C   1 
ATOM   1085 O  O   . VAL A 1 136 ? -61.350 -0.349 -10.161 1.00 41.12 ? 130 VAL A O   1 
ATOM   1086 C  CB  . VAL A 1 136 ? -61.622 1.997  -8.021  1.00 44.76 ? 130 VAL A CB  1 
ATOM   1087 C  CG1 . VAL A 1 136 ? -62.437 3.031  -7.264  1.00 46.53 ? 130 VAL A CG1 1 
ATOM   1088 C  CG2 . VAL A 1 136 ? -61.541 0.682  -7.244  1.00 48.00 ? 130 VAL A CG2 1 
ATOM   1089 N  N   . GLN A 1 137 ? -60.378 1.516  -10.955 1.00 36.59 ? 131 GLN A N   1 
ATOM   1090 C  CA  . GLN A 1 137 ? -59.384 0.777  -11.733 1.00 37.02 ? 131 GLN A CA  1 
ATOM   1091 C  C   . GLN A 1 137 ? -58.005 0.969  -11.103 1.00 33.04 ? 131 GLN A C   1 
ATOM   1092 O  O   . GLN A 1 137 ? -57.213 1.839  -11.511 1.00 33.74 ? 131 GLN A O   1 
ATOM   1093 C  CB  . GLN A 1 137 ? -59.400 1.184  -13.205 1.00 36.77 ? 131 GLN A CB  1 
ATOM   1094 C  CG  . GLN A 1 137 ? -60.703 0.841  -13.919 1.00 39.98 ? 131 GLN A CG  1 
ATOM   1095 C  CD  . GLN A 1 137 ? -60.676 1.213  -15.400 1.00 42.29 ? 131 GLN A CD  1 
ATOM   1096 O  OE1 . GLN A 1 137 ? -59.607 1.440  -15.995 1.00 43.90 ? 131 GLN A OE1 1 
ATOM   1097 N  NE2 . GLN A 1 137 ? -61.863 1.305  -15.998 1.00 43.17 ? 131 GLN A NE2 1 
ATOM   1098 N  N   . VAL A 1 138 ? -57.721 0.122  -10.121 1.00 33.18 ? 132 VAL A N   1 
ATOM   1099 C  CA  . VAL A 1 138 ? -56.520 0.239  -9.309  1.00 34.25 ? 132 VAL A CA  1 
ATOM   1100 C  C   . VAL A 1 138 ? -55.246 0.309  -10.124 1.00 34.41 ? 132 VAL A C   1 
ATOM   1101 O  O   . VAL A 1 138 ? -54.310 1.023  -9.771  1.00 33.01 ? 132 VAL A O   1 
ATOM   1102 C  CB  . VAL A 1 138 ? -56.427 -0.903 -8.271  1.00 36.20 ? 132 VAL A CB  1 
ATOM   1103 C  CG1 . VAL A 1 138 ? -55.120 -0.835 -7.488  1.00 40.80 ? 132 VAL A CG1 1 
ATOM   1104 C  CG2 . VAL A 1 138 ? -57.614 -0.853 -7.310  1.00 40.41 ? 132 VAL A CG2 1 
ATOM   1105 N  N   . ASP A 1 139 ? -55.196 -0.440 -11.230 1.00 34.59 ? 133 ASP A N   1 
ATOM   1106 C  CA  . ASP A 1 139 ? -53.976 -0.482 -12.030 1.00 36.22 ? 133 ASP A CA  1 
ATOM   1107 C  C   . ASP A 1 139 ? -53.637 0.839  -12.700 1.00 33.34 ? 133 ASP A C   1 
ATOM   1108 O  O   . ASP A 1 139 ? -52.514 1.032  -13.175 1.00 34.10 ? 133 ASP A O   1 
ATOM   1109 C  CB  . ASP A 1 139 ? -54.075 -1.596 -13.093 1.00 39.49 ? 133 ASP A CB  1 
ATOM   1110 C  CG  . ASP A 1 139 ? -55.338 -1.478 -13.956 1.00 46.74 ? 133 ASP A CG  1 
ATOM   1111 O  OD1 . ASP A 1 139 ? -56.446 -1.319 -13.386 1.00 47.04 ? 133 ASP A OD1 1 
ATOM   1112 O  OD2 . ASP A 1 139 ? -55.227 -1.550 -15.216 1.00 52.78 ? 133 ASP A OD2 1 
ATOM   1113 N  N   . HIS A 1 140 ? -54.609 1.752  -12.741 1.00 32.08 ? 134 HIS A N   1 
ATOM   1114 C  CA  . HIS A 1 140 ? -54.411 3.048  -13.389 1.00 30.38 ? 134 HIS A CA  1 
ATOM   1115 C  C   . HIS A 1 140 ? -54.200 4.192  -12.386 1.00 29.07 ? 134 HIS A C   1 
ATOM   1116 O  O   . HIS A 1 140 ? -54.163 5.359  -12.769 1.00 30.38 ? 134 HIS A O   1 
ATOM   1117 C  CB  . HIS A 1 140 ? -55.632 3.391  -14.221 1.00 32.28 ? 134 HIS A CB  1 
ATOM   1118 C  CG  . HIS A 1 140 ? -55.657 2.693  -15.543 1.00 35.12 ? 134 HIS A CG  1 
ATOM   1119 N  ND1 . HIS A 1 140 ? -54.872 3.101  -16.592 1.00 39.00 ? 134 HIS A ND1 1 
ATOM   1120 C  CD2 . HIS A 1 140 ? -56.335 1.601  -15.968 1.00 41.63 ? 134 HIS A CD2 1 
ATOM   1121 C  CE1 . HIS A 1 140 ? -55.088 2.304  -17.628 1.00 38.95 ? 134 HIS A CE1 1 
ATOM   1122 N  NE2 . HIS A 1 140 ? -55.962 1.381  -17.269 1.00 39.49 ? 134 HIS A NE2 1 
ATOM   1123 N  N   . ILE A 1 141 ? -54.124 3.839  -11.112 1.00 28.44 ? 135 ILE A N   1 
ATOM   1124 C  CA  . ILE A 1 141 ? -53.899 4.869  -10.073 1.00 27.70 ? 135 ILE A CA  1 
ATOM   1125 C  C   . ILE A 1 141 ? -52.412 5.133  -9.871  1.00 27.67 ? 135 ILE A C   1 
ATOM   1126 O  O   . ILE A 1 141 ? -51.592 4.196  -9.655  1.00 29.99 ? 135 ILE A O   1 
ATOM   1127 C  CB  . ILE A 1 141 ? -54.542 4.463  -8.721  1.00 25.34 ? 135 ILE A CB  1 
ATOM   1128 C  CG1 . ILE A 1 141 ? -56.055 4.256  -8.834  1.00 29.03 ? 135 ILE A CG1 1 
ATOM   1129 C  CG2 . ILE A 1 141 ? -54.207 5.571  -7.633  1.00 26.13 ? 135 ILE A CG2 1 
ATOM   1130 C  CD1 . ILE A 1 141 ? -56.712 3.552  -7.624  1.00 29.57 ? 135 ILE A CD1 1 
ATOM   1131 N  N   . VAL A 1 142 ? -52.034 6.409  -9.942  1.00 25.84 ? 136 VAL A N   1 
ATOM   1132 C  CA  . VAL A 1 142 ? -50.677 6.837  -9.667  1.00 24.49 ? 136 VAL A CA  1 
ATOM   1133 C  C   . VAL A 1 142 ? -50.709 7.583  -8.313  1.00 26.18 ? 136 VAL A C   1 
ATOM   1134 O  O   . VAL A 1 142 ? -51.597 8.402  -8.125  1.00 25.72 ? 136 VAL A O   1 
ATOM   1135 C  CB  . VAL A 1 142 ? -50.145 7.788  -10.738 1.00 27.73 ? 136 VAL A CB  1 
ATOM   1136 C  CG1 . VAL A 1 142 ? -48.781 8.380  -10.333 1.00 30.83 ? 136 VAL A CG1 1 
ATOM   1137 C  CG2 . VAL A 1 142 ? -50.006 7.023  -12.107 1.00 31.11 ? 136 VAL A CG2 1 
ATOM   1138 N  N   . ARG A 1 143 ? -49.792 7.253  -7.416  1.00 24.42 ? 137 ARG A N   1 
ATOM   1139 C  CA  . ARG A 1 143 ? -49.714 7.975  -6.129  1.00 25.55 ? 137 ARG A CA  1 
ATOM   1140 C  C   . ARG A 1 143 ? -48.537 8.928  -6.131  1.00 27.09 ? 137 ARG A C   1 
ATOM   1141 O  O   . ARG A 1 143 ? -47.469 8.670  -6.741  1.00 26.77 ? 137 ARG A O   1 
ATOM   1142 C  CB  . ARG A 1 143 ? -49.634 7.001  -4.932  1.00 28.07 ? 137 ARG A CB  1 
ATOM   1143 C  CG  . ARG A 1 143 ? -48.291 6.411  -4.740  1.00 28.11 ? 137 ARG A CG  1 
ATOM   1144 C  CD  . ARG A 1 143 ? -48.160 5.661  -3.392  1.00 28.90 ? 137 ARG A CD  1 
ATOM   1145 N  NE  . ARG A 1 143 ? -46.809 5.110  -3.319  1.00 27.11 ? 137 ARG A NE  1 
ATOM   1146 C  CZ  . ARG A 1 143 ? -46.563 3.798  -3.385  1.00 28.56 ? 137 ARG A CZ  1 
ATOM   1147 N  NH1 . ARG A 1 143 ? -47.586 2.948  -3.444  1.00 26.77 ? 137 ARG A NH1 1 
ATOM   1148 N  NH2 . ARG A 1 143 ? -45.315 3.372  -3.331  1.00 26.28 ? 137 ARG A NH2 1 
ATOM   1149 N  N   . ASN A 1 144 ? -48.675 10.041 -5.402  1.00 23.43 ? 138 ASN A N   1 
ATOM   1150 C  CA  . ASN A 1 144 ? -47.606 11.014 -5.378  1.00 24.36 ? 138 ASN A CA  1 
ATOM   1151 C  C   . ASN A 1 144 ? -47.496 11.506 -3.940  1.00 24.39 ? 138 ASN A C   1 
ATOM   1152 O  O   . ASN A 1 144 ? -48.408 12.175 -3.452  1.00 25.38 ? 138 ASN A O   1 
ATOM   1153 C  CB  . ASN A 1 144 ? -47.922 12.202 -6.310  1.00 26.84 ? 138 ASN A CB  1 
ATOM   1154 C  CG  . ASN A 1 144 ? -46.761 13.186 -6.412  1.00 32.56 ? 138 ASN A CG  1 
ATOM   1155 O  OD1 . ASN A 1 144 ? -46.596 13.835 -7.439  1.00 46.92 ? 138 ASN A OD1 1 
ATOM   1156 N  ND2 . ASN A 1 144 ? -45.971 13.312 -5.375  1.00 36.73 ? 138 ASN A ND2 1 
ATOM   1157 N  N   . ILE A 1 145 ? -46.445 11.093 -3.253  1.00 21.65 ? 139 ILE A N   1 
ATOM   1158 C  CA  . ILE A 1 145 ? -46.213 11.538 -1.884  1.00 20.85 ? 139 ILE A CA  1 
ATOM   1159 C  C   . ILE A 1 145 ? -45.628 12.947 -1.913  1.00 26.45 ? 139 ILE A C   1 
ATOM   1160 O  O   . ILE A 1 145 ? -44.651 13.213 -2.638  1.00 25.95 ? 139 ILE A O   1 
ATOM   1161 C  CB  . ILE A 1 145 ? -45.263 10.566 -1.166  1.00 22.25 ? 139 ILE A CB  1 
ATOM   1162 C  CG1 . ILE A 1 145 ? -45.897 9.172  -1.176  1.00 23.87 ? 139 ILE A CG1 1 
ATOM   1163 C  CG2 . ILE A 1 145 ? -45.026 11.034 0.282   1.00 23.85 ? 139 ILE A CG2 1 
ATOM   1164 C  CD1 . ILE A 1 145 ? -44.944 8.074  -0.596  1.00 24.74 ? 139 ILE A CD1 1 
ATOM   1165 N  N   . LEU A 1 146 ? -46.181 13.846 -1.090  1.00 24.18 ? 140 LEU A N   1 
ATOM   1166 C  CA  . LEU A 1 146 ? -45.570 15.193 -0.967  1.00 25.56 ? 140 LEU A CA  1 
ATOM   1167 C  C   . LEU A 1 146 ? -44.312 15.131 -0.068  1.00 25.17 ? 140 LEU A C   1 
ATOM   1168 O  O   . LEU A 1 146 ? -44.289 15.550 1.088   1.00 24.23 ? 140 LEU A O   1 
ATOM   1169 C  CB  . LEU A 1 146 ? -46.638 16.190 -0.482  1.00 24.01 ? 140 LEU A CB  1 
ATOM   1170 C  CG  . LEU A 1 146 ? -46.179 17.628 -0.239  1.00 26.29 ? 140 LEU A CG  1 
ATOM   1171 C  CD1 . LEU A 1 146 ? -45.570 18.173 -1.540  1.00 27.92 ? 140 LEU A CD1 1 
ATOM   1172 C  CD2 . LEU A 1 146 ? -47.380 18.467 0.183   1.00 25.73 ? 140 LEU A CD2 1 
ATOM   1173 N  N   . ALA A 1 147 ? -43.239 14.556 -0.618  1.00 26.08 ? 141 ALA A N   1 
ATOM   1174 C  CA  . ALA A 1 147 ? -42.040 14.257 0.132   1.00 27.38 ? 141 ALA A CA  1 
ATOM   1175 C  C   . ALA A 1 147 ? -41.320 15.502 0.602   1.00 27.32 ? 141 ALA A C   1 
ATOM   1176 O  O   . ALA A 1 147 ? -40.575 15.450 1.572   1.00 29.37 ? 141 ALA A O   1 
ATOM   1177 C  CB  . ALA A 1 147 ? -41.083 13.398 -0.759  1.00 28.92 ? 141 ALA A CB  1 
ATOM   1178 N  N   A GLU A 1 148 ? -41.510 16.627 -0.073  0.50 28.50 ? 142 GLU A N   1 
ATOM   1179 N  N   B GLU A 1 148 ? -41.563 16.608 -0.109  0.50 27.88 ? 142 GLU A N   1 
ATOM   1180 C  CA  A GLU A 1 148 ? -40.775 17.827 0.342   0.50 29.29 ? 142 GLU A CA  1 
ATOM   1181 C  CA  B GLU A 1 148 ? -40.971 17.926 0.190   0.50 29.31 ? 142 GLU A CA  1 
ATOM   1182 C  C   A GLU A 1 148 ? -41.457 18.581 1.508   0.50 29.18 ? 142 GLU A C   1 
ATOM   1183 C  C   B GLU A 1 148 ? -41.360 18.425 1.585   0.50 28.88 ? 142 GLU A C   1 
ATOM   1184 O  O   A GLU A 1 148 ? -40.983 19.628 1.954   0.50 27.01 ? 142 GLU A O   1 
ATOM   1185 O  O   B GLU A 1 148 ? -40.580 19.121 2.249   0.50 27.47 ? 142 GLU A O   1 
ATOM   1186 C  CB  A GLU A 1 148 ? -40.487 18.756 -0.851  0.50 32.84 ? 142 GLU A CB  1 
ATOM   1187 C  CB  B GLU A 1 148 ? -41.462 18.995 -0.822  0.50 29.61 ? 142 GLU A CB  1 
ATOM   1188 C  CG  A GLU A 1 148 ? -40.344 18.094 -2.232  0.50 38.75 ? 142 GLU A CG  1 
ATOM   1189 C  CG  B GLU A 1 148 ? -41.554 18.575 -2.300  0.50 36.47 ? 142 GLU A CG  1 
ATOM   1190 C  CD  A GLU A 1 148 ? -39.541 16.795 -2.261  0.50 44.28 ? 142 GLU A CD  1 
ATOM   1191 C  CD  B GLU A 1 148 ? -42.464 19.499 -3.140  0.50 34.39 ? 142 GLU A CD  1 
ATOM   1192 O  OE1 A GLU A 1 148 ? -38.543 16.671 -1.511  0.50 46.37 ? 142 GLU A OE1 1 
ATOM   1193 O  OE1 B GLU A 1 148 ? -42.562 20.716 -2.838  0.50 39.86 ? 142 GLU A OE1 1 
ATOM   1194 O  OE2 A GLU A 1 148 ? -39.910 15.899 -3.069  0.50 45.13 ? 142 GLU A OE2 1 
ATOM   1195 O  OE2 B GLU A 1 148 ? -43.106 18.997 -4.090  0.50 34.27 ? 142 GLU A OE2 1 
ATOM   1196 N  N   . LYS A 1 149 ? -42.564 18.044 2.022   1.00 25.59 ? 143 LYS A N   1 
ATOM   1197 C  CA  . LYS A 1 149 ? -43.236 18.692 3.154   1.00 27.27 ? 143 LYS A CA  1 
ATOM   1198 C  C   . LYS A 1 149 ? -43.661 17.698 4.240   1.00 25.53 ? 143 LYS A C   1 
ATOM   1199 O  O   . LYS A 1 149 ? -44.837 17.592 4.558   1.00 27.03 ? 143 LYS A O   1 
ATOM   1200 C  CB  . LYS A 1 149 ? -44.418 19.563 2.675   1.00 30.93 ? 143 LYS A CB  1 
ATOM   1201 C  CG  . LYS A 1 149 ? -43.906 20.849 1.897   1.00 32.93 ? 143 LYS A CG  1 
ATOM   1202 C  CD  . LYS A 1 149 ? -44.996 21.876 1.545   1.00 37.85 ? 143 LYS A CD  1 
ATOM   1203 C  CE  . LYS A 1 149 ? -44.412 22.998 0.615   1.00 37.47 ? 143 LYS A CE  1 
ATOM   1204 N  NZ  . LYS A 1 149 ? -45.422 24.101 0.213   1.00 38.90 ? 143 LYS A NZ  1 
ATOM   1205 N  N   . PRO A 1 150 ? -42.674 17.006 4.844   1.00 26.74 ? 144 PRO A N   1 
ATOM   1206 C  CA  . PRO A 1 150 ? -43.037 16.061 5.921   1.00 26.11 ? 144 PRO A CA  1 
ATOM   1207 C  C   . PRO A 1 150 ? -43.532 16.923 7.073   1.00 27.12 ? 144 PRO A C   1 
ATOM   1208 O  O   . PRO A 1 150 ? -42.977 18.009 7.327   1.00 27.12 ? 144 PRO A O   1 
ATOM   1209 C  CB  . PRO A 1 150 ? -41.691 15.437 6.295   1.00 27.83 ? 144 PRO A CB  1 
ATOM   1210 C  CG  . PRO A 1 150 ? -40.660 16.498 5.915   1.00 27.58 ? 144 PRO A CG  1 
ATOM   1211 C  CD  . PRO A 1 150 ? -41.222 17.042 4.615   1.00 27.56 ? 144 PRO A CD  1 
ATOM   1212 N  N   . ARG A 1 151 ? -44.566 16.450 7.772   1.00 24.26 ? 145 ARG A N   1 
ATOM   1213 C  CA  . ARG A 1 151 ? -45.038 17.188 8.932   1.00 24.42 ? 145 ARG A CA  1 
ATOM   1214 C  C   . ARG A 1 151 ? -44.626 16.368 10.144  1.00 26.90 ? 145 ARG A C   1 
ATOM   1215 O  O   . ARG A 1 151 ? -45.213 15.282 10.360  1.00 26.20 ? 145 ARG A O   1 
ATOM   1216 C  CB  . ARG A 1 151 ? -46.542 17.313 8.859   1.00 27.32 ? 145 ARG A CB  1 
ATOM   1217 C  CG  . ARG A 1 151 ? -47.048 17.755 7.478   1.00 37.14 ? 145 ARG A CG  1 
ATOM   1218 C  CD  . ARG A 1 151 ? -46.353 19.037 7.019   1.00 38.70 ? 145 ARG A CD  1 
ATOM   1219 N  NE  . ARG A 1 151 ? -47.111 20.255 7.321   1.00 44.56 ? 145 ARG A NE  1 
ATOM   1220 C  CZ  . ARG A 1 151 ? -46.721 21.472 6.940   1.00 48.53 ? 145 ARG A CZ  1 
ATOM   1221 N  NH1 . ARG A 1 151 ? -45.573 21.623 6.286   1.00 48.73 ? 145 ARG A NH1 1 
ATOM   1222 N  NH2 . ARG A 1 151 ? -47.463 22.544 7.217   1.00 52.49 ? 145 ARG A NH2 1 
ATOM   1223 N  N   . VAL A 1 152 ? -43.656 16.877 10.902  1.00 22.57 ? 146 VAL A N   1 
ATOM   1224 C  CA  . VAL A 1 152 ? -42.968 16.120 11.969  1.00 21.97 ? 146 VAL A CA  1 
ATOM   1225 C  C   . VAL A 1 152 ? -43.438 16.596 13.332  1.00 27.95 ? 146 VAL A C   1 
ATOM   1226 O  O   . VAL A 1 152 ? -43.367 17.803 13.638  1.00 28.75 ? 146 VAL A O   1 
ATOM   1227 C  CB  . VAL A 1 152 ? -41.461 16.272 11.868  1.00 25.46 ? 146 VAL A CB  1 
ATOM   1228 C  CG1 . VAL A 1 152 ? -40.767 15.462 12.977  1.00 28.98 ? 146 VAL A CG1 1 
ATOM   1229 C  CG2 . VAL A 1 152 ? -40.980 15.828 10.465  1.00 26.65 ? 146 VAL A CG2 1 
ATOM   1230 N  N   . THR A 1 153 ? -43.980 15.691 14.127  1.00 22.72 ? 147 THR A N   1 
ATOM   1231 C  CA  . THR A 1 153 ? -44.492 16.091 15.452  1.00 22.83 ? 147 THR A CA  1 
ATOM   1232 C  C   . THR A 1 153 ? -43.718 15.320 16.502  1.00 25.04 ? 147 THR A C   1 
ATOM   1233 O  O   . THR A 1 153 ? -43.626 14.075 16.440  1.00 24.27 ? 147 THR A O   1 
ATOM   1234 C  CB  . THR A 1 153 ? -45.999 15.778 15.585  1.00 24.31 ? 147 THR A CB  1 
ATOM   1235 O  OG1 . THR A 1 153 ? -46.752 16.465 14.568  1.00 25.52 ? 147 THR A OG1 1 
ATOM   1236 C  CG2 . THR A 1 153 ? -46.546 16.193 16.958  1.00 26.38 ? 147 THR A CG2 1 
ATOM   1237 N  N   . ARG A 1 154 ? -43.166 16.036 17.474  1.00 22.98 ? 148 ARG A N   1 
ATOM   1238 C  CA  . ARG A 1 154 ? -42.415 15.384 18.546  1.00 24.01 ? 148 ARG A CA  1 
ATOM   1239 C  C   . ARG A 1 154 ? -43.155 15.484 19.877  1.00 26.41 ? 148 ARG A C   1 
ATOM   1240 O  O   . ARG A 1 154 ? -43.796 16.526 20.179  1.00 26.13 ? 148 ARG A O   1 
ATOM   1241 C  CB  . ARG A 1 154 ? -41.038 16.014 18.678  1.00 27.65 ? 148 ARG A CB  1 
ATOM   1242 C  CG  . ARG A 1 154 ? -40.144 15.743 17.489  1.00 36.71 ? 148 ARG A CG  1 
ATOM   1243 C  CD  . ARG A 1 154 ? -38.797 16.446 17.640  1.00 44.07 ? 148 ARG A CD  1 
ATOM   1244 N  NE  . ARG A 1 154 ? -37.906 15.799 18.615  1.00 48.43 ? 148 ARG A NE  1 
ATOM   1245 C  CZ  . ARG A 1 154 ? -36.578 15.797 18.491  1.00 51.69 ? 148 ARG A CZ  1 
ATOM   1246 N  NH1 . ARG A 1 154 ? -36.028 16.394 17.435  1.00 54.89 ? 148 ARG A NH1 1 
ATOM   1247 N  NH2 . ARG A 1 154 ? -35.801 15.195 19.393  1.00 45.27 ? 148 ARG A NH2 1 
ATOM   1248 N  N   . PHE A 1 155 ? -43.092 14.401 20.651  1.00 23.15 ? 149 PHE A N   1 
ATOM   1249 C  CA  . PHE A 1 155 ? -43.695 14.334 21.993  1.00 26.64 ? 149 PHE A CA  1 
ATOM   1250 C  C   . PHE A 1 155 ? -42.589 14.117 22.987  1.00 30.62 ? 149 PHE A C   1 
ATOM   1251 O  O   . PHE A 1 155 ? -41.719 13.265 22.786  1.00 29.30 ? 149 PHE A O   1 
ATOM   1252 C  CB  . PHE A 1 155 ? -44.692 13.164 22.091  1.00 28.39 ? 149 PHE A CB  1 
ATOM   1253 C  CG  . PHE A 1 155 ? -45.740 13.207 21.032  1.00 26.49 ? 149 PHE A CG  1 
ATOM   1254 C  CD1 . PHE A 1 155 ? -46.845 14.053 21.160  1.00 31.47 ? 149 PHE A CD1 1 
ATOM   1255 C  CD2 . PHE A 1 155 ? -45.608 12.444 19.870  1.00 29.53 ? 149 PHE A CD2 1 
ATOM   1256 C  CE1 . PHE A 1 155 ? -47.793 14.119 20.149  1.00 30.16 ? 149 PHE A CE1 1 
ATOM   1257 C  CE2 . PHE A 1 155 ? -46.555 12.488 18.887  1.00 28.95 ? 149 PHE A CE2 1 
ATOM   1258 C  CZ  . PHE A 1 155 ? -47.642 13.339 19.010  1.00 30.59 ? 149 PHE A CZ  1 
ATOM   1259 N  N   . ASN A 1 156 ? -42.623 14.890 24.072  1.00 28.20 ? 150 ASN A N   1 
ATOM   1260 C  CA  . ASN A 1 156 ? -41.579 14.806 25.069  1.00 30.17 ? 150 ASN A CA  1 
ATOM   1261 C  C   . ASN A 1 156 ? -41.907 13.657 26.018  1.00 31.56 ? 150 ASN A C   1 
ATOM   1262 O  O   . ASN A 1 156 ? -42.801 13.771 26.844  1.00 33.53 ? 150 ASN A O   1 
ATOM   1263 C  CB  . ASN A 1 156 ? -41.538 16.137 25.846  1.00 32.28 ? 150 ASN A CB  1 
ATOM   1264 C  CG  . ASN A 1 156 ? -40.514 16.122 26.977  1.00 37.73 ? 150 ASN A CG  1 
ATOM   1265 O  OD1 . ASN A 1 156 ? -40.059 15.056 27.426  1.00 39.49 ? 150 ASN A OD1 1 
ATOM   1266 N  ND2 . ASN A 1 156 ? -40.144 17.313 27.443  1.00 42.22 ? 150 ASN A ND2 1 
ATOM   1267 N  N   . ILE A 1 157 ? -41.235 12.525 25.867  1.00 30.44 ? 151 ILE A N   1 
ATOM   1268 C  CA  . ILE A 1 157 ? -41.602 11.370 26.701  1.00 28.98 ? 151 ILE A CA  1 
ATOM   1269 C  C   . ILE A 1 157 ? -40.588 11.127 27.803  1.00 30.13 ? 151 ILE A C   1 
ATOM   1270 O  O   . ILE A 1 157 ? -39.471 11.657 27.785  1.00 29.39 ? 151 ILE A O   1 
ATOM   1271 C  CB  . ILE A 1 157 ? -41.723 10.055 25.861  1.00 28.43 ? 151 ILE A CB  1 
ATOM   1272 C  CG1 . ILE A 1 157 ? -40.366 9.634  25.295  1.00 29.85 ? 151 ILE A CG1 1 
ATOM   1273 C  CG2 . ILE A 1 157 ? -42.782 10.211 24.771  1.00 28.55 ? 151 ILE A CG2 1 
ATOM   1274 C  CD1 . ILE A 1 157 ? -40.327 8.169  24.751  1.00 29.45 ? 151 ILE A CD1 1 
ATOM   1275 N  N   . VAL A 1 158 ? -40.972 10.293 28.763  1.00 29.65 ? 152 VAL A N   1 
ATOM   1276 C  CA  . VAL A 1 158 ? -39.996 9.768  29.715  1.00 30.32 ? 152 VAL A CA  1 
ATOM   1277 C  C   . VAL A 1 158 ? -39.217 8.628  29.049  1.00 32.06 ? 152 VAL A C   1 
ATOM   1278 O  O   . VAL A 1 158 ? -39.836 7.755  28.452  1.00 34.95 ? 152 VAL A O   1 
ATOM   1279 C  CB  . VAL A 1 158 ? -40.699 9.222  30.959  1.00 33.17 ? 152 VAL A CB  1 
ATOM   1280 C  CG1 . VAL A 1 158 ? -39.702 8.440  31.808  1.00 34.37 ? 152 VAL A CG1 1 
ATOM   1281 C  CG2 . VAL A 1 158 ? -41.352 10.375 31.732  1.00 31.38 ? 152 VAL A CG2 1 
ATOM   1282 N  N   . TRP A 1 159 ? -37.886 8.665  29.119  1.00 31.62 ? 153 TRP A N   1 
ATOM   1283 C  CA  . TRP A 1 159 ? -36.989 7.702  28.439  1.00 33.44 ? 153 TRP A CA  1 
ATOM   1284 C  C   . TRP A 1 159 ? -36.434 6.593  29.309  1.00 41.07 ? 153 TRP A C   1 
ATOM   1285 O  O   . TRP A 1 159 ? -36.118 5.498  28.827  1.00 43.86 ? 153 TRP A O   1 
ATOM   1286 C  CB  . TRP A 1 159 ? -35.814 8.426  27.768  1.00 34.90 ? 153 TRP A CB  1 
ATOM   1287 C  CG  . TRP A 1 159 ? -36.259 9.219  26.596  1.00 34.79 ? 153 TRP A CG  1 
ATOM   1288 C  CD1 . TRP A 1 159 ? -36.637 10.536 26.591  1.00 32.00 ? 153 TRP A CD1 1 
ATOM   1289 C  CD2 . TRP A 1 159 ? -36.418 8.749  25.254  1.00 32.36 ? 153 TRP A CD2 1 
ATOM   1290 N  NE1 . TRP A 1 159 ? -37.025 10.914 25.324  1.00 32.56 ? 153 TRP A NE1 1 
ATOM   1291 C  CE2 . TRP A 1 159 ? -36.909 9.832  24.489  1.00 31.13 ? 153 TRP A CE2 1 
ATOM   1292 C  CE3 . TRP A 1 159 ? -36.203 7.518  24.622  1.00 34.45 ? 153 TRP A CE3 1 
ATOM   1293 C  CZ2 . TRP A 1 159 ? -37.155 9.734  23.131  1.00 34.51 ? 153 TRP A CZ2 1 
ATOM   1294 C  CZ3 . TRP A 1 159 ? -36.472 7.423  23.256  1.00 31.37 ? 153 TRP A CZ3 1 
ATOM   1295 C  CH2 . TRP A 1 159 ? -36.938 8.522  22.533  1.00 32.50 ? 153 TRP A CH2 1 
ATOM   1296 N  N   . ASP A 1 160 ? -36.252 6.879  30.582  1.00 41.51 ? 154 ASP A N   1 
ATOM   1297 C  CA  . ASP A 1 160 ? -35.723 5.870  31.478  1.00 45.19 ? 154 ASP A CA  1 
ATOM   1298 C  C   . ASP A 1 160 ? -36.574 5.877  32.733  1.00 45.56 ? 154 ASP A C   1 
ATOM   1299 O  O   . ASP A 1 160 ? -36.423 6.755  33.568  1.00 42.43 ? 154 ASP A O   1 
ATOM   1300 C  CB  . ASP A 1 160 ? -34.267 6.206  31.795  1.00 47.13 ? 154 ASP A CB  1 
ATOM   1301 C  CG  . ASP A 1 160 ? -33.623 5.216  32.753  1.00 51.19 ? 154 ASP A CG  1 
ATOM   1302 O  OD1 . ASP A 1 160 ? -32.391 5.303  32.931  1.00 54.16 ? 154 ASP A OD1 1 
ATOM   1303 O  OD2 . ASP A 1 160 ? -34.333 4.363  33.323  1.00 53.35 ? 154 ASP A OD2 1 
ATOM   1304 N  N   . ASN A 1 161 ? -37.490 4.920  32.834  1.00 47.77 ? 155 ASN A N   1 
ATOM   1305 C  CA  . ASN A 1 161 ? -38.338 4.763  34.023  1.00 55.45 ? 155 ASN A CA  1 
ATOM   1306 C  C   . ASN A 1 161 ? -37.583 4.697  35.357  1.00 56.56 ? 155 ASN A C   1 
ATOM   1307 O  O   . ASN A 1 161 ? -38.151 4.987  36.408  1.00 59.03 ? 155 ASN A O   1 
ATOM   1308 C  CB  . ASN A 1 161 ? -39.267 3.543  33.883  1.00 57.93 ? 155 ASN A CB  1 
ATOM   1309 C  CG  . ASN A 1 161 ? -40.358 3.751  32.835  1.00 61.80 ? 155 ASN A CG  1 
ATOM   1310 O  OD1 . ASN A 1 161 ? -40.830 4.875  32.618  1.00 61.63 ? 155 ASN A OD1 1 
ATOM   1311 N  ND2 . ASN A 1 161 ? -40.768 2.660  32.182  1.00 63.25 ? 155 ASN A ND2 1 
ATOM   1312 N  N   . GLU A 1 162 ? -36.307 4.324  35.327  1.00 58.14 ? 156 GLU A N   1 
ATOM   1313 C  CA  . GLU A 1 162 ? -35.512 4.299  36.556  1.00 58.60 ? 156 GLU A CA  1 
ATOM   1314 C  C   . GLU A 1 162 ? -34.987 5.698  36.893  1.00 58.73 ? 156 GLU A C   1 
ATOM   1315 O  O   . GLU A 1 162 ? -34.831 6.062  38.061  1.00 60.52 ? 156 GLU A O   1 
ATOM   1316 C  CB  . GLU A 1 162 ? -34.347 3.316  36.416  1.00 60.41 ? 156 GLU A CB  1 
ATOM   1317 N  N   . ASN A 1 163 ? -34.707 6.475  35.857  1.00 55.27 ? 157 ASN A N   1 
ATOM   1318 C  CA  . ASN A 1 163 ? -34.153 7.806  36.021  1.00 52.61 ? 157 ASN A CA  1 
ATOM   1319 C  C   . ASN A 1 163 ? -35.192 8.897  36.229  1.00 48.35 ? 157 ASN A C   1 
ATOM   1320 O  O   . ASN A 1 163 ? -34.870 9.943  36.776  1.00 44.63 ? 157 ASN A O   1 
ATOM   1321 C  CB  . ASN A 1 163 ? -33.330 8.194  34.791  1.00 55.91 ? 157 ASN A CB  1 
ATOM   1322 C  CG  . ASN A 1 163 ? -32.025 7.439  34.708  1.00 61.17 ? 157 ASN A CG  1 
ATOM   1323 O  OD1 . ASN A 1 163 ? -31.599 6.800  35.682  1.00 64.28 ? 157 ASN A OD1 1 
ATOM   1324 N  ND2 . ASN A 1 163 ? -31.381 7.495  33.541  1.00 61.60 ? 157 ASN A ND2 1 
ATOM   1325 N  N   . GLU A 1 164 ? -36.418 8.668  35.765  1.00 42.40 ? 158 GLU A N   1 
ATOM   1326 C  CA  . GLU A 1 164 ? -37.426 9.736  35.759  1.00 40.50 ? 158 GLU A CA  1 
ATOM   1327 C  C   . GLU A 1 164 ? -38.825 9.186  35.952  1.00 39.83 ? 158 GLU A C   1 
ATOM   1328 O  O   . GLU A 1 164 ? -39.135 8.086  35.475  1.00 38.92 ? 158 GLU A O   1 
ATOM   1329 C  CB  . GLU A 1 164 ? -37.346 10.499 34.435  1.00 40.84 ? 158 GLU A CB  1 
ATOM   1330 C  CG  . GLU A 1 164 ? -38.397 11.588 34.274  1.00 41.00 ? 158 GLU A CG  1 
ATOM   1331 C  CD  . GLU A 1 164 ? -38.290 12.295 32.932  1.00 43.02 ? 158 GLU A CD  1 
ATOM   1332 O  OE1 . GLU A 1 164 ? -37.548 11.787 32.051  1.00 43.80 ? 158 GLU A OE1 1 
ATOM   1333 O  OE2 . GLU A 1 164 ? -38.953 13.348 32.765  1.00 40.65 ? 158 GLU A OE2 1 
ATOM   1334 N  N   . GLY A 1 165 ? -39.676 9.941  36.646  1.00 35.55 ? 159 GLY A N   1 
ATOM   1335 C  CA  . GLY A 1 165 ? -41.018 9.473  36.947  1.00 36.06 ? 159 GLY A CA  1 
ATOM   1336 C  C   . GLY A 1 165 ? -42.065 10.479 36.514  1.00 34.89 ? 159 GLY A C   1 
ATOM   1337 O  O   . GLY A 1 165 ? -41.965 11.665 36.812  1.00 30.51 ? 159 GLY A O   1 
ATOM   1338 N  N   . ASP A 1 166 ? -43.054 10.012 35.771  1.00 30.26 ? 160 ASP A N   1 
ATOM   1339 C  CA  . ASP A 1 166 ? -44.181 10.845 35.435  1.00 29.23 ? 160 ASP A CA  1 
ATOM   1340 C  C   . ASP A 1 166 ? -45.168 10.755 36.600  1.00 28.03 ? 160 ASP A C   1 
ATOM   1341 O  O   . ASP A 1 166 ? -45.559 9.646  37.009  1.00 29.10 ? 160 ASP A O   1 
ATOM   1342 C  CB  . ASP A 1 166 ? -44.801 10.275 34.174  1.00 32.67 ? 160 ASP A CB  1 
ATOM   1343 C  CG  . ASP A 1 166 ? -45.840 11.171 33.577  1.00 37.61 ? 160 ASP A CG  1 
ATOM   1344 O  OD1 . ASP A 1 166 ? -46.385 12.084 34.253  1.00 35.89 ? 160 ASP A OD1 1 
ATOM   1345 O  OD2 . ASP A 1 166 ? -46.132 10.933 32.378  1.00 39.78 ? 160 ASP A OD2 1 
ATOM   1346 N  N   . LEU A 1 167 ? -45.573 11.889 37.165  1.00 23.27 ? 161 LEU A N   1 
ATOM   1347 C  CA  . LEU A 1 167 ? -46.488 11.831 38.296  1.00 24.07 ? 161 LEU A CA  1 
ATOM   1348 C  C   . LEU A 1 167 ? -47.936 11.599 37.886  1.00 25.59 ? 161 LEU A C   1 
ATOM   1349 O  O   . LEU A 1 167 ? -48.786 11.392 38.770  1.00 28.27 ? 161 LEU A O   1 
ATOM   1350 C  CB  . LEU A 1 167 ? -46.421 13.092 39.138  1.00 25.48 ? 161 LEU A CB  1 
ATOM   1351 C  CG  . LEU A 1 167 ? -45.027 13.298 39.727  1.00 22.34 ? 161 LEU A CG  1 
ATOM   1352 C  CD1 . LEU A 1 167 ? -45.052 14.516 40.621  1.00 22.60 ? 161 LEU A CD1 1 
ATOM   1353 C  CD2 . LEU A 1 167 ? -44.490 12.107 40.539  1.00 26.06 ? 161 LEU A CD2 1 
ATOM   1354 N  N   . TYR A 1 168 ? -48.203 11.640 36.569  1.00 28.36 ? 162 TYR A N   1 
ATOM   1355 C  CA  . TYR A 1 168 ? -49.554 11.397 36.036  1.00 32.47 ? 162 TYR A CA  1 
ATOM   1356 C  C   . TYR A 1 168 ? -49.384 10.365 34.912  1.00 35.62 ? 162 TYR A C   1 
ATOM   1357 O  O   . TYR A 1 168 ? -49.453 10.720 33.754  1.00 40.34 ? 162 TYR A O   1 
ATOM   1358 C  CB  . TYR A 1 168 ? -50.187 12.689 35.504  1.00 29.96 ? 162 TYR A CB  1 
ATOM   1359 C  CG  . TYR A 1 168 ? -50.425 13.753 36.586  1.00 26.25 ? 162 TYR A CG  1 
ATOM   1360 C  CD1 . TYR A 1 168 ? -49.428 14.670 36.916  1.00 25.43 ? 162 TYR A CD1 1 
ATOM   1361 C  CD2 . TYR A 1 168 ? -51.613 13.789 37.315  1.00 27.28 ? 162 TYR A CD2 1 
ATOM   1362 C  CE1 . TYR A 1 168 ? -49.623 15.638 37.911  1.00 25.68 ? 162 TYR A CE1 1 
ATOM   1363 C  CE2 . TYR A 1 168 ? -51.832 14.760 38.310  1.00 25.78 ? 162 TYR A CE2 1 
ATOM   1364 C  CZ  . TYR A 1 168 ? -50.816 15.670 38.620  1.00 24.14 ? 162 TYR A CZ  1 
ATOM   1365 O  OH  . TYR A 1 168 ? -51.036 16.608 39.595  1.00 25.50 ? 162 TYR A OH  1 
ATOM   1366 N  N   . PRO A 1 169 ? -49.101 9.112  35.264  1.00 43.83 ? 163 PRO A N   1 
ATOM   1367 C  CA  . PRO A 1 169 ? -48.968 8.117  34.193  1.00 48.71 ? 163 PRO A CA  1 
ATOM   1368 C  C   . PRO A 1 169 ? -50.354 7.744  33.647  1.00 53.30 ? 163 PRO A C   1 
ATOM   1369 O  O   . PRO A 1 169 ? -51.362 7.978  34.318  1.00 53.52 ? 163 PRO A O   1 
ATOM   1370 C  CB  . PRO A 1 169 ? -48.301 6.935  34.898  1.00 50.01 ? 163 PRO A CB  1 
ATOM   1371 C  CG  . PRO A 1 169 ? -48.750 7.051  36.340  1.00 49.89 ? 163 PRO A CG  1 
ATOM   1372 C  CD  . PRO A 1 169 ? -48.890 8.538  36.605  1.00 45.11 ? 163 PRO A CD  1 
ATOM   1373 N  N   . PRO A 1 170 ? -50.409 7.187  32.423  1.00 57.47 ? 164 PRO A N   1 
ATOM   1374 C  CA  . PRO A 1 170 ? -51.688 6.778  31.832  1.00 59.85 ? 164 PRO A CA  1 
ATOM   1375 C  C   . PRO A 1 170 ? -52.150 5.412  32.334  1.00 61.16 ? 164 PRO A C   1 
ATOM   1376 O  O   . PRO A 1 170 ? -52.633 5.306  33.467  1.00 62.72 ? 164 PRO A O   1 
ATOM   1377 C  CB  . PRO A 1 170 ? -51.368 6.711  30.343  1.00 60.25 ? 164 PRO A CB  1 
ATOM   1378 C  CG  . PRO A 1 170 ? -49.918 6.321  30.299  1.00 59.47 ? 164 PRO A CG  1 
ATOM   1379 C  CD  . PRO A 1 170 ? -49.269 6.932  31.520  1.00 58.66 ? 164 PRO A CD  1 
ATOM   1380 N  N   . ALA B 2 2   ? -57.286 37.812 19.909  1.00 58.99 ? 60  ALA B N   1 
ATOM   1381 C  CA  . ALA B 2 2   ? -57.237 38.789 18.785  1.00 59.18 ? 60  ALA B CA  1 
ATOM   1382 C  C   . ALA B 2 2   ? -58.168 38.399 17.623  1.00 58.24 ? 60  ALA B C   1 
ATOM   1383 O  O   . ALA B 2 2   ? -59.064 39.167 17.263  1.00 60.96 ? 60  ALA B O   1 
ATOM   1384 C  CB  . ALA B 2 2   ? -55.803 38.970 18.299  1.00 59.83 ? 60  ALA B CB  1 
ATOM   1385 N  N   . LEU B 2 3   ? -57.960 37.219 17.033  1.00 53.79 ? 61  LEU B N   1 
ATOM   1386 C  CA  . LEU B 2 3   ? -58.842 36.742 15.959  1.00 49.64 ? 61  LEU B CA  1 
ATOM   1387 C  C   . LEU B 2 3   ? -60.120 36.140 16.526  1.00 46.03 ? 61  LEU B C   1 
ATOM   1388 O  O   . LEU B 2 3   ? -61.125 36.059 15.824  1.00 47.14 ? 61  LEU B O   1 
ATOM   1389 C  CB  . LEU B 2 3   ? -58.162 35.683 15.076  1.00 50.76 ? 61  LEU B CB  1 
ATOM   1390 C  CG  . LEU B 2 3   ? -57.000 36.024 14.136  1.00 53.28 ? 61  LEU B CG  1 
ATOM   1391 C  CD1 . LEU B 2 3   ? -57.238 37.359 13.418  1.00 57.59 ? 61  LEU B CD1 1 
ATOM   1392 C  CD2 . LEU B 2 3   ? -55.695 36.054 14.911  1.00 57.06 ? 61  LEU B CD2 1 
ATOM   1393 N  N   . ILE B 2 4   ? -60.059 35.663 17.770  1.00 39.05 ? 62  ILE B N   1 
ATOM   1394 C  CA  . ILE B 2 4   ? -61.216 35.058 18.429  1.00 35.62 ? 62  ILE B CA  1 
ATOM   1395 C  C   . ILE B 2 4   ? -61.712 36.109 19.421  1.00 39.64 ? 62  ILE B C   1 
ATOM   1396 O  O   . ILE B 2 4   ? -60.907 36.795 20.047  1.00 39.36 ? 62  ILE B O   1 
ATOM   1397 C  CB  . ILE B 2 4   ? -60.837 33.722 19.151  1.00 33.89 ? 62  ILE B CB  1 
ATOM   1398 C  CG1 . ILE B 2 4   ? -60.407 32.660 18.121  1.00 31.92 ? 62  ILE B CG1 1 
ATOM   1399 C  CG2 . ILE B 2 4   ? -61.985 33.139 19.955  1.00 31.91 ? 62  ILE B CG2 1 
ATOM   1400 C  CD1 . ILE B 2 4   ? -60.119 31.274 18.743  1.00 30.24 ? 62  ILE B CD1 1 
ATOM   1401 N  N   . ARG B 2 5   ? -63.028 36.250 19.537  1.00 37.91 ? 63  ARG B N   1 
ATOM   1402 C  CA  . ARG B 2 5   ? -63.584 37.195 20.472  1.00 37.73 ? 63  ARG B CA  1 
ATOM   1403 C  C   . ARG B 2 5   ? -63.655 36.532 21.854  1.00 32.04 ? 63  ARG B C   1 
ATOM   1404 O  O   . ARG B 2 5   ? -64.051 35.380 21.982  1.00 31.12 ? 63  ARG B O   1 
ATOM   1405 C  CB  . ARG B 2 5   ? -64.963 37.667 19.986  1.00 38.78 ? 63  ARG B CB  1 
ATOM   1406 C  CG  . ARG B 2 5   ? -65.557 38.874 20.708  1.00 38.46 ? 63  ARG B CG  1 
ATOM   1407 C  CD  . ARG B 2 5   ? -66.358 39.775 19.774  1.00 35.31 ? 63  ARG B CD  1 
ATOM   1408 N  NE  . ARG B 2 5   ? -67.296 39.031 18.910  1.00 31.42 ? 63  ARG B NE  1 
ATOM   1409 C  CZ  . ARG B 2 5   ? -68.457 38.487 19.290  1.00 29.93 ? 63  ARG B CZ  1 
ATOM   1410 N  NH1 . ARG B 2 5   ? -68.869 38.581 20.537  1.00 26.70 ? 63  ARG B NH1 1 
ATOM   1411 N  NH2 . ARG B 2 5   ? -69.190 37.845 18.383  1.00 32.35 ? 63  ARG B NH2 1 
ATOM   1412 N  N   . LYS B 2 6   ? -63.411 37.217 22.894  1.00 33.83 ? 64  LYS B N   1 
ATOM   1413 C  CA  . LYS B 2 6   ? -63.304 36.516 24.123  1.00 31.43 ? 64  LYS B CA  1 
ATOM   1414 C  C   . LYS B 2 6   ? -64.526 35.984 24.841  1.00 31.64 ? 64  LYS B C   1 
ATOM   1415 O  O   . LYS B 2 6   ? -64.536 34.853 25.316  1.00 26.46 ? 64  LYS B O   1 
ATOM   1416 C  CB  . LYS B 2 6   ? -62.593 37.496 25.028  1.00 37.48 ? 64  LYS B CB  1 
ATOM   1417 C  CG  . LYS B 2 6   ? -62.994 37.411 26.461  1.00 46.10 ? 64  LYS B CG  1 
ATOM   1418 C  CD  . LYS B 2 6   ? -61.903 36.673 27.227  1.00 51.91 ? 64  LYS B CD  1 
ATOM   1419 C  CE  . LYS B 2 6   ? -62.041 36.912 28.706  1.00 55.55 ? 64  LYS B CE  1 
ATOM   1420 N  NZ  . LYS B 2 6   ? -63.361 36.444 29.209  1.00 54.54 ? 64  LYS B NZ  1 
ATOM   1421 N  N   . LEU B 2 7   ? -65.553 36.784 24.907  1.00 28.42 ? 65  LEU B N   1 
ATOM   1422 C  CA  . LEU B 2 7   ? -66.646 36.251 25.731  1.00 27.35 ? 65  LEU B CA  1 
ATOM   1423 C  C   . LEU B 2 7   ? -67.345 34.949 25.282  1.00 23.70 ? 65  LEU B C   1 
ATOM   1424 O  O   . LEU B 2 7   ? -67.630 34.100 26.084  1.00 27.01 ? 65  LEU B O   1 
ATOM   1425 C  CB  . LEU B 2 7   ? -67.672 37.384 26.025  1.00 29.06 ? 65  LEU B CB  1 
ATOM   1426 C  CG  . LEU B 2 7   ? -67.096 38.450 26.963  1.00 30.84 ? 65  LEU B CG  1 
ATOM   1427 C  CD1 . LEU B 2 7   ? -68.051 39.659 27.051  1.00 31.37 ? 65  LEU B CD1 1 
ATOM   1428 C  CD2 . LEU B 2 7   ? -66.885 37.818 28.337  1.00 32.44 ? 65  LEU B CD2 1 
ATOM   1429 N  N   . PRO B 2 8   ? -67.661 34.828 23.958  1.00 25.05 ? 66  PRO B N   1 
ATOM   1430 C  CA  . PRO B 2 8   ? -68.326 33.563 23.576  1.00 23.88 ? 66  PRO B CA  1 
ATOM   1431 C  C   . PRO B 2 8   ? -67.339 32.390 23.805  1.00 22.35 ? 66  PRO B C   1 
ATOM   1432 O  O   . PRO B 2 8   ? -67.782 31.327 24.167  1.00 23.77 ? 66  PRO B O   1 
ATOM   1433 C  CB  . PRO B 2 8   ? -68.608 33.742 22.066  1.00 25.42 ? 66  PRO B CB  1 
ATOM   1434 C  CG  . PRO B 2 8   ? -68.501 35.287 21.813  1.00 26.40 ? 66  PRO B CG  1 
ATOM   1435 C  CD  . PRO B 2 8   ? -67.443 35.749 22.837  1.00 27.17 ? 66  PRO B CD  1 
ATOM   1436 N  N   . PHE B 2 9   ? -66.046 32.637 23.592  1.00 24.49 ? 67  PHE B N   1 
ATOM   1437 C  CA  . PHE B 2 9   ? -64.995 31.633 23.794  1.00 25.13 ? 67  PHE B CA  1 
ATOM   1438 C  C   . PHE B 2 9   ? -64.949 31.233 25.266  1.00 25.80 ? 67  PHE B C   1 
ATOM   1439 O  O   . PHE B 2 9   ? -64.911 30.051 25.595  1.00 24.98 ? 67  PHE B O   1 
ATOM   1440 C  CB  . PHE B 2 9   ? -63.638 32.160 23.329  1.00 25.97 ? 67  PHE B CB  1 
ATOM   1441 C  CG  . PHE B 2 9   ? -62.544 31.107 23.532  1.00 24.44 ? 67  PHE B CG  1 
ATOM   1442 C  CD1 . PHE B 2 9   ? -62.299 30.135 22.581  1.00 25.35 ? 67  PHE B CD1 1 
ATOM   1443 C  CD2 . PHE B 2 9   ? -61.777 31.109 24.672  1.00 24.56 ? 67  PHE B CD2 1 
ATOM   1444 C  CE1 . PHE B 2 9   ? -61.322 29.169 22.781  1.00 24.08 ? 67  PHE B CE1 1 
ATOM   1445 C  CE2 . PHE B 2 9   ? -60.810 30.147 24.897  1.00 24.27 ? 67  PHE B CE2 1 
ATOM   1446 C  CZ  . PHE B 2 9   ? -60.578 29.185 23.937  1.00 23.63 ? 67  PHE B CZ  1 
ATOM   1447 N  N   . GLN B 2 10  ? -64.967 32.236 26.139  1.00 29.25 ? 68  GLN B N   1 
ATOM   1448 C  CA  . GLN B 2 10  ? -65.001 31.970 27.573  1.00 29.91 ? 68  GLN B CA  1 
ATOM   1449 C  C   . GLN B 2 10  ? -66.205 31.154 27.985  1.00 29.64 ? 68  GLN B C   1 
ATOM   1450 O  O   . GLN B 2 10  ? -66.106 30.270 28.809  1.00 30.66 ? 68  GLN B O   1 
ATOM   1451 C  CB  . GLN B 2 10  ? -64.946 33.260 28.375  1.00 32.81 ? 68  GLN B CB  1 
ATOM   1452 C  CG  . GLN B 2 10  ? -65.182 32.870 29.834  1.00 40.71 ? 68  GLN B CG  1 
ATOM   1453 C  CD  . GLN B 2 10  ? -65.029 34.001 30.795  1.00 47.62 ? 68  GLN B CD  1 
ATOM   1454 O  OE1 . GLN B 2 10  ? -65.752 35.019 30.722  1.00 45.97 ? 68  GLN B OE1 1 
ATOM   1455 N  NE2 . GLN B 2 10  ? -64.126 33.812 31.763  1.00 42.15 ? 68  GLN B NE2 1 
ATOM   1456 N  N   . ARG B 2 11  ? -67.382 31.399 27.390  1.00 31.04 ? 69  ARG B N   1 
ATOM   1457 C  CA  . ARG B 2 11  ? -68.548 30.592 27.730  1.00 29.61 ? 69  ARG B CA  1 
ATOM   1458 C  C   . ARG B 2 11  ? -68.388 29.150 27.311  1.00 28.77 ? 69  ARG B C   1 
ATOM   1459 O  O   . ARG B 2 11  ? -68.758 28.224 28.031  1.00 29.06 ? 69  ARG B O   1 
ATOM   1460 C  CB  . ARG B 2 11  ? -69.876 31.177 27.140  1.00 31.86 ? 69  ARG B CB  1 
ATOM   1461 C  CG  . ARG B 2 11  ? -71.199 30.639 27.798  1.00 35.60 ? 69  ARG B CG  1 
ATOM   1462 C  CD  . ARG B 2 11  ? -71.935 31.692 28.831  1.00 39.53 ? 69  ARG B CD  1 
ATOM   1463 N  NE  . ARG B 2 11  ? -73.279 31.209 29.326  1.00 45.78 ? 69  ARG B NE  1 
ATOM   1464 C  CZ  . ARG B 2 11  ? -73.623 29.917 29.460  1.00 44.76 ? 69  ARG B CZ  1 
ATOM   1465 N  NH1 . ARG B 2 11  ? -72.734 28.971 29.203  1.00 40.61 ? 69  ARG B NH1 1 
ATOM   1466 N  NH2 . ARG B 2 11  ? -74.833 29.542 29.868  1.00 43.29 ? 69  ARG B NH2 1 
ATOM   1467 N  N   . LEU B 2 12  ? -67.863 28.921 26.108  1.00 25.96 ? 70  LEU B N   1 
ATOM   1468 C  CA  . LEU B 2 12  ? -67.619 27.563 25.672  1.00 25.86 ? 70  LEU B CA  1 
ATOM   1469 C  C   . LEU B 2 12  ? -66.673 26.843 26.660  1.00 23.10 ? 70  LEU B C   1 
ATOM   1470 O  O   . LEU B 2 12  ? -66.920 25.701 27.040  1.00 28.59 ? 70  LEU B O   1 
ATOM   1471 C  CB  . LEU B 2 12  ? -67.043 27.532 24.267  1.00 24.63 ? 70  LEU B CB  1 
ATOM   1472 C  CG  . LEU B 2 12  ? -66.697 26.124 23.759  1.00 26.76 ? 70  LEU B CG  1 
ATOM   1473 C  CD1 . LEU B 2 12  ? -67.948 25.248 23.740  1.00 30.04 ? 70  LEU B CD1 1 
ATOM   1474 C  CD2 . LEU B 2 12  ? -66.069 26.186 22.378  1.00 28.60 ? 70  LEU B CD2 1 
ATOM   1475 N  N   . VAL B 2 13  ? -65.612 27.530 27.059  1.00 27.50 ? 71  VAL B N   1 
ATOM   1476 C  CA  . VAL B 2 13  ? -64.617 26.931 27.989  1.00 26.77 ? 71  VAL B CA  1 
ATOM   1477 C  C   . VAL B 2 13  ? -65.351 26.526 29.292  1.00 30.50 ? 71  VAL B C   1 
ATOM   1478 O  O   . VAL B 2 13  ? -65.239 25.372 29.753  1.00 31.15 ? 71  VAL B O   1 
ATOM   1479 C  CB  . VAL B 2 13  ? -63.486 27.885 28.231  1.00 26.47 ? 71  VAL B CB  1 
ATOM   1480 C  CG1 . VAL B 2 13  ? -62.644 27.428 29.454  1.00 29.02 ? 71  VAL B CG1 1 
ATOM   1481 C  CG2 . VAL B 2 13  ? -62.616 27.974 26.957  1.00 25.89 ? 71  VAL B CG2 1 
ATOM   1482 N  N   . ARG B 2 14  ? -66.152 27.452 29.813  1.00 34.32 ? 72  ARG B N   1 
ATOM   1483 C  CA  . ARG B 2 14  ? -66.950 27.200 31.027  1.00 39.58 ? 72  ARG B CA  1 
ATOM   1484 C  C   . ARG B 2 14  ? -67.883 26.014 30.901  1.00 38.12 ? 72  ARG B C   1 
ATOM   1485 O  O   . ARG B 2 14  ? -67.983 25.196 31.827  1.00 40.75 ? 72  ARG B O   1 
ATOM   1486 C  CB  . ARG B 2 14  ? -67.726 28.457 31.436  1.00 41.44 ? 72  ARG B CB  1 
ATOM   1487 C  CG  . ARG B 2 14  ? -66.817 29.577 31.926  1.00 42.83 ? 72  ARG B CG  1 
ATOM   1488 C  CD  . ARG B 2 14  ? -67.603 30.803 32.432  1.00 48.76 ? 72  ARG B CD  1 
ATOM   1489 N  NE  . ARG B 2 14  ? -66.711 31.752 33.095  1.00 56.76 ? 72  ARG B NE  1 
ATOM   1490 C  CZ  . ARG B 2 14  ? -67.094 32.909 33.631  1.00 62.90 ? 72  ARG B CZ  1 
ATOM   1491 N  NH1 . ARG B 2 14  ? -68.375 33.289 33.574  1.00 65.08 ? 72  ARG B NH1 1 
ATOM   1492 N  NH2 . ARG B 2 14  ? -66.191 33.693 34.224  1.00 61.76 ? 72  ARG B NH2 1 
ATOM   1493 N  N   . GLU B 2 15  ? -68.578 25.888 29.769  1.00 36.13 ? 73  GLU B N   1 
ATOM   1494 C  CA  . GLU B 2 15  ? -69.474 24.747 29.568  1.00 36.93 ? 73  GLU B CA  1 
ATOM   1495 C  C   . GLU B 2 15  ? -68.720 23.448 29.484  1.00 37.72 ? 73  GLU B C   1 
ATOM   1496 O  O   . GLU B 2 15  ? -69.152 22.425 30.014  1.00 40.32 ? 73  GLU B O   1 
ATOM   1497 C  CB  . GLU B 2 15  ? -70.353 24.913 28.318  1.00 38.85 ? 73  GLU B CB  1 
ATOM   1498 C  CG  . GLU B 2 15  ? -71.360 26.037 28.435  1.00 41.84 ? 73  GLU B CG  1 
ATOM   1499 C  CD  . GLU B 2 15  ? -72.400 25.792 29.546  1.00 47.29 ? 73  GLU B CD  1 
ATOM   1500 O  OE1 . GLU B 2 15  ? -72.704 24.619 29.880  1.00 52.09 ? 73  GLU B OE1 1 
ATOM   1501 O  OE2 . GLU B 2 15  ? -72.891 26.789 30.077  1.00 48.40 ? 73  GLU B OE2 1 
ATOM   1502 N  N   . ILE B 2 16  ? -67.594 23.466 28.784  1.00 35.38 ? 74  ILE B N   1 
ATOM   1503 C  CA  . ILE B 2 16  ? -66.803 22.280 28.679  1.00 32.84 ? 74  ILE B CA  1 
ATOM   1504 C  C   . ILE B 2 16  ? -66.278 21.887 30.069  1.00 35.11 ? 74  ILE B C   1 
ATOM   1505 O  O   . ILE B 2 16  ? -66.387 20.730 30.452  1.00 37.57 ? 74  ILE B O   1 
ATOM   1506 C  CB  . ILE B 2 16  ? -65.617 22.452 27.689  1.00 32.53 ? 74  ILE B CB  1 
ATOM   1507 C  CG1 . ILE B 2 16  ? -66.147 22.547 26.261  1.00 31.24 ? 74  ILE B CG1 1 
ATOM   1508 C  CG2 . ILE B 2 16  ? -64.696 21.246 27.776  1.00 29.87 ? 74  ILE B CG2 1 
ATOM   1509 C  CD1 . ILE B 2 16  ? -65.064 22.917 25.283  1.00 27.35 ? 74  ILE B CD1 1 
ATOM   1510 N  N   . ALA B 2 17  ? -65.736 22.852 30.802  1.00 37.92 ? 75  ALA B N   1 
ATOM   1511 C  CA  . ALA B 2 17  ? -65.136 22.562 32.119  1.00 41.56 ? 75  ALA B CA  1 
ATOM   1512 C  C   . ALA B 2 17  ? -66.191 22.029 33.080  1.00 45.72 ? 75  ALA B C   1 
ATOM   1513 O  O   . ALA B 2 17  ? -65.871 21.289 34.007  1.00 45.74 ? 75  ALA B O   1 
ATOM   1514 C  CB  . ALA B 2 17  ? -64.480 23.793 32.693  1.00 40.23 ? 75  ALA B CB  1 
ATOM   1515 N  N   . GLN B 2 18  ? -67.438 22.425 32.860  1.00 49.23 ? 76  GLN B N   1 
ATOM   1516 C  CA  . GLN B 2 18  ? -68.547 21.979 33.696  1.00 54.98 ? 76  GLN B CA  1 
ATOM   1517 C  C   . GLN B 2 18  ? -68.715 20.470 33.600  1.00 55.98 ? 76  GLN B C   1 
ATOM   1518 O  O   . GLN B 2 18  ? -68.982 19.804 34.598  1.00 58.64 ? 76  GLN B O   1 
ATOM   1519 C  CB  . GLN B 2 18  ? -69.845 22.700 33.294  1.00 56.66 ? 76  GLN B CB  1 
ATOM   1520 C  CG  . GLN B 2 18  ? -71.119 22.210 33.994  1.00 62.53 ? 76  GLN B CG  1 
ATOM   1521 C  CD  . GLN B 2 18  ? -71.170 22.580 35.474  1.00 66.91 ? 76  GLN B CD  1 
ATOM   1522 O  OE1 . GLN B 2 18  ? -70.340 23.349 35.966  1.00 68.27 ? 76  GLN B OE1 1 
ATOM   1523 N  NE2 . GLN B 2 18  ? -72.158 22.034 36.190  1.00 68.11 ? 76  GLN B NE2 1 
ATOM   1524 N  N   . ASP B 2 19  ? -68.558 19.919 32.404  1.00 58.09 ? 77  ASP B N   1 
ATOM   1525 C  CA  . ASP B 2 19  ? -68.701 18.482 32.226  1.00 59.11 ? 77  ASP B CA  1 
ATOM   1526 C  C   . ASP B 2 19  ? -67.621 17.695 32.947  1.00 58.92 ? 77  ASP B C   1 
ATOM   1527 O  O   . ASP B 2 19  ? -67.733 16.480 33.081  1.00 59.65 ? 77  ASP B O   1 
ATOM   1528 C  CB  . ASP B 2 19  ? -68.690 18.114 30.747  1.00 61.62 ? 77  ASP B CB  1 
ATOM   1529 C  CG  . ASP B 2 19  ? -69.822 18.755 29.990  1.00 64.55 ? 77  ASP B CG  1 
ATOM   1530 O  OD1 . ASP B 2 19  ? -70.442 19.685 30.547  1.00 67.69 ? 77  ASP B OD1 1 
ATOM   1531 O  OD2 . ASP B 2 19  ? -70.087 18.337 28.846  1.00 67.57 ? 77  ASP B OD2 1 
ATOM   1532 N  N   . PHE B 2 20  ? -66.568 18.380 33.390  1.00 57.35 ? 78  PHE B N   1 
ATOM   1533 C  CA  . PHE B 2 20  ? -65.480 17.718 34.112  1.00 56.89 ? 78  PHE B CA  1 
ATOM   1534 C  C   . PHE B 2 20  ? -65.572 17.931 35.626  1.00 58.18 ? 78  PHE B C   1 
ATOM   1535 O  O   . PHE B 2 20  ? -65.332 17.011 36.406  1.00 60.61 ? 78  PHE B O   1 
ATOM   1536 C  CB  . PHE B 2 20  ? -64.117 18.181 33.590  1.00 53.16 ? 78  PHE B CB  1 
ATOM   1537 C  CG  . PHE B 2 20  ? -63.844 17.761 32.176  1.00 49.80 ? 78  PHE B CG  1 
ATOM   1538 C  CD1 . PHE B 2 20  ? -63.621 18.707 31.183  1.00 48.69 ? 78  PHE B CD1 1 
ATOM   1539 C  CD2 . PHE B 2 20  ? -63.839 16.425 31.830  1.00 49.23 ? 78  PHE B CD2 1 
ATOM   1540 C  CE1 . PHE B 2 20  ? -63.376 18.315 29.877  1.00 44.25 ? 78  PHE B CE1 1 
ATOM   1541 C  CE2 . PHE B 2 20  ? -63.586 16.029 30.517  1.00 48.18 ? 78  PHE B CE2 1 
ATOM   1542 C  CZ  . PHE B 2 20  ? -63.370 16.984 29.539  1.00 45.51 ? 78  PHE B CZ  1 
ATOM   1543 N  N   . LYS B 2 21  ? -65.918 19.145 36.033  1.00 59.61 ? 79  LYS B N   1 
ATOM   1544 C  CA  . LYS B 2 21  ? -66.033 19.465 37.449  1.00 60.49 ? 79  LYS B CA  1 
ATOM   1545 C  C   . LYS B 2 21  ? -66.889 20.698 37.688  1.00 60.27 ? 79  LYS B C   1 
ATOM   1546 O  O   . LYS B 2 21  ? -66.570 21.797 37.230  1.00 59.91 ? 79  LYS B O   1 
ATOM   1547 C  CB  . LYS B 2 21  ? -64.651 19.673 38.075  1.00 60.87 ? 79  LYS B CB  1 
ATOM   1548 C  CG  . LYS B 2 21  ? -64.724 20.196 39.499  1.00 63.89 ? 79  LYS B CG  1 
ATOM   1549 C  CD  . LYS B 2 21  ? -63.393 20.126 40.234  1.00 64.70 ? 79  LYS B CD  1 
ATOM   1550 C  CE  . LYS B 2 21  ? -63.583 20.553 41.684  1.00 67.07 ? 79  LYS B CE  1 
ATOM   1551 N  NZ  . LYS B 2 21  ? -64.782 19.875 42.276  1.00 67.16 ? 79  LYS B NZ  1 
ATOM   1552 N  N   . THR B 2 22  ? -67.971 20.513 38.433  1.00 60.31 ? 80  THR B N   1 
ATOM   1553 C  CA  . THR B 2 22  ? -68.863 21.617 38.775  1.00 61.00 ? 80  THR B CA  1 
ATOM   1554 C  C   . THR B 2 22  ? -68.110 22.633 39.639  1.00 60.88 ? 80  THR B C   1 
ATOM   1555 O  O   . THR B 2 22  ? -67.100 22.291 40.271  1.00 61.19 ? 80  THR B O   1 
ATOM   1556 C  CB  . THR B 2 22  ? -70.125 21.104 39.532  1.00 61.19 ? 80  THR B CB  1 
ATOM   1557 O  OG1 . THR B 2 22  ? -69.720 20.391 40.707  1.00 63.03 ? 80  THR B OG1 1 
ATOM   1558 C  CG2 . THR B 2 22  ? -70.927 20.154 38.656  1.00 60.86 ? 80  THR B CG2 1 
ATOM   1559 N  N   A ASP B 2 23  ? -68.590 23.875 39.620  0.50 60.66 ? 81  ASP B N   1 
ATOM   1560 N  N   B ASP B 2 23  ? -68.623 23.861 39.686  0.50 61.04 ? 81  ASP B N   1 
ATOM   1561 C  CA  A ASP B 2 23  ? -68.041 24.969 40.424  0.50 60.49 ? 81  ASP B CA  1 
ATOM   1562 C  CA  B ASP B 2 23  ? -68.020 24.962 40.452  0.50 61.19 ? 81  ASP B CA  1 
ATOM   1563 C  C   A ASP B 2 23  ? -66.514 25.077 40.344  0.50 60.01 ? 81  ASP B C   1 
ATOM   1564 C  C   B ASP B 2 23  ? -66.496 25.041 40.337  0.50 60.43 ? 81  ASP B C   1 
ATOM   1565 O  O   A ASP B 2 23  ? -65.802 24.819 41.323  0.50 60.39 ? 81  ASP B O   1 
ATOM   1566 O  O   B ASP B 2 23  ? -65.765 24.729 41.286  0.50 60.82 ? 81  ASP B O   1 
ATOM   1567 C  CB  A ASP B 2 23  ? -68.511 24.839 41.876  0.50 61.07 ? 81  ASP B CB  1 
ATOM   1568 C  CB  B ASP B 2 23  ? -68.459 24.951 41.927  0.50 62.34 ? 81  ASP B CB  1 
ATOM   1569 C  CG  A ASP B 2 23  ? -70.018 24.645 41.983  0.50 60.83 ? 81  ASP B CG  1 
ATOM   1570 C  CG  B ASP B 2 23  ? -68.199 23.621 42.614  0.50 63.13 ? 81  ASP B CG  1 
ATOM   1571 O  OD1 A ASP B 2 23  ? -70.755 25.217 41.147  0.50 59.81 ? 81  ASP B OD1 1 
ATOM   1572 O  OD1 B ASP B 2 23  ? -68.915 22.638 42.315  0.50 63.96 ? 81  ASP B OD1 1 
ATOM   1573 O  OD2 A ASP B 2 23  ? -70.459 23.916 42.897  0.50 60.33 ? 81  ASP B OD2 1 
ATOM   1574 O  OD2 B ASP B 2 23  ? -67.298 23.568 43.477  0.50 63.76 ? 81  ASP B OD2 1 
ATOM   1575 N  N   . LEU B 2 24  ? -66.028 25.480 39.174  1.00 58.04 ? 82  LEU B N   1 
ATOM   1576 C  CA  . LEU B 2 24  ? -64.606 25.564 38.912  1.00 55.99 ? 82  LEU B CA  1 
ATOM   1577 C  C   . LEU B 2 24  ? -64.379 26.691 37.928  1.00 54.28 ? 82  LEU B C   1 
ATOM   1578 O  O   . LEU B 2 24  ? -64.745 26.552 36.758  1.00 56.21 ? 82  LEU B O   1 
ATOM   1579 C  CB  . LEU B 2 24  ? -64.204 24.253 38.260  1.00 58.11 ? 82  LEU B CB  1 
ATOM   1580 C  CG  . LEU B 2 24  ? -62.800 23.895 37.807  1.00 61.66 ? 82  LEU B CG  1 
ATOM   1581 C  CD1 . LEU B 2 24  ? -61.897 23.605 38.993  1.00 62.54 ? 82  LEU B CD1 1 
ATOM   1582 C  CD2 . LEU B 2 24  ? -62.960 22.642 36.955  1.00 63.24 ? 82  LEU B CD2 1 
ATOM   1583 N  N   . ARG B 2 25  ? -63.794 27.800 38.372  1.00 48.31 ? 83  ARG B N   1 
ATOM   1584 C  CA  . ARG B 2 25  ? -63.569 28.930 37.472  1.00 49.94 ? 83  ARG B CA  1 
ATOM   1585 C  C   . ARG B 2 25  ? -62.156 28.904 36.913  1.00 43.90 ? 83  ARG B C   1 
ATOM   1586 O  O   . ARG B 2 25  ? -61.280 28.229 37.459  1.00 40.47 ? 83  ARG B O   1 
ATOM   1587 C  CB  . ARG B 2 25  ? -63.760 30.279 38.183  1.00 52.31 ? 83  ARG B CB  1 
ATOM   1588 C  CG  . ARG B 2 25  ? -65.213 30.740 38.441  1.00 58.59 ? 83  ARG B CG  1 
ATOM   1589 C  CD  . ARG B 2 25  ? -65.199 32.202 38.962  1.00 59.63 ? 83  ARG B CD  1 
ATOM   1590 N  NE  . ARG B 2 25  ? -66.379 32.539 39.767  1.00 68.97 ? 83  ARG B NE  1 
ATOM   1591 C  CZ  . ARG B 2 25  ? -66.511 33.659 40.474  1.00 71.07 ? 83  ARG B CZ  1 
ATOM   1592 N  NH1 . ARG B 2 25  ? -65.538 34.566 40.481  1.00 73.21 ? 83  ARG B NH1 1 
ATOM   1593 N  NH2 . ARG B 2 25  ? -67.618 33.875 41.177  1.00 74.24 ? 83  ARG B NH2 1 
ATOM   1594 N  N   . PHE B 2 26  ? -61.954 29.645 35.826  1.00 39.64 ? 84  PHE B N   1 
ATOM   1595 C  CA  . PHE B 2 26  ? -60.636 29.846 35.266  1.00 37.20 ? 84  PHE B CA  1 
ATOM   1596 C  C   . PHE B 2 26  ? -60.185 31.244 35.589  1.00 38.09 ? 84  PHE B C   1 
ATOM   1597 O  O   . PHE B 2 26  ? -60.980 32.195 35.484  1.00 40.20 ? 84  PHE B O   1 
ATOM   1598 C  CB  . PHE B 2 26  ? -60.687 29.701 33.751  1.00 36.96 ? 84  PHE B CB  1 
ATOM   1599 C  CG  . PHE B 2 26  ? -60.937 28.302 33.310  1.00 37.14 ? 84  PHE B CG  1 
ATOM   1600 C  CD1 . PHE B 2 26  ? -62.103 27.652 33.683  1.00 40.27 ? 84  PHE B CD1 1 
ATOM   1601 C  CD2 . PHE B 2 26  ? -60.007 27.635 32.574  1.00 39.34 ? 84  PHE B CD2 1 
ATOM   1602 C  CE1 . PHE B 2 26  ? -62.331 26.334 33.308  1.00 43.63 ? 84  PHE B CE1 1 
ATOM   1603 C  CE2 . PHE B 2 26  ? -60.231 26.305 32.179  1.00 38.12 ? 84  PHE B CE2 1 
ATOM   1604 C  CZ  . PHE B 2 26  ? -61.394 25.678 32.543  1.00 37.25 ? 84  PHE B CZ  1 
ATOM   1605 N  N   . GLN B 2 27  ? -58.919 31.398 35.952  1.00 33.88 ? 85  GLN B N   1 
ATOM   1606 C  CA  . GLN B 2 27  ? -58.348 32.723 36.071  1.00 36.31 ? 85  GLN B CA  1 
ATOM   1607 C  C   . GLN B 2 27  ? -58.405 33.389 34.704  1.00 39.74 ? 85  GLN B C   1 
ATOM   1608 O  O   . GLN B 2 27  ? -58.328 32.704 33.672  1.00 34.11 ? 85  GLN B O   1 
ATOM   1609 C  CB  . GLN B 2 27  ? -56.898 32.640 36.519  1.00 38.91 ? 85  GLN B CB  1 
ATOM   1610 C  CG  . GLN B 2 27  ? -56.727 32.094 37.940  1.00 45.57 ? 85  GLN B CG  1 
ATOM   1611 C  CD  . GLN B 2 27  ? -55.414 32.508 38.566  1.00 52.04 ? 85  GLN B CD  1 
ATOM   1612 O  OE1 . GLN B 2 27  ? -54.353 32.410 37.942  1.00 53.82 ? 85  GLN B OE1 1 
ATOM   1613 N  NE2 . GLN B 2 27  ? -55.474 32.974 39.813  1.00 54.64 ? 85  GLN B NE2 1 
ATOM   1614 N  N   . SER B 2 28  ? -58.553 34.711 34.670  1.00 37.89 ? 86  SER B N   1 
ATOM   1615 C  CA  . SER B 2 28  ? -58.622 35.395 33.380  1.00 38.04 ? 86  SER B CA  1 
ATOM   1616 C  C   . SER B 2 28  ? -57.397 35.062 32.518  1.00 36.39 ? 86  SER B C   1 
ATOM   1617 O  O   . SER B 2 28  ? -57.527 34.867 31.312  1.00 33.24 ? 86  SER B O   1 
ATOM   1618 C  CB  . SER B 2 28  ? -58.766 36.910 33.549  1.00 41.86 ? 86  SER B CB  1 
ATOM   1619 O  OG  . SER B 2 28  ? -57.629 37.439 34.210  1.00 50.09 ? 86  SER B OG  1 
ATOM   1620 N  N   . SER B 2 29  ? -56.219 34.976 33.139  1.00 35.03 ? 87  SER B N   1 
ATOM   1621 C  CA  . SER B 2 29  ? -54.986 34.656 32.406  1.00 34.81 ? 87  SER B CA  1 
ATOM   1622 C  C   . SER B 2 29  ? -55.011 33.232 31.817  1.00 34.06 ? 87  SER B C   1 
ATOM   1623 O  O   . SER B 2 29  ? -54.382 32.987 30.762  1.00 32.61 ? 87  SER B O   1 
ATOM   1624 C  CB  . SER B 2 29  ? -53.757 34.840 33.303  1.00 37.73 ? 87  SER B CB  1 
ATOM   1625 O  OG  . SER B 2 29  ? -53.868 34.008 34.445  1.00 38.24 ? 87  SER B OG  1 
ATOM   1626 N  N   . ALA B 2 30  ? -55.716 32.314 32.498  1.00 31.46 ? 88  ALA B N   1 
ATOM   1627 C  CA  . ALA B 2 30  ? -55.864 30.933 32.037  1.00 32.74 ? 88  ALA B CA  1 
ATOM   1628 C  C   . ALA B 2 30  ? -56.768 30.866 30.801  1.00 31.10 ? 88  ALA B C   1 
ATOM   1629 O  O   . ALA B 2 30  ? -56.474 30.147 29.818  1.00 30.88 ? 88  ALA B O   1 
ATOM   1630 C  CB  . ALA B 2 30  ? -56.438 30.067 33.123  1.00 33.32 ? 88  ALA B CB  1 
ATOM   1631 N  N   . VAL B 2 31  ? -57.910 31.544 30.874  1.00 28.10 ? 89  VAL B N   1 
ATOM   1632 C  CA  . VAL B 2 31  ? -58.788 31.638 29.697  1.00 27.16 ? 89  VAL B CA  1 
ATOM   1633 C  C   . VAL B 2 31  ? -58.042 32.268 28.526  1.00 25.23 ? 89  VAL B C   1 
ATOM   1634 O  O   . VAL B 2 31  ? -58.162 31.797 27.356  1.00 25.83 ? 89  VAL B O   1 
ATOM   1635 C  CB  . VAL B 2 31  ? -60.112 32.461 30.009  1.00 29.42 ? 89  VAL B CB  1 
ATOM   1636 C  CG1 . VAL B 2 31  ? -61.000 32.497 28.763  1.00 33.88 ? 89  VAL B CG1 1 
ATOM   1637 C  CG2 . VAL B 2 31  ? -60.883 31.813 31.110  1.00 34.15 ? 89  VAL B CG2 1 
ATOM   1638 N  N   A MET B 2 32  ? -57.261 33.299 28.804  0.75 26.62 ? 90  MET B N   1 
ATOM   1639 N  N   B MET B 2 32  ? -57.258 33.302 28.810  0.25 26.73 ? 90  MET B N   1 
ATOM   1640 C  CA  A MET B 2 32  ? -56.494 33.983 27.762  0.75 30.17 ? 90  MET B CA  1 
ATOM   1641 C  CA  B MET B 2 32  ? -56.491 34.002 27.776  0.25 28.25 ? 90  MET B CA  1 
ATOM   1642 C  C   A MET B 2 32  ? -55.495 32.998 27.159  0.75 27.48 ? 90  MET B C   1 
ATOM   1643 C  C   B MET B 2 32  ? -55.369 33.134 27.194  0.25 27.97 ? 90  MET B C   1 
ATOM   1644 O  O   A MET B 2 32  ? -55.350 32.917 25.943  0.75 26.78 ? 90  MET B O   1 
ATOM   1645 O  O   B MET B 2 32  ? -55.015 33.275 26.023  0.25 27.82 ? 90  MET B O   1 
ATOM   1646 C  CB  A MET B 2 32  ? -55.771 35.207 28.327  0.75 32.91 ? 90  MET B CB  1 
ATOM   1647 C  CB  B MET B 2 32  ? -55.967 35.345 28.295  0.25 29.75 ? 90  MET B CB  1 
ATOM   1648 C  CG  A MET B 2 32  ? -54.875 35.917 27.332  0.75 36.95 ? 90  MET B CG  1 
ATOM   1649 C  CG  B MET B 2 32  ? -57.067 36.392 28.447  0.25 29.52 ? 90  MET B CG  1 
ATOM   1650 S  SD  A MET B 2 32  ? -54.288 37.550 27.896  0.75 48.37 ? 90  MET B SD  1 
ATOM   1651 S  SD  B MET B 2 32  ? -56.546 38.010 29.060  0.25 34.55 ? 90  MET B SD  1 
ATOM   1652 C  CE  A MET B 2 32  ? -53.324 37.147 29.358  0.75 49.15 ? 90  MET B CE  1 
ATOM   1653 C  CE  B MET B 2 32  ? -57.703 39.105 28.234  0.25 32.48 ? 90  MET B CE  1 
ATOM   1654 N  N   . ALA B 2 33  ? -54.809 32.250 28.015  1.00 28.13 ? 91  ALA B N   1 
ATOM   1655 C  CA  . ALA B 2 33  ? -53.823 31.257 27.527  1.00 29.01 ? 91  ALA B CA  1 
ATOM   1656 C  C   . ALA B 2 33  ? -54.519 30.248 26.610  1.00 28.62 ? 91  ALA B C   1 
ATOM   1657 O  O   . ALA B 2 33  ? -53.984 29.929 25.522  1.00 28.77 ? 91  ALA B O   1 
ATOM   1658 C  CB  . ALA B 2 33  ? -53.167 30.517 28.703  1.00 31.76 ? 91  ALA B CB  1 
ATOM   1659 N  N   . LEU B 2 34  ? -55.700 29.766 27.006  1.00 24.21 ? 92  LEU B N   1 
ATOM   1660 C  CA  . LEU B 2 34  ? -56.457 28.811 26.190  1.00 25.64 ? 92  LEU B CA  1 
ATOM   1661 C  C   . LEU B 2 34  ? -56.899 29.454 24.888  1.00 25.92 ? 92  LEU B C   1 
ATOM   1662 O  O   . LEU B 2 34  ? -56.851 28.829 23.846  1.00 23.76 ? 92  LEU B O   1 
ATOM   1663 C  CB  . LEU B 2 34  ? -57.716 28.272 26.873  1.00 28.74 ? 92  LEU B CB  1 
ATOM   1664 C  CG  . LEU B 2 34  ? -57.617 27.133 27.872  1.00 36.80 ? 92  LEU B CG  1 
ATOM   1665 C  CD1 . LEU B 2 34  ? -58.944 26.944 28.602  1.00 34.93 ? 92  LEU B CD1 1 
ATOM   1666 C  CD2 . LEU B 2 34  ? -57.191 25.862 27.071  1.00 35.79 ? 92  LEU B CD2 1 
ATOM   1667 N  N   . GLN B 2 35  ? -57.326 30.713 24.941  1.00 24.67 ? 93  GLN B N   1 
ATOM   1668 C  CA  . GLN B 2 35  ? -57.719 31.413 23.695  1.00 23.65 ? 93  GLN B CA  1 
ATOM   1669 C  C   . GLN B 2 35  ? -56.570 31.547 22.709  1.00 24.53 ? 93  GLN B C   1 
ATOM   1670 O  O   . GLN B 2 35  ? -56.724 31.249 21.505  1.00 23.51 ? 93  GLN B O   1 
ATOM   1671 C  CB  . GLN B 2 35  ? -58.265 32.811 24.025  1.00 24.91 ? 93  GLN B CB  1 
ATOM   1672 C  CG  . GLN B 2 35  ? -58.897 33.401 22.803  1.00 28.06 ? 93  GLN B CG  1 
ATOM   1673 C  CD  . GLN B 2 35  ? -59.529 34.749 23.031  1.00 38.54 ? 93  GLN B CD  1 
ATOM   1674 O  OE1 . GLN B 2 35  ? -59.963 35.083 24.139  1.00 37.73 ? 93  GLN B OE1 1 
ATOM   1675 N  NE2 . GLN B 2 35  ? -59.576 35.547 21.964  1.00 42.56 ? 93  GLN B NE2 1 
ATOM   1676 N  N   . GLU B 2 36  ? -55.413 31.989 23.214  1.00 23.13 ? 94  GLU B N   1 
ATOM   1677 C  CA  . GLU B 2 36  ? -54.242 32.208 22.376  1.00 25.77 ? 94  GLU B CA  1 
ATOM   1678 C  C   . GLU B 2 36  ? -53.834 30.860 21.777  1.00 24.67 ? 94  GLU B C   1 
ATOM   1679 O  O   . GLU B 2 36  ? -53.488 30.776 20.580  1.00 24.35 ? 94  GLU B O   1 
ATOM   1680 C  CB  . GLU B 2 36  ? -53.090 32.830 23.190  1.00 28.03 ? 94  GLU B CB  1 
ATOM   1681 C  CG  . GLU B 2 36  ? -53.428 34.277 23.569  1.00 34.44 ? 94  GLU B CG  1 
ATOM   1682 C  CD  . GLU B 2 36  ? -52.415 34.915 24.522  1.00 39.83 ? 94  GLU B CD  1 
ATOM   1683 O  OE1 . GLU B 2 36  ? -51.519 34.197 25.029  1.00 48.13 ? 94  GLU B OE1 1 
ATOM   1684 O  OE2 . GLU B 2 36  ? -52.549 36.141 24.781  1.00 50.08 ? 94  GLU B OE2 1 
ATOM   1685 N  N   . ALA B 2 37  ? -53.874 29.823 22.609  1.00 23.59 ? 95  ALA B N   1 
ATOM   1686 C  CA  . ALA B 2 37  ? -53.486 28.480 22.117  1.00 25.71 ? 95  ALA B CA  1 
ATOM   1687 C  C   . ALA B 2 37  ? -54.448 27.929 21.076  1.00 21.86 ? 95  ALA B C   1 
ATOM   1688 O  O   . ALA B 2 37  ? -54.021 27.191 20.148  1.00 20.96 ? 95  ALA B O   1 
ATOM   1689 C  CB  . ALA B 2 37  ? -53.352 27.485 23.264  1.00 25.79 ? 95  ALA B CB  1 
ATOM   1690 N  N   . SER B 2 38  ? -55.737 28.237 21.241  1.00 20.26 ? 96  SER B N   1 
ATOM   1691 C  CA  . SER B 2 38  ? -56.799 27.807 20.306  1.00 20.47 ? 96  SER B CA  1 
ATOM   1692 C  C   . SER B 2 38  ? -56.584 28.500 18.966  1.00 20.68 ? 96  SER B C   1 
ATOM   1693 O  O   . SER B 2 38  ? -56.691 27.888 17.894  1.00 20.71 ? 96  SER B O   1 
ATOM   1694 C  CB  . SER B 2 38  ? -58.195 28.126 20.867  1.00 22.27 ? 96  SER B CB  1 
ATOM   1695 O  OG  . SER B 2 38  ? -58.421 27.323 22.010  1.00 23.06 ? 96  SER B OG  1 
ATOM   1696 N  N   . GLU B 2 39  ? -56.292 29.792 19.005  1.00 21.81 ? 97  GLU B N   1 
ATOM   1697 C  CA  . GLU B 2 39  ? -55.989 30.507 17.770  1.00 22.41 ? 97  GLU B CA  1 
ATOM   1698 C  C   . GLU B 2 39  ? -54.774 29.906 17.065  1.00 22.94 ? 97  GLU B C   1 
ATOM   1699 O  O   . GLU B 2 39  ? -54.811 29.644 15.861  1.00 22.28 ? 97  GLU B O   1 
ATOM   1700 C  CB  . GLU B 2 39  ? -55.746 31.994 18.057  1.00 22.77 ? 97  GLU B CB  1 
ATOM   1701 C  CG  . GLU B 2 39  ? -56.991 32.672 18.605  1.00 29.31 ? 97  GLU B CG  1 
ATOM   1702 C  CD  . GLU B 2 39  ? -56.851 34.197 18.657  1.00 41.19 ? 97  GLU B CD  1 
ATOM   1703 O  OE1 . GLU B 2 39  ? -56.053 34.760 17.845  1.00 40.20 ? 97  GLU B OE1 1 
ATOM   1704 O  OE2 . GLU B 2 39  ? -57.532 34.808 19.515  1.00 40.51 ? 97  GLU B OE2 1 
ATOM   1705 N  N   . ALA B 2 40  ? -53.718 29.632 17.828  1.00 22.62 ? 98  ALA B N   1 
ATOM   1706 C  CA  . ALA B 2 40  ? -52.481 29.145 17.228  1.00 22.45 ? 98  ALA B CA  1 
ATOM   1707 C  C   . ALA B 2 40  ? -52.769 27.742 16.662  1.00 22.70 ? 98  ALA B C   1 
ATOM   1708 O  O   . ALA B 2 40  ? -52.355 27.437 15.569  1.00 22.38 ? 98  ALA B O   1 
ATOM   1709 C  CB  . ALA B 2 40  ? -51.419 29.070 18.276  1.00 23.37 ? 98  ALA B CB  1 
ATOM   1710 N  N   . TYR B 2 41  ? -53.555 26.944 17.390  1.00 21.28 ? 99  TYR B N   1 
ATOM   1711 C  CA  . TYR B 2 41  ? -53.880 25.561 16.951  1.00 20.37 ? 99  TYR B CA  1 
ATOM   1712 C  C   . TYR B 2 41  ? -54.637 25.593 15.636  1.00 20.09 ? 99  TYR B C   1 
ATOM   1713 O  O   . TYR B 2 41  ? -54.310 24.870 14.679  1.00 20.37 ? 99  TYR B O   1 
ATOM   1714 C  CB  . TYR B 2 41  ? -54.729 24.883 18.013  1.00 21.78 ? 99  TYR B CB  1 
ATOM   1715 C  CG  . TYR B 2 41  ? -55.274 23.548 17.568  1.00 22.29 ? 99  TYR B CG  1 
ATOM   1716 C  CD1 . TYR B 2 41  ? -54.411 22.471 17.342  1.00 27.34 ? 99  TYR B CD1 1 
ATOM   1717 C  CD2 . TYR B 2 41  ? -56.633 23.360 17.332  1.00 23.46 ? 99  TYR B CD2 1 
ATOM   1718 C  CE1 . TYR B 2 41  ? -54.891 21.219 16.911  1.00 28.28 ? 99  TYR B CE1 1 
ATOM   1719 C  CE2 . TYR B 2 41  ? -57.125 22.120 16.912  1.00 25.92 ? 99  TYR B CE2 1 
ATOM   1720 C  CZ  . TYR B 2 41  ? -56.246 21.059 16.688  1.00 29.42 ? 99  TYR B CZ  1 
ATOM   1721 O  OH  . TYR B 2 41  ? -56.764 19.850 16.233  1.00 29.42 ? 99  TYR B OH  1 
ATOM   1722 N  N   . LEU B 2 42  ? -55.675 26.432 15.590  1.00 19.12 ? 100 LEU B N   1 
ATOM   1723 C  CA  . LEU B 2 42  ? -56.530 26.470 14.378  1.00 18.80 ? 100 LEU B CA  1 
ATOM   1724 C  C   . LEU B 2 42  ? -55.786 27.073 13.183  1.00 20.35 ? 100 LEU B C   1 
ATOM   1725 O  O   . LEU B 2 42  ? -55.968 26.616 12.044  1.00 19.94 ? 100 LEU B O   1 
ATOM   1726 C  CB  . LEU B 2 42  ? -57.842 27.222 14.656  1.00 19.77 ? 100 LEU B CB  1 
ATOM   1727 C  CG  . LEU B 2 42  ? -58.804 26.488 15.588  1.00 19.25 ? 100 LEU B CG  1 
ATOM   1728 C  CD1 . LEU B 2 42  ? -60.071 27.375 15.786  1.00 23.45 ? 100 LEU B CD1 1 
ATOM   1729 C  CD2 . LEU B 2 42  ? -59.192 25.071 15.014  1.00 19.07 ? 100 LEU B CD2 1 
ATOM   1730 N  N   . VAL B 2 43  ? -54.971 28.106 13.429  1.00 19.53 ? 101 VAL B N   1 
ATOM   1731 C  CA  . VAL B 2 43  ? -54.176 28.663 12.299  1.00 19.37 ? 101 VAL B CA  1 
ATOM   1732 C  C   . VAL B 2 43  ? -53.253 27.594 11.712  1.00 20.07 ? 101 VAL B C   1 
ATOM   1733 O  O   . VAL B 2 43  ? -53.215 27.390 10.494  1.00 21.24 ? 101 VAL B O   1 
ATOM   1734 C  CB  . VAL B 2 43  ? -53.376 29.879 12.715  1.00 21.88 ? 101 VAL B CB  1 
ATOM   1735 C  CG1 . VAL B 2 43  ? -52.334 30.246 11.622  1.00 21.54 ? 101 VAL B CG1 1 
ATOM   1736 C  CG2 . VAL B 2 43  ? -54.311 31.080 12.974  1.00 22.28 ? 101 VAL B CG2 1 
ATOM   1737 N  N   . ALA B 2 44  ? -52.579 26.843 12.590  1.00 20.47 ? 102 ALA B N   1 
ATOM   1738 C  CA  . ALA B 2 44  ? -51.667 25.791 12.146  1.00 22.44 ? 102 ALA B CA  1 
ATOM   1739 C  C   . ALA B 2 44  ? -52.434 24.687 11.446  1.00 21.98 ? 102 ALA B C   1 
ATOM   1740 O  O   . ALA B 2 44  ? -52.007 24.187 10.378  1.00 21.46 ? 102 ALA B O   1 
ATOM   1741 C  CB  . ALA B 2 44  ? -50.893 25.262 13.328  1.00 21.69 ? 102 ALA B CB  1 
ATOM   1742 N  N   . LEU B 2 45  ? -53.611 24.352 11.980  1.00 20.68 ? 103 LEU B N   1 
ATOM   1743 C  CA  . LEU B 2 45  ? -54.449 23.317 11.346  1.00 20.02 ? 103 LEU B CA  1 
ATOM   1744 C  C   . LEU B 2 45  ? -54.875 23.788 9.970   1.00 20.22 ? 103 LEU B C   1 
ATOM   1745 O  O   . LEU B 2 45  ? -54.813 23.039 8.991   1.00 19.51 ? 103 LEU B O   1 
ATOM   1746 C  CB  . LEU B 2 45  ? -55.672 23.057 12.219  1.00 21.35 ? 103 LEU B CB  1 
ATOM   1747 C  CG  . LEU B 2 45  ? -56.559 21.943 11.679  1.00 29.26 ? 103 LEU B CG  1 
ATOM   1748 C  CD1 . LEU B 2 45  ? -55.773 20.650 11.756  1.00 28.56 ? 103 LEU B CD1 1 
ATOM   1749 C  CD2 . LEU B 2 45  ? -57.787 21.828 12.500  1.00 31.81 ? 103 LEU B CD2 1 
ATOM   1750 N  N   . PHE B 2 46  ? -55.230 25.063 9.841   1.00 18.86 ? 104 PHE B N   1 
ATOM   1751 C  CA  . PHE B 2 46  ? -55.627 25.550 8.522   1.00 19.71 ? 104 PHE B CA  1 
ATOM   1752 C  C   . PHE B 2 46  ? -54.454 25.566 7.540   1.00 20.41 ? 104 PHE B C   1 
ATOM   1753 O  O   . PHE B 2 46  ? -54.692 25.365 6.358   1.00 21.54 ? 104 PHE B O   1 
ATOM   1754 C  CB  . PHE B 2 46  ? -56.252 26.943 8.614   1.00 20.74 ? 104 PHE B CB  1 
ATOM   1755 C  CG  . PHE B 2 46  ? -57.717 26.896 8.990   1.00 20.20 ? 104 PHE B CG  1 
ATOM   1756 C  CD1 . PHE B 2 46  ? -58.199 27.625 10.067  1.00 20.75 ? 104 PHE B CD1 1 
ATOM   1757 C  CD2 . PHE B 2 46  ? -58.613 26.143 8.231   1.00 21.64 ? 104 PHE B CD2 1 
ATOM   1758 C  CE1 . PHE B 2 46  ? -59.556 27.550 10.410  1.00 21.16 ? 104 PHE B CE1 1 
ATOM   1759 C  CE2 . PHE B 2 46  ? -59.979 26.066 8.560   1.00 21.88 ? 104 PHE B CE2 1 
ATOM   1760 C  CZ  . PHE B 2 46  ? -60.437 26.783 9.657   1.00 23.91 ? 104 PHE B CZ  1 
ATOM   1761 N  N   . GLU B 2 47  ? -53.242 25.792 8.032   1.00 19.44 ? 105 GLU B N   1 
ATOM   1762 C  CA  . GLU B 2 47  ? -52.037 25.772 7.164   1.00 21.11 ? 105 GLU B CA  1 
ATOM   1763 C  C   . GLU B 2 47  ? -51.921 24.345 6.571   1.00 21.64 ? 105 GLU B C   1 
ATOM   1764 O  O   . GLU B 2 47  ? -51.780 24.191 5.340   1.00 23.20 ? 105 GLU B O   1 
ATOM   1765 C  CB  . GLU B 2 47  ? -50.779 26.120 7.956   1.00 22.79 ? 105 GLU B CB  1 
ATOM   1766 C  CG  . GLU B 2 47  ? -50.747 27.620 8.235   1.00 27.71 ? 105 GLU B CG  1 
ATOM   1767 C  CD  . GLU B 2 47  ? -49.626 28.034 9.176   1.00 37.25 ? 105 GLU B CD  1 
ATOM   1768 O  OE1 . GLU B 2 47  ? -49.010 27.151 9.822   1.00 37.56 ? 105 GLU B OE1 1 
ATOM   1769 O  OE2 . GLU B 2 47  ? -49.403 29.250 9.280   1.00 37.80 ? 105 GLU B OE2 1 
ATOM   1770 N  N   . ASP B 2 48  ? -52.050 23.340 7.435   1.00 21.93 ? 106 ASP B N   1 
ATOM   1771 C  CA  . ASP B 2 48  ? -51.949 21.930 6.979   1.00 23.51 ? 106 ASP B CA  1 
ATOM   1772 C  C   . ASP B 2 48  ? -53.132 21.576 6.086   1.00 22.48 ? 106 ASP B C   1 
ATOM   1773 O  O   . ASP B 2 48  ? -53.026 20.787 5.131   1.00 23.09 ? 106 ASP B O   1 
ATOM   1774 C  CB  . ASP B 2 48  ? -51.892 20.995 8.180   1.00 25.98 ? 106 ASP B CB  1 
ATOM   1775 C  CG  . ASP B 2 48  ? -50.529 21.043 8.946   1.00 33.16 ? 106 ASP B CG  1 
ATOM   1776 O  OD1 . ASP B 2 48  ? -49.500 21.409 8.368   1.00 44.29 ? 106 ASP B OD1 1 
ATOM   1777 O  OD2 . ASP B 2 48  ? -50.533 20.704 10.145  1.00 44.30 ? 106 ASP B OD2 1 
ATOM   1778 N  N   . THR B 2 49  ? -54.301 22.124 6.410   1.00 21.73 ? 107 THR B N   1 
ATOM   1779 C  CA  . THR B 2 49  ? -55.510 21.895 5.635   1.00 21.67 ? 107 THR B CA  1 
ATOM   1780 C  C   . THR B 2 49  ? -55.331 22.407 4.222   1.00 22.46 ? 107 THR B C   1 
ATOM   1781 O  O   . THR B 2 49  ? -55.686 21.728 3.238   1.00 23.60 ? 107 THR B O   1 
ATOM   1782 C  CB  . THR B 2 49  ? -56.734 22.567 6.335   1.00 23.37 ? 107 THR B CB  1 
ATOM   1783 O  OG1 . THR B 2 49  ? -56.922 21.923 7.612   1.00 23.36 ? 107 THR B OG1 1 
ATOM   1784 C  CG2 . THR B 2 49  ? -58.009 22.406 5.527   1.00 23.95 ? 107 THR B CG2 1 
ATOM   1785 N  N   . ASN B 2 50  ? -54.779 23.614 4.100   1.00 22.84 ? 108 ASN B N   1 
ATOM   1786 C  CA  . ASN B 2 50  ? -54.577 24.209 2.779   1.00 24.43 ? 108 ASN B CA  1 
ATOM   1787 C  C   . ASN B 2 50  ? -53.572 23.392 1.982   1.00 22.53 ? 108 ASN B C   1 
ATOM   1788 O  O   . ASN B 2 50  ? -53.751 23.184 0.760   1.00 23.99 ? 108 ASN B O   1 
ATOM   1789 C  CB  . ASN B 2 50  ? -54.071 25.657 2.917   1.00 24.05 ? 108 ASN B CB  1 
ATOM   1790 C  CG  . ASN B 2 50  ? -54.143 26.419 1.611   1.00 25.43 ? 108 ASN B CG  1 
ATOM   1791 O  OD1 . ASN B 2 50  ? -55.125 26.321 0.890   1.00 28.89 ? 108 ASN B OD1 1 
ATOM   1792 N  ND2 . ASN B 2 50  ? -53.101 27.175 1.310   1.00 29.50 ? 108 ASN B ND2 1 
ATOM   1793 N  N   A LEU B 2 51  ? -52.514 22.927 2.649   0.50 23.75 ? 109 LEU B N   1 
ATOM   1794 N  N   B LEU B 2 51  ? -52.527 22.906 2.648   0.50 23.24 ? 109 LEU B N   1 
ATOM   1795 C  CA  A LEU B 2 51  ? -51.508 22.088 1.983   0.50 23.12 ? 109 LEU B CA  1 
ATOM   1796 C  CA  B LEU B 2 51  ? -51.517 22.097 1.960   0.50 21.96 ? 109 LEU B CA  1 
ATOM   1797 C  C   A LEU B 2 51  ? -52.139 20.833 1.405   0.50 22.23 ? 109 LEU B C   1 
ATOM   1798 C  C   B LEU B 2 51  ? -52.119 20.813 1.413   0.50 21.56 ? 109 LEU B C   1 
ATOM   1799 O  O   A LEU B 2 51  ? -51.818 20.422 0.283   0.50 22.51 ? 109 LEU B O   1 
ATOM   1800 O  O   B LEU B 2 51  ? -51.758 20.361 0.319   0.50 21.86 ? 109 LEU B O   1 
ATOM   1801 C  CB  A LEU B 2 51  ? -50.402 21.675 2.958   0.50 24.81 ? 109 LEU B CB  1 
ATOM   1802 C  CB  B LEU B 2 51  ? -50.376 21.758 2.911   0.50 22.91 ? 109 LEU B CB  1 
ATOM   1803 C  CG  A LEU B 2 51  ? -49.246 22.628 3.279   0.50 25.45 ? 109 LEU B CG  1 
ATOM   1804 C  CG  B LEU B 2 51  ? -49.127 21.126 2.296   0.50 21.10 ? 109 LEU B CG  1 
ATOM   1805 C  CD1 A LEU B 2 51  ? -48.284 21.897 4.213   0.50 26.05 ? 109 LEU B CD1 1 
ATOM   1806 C  CD1 B LEU B 2 51  ? -48.555 21.994 1.150   0.50 20.28 ? 109 LEU B CD1 1 
ATOM   1807 C  CD2 A LEU B 2 51  ? -48.493 23.073 2.026   0.50 25.04 ? 109 LEU B CD2 1 
ATOM   1808 C  CD2 B LEU B 2 51  ? -48.113 20.951 3.394   0.50 20.28 ? 109 LEU B CD2 1 
ATOM   1809 N  N   . CYS B 2 52  ? -53.031 20.224 2.183   1.00 22.03 ? 110 CYS B N   1 
ATOM   1810 C  CA  . CYS B 2 52  ? -53.720 19.006 1.770   1.00 21.92 ? 110 CYS B CA  1 
ATOM   1811 C  C   . CYS B 2 52  ? -54.493 19.281 0.474   1.00 24.28 ? 110 CYS B C   1 
ATOM   1812 O  O   . CYS B 2 52  ? -54.360 18.566 -0.551  1.00 23.05 ? 110 CYS B O   1 
ATOM   1813 C  CB  . CYS B 2 52  ? -54.668 18.544 2.881   1.00 23.21 ? 110 CYS B CB  1 
ATOM   1814 S  SG  . CYS B 2 52  ? -55.415 16.940 2.510   1.00 23.24 ? 110 CYS B SG  1 
ATOM   1815 N  N   . ALA B 2 53  ? -55.257 20.370 0.479   1.00 21.08 ? 111 ALA B N   1 
ATOM   1816 C  CA  . ALA B 2 53  ? -56.052 20.737 -0.697  1.00 21.54 ? 111 ALA B CA  1 
ATOM   1817 C  C   . ALA B 2 53  ? -55.187 20.992 -1.914  1.00 20.18 ? 111 ALA B C   1 
ATOM   1818 O  O   . ALA B 2 53  ? -55.502 20.523 -3.020  1.00 21.99 ? 111 ALA B O   1 
ATOM   1819 C  CB  . ALA B 2 53  ? -56.918 22.006 -0.373  1.00 21.84 ? 111 ALA B CB  1 
ATOM   1820 N  N   . ILE B 2 54  ? -54.103 21.718 -1.705  1.00 20.62 ? 112 ILE B N   1 
ATOM   1821 C  CA  . ILE B 2 54  ? -53.196 22.059 -2.786  1.00 21.74 ? 112 ILE B CA  1 
ATOM   1822 C  C   . ILE B 2 54  ? -52.666 20.759 -3.375  1.00 22.27 ? 112 ILE B C   1 
ATOM   1823 O  O   . ILE B 2 54  ? -52.603 20.604 -4.615  1.00 22.26 ? 112 ILE B O   1 
ATOM   1824 C  CB  . ILE B 2 54  ? -52.060 22.902 -2.289  1.00 22.03 ? 112 ILE B CB  1 
ATOM   1825 C  CG1 . ILE B 2 54  ? -52.582 24.327 -2.004  1.00 24.46 ? 112 ILE B CG1 1 
ATOM   1826 C  CG2 . ILE B 2 54  ? -50.983 23.014 -3.362  1.00 25.17 ? 112 ILE B CG2 1 
ATOM   1827 C  CD1 . ILE B 2 54  ? -51.544 25.157 -1.245  1.00 27.07 ? 112 ILE B CD1 1 
ATOM   1828 N  N   . HIS B 2 55  ? -52.265 19.853 -2.481  1.00 20.42 ? 113 HIS B N   1 
ATOM   1829 C  CA  . HIS B 2 55  ? -51.694 18.600 -2.993  1.00 22.52 ? 113 HIS B CA  1 
ATOM   1830 C  C   . HIS B 2 55  ? -52.719 17.771 -3.779  1.00 21.87 ? 113 HIS B C   1 
ATOM   1831 O  O   . HIS B 2 55  ? -52.315 16.995 -4.706  1.00 24.88 ? 113 HIS B O   1 
ATOM   1832 C  CB  . HIS B 2 55  ? -50.960 17.817 -1.879  1.00 23.49 ? 113 HIS B CB  1 
ATOM   1833 C  CG  . HIS B 2 55  ? -50.050 16.752 -2.422  1.00 23.25 ? 113 HIS B CG  1 
ATOM   1834 N  ND1 . HIS B 2 55  ? -49.000 17.050 -3.264  1.00 24.33 ? 113 HIS B ND1 1 
ATOM   1835 C  CD2 . HIS B 2 55  ? -50.057 15.400 -2.277  1.00 25.65 ? 113 HIS B CD2 1 
ATOM   1836 C  CE1 . HIS B 2 55  ? -48.369 15.926 -3.588  1.00 28.78 ? 113 HIS B CE1 1 
ATOM   1837 N  NE2 . HIS B 2 55  ? -49.003 14.909 -3.019  1.00 23.88 ? 113 HIS B NE2 1 
ATOM   1838 N  N   . ALA B 2 56  ? -54.010 17.893 -3.440  1.00 20.51 ? 114 ALA B N   1 
ATOM   1839 C  CA  . ALA B 2 56  ? -55.154 17.248 -4.108  1.00 20.92 ? 114 ALA B CA  1 
ATOM   1840 C  C   . ALA B 2 56  ? -55.538 17.957 -5.428  1.00 21.38 ? 114 ALA B C   1 
ATOM   1841 O  O   . ALA B 2 56  ? -56.490 17.549 -6.111  1.00 23.82 ? 114 ALA B O   1 
ATOM   1842 C  CB  . ALA B 2 56  ? -56.348 17.260 -3.192  1.00 21.45 ? 114 ALA B CB  1 
ATOM   1843 N  N   . LYS B 2 57  ? -54.822 19.028 -5.704  1.00 21.73 ? 115 LYS B N   1 
ATOM   1844 C  CA  . LYS B 2 57  ? -55.060 19.913 -6.884  1.00 22.43 ? 115 LYS B CA  1 
ATOM   1845 C  C   . LYS B 2 57  ? -56.415 20.602 -6.772  1.00 25.72 ? 115 LYS B C   1 
ATOM   1846 O  O   . LYS B 2 57  ? -57.164 20.729 -7.765  1.00 28.41 ? 115 LYS B O   1 
ATOM   1847 C  CB  . LYS B 2 57  ? -54.931 19.120 -8.215  1.00 24.50 ? 115 LYS B CB  1 
ATOM   1848 C  CG  . LYS B 2 57  ? -53.528 18.499 -8.354  1.00 26.01 ? 115 LYS B CG  1 
ATOM   1849 C  CD  . LYS B 2 57  ? -53.441 17.775 -9.723  1.00 27.57 ? 115 LYS B CD  1 
ATOM   1850 C  CE  . LYS B 2 57  ? -52.059 17.115 -9.831  1.00 31.78 ? 115 LYS B CE  1 
ATOM   1851 N  NZ  . LYS B 2 57  ? -51.946 16.326 -11.105 1.00 33.79 ? 115 LYS B NZ  1 
ATOM   1852 N  N   . ARG B 2 58  ? -56.716 21.074 -5.552  1.00 23.97 ? 116 ARG B N   1 
ATOM   1853 C  CA  . ARG B 2 58  ? -57.922 21.843 -5.293  1.00 23.79 ? 116 ARG B CA  1 
ATOM   1854 C  C   . ARG B 2 58  ? -57.575 23.195 -4.681  1.00 25.77 ? 116 ARG B C   1 
ATOM   1855 O  O   . ARG B 2 58  ? -56.570 23.329 -3.990  1.00 28.41 ? 116 ARG B O   1 
ATOM   1856 C  CB  . ARG B 2 58  ? -58.823 21.084 -4.325  1.00 25.79 ? 116 ARG B CB  1 
ATOM   1857 C  CG  . ARG B 2 58  ? -59.510 19.922 -4.991  1.00 27.03 ? 116 ARG B CG  1 
ATOM   1858 C  CD  . ARG B 2 58  ? -60.521 19.320 -4.030  1.00 24.62 ? 116 ARG B CD  1 
ATOM   1859 N  NE  . ARG B 2 58  ? -59.907 18.373 -3.077  1.00 25.84 ? 116 ARG B NE  1 
ATOM   1860 C  CZ  . ARG B 2 58  ? -59.645 18.630 -1.793  1.00 25.66 ? 116 ARG B CZ  1 
ATOM   1861 N  NH1 . ARG B 2 58  ? -59.821 19.866 -1.237  1.00 23.99 ? 116 ARG B NH1 1 
ATOM   1862 N  NH2 . ARG B 2 58  ? -59.138 17.654 -1.052  1.00 22.34 ? 116 ARG B NH2 1 
ATOM   1863 N  N   . VAL B 2 59  ? -58.410 24.204 -4.950  1.00 24.82 ? 117 VAL B N   1 
ATOM   1864 C  CA  . VAL B 2 59  ? -58.192 25.504 -4.308  1.00 27.43 ? 117 VAL B CA  1 
ATOM   1865 C  C   . VAL B 2 59  ? -59.162 25.739 -3.146  1.00 26.48 ? 117 VAL B C   1 
ATOM   1866 O  O   . VAL B 2 59  ? -58.975 26.703 -2.382  1.00 31.25 ? 117 VAL B O   1 
ATOM   1867 C  CB  . VAL B 2 59  ? -58.319 26.682 -5.326  1.00 28.86 ? 117 VAL B CB  1 
ATOM   1868 C  CG1 . VAL B 2 59  ? -57.219 26.586 -6.390  1.00 30.65 ? 117 VAL B CG1 1 
ATOM   1869 C  CG2 . VAL B 2 59  ? -59.669 26.650 -5.964  1.00 31.26 ? 117 VAL B CG2 1 
ATOM   1870 N  N   . THR B 2 60  ? -60.141 24.856 -2.970  1.00 24.79 ? 118 THR B N   1 
ATOM   1871 C  CA  . THR B 2 60  ? -61.134 24.990 -1.931  1.00 24.51 ? 118 THR B CA  1 
ATOM   1872 C  C   . THR B 2 60  ? -60.904 23.918 -0.866  1.00 27.29 ? 118 THR B C   1 
ATOM   1873 O  O   . THR B 2 60  ? -60.770 22.729 -1.198  1.00 26.68 ? 118 THR B O   1 
ATOM   1874 C  CB  . THR B 2 60  ? -62.535 24.828 -2.514  1.00 29.02 ? 118 THR B CB  1 
ATOM   1875 O  OG1 . THR B 2 60  ? -62.708 25.822 -3.532  1.00 30.97 ? 118 THR B OG1 1 
ATOM   1876 C  CG2 . THR B 2 60  ? -63.616 24.980 -1.465  1.00 29.84 ? 118 THR B CG2 1 
ATOM   1877 N  N   . ILE B 2 61  ? -60.781 24.335 0.396   1.00 23.32 ? 119 ILE B N   1 
ATOM   1878 C  CA  . ILE B 2 61  ? -60.691 23.355 1.475   1.00 21.88 ? 119 ILE B CA  1 
ATOM   1879 C  C   . ILE B 2 61  ? -62.024 22.710 1.844   1.00 22.44 ? 119 ILE B C   1 
ATOM   1880 O  O   . ILE B 2 61  ? -63.087 23.370 1.880   1.00 24.41 ? 119 ILE B O   1 
ATOM   1881 C  CB  . ILE B 2 61  ? -59.962 23.857 2.744   1.00 19.91 ? 119 ILE B CB  1 
ATOM   1882 C  CG1 . ILE B 2 61  ? -60.771 24.949 3.436   1.00 24.43 ? 119 ILE B CG1 1 
ATOM   1883 C  CG2 . ILE B 2 61  ? -58.575 24.396 2.336   1.00 20.35 ? 119 ILE B CG2 1 
ATOM   1884 C  CD1 . ILE B 2 61  ? -60.267 25.218 4.916   1.00 23.41 ? 119 ILE B CD1 1 
ATOM   1885 N  N   . MET B 2 62  ? -61.953 21.420 2.166   1.00 21.21 ? 120 MET B N   1 
ATOM   1886 C  CA  . MET B 2 62  ? -63.126 20.594 2.469   1.00 22.48 ? 120 MET B CA  1 
ATOM   1887 C  C   . MET B 2 62  ? -62.973 19.972 3.861   1.00 21.99 ? 120 MET B C   1 
ATOM   1888 O  O   . MET B 2 62  ? -61.857 19.892 4.393   1.00 21.61 ? 120 MET B O   1 
ATOM   1889 C  CB  . MET B 2 62  ? -63.241 19.434 1.443   1.00 23.85 ? 120 MET B CB  1 
ATOM   1890 C  CG  . MET B 2 62  ? -63.237 19.848 0.000   1.00 29.26 ? 120 MET B CG  1 
ATOM   1891 S  SD  . MET B 2 62  ? -64.809 20.628 -0.354  1.00 35.20 ? 120 MET B SD  1 
ATOM   1892 C  CE  . MET B 2 62  ? -66.019 19.308 -0.164  1.00 32.25 ? 120 MET B CE  1 
ATOM   1893 N  N   . PRO B 2 63  ? -64.073 19.507 4.451   1.00 22.92 ? 121 PRO B N   1 
ATOM   1894 C  CA  . PRO B 2 63  ? -63.952 18.826 5.737   1.00 23.87 ? 121 PRO B CA  1 
ATOM   1895 C  C   . PRO B 2 63  ? -62.908 17.708 5.699   1.00 24.23 ? 121 PRO B C   1 
ATOM   1896 O  O   . PRO B 2 63  ? -62.202 17.527 6.688   1.00 23.33 ? 121 PRO B O   1 
ATOM   1897 C  CB  . PRO B 2 63  ? -65.355 18.253 5.962   1.00 26.29 ? 121 PRO B CB  1 
ATOM   1898 C  CG  . PRO B 2 63  ? -66.275 19.290 5.276   1.00 27.85 ? 121 PRO B CG  1 
ATOM   1899 C  CD  . PRO B 2 63  ? -65.492 19.636 4.027   1.00 24.04 ? 121 PRO B CD  1 
ATOM   1900 N  N   . LYS B 2 64  ? -62.799 16.973 4.580   1.00 22.60 ? 122 LYS B N   1 
ATOM   1901 C  CA  . LYS B 2 64  ? -61.799 15.899 4.541   1.00 24.39 ? 122 LYS B CA  1 
ATOM   1902 C  C   . LYS B 2 64  ? -60.392 16.451 4.761   1.00 22.32 ? 122 LYS B C   1 
ATOM   1903 O  O   . LYS B 2 64  ? -59.548 15.795 5.403   1.00 23.00 ? 122 LYS B O   1 
ATOM   1904 C  CB  . LYS B 2 64  ? -61.881 15.070 3.240   1.00 27.59 ? 122 LYS B CB  1 
ATOM   1905 C  CG  . LYS B 2 64  ? -61.531 15.779 1.997   1.00 31.31 ? 122 LYS B CG  1 
ATOM   1906 C  CD  . LYS B 2 64  ? -61.231 14.738 0.826   1.00 28.88 ? 122 LYS B CD  1 
ATOM   1907 C  CE  . LYS B 2 64  ? -59.931 13.980 1.072   1.00 31.17 ? 122 LYS B CE  1 
ATOM   1908 N  NZ  . LYS B 2 64  ? -59.670 13.023 -0.034  1.00 30.80 ? 122 LYS B NZ  1 
ATOM   1909 N  N   . ASP B 2 65  ? -60.124 17.660 4.255   1.00 21.34 ? 123 ASP B N   1 
ATOM   1910 C  CA  . ASP B 2 65  ? -58.800 18.263 4.413   1.00 22.23 ? 123 ASP B CA  1 
ATOM   1911 C  C   . ASP B 2 65  ? -58.488 18.560 5.862   1.00 22.49 ? 123 ASP B C   1 
ATOM   1912 O  O   . ASP B 2 65  ? -57.359 18.328 6.334   1.00 22.89 ? 123 ASP B O   1 
ATOM   1913 C  CB  . ASP B 2 65  ? -58.678 19.542 3.566   1.00 20.97 ? 123 ASP B CB  1 
ATOM   1914 C  CG  . ASP B 2 65  ? -58.938 19.287 2.096   1.00 25.74 ? 123 ASP B CG  1 
ATOM   1915 O  OD1 . ASP B 2 65  ? -58.441 18.247 1.594   1.00 25.02 ? 123 ASP B OD1 1 
ATOM   1916 O  OD2 . ASP B 2 65  ? -59.679 20.063 1.456   1.00 25.49 ? 123 ASP B OD2 1 
ATOM   1917 N  N   . ILE B 2 66  ? -59.488 19.058 6.597   1.00 23.50 ? 124 ILE B N   1 
ATOM   1918 C  CA  . ILE B 2 66  ? -59.290 19.279 8.032   1.00 24.23 ? 124 ILE B CA  1 
ATOM   1919 C  C   . ILE B 2 66  ? -59.040 17.952 8.775   1.00 22.59 ? 124 ILE B C   1 
ATOM   1920 O  O   . ILE B 2 66  ? -58.115 17.866 9.613   1.00 25.09 ? 124 ILE B O   1 
ATOM   1921 C  CB  . ILE B 2 66  ? -60.552 19.980 8.630   1.00 24.25 ? 124 ILE B CB  1 
ATOM   1922 C  CG1 . ILE B 2 66  ? -60.596 21.419 8.125   1.00 27.28 ? 124 ILE B CG1 1 
ATOM   1923 C  CG2 . ILE B 2 66  ? -60.479 19.973 10.183  1.00 26.35 ? 124 ILE B CG2 1 
ATOM   1924 C  CD1 . ILE B 2 66  ? -61.829 22.185 8.672   1.00 29.25 ? 124 ILE B CD1 1 
ATOM   1925 N  N   A GLN B 2 67  ? -59.825 16.918 8.510   0.50 22.00 ? 125 GLN B N   1 
ATOM   1926 N  N   B GLN B 2 67  ? -59.857 16.944 8.417   0.50 23.14 ? 125 GLN B N   1 
ATOM   1927 C  CA  A GLN B 2 67  ? -59.585 15.657 9.225   0.50 21.21 ? 125 GLN B CA  1 
ATOM   1928 C  CA  B GLN B 2 67  ? -59.827 15.553 8.951   0.50 24.51 ? 125 GLN B CA  1 
ATOM   1929 C  C   A GLN B 2 67  ? -58.202 15.102 8.852   0.50 22.82 ? 125 GLN B C   1 
ATOM   1930 C  C   B GLN B 2 67  ? -58.463 14.875 8.722   0.50 24.88 ? 125 GLN B C   1 
ATOM   1931 O  O   A GLN B 2 67  ? -57.430 14.662 9.724   0.50 17.98 ? 125 GLN B O   1 
ATOM   1932 O  O   B GLN B 2 67  ? -57.981 14.117 9.575   0.50 24.83 ? 125 GLN B O   1 
ATOM   1933 C  CB  A GLN B 2 67  ? -60.711 14.660 8.964   0.50 22.12 ? 125 GLN B CB  1 
ATOM   1934 C  CB  B GLN B 2 67  ? -60.956 14.699 8.310   0.50 24.50 ? 125 GLN B CB  1 
ATOM   1935 C  CG  A GLN B 2 67  ? -62.066 15.173 9.522   0.50 20.68 ? 125 GLN B CG  1 
ATOM   1936 C  CG  B GLN B 2 67  ? -62.402 15.119 8.729   0.50 23.23 ? 125 GLN B CG  1 
ATOM   1937 C  CD  A GLN B 2 67  ? -62.044 15.416 11.045  0.50 23.07 ? 125 GLN B CD  1 
ATOM   1938 C  CD  B GLN B 2 67  ? -63.575 14.503 7.901   0.50 28.32 ? 125 GLN B CD  1 
ATOM   1939 O  OE1 A GLN B 2 67  ? -61.263 14.809 11.782  0.50 24.66 ? 125 GLN B OE1 1 
ATOM   1940 O  OE1 B GLN B 2 67  ? -63.393 13.815 6.873   0.50 23.53 ? 125 GLN B OE1 1 
ATOM   1941 N  NE2 A GLN B 2 67  ? -62.923 16.306 11.516  0.50 26.84 ? 125 GLN B NE2 1 
ATOM   1942 N  NE2 B GLN B 2 67  ? -64.804 14.781 8.362   0.50 28.76 ? 125 GLN B NE2 1 
ATOM   1943 N  N   . LEU B 2 68  ? -57.851 15.159 7.569   1.00 23.55 ? 126 LEU B N   1 
ATOM   1944 C  CA  . LEU B 2 68  ? -56.526 14.645 7.220   1.00 23.43 ? 126 LEU B CA  1 
ATOM   1945 C  C   . LEU B 2 68  ? -55.415 15.485 7.896   1.00 24.98 ? 126 LEU B C   1 
ATOM   1946 O  O   . LEU B 2 68  ? -54.431 14.937 8.379   1.00 27.26 ? 126 LEU B O   1 
ATOM   1947 C  CB  . LEU B 2 68  ? -56.304 14.583 5.713   1.00 22.82 ? 126 LEU B CB  1 
ATOM   1948 C  CG  . LEU B 2 68  ? -57.214 13.561 5.021   1.00 21.12 ? 126 LEU B CG  1 
ATOM   1949 C  CD1 . LEU B 2 68  ? -57.041 13.793 3.506   1.00 19.96 ? 126 LEU B CD1 1 
ATOM   1950 C  CD2 . LEU B 2 68  ? -56.794 12.106 5.423   1.00 25.56 ? 126 LEU B CD2 1 
ATOM   1951 N  N   . ALA B 2 69  ? -55.600 16.795 7.979   1.00 23.33 ? 127 ALA B N   1 
ATOM   1952 C  CA  . ALA B 2 69  ? -54.609 17.632 8.688   1.00 25.27 ? 127 ALA B CA  1 
ATOM   1953 C  C   . ALA B 2 69  ? -54.502 17.200 10.159  1.00 25.28 ? 127 ALA B C   1 
ATOM   1954 O  O   . ALA B 2 69  ? -53.409 17.183 10.734  1.00 26.16 ? 127 ALA B O   1 
ATOM   1955 C  CB  . ALA B 2 69  ? -54.989 19.131 8.588   1.00 25.53 ? 127 ALA B CB  1 
ATOM   1956 N  N   . ARG B 2 70  ? -55.604 16.795 10.765  1.00 24.55 ? 128 ARG B N   1 
ATOM   1957 C  CA  . ARG B 2 70  ? -55.546 16.287 12.150  1.00 28.40 ? 128 ARG B CA  1 
ATOM   1958 C  C   . ARG B 2 70  ? -54.787 14.966 12.250  1.00 33.19 ? 128 ARG B C   1 
ATOM   1959 O  O   . ARG B 2 70  ? -54.182 14.659 13.277  1.00 37.34 ? 128 ARG B O   1 
ATOM   1960 C  CB  . ARG B 2 70  ? -56.913 16.092 12.696  1.00 28.42 ? 128 ARG B CB  1 
ATOM   1961 C  CG  . ARG B 2 70  ? -57.666 17.386 12.891  1.00 28.33 ? 128 ARG B CG  1 
ATOM   1962 C  CD  . ARG B 2 70  ? -59.024 16.980 13.326  1.00 33.68 ? 128 ARG B CD  1 
ATOM   1963 N  NE  . ARG B 2 70  ? -58.979 16.626 14.734  1.00 33.85 ? 128 ARG B NE  1 
ATOM   1964 C  CZ  . ARG B 2 70  ? -59.966 16.001 15.379  1.00 40.19 ? 128 ARG B CZ  1 
ATOM   1965 N  NH1 . ARG B 2 70  ? -61.080 15.628 14.740  1.00 38.31 ? 128 ARG B NH1 1 
ATOM   1966 N  NH2 . ARG B 2 70  ? -59.838 15.754 16.678  1.00 42.97 ? 128 ARG B NH2 1 
ATOM   1967 N  N   . ARG B 2 71  ? -54.843 14.162 11.194  1.00 28.74 ? 129 ARG B N   1 
ATOM   1968 C  CA  . ARG B 2 71  ? -53.917 13.000 11.119  1.00 30.50 ? 129 ARG B CA  1 
ATOM   1969 C  C   . ARG B 2 71  ? -52.446 13.442 10.759  1.00 28.30 ? 129 ARG B C   1 
ATOM   1970 O  O   . ARG B 2 71  ? -51.470 12.927 11.324  1.00 35.64 ? 129 ARG B O   1 
ATOM   1971 C  CB  . ARG B 2 71  ? -54.432 11.987 10.065  1.00 26.90 ? 129 ARG B CB  1 
ATOM   1972 C  CG  . ARG B 2 71  ? -55.890 11.473 10.164  1.00 25.94 ? 129 ARG B CG  1 
ATOM   1973 C  CD  . ARG B 2 71  ? -56.316 10.840 11.501  1.00 33.43 ? 129 ARG B CD  1 
ATOM   1974 N  NE  . ARG B 2 71  ? -55.424 9.734  11.905  1.00 30.63 ? 129 ARG B NE  1 
ATOM   1975 C  CZ  . ARG B 2 71  ? -55.526 8.467  11.489  1.00 31.63 ? 129 ARG B CZ  1 
ATOM   1976 N  NH1 . ARG B 2 71  ? -56.483 8.067  10.664  1.00 28.17 ? 129 ARG B NH1 1 
ATOM   1977 N  NH2 . ARG B 2 71  ? -54.638 7.571  11.935  1.00 31.90 ? 129 ARG B NH2 1 
ATOM   1978 N  N   . ILE B 2 72  ? -52.238 14.351 9.824   1.00 34.56 ? 130 ILE B N   1 
ATOM   1979 C  CA  . ILE B 2 72  ? -50.842 14.665 9.395   1.00 32.58 ? 130 ILE B CA  1 
ATOM   1980 C  C   . ILE B 2 72  ? -50.002 15.347 10.478  1.00 35.03 ? 130 ILE B C   1 
ATOM   1981 O  O   . ILE B 2 72  ? -48.765 15.238 10.484  1.00 35.67 ? 130 ILE B O   1 
ATOM   1982 C  CB  . ILE B 2 72  ? -50.748 15.461 8.062   1.00 35.19 ? 130 ILE B CB  1 
ATOM   1983 C  CG1 . ILE B 2 72  ? -49.448 15.090 7.343   1.00 34.36 ? 130 ILE B CG1 1 
ATOM   1984 C  CG2 . ILE B 2 72  ? -50.748 16.967 8.361   1.00 32.65 ? 130 ILE B CG2 1 
ATOM   1985 C  CD1 . ILE B 2 72  ? -49.134 15.933 6.089   1.00 35.69 ? 130 ILE B CD1 1 
ATOM   1986 N  N   . ARG B 2 73  ? -50.670 16.025 11.441  0.50 33.02 ? 131 ARG B N   1 
ATOM   1987 C  CA  . ARG B 2 73  ? -50.023 16.732 12.547  0.50 35.56 ? 131 ARG B CA  1 
ATOM   1988 C  C   . ARG B 2 73  ? -49.864 15.878 13.791  0.50 40.42 ? 131 ARG B C   1 
ATOM   1989 O  O   . ARG B 2 73  ? -49.245 16.295 14.768  0.50 40.85 ? 131 ARG B O   1 
ATOM   1990 C  CB  . ARG B 2 73  ? -50.846 17.950 12.947  0.50 30.76 ? 131 ARG B CB  1 
ATOM   1991 C  CG  . ARG B 2 73  ? -51.074 18.899 11.809  0.50 33.26 ? 131 ARG B CG  1 
ATOM   1992 C  CD  . ARG B 2 73  ? -51.963 20.054 12.236  0.50 31.55 ? 131 ARG B CD  1 
ATOM   1993 N  NE  . ARG B 2 73  ? -51.415 20.698 13.426  0.50 29.66 ? 131 ARG B NE  1 
ATOM   1994 C  CZ  . ARG B 2 73  ? -50.418 21.574 13.430  0.50 17.57 ? 131 ARG B CZ  1 
ATOM   1995 N  NH1 . ARG B 2 73  ? -49.799 21.916 12.323  0.50 26.60 ? 131 ARG B NH1 1 
ATOM   1996 N  NH2 . ARG B 2 73  ? -50.000 22.060 14.601  0.50 29.32 ? 131 ARG B NH2 1 
ATOM   1997 N  N   . GLY B 2 74  ? -50.413 14.667 13.793  1.00 48.19 ? 132 GLY B N   1 
ATOM   1998 C  CA  . GLY B 2 74  ? -50.223 13.891 15.050  1.00 54.44 ? 132 GLY B CA  1 
ATOM   1999 C  C   . GLY B 2 74  ? -51.428 13.146 15.618  1.00 56.78 ? 132 GLY B C   1 
ATOM   2000 O  O   . GLY B 2 74  ? -51.265 12.082 16.205  1.00 55.25 ? 132 GLY B O   1 
ATOM   2001 N  N   . GLU B 2 75  ? -52.635 13.679 15.461  1.00 60.00 ? 133 GLU B N   1 
ATOM   2002 C  CA  . GLU B 2 75  ? -53.845 12.968 15.916  1.00 64.97 ? 133 GLU B CA  1 
ATOM   2003 C  C   . GLU B 2 75  ? -53.771 12.529 17.378  1.00 67.05 ? 133 GLU B C   1 
ATOM   2004 O  O   . GLU B 2 75  ? -53.100 13.164 18.190  1.00 69.89 ? 133 GLU B O   1 
ATOM   2005 C  CB  . GLU B 2 75  ? -54.082 11.737 15.027  1.00 65.33 ? 133 GLU B CB  1 
ATOM   2006 C  CG  . GLU B 2 75  ? -55.540 11.374 14.769  1.00 70.50 ? 133 GLU B CG  1 
ATOM   2007 C  CD  . GLU B 2 75  ? -56.230 10.723 15.954  1.00 74.42 ? 133 GLU B CD  1 
ATOM   2008 O  OE1 . GLU B 2 75  ? -55.684 9.734  16.498  1.00 76.58 ? 133 GLU B OE1 1 
ATOM   2009 O  OE2 . GLU B 2 75  ? -57.329 11.192 16.331  1.00 75.73 ? 133 GLU B OE2 1 
ATOM   2010 N  N   . ARG B 2 76  ? -54.468 11.438 17.699  1.00 68.71 ? 134 ARG B N   1 
ATOM   2011 C  CA  . ARG B 2 76  ? -54.535 10.878 19.060  1.00 69.89 ? 134 ARG B CA  1 
ATOM   2012 C  C   . ARG B 2 76  ? -55.960 10.906 19.624  1.00 70.49 ? 134 ARG B C   1 
ATOM   2013 O  O   . ARG B 2 76  ? -56.908 10.477 18.964  1.00 71.70 ? 134 ARG B O   1 
ATOM   2014 C  CB  . ARG B 2 76  ? -53.606 11.633 20.001  1.00 69.44 ? 134 ARG B CB  1 
ATOM   2015 N  N   . LYS C 3 2   ? -78.379 18.610 19.437  1.00 55.65 ? 20  LYS C N   1 
ATOM   2016 C  CA  . LYS C 3 2   ? -79.834 18.345 19.602  1.00 55.41 ? 20  LYS C CA  1 
ATOM   2017 C  C   . LYS C 3 2   ? -80.497 19.476 20.396  1.00 52.57 ? 20  LYS C C   1 
ATOM   2018 O  O   . LYS C 3 2   ? -81.479 20.056 19.926  1.00 52.78 ? 20  LYS C O   1 
ATOM   2019 C  CB  . LYS C 3 2   ? -80.091 16.973 20.255  1.00 57.69 ? 20  LYS C CB  1 
ATOM   2020 C  CG  . LYS C 3 2   ? -81.535 16.508 20.170  1.00 58.45 ? 20  LYS C CG  1 
ATOM   2021 C  CD  . LYS C 3 2   ? -82.013 16.487 18.719  1.00 62.87 ? 20  LYS C CD  1 
ATOM   2022 C  CE  . LYS C 3 2   ? -83.543 16.515 18.633  1.00 65.23 ? 20  LYS C CE  1 
ATOM   2023 N  NZ  . LYS C 3 2   ? -84.027 17.096 17.343  1.00 63.75 ? 20  LYS C NZ  1 
ATOM   2024 N  N   . VAL C 3 3   ? -79.963 19.785 21.580  1.00 48.28 ? 21  VAL C N   1 
ATOM   2025 C  CA  . VAL C 3 3   ? -80.460 20.910 22.379  1.00 45.43 ? 21  VAL C CA  1 
ATOM   2026 C  C   . VAL C 3 3   ? -79.492 22.106 22.470  1.00 43.10 ? 21  VAL C C   1 
ATOM   2027 O  O   . VAL C 3 3   ? -78.319 22.022 22.076  1.00 41.43 ? 21  VAL C O   1 
ATOM   2028 C  CB  . VAL C 3 3   ? -80.875 20.502 23.804  1.00 45.48 ? 21  VAL C CB  1 
ATOM   2029 C  CG1 . VAL C 3 3   ? -81.972 19.427 23.765  1.00 48.17 ? 21  VAL C CG1 1 
ATOM   2030 C  CG2 . VAL C 3 3   ? -79.669 20.050 24.617  1.00 45.64 ? 21  VAL C CG2 1 
ATOM   2031 N  N   . LEU C 3 4   ? -79.983 23.209 23.033  1.00 39.99 ? 22  LEU C N   1 
ATOM   2032 C  CA  . LEU C 3 4   ? -79.211 24.453 23.048  1.00 38.41 ? 22  LEU C CA  1 
ATOM   2033 C  C   . LEU C 3 4   ? -77.794 24.273 23.569  1.00 38.56 ? 22  LEU C C   1 
ATOM   2034 O  O   . LEU C 3 4   ? -76.845 24.759 22.973  1.00 35.36 ? 22  LEU C O   1 
ATOM   2035 C  CB  . LEU C 3 4   ? -79.933 25.543 23.845  1.00 36.00 ? 22  LEU C CB  1 
ATOM   2036 C  CG  . LEU C 3 4   ? -79.196 26.884 23.844  1.00 36.80 ? 22  LEU C CG  1 
ATOM   2037 C  CD1 . LEU C 3 4   ? -80.152 28.064 23.893  1.00 37.20 ? 22  LEU C CD1 1 
ATOM   2038 C  CD2 . LEU C 3 4   ? -78.121 26.966 24.986  1.00 37.92 ? 22  LEU C CD2 1 
ATOM   2039 N  N   . ARG C 3 5   ? -77.652 23.575 24.687  1.00 37.70 ? 23  ARG C N   1 
ATOM   2040 C  CA  . ARG C 3 5   ? -76.342 23.434 25.297  1.00 41.64 ? 23  ARG C CA  1 
ATOM   2041 C  C   . ARG C 3 5   ? -75.347 22.768 24.354  1.00 38.63 ? 23  ARG C C   1 
ATOM   2042 O  O   . ARG C 3 5   ? -74.180 23.166 24.314  1.00 39.75 ? 23  ARG C O   1 
ATOM   2043 C  CB  . ARG C 3 5   ? -76.433 22.674 26.627  1.00 41.70 ? 23  ARG C CB  1 
ATOM   2044 C  CG  . ARG C 3 5   ? -75.186 22.841 27.474  1.00 46.27 ? 23  ARG C CG  1 
ATOM   2045 C  CD  . ARG C 3 5   ? -75.219 22.041 28.790  1.00 44.24 ? 23  ARG C CD  1 
ATOM   2046 N  NE  . ARG C 3 5   ? -73.959 22.252 29.504  1.00 49.11 ? 23  ARG C NE  1 
ATOM   2047 C  CZ  . ARG C 3 5   ? -72.926 21.416 29.468  1.00 47.40 ? 23  ARG C CZ  1 
ATOM   2048 N  NH1 . ARG C 3 5   ? -72.999 20.291 28.771  1.00 50.32 ? 23  ARG C NH1 1 
ATOM   2049 N  NH2 . ARG C 3 5   ? -71.819 21.705 30.140  1.00 49.51 ? 23  ARG C NH2 1 
ATOM   2050 N  N   . ASP C 3 6   ? -75.813 21.778 23.592  1.00 36.81 ? 24  ASP C N   1 
ATOM   2051 C  CA  . ASP C 3 6   ? -74.973 21.038 22.643  1.00 36.61 ? 24  ASP C CA  1 
ATOM   2052 C  C   . ASP C 3 6   ? -74.434 21.962 21.573  1.00 36.83 ? 24  ASP C C   1 
ATOM   2053 O  O   . ASP C 3 6   ? -73.401 21.683 20.946  1.00 35.94 ? 24  ASP C O   1 
ATOM   2054 C  CB  . ASP C 3 6   ? -75.798 19.983 21.897  1.00 39.88 ? 24  ASP C CB  1 
ATOM   2055 C  CG  . ASP C 3 6   ? -76.345 18.897 22.807  1.00 47.08 ? 24  ASP C CG  1 
ATOM   2056 O  OD1 . ASP C 3 6   ? -75.650 18.532 23.779  1.00 49.46 ? 24  ASP C OD1 1 
ATOM   2057 O  OD2 . ASP C 3 6   ? -77.467 18.413 22.530  1.00 48.77 ? 24  ASP C OD2 1 
ATOM   2058 N  N   . ASN C 3 7   ? -75.197 23.019 21.302  1.00 33.08 ? 25  ASN C N   1 
ATOM   2059 C  CA  . ASN C 3 7   ? -74.875 23.913 20.191  1.00 29.56 ? 25  ASN C CA  1 
ATOM   2060 C  C   . ASN C 3 7   ? -74.233 25.223 20.584  1.00 28.14 ? 25  ASN C C   1 
ATOM   2061 O  O   . ASN C 3 7   ? -74.118 26.118 19.753  1.00 26.16 ? 25  ASN C O   1 
ATOM   2062 C  CB  . ASN C 3 7   ? -76.129 24.183 19.353  1.00 31.90 ? 25  ASN C CB  1 
ATOM   2063 C  CG  . ASN C 3 7   ? -76.654 22.939 18.686  1.00 36.42 ? 25  ASN C CG  1 
ATOM   2064 O  OD1 . ASN C 3 7   ? -76.070 21.857 18.824  1.00 40.60 ? 25  ASN C OD1 1 
ATOM   2065 N  ND2 . ASN C 3 7   ? -77.755 23.077 17.943  1.00 34.94 ? 25  ASN C ND2 1 
ATOM   2066 N  N   . ILE C 3 8   ? -73.778 25.333 21.836  1.00 26.59 ? 26  ILE C N   1 
ATOM   2067 C  CA  . ILE C 3 8   ? -73.046 26.499 22.269  1.00 27.98 ? 26  ILE C CA  1 
ATOM   2068 C  C   . ILE C 3 8   ? -71.671 26.531 21.560  1.00 27.47 ? 26  ILE C C   1 
ATOM   2069 O  O   . ILE C 3 8   ? -70.987 25.506 21.522  1.00 26.93 ? 26  ILE C O   1 
ATOM   2070 C  CB  . ILE C 3 8   ? -72.849 26.463 23.804  1.00 28.04 ? 26  ILE C CB  1 
ATOM   2071 C  CG1 . ILE C 3 8   ? -74.213 26.652 24.484  1.00 33.16 ? 26  ILE C CG1 1 
ATOM   2072 C  CG2 . ILE C 3 8   ? -71.862 27.536 24.232  1.00 28.47 ? 26  ILE C CG2 1 
ATOM   2073 C  CD1 . ILE C 3 8   ? -74.168 26.589 26.012  1.00 34.69 ? 26  ILE C CD1 1 
ATOM   2074 N  N   . GLN C 3 9   ? -71.303 27.674 20.993  1.00 23.04 ? 27  GLN C N   1 
ATOM   2075 C  CA  . GLN C 3 9   ? -70.048 27.781 20.218  1.00 25.30 ? 27  GLN C CA  1 
ATOM   2076 C  C   . GLN C 3 9   ? -69.099 28.818 20.813  1.00 25.94 ? 27  GLN C C   1 
ATOM   2077 O  O   . GLN C 3 9   ? -69.533 29.763 21.479  1.00 25.29 ? 27  GLN C O   1 
ATOM   2078 C  CB  . GLN C 3 9   ? -70.391 28.182 18.764  1.00 25.91 ? 27  GLN C CB  1 
ATOM   2079 C  CG  . GLN C 3 9   ? -71.398 27.237 18.080  1.00 24.38 ? 27  GLN C CG  1 
ATOM   2080 C  CD  . GLN C 3 9   ? -70.904 25.777 17.954  1.00 28.92 ? 27  GLN C CD  1 
ATOM   2081 O  OE1 . GLN C 3 9   ? -69.693 25.489 18.091  1.00 27.94 ? 27  GLN C OE1 1 
ATOM   2082 N  NE2 . GLN C 3 9   ? -71.826 24.866 17.654  1.00 28.86 ? 27  GLN C NE2 1 
ATOM   2083 N  N   . GLY C 3 10  ? -67.791 28.678 20.549  1.00 22.09 ? 28  GLY C N   1 
ATOM   2084 C  CA  . GLY C 3 10  ? -66.826 29.600 21.064  1.00 24.17 ? 28  GLY C CA  1 
ATOM   2085 C  C   . GLY C 3 10  ? -66.130 30.434 19.998  1.00 21.78 ? 28  GLY C C   1 
ATOM   2086 O  O   . GLY C 3 10  ? -65.327 31.304 20.318  1.00 24.18 ? 28  GLY C O   1 
ATOM   2087 N  N   . ILE C 3 11  ? -66.409 30.140 18.708  1.00 23.68 ? 29  ILE C N   1 
ATOM   2088 C  CA  . ILE C 3 11  ? -65.788 30.933 17.626  1.00 22.27 ? 29  ILE C CA  1 
ATOM   2089 C  C   . ILE C 3 11  ? -66.885 31.218 16.609  1.00 22.50 ? 29  ILE C C   1 
ATOM   2090 O  O   . ILE C 3 11  ? -67.700 30.331 16.292  1.00 21.29 ? 29  ILE C O   1 
ATOM   2091 C  CB  . ILE C 3 11  ? -64.620 30.184 16.910  1.00 25.46 ? 29  ILE C CB  1 
ATOM   2092 C  CG1 . ILE C 3 11  ? -65.084 28.796 16.501  1.00 24.19 ? 29  ILE C CG1 1 
ATOM   2093 C  CG2 . ILE C 3 11  ? -63.435 30.017 17.860  1.00 32.05 ? 29  ILE C CG2 1 
ATOM   2094 C  CD1 . ILE C 3 11  ? -63.943 27.972 15.812  1.00 28.66 ? 29  ILE C CD1 1 
ATOM   2095 N  N   . THR C 3 12  ? -66.942 32.462 16.130  1.00 22.97 ? 30  THR C N   1 
ATOM   2096 C  CA  . THR C 3 12  ? -67.998 32.844 15.186  1.00 23.35 ? 30  THR C CA  1 
ATOM   2097 C  C   . THR C 3 12  ? -67.571 32.496 13.775  1.00 24.06 ? 30  THR C C   1 
ATOM   2098 O  O   . THR C 3 12  ? -66.416 32.169 13.552  1.00 23.18 ? 30  THR C O   1 
ATOM   2099 C  CB  . THR C 3 12  ? -68.172 34.363 15.174  1.00 24.84 ? 30  THR C CB  1 
ATOM   2100 O  OG1 . THR C 3 12  ? -66.928 34.984 14.780  1.00 25.43 ? 30  THR C OG1 1 
ATOM   2101 C  CG2 . THR C 3 12  ? -68.563 34.877 16.616  1.00 27.51 ? 30  THR C CG2 1 
ATOM   2102 N  N   . LYS C 3 13  ? -68.504 32.590 12.824  1.00 23.25 ? 31  LYS C N   1 
ATOM   2103 C  CA  . LYS C 3 13  ? -68.165 32.310 11.427  1.00 23.67 ? 31  LYS C CA  1 
ATOM   2104 C  C   . LYS C 3 13  ? -67.148 33.317 10.866  1.00 25.06 ? 31  LYS C C   1 
ATOM   2105 O  O   . LYS C 3 13  ? -66.152 32.908 10.208  1.00 23.21 ? 31  LYS C O   1 
ATOM   2106 C  CB  . LYS C 3 13  ? -69.432 32.167 10.580  1.00 24.41 ? 31  LYS C CB  1 
ATOM   2107 C  CG  . LYS C 3 13  ? -70.237 30.905 10.955  1.00 26.57 ? 31  LYS C CG  1 
ATOM   2108 C  CD  . LYS C 3 13  ? -71.406 30.671 9.957   1.00 30.33 ? 31  LYS C CD  1 
ATOM   2109 C  CE  . LYS C 3 13  ? -72.362 29.674 10.496  1.00 33.25 ? 31  LYS C CE  1 
ATOM   2110 N  NZ  . LYS C 3 13  ? -73.428 29.334 9.490   1.00 37.72 ? 31  LYS C NZ  1 
ATOM   2111 N  N   . PRO C 3 14  ? -67.326 34.638 11.125  1.00 24.83 ? 32  PRO C N   1 
ATOM   2112 C  CA  . PRO C 3 14  ? -66.242 35.527 10.695  1.00 24.44 ? 32  PRO C CA  1 
ATOM   2113 C  C   . PRO C 3 14  ? -64.907 35.186 11.300  1.00 23.85 ? 32  PRO C C   1 
ATOM   2114 O  O   . PRO C 3 14  ? -63.880 35.352 10.647  1.00 23.04 ? 32  PRO C O   1 
ATOM   2115 C  CB  . PRO C 3 14  ? -66.709 36.928 11.179  1.00 27.62 ? 32  PRO C CB  1 
ATOM   2116 C  CG  . PRO C 3 14  ? -68.199 36.833 11.132  1.00 26.74 ? 32  PRO C CG  1 
ATOM   2117 C  CD  . PRO C 3 14  ? -68.473 35.407 11.671  1.00 27.59 ? 32  PRO C CD  1 
ATOM   2118 N  N   . ALA C 3 15  ? -64.894 34.758 12.562  1.00 22.75 ? 33  ALA C N   1 
ATOM   2119 C  CA  . ALA C 3 15  ? -63.610 34.399 13.187  1.00 23.43 ? 33  ALA C CA  1 
ATOM   2120 C  C   . ALA C 3 15  ? -62.963 33.194 12.460  1.00 22.68 ? 33  ALA C C   1 
ATOM   2121 O  O   . ALA C 3 15  ? -61.751 33.180 12.225  1.00 20.13 ? 33  ALA C O   1 
ATOM   2122 C  CB  . ALA C 3 15  ? -63.814 34.066 14.674  1.00 25.70 ? 33  ALA C CB  1 
ATOM   2123 N  N   . ILE C 3 16  ? -63.795 32.239 12.098  1.00 21.77 ? 34  ILE C N   1 
ATOM   2124 C  CA  . ILE C 3 16  ? -63.323 31.039 11.360  1.00 22.31 ? 34  ILE C CA  1 
ATOM   2125 C  C   . ILE C 3 16  ? -62.702 31.523 10.042  1.00 22.67 ? 34  ILE C C   1 
ATOM   2126 O  O   . ILE C 3 16  ? -61.610 31.107 9.674   1.00 21.97 ? 34  ILE C O   1 
ATOM   2127 C  CB  . ILE C 3 16  ? -64.450 30.013 11.173  1.00 22.25 ? 34  ILE C CB  1 
ATOM   2128 C  CG1 . ILE C 3 16  ? -64.805 29.373 12.541  1.00 22.52 ? 34  ILE C CG1 1 
ATOM   2129 C  CG2 . ILE C 3 16  ? -64.063 28.954 10.068  1.00 22.36 ? 34  ILE C CG2 1 
ATOM   2130 C  CD1 . ILE C 3 16  ? -66.058 28.476 12.500  1.00 24.38 ? 34  ILE C CD1 1 
ATOM   2131 N  N   . ARG C 3 17  ? -63.374 32.433 9.336   1.00 21.53 ? 35  ARG C N   1 
ATOM   2132 C  CA  . ARG C 3 17  ? -62.771 32.953 8.120   1.00 22.04 ? 35  ARG C CA  1 
ATOM   2133 C  C   . ARG C 3 17  ? -61.429 33.692 8.342   1.00 22.94 ? 35  ARG C C   1 
ATOM   2134 O  O   . ARG C 3 17  ? -60.494 33.532 7.538   1.00 24.28 ? 35  ARG C O   1 
ATOM   2135 C  CB  . ARG C 3 17  ? -63.822 33.855 7.423   1.00 21.72 ? 35  ARG C CB  1 
ATOM   2136 C  CG  . ARG C 3 17  ? -64.972 33.059 6.819   1.00 23.25 ? 35  ARG C CG  1 
ATOM   2137 C  CD  . ARG C 3 17  ? -65.816 33.895 5.845   1.00 25.25 ? 35  ARG C CD  1 
ATOM   2138 N  NE  . ARG C 3 17  ? -66.402 35.074 6.498   1.00 27.55 ? 35  ARG C NE  1 
ATOM   2139 C  CZ  . ARG C 3 17  ? -67.579 35.070 7.123   1.00 24.24 ? 35  ARG C CZ  1 
ATOM   2140 N  NH1 . ARG C 3 17  ? -68.300 33.962 7.207   1.00 26.53 ? 35  ARG C NH1 1 
ATOM   2141 N  NH2 . ARG C 3 17  ? -68.035 36.234 7.639   1.00 27.36 ? 35  ARG C NH2 1 
ATOM   2142 N  N   . ARG C 3 18  ? -61.294 34.483 9.430   1.00 20.72 ? 36  ARG C N   1 
ATOM   2143 C  CA  . ARG C 3 18  ? -60.065 35.176 9.733   1.00 22.74 ? 36  ARG C CA  1 
ATOM   2144 C  C   . ARG C 3 18  ? -58.947 34.171 10.005  1.00 20.76 ? 36  ARG C C   1 
ATOM   2145 O  O   . ARG C 3 18  ? -57.848 34.330 9.542   1.00 21.93 ? 36  ARG C O   1 
ATOM   2146 C  CB  . ARG C 3 18  ? -60.236 36.103 10.972  1.00 23.51 ? 36  ARG C CB  1 
ATOM   2147 C  CG  . ARG C 3 18  ? -61.208 37.258 10.689  1.00 30.61 ? 36  ARG C CG  1 
ATOM   2148 C  CD  . ARG C 3 18  ? -61.139 38.318 11.834  1.00 31.21 ? 36  ARG C CD  1 
ATOM   2149 N  NE  . ARG C 3 18  ? -61.635 37.845 13.129  1.00 36.94 ? 36  ARG C NE  1 
ATOM   2150 C  CZ  . ARG C 3 18  ? -62.905 37.952 13.526  1.00 36.69 ? 36  ARG C CZ  1 
ATOM   2151 N  NH1 . ARG C 3 18  ? -63.832 38.511 12.733  1.00 35.16 ? 36  ARG C NH1 1 
ATOM   2152 N  NH2 . ARG C 3 18  ? -63.244 37.520 14.724  1.00 35.71 ? 36  ARG C NH2 1 
ATOM   2153 N  N   . LEU C 3 19  ? -59.265 33.157 10.805  1.00 21.06 ? 37  LEU C N   1 
ATOM   2154 C  CA  . LEU C 3 19  ? -58.270 32.146 11.142  1.00 20.02 ? 37  LEU C CA  1 
ATOM   2155 C  C   . LEU C 3 19  ? -57.849 31.392 9.878   1.00 19.82 ? 37  LEU C C   1 
ATOM   2156 O  O   . LEU C 3 19  ? -56.662 31.143 9.671   1.00 21.24 ? 37  LEU C O   1 
ATOM   2157 C  CB  . LEU C 3 19  ? -58.845 31.178 12.192  1.00 23.76 ? 37  LEU C CB  1 
ATOM   2158 C  CG  . LEU C 3 19  ? -59.049 31.737 13.609  1.00 25.09 ? 37  LEU C CG  1 
ATOM   2159 C  CD1 . LEU C 3 19  ? -60.018 30.797 14.307  1.00 27.61 ? 37  LEU C CD1 1 
ATOM   2160 C  CD2 . LEU C 3 19  ? -57.740 31.703 14.361  1.00 27.67 ? 37  LEU C CD2 1 
ATOM   2161 N  N   . ALA C 3 20  ? -58.813 31.070 9.029   1.00 21.10 ? 38  ALA C N   1 
ATOM   2162 C  CA  . ALA C 3 20  ? -58.499 30.395 7.777   1.00 21.00 ? 38  ALA C CA  1 
ATOM   2163 C  C   . ALA C 3 20  ? -57.567 31.253 6.898   1.00 20.96 ? 38  ALA C C   1 
ATOM   2164 O  O   . ALA C 3 20  ? -56.574 30.742 6.360   1.00 20.50 ? 38  ALA C O   1 
ATOM   2165 C  CB  . ALA C 3 20  ? -59.768 30.037 7.038   1.00 20.54 ? 38  ALA C CB  1 
ATOM   2166 N  N   . ARG C 3 21  ? -57.872 32.546 6.742   1.00 21.70 ? 39  ARG C N   1 
ATOM   2167 C  CA  . ARG C 3 21  ? -57.012 33.450 5.943   1.00 23.53 ? 39  ARG C CA  1 
ATOM   2168 C  C   . ARG C 3 21  ? -55.638 33.518 6.533   1.00 21.93 ? 39  ARG C C   1 
ATOM   2169 O  O   . ARG C 3 21  ? -54.631 33.461 5.813   1.00 22.51 ? 39  ARG C O   1 
ATOM   2170 C  CB  . ARG C 3 21  ? -57.644 34.859 5.823   1.00 24.09 ? 39  ARG C CB  1 
ATOM   2171 C  CG  . ARG C 3 21  ? -58.825 34.928 4.859   1.00 23.99 ? 39  ARG C CG  1 
ATOM   2172 C  CD  . ARG C 3 21  ? -59.156 36.403 4.451   1.00 26.71 ? 39  ARG C CD  1 
ATOM   2173 N  NE  . ARG C 3 21  ? -59.833 36.950 5.593   1.00 33.43 ? 39  ARG C NE  1 
ATOM   2174 C  CZ  . ARG C 3 21  ? -61.151 36.939 5.775   1.00 28.19 ? 39  ARG C CZ  1 
ATOM   2175 N  NH1 . ARG C 3 21  ? -62.016 36.573 4.825   1.00 29.80 ? 39  ARG C NH1 1 
ATOM   2176 N  NH2 . ARG C 3 21  ? -61.590 37.412 6.914   1.00 33.46 ? 39  ARG C NH2 1 
ATOM   2177 N  N   . ARG C 3 22  ? -55.568 33.635 7.870   1.00 22.08 ? 40  ARG C N   1 
ATOM   2178 C  CA  . ARG C 3 22  ? -54.281 33.653 8.550   1.00 23.16 ? 40  ARG C CA  1 
ATOM   2179 C  C   . ARG C 3 22  ? -53.469 32.388 8.267   1.00 22.70 ? 40  ARG C C   1 
ATOM   2180 O  O   . ARG C 3 22  ? -52.249 32.432 8.203   1.00 25.01 ? 40  ARG C O   1 
ATOM   2181 C  CB  . ARG C 3 22  ? -54.507 33.867 10.071  1.00 26.20 ? 40  ARG C CB  1 
ATOM   2182 C  CG  . ARG C 3 22  ? -53.230 33.977 10.910  1.00 33.26 ? 40  ARG C CG  1 
ATOM   2183 C  CD  . ARG C 3 22  ? -52.501 35.301 10.690  1.00 39.42 ? 40  ARG C CD  1 
ATOM   2184 N  NE  . ARG C 3 22  ? -53.321 36.437 11.149  1.00 46.43 ? 40  ARG C NE  1 
ATOM   2185 C  CZ  . ARG C 3 22  ? -53.331 36.927 12.394  1.00 51.33 ? 40  ARG C CZ  1 
ATOM   2186 N  NH1 . ARG C 3 22  ? -52.562 36.400 13.347  1.00 51.06 ? 40  ARG C NH1 1 
ATOM   2187 N  NH2 . ARG C 3 22  ? -54.120 37.957 12.690  1.00 50.94 ? 40  ARG C NH2 1 
ATOM   2188 N  N   . GLY C 3 23  ? -54.141 31.253 8.093   1.00 21.23 ? 41  GLY C N   1 
ATOM   2189 C  CA  . GLY C 3 23  ? -53.453 29.999 7.763   1.00 21.95 ? 41  GLY C CA  1 
ATOM   2190 C  C   . GLY C 3 23  ? -53.202 29.803 6.275   1.00 23.45 ? 41  GLY C C   1 
ATOM   2191 O  O   . GLY C 3 23  ? -52.748 28.701 5.855   1.00 24.85 ? 41  GLY C O   1 
ATOM   2192 N  N   . GLY C 3 24  ? -53.518 30.810 5.486   1.00 22.09 ? 42  GLY C N   1 
ATOM   2193 C  CA  . GLY C 3 24  ? -53.219 30.726 4.033   1.00 25.36 ? 42  GLY C CA  1 
ATOM   2194 C  C   . GLY C 3 24  ? -54.346 30.195 3.154   1.00 23.15 ? 42  GLY C C   1 
ATOM   2195 O  O   . GLY C 3 24  ? -54.168 30.072 1.949   1.00 23.38 ? 42  GLY C O   1 
ATOM   2196 N  N   . VAL C 3 25  ? -55.512 29.867 3.745   1.00 22.14 ? 43  VAL C N   1 
ATOM   2197 C  CA  . VAL C 3 25  ? -56.637 29.356 2.973   1.00 20.17 ? 43  VAL C CA  1 
ATOM   2198 C  C   . VAL C 3 25  ? -57.198 30.461 2.097   1.00 21.25 ? 43  VAL C C   1 
ATOM   2199 O  O   . VAL C 3 25  ? -57.224 31.607 2.544   1.00 22.28 ? 43  VAL C O   1 
ATOM   2200 C  CB  . VAL C 3 25  ? -57.713 28.815 3.930   1.00 19.80 ? 43  VAL C CB  1 
ATOM   2201 C  CG1 . VAL C 3 25  ? -58.943 28.344 3.175   1.00 22.13 ? 43  VAL C CG1 1 
ATOM   2202 C  CG2 . VAL C 3 25  ? -57.093 27.651 4.772   1.00 23.06 ? 43  VAL C CG2 1 
ATOM   2203 N  N   . LYS C 3 26  ? -57.609 30.107 0.879   1.00 20.48 ? 44  LYS C N   1 
ATOM   2204 C  CA  . LYS C 3 26  ? -58.231 31.057 -0.047  1.00 22.25 ? 44  LYS C CA  1 
ATOM   2205 C  C   . LYS C 3 26  ? -59.737 30.876 -0.279  1.00 24.04 ? 44  LYS C C   1 
ATOM   2206 O  O   . LYS C 3 26  ? -60.448 31.861 -0.544  1.00 24.09 ? 44  LYS C O   1 
ATOM   2207 C  CB  . LYS C 3 26  ? -57.524 30.975 -1.408  1.00 26.72 ? 44  LYS C CB  1 
ATOM   2208 C  CG  . LYS C 3 26  ? -56.314 31.944 -1.565  1.00 36.22 ? 44  LYS C CG  1 
ATOM   2209 C  CD  . LYS C 3 26  ? -55.393 31.944 -0.454  1.00 31.45 ? 44  LYS C CD  1 
ATOM   2210 C  CE  . LYS C 3 26  ? -53.928 32.229 -0.843  1.00 25.81 ? 44  LYS C CE  1 
ATOM   2211 N  NZ  . LYS C 3 26  ? -53.017 31.189 -0.256  1.00 24.78 ? 44  LYS C NZ  1 
ATOM   2212 N  N   . ARG C 3 27  ? -60.214 29.628 -0.251  1.00 21.53 ? 45  ARG C N   1 
ATOM   2213 C  CA  . ARG C 3 27  ? -61.623 29.312 -0.499  1.00 21.64 ? 45  ARG C CA  1 
ATOM   2214 C  C   . ARG C 3 27  ? -62.018 28.175 0.399   1.00 25.03 ? 45  ARG C C   1 
ATOM   2215 O  O   . ARG C 3 27  ? -61.188 27.313 0.695   1.00 22.42 ? 45  ARG C O   1 
ATOM   2216 C  CB  . ARG C 3 27  ? -61.796 28.869 -1.944  1.00 23.28 ? 45  ARG C CB  1 
ATOM   2217 C  CG  . ARG C 3 27  ? -61.586 30.058 -2.918  1.00 26.94 ? 45  ARG C CG  1 
ATOM   2218 C  CD  . ARG C 3 27  ? -61.591 29.708 -4.416  1.00 30.62 ? 45  ARG C CD  1 
ATOM   2219 N  NE  . ARG C 3 27  ? -62.696 28.876 -4.872  1.00 34.37 ? 45  ARG C NE  1 
ATOM   2220 C  CZ  . ARG C 3 27  ? -62.929 28.641 -6.171  1.00 34.44 ? 45  ARG C CZ  1 
ATOM   2221 N  NH1 . ARG C 3 27  ? -62.182 29.229 -7.091  1.00 32.64 ? 45  ARG C NH1 1 
ATOM   2222 N  NH2 . ARG C 3 27  ? -63.906 27.833 -6.546  1.00 38.49 ? 45  ARG C NH2 1 
ATOM   2223 N  N   . ILE C 3 28  ? -63.275 28.186 0.833   1.00 23.12 ? 46  ILE C N   1 
ATOM   2224 C  CA  . ILE C 3 28  ? -63.779 27.185 1.768   1.00 22.68 ? 46  ILE C CA  1 
ATOM   2225 C  C   . ILE C 3 28  ? -65.117 26.594 1.374   1.00 24.91 ? 46  ILE C C   1 
ATOM   2226 O  O   . ILE C 3 28  ? -65.987 27.290 0.816   1.00 27.85 ? 46  ILE C O   1 
ATOM   2227 C  CB  . ILE C 3 28  ? -63.923 27.741 3.220   1.00 21.90 ? 46  ILE C CB  1 
ATOM   2228 C  CG1 . ILE C 3 28  ? -64.918 28.924 3.281   1.00 26.03 ? 46  ILE C CG1 1 
ATOM   2229 C  CG2 . ILE C 3 28  ? -62.551 28.121 3.819   1.00 23.05 ? 46  ILE C CG2 1 
ATOM   2230 C  CD1 . ILE C 3 28  ? -65.302 29.318 4.741   1.00 28.09 ? 46  ILE C CD1 1 
ATOM   2231 N  N   . SER C 3 29  ? -65.275 25.300 1.653   1.00 24.84 ? 47  SER C N   1 
ATOM   2232 C  CA  . SER C 3 29  ? -66.587 24.683 1.646   1.00 27.14 ? 47  SER C CA  1 
ATOM   2233 C  C   . SER C 3 29  ? -67.413 25.301 2.783   1.00 28.89 ? 47  SER C C   1 
ATOM   2234 O  O   . SER C 3 29  ? -66.891 25.589 3.876   1.00 26.96 ? 47  SER C O   1 
ATOM   2235 C  CB  . SER C 3 29  ? -66.425 23.191 1.971   1.00 27.05 ? 47  SER C CB  1 
ATOM   2236 O  OG  . SER C 3 29  ? -67.696 22.648 2.266   1.00 28.93 ? 47  SER C OG  1 
ATOM   2237 N  N   . GLY C 3 30  ? -68.717 25.448 2.554   1.00 30.19 ? 48  GLY C N   1 
ATOM   2238 C  CA  . GLY C 3 30  ? -69.631 25.897 3.620   1.00 30.77 ? 48  GLY C CA  1 
ATOM   2239 C  C   . GLY C 3 30  ? -69.680 24.931 4.815   1.00 31.53 ? 48  GLY C C   1 
ATOM   2240 O  O   . GLY C 3 30  ? -70.034 25.332 5.930   1.00 31.00 ? 48  GLY C O   1 
ATOM   2241 N  N   . LEU C 3 31  ? -69.281 23.678 4.598   1.00 24.27 ? 49  LEU C N   1 
ATOM   2242 C  CA  . LEU C 3 31  ? -69.264 22.679 5.691   1.00 23.87 ? 49  LEU C CA  1 
ATOM   2243 C  C   . LEU C 3 31  ? -68.075 22.880 6.660   1.00 22.51 ? 49  LEU C C   1 
ATOM   2244 O  O   . LEU C 3 31  ? -67.981 22.221 7.712   1.00 24.39 ? 49  LEU C O   1 
ATOM   2245 C  CB  . LEU C 3 31  ? -69.146 21.307 5.054   1.00 26.27 ? 49  LEU C CB  1 
ATOM   2246 C  CG  . LEU C 3 31  ? -70.327 20.937 4.171   1.00 32.13 ? 49  LEU C CG  1 
ATOM   2247 C  CD1 . LEU C 3 31  ? -70.008 19.579 3.525   1.00 32.87 ? 49  LEU C CD1 1 
ATOM   2248 C  CD2 . LEU C 3 31  ? -71.570 20.854 5.076   1.00 34.89 ? 49  LEU C CD2 1 
ATOM   2249 N  N   . ILE C 3 32  ? -67.182 23.790 6.303   1.00 21.46 ? 50  ILE C N   1 
ATOM   2250 C  CA  . ILE C 3 32  ? -65.978 24.023 7.115   1.00 20.78 ? 50  ILE C CA  1 
ATOM   2251 C  C   . ILE C 3 32  ? -66.288 24.637 8.482   1.00 21.48 ? 50  ILE C C   1 
ATOM   2252 O  O   . ILE C 3 32  ? -65.592 24.363 9.471   1.00 22.12 ? 50  ILE C O   1 
ATOM   2253 C  CB  . ILE C 3 32  ? -64.990 24.951 6.326   1.00 23.38 ? 50  ILE C CB  1 
ATOM   2254 C  CG1 . ILE C 3 32  ? -64.368 24.142 5.195   1.00 25.20 ? 50  ILE C CG1 1 
ATOM   2255 C  CG2 . ILE C 3 32  ? -63.936 25.581 7.252   1.00 30.21 ? 50  ILE C CG2 1 
ATOM   2256 C  CD1 . ILE C 3 32  ? -63.511 22.937 5.675   1.00 27.05 ? 50  ILE C CD1 1 
ATOM   2257 N  N   . TYR C 3 33  ? -67.354 25.433 8.571   1.00 21.57 ? 51  TYR C N   1 
ATOM   2258 C  CA  . TYR C 3 33  ? -67.649 26.049 9.888   1.00 22.23 ? 51  TYR C CA  1 
ATOM   2259 C  C   . TYR C 3 33  ? -67.957 24.982 10.935  1.00 22.62 ? 51  TYR C C   1 
ATOM   2260 O  O   . TYR C 3 33  ? -67.344 24.995 12.033  1.00 21.94 ? 51  TYR C O   1 
ATOM   2261 C  CB  . TYR C 3 33  ? -68.840 27.006 9.765   1.00 24.05 ? 51  TYR C CB  1 
ATOM   2262 C  CG  . TYR C 3 33  ? -68.584 28.144 8.783   1.00 23.90 ? 51  TYR C CG  1 
ATOM   2263 C  CD1 . TYR C 3 33  ? -67.672 29.145 9.067   1.00 25.19 ? 51  TYR C CD1 1 
ATOM   2264 C  CD2 . TYR C 3 33  ? -69.283 28.208 7.583   1.00 29.52 ? 51  TYR C CD2 1 
ATOM   2265 C  CE1 . TYR C 3 33  ? -67.438 30.210 8.178   1.00 25.53 ? 51  TYR C CE1 1 
ATOM   2266 C  CE2 . TYR C 3 33  ? -69.068 29.252 6.688   1.00 31.46 ? 51  TYR C CE2 1 
ATOM   2267 C  CZ  . TYR C 3 33  ? -68.148 30.252 6.996   1.00 28.87 ? 51  TYR C CZ  1 
ATOM   2268 O  OH  . TYR C 3 33  ? -67.939 31.306 6.142   1.00 29.09 ? 51  TYR C OH  1 
ATOM   2269 N  N   . GLU C 3 34  ? -68.851 24.045 10.617  1.00 22.60 ? 52  GLU C N   1 
ATOM   2270 C  CA  . GLU C 3 34  ? -69.200 23.015 11.586  1.00 25.04 ? 52  GLU C CA  1 
ATOM   2271 C  C   . GLU C 3 34  ? -67.982 22.099 11.834  1.00 23.77 ? 52  GLU C C   1 
ATOM   2272 O  O   . GLU C 3 34  ? -67.732 21.685 12.969  1.00 24.10 ? 52  GLU C O   1 
ATOM   2273 C  CB  . GLU C 3 34  ? -70.383 22.161 11.167  1.00 29.95 ? 52  GLU C CB  1 
ATOM   2274 C  CG  . GLU C 3 34  ? -70.705 21.078 12.236  1.00 37.30 ? 52  GLU C CG  1 
ATOM   2275 C  CD  . GLU C 3 34  ? -70.785 21.622 13.709  1.00 47.09 ? 52  GLU C CD  1 
ATOM   2276 O  OE1 . GLU C 3 34  ? -71.715 22.428 14.011  1.00 45.94 ? 52  GLU C OE1 1 
ATOM   2277 O  OE2 . GLU C 3 34  ? -69.914 21.238 14.569  1.00 47.19 ? 52  GLU C OE2 1 
ATOM   2278 N  N   . GLU C 3 35  ? -67.223 21.812 10.770  1.00 22.32 ? 53  GLU C N   1 
ATOM   2279 C  CA  . GLU C 3 35  ? -66.050 20.942 10.960  1.00 23.38 ? 53  GLU C CA  1 
ATOM   2280 C  C   . GLU C 3 35  ? -65.043 21.570 11.937  1.00 23.79 ? 53  GLU C C   1 
ATOM   2281 O  O   . GLU C 3 35  ? -64.530 20.889 12.858  1.00 22.76 ? 53  GLU C O   1 
ATOM   2282 C  CB  . GLU C 3 35  ? -65.366 20.618 9.616   1.00 23.35 ? 53  GLU C CB  1 
ATOM   2283 C  CG  . GLU C 3 35  ? -64.513 19.339 9.688   1.00 27.04 ? 53  GLU C CG  1 
ATOM   2284 C  CD  . GLU C 3 35  ? -65.370 18.040 9.705   1.00 31.83 ? 53  GLU C CD  1 
ATOM   2285 O  OE1 . GLU C 3 35  ? -66.585 18.050 9.414   1.00 32.85 ? 53  GLU C OE1 1 
ATOM   2286 O  OE2 . GLU C 3 35  ? -64.824 16.998 10.026  1.00 36.85 ? 53  GLU C OE2 1 
ATOM   2287 N  N   . THR C 3 36  ? -64.743 22.843 11.718  1.00 21.89 ? 54  THR C N   1 
ATOM   2288 C  CA  . THR C 3 36  ? -63.782 23.558 12.535  1.00 21.76 ? 54  THR C CA  1 
ATOM   2289 C  C   . THR C 3 36  ? -64.251 23.614 13.992  1.00 22.20 ? 54  THR C C   1 
ATOM   2290 O  O   . THR C 3 36  ? -63.472 23.380 14.931  1.00 21.22 ? 54  THR C O   1 
ATOM   2291 C  CB  . THR C 3 36  ? -63.573 24.965 11.981  1.00 22.05 ? 54  THR C CB  1 
ATOM   2292 O  OG1 . THR C 3 36  ? -63.095 24.890 10.624  1.00 22.42 ? 54  THR C OG1 1 
ATOM   2293 C  CG2 . THR C 3 36  ? -62.560 25.710 12.835  1.00 23.13 ? 54  THR C CG2 1 
ATOM   2294 N  N   . ARG C 3 37  ? -65.529 23.929 14.184  1.00 21.40 ? 55  ARG C N   1 
ATOM   2295 C  CA  . ARG C 3 37  ? -66.110 23.921 15.551  1.00 21.78 ? 55  ARG C CA  1 
ATOM   2296 C  C   . ARG C 3 37  ? -65.958 22.575 16.254  1.00 22.16 ? 55  ARG C C   1 
ATOM   2297 O  O   . ARG C 3 37  ? -65.615 22.520 17.440  1.00 22.86 ? 55  ARG C O   1 
ATOM   2298 C  CB  . ARG C 3 37  ? -67.571 24.369 15.468  1.00 22.81 ? 55  ARG C CB  1 
ATOM   2299 C  CG  . ARG C 3 37  ? -67.626 25.856 15.181  1.00 23.42 ? 55  ARG C CG  1 
ATOM   2300 C  CD  . ARG C 3 37  ? -69.070 26.293 14.839  1.00 24.14 ? 55  ARG C CD  1 
ATOM   2301 N  NE  . ARG C 3 37  ? -69.106 27.767 14.953  1.00 24.24 ? 55  ARG C NE  1 
ATOM   2302 C  CZ  . ARG C 3 37  ? -70.175 28.488 14.672  1.00 27.49 ? 55  ARG C CZ  1 
ATOM   2303 N  NH1 . ARG C 3 37  ? -71.270 27.878 14.224  1.00 25.82 ? 55  ARG C NH1 1 
ATOM   2304 N  NH2 . ARG C 3 37  ? -70.118 29.807 14.810  1.00 27.76 ? 55  ARG C NH2 1 
ATOM   2305 N  N   . GLY C 3 38  ? -66.212 21.481 15.529  1.00 22.49 ? 56  GLY C N   1 
ATOM   2306 C  CA  . GLY C 3 38  ? -66.036 20.128 16.108  1.00 24.54 ? 56  GLY C CA  1 
ATOM   2307 C  C   . GLY C 3 38  ? -64.610 19.869 16.531  1.00 23.39 ? 56  GLY C C   1 
ATOM   2308 O  O   . GLY C 3 38  ? -64.357 19.326 17.631  1.00 23.54 ? 56  GLY C O   1 
ATOM   2309 N  N   . VAL C 3 39  ? -63.660 20.275 15.684  1.00 22.49 ? 57  VAL C N   1 
ATOM   2310 C  CA  . VAL C 3 39  ? -62.234 20.044 15.967  1.00 21.64 ? 57  VAL C CA  1 
ATOM   2311 C  C   . VAL C 3 39  ? -61.800 20.881 17.157  1.00 23.20 ? 57  VAL C C   1 
ATOM   2312 O  O   . VAL C 3 39  ? -61.042 20.411 18.042  1.00 23.07 ? 57  VAL C O   1 
ATOM   2313 C  CB  . VAL C 3 39  ? -61.373 20.305 14.718  1.00 23.12 ? 57  VAL C CB  1 
ATOM   2314 C  CG1 . VAL C 3 39  ? -59.909 20.237 15.063  1.00 29.96 ? 57  VAL C CG1 1 
ATOM   2315 C  CG2 . VAL C 3 39  ? -61.754 19.269 13.631  1.00 25.98 ? 57  VAL C CG2 1 
ATOM   2316 N  N   . LEU C 3 40  ? -62.311 22.111 17.222  1.00 20.04 ? 58  LEU C N   1 
ATOM   2317 C  CA  . LEU C 3 40  ? -61.961 22.981 18.351  1.00 21.65 ? 58  LEU C CA  1 
ATOM   2318 C  C   . LEU C 3 40  ? -62.500 22.372 19.666  1.00 21.83 ? 58  LEU C C   1 
ATOM   2319 O  O   . LEU C 3 40  ? -61.835 22.429 20.719  1.00 22.06 ? 58  LEU C O   1 
ATOM   2320 C  CB  . LEU C 3 40  ? -62.579 24.379 18.176  1.00 21.92 ? 58  LEU C CB  1 
ATOM   2321 C  CG  . LEU C 3 40  ? -62.331 25.294 19.396  1.00 19.71 ? 58  LEU C CG  1 
ATOM   2322 C  CD1 . LEU C 3 40  ? -60.807 25.546 19.681  1.00 22.10 ? 58  LEU C CD1 1 
ATOM   2323 C  CD2 . LEU C 3 40  ? -63.025 26.660 19.196  1.00 23.10 ? 58  LEU C CD2 1 
ATOM   2324 N  N   A LYS C 3 41  ? -63.688 21.790 19.611  0.50 21.74 ? 59  LYS C N   1 
ATOM   2325 N  N   B LYS C 3 41  ? -63.700 21.796 19.599  0.50 21.44 ? 59  LYS C N   1 
ATOM   2326 C  CA  A LYS C 3 41  ? -64.280 21.278 20.840  0.50 22.64 ? 59  LYS C CA  1 
ATOM   2327 C  CA  B LYS C 3 41  ? -64.322 21.205 20.791  0.50 22.30 ? 59  LYS C CA  1 
ATOM   2328 C  C   A LYS C 3 41  ? -63.491 20.072 21.370  0.50 23.02 ? 59  LYS C C   1 
ATOM   2329 C  C   B LYS C 3 41  ? -63.394 20.135 21.343  0.50 22.17 ? 59  LYS C C   1 
ATOM   2330 O  O   A LYS C 3 41  ? -63.345 19.912 22.581  0.50 24.10 ? 59  LYS C O   1 
ATOM   2331 O  O   B LYS C 3 41  ? -63.054 20.125 22.522  0.50 22.70 ? 59  LYS C O   1 
ATOM   2332 C  CB  A LYS C 3 41  ? -65.755 20.966 20.636  0.50 23.30 ? 59  LYS C CB  1 
ATOM   2333 C  CB  B LYS C 3 41  ? -65.675 20.571 20.451  0.50 22.35 ? 59  LYS C CB  1 
ATOM   2334 C  CG  A LYS C 3 41  ? -66.435 20.312 21.837  0.50 25.81 ? 59  LYS C CG  1 
ATOM   2335 C  CG  B LYS C 3 41  ? -66.299 19.725 21.596  0.50 22.68 ? 59  LYS C CG  1 
ATOM   2336 C  CD  A LYS C 3 41  ? -67.867 19.986 21.472  0.50 27.91 ? 59  LYS C CD  1 
ATOM   2337 C  CD  B LYS C 3 41  ? -67.778 19.450 21.348  0.50 24.87 ? 59  LYS C CD  1 
ATOM   2338 C  CE  A LYS C 3 41  ? -68.630 19.443 22.649  0.50 30.16 ? 59  LYS C CE  1 
ATOM   2339 C  CE  B LYS C 3 41  ? -68.392 18.527 22.438  0.50 29.62 ? 59  LYS C CE  1 
ATOM   2340 N  NZ  A LYS C 3 41  ? -69.597 18.424 22.221  0.50 34.84 ? 59  LYS C NZ  1 
ATOM   2341 N  NZ  B LYS C 3 41  ? -69.889 18.552 22.544  0.50 32.58 ? 59  LYS C NZ  1 
ATOM   2342 N  N   . VAL C 3 42  ? -62.996 19.235 20.467  1.00 22.02 ? 60  VAL C N   1 
ATOM   2343 C  CA  . VAL C 3 42  ? -62.150 18.117 20.889  1.00 24.62 ? 60  VAL C CA  1 
ATOM   2344 C  C   . VAL C 3 42  ? -60.854 18.650 21.500  1.00 23.32 ? 60  VAL C C   1 
ATOM   2345 O  O   . VAL C 3 42  ? -60.420 18.167 22.560  1.00 23.82 ? 60  VAL C O   1 
ATOM   2346 C  CB  . VAL C 3 42  ? -61.834 17.189 19.734  1.00 25.58 ? 60  VAL C CB  1 
ATOM   2347 C  CG1 . VAL C 3 42  ? -60.751 16.144 20.158  1.00 30.47 ? 60  VAL C CG1 1 
ATOM   2348 C  CG2 . VAL C 3 42  ? -63.097 16.456 19.316  1.00 27.10 ? 60  VAL C CG2 1 
ATOM   2349 N  N   . PHE C 3 43  ? -60.225 19.612 20.825  1.00 22.47 ? 61  PHE C N   1 
ATOM   2350 C  CA  . PHE C 3 43  ? -58.963 20.199 21.327  1.00 22.02 ? 61  PHE C CA  1 
ATOM   2351 C  C   . PHE C 3 43  ? -59.176 20.739 22.745  1.00 23.23 ? 61  PHE C C   1 
ATOM   2352 O  O   . PHE C 3 43  ? -58.395 20.465 23.685  1.00 22.40 ? 61  PHE C O   1 
ATOM   2353 C  CB  . PHE C 3 43  ? -58.534 21.361 20.385  1.00 22.40 ? 61  PHE C CB  1 
ATOM   2354 C  CG  . PHE C 3 43  ? -57.326 22.142 20.871  1.00 21.30 ? 61  PHE C CG  1 
ATOM   2355 C  CD1 . PHE C 3 43  ? -56.030 21.649 20.662  1.00 25.72 ? 61  PHE C CD1 1 
ATOM   2356 C  CD2 . PHE C 3 43  ? -57.479 23.398 21.486  1.00 22.55 ? 61  PHE C CD2 1 
ATOM   2357 C  CE1 . PHE C 3 43  ? -54.914 22.378 21.087  1.00 23.37 ? 61  PHE C CE1 1 
ATOM   2358 C  CE2 . PHE C 3 43  ? -56.362 24.150 21.913  1.00 25.27 ? 61  PHE C CE2 1 
ATOM   2359 C  CZ  . PHE C 3 43  ? -55.063 23.629 21.720  1.00 24.43 ? 61  PHE C CZ  1 
ATOM   2360 N  N   . LEU C 3 44  ? -60.233 21.514 22.934  1.00 22.34 ? 62  LEU C N   1 
ATOM   2361 C  CA  . LEU C 3 44  ? -60.490 22.134 24.247  1.00 22.97 ? 62  LEU C CA  1 
ATOM   2362 C  C   . LEU C 3 44  ? -60.839 21.051 25.285  1.00 25.54 ? 62  LEU C C   1 
ATOM   2363 O  O   . LEU C 3 44  ? -60.402 21.144 26.435  1.00 25.38 ? 62  LEU C O   1 
ATOM   2364 C  CB  . LEU C 3 44  ? -61.645 23.132 24.148  1.00 22.19 ? 62  LEU C CB  1 
ATOM   2365 C  CG  . LEU C 3 44  ? -61.332 24.395 23.353  1.00 20.36 ? 62  LEU C CG  1 
ATOM   2366 C  CD1 . LEU C 3 44  ? -62.594 25.243 23.189  1.00 26.89 ? 62  LEU C CD1 1 
ATOM   2367 C  CD2 . LEU C 3 44  ? -60.209 25.200 24.046  1.00 25.10 ? 62  LEU C CD2 1 
ATOM   2368 N  N   . GLU C 3 45  ? -61.623 20.056 24.898  1.00 25.03 ? 63  GLU C N   1 
ATOM   2369 C  CA  . GLU C 3 45  ? -61.971 18.991 25.866  1.00 27.33 ? 63  GLU C CA  1 
ATOM   2370 C  C   . GLU C 3 45  ? -60.711 18.290 26.375  1.00 25.90 ? 63  GLU C C   1 
ATOM   2371 O  O   . GLU C 3 45  ? -60.575 18.054 27.584  1.00 28.39 ? 63  GLU C O   1 
ATOM   2372 C  CB  . GLU C 3 45  ? -62.904 17.953 25.246  1.00 27.91 ? 63  GLU C CB  1 
ATOM   2373 C  CG  . GLU C 3 45  ? -64.318 18.458 25.066  1.00 32.30 ? 63  GLU C CG  1 
ATOM   2374 C  CD  . GLU C 3 45  ? -65.176 17.484 24.260  1.00 35.52 ? 63  GLU C CD  1 
ATOM   2375 O  OE1 . GLU C 3 45  ? -64.612 16.681 23.493  1.00 35.92 ? 63  GLU C OE1 1 
ATOM   2376 O  OE2 . GLU C 3 45  ? -66.421 17.570 24.378  1.00 42.20 ? 63  GLU C OE2 1 
ATOM   2377 N  N   . ASN C 3 46  ? -59.799 17.964 25.470  1.00 26.05 ? 64  ASN C N   1 
ATOM   2378 C  CA  . ASN C 3 46  ? -58.532 17.311 25.844  1.00 28.04 ? 64  ASN C CA  1 
ATOM   2379 C  C   . ASN C 3 46  ? -57.662 18.183 26.777  1.00 30.40 ? 64  ASN C C   1 
ATOM   2380 O  O   . ASN C 3 46  ? -57.155 17.716 27.830  1.00 27.26 ? 64  ASN C O   1 
ATOM   2381 C  CB  . ASN C 3 46  ? -57.756 16.929 24.584  1.00 29.00 ? 64  ASN C CB  1 
ATOM   2382 C  CG  . ASN C 3 46  ? -58.402 15.768 23.841  1.00 33.40 ? 64  ASN C CG  1 
ATOM   2383 O  OD1 . ASN C 3 46  ? -59.179 15.003 24.420  1.00 35.13 ? 64  ASN C OD1 1 
ATOM   2384 N  ND2 . ASN C 3 46  ? -58.096 15.640 22.553  1.00 32.76 ? 64  ASN C ND2 1 
ATOM   2385 N  N   . VAL C 3 47  ? -57.479 19.441 26.403  1.00 24.73 ? 65  VAL C N   1 
ATOM   2386 C  CA  . VAL C 3 47  ? -56.654 20.335 27.212  1.00 23.57 ? 65  VAL C CA  1 
ATOM   2387 C  C   . VAL C 3 47  ? -57.300 20.616 28.575  1.00 27.03 ? 65  VAL C C   1 
ATOM   2388 O  O   . VAL C 3 47  ? -56.634 20.564 29.629  1.00 25.40 ? 65  VAL C O   1 
ATOM   2389 C  CB  . VAL C 3 47  ? -56.392 21.659 26.466  1.00 23.09 ? 65  VAL C CB  1 
ATOM   2390 C  CG1 . VAL C 3 47  ? -55.693 22.680 27.388  1.00 23.20 ? 65  VAL C CG1 1 
ATOM   2391 C  CG2 . VAL C 3 47  ? -55.577 21.379 25.159  1.00 23.23 ? 65  VAL C CG2 1 
ATOM   2392 N  N   . ILE C 3 48  ? -58.594 20.957 28.560  1.00 25.18 ? 66  ILE C N   1 
ATOM   2393 C  CA  . ILE C 3 48  ? -59.288 21.325 29.800  1.00 26.46 ? 66  ILE C CA  1 
ATOM   2394 C  C   . ILE C 3 48  ? -59.360 20.114 30.734  1.00 27.33 ? 66  ILE C C   1 
ATOM   2395 O  O   . ILE C 3 48  ? -59.218 20.268 31.975  1.00 29.04 ? 66  ILE C O   1 
ATOM   2396 C  CB  . ILE C 3 48  ? -60.696 21.897 29.498  1.00 24.70 ? 66  ILE C CB  1 
ATOM   2397 C  CG1 . ILE C 3 48  ? -60.563 23.255 28.842  1.00 25.39 ? 66  ILE C CG1 1 
ATOM   2398 C  CG2 . ILE C 3 48  ? -61.518 22.055 30.807  1.00 28.99 ? 66  ILE C CG2 1 
ATOM   2399 C  CD1 . ILE C 3 48  ? -61.878 23.741 28.246  1.00 28.48 ? 66  ILE C CD1 1 
ATOM   2400 N  N   . ARG C 3 49  ? -59.527 18.924 30.173  1.00 27.33 ? 67  ARG C N   1 
ATOM   2401 C  CA  . ARG C 3 49  ? -59.567 17.705 31.016  1.00 29.46 ? 67  ARG C CA  1 
ATOM   2402 C  C   . ARG C 3 49  ? -58.278 17.596 31.846  1.00 30.56 ? 67  ARG C C   1 
ATOM   2403 O  O   . ARG C 3 49  ? -58.303 17.314 33.069  1.00 29.73 ? 67  ARG C O   1 
ATOM   2404 C  CB  . ARG C 3 49  ? -59.749 16.434 30.170  1.00 30.91 ? 67  ARG C CB  1 
ATOM   2405 C  CG  . ARG C 3 49  ? -59.770 15.116 30.997  1.00 33.84 ? 67  ARG C CG  1 
ATOM   2406 C  CD  . ARG C 3 49  ? -59.732 13.875 30.092  1.00 35.04 ? 67  ARG C CD  1 
ATOM   2407 N  NE  . ARG C 3 49  ? -60.885 13.860 29.179  1.00 42.73 ? 67  ARG C NE  1 
ATOM   2408 C  CZ  . ARG C 3 49  ? -60.805 14.048 27.859  1.00 45.67 ? 67  ARG C CZ  1 
ATOM   2409 N  NH1 . ARG C 3 49  ? -59.626 14.220 27.271  1.00 44.55 ? 67  ARG C NH1 1 
ATOM   2410 N  NH2 . ARG C 3 49  ? -61.908 14.028 27.113  1.00 48.70 ? 67  ARG C NH2 1 
ATOM   2411 N  N   . ASP C 3 50  ? -57.149 17.836 31.186  1.00 26.95 ? 68  ASP C N   1 
ATOM   2412 C  CA  . ASP C 3 50  ? -55.868 17.762 31.884  1.00 27.40 ? 68  ASP C CA  1 
ATOM   2413 C  C   . ASP C 3 50  ? -55.675 18.912 32.851  1.00 27.53 ? 68  ASP C C   1 
ATOM   2414 O  O   . ASP C 3 50  ? -55.210 18.699 33.989  1.00 26.56 ? 68  ASP C O   1 
ATOM   2415 C  CB  . ASP C 3 50  ? -54.723 17.683 30.858  1.00 26.65 ? 68  ASP C CB  1 
ATOM   2416 C  CG  . ASP C 3 50  ? -54.655 16.329 30.162  1.00 29.54 ? 68  ASP C CG  1 
ATOM   2417 O  OD1 . ASP C 3 50  ? -55.367 15.375 30.569  1.00 33.69 ? 68  ASP C OD1 1 
ATOM   2418 O  OD2 . ASP C 3 50  ? -53.890 16.192 29.187  1.00 30.62 ? 68  ASP C OD2 1 
ATOM   2419 N  N   . ALA C 3 51  ? -56.022 20.124 32.411  1.00 25.58 ? 69  ALA C N   1 
ATOM   2420 C  CA  . ALA C 3 51  ? -55.901 21.309 33.232  1.00 25.90 ? 69  ALA C CA  1 
ATOM   2421 C  C   . ALA C 3 51  ? -56.672 21.114 34.530  1.00 28.58 ? 69  ALA C C   1 
ATOM   2422 O  O   . ALA C 3 51  ? -56.186 21.450 35.617  1.00 28.04 ? 69  ALA C O   1 
ATOM   2423 C  CB  . ALA C 3 51  ? -56.386 22.549 32.491  1.00 26.47 ? 69  ALA C CB  1 
ATOM   2424 N  N   . VAL C 3 52  ? -57.881 20.574 34.411  1.00 28.40 ? 70  VAL C N   1 
ATOM   2425 C  CA  . VAL C 3 52  ? -58.713 20.345 35.586  1.00 30.69 ? 70  VAL C CA  1 
ATOM   2426 C  C   . VAL C 3 52  ? -58.076 19.319 36.536  1.00 29.64 ? 70  VAL C C   1 
ATOM   2427 O  O   . VAL C 3 52  ? -58.116 19.501 37.771  1.00 32.09 ? 70  VAL C O   1 
ATOM   2428 C  CB  . VAL C 3 52  ? -60.161 19.950 35.189  1.00 31.37 ? 70  VAL C CB  1 
ATOM   2429 C  CG1 . VAL C 3 52  ? -60.933 19.523 36.416  1.00 34.49 ? 70  VAL C CG1 1 
ATOM   2430 C  CG2 . VAL C 3 52  ? -60.823 21.156 34.555  1.00 29.90 ? 70  VAL C CG2 1 
ATOM   2431 N  N   . THR C 3 53  ? -57.494 18.271 35.979  1.00 28.01 ? 71  THR C N   1 
ATOM   2432 C  CA  . THR C 3 53  ? -56.785 17.236 36.791  1.00 29.93 ? 71  THR C CA  1 
ATOM   2433 C  C   . THR C 3 53  ? -55.685 17.897 37.657  1.00 30.61 ? 71  THR C C   1 
ATOM   2434 O  O   . THR C 3 53  ? -55.529 17.605 38.863  1.00 27.16 ? 71  THR C O   1 
ATOM   2435 C  CB  . THR C 3 53  ? -56.157 16.174 35.895  1.00 33.37 ? 71  THR C CB  1 
ATOM   2436 O  OG1 . THR C 3 53  ? -57.183 15.449 35.197  1.00 36.57 ? 71  THR C OG1 1 
ATOM   2437 C  CG2 . THR C 3 53  ? -55.340 15.184 36.694  1.00 31.23 ? 71  THR C CG2 1 
ATOM   2438 N  N   . TYR C 3 54  ? -54.933 18.814 37.049  1.00 26.67 ? 72  TYR C N   1 
ATOM   2439 C  CA  . TYR C 3 54  ? -53.815 19.435 37.781  1.00 25.65 ? 72  TYR C CA  1 
ATOM   2440 C  C   . TYR C 3 54  ? -54.349 20.368 38.852  1.00 28.32 ? 72  TYR C C   1 
ATOM   2441 O  O   . TYR C 3 54  ? -53.812 20.476 39.970  1.00 27.71 ? 72  TYR C O   1 
ATOM   2442 C  CB  . TYR C 3 54  ? -52.903 20.198 36.801  1.00 25.08 ? 72  TYR C CB  1 
ATOM   2443 C  CG  . TYR C 3 54  ? -52.395 19.322 35.668  1.00 23.81 ? 72  TYR C CG  1 
ATOM   2444 C  CD1 . TYR C 3 54  ? -52.317 19.828 34.339  1.00 25.23 ? 72  TYR C CD1 1 
ATOM   2445 C  CD2 . TYR C 3 54  ? -52.016 18.002 35.873  1.00 27.50 ? 72  TYR C CD2 1 
ATOM   2446 C  CE1 . TYR C 3 54  ? -51.893 19.034 33.309  1.00 26.35 ? 72  TYR C CE1 1 
ATOM   2447 C  CE2 . TYR C 3 54  ? -51.572 17.224 34.825  1.00 30.18 ? 72  TYR C CE2 1 
ATOM   2448 C  CZ  . TYR C 3 54  ? -51.519 17.748 33.544  1.00 28.92 ? 72  TYR C CZ  1 
ATOM   2449 O  OH  . TYR C 3 54  ? -51.073 16.978 32.494  1.00 30.21 ? 72  TYR C OH  1 
ATOM   2450 N  N   . THR C 3 55  ? -55.448 21.036 38.525  1.00 26.52 ? 73  THR C N   1 
ATOM   2451 C  CA  . THR C 3 55  ? -56.076 21.969 39.470  1.00 28.40 ? 73  THR C CA  1 
ATOM   2452 C  C   . THR C 3 55  ? -56.581 21.199 40.684  1.00 29.11 ? 73  THR C C   1 
ATOM   2453 O  O   . THR C 3 55  ? -56.378 21.623 41.832  1.00 33.29 ? 73  THR C O   1 
ATOM   2454 C  CB  . THR C 3 55  ? -57.287 22.661 38.802  1.00 28.93 ? 73  THR C CB  1 
ATOM   2455 O  OG1 . THR C 3 55  ? -56.817 23.443 37.698  1.00 31.21 ? 73  THR C OG1 1 
ATOM   2456 C  CG2 . THR C 3 55  ? -57.939 23.627 39.782  1.00 29.44 ? 73  THR C CG2 1 
ATOM   2457 N  N   . GLU C 3 56  ? -57.205 20.069 40.442  1.00 29.70 ? 74  GLU C N   1 
ATOM   2458 C  CA  . GLU C 3 56  ? -57.750 19.236 41.521  1.00 30.34 ? 74  GLU C CA  1 
ATOM   2459 C  C   . GLU C 3 56  ? -56.631 18.710 42.408  1.00 33.56 ? 74  GLU C C   1 
ATOM   2460 O  O   . GLU C 3 56  ? -56.785 18.684 43.633  1.00 32.29 ? 74  GLU C O   1 
ATOM   2461 C  CB  . GLU C 3 56  ? -58.537 18.060 40.959  1.00 35.50 ? 74  GLU C CB  1 
ATOM   2462 C  CG  . GLU C 3 56  ? -59.916 18.501 40.399  1.00 40.68 ? 74  GLU C CG  1 
ATOM   2463 C  CD  . GLU C 3 56  ? -60.661 17.374 39.723  1.00 47.11 ? 74  GLU C CD  1 
ATOM   2464 O  OE1 . GLU C 3 56  ? -60.012 16.413 39.247  1.00 51.67 ? 74  GLU C OE1 1 
ATOM   2465 O  OE2 . GLU C 3 56  ? -61.903 17.464 39.650  1.00 55.15 ? 74  GLU C OE2 1 
ATOM   2466 N  N   . HIS C 3 57  ? -55.519 18.300 41.807  1.00 27.58 ? 75  HIS C N   1 
ATOM   2467 C  CA  . HIS C 3 57  ? -54.411 17.755 42.636  1.00 28.29 ? 75  HIS C CA  1 
ATOM   2468 C  C   . HIS C 3 57  ? -53.728 18.816 43.468  1.00 30.11 ? 75  HIS C C   1 
ATOM   2469 O  O   . HIS C 3 57  ? -53.125 18.527 44.520  1.00 30.74 ? 75  HIS C O   1 
ATOM   2470 C  CB  . HIS C 3 57  ? -53.404 16.984 41.773  1.00 28.31 ? 75  HIS C CB  1 
ATOM   2471 C  CG  . HIS C 3 57  ? -53.845 15.587 41.475  1.00 31.30 ? 75  HIS C CG  1 
ATOM   2472 N  ND1 . HIS C 3 57  ? -54.792 15.282 40.511  1.00 31.70 ? 75  HIS C ND1 1 
ATOM   2473 C  CD2 . HIS C 3 57  ? -53.504 14.413 42.049  1.00 32.31 ? 75  HIS C CD2 1 
ATOM   2474 C  CE1 . HIS C 3 57  ? -54.969 13.973 40.472  1.00 33.33 ? 75  HIS C CE1 1 
ATOM   2475 N  NE2 . HIS C 3 57  ? -54.192 13.422 41.390  1.00 33.17 ? 75  HIS C NE2 1 
ATOM   2476 N  N   . ALA C 3 58  ? -53.804 20.049 43.003  1.00 30.09 ? 76  ALA C N   1 
ATOM   2477 C  CA  . ALA C 3 58  ? -53.274 21.184 43.753  1.00 33.05 ? 76  ALA C CA  1 
ATOM   2478 C  C   . ALA C 3 58  ? -54.277 21.689 44.802  1.00 36.66 ? 76  ALA C C   1 
ATOM   2479 O  O   . ALA C 3 58  ? -54.017 22.713 45.453  1.00 38.05 ? 76  ALA C O   1 
ATOM   2480 C  CB  . ALA C 3 58  ? -52.894 22.289 42.811  1.00 35.55 ? 76  ALA C CB  1 
ATOM   2481 N  N   A LYS C 3 59  ? -55.374 20.971 45.027  0.50 38.53 ? 77  LYS C N   1 
ATOM   2482 N  N   B LYS C 3 59  ? -55.403 20.968 44.898  0.50 36.88 ? 77  LYS C N   1 
ATOM   2483 C  CA  A LYS C 3 59  ? -56.387 21.448 45.977  0.50 41.90 ? 77  LYS C CA  1 
ATOM   2484 C  CA  B LYS C 3 59  ? -56.518 21.218 45.829  0.50 39.00 ? 77  LYS C CA  1 
ATOM   2485 C  C   A LYS C 3 59  ? -56.772 22.870 45.640  0.50 43.22 ? 77  LYS C C   1 
ATOM   2486 C  C   B LYS C 3 59  ? -57.194 22.573 45.661  0.50 40.59 ? 77  LYS C C   1 
ATOM   2487 O  O   A LYS C 3 59  ? -56.639 23.802 46.443  0.50 44.78 ? 77  LYS C O   1 
ATOM   2488 O  O   B LYS C 3 59  ? -57.707 23.139 46.624  0.50 39.26 ? 77  LYS C O   1 
ATOM   2489 C  CB  A LYS C 3 59  ? -55.913 21.374 47.430  0.50 42.42 ? 77  LYS C CB  1 
ATOM   2490 C  CB  B LYS C 3 59  ? -56.088 20.983 47.282  0.50 39.39 ? 77  LYS C CB  1 
ATOM   2491 C  CG  A LYS C 3 59  ? -56.367 20.127 48.153  0.50 45.42 ? 77  LYS C CG  1 
ATOM   2492 C  CG  B LYS C 3 59  ? -55.809 19.530 47.581  0.50 41.23 ? 77  LYS C CG  1 
ATOM   2493 C  CD  A LYS C 3 59  ? -56.227 20.296 49.659  0.50 48.12 ? 77  LYS C CD  1 
ATOM   2494 C  CD  B LYS C 3 59  ? -57.083 18.701 47.568  0.50 42.66 ? 77  LYS C CD  1 
ATOM   2495 C  CE  A LYS C 3 59  ? -56.537 18.994 50.385  0.50 50.16 ? 77  LYS C CE  1 
ATOM   2496 C  CE  B LYS C 3 59  ? -56.757 17.221 47.583  0.50 45.57 ? 77  LYS C CE  1 
ATOM   2497 N  NZ  A LYS C 3 59  ? -56.430 19.136 51.857  0.50 51.41 ? 77  LYS C NZ  1 
ATOM   2498 N  NZ  B LYS C 3 59  ? -57.975 16.366 47.550  0.50 47.44 ? 77  LYS C NZ  1 
ATOM   2499 N  N   . ARG C 3 60  ? -57.224 23.044 44.412  1.00 43.02 ? 78  ARG C N   1 
ATOM   2500 C  CA  . ARG C 3 60  ? -57.730 24.335 44.014  1.00 45.03 ? 78  ARG C CA  1 
ATOM   2501 C  C   . ARG C 3 60  ? -59.063 24.111 43.347  1.00 41.77 ? 78  ARG C C   1 
ATOM   2502 O  O   . ARG C 3 60  ? -59.388 22.990 42.946  1.00 39.23 ? 78  ARG C O   1 
ATOM   2503 C  CB  . ARG C 3 60  ? -56.776 24.960 43.003  1.00 45.15 ? 78  ARG C CB  1 
ATOM   2504 C  CG  . ARG C 3 60  ? -55.623 25.674 43.591  1.00 43.83 ? 78  ARG C CG  1 
ATOM   2505 C  CD  . ARG C 3 60  ? -54.882 26.444 42.506  1.00 43.72 ? 78  ARG C CD  1 
ATOM   2506 N  NE  . ARG C 3 60  ? -53.829 25.665 41.852  1.00 41.60 ? 78  ARG C NE  1 
ATOM   2507 C  CZ  . ARG C 3 60  ? -53.922 25.126 40.641  1.00 43.76 ? 78  ARG C CZ  1 
ATOM   2508 N  NH1 . ARG C 3 60  ? -55.039 25.266 39.918  1.00 42.57 ? 78  ARG C NH1 1 
ATOM   2509 N  NH2 . ARG C 3 60  ? -52.897 24.447 40.141  1.00 38.05 ? 78  ARG C NH2 1 
ATOM   2510 N  N   . LYS C 3 61  ? -59.850 25.173 43.275  1.00 46.79 ? 79  LYS C N   1 
ATOM   2511 C  CA  . LYS C 3 61  ? -61.094 25.146 42.519  1.00 51.27 ? 79  LYS C CA  1 
ATOM   2512 C  C   . LYS C 3 61  ? -60.931 26.063 41.315  1.00 50.39 ? 79  LYS C C   1 
ATOM   2513 O  O   . LYS C 3 61  ? -61.774 26.055 40.412  1.00 51.61 ? 79  LYS C O   1 
ATOM   2514 C  CB  . LYS C 3 61  ? -62.299 25.588 43.372  1.00 52.60 ? 79  LYS C CB  1 
ATOM   2515 C  CG  . LYS C 3 61  ? -62.794 24.530 44.358  1.00 56.64 ? 79  LYS C CG  1 
ATOM   2516 C  CD  . LYS C 3 61  ? -64.009 25.029 45.131  1.00 57.70 ? 79  LYS C CD  1 
ATOM   2517 C  CE  . LYS C 3 61  ? -64.506 23.990 46.149  1.00 63.40 ? 79  LYS C CE  1 
ATOM   2518 N  NZ  . LYS C 3 61  ? -65.784 24.444 46.797  1.00 64.47 ? 79  LYS C NZ  1 
ATOM   2519 N  N   . THR C 3 62  ? -59.837 26.833 41.310  1.00 45.51 ? 80  THR C N   1 
ATOM   2520 C  CA  . THR C 3 62  ? -59.550 27.814 40.246  1.00 42.00 ? 80  THR C CA  1 
ATOM   2521 C  C   . THR C 3 62  ? -58.439 27.338 39.305  1.00 39.21 ? 80  THR C C   1 
ATOM   2522 O  O   . THR C 3 62  ? -57.346 27.023 39.755  1.00 33.90 ? 80  THR C O   1 
ATOM   2523 C  CB  . THR C 3 62  ? -59.076 29.111 40.860  1.00 44.59 ? 80  THR C CB  1 
ATOM   2524 O  OG1 . THR C 3 62  ? -60.098 29.615 41.733  1.00 52.39 ? 80  THR C OG1 1 
ATOM   2525 C  CG2 . THR C 3 62  ? -58.789 30.131 39.779  1.00 45.03 ? 80  THR C CG2 1 
ATOM   2526 N  N   . VAL C 3 63  ? -58.728 27.277 38.006  1.00 34.19 ? 81  VAL C N   1 
ATOM   2527 C  CA  . VAL C 3 63  ? -57.727 26.786 37.024  1.00 30.79 ? 81  VAL C CA  1 
ATOM   2528 C  C   . VAL C 3 63  ? -56.795 27.925 36.689  1.00 29.01 ? 81  VAL C C   1 
ATOM   2529 O  O   . VAL C 3 63  ? -57.246 29.046 36.401  1.00 30.84 ? 81  VAL C O   1 
ATOM   2530 C  CB  . VAL C 3 63  ? -58.390 26.252 35.727  1.00 28.07 ? 81  VAL C CB  1 
ATOM   2531 C  CG1 . VAL C 3 63  ? -57.296 25.754 34.739  1.00 28.16 ? 81  VAL C CG1 1 
ATOM   2532 C  CG2 . VAL C 3 63  ? -59.421 25.176 36.035  1.00 30.73 ? 81  VAL C CG2 1 
ATOM   2533 N  N   . THR C 3 64  ? -55.475 27.664 36.737  1.00 28.15 ? 82  THR C N   1 
ATOM   2534 C  CA  . THR C 3 64  ? -54.472 28.692 36.509  1.00 26.52 ? 82  THR C CA  1 
ATOM   2535 C  C   . THR C 3 64  ? -53.824 28.551 35.134  1.00 25.98 ? 82  THR C C   1 
ATOM   2536 O  O   . THR C 3 64  ? -53.913 27.492 34.540  1.00 26.42 ? 82  THR C O   1 
ATOM   2537 C  CB  . THR C 3 64  ? -53.328 28.588 37.531  1.00 28.29 ? 82  THR C CB  1 
ATOM   2538 O  OG1 . THR C 3 64  ? -52.654 27.341 37.327  1.00 33.39 ? 82  THR C OG1 1 
ATOM   2539 C  CG2 . THR C 3 64  ? -53.921 28.632 38.977  1.00 33.17 ? 82  THR C CG2 1 
ATOM   2540 N  N   . ALA C 3 65  ? -53.157 29.616 34.678  1.00 27.00 ? 83  ALA C N   1 
ATOM   2541 C  CA  . ALA C 3 65  ? -52.436 29.560 33.398  1.00 26.01 ? 83  ALA C CA  1 
ATOM   2542 C  C   . ALA C 3 65  ? -51.384 28.430 33.426  1.00 27.18 ? 83  ALA C C   1 
ATOM   2543 O  O   . ALA C 3 65  ? -51.174 27.760 32.426  1.00 27.38 ? 83  ALA C O   1 
ATOM   2544 C  CB  . ALA C 3 65  ? -51.740 30.873 33.133  1.00 32.07 ? 83  ALA C CB  1 
ATOM   2545 N  N   A MET C 3 66  ? -50.735 28.218 34.573  0.50 26.25 ? 84  MET C N   1 
ATOM   2546 N  N   B MET C 3 66  ? -50.754 28.234 34.575  0.50 26.88 ? 84  MET C N   1 
ATOM   2547 C  CA  A MET C 3 66  ? -49.731 27.144 34.690  0.50 27.13 ? 84  MET C CA  1 
ATOM   2548 C  CA  B MET C 3 66  ? -49.763 27.182 34.697  0.50 28.76 ? 84  MET C CA  1 
ATOM   2549 C  C   A MET C 3 66  ? -50.322 25.768 34.358  0.50 26.23 ? 84  MET C C   1 
ATOM   2550 C  C   B MET C 3 66  ? -50.355 25.822 34.301  0.50 27.00 ? 84  MET C C   1 
ATOM   2551 O  O   A MET C 3 66  ? -49.655 24.933 33.720  0.50 27.79 ? 84  MET C O   1 
ATOM   2552 O  O   B MET C 3 66  ? -49.731 25.065 33.538  0.50 28.51 ? 84  MET C O   1 
ATOM   2553 C  CB  A MET C 3 66  ? -49.106 27.093 36.101  0.50 26.21 ? 84  MET C CB  1 
ATOM   2554 C  CB  B MET C 3 66  ? -49.222 27.121 36.130  0.50 27.74 ? 84  MET C CB  1 
ATOM   2555 C  CG  A MET C 3 66  ? -48.239 28.270 36.448  0.50 28.48 ? 84  MET C CG  1 
ATOM   2556 C  CG  B MET C 3 66  ? -48.049 26.217 36.239  0.50 30.28 ? 84  MET C CG  1 
ATOM   2557 S  SD  A MET C 3 66  ? -47.325 27.925 37.992  0.50 30.05 ? 84  MET C SD  1 
ATOM   2558 S  SD  B MET C 3 66  ? -47.424 26.136 37.928  0.50 34.67 ? 84  MET C SD  1 
ATOM   2559 C  CE  A MET C 3 66  ? -45.950 26.976 37.409  0.50 30.64 ? 84  MET C CE  1 
ATOM   2560 C  CE  B MET C 3 66  ? -48.617 25.049 38.745  0.50 32.64 ? 84  MET C CE  1 
ATOM   2561 N  N   . ASP C 3 67  ? -51.555 25.517 34.811  1.00 26.30 ? 85  ASP C N   1 
ATOM   2562 C  CA  . ASP C 3 67  ? -52.220 24.232 34.513  1.00 25.29 ? 85  ASP C CA  1 
ATOM   2563 C  C   . ASP C 3 67  ? -52.455 24.137 32.996  1.00 24.87 ? 85  ASP C C   1 
ATOM   2564 O  O   . ASP C 3 67  ? -52.318 23.072 32.394  1.00 24.59 ? 85  ASP C O   1 
ATOM   2565 C  CB  . ASP C 3 67  ? -53.596 24.095 35.216  1.00 29.40 ? 85  ASP C CB  1 
ATOM   2566 C  CG  . ASP C 3 67  ? -53.537 24.286 36.747  1.00 36.91 ? 85  ASP C CG  1 
ATOM   2567 O  OD1 . ASP C 3 67  ? -52.589 23.754 37.385  1.00 30.62 ? 85  ASP C OD1 1 
ATOM   2568 O  OD2 . ASP C 3 67  ? -54.479 24.914 37.322  1.00 38.20 ? 85  ASP C OD2 1 
ATOM   2569 N  N   . VAL C 3 68  ? -52.891 25.242 32.398  1.00 23.84 ? 86  VAL C N   1 
ATOM   2570 C  CA  . VAL C 3 68  ? -53.206 25.253 30.964  1.00 24.85 ? 86  VAL C CA  1 
ATOM   2571 C  C   . VAL C 3 68  ? -51.929 25.111 30.140  1.00 21.59 ? 86  VAL C C   1 
ATOM   2572 O  O   . VAL C 3 68  ? -51.873 24.284 29.215  1.00 25.08 ? 86  VAL C O   1 
ATOM   2573 C  CB  . VAL C 3 68  ? -53.932 26.538 30.588  1.00 25.74 ? 86  VAL C CB  1 
ATOM   2574 C  CG1 . VAL C 3 68  ? -54.067 26.667 29.063  1.00 29.23 ? 86  VAL C CG1 1 
ATOM   2575 C  CG2 . VAL C 3 68  ? -55.339 26.513 31.231  1.00 26.93 ? 86  VAL C CG2 1 
ATOM   2576 N  N   . VAL C 3 69  ? -50.879 25.849 30.519  1.00 24.12 ? 87  VAL C N   1 
ATOM   2577 C  CA  . VAL C 3 69  ? -49.633 25.769 29.759  1.00 24.49 ? 87  VAL C CA  1 
ATOM   2578 C  C   . VAL C 3 69  ? -49.102 24.334 29.739  1.00 24.76 ? 87  VAL C C   1 
ATOM   2579 O  O   . VAL C 3 69  ? -48.692 23.826 28.697  1.00 25.03 ? 87  VAL C O   1 
ATOM   2580 C  CB  . VAL C 3 69  ? -48.586 26.771 30.310  1.00 26.83 ? 87  VAL C CB  1 
ATOM   2581 C  CG1 . VAL C 3 69  ? -47.201 26.496 29.736  1.00 29.82 ? 87  VAL C CG1 1 
ATOM   2582 C  CG2 . VAL C 3 69  ? -49.056 28.218 30.030  1.00 31.31 ? 87  VAL C CG2 1 
ATOM   2583 N  N   . TYR C 3 70  ? -49.095 23.664 30.890  1.00 24.15 ? 88  TYR C N   1 
ATOM   2584 C  CA  . TYR C 3 70  ? -48.616 22.288 30.885  1.00 23.49 ? 88  TYR C CA  1 
ATOM   2585 C  C   . TYR C 3 70  ? -49.502 21.353 30.058  1.00 24.91 ? 88  TYR C C   1 
ATOM   2586 O  O   . TYR C 3 70  ? -49.002 20.519 29.305  1.00 26.32 ? 88  TYR C O   1 
ATOM   2587 C  CB  . TYR C 3 70  ? -48.390 21.761 32.312  1.00 25.11 ? 88  TYR C CB  1 
ATOM   2588 C  CG  . TYR C 3 70  ? -47.739 20.383 32.267  1.00 24.14 ? 88  TYR C CG  1 
ATOM   2589 C  CD1 . TYR C 3 70  ? -48.489 19.228 32.403  1.00 27.45 ? 88  TYR C CD1 1 
ATOM   2590 C  CD2 . TYR C 3 70  ? -46.360 20.252 32.047  1.00 30.23 ? 88  TYR C CD2 1 
ATOM   2591 C  CE1 . TYR C 3 70  ? -47.900 17.953 32.341  1.00 34.10 ? 88  TYR C CE1 1 
ATOM   2592 C  CE2 . TYR C 3 70  ? -45.760 18.975 31.992  1.00 31.35 ? 88  TYR C CE2 1 
ATOM   2593 C  CZ  . TYR C 3 70  ? -46.533 17.844 32.133  1.00 31.95 ? 88  TYR C CZ  1 
ATOM   2594 O  OH  . TYR C 3 70  ? -45.944 16.578 32.106  1.00 35.51 ? 88  TYR C OH  1 
ATOM   2595 N  N   . ALA C 3 71  ? -50.829 21.499 30.178  1.00 22.22 ? 89  ALA C N   1 
ATOM   2596 C  CA  . ALA C 3 71  ? -51.766 20.644 29.452  1.00 22.91 ? 89  ALA C CA  1 
ATOM   2597 C  C   . ALA C 3 71  ? -51.521 20.822 27.951  1.00 23.97 ? 89  ALA C C   1 
ATOM   2598 O  O   . ALA C 3 71  ? -51.667 19.869 27.179  1.00 25.65 ? 89  ALA C O   1 
ATOM   2599 C  CB  . ALA C 3 71  ? -53.205 21.045 29.797  1.00 23.86 ? 89  ALA C CB  1 
ATOM   2600 N  N   . LEU C 3 72  ? -51.121 22.034 27.552  1.00 24.05 ? 90  LEU C N   1 
ATOM   2601 C  CA  . LEU C 3 72  ? -50.909 22.309 26.115  1.00 26.93 ? 90  LEU C CA  1 
ATOM   2602 C  C   . LEU C 3 72  ? -49.675 21.624 25.516  1.00 30.44 ? 90  LEU C C   1 
ATOM   2603 O  O   . LEU C 3 72  ? -49.491 21.618 24.290  1.00 32.65 ? 90  LEU C O   1 
ATOM   2604 C  CB  . LEU C 3 72  ? -50.853 23.815 25.862  1.00 26.54 ? 90  LEU C CB  1 
ATOM   2605 C  CG  . LEU C 3 72  ? -52.159 24.606 25.985  1.00 26.28 ? 90  LEU C CG  1 
ATOM   2606 C  CD1 . LEU C 3 72  ? -51.893 26.106 26.098  1.00 31.03 ? 90  LEU C CD1 1 
ATOM   2607 C  CD2 . LEU C 3 72  ? -53.021 24.231 24.762  1.00 24.60 ? 90  LEU C CD2 1 
ATOM   2608 N  N   . LYS C 3 73  ? -48.804 21.074 26.364  1.00 29.53 ? 91  LYS C N   1 
ATOM   2609 C  CA  . LYS C 3 73  ? -47.635 20.328 25.880  1.00 30.45 ? 91  LYS C CA  1 
ATOM   2610 C  C   . LYS C 3 73  ? -47.977 18.951 25.333  1.00 32.37 ? 91  LYS C C   1 
ATOM   2611 O  O   . LYS C 3 73  ? -47.236 18.408 24.519  1.00 33.74 ? 91  LYS C O   1 
ATOM   2612 C  CB  . LYS C 3 73  ? -46.598 20.185 27.006  1.00 31.06 ? 91  LYS C CB  1 
ATOM   2613 C  CG  . LYS C 3 73  ? -45.987 21.530 27.314  1.00 33.59 ? 91  LYS C CG  1 
ATOM   2614 C  CD  . LYS C 3 73  ? -45.067 21.498 28.516  1.00 41.10 ? 91  LYS C CD  1 
ATOM   2615 C  CE  . LYS C 3 73  ? -44.232 22.759 28.482  1.00 46.53 ? 91  LYS C CE  1 
ATOM   2616 N  NZ  . LYS C 3 73  ? -43.824 23.189 29.836  1.00 55.92 ? 91  LYS C NZ  1 
ATOM   2617 N  N   . ARG C 3 74  ? -49.109 18.393 25.758  1.00 34.50 ? 92  ARG C N   1 
ATOM   2618 C  CA  . ARG C 3 74  ? -49.479 17.030 25.374  1.00 33.02 ? 92  ARG C CA  1 
ATOM   2619 C  C   . ARG C 3 74  ? -49.675 16.852 23.872  1.00 34.94 ? 92  ARG C C   1 
ATOM   2620 O  O   . ARG C 3 74  ? -49.418 15.766 23.339  1.00 35.37 ? 92  ARG C O   1 
ATOM   2621 C  CB  . ARG C 3 74  ? -50.757 16.615 26.098  1.00 36.47 ? 92  ARG C CB  1 
ATOM   2622 C  CG  . ARG C 3 74  ? -51.100 15.165 25.908  1.00 39.11 ? 92  ARG C CG  1 
ATOM   2623 C  CD  . ARG C 3 74  ? -52.272 14.794 26.799  1.00 45.08 ? 92  ARG C CD  1 
ATOM   2624 N  NE  . ARG C 3 74  ? -52.472 13.357 26.838  1.00 48.62 ? 92  ARG C NE  1 
ATOM   2625 C  CZ  . ARG C 3 74  ? -53.249 12.750 27.727  1.00 52.79 ? 92  ARG C CZ  1 
ATOM   2626 N  NH1 . ARG C 3 74  ? -53.895 13.471 28.647  1.00 50.03 ? 92  ARG C NH1 1 
ATOM   2627 N  NH2 . ARG C 3 74  ? -53.383 11.428 27.698  1.00 50.96 ? 92  ARG C NH2 1 
ATOM   2628 N  N   . GLN C 3 75  ? -50.109 17.915 23.192  1.00 29.47 ? 93  GLN C N   1 
ATOM   2629 C  CA  . GLN C 3 75  ? -50.299 17.888 21.728  1.00 34.76 ? 93  GLN C CA  1 
ATOM   2630 C  C   . GLN C 3 75  ? -49.006 17.727 20.949  1.00 32.40 ? 93  GLN C C   1 
ATOM   2631 O  O   . GLN C 3 75  ? -49.021 17.475 19.725  1.00 32.79 ? 93  GLN C O   1 
ATOM   2632 C  CB  . GLN C 3 75  ? -51.000 19.177 21.261  1.00 34.00 ? 93  GLN C CB  1 
ATOM   2633 C  CG  . GLN C 3 75  ? -50.192 20.481 21.483  1.00 36.49 ? 93  GLN C CG  1 
ATOM   2634 C  CD  . GLN C 3 75  ? -50.968 21.740 21.037  1.00 39.84 ? 93  GLN C CD  1 
ATOM   2635 O  OE1 . GLN C 3 75  ? -51.120 22.709 21.810  1.00 38.07 ? 93  GLN C OE1 1 
ATOM   2636 N  NE2 . GLN C 3 75  ? -51.435 21.737 19.785  1.00 32.99 ? 93  GLN C NE2 1 
ATOM   2637 N  N   . GLY C 3 76  ? -47.896 17.866 21.649  1.00 29.75 ? 94  GLY C N   1 
ATOM   2638 C  CA  . GLY C 3 76  ? -46.581 17.792 21.017  1.00 29.88 ? 94  GLY C CA  1 
ATOM   2639 C  C   . GLY C 3 76  ? -46.246 19.046 20.236  1.00 31.85 ? 94  GLY C C   1 
ATOM   2640 O  O   . GLY C 3 76  ? -46.979 20.049 20.299  1.00 31.56 ? 94  GLY C O   1 
ATOM   2641 N  N   . ARG C 3 77  ? -45.112 19.015 19.547  1.00 30.39 ? 95  ARG C N   1 
ATOM   2642 C  CA  . ARG C 3 77  ? -44.643 20.170 18.807  1.00 35.80 ? 95  ARG C CA  1 
ATOM   2643 C  C   . ARG C 3 77  ? -44.490 19.740 17.372  1.00 32.66 ? 95  ARG C C   1 
ATOM   2644 O  O   . ARG C 3 77  ? -43.708 18.838 17.108  1.00 29.09 ? 95  ARG C O   1 
ATOM   2645 C  CB  . ARG C 3 77  ? -43.288 20.632 19.353  1.00 37.90 ? 95  ARG C CB  1 
ATOM   2646 C  CG  . ARG C 3 77  ? -43.388 21.170 20.771  1.00 44.62 ? 95  ARG C CG  1 
ATOM   2647 C  CD  . ARG C 3 77  ? -42.084 21.868 21.231  1.00 48.79 ? 95  ARG C CD  1 
ATOM   2648 N  NE  . ARG C 3 77  ? -42.284 22.533 22.527  1.00 59.28 ? 95  ARG C NE  1 
ATOM   2649 C  CZ  . ARG C 3 77  ? -41.315 23.098 23.244  1.00 62.25 ? 95  ARG C CZ  1 
ATOM   2650 N  NH1 . ARG C 3 77  ? -40.061 23.080 22.801  1.00 64.37 ? 95  ARG C NH1 1 
ATOM   2651 N  NH2 . ARG C 3 77  ? -41.604 23.675 24.405  1.00 64.80 ? 95  ARG C NH2 1 
ATOM   2652 N  N   . THR C 3 78  ? -45.216 20.380 16.454  1.00 32.56 ? 96  THR C N   1 
ATOM   2653 C  CA  . THR C 3 78  ? -45.171 19.951 15.030  1.00 35.11 ? 96  THR C CA  1 
ATOM   2654 C  C   . THR C 3 78  ? -44.437 20.952 14.182  1.00 39.56 ? 96  THR C C   1 
ATOM   2655 O  O   . THR C 3 78  ? -44.774 22.124 14.203  1.00 37.38 ? 96  THR C O   1 
ATOM   2656 C  CB  . THR C 3 78  ? -46.607 19.799 14.390  1.00 35.91 ? 96  THR C CB  1 
ATOM   2657 O  OG1 . THR C 3 78  ? -47.412 18.927 15.201  1.00 34.02 ? 96  THR C OG1 1 
ATOM   2658 C  CG2 . THR C 3 78  ? -46.533 19.282 12.912  1.00 33.33 ? 96  THR C CG2 1 
ATOM   2659 N  N   . LEU C 3 79  ? -43.448 20.499 13.414  1.00 40.62 ? 97  LEU C N   1 
ATOM   2660 C  CA  . LEU C 3 79  ? -42.795 21.419 12.488  1.00 44.11 ? 97  LEU C CA  1 
ATOM   2661 C  C   . LEU C 3 79  ? -42.581 20.816 11.103  1.00 45.16 ? 97  LEU C C   1 
ATOM   2662 O  O   . LEU C 3 79  ? -42.942 19.667 10.840  1.00 36.95 ? 97  LEU C O   1 
ATOM   2663 C  CB  . LEU C 3 79  ? -41.492 21.945 13.074  1.00 47.17 ? 97  LEU C CB  1 
ATOM   2664 C  CG  . LEU C 3 79  ? -40.391 20.945 13.365  1.00 50.51 ? 97  LEU C CG  1 
ATOM   2665 C  CD1 . LEU C 3 79  ? -40.859 19.962 14.415  1.00 51.92 ? 97  LEU C CD1 1 
ATOM   2666 C  CD2 . LEU C 3 79  ? -40.004 20.258 12.093  1.00 51.58 ? 97  LEU C CD2 1 
ATOM   2667 N  N   . TYR C 3 80  ? -42.028 21.604 10.190  1.00 46.87 ? 98  TYR C N   1 
ATOM   2668 C  CA  . TYR C 3 80  ? -41.772 21.094 8.853   1.00 50.09 ? 98  TYR C CA  1 
ATOM   2669 C  C   . TYR C 3 80  ? -40.322 20.627 8.847   1.00 52.54 ? 98  TYR C C   1 
ATOM   2670 O  O   . TYR C 3 80  ? -39.443 21.364 9.277   1.00 56.30 ? 98  TYR C O   1 
ATOM   2671 C  CB  . TYR C 3 80  ? -42.018 22.207 7.808   1.00 49.92 ? 98  TYR C CB  1 
ATOM   2672 N  N   . GLY C 3 81  ? -40.055 19.399 8.421   1.00 52.92 ? 99  GLY C N   1 
ATOM   2673 C  CA  . GLY C 3 81  ? -38.665 18.905 8.422   1.00 54.90 ? 99  GLY C CA  1 
ATOM   2674 C  C   . GLY C 3 81  ? -38.190 18.346 9.760   1.00 55.29 ? 99  GLY C C   1 
ATOM   2675 O  O   . GLY C 3 81  ? -38.925 18.333 10.741  1.00 54.24 ? 99  GLY C O   1 
ATOM   2676 N  N   . PHE C 3 82  ? -36.940 17.910 9.818   1.00 56.92 ? 100 PHE C N   1 
ATOM   2677 C  CA  . PHE C 3 82  ? -36.439 17.205 11.001  1.00 57.26 ? 100 PHE C CA  1 
ATOM   2678 C  C   . PHE C 3 82  ? -35.488 17.984 11.915  1.00 60.35 ? 100 PHE C C   1 
ATOM   2679 O  O   . PHE C 3 82  ? -34.759 17.385 12.713  1.00 61.83 ? 100 PHE C O   1 
ATOM   2680 C  CB  . PHE C 3 82  ? -35.792 15.898 10.546  1.00 53.72 ? 100 PHE C CB  1 
ATOM   2681 C  CG  . PHE C 3 82  ? -36.636 15.139 9.576   1.00 50.37 ? 100 PHE C CG  1 
ATOM   2682 C  CD1 . PHE C 3 82  ? -36.543 15.381 8.217   1.00 49.37 ? 100 PHE C CD1 1 
ATOM   2683 C  CD2 . PHE C 3 82  ? -37.555 14.206 10.025  1.00 49.26 ? 100 PHE C CD2 1 
ATOM   2684 C  CE1 . PHE C 3 82  ? -37.339 14.699 7.308   1.00 47.94 ? 100 PHE C CE1 1 
ATOM   2685 C  CE2 . PHE C 3 82  ? -38.356 13.514 9.125   1.00 46.19 ? 100 PHE C CE2 1 
ATOM   2686 C  CZ  . PHE C 3 82  ? -38.249 13.759 7.762   1.00 49.25 ? 100 PHE C CZ  1 
ATOM   2687 N  N   . GLY C 3 83  ? -35.508 19.312 11.812  1.00 62.38 ? 101 GLY C N   1 
ATOM   2688 C  CA  . GLY C 3 83  ? -34.651 20.163 12.645  1.00 64.00 ? 101 GLY C CA  1 
ATOM   2689 C  C   . GLY C 3 83  ? -34.909 20.028 14.137  1.00 64.94 ? 101 GLY C C   1 
ATOM   2690 O  O   . GLY C 3 83  ? -36.059 19.941 14.577  1.00 65.90 ? 101 GLY C O   1 
HETATM 2691 ZN ZN  . ZN  D 4 .   ? -57.029 0.600  -18.906 0.50 36.96 ? 403 ZN  A ZN  1 
HETATM 2692 C  C1  . GOL E 5 .   ? -56.490 15.308 -7.988  1.00 36.85 ? 501 GOL A C1  1 
HETATM 2693 O  O1  . GOL E 5 .   ? -55.255 15.164 -8.598  1.00 41.55 ? 501 GOL A O1  1 
HETATM 2694 C  C2  . GOL E 5 .   ? -56.575 14.174 -7.005  1.00 45.05 ? 501 GOL A C2  1 
HETATM 2695 O  O2  . GOL E 5 .   ? -57.126 14.557 -5.759  1.00 42.91 ? 501 GOL A O2  1 
HETATM 2696 C  C3  . GOL E 5 .   ? -57.189 12.968 -7.713  1.00 35.52 ? 501 GOL A C3  1 
HETATM 2697 O  O3  . GOL E 5 .   ? -58.089 12.327 -6.861  1.00 36.82 ? 501 GOL A O3  1 
HETATM 2698 S  S   . SO4 F 6 .   ? -66.661 38.565 15.290  1.00 38.47 ? 401 SO4 B S   1 
HETATM 2699 O  O1  . SO4 F 6 .   ? -65.991 39.342 16.333  1.00 43.07 ? 401 SO4 B O1  1 
HETATM 2700 O  O2  . SO4 F 6 .   ? -68.091 38.414 15.525  1.00 44.04 ? 401 SO4 B O2  1 
HETATM 2701 O  O3  . SO4 F 6 .   ? -66.063 37.258 15.378  1.00 45.83 ? 401 SO4 B O3  1 
HETATM 2702 O  O4  . SO4 F 6 .   ? -66.406 39.141 13.978  1.00 45.31 ? 401 SO4 B O4  1 
HETATM 2703 S  S   . SO4 G 6 .   ? -59.586 14.748 -3.585  1.00 37.15 ? 402 SO4 B S   1 
HETATM 2704 O  O1  . SO4 G 6 .   ? -59.785 14.989 -2.153  1.00 32.89 ? 402 SO4 B O1  1 
HETATM 2705 O  O2  . SO4 G 6 .   ? -60.770 13.955 -3.991  1.00 37.29 ? 402 SO4 B O2  1 
HETATM 2706 O  O3  . SO4 G 6 .   ? -58.293 14.088 -3.904  1.00 39.58 ? 402 SO4 B O3  1 
HETATM 2707 O  O4  . SO4 G 6 .   ? -59.672 15.983 -4.420  1.00 42.25 ? 402 SO4 B O4  1 
HETATM 2708 C  C1  . GOL H 5 .   ? -70.059 21.449 26.359  1.00 52.56 ? 502 GOL C C1  1 
HETATM 2709 O  O1  . GOL H 5 .   ? -70.107 20.075 26.078  1.00 55.73 ? 502 GOL C O1  1 
HETATM 2710 C  C2  . GOL H 5 .   ? -70.440 22.251 25.122  1.00 56.44 ? 502 GOL C C2  1 
HETATM 2711 O  O2  . GOL H 5 .   ? -70.452 21.444 23.961  1.00 57.14 ? 502 GOL C O2  1 
HETATM 2712 C  C3  . GOL H 5 .   ? -71.821 22.816 25.369  1.00 57.42 ? 502 GOL C C3  1 
HETATM 2713 O  O3  . GOL H 5 .   ? -71.667 24.075 25.971  1.00 57.62 ? 502 GOL C O3  1 
HETATM 2714 O  O   . HOH I 7 .   ? -46.459 15.972 2.968   1.00 23.68 ? 502 HOH A O   1 
HETATM 2715 O  O   . HOH I 7 .   ? -50.483 2.983  -2.328  1.00 26.95 ? 503 HOH A O   1 
HETATM 2716 O  O   . HOH I 7 .   ? -51.712 5.502  -2.406  1.00 26.52 ? 504 HOH A O   1 
HETATM 2717 O  O   . HOH I 7 .   ? -47.031 14.685 12.634  1.00 25.36 ? 505 HOH A O   1 
HETATM 2718 O  O   . HOH I 7 .   ? -49.242 18.459 39.938  1.00 27.15 ? 506 HOH A O   1 
HETATM 2719 O  O   . HOH I 7 .   ? -58.679 5.486  8.054   1.00 29.89 ? 507 HOH A O   1 
HETATM 2720 O  O   . HOH I 7 .   ? -56.507 5.774  -0.972  1.00 25.26 ? 508 HOH A O   1 
HETATM 2721 O  O   . HOH I 7 .   ? -44.789 -4.640 4.513   1.00 31.02 ? 509 HOH A O   1 
HETATM 2722 O  O   . HOH I 7 .   ? -58.430 1.081  4.403   1.00 31.34 ? 510 HOH A O   1 
HETATM 2723 O  O   . HOH I 7 .   ? -44.791 7.126  -3.940  1.00 31.12 ? 511 HOH A O   1 
HETATM 2724 O  O   . HOH I 7 .   ? -58.009 6.944  1.063   1.00 31.90 ? 512 HOH A O   1 
HETATM 2725 O  O   . HOH I 7 .   ? -62.155 7.005  -5.522  1.00 35.57 ? 513 HOH A O   1 
HETATM 2726 O  O   . HOH I 7 .   ? -37.787 12.419 0.631   1.00 35.14 ? 514 HOH A O   1 
HETATM 2727 O  O   . HOH I 7 .   ? -37.150 12.735 19.542  1.00 37.51 ? 515 HOH A O   1 
HETATM 2728 O  O   . HOH I 7 .   ? -34.912 3.077  29.402  1.00 40.60 ? 516 HOH A O   1 
HETATM 2729 O  O   . HOH I 7 .   ? -42.035 0.607  21.457  1.00 31.57 ? 517 HOH A O   1 
HETATM 2730 O  O   . HOH I 7 .   ? -46.866 -2.472 -8.714  1.00 35.23 ? 518 HOH A O   1 
HETATM 2731 O  O   . HOH I 7 .   ? -51.391 0.793  -9.398  1.00 34.16 ? 519 HOH A O   1 
HETATM 2732 O  O   . HOH I 7 .   ? -39.062 13.427 3.365   1.00 38.28 ? 520 HOH A O   1 
HETATM 2733 O  O   . HOH I 7 .   ? -41.267 -4.680 23.278  1.00 30.81 ? 521 HOH A O   1 
HETATM 2734 O  O   . HOH I 7 .   ? -43.175 5.270  -2.137  1.00 33.28 ? 522 HOH A O   1 
HETATM 2735 O  O   . HOH I 7 .   ? -41.402 4.913  -8.631  1.00 36.16 ? 523 HOH A O   1 
HETATM 2736 O  O   . HOH I 7 .   ? -60.501 10.892 11.010  1.00 35.44 ? 524 HOH A O   1 
HETATM 2737 O  O   . HOH I 7 .   ? -47.891 5.010  11.992  1.00 30.82 ? 525 HOH A O   1 
HETATM 2738 O  O   . HOH I 7 .   ? -53.960 -2.797 9.737   1.00 38.25 ? 526 HOH A O   1 
HETATM 2739 O  O   . HOH I 7 .   ? -43.554 -6.304 8.255   1.00 39.49 ? 527 HOH A O   1 
HETATM 2740 O  O   . HOH I 7 .   ? -38.127 8.366  -7.051  1.00 40.24 ? 528 HOH A O   1 
HETATM 2741 O  O   . HOH I 7 .   ? -43.763 9.498  28.847  1.00 36.84 ? 529 HOH A O   1 
HETATM 2742 O  O   . HOH I 7 .   ? -58.068 10.776 -10.875 1.00 32.58 ? 530 HOH A O   1 
HETATM 2743 O  O   . HOH I 7 .   ? -40.170 12.451 -4.172  1.00 40.63 ? 531 HOH A O   1 
HETATM 2744 O  O   . HOH I 7 .   ? -37.406 12.915 16.624  1.00 42.75 ? 532 HOH A O   1 
HETATM 2745 O  O   . HOH I 7 .   ? -58.497 9.442  3.283   1.00 36.33 ? 533 HOH A O   1 
HETATM 2746 O  O   . HOH I 7 .   ? -53.626 -3.946 4.726   1.00 42.16 ? 534 HOH A O   1 
HETATM 2747 O  O   . HOH I 7 .   ? -46.237 9.837  24.037  1.00 41.44 ? 535 HOH A O   1 
HETATM 2748 O  O   . HOH I 7 .   ? -41.902 5.640  0.122   1.00 40.63 ? 536 HOH A O   1 
HETATM 2749 O  O   . HOH I 7 .   ? -39.266 13.214 20.745  1.00 43.50 ? 537 HOH A O   1 
HETATM 2750 O  O   . HOH I 7 .   ? -39.812 -3.395 5.165   1.00 38.97 ? 538 HOH A O   1 
HETATM 2751 O  O   . HOH I 7 .   ? -58.963 -2.484 -10.095 1.00 44.36 ? 539 HOH A O   1 
HETATM 2752 O  O   . HOH I 7 .   ? -42.048 2.475  -7.532  1.00 36.86 ? 540 HOH A O   1 
HETATM 2753 O  O   . HOH I 7 .   ? -50.534 11.073 -8.286  1.00 36.81 ? 541 HOH A O   1 
HETATM 2754 O  O   . HOH I 7 .   ? -34.953 14.064 5.550   1.00 43.21 ? 542 HOH A O   1 
HETATM 2755 O  O   . HOH I 7 .   ? -62.990 5.623  -10.188 1.00 42.37 ? 543 HOH A O   1 
HETATM 2756 O  O   . HOH I 7 .   ? -54.793 -3.527 -3.820  1.00 43.33 ? 544 HOH A O   1 
HETATM 2757 O  O   . HOH I 7 .   ? -44.517 2.549  17.293  1.00 42.90 ? 545 HOH A O   1 
HETATM 2758 O  O   . HOH I 7 .   ? -52.264 -2.523 -3.572  1.00 39.55 ? 546 HOH A O   1 
HETATM 2759 O  O   . HOH I 7 .   ? -32.573 8.749  5.734   1.00 38.27 ? 547 HOH A O   1 
HETATM 2760 O  O   . HOH I 7 .   ? -26.992 0.614  13.378  1.00 43.34 ? 548 HOH A O   1 
HETATM 2761 O  O   . HOH I 7 .   ? -41.352 7.825  -10.341 1.00 41.42 ? 549 HOH A O   1 
HETATM 2762 O  O   . HOH I 7 .   ? -50.592 -4.160 3.247   1.00 35.99 ? 550 HOH A O   1 
HETATM 2763 O  O   . HOH I 7 .   ? -27.332 1.597  11.061  1.00 44.83 ? 551 HOH A O   1 
HETATM 2764 O  O   . HOH I 7 .   ? -39.547 -2.638 25.169  1.00 41.50 ? 552 HOH A O   1 
HETATM 2765 O  O   . HOH I 7 .   ? -52.305 10.997 12.962  1.00 46.77 ? 553 HOH A O   1 
HETATM 2766 O  O   . HOH I 7 .   ? -60.986 -0.869 6.054   1.00 49.72 ? 554 HOH A O   1 
HETATM 2767 O  O   . HOH I 7 .   ? -58.997 9.600  0.585   1.00 34.51 ? 555 HOH A O   1 
HETATM 2768 O  O   . HOH I 7 .   ? -47.121 -7.134 4.402   1.00 45.40 ? 556 HOH A O   1 
HETATM 2769 O  O   . HOH I 7 .   ? -33.340 15.568 7.388   1.00 45.24 ? 557 HOH A O   1 
HETATM 2770 O  O   . HOH I 7 .   ? -57.788 1.951  -20.465 1.00 60.38 ? 558 HOH A O   1 
HETATM 2771 O  O   . HOH I 7 .   ? -62.325 11.296 -0.852  1.00 50.59 ? 559 HOH A O   1 
HETATM 2772 O  O   . HOH I 7 .   ? -50.635 -5.096 -0.338  1.00 44.71 ? 560 HOH A O   1 
HETATM 2773 O  O   . HOH I 7 .   ? -37.527 12.554 29.410  1.00 46.97 ? 561 HOH A O   1 
HETATM 2774 O  O   . HOH I 7 .   ? -64.104 0.493  -14.161 1.00 46.44 ? 562 HOH A O   1 
HETATM 2775 O  O   . HOH I 7 .   ? -32.457 -0.377 23.823  1.00 50.68 ? 563 HOH A O   1 
HETATM 2776 O  O   . HOH I 7 .   ? -22.708 7.167  14.966  1.00 46.55 ? 564 HOH A O   1 
HETATM 2777 O  O   . HOH I 7 .   ? -54.152 3.456  13.196  1.00 40.64 ? 565 HOH A O   1 
HETATM 2778 O  O   . HOH I 7 .   ? -50.577 13.946 -7.865  1.00 40.11 ? 566 HOH A O   1 
HETATM 2779 O  O   . HOH I 7 .   ? -47.030 14.205 33.787  1.00 51.60 ? 567 HOH A O   1 
HETATM 2780 O  O   . HOH I 7 .   ? -61.016 12.045 -5.933  1.00 50.46 ? 568 HOH A O   1 
HETATM 2781 O  O   . HOH I 7 .   ? -35.990 9.684  31.181  1.00 46.64 ? 569 HOH A O   1 
HETATM 2782 O  O   . HOH I 7 .   ? -42.615 17.972 22.234  1.00 50.87 ? 570 HOH A O   1 
HETATM 2783 O  O   . HOH I 7 .   ? -62.678 9.977  -5.218  1.00 49.61 ? 571 HOH A O   1 
HETATM 2784 O  O   . HOH I 7 .   ? -37.210 -3.920 3.392   1.00 45.70 ? 572 HOH A O   1 
HETATM 2785 O  O   . HOH I 7 .   ? -51.328 -1.956 -10.436 1.00 42.50 ? 573 HOH A O   1 
HETATM 2786 O  O   . HOH I 7 .   ? -58.390 -1.729 7.545   1.00 53.14 ? 574 HOH A O   1 
HETATM 2787 O  O   . HOH I 7 .   ? -31.251 12.336 20.027  1.00 54.32 ? 575 HOH A O   1 
HETATM 2788 O  O   . HOH I 7 .   ? -39.159 20.836 -3.643  1.00 81.26 ? 576 HOH A O   1 
HETATM 2789 O  O   . HOH I 7 .   ? -44.472 15.445 -4.595  1.00 46.63 ? 577 HOH A O   1 
HETATM 2790 O  O   . HOH I 7 .   ? -44.879 16.476 24.448  1.00 45.47 ? 578 HOH A O   1 
HETATM 2791 O  O   . HOH I 7 .   ? -38.472 13.107 24.801  1.00 48.24 ? 579 HOH A O   1 
HETATM 2792 O  O   . HOH I 7 .   ? -43.409 -1.291 20.572  1.00 39.96 ? 580 HOH A O   1 
HETATM 2793 O  O   . HOH I 7 .   ? -24.434 0.450  20.848  1.00 49.75 ? 581 HOH A O   1 
HETATM 2794 O  O   . HOH I 7 .   ? -42.151 -4.970 -0.367  1.00 64.45 ? 582 HOH A O   1 
HETATM 2795 O  O   . HOH I 7 .   ? -34.772 -4.034 24.219  1.00 42.83 ? 583 HOH A O   1 
HETATM 2796 O  O   . HOH I 7 .   ? -67.736 1.381  -13.200 1.00 61.98 ? 584 HOH A O   1 
HETATM 2797 O  O   . HOH I 7 .   ? -66.356 10.593 -0.108  1.00 54.65 ? 585 HOH A O   1 
HETATM 2798 O  O   . HOH I 7 .   ? -42.631 16.593 -2.958  1.00 36.92 ? 586 HOH A O   1 
HETATM 2799 O  O   . HOH I 7 .   ? -52.019 9.316  36.238  1.00 52.35 ? 587 HOH A O   1 
HETATM 2800 O  O   . HOH I 7 .   ? -43.271 20.363 5.872   1.00 51.72 ? 588 HOH A O   1 
HETATM 2801 O  O   . HOH I 7 .   ? -44.156 26.159 -1.512  1.00 42.19 ? 589 HOH A O   1 
HETATM 2802 O  O   . HOH I 7 .   ? -37.167 2.984  29.880  1.00 56.37 ? 590 HOH A O   1 
HETATM 2803 O  O   . HOH I 7 .   ? -55.601 -3.786 7.732   1.00 49.95 ? 591 HOH A O   1 
HETATM 2804 O  O   . HOH I 7 .   ? -47.572 12.209 -10.116 1.00 51.44 ? 592 HOH A O   1 
HETATM 2805 O  O   . HOH I 7 .   ? -31.878 11.409 5.553   1.00 44.57 ? 593 HOH A O   1 
HETATM 2806 O  O   . HOH I 7 .   ? -32.936 -2.076 6.441   1.00 43.00 ? 594 HOH A O   1 
HETATM 2807 O  O   . HOH I 7 .   ? -46.927 8.413  39.746  1.00 54.90 ? 595 HOH A O   1 
HETATM 2808 O  O   . HOH I 7 .   ? -48.555 -4.865 4.960   1.00 44.22 ? 596 HOH A O   1 
HETATM 2809 O  O   . HOH I 7 .   ? -38.487 2.517  6.902   1.00 65.51 ? 597 HOH A O   1 
HETATM 2810 O  O   . HOH I 7 .   ? -36.074 -2.524 28.808  1.00 68.25 ? 598 HOH A O   1 
HETATM 2811 O  O   . HOH I 7 .   ? -57.817 -0.185 11.275  1.00 59.06 ? 599 HOH A O   1 
HETATM 2812 O  O   . HOH I 7 .   ? -67.889 5.474  1.055   1.00 58.03 ? 600 HOH A O   1 
HETATM 2813 O  O   . HOH I 7 .   ? -64.045 11.857 3.117   1.00 40.80 ? 601 HOH A O   1 
HETATM 2814 O  O   . HOH I 7 .   ? -50.739 2.972  -11.968 1.00 44.39 ? 602 HOH A O   1 
HETATM 2815 O  O   . HOH I 7 .   ? -29.570 -1.443 9.208   1.00 51.38 ? 603 HOH A O   1 
HETATM 2816 O  O   . HOH I 7 .   ? -34.478 6.961  -4.688  1.00 51.45 ? 604 HOH A O   1 
HETATM 2817 O  O   . HOH I 7 .   ? -31.533 16.338 10.797  1.00 51.22 ? 605 HOH A O   1 
HETATM 2818 O  O   . HOH I 7 .   ? -42.396 19.685 26.614  1.00 58.26 ? 606 HOH A O   1 
HETATM 2819 O  O   . HOH I 7 .   ? -32.368 16.893 18.059  1.00 65.41 ? 607 HOH A O   1 
HETATM 2820 O  O   . HOH I 7 .   ? -44.869 8.599  30.930  1.00 42.24 ? 608 HOH A O   1 
HETATM 2821 O  O   . HOH I 7 .   ? -48.451 4.109  33.057  1.00 68.70 ? 609 HOH A O   1 
HETATM 2822 O  O   . HOH I 7 .   ? -52.639 7.608  14.295  1.00 53.84 ? 610 HOH A O   1 
HETATM 2823 O  O   . HOH I 7 .   ? -47.859 -5.070 -4.479  1.00 54.36 ? 611 HOH A O   1 
HETATM 2824 O  O   . HOH I 7 .   ? -24.718 4.577  26.431  1.00 58.64 ? 612 HOH A O   1 
HETATM 2825 O  O   . HOH I 7 .   ? -24.803 9.892  18.726  1.00 58.52 ? 613 HOH A O   1 
HETATM 2826 O  O   . HOH I 7 .   ? -38.899 -2.531 -2.801  1.00 59.15 ? 614 HOH A O   1 
HETATM 2827 O  O   . HOH I 7 .   ? -31.361 5.042  0.581   1.00 70.94 ? 615 HOH A O   1 
HETATM 2828 O  O   . HOH I 7 .   ? -40.522 -2.874 29.858  1.00 68.75 ? 616 HOH A O   1 
HETATM 2829 O  O   . HOH I 7 .   ? -60.516 10.247 -8.969  1.00 55.09 ? 617 HOH A O   1 
HETATM 2830 O  O   . HOH I 7 .   ? -47.016 -3.256 -11.247 1.00 53.10 ? 618 HOH A O   1 
HETATM 2831 O  O   . HOH I 7 .   ? -63.177 7.192  -7.942  1.00 47.00 ? 619 HOH A O   1 
HETATM 2832 O  O   . HOH I 7 .   ? -47.586 23.693 -1.421  1.00 49.48 ? 620 HOH A O   1 
HETATM 2833 O  O   . HOH I 7 .   ? -45.620 9.239  26.790  1.00 54.54 ? 621 HOH A O   1 
HETATM 2834 O  O   . HOH I 7 .   ? -49.808 3.971  -14.040 1.00 50.52 ? 622 HOH A O   1 
HETATM 2835 O  O   . HOH I 7 .   ? -45.604 25.430 2.873   1.00 43.94 ? 623 HOH A O   1 
HETATM 2836 O  O   . HOH I 7 .   ? -24.297 3.658  15.302  1.00 46.22 ? 624 HOH A O   1 
HETATM 2837 O  O   . HOH I 7 .   ? -59.240 4.159  -19.385 1.00 59.57 ? 625 HOH A O   1 
HETATM 2838 O  O   . HOH I 7 .   ? -56.465 -4.352 -5.902  1.00 54.96 ? 626 HOH A O   1 
HETATM 2839 O  O   . HOH I 7 .   ? -44.210 -0.693 -11.010 1.00 61.58 ? 627 HOH A O   1 
HETATM 2840 O  O   . HOH I 7 .   ? -64.687 -0.038 -6.819  1.00 49.50 ? 628 HOH A O   1 
HETATM 2841 O  O   . HOH I 7 .   ? -37.912 13.517 -1.828  1.00 51.32 ? 629 HOH A O   1 
HETATM 2842 O  O   . HOH I 7 .   ? -51.692 -4.862 8.802   1.00 52.91 ? 630 HOH A O   1 
HETATM 2843 O  O   . HOH I 7 .   ? -52.195 14.922 -13.931 1.00 61.63 ? 631 HOH A O   1 
HETATM 2844 O  O   . HOH I 7 .   ? -35.986 20.038 27.913  1.00 57.63 ? 632 HOH A O   1 
HETATM 2845 O  O   . HOH I 7 .   ? -29.986 1.381  23.765  1.00 78.87 ? 633 HOH A O   1 
HETATM 2846 O  O   . HOH I 7 .   ? -50.848 8.475  18.520  1.00 76.03 ? 634 HOH A O   1 
HETATM 2847 O  O   . HOH I 7 .   ? -49.691 6.895  13.429  1.00 46.18 ? 635 HOH A O   1 
HETATM 2848 O  O   . HOH I 7 .   ? -39.974 -5.026 30.904  1.00 56.73 ? 636 HOH A O   1 
HETATM 2849 O  O   . HOH I 7 .   ? -51.588 10.687 -12.409 1.00 44.48 ? 637 HOH A O   1 
HETATM 2850 O  O   . HOH I 7 .   ? -66.557 1.311  3.927   1.00 58.07 ? 638 HOH A O   1 
HETATM 2851 O  O   . HOH I 7 .   ? -51.105 -4.820 -4.268  1.00 52.76 ? 639 HOH A O   1 
HETATM 2852 O  O   . HOH I 7 .   ? -67.401 4.298  -1.215  1.00 55.86 ? 640 HOH A O   1 
HETATM 2853 O  O   . HOH I 7 .   ? -37.398 -5.694 0.988   1.00 54.93 ? 641 HOH A O   1 
HETATM 2854 O  O   . HOH I 7 .   ? -28.447 -1.041 25.339  1.00 51.55 ? 642 HOH A O   1 
HETATM 2855 O  O   . HOH I 7 .   ? -58.258 13.555 -11.117 1.00 53.83 ? 643 HOH A O   1 
HETATM 2856 O  O   . HOH I 7 .   ? -57.714 9.085  -21.658 1.00 63.55 ? 644 HOH A O   1 
HETATM 2857 O  O   . HOH I 7 .   ? -37.349 15.383 4.192   1.00 65.53 ? 645 HOH A O   1 
HETATM 2858 O  O   . HOH I 7 .   ? -61.916 0.473  -2.777  1.00 62.77 ? 646 HOH A O   1 
HETATM 2859 O  O   . HOH I 7 .   ? -52.026 9.725  39.994  1.00 62.60 ? 647 HOH A O   1 
HETATM 2860 O  O   . HOH I 7 .   ? -27.475 -0.945 22.570  1.00 53.18 ? 648 HOH A O   1 
HETATM 2861 O  O   . HOH I 7 .   ? -64.869 6.471  13.810  1.00 60.78 ? 649 HOH A O   1 
HETATM 2862 O  O   . HOH I 7 .   ? -34.970 2.131  -3.776  1.00 58.79 ? 650 HOH A O   1 
HETATM 2863 O  O   . HOH I 7 .   ? -49.759 11.651 -10.711 1.00 51.51 ? 651 HOH A O   1 
HETATM 2864 O  O   . HOH I 7 .   ? -41.041 22.489 -1.615  1.00 60.57 ? 652 HOH A O   1 
HETATM 2865 O  O   . HOH I 7 .   ? -53.088 -6.125 -0.569  1.00 66.11 ? 653 HOH A O   1 
HETATM 2866 O  O   . HOH I 7 .   ? -23.808 1.843  28.235  1.00 62.89 ? 654 HOH A O   1 
HETATM 2867 O  O   . HOH I 7 .   ? -49.224 10.527 21.290  1.00 63.44 ? 655 HOH A O   1 
HETATM 2868 O  O   . HOH I 7 .   ? -57.854 1.483  13.367  1.00 60.79 ? 656 HOH A O   1 
HETATM 2869 O  O   . HOH I 7 .   ? -54.633 -6.588 4.264   1.00 48.27 ? 657 HOH A O   1 
HETATM 2870 O  O   . HOH I 7 .   ? -42.885 -2.445 25.959  1.00 64.41 ? 658 HOH A O   1 
HETATM 2871 O  O   . HOH I 7 .   ? -36.909 4.474  -6.990  1.00 56.88 ? 659 HOH A O   1 
HETATM 2872 O  O   . HOH I 7 .   ? -63.314 -1.719 -14.469 1.00 56.51 ? 660 HOH A O   1 
HETATM 2873 O  O   . HOH I 7 .   ? -56.515 16.039 -12.162 1.00 56.35 ? 661 HOH A O   1 
HETATM 2874 O  O   . HOH I 7 .   ? -47.579 6.923  23.279  1.00 58.26 ? 662 HOH A O   1 
HETATM 2875 O  O   . HOH I 7 .   ? -45.739 12.634 25.819  1.00 58.02 ? 663 HOH A O   1 
HETATM 2876 O  O   . HOH I 7 .   ? -44.714 3.426  29.319  1.00 54.95 ? 664 HOH A O   1 
HETATM 2877 O  O   . HOH I 7 .   ? -37.980 7.285  39.519  1.00 59.86 ? 665 HOH A O   1 
HETATM 2878 O  O   . HOH I 7 .   ? -33.374 10.034 30.350  1.00 58.03 ? 666 HOH A O   1 
HETATM 2879 O  O   . HOH I 7 .   ? -58.201 17.201 -24.929 1.00 63.30 ? 667 HOH A O   1 
HETATM 2880 O  O   . HOH I 7 .   ? -57.884 -2.493 -12.163 1.00 60.46 ? 668 HOH A O   1 
HETATM 2881 O  O   . HOH I 7 .   ? -45.719 17.343 -6.065  1.00 55.61 ? 669 HOH A O   1 
HETATM 2882 O  O   . HOH I 7 .   ? -33.950 12.010 28.845  1.00 53.71 ? 670 HOH A O   1 
HETATM 2883 O  O   . HOH I 7 .   ? -43.333 14.299 -7.018  1.00 59.36 ? 671 HOH A O   1 
HETATM 2884 O  O   . HOH I 7 .   ? -39.842 -0.190 37.054  0.50 63.30 ? 672 HOH A O   1 
HETATM 2885 O  O   . HOH I 7 .   ? -67.858 11.147 -2.066  1.00 69.69 ? 673 HOH A O   1 
HETATM 2886 O  O   . HOH I 7 .   ? -63.544 -1.874 -8.328  1.00 65.46 ? 674 HOH A O   1 
HETATM 2887 O  O   . HOH I 7 .   ? -55.462 -5.812 -2.835  1.00 61.87 ? 675 HOH A O   1 
HETATM 2888 O  O   . HOH I 7 .   ? -66.505 0.885  -1.000  1.00 57.41 ? 676 HOH A O   1 
HETATM 2889 O  O   . HOH I 7 .   ? -64.034 5.921  7.694   1.00 62.82 ? 677 HOH A O   1 
HETATM 2890 O  O   . HOH I 7 .   ? -64.150 -1.359 -1.313  1.00 67.17 ? 678 HOH A O   1 
HETATM 2891 O  O   . HOH I 7 .   ? -62.138 7.261  14.044  1.00 54.57 ? 679 HOH A O   1 
HETATM 2892 O  O   . HOH I 7 .   ? -30.038 11.441 -1.239  1.00 66.14 ? 680 HOH A O   1 
HETATM 2893 O  O   . HOH I 7 .   ? -31.037 15.578 23.796  1.00 78.05 ? 681 HOH A O   1 
HETATM 2894 O  O   . HOH J 7 .   ? -65.040 16.483 2.681   1.00 25.74 ? 403 HOH B O   1 
HETATM 2895 O  O   . HOH J 7 .   ? -50.041 28.680 14.673  1.00 28.67 ? 404 HOH B O   1 
HETATM 2896 O  O   . HOH J 7 .   ? -58.822 18.628 17.789  1.00 27.58 ? 405 HOH B O   1 
HETATM 2897 O  O   . HOH J 7 .   ? -51.853 25.549 20.537  1.00 29.87 ? 406 HOH B O   1 
HETATM 2898 O  O   . HOH J 7 .   ? -57.558 27.557 -0.183  1.00 29.71 ? 407 HOH B O   1 
HETATM 2899 O  O   . HOH J 7 .   ? -59.106 13.151 11.743  1.00 29.69 ? 408 HOH B O   1 
HETATM 2900 O  O   . HOH J 7 .   ? -65.562 34.009 20.211  1.00 28.50 ? 409 HOH B O   1 
HETATM 2901 O  O   . HOH J 7 .   ? -48.342 19.794 -3.624  1.00 36.23 ? 410 HOH B O   1 
HETATM 2902 O  O   . HOH J 7 .   ? -50.194 25.710 3.849   1.00 34.65 ? 411 HOH B O   1 
HETATM 2903 O  O   . HOH J 7 .   ? -55.106 27.401 -2.367  1.00 34.46 ? 412 HOH B O   1 
HETATM 2904 O  O   . HOH J 7 .   ? -50.504 17.192 -6.584  1.00 35.59 ? 413 HOH B O   1 
HETATM 2905 O  O   . HOH J 7 .   ? -52.717 22.527 14.718  1.00 37.65 ? 414 HOH B O   1 
HETATM 2906 O  O   . HOH J 7 .   ? -48.621 28.007 12.470  1.00 42.33 ? 415 HOH B O   1 
HETATM 2907 O  O   . HOH J 7 .   ? -60.562 23.395 -7.176  1.00 44.19 ? 416 HOH B O   1 
HETATM 2908 O  O   . HOH J 7 .   ? -58.843 9.238  9.638   1.00 31.13 ? 417 HOH B O   1 
HETATM 2909 O  O   . HOH J 7 .   ? -55.980 25.170 -1.624  1.00 34.26 ? 418 HOH B O   1 
HETATM 2910 O  O   . HOH J 7 .   ? -51.141 30.096 25.192  1.00 36.94 ? 419 HOH B O   1 
HETATM 2911 O  O   . HOH J 7 .   ? -52.554 22.414 -6.632  1.00 46.62 ? 420 HOH B O   1 
HETATM 2912 O  O   . HOH J 7 .   ? -65.516 39.679 24.035  1.00 41.20 ? 421 HOH B O   1 
HETATM 2913 O  O   . HOH J 7 .   ? -68.021 39.828 22.913  1.00 36.62 ? 422 HOH B O   1 
HETATM 2914 O  O   . HOH J 7 .   ? -60.321 21.155 -9.600  1.00 71.42 ? 423 HOH B O   1 
HETATM 2915 O  O   . HOH J 7 .   ? -49.075 24.063 10.259  1.00 43.74 ? 424 HOH B O   1 
HETATM 2916 O  O   . HOH J 7 .   ? -55.781 36.129 35.779  1.00 48.47 ? 425 HOH B O   1 
HETATM 2917 O  O   . HOH J 7 .   ? -67.983 40.242 12.210  1.00 50.46 ? 426 HOH B O   1 
HETATM 2918 O  O   . HOH J 7 .   ? -53.273 32.006 35.750  1.00 45.73 ? 427 HOH B O   1 
HETATM 2919 O  O   . HOH J 7 .   ? -47.657 25.312 8.887   1.00 61.39 ? 428 HOH B O   1 
HETATM 2920 O  O   . HOH J 7 .   ? -64.005 16.438 14.684  1.00 45.25 ? 429 HOH B O   1 
HETATM 2921 O  O   . HOH J 7 .   ? -58.785 36.242 37.237  1.00 51.63 ? 430 HOH B O   1 
HETATM 2922 O  O   . HOH J 7 .   ? -70.412 31.798 34.512  1.00 45.62 ? 431 HOH B O   1 
HETATM 2923 O  O   . HOH J 7 .   ? -66.985 30.257 41.397  1.00 64.54 ? 432 HOH B O   1 
HETATM 2924 O  O   . HOH J 7 .   ? -50.333 29.648 22.569  1.00 47.40 ? 433 HOH B O   1 
HETATM 2925 O  O   . HOH J 7 .   ? -64.269 36.486 17.349  1.00 44.24 ? 434 HOH B O   1 
HETATM 2926 O  O   . HOH J 7 .   ? -61.586 34.455 26.037  1.00 46.57 ? 435 HOH B O   1 
HETATM 2927 O  O   . HOH J 7 .   ? -62.383 40.036 23.087  1.00 54.14 ? 436 HOH B O   1 
HETATM 2928 O  O   . HOH J 7 .   ? -71.435 30.696 31.698  1.00 53.16 ? 437 HOH B O   1 
HETATM 2929 O  O   . HOH J 7 .   ? -54.990 17.984 15.691  1.00 29.36 ? 438 HOH B O   1 
HETATM 2930 O  O   . HOH J 7 .   ? -59.108 16.219 -7.104  1.00 42.28 ? 439 HOH B O   1 
HETATM 2931 O  O   . HOH J 7 .   ? -67.106 33.068 36.318  1.00 56.54 ? 440 HOH B O   1 
HETATM 2932 O  O   . HOH J 7 .   ? -62.858 21.832 -5.122  1.00 44.88 ? 441 HOH B O   1 
HETATM 2933 O  O   . HOH J 7 .   ? -48.592 24.154 -5.675  1.00 39.14 ? 442 HOH B O   1 
HETATM 2934 O  O   . HOH J 7 .   ? -49.325 21.101 -1.110  1.00 46.16 ? 443 HOH B O   1 
HETATM 2935 O  O   . HOH J 7 .   ? -64.547 15.610 0.040   1.00 38.11 ? 444 HOH B O   1 
HETATM 2936 O  O   . HOH J 7 .   ? -71.480 36.312 14.057  1.00 52.49 ? 445 HOH B O   1 
HETATM 2937 O  O   . HOH J 7 .   ? -49.740 26.995 21.580  1.00 48.22 ? 446 HOH B O   1 
HETATM 2938 O  O   . HOH J 7 .   ? -69.060 32.027 30.851  1.00 52.59 ? 447 HOH B O   1 
HETATM 2939 O  O   . HOH J 7 .   ? -54.812 37.050 17.521  1.00 56.53 ? 448 HOH B O   1 
HETATM 2940 O  O   . HOH J 7 .   ? -58.206 12.443 14.393  1.00 40.46 ? 449 HOH B O   1 
HETATM 2941 O  O   . HOH J 7 .   ? -52.018 32.700 19.212  1.00 40.25 ? 450 HOH B O   1 
HETATM 2942 O  O   . HOH J 7 .   ? -49.551 29.186 26.765  1.00 48.54 ? 451 HOH B O   1 
HETATM 2943 O  O   . HOH J 7 .   ? -67.714 17.219 2.851   1.00 46.44 ? 452 HOH B O   1 
HETATM 2944 O  O   . HOH J 7 .   ? -49.713 31.964 20.435  1.00 49.92 ? 453 HOH B O   1 
HETATM 2945 O  O   . HOH J 7 .   ? -52.118 34.100 29.913  1.00 49.66 ? 454 HOH B O   1 
HETATM 2946 O  O   . HOH J 7 .   ? -63.244 40.289 16.823  1.00 51.40 ? 455 HOH B O   1 
HETATM 2947 O  O   . HOH J 7 .   ? -58.712 36.562 26.618  1.00 68.43 ? 456 HOH B O   1 
HETATM 2948 O  O   . HOH J 7 .   ? -65.170 14.058 4.442   1.00 43.98 ? 457 HOH B O   1 
HETATM 2949 O  O   . HOH J 7 .   ? -52.100 14.103 19.839  1.00 70.29 ? 458 HOH B O   1 
HETATM 2950 O  O   . HOH J 7 .   ? -50.754 22.681 16.724  1.00 53.31 ? 459 HOH B O   1 
HETATM 2951 O  O   . HOH J 7 .   ? -47.434 23.488 13.274  1.00 44.49 ? 460 HOH B O   1 
HETATM 2952 O  O   . HOH J 7 .   ? -55.876 23.950 -8.649  1.00 61.70 ? 461 HOH B O   1 
HETATM 2953 O  O   . HOH J 7 .   ? -49.915 31.261 15.449  1.00 52.12 ? 462 HOH B O   1 
HETATM 2954 O  O   . HOH J 7 .   ? -61.682 13.691 17.110  1.00 54.26 ? 463 HOH B O   1 
HETATM 2955 O  O   . HOH J 7 .   ? -58.601 18.370 -8.887  1.00 56.17 ? 464 HOH B O   1 
HETATM 2956 O  O   . HOH J 7 .   ? -59.354 38.075 30.165  1.00 74.65 ? 465 HOH B O   1 
HETATM 2957 O  O   . HOH J 7 .   ? -63.225 17.777 -6.556  1.00 53.97 ? 466 HOH B O   1 
HETATM 2958 O  O   . HOH J 7 .   ? -70.135 38.136 14.453  1.00 50.81 ? 467 HOH B O   1 
HETATM 2959 O  O   . HOH J 7 .   ? -62.534 34.157 33.833  1.00 56.07 ? 468 HOH B O   1 
HETATM 2960 O  O   . HOH J 7 .   ? -47.691 25.159 4.526   1.00 51.73 ? 469 HOH B O   1 
HETATM 2961 O  O   . HOH J 7 .   ? -70.776 39.506 12.422  1.00 46.22 ? 470 HOH B O   1 
HETATM 2962 O  O   . HOH J 7 .   ? -66.071 30.578 35.649  1.00 68.76 ? 471 HOH B O   1 
HETATM 2963 O  O   . HOH J 7 .   ? -69.549 40.862 16.552  1.00 55.43 ? 472 HOH B O   1 
HETATM 2964 O  O   . HOH J 7 .   ? -64.063 30.126 33.711  1.00 51.48 ? 473 HOH B O   1 
HETATM 2965 O  O   . HOH J 7 .   ? -62.958 13.744 -2.570  1.00 59.03 ? 474 HOH B O   1 
HETATM 2966 O  O   . HOH J 7 .   ? -49.451 14.892 -10.609 1.00 57.93 ? 475 HOH B O   1 
HETATM 2967 O  O   . HOH J 7 .   ? -67.044 23.999 36.353  1.00 55.68 ? 476 HOH B O   1 
HETATM 2968 O  O   . HOH J 7 .   ? -60.972 38.515 36.232  1.00 65.84 ? 477 HOH B O   1 
HETATM 2969 O  O   . HOH J 7 .   ? -52.066 18.303 -13.022 1.00 56.97 ? 478 HOH B O   1 
HETATM 2970 O  O   . HOH J 7 .   ? -46.818 21.750 -3.415  1.00 61.27 ? 479 HOH B O   1 
HETATM 2971 O  O   . HOH J 7 .   ? -52.609 22.155 -9.103  1.00 59.50 ? 480 HOH B O   1 
HETATM 2972 O  O   . HOH J 7 .   ? -68.688 36.607 39.489  1.00 61.68 ? 481 HOH B O   1 
HETATM 2973 O  O   . HOH J 7 .   ? -59.526 39.712 14.507  1.00 67.04 ? 482 HOH B O   1 
HETATM 2974 O  O   . HOH J 7 .   ? -64.796 41.513 25.894  1.00 51.45 ? 483 HOH B O   1 
HETATM 2975 O  O   . HOH J 7 .   ? -48.095 28.092 19.139  1.00 59.69 ? 484 HOH B O   1 
HETATM 2976 O  O   . HOH J 7 .   ? -48.383 31.139 10.764  1.00 60.29 ? 485 HOH B O   1 
HETATM 2977 O  O   . HOH K 7 .   ? -66.157 24.205 19.530  1.00 26.14 ? 503 HOH C O   1 
HETATM 2978 O  O   . HOH K 7 .   ? -70.780 24.356 8.426   1.00 28.74 ? 504 HOH C O   1 
HETATM 2979 O  O   . HOH K 7 .   ? -67.194 26.657 18.719  1.00 25.93 ? 505 HOH C O   1 
HETATM 2980 O  O   . HOH K 7 .   ? -53.803 18.187 27.148  1.00 28.91 ? 506 HOH C O   1 
HETATM 2981 O  O   . HOH K 7 .   ? -70.811 31.007 23.590  1.00 27.97 ? 507 HOH C O   1 
HETATM 2982 O  O   . HOH K 7 .   ? -52.754 28.597 -1.572  1.00 27.75 ? 508 HOH C O   1 
HETATM 2983 O  O   . HOH K 7 .   ? -65.133 34.253 17.581  1.00 30.25 ? 509 HOH C O   1 
HETATM 2984 O  O   . HOH K 7 .   ? -47.302 24.942 26.549  1.00 32.59 ? 510 HOH C O   1 
HETATM 2985 O  O   . HOH K 7 .   ? -46.828 25.063 33.533  1.00 29.81 ? 511 HOH C O   1 
HETATM 2986 O  O   . HOH K 7 .   ? -70.685 22.880 21.571  1.00 34.92 ? 512 HOH C O   1 
HETATM 2987 O  O   . HOH K 7 .   ? -50.321 22.933 37.390  1.00 34.69 ? 513 HOH C O   1 
HETATM 2988 O  O   . HOH K 7 .   ? -50.080 31.070 7.309   1.00 34.72 ? 514 HOH C O   1 
HETATM 2989 O  O   . HOH K 7 .   ? -49.201 17.728 28.758  1.00 37.07 ? 515 HOH C O   1 
HETATM 2990 O  O   . HOH K 7 .   ? -51.486 20.293 17.720  1.00 43.84 ? 516 HOH C O   1 
HETATM 2991 O  O   . HOH K 7 .   ? -69.747 35.641 3.969   1.00 63.43 ? 517 HOH C O   1 
HETATM 2992 O  O   . HOH K 7 .   ? -56.908 14.946 28.100  1.00 37.54 ? 518 HOH C O   1 
HETATM 2993 O  O   . HOH K 7 .   ? -79.750 22.840 26.571  1.00 43.79 ? 519 HOH C O   1 
HETATM 2994 O  O   . HOH K 7 .   ? -72.187 25.207 14.107  1.00 38.15 ? 520 HOH C O   1 
HETATM 2995 O  O   . HOH K 7 .   ? -51.447 17.086 30.038  1.00 40.28 ? 521 HOH C O   1 
HETATM 2996 O  O   . HOH K 7 .   ? -68.874 23.336 19.606  1.00 31.80 ? 522 HOH C O   1 
HETATM 2997 O  O   . HOH K 7 .   ? -51.307 27.897 3.628   1.00 34.94 ? 523 HOH C O   1 
HETATM 2998 O  O   . HOH K 7 .   ? -64.070 37.333 8.515   1.00 36.77 ? 524 HOH C O   1 
HETATM 2999 O  O   . HOH K 7 .   ? -60.333 16.150 34.504  1.00 42.80 ? 525 HOH C O   1 
HETATM 3000 O  O   . HOH K 7 .   ? -58.947 27.667 44.034  1.00 49.28 ? 526 HOH C O   1 
HETATM 3001 O  O   . HOH K 7 .   ? -72.789 22.480 8.496   1.00 41.49 ? 527 HOH C O   1 
HETATM 3002 O  O   . HOH K 7 .   ? -66.371 17.655 18.597  1.00 35.74 ? 528 HOH C O   1 
HETATM 3003 O  O   . HOH K 7 .   ? -48.745 19.400 17.567  1.00 39.36 ? 529 HOH C O   1 
HETATM 3004 O  O   . HOH K 7 .   ? -58.556 38.210 7.548   1.00 43.42 ? 530 HOH C O   1 
HETATM 3005 O  O   . HOH K 7 .   ? -50.761 27.090 39.289  1.00 35.87 ? 531 HOH C O   1 
HETATM 3006 O  O   . HOH K 7 .   ? -57.280 17.582 19.816  1.00 37.88 ? 532 HOH C O   1 
HETATM 3007 O  O   . HOH K 7 .   ? -56.235 14.250 32.909  1.00 38.44 ? 533 HOH C O   1 
HETATM 3008 O  O   . HOH K 7 .   ? -50.528 30.493 36.662  1.00 35.09 ? 534 HOH C O   1 
HETATM 3009 O  O   . HOH K 7 .   ? -44.971 24.065 31.695  1.00 37.41 ? 535 HOH C O   1 
HETATM 3010 O  O   . HOH K 7 .   ? -50.991 20.695 39.651  1.00 36.74 ? 536 HOH C O   1 
HETATM 3011 O  O   . HOH K 7 .   ? -83.898 19.862 20.397  1.00 47.68 ? 537 HOH C O   1 
HETATM 3012 O  O   . HOH K 7 .   ? -41.152 23.663 30.611  1.00 44.39 ? 538 HOH C O   1 
HETATM 3013 O  O   . HOH K 7 .   ? -65.462 18.308 13.371  1.00 38.76 ? 539 HOH C O   1 
HETATM 3014 O  O   . HOH K 7 .   ? -57.159 37.054 9.160   1.00 38.26 ? 540 HOH C O   1 
HETATM 3015 O  O   . HOH K 7 .   ? -44.280 26.432 27.425  1.00 59.46 ? 541 HOH C O   1 
HETATM 3016 O  O   . HOH K 7 .   ? -51.674 22.844 47.240  1.00 40.24 ? 542 HOH C O   1 
HETATM 3017 O  O   . HOH K 7 .   ? -81.643 20.257 17.072  1.00 48.83 ? 543 HOH C O   1 
HETATM 3018 O  O   . HOH K 7 .   ? -66.387 16.296 21.123  1.00 42.30 ? 544 HOH C O   1 
HETATM 3019 O  O   . HOH K 7 .   ? -58.136 14.910 39.652  1.00 56.19 ? 545 HOH C O   1 
HETATM 3020 O  O   . HOH K 7 .   ? -43.774 26.342 30.051  1.00 41.43 ? 546 HOH C O   1 
HETATM 3021 O  O   . HOH K 7 .   ? -71.641 22.151 16.920  1.00 47.91 ? 547 HOH C O   1 
HETATM 3022 O  O   . HOH K 7 .   ? -50.884 24.452 18.218  1.00 43.99 ? 548 HOH C O   1 
HETATM 3023 O  O   . HOH K 7 .   ? -63.504 39.583 10.229  1.00 44.05 ? 549 HOH C O   1 
HETATM 3024 O  O   . HOH K 7 .   ? -71.037 34.364 8.248   1.00 46.19 ? 550 HOH C O   1 
HETATM 3025 O  O   . HOH K 7 .   ? -59.170 18.598 51.072  1.00 71.22 ? 551 HOH C O   1 
HETATM 3026 O  O   . HOH K 7 .   ? -53.574 16.528 46.326  1.00 42.04 ? 552 HOH C O   1 
HETATM 3027 O  O   . HOH K 7 .   ? -46.129 27.925 33.414  1.00 31.76 ? 553 HOH C O   1 
HETATM 3028 O  O   . HOH K 7 .   ? -52.073 19.645 24.225  1.00 36.46 ? 554 HOH C O   1 
HETATM 3029 O  O   . HOH K 7 .   ? -54.051 17.675 24.407  1.00 41.80 ? 555 HOH C O   1 
HETATM 3030 O  O   . HOH K 7 .   ? -72.644 26.252 9.611   1.00 41.11 ? 556 HOH C O   1 
HETATM 3031 O  O   . HOH K 7 .   ? -73.714 25.661 11.928  1.00 44.75 ? 557 HOH C O   1 
HETATM 3032 O  O   . HOH K 7 .   ? -79.664 21.726 16.077  1.00 44.42 ? 558 HOH C O   1 
HETATM 3033 O  O   . HOH K 7 .   ? -49.844 29.786 39.031  1.00 45.56 ? 559 HOH C O   1 
HETATM 3034 O  O   . HOH K 7 .   ? -68.655 31.146 3.715   1.00 42.05 ? 560 HOH C O   1 
HETATM 3035 O  O   . HOH K 7 .   ? -50.346 23.854 39.921  1.00 65.84 ? 561 HOH C O   1 
HETATM 3036 O  O   . HOH K 7 .   ? -44.727 19.355 23.683  1.00 49.94 ? 562 HOH C O   1 
HETATM 3037 O  O   . HOH K 7 .   ? -53.697 13.436 33.598  1.00 56.62 ? 563 HOH C O   1 
HETATM 3038 O  O   . HOH K 7 .   ? -84.645 21.604 22.324  1.00 48.60 ? 564 HOH C O   1 
HETATM 3039 O  O   . HOH K 7 .   ? -47.506 21.983 17.804  1.00 48.83 ? 565 HOH C O   1 
HETATM 3040 O  O   . HOH K 7 .   ? -68.981 21.201 17.723  1.00 43.40 ? 566 HOH C O   1 
HETATM 3041 O  O   . HOH K 7 .   ? -72.742 29.102 6.653   1.00 47.81 ? 567 HOH C O   1 
HETATM 3042 O  O   . HOH K 7 .   ? -76.584 17.887 18.172  1.00 55.46 ? 568 HOH C O   1 
HETATM 3043 O  O   . HOH K 7 .   ? -68.908 18.538 18.116  1.00 39.76 ? 569 HOH C O   1 
HETATM 3044 O  O   . HOH K 7 .   ? -69.290 19.692 8.413   1.00 46.81 ? 570 HOH C O   1 
HETATM 3045 O  O   . HOH K 7 .   ? -48.131 30.028 33.019  1.00 43.64 ? 571 HOH C O   1 
HETATM 3046 O  O   . HOH K 7 .   ? -37.102 21.366 10.589  1.00 67.39 ? 572 HOH C O   1 
HETATM 3047 O  O   . HOH K 7 .   ? -64.799 37.479 6.079   1.00 40.78 ? 573 HOH C O   1 
HETATM 3048 O  O   . HOH K 7 .   ? -44.988 20.904 9.282   1.00 53.83 ? 574 HOH C O   1 
HETATM 3049 O  O   . HOH K 7 .   ? -40.484 24.360 11.587  1.00 60.34 ? 575 HOH C O   1 
HETATM 3050 O  O   . HOH K 7 .   ? -51.098 27.469 42.043  1.00 46.52 ? 576 HOH C O   1 
HETATM 3051 O  O   . HOH K 7 .   ? -40.783 23.492 18.283  1.00 63.99 ? 577 HOH C O   1 
HETATM 3052 O  O   . HOH K 7 .   ? -62.064 14.239 34.010  1.00 57.77 ? 578 HOH C O   1 
HETATM 3053 O  O   . HOH K 7 .   ? -59.341 18.663 44.845  1.00 48.20 ? 579 HOH C O   1 
HETATM 3054 O  O   . HOH K 7 .   ? -70.157 17.540 20.247  1.00 64.83 ? 580 HOH C O   1 
HETATM 3055 O  O   . HOH K 7 .   ? -63.004 14.964 23.502  1.00 55.65 ? 581 HOH C O   1 
HETATM 3056 O  O   . HOH K 7 .   ? -47.104 22.077 22.328  1.00 54.65 ? 582 HOH C O   1 
HETATM 3057 O  O   . HOH K 7 .   ? -46.905 16.277 28.302  1.00 46.73 ? 583 HOH C O   1 
HETATM 3058 O  O   . HOH K 7 .   ? -47.079 14.398 24.898  1.00 59.94 ? 584 HOH C O   1 
HETATM 3059 O  O   . HOH K 7 .   ? -51.929 25.335 44.191  1.00 46.37 ? 585 HOH C O   1 
HETATM 3060 O  O   . HOH K 7 .   ? -55.540 14.247 25.517  1.00 61.30 ? 586 HOH C O   1 
HETATM 3061 O  O   . HOH K 7 .   ? -50.162 33.851 12.634  1.00 59.51 ? 587 HOH C O   1 
HETATM 3062 O  O   . HOH K 7 .   ? -55.809 18.925 22.545  1.00 42.27 ? 588 HOH C O   1 
HETATM 3063 O  O   . HOH K 7 .   ? -38.680 17.948 14.407  1.00 65.14 ? 589 HOH C O   1 
HETATM 3064 O  O   . HOH K 7 .   ? -43.114 22.509 32.336  1.00 48.96 ? 590 HOH C O   1 
HETATM 3065 O  O   . HOH K 7 .   ? -54.943 17.969 19.973  1.00 49.32 ? 591 HOH C O   1 
HETATM 3066 O  O   . HOH K 7 .   ? -56.453 29.036 44.156  1.00 58.80 ? 592 HOH C O   1 
HETATM 3067 O  O   . HOH K 7 .   ? -73.855 20.577 17.468  1.00 61.94 ? 593 HOH C O   1 
HETATM 3068 O  O   . HOH K 7 .   ? -50.893 15.967 18.514  1.00 45.30 ? 594 HOH C O   1 
HETATM 3069 O  O   . HOH K 7 .   ? -58.759 13.839 37.114  1.00 64.14 ? 595 HOH C O   1 
HETATM 3070 O  O   . HOH K 7 .   ? -72.123 20.146 9.189   1.00 52.90 ? 596 HOH C O   1 
HETATM 3071 O  O   . HOH K 7 .   ? -35.201 18.681 7.730   1.00 59.68 ? 597 HOH C O   1 
HETATM 3072 O  O   . HOH K 7 .   ? -55.468 14.939 45.564  1.00 57.67 ? 598 HOH C O   1 
HETATM 3073 O  O   . HOH K 7 .   ? -34.044 19.278 9.871   1.00 66.13 ? 599 HOH C O   1 
HETATM 3074 O  O   . HOH K 7 .   ? -79.293 20.780 27.795  1.00 68.72 ? 600 HOH C O   1 
HETATM 3075 O  O   . HOH K 7 .   ? -66.256 38.744 7.533   1.00 65.91 ? 601 HOH C O   1 
HETATM 3076 O  O   . HOH K 7 .   ? -69.440 18.688 15.109  1.00 66.25 ? 602 HOH C O   1 
HETATM 3077 O  O   . HOH K 7 .   ? -48.553 14.265 30.443  1.00 67.00 ? 603 HOH C O   1 
HETATM 3078 O  O   . HOH K 7 .   ? -56.851 12.465 38.749  1.00 66.21 ? 604 HOH C O   1 
HETATM 3079 O  O   . HOH K 7 .   ? -65.691 15.180 17.040  1.00 61.05 ? 605 HOH C O   1 
HETATM 3080 O  O   . HOH K 7 .   ? -68.244 33.615 2.505   1.00 62.52 ? 606 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   -5  ?   ?   ?   A . n 
A 1 2   LEU 2   -4  ?   ?   ?   A . n 
A 1 3   GLY 3   -3  ?   ?   ?   A . n 
A 1 4   SER 4   -2  ?   ?   ?   A . n 
A 1 5   PRO 5   -1  ?   ?   ?   A . n 
A 1 6   ASN 6   0   ?   ?   ?   A . n 
A 1 7   SER 7   1   1   SER SER A . n 
A 1 8   SER 8   2   2   SER SER A . n 
A 1 9   ILE 9   3   3   ILE ILE A . n 
A 1 10  VAL 10  4   4   VAL VAL A . n 
A 1 11  SER 11  5   5   SER SER A . n 
A 1 12  LEU 12  6   6   LEU LEU A . n 
A 1 13  LEU 13  7   7   LEU LEU A . n 
A 1 14  GLY 14  8   8   GLY GLY A . n 
A 1 15  ILE 15  9   9   ILE ILE A . n 
A 1 16  LYS 16  10  10  LYS LYS A . n 
A 1 17  VAL 17  11  11  VAL VAL A . n 
A 1 18  LEU 18  12  12  LEU LEU A . n 
A 1 19  ASN 19  13  13  ASN ASN A . n 
A 1 20  ASN 20  14  14  ASN ASN A . n 
A 1 21  PRO 21  15  15  PRO PRO A . n 
A 1 22  ALA 22  16  16  ALA ALA A . n 
A 1 23  LYS 23  17  17  LYS LYS A . n 
A 1 24  PHE 24  18  18  PHE PHE A . n 
A 1 25  THR 25  19  19  THR THR A . n 
A 1 26  ASP 26  20  20  ASP ASP A . n 
A 1 27  PRO 27  21  21  PRO PRO A . n 
A 1 28  TYR 28  22  22  TYR TYR A . n 
A 1 29  GLU 29  23  23  GLU GLU A . n 
A 1 30  PHE 30  24  24  PHE PHE A . n 
A 1 31  GLU 31  25  25  GLU GLU A . n 
A 1 32  ILE 32  26  26  ILE ILE A . n 
A 1 33  THR 33  27  27  THR THR A . n 
A 1 34  PHE 34  28  28  PHE PHE A . n 
A 1 35  GLU 35  29  29  GLU GLU A . n 
A 1 36  CYS 36  30  30  CYS CYS A . n 
A 1 37  LEU 37  31  31  LEU LEU A . n 
A 1 38  GLU 38  32  32  GLU GLU A . n 
A 1 39  SER 39  33  33  SER SER A . n 
A 1 40  LEU 40  34  34  LEU LEU A . n 
A 1 41  LYS 41  35  35  LYS LYS A . n 
A 1 42  HIS 42  36  36  HIS HIS A . n 
A 1 43  ASP 43  37  37  ASP ASP A . n 
A 1 44  LEU 44  38  38  LEU LEU A . n 
A 1 45  GLU 45  39  39  GLU GLU A . n 
A 1 46  TRP 46  40  40  TRP TRP A . n 
A 1 47  LYS 47  41  41  LYS LYS A . n 
A 1 48  LEU 48  42  42  LEU LEU A . n 
A 1 49  THR 49  43  43  THR THR A . n 
A 1 50  TYR 50  44  44  TYR TYR A . n 
A 1 51  VAL 51  45  45  VAL VAL A . n 
A 1 52  GLY 52  46  46  GLY GLY A . n 
A 1 53  SER 53  47  47  SER SER A . n 
A 1 54  SER 54  48  48  SER SER A . n 
A 1 55  ARG 55  49  49  ARG ARG A . n 
A 1 56  SER 56  50  50  SER SER A . n 
A 1 57  LEU 57  51  51  LEU LEU A . n 
A 1 58  ASP 58  52  52  ASP ASP A . n 
A 1 59  HIS 59  53  53  HIS HIS A . n 
A 1 60  ASP 60  54  54  ASP ASP A . n 
A 1 61  GLN 61  55  55  GLN GLN A . n 
A 1 62  GLU 62  56  56  GLU GLU A . n 
A 1 63  LEU 63  57  57  LEU LEU A . n 
A 1 64  ASP 64  58  58  ASP ASP A . n 
A 1 65  SER 65  59  59  SER SER A . n 
A 1 66  ILE 66  60  60  ILE ILE A . n 
A 1 67  LEU 67  61  61  LEU LEU A . n 
A 1 68  VAL 68  62  62  VAL VAL A . n 
A 1 69  GLY 69  63  63  GLY GLY A . n 
A 1 70  PRO 70  64  64  PRO PRO A . n 
A 1 71  VAL 71  65  65  VAL VAL A . n 
A 1 72  PRO 72  66  66  PRO PRO A . n 
A 1 73  VAL 73  67  67  VAL VAL A . n 
A 1 74  GLY 74  68  68  GLY GLY A . n 
A 1 75  VAL 75  69  69  VAL VAL A . n 
A 1 76  ASN 76  70  70  ASN ASN A . n 
A 1 77  LYS 77  71  71  LYS LYS A . n 
A 1 78  PHE 78  72  72  PHE PHE A . n 
A 1 79  VAL 79  73  73  VAL VAL A . n 
A 1 80  PHE 80  74  74  PHE PHE A . n 
A 1 81  SER 81  75  75  SER SER A . n 
A 1 82  ALA 82  76  76  ALA ALA A . n 
A 1 83  ASP 83  77  77  ASP ASP A . n 
A 1 84  PRO 84  78  78  PRO PRO A . n 
A 1 85  PRO 85  79  79  PRO PRO A . n 
A 1 86  SER 86  80  80  SER SER A . n 
A 1 87  ALA 87  81  81  ALA ALA A . n 
A 1 88  GLU 88  82  82  GLU GLU A . n 
A 1 89  LEU 89  83  83  LEU LEU A . n 
A 1 90  ILE 90  84  84  ILE ILE A . n 
A 1 91  PRO 91  85  85  PRO PRO A . n 
A 1 92  ALA 92  86  86  ALA ALA A . n 
A 1 93  SER 93  87  87  SER SER A . n 
A 1 94  GLU 94  88  88  GLU GLU A . n 
A 1 95  LEU 95  89  89  LEU LEU A . n 
A 1 96  VAL 96  90  90  VAL VAL A . n 
A 1 97  SER 97  91  91  SER SER A . n 
A 1 98  VAL 98  92  92  VAL VAL A . n 
A 1 99  THR 99  93  93  THR THR A . n 
A 1 100 VAL 100 94  94  VAL VAL A . n 
A 1 101 ILE 101 95  95  ILE ILE A . n 
A 1 102 LEU 102 96  96  LEU LEU A . n 
A 1 103 LEU 103 97  97  LEU LEU A . n 
A 1 104 SER 104 98  98  SER SER A . n 
A 1 105 CYS 105 99  99  CYS CYS A . n 
A 1 106 SER 106 100 100 SER SER A . n 
A 1 107 TYR 107 101 101 TYR TYR A . n 
A 1 108 ASP 108 102 102 ASP ASP A . n 
A 1 109 GLY 109 103 103 GLY GLY A . n 
A 1 110 ARG 110 104 104 ARG ARG A . n 
A 1 111 GLU 111 105 105 GLU GLU A . n 
A 1 112 PHE 112 106 106 PHE PHE A . n 
A 1 113 VAL 113 107 107 VAL VAL A . n 
A 1 114 ARG 114 108 108 ARG ARG A . n 
A 1 115 VAL 115 109 109 VAL VAL A . n 
A 1 116 GLY 116 110 110 GLY GLY A . n 
A 1 117 TYR 117 111 111 TYR TYR A . n 
A 1 118 TYR 118 112 112 TYR TYR A . n 
A 1 119 VAL 119 113 113 VAL VAL A . n 
A 1 120 ASN 120 114 114 ASN ASN A . n 
A 1 121 ASN 121 115 115 ASN ASN A . n 
A 1 122 GLU 122 116 116 GLU GLU A . n 
A 1 123 TYR 123 117 117 TYR TYR A . n 
A 1 124 ASP 124 118 118 ASP ASP A . n 
A 1 125 GLU 125 119 119 GLU GLU A . n 
A 1 126 GLU 126 120 120 GLU GLU A . n 
A 1 127 GLU 127 121 121 GLU GLU A . n 
A 1 128 LEU 128 122 122 LEU LEU A . n 
A 1 129 ARG 129 123 123 ARG ARG A . n 
A 1 130 GLU 130 124 124 GLU GLU A . n 
A 1 131 ASN 131 125 125 ASN ASN A . n 
A 1 132 PRO 132 126 126 PRO PRO A . n 
A 1 133 PRO 133 127 127 PRO PRO A . n 
A 1 134 ALA 134 128 128 ALA ALA A . n 
A 1 135 LYS 135 129 129 LYS LYS A . n 
A 1 136 VAL 136 130 130 VAL VAL A . n 
A 1 137 GLN 137 131 131 GLN GLN A . n 
A 1 138 VAL 138 132 132 VAL VAL A . n 
A 1 139 ASP 139 133 133 ASP ASP A . n 
A 1 140 HIS 140 134 134 HIS HIS A . n 
A 1 141 ILE 141 135 135 ILE ILE A . n 
A 1 142 VAL 142 136 136 VAL VAL A . n 
A 1 143 ARG 143 137 137 ARG ARG A . n 
A 1 144 ASN 144 138 138 ASN ASN A . n 
A 1 145 ILE 145 139 139 ILE ILE A . n 
A 1 146 LEU 146 140 140 LEU LEU A . n 
A 1 147 ALA 147 141 141 ALA ALA A . n 
A 1 148 GLU 148 142 142 GLU GLU A . n 
A 1 149 LYS 149 143 143 LYS LYS A . n 
A 1 150 PRO 150 144 144 PRO PRO A . n 
A 1 151 ARG 151 145 145 ARG ARG A . n 
A 1 152 VAL 152 146 146 VAL VAL A . n 
A 1 153 THR 153 147 147 THR THR A . n 
A 1 154 ARG 154 148 148 ARG ARG A . n 
A 1 155 PHE 155 149 149 PHE PHE A . n 
A 1 156 ASN 156 150 150 ASN ASN A . n 
A 1 157 ILE 157 151 151 ILE ILE A . n 
A 1 158 VAL 158 152 152 VAL VAL A . n 
A 1 159 TRP 159 153 153 TRP TRP A . n 
A 1 160 ASP 160 154 154 ASP ASP A . n 
A 1 161 ASN 161 155 155 ASN ASN A . n 
A 1 162 GLU 162 156 156 GLU GLU A . n 
A 1 163 ASN 163 157 157 ASN ASN A . n 
A 1 164 GLU 164 158 158 GLU GLU A . n 
A 1 165 GLY 165 159 159 GLY GLY A . n 
A 1 166 ASP 166 160 160 ASP ASP A . n 
A 1 167 LEU 167 161 161 LEU LEU A . n 
A 1 168 TYR 168 162 162 TYR TYR A . n 
A 1 169 PRO 169 163 163 PRO PRO A . n 
A 1 170 PRO 170 164 164 PRO PRO A . n 
A 1 171 GLU 171 165 ?   ?   ?   A . n 
A 1 172 GLN 172 166 ?   ?   ?   A . n 
A 1 173 PRO 173 167 ?   ?   ?   A . n 
A 1 174 GLY 174 168 ?   ?   ?   A . n 
A 1 175 VAL 175 169 ?   ?   ?   A . n 
B 2 1   MET 1   59  ?   ?   ?   B . n 
B 2 2   ALA 2   60  60  ALA ALA B . n 
B 2 3   LEU 3   61  61  LEU LEU B . n 
B 2 4   ILE 4   62  62  ILE ILE B . n 
B 2 5   ARG 5   63  63  ARG ARG B . n 
B 2 6   LYS 6   64  64  LYS LYS B . n 
B 2 7   LEU 7   65  65  LEU LEU B . n 
B 2 8   PRO 8   66  66  PRO PRO B . n 
B 2 9   PHE 9   67  67  PHE PHE B . n 
B 2 10  GLN 10  68  68  GLN GLN B . n 
B 2 11  ARG 11  69  69  ARG ARG B . n 
B 2 12  LEU 12  70  70  LEU LEU B . n 
B 2 13  VAL 13  71  71  VAL VAL B . n 
B 2 14  ARG 14  72  72  ARG ARG B . n 
B 2 15  GLU 15  73  73  GLU GLU B . n 
B 2 16  ILE 16  74  74  ILE ILE B . n 
B 2 17  ALA 17  75  75  ALA ALA B . n 
B 2 18  GLN 18  76  76  GLN GLN B . n 
B 2 19  ASP 19  77  77  ASP ASP B . n 
B 2 20  PHE 20  78  78  PHE PHE B . n 
B 2 21  LYS 21  79  79  LYS LYS B . n 
B 2 22  THR 22  80  80  THR THR B . n 
B 2 23  ASP 23  81  81  ASP ASP B . n 
B 2 24  LEU 24  82  82  LEU LEU B . n 
B 2 25  ARG 25  83  83  ARG ARG B . n 
B 2 26  PHE 26  84  84  PHE PHE B . n 
B 2 27  GLN 27  85  85  GLN GLN B . n 
B 2 28  SER 28  86  86  SER SER B . n 
B 2 29  SER 29  87  87  SER SER B . n 
B 2 30  ALA 30  88  88  ALA ALA B . n 
B 2 31  VAL 31  89  89  VAL VAL B . n 
B 2 32  MET 32  90  90  MET MET B . n 
B 2 33  ALA 33  91  91  ALA ALA B . n 
B 2 34  LEU 34  92  92  LEU LEU B . n 
B 2 35  GLN 35  93  93  GLN GLN B . n 
B 2 36  GLU 36  94  94  GLU GLU B . n 
B 2 37  ALA 37  95  95  ALA ALA B . n 
B 2 38  SER 38  96  96  SER SER B . n 
B 2 39  GLU 39  97  97  GLU GLU B . n 
B 2 40  ALA 40  98  98  ALA ALA B . n 
B 2 41  TYR 41  99  99  TYR TYR B . n 
B 2 42  LEU 42  100 100 LEU LEU B . n 
B 2 43  VAL 43  101 101 VAL VAL B . n 
B 2 44  ALA 44  102 102 ALA ALA B . n 
B 2 45  LEU 45  103 103 LEU LEU B . n 
B 2 46  PHE 46  104 104 PHE PHE B . n 
B 2 47  GLU 47  105 105 GLU GLU B . n 
B 2 48  ASP 48  106 106 ASP ASP B . n 
B 2 49  THR 49  107 107 THR THR B . n 
B 2 50  ASN 50  108 108 ASN ASN B . n 
B 2 51  LEU 51  109 109 LEU LEU B . n 
B 2 52  CYS 52  110 110 CYS CYS B . n 
B 2 53  ALA 53  111 111 ALA ALA B . n 
B 2 54  ILE 54  112 112 ILE ILE B . n 
B 2 55  HIS 55  113 113 HIS HIS B . n 
B 2 56  ALA 56  114 114 ALA ALA B . n 
B 2 57  LYS 57  115 115 LYS LYS B . n 
B 2 58  ARG 58  116 116 ARG ARG B . n 
B 2 59  VAL 59  117 117 VAL VAL B . n 
B 2 60  THR 60  118 118 THR THR B . n 
B 2 61  ILE 61  119 119 ILE ILE B . n 
B 2 62  MET 62  120 120 MET MET B . n 
B 2 63  PRO 63  121 121 PRO PRO B . n 
B 2 64  LYS 64  122 122 LYS LYS B . n 
B 2 65  ASP 65  123 123 ASP ASP B . n 
B 2 66  ILE 66  124 124 ILE ILE B . n 
B 2 67  GLN 67  125 125 GLN GLN B . n 
B 2 68  LEU 68  126 126 LEU LEU B . n 
B 2 69  ALA 69  127 127 ALA ALA B . n 
B 2 70  ARG 70  128 128 ARG ARG B . n 
B 2 71  ARG 71  129 129 ARG ARG B . n 
B 2 72  ILE 72  130 130 ILE ILE B . n 
B 2 73  ARG 73  131 131 ARG ARG B . n 
B 2 74  GLY 74  132 132 GLY GLY B . n 
B 2 75  GLU 75  133 133 GLU GLU B . n 
B 2 76  ARG 76  134 134 ARG ARG B . n 
B 2 77  ALA 77  135 ?   ?   ?   B . n 
C 3 1   MET 1   19  ?   ?   ?   C . n 
C 3 2   LYS 2   20  20  LYS LYS C . n 
C 3 3   VAL 3   21  21  VAL VAL C . n 
C 3 4   LEU 4   22  22  LEU LEU C . n 
C 3 5   ARG 5   23  23  ARG ARG C . n 
C 3 6   ASP 6   24  24  ASP ASP C . n 
C 3 7   ASN 7   25  25  ASN ASN C . n 
C 3 8   ILE 8   26  26  ILE ILE C . n 
C 3 9   GLN 9   27  27  GLN GLN C . n 
C 3 10  GLY 10  28  28  GLY GLY C . n 
C 3 11  ILE 11  29  29  ILE ILE C . n 
C 3 12  THR 12  30  30  THR THR C . n 
C 3 13  LYS 13  31  31  LYS LYS C . n 
C 3 14  PRO 14  32  32  PRO PRO C . n 
C 3 15  ALA 15  33  33  ALA ALA C . n 
C 3 16  ILE 16  34  34  ILE ILE C . n 
C 3 17  ARG 17  35  35  ARG ARG C . n 
C 3 18  ARG 18  36  36  ARG ARG C . n 
C 3 19  LEU 19  37  37  LEU LEU C . n 
C 3 20  ALA 20  38  38  ALA ALA C . n 
C 3 21  ARG 21  39  39  ARG ARG C . n 
C 3 22  ARG 22  40  40  ARG ARG C . n 
C 3 23  GLY 23  41  41  GLY GLY C . n 
C 3 24  GLY 24  42  42  GLY GLY C . n 
C 3 25  VAL 25  43  43  VAL VAL C . n 
C 3 26  LYS 26  44  44  LYS LYS C . n 
C 3 27  ARG 27  45  45  ARG ARG C . n 
C 3 28  ILE 28  46  46  ILE ILE C . n 
C 3 29  SER 29  47  47  SER SER C . n 
C 3 30  GLY 30  48  48  GLY GLY C . n 
C 3 31  LEU 31  49  49  LEU LEU C . n 
C 3 32  ILE 32  50  50  ILE ILE C . n 
C 3 33  TYR 33  51  51  TYR TYR C . n 
C 3 34  GLU 34  52  52  GLU GLU C . n 
C 3 35  GLU 35  53  53  GLU GLU C . n 
C 3 36  THR 36  54  54  THR THR C . n 
C 3 37  ARG 37  55  55  ARG ARG C . n 
C 3 38  GLY 38  56  56  GLY GLY C . n 
C 3 39  VAL 39  57  57  VAL VAL C . n 
C 3 40  LEU 40  58  58  LEU LEU C . n 
C 3 41  LYS 41  59  59  LYS LYS C . n 
C 3 42  VAL 42  60  60  VAL VAL C . n 
C 3 43  PHE 43  61  61  PHE PHE C . n 
C 3 44  LEU 44  62  62  LEU LEU C . n 
C 3 45  GLU 45  63  63  GLU GLU C . n 
C 3 46  ASN 46  64  64  ASN ASN C . n 
C 3 47  VAL 47  65  65  VAL VAL C . n 
C 3 48  ILE 48  66  66  ILE ILE C . n 
C 3 49  ARG 49  67  67  ARG ARG C . n 
C 3 50  ASP 50  68  68  ASP ASP C . n 
C 3 51  ALA 51  69  69  ALA ALA C . n 
C 3 52  VAL 52  70  70  VAL VAL C . n 
C 3 53  THR 53  71  71  THR THR C . n 
C 3 54  TYR 54  72  72  TYR TYR C . n 
C 3 55  THR 55  73  73  THR THR C . n 
C 3 56  GLU 56  74  74  GLU GLU C . n 
C 3 57  HIS 57  75  75  HIS HIS C . n 
C 3 58  ALA 58  76  76  ALA ALA C . n 
C 3 59  LYS 59  77  77  LYS LYS C . n 
C 3 60  ARG 60  78  78  ARG ARG C . n 
C 3 61  LYS 61  79  79  LYS LYS C . n 
C 3 62  THR 62  80  80  THR THR C . n 
C 3 63  VAL 63  81  81  VAL VAL C . n 
C 3 64  THR 64  82  82  THR THR C . n 
C 3 65  ALA 65  83  83  ALA ALA C . n 
C 3 66  MET 66  84  84  MET MET C . n 
C 3 67  ASP 67  85  85  ASP ASP C . n 
C 3 68  VAL 68  86  86  VAL VAL C . n 
C 3 69  VAL 69  87  87  VAL VAL C . n 
C 3 70  TYR 70  88  88  TYR TYR C . n 
C 3 71  ALA 71  89  89  ALA ALA C . n 
C 3 72  LEU 72  90  90  LEU LEU C . n 
C 3 73  LYS 73  91  91  LYS LYS C . n 
C 3 74  ARG 74  92  92  ARG ARG C . n 
C 3 75  GLN 75  93  93  GLN GLN C . n 
C 3 76  GLY 76  94  94  GLY GLY C . n 
C 3 77  ARG 77  95  95  ARG ARG C . n 
C 3 78  THR 78  96  96  THR THR C . n 
C 3 79  LEU 79  97  97  LEU LEU C . n 
C 3 80  TYR 80  98  98  TYR TYR C . n 
C 3 81  GLY 81  99  99  GLY GLY C . n 
C 3 82  PHE 82  100 100 PHE PHE C . n 
C 3 83  GLY 83  101 101 GLY GLY C . n 
C 3 84  GLY 84  102 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   403 403 ZN  ZN  A . 
E 5 GOL 1   501 501 GOL GOL A . 
F 6 SO4 1   401 401 SO4 SO4 B . 
G 6 SO4 1   402 402 SO4 SO4 B . 
H 5 GOL 1   502 502 GOL GOL C . 
I 7 HOH 1   502 1   HOH HOH A . 
I 7 HOH 2   503 2   HOH HOH A . 
I 7 HOH 3   504 3   HOH HOH A . 
I 7 HOH 4   505 4   HOH HOH A . 
I 7 HOH 5   506 9   HOH HOH A . 
I 7 HOH 6   507 13  HOH HOH A . 
I 7 HOH 7   508 15  HOH HOH A . 
I 7 HOH 8   509 17  HOH HOH A . 
I 7 HOH 9   510 20  HOH HOH A . 
I 7 HOH 10  511 21  HOH HOH A . 
I 7 HOH 11  512 22  HOH HOH A . 
I 7 HOH 12  513 23  HOH HOH A . 
I 7 HOH 13  514 27  HOH HOH A . 
I 7 HOH 14  515 30  HOH HOH A . 
I 7 HOH 15  516 32  HOH HOH A . 
I 7 HOH 16  517 33  HOH HOH A . 
I 7 HOH 17  518 34  HOH HOH A . 
I 7 HOH 18  519 37  HOH HOH A . 
I 7 HOH 19  520 40  HOH HOH A . 
I 7 HOH 20  521 41  HOH HOH A . 
I 7 HOH 21  522 42  HOH HOH A . 
I 7 HOH 22  523 43  HOH HOH A . 
I 7 HOH 23  524 44  HOH HOH A . 
I 7 HOH 24  525 45  HOH HOH A . 
I 7 HOH 25  526 49  HOH HOH A . 
I 7 HOH 26  527 50  HOH HOH A . 
I 7 HOH 27  528 56  HOH HOH A . 
I 7 HOH 28  529 58  HOH HOH A . 
I 7 HOH 29  530 60  HOH HOH A . 
I 7 HOH 30  531 63  HOH HOH A . 
I 7 HOH 31  532 65  HOH HOH A . 
I 7 HOH 32  533 66  HOH HOH A . 
I 7 HOH 33  534 67  HOH HOH A . 
I 7 HOH 34  535 68  HOH HOH A . 
I 7 HOH 35  536 69  HOH HOH A . 
I 7 HOH 36  537 70  HOH HOH A . 
I 7 HOH 37  538 75  HOH HOH A . 
I 7 HOH 38  539 76  HOH HOH A . 
I 7 HOH 39  540 77  HOH HOH A . 
I 7 HOH 40  541 79  HOH HOH A . 
I 7 HOH 41  542 82  HOH HOH A . 
I 7 HOH 42  543 84  HOH HOH A . 
I 7 HOH 43  544 85  HOH HOH A . 
I 7 HOH 44  545 88  HOH HOH A . 
I 7 HOH 45  546 90  HOH HOH A . 
I 7 HOH 46  547 92  HOH HOH A . 
I 7 HOH 47  548 93  HOH HOH A . 
I 7 HOH 48  549 95  HOH HOH A . 
I 7 HOH 49  550 98  HOH HOH A . 
I 7 HOH 50  551 103 HOH HOH A . 
I 7 HOH 51  552 104 HOH HOH A . 
I 7 HOH 52  553 107 HOH HOH A . 
I 7 HOH 53  554 108 HOH HOH A . 
I 7 HOH 54  555 110 HOH HOH A . 
I 7 HOH 55  556 111 HOH HOH A . 
I 7 HOH 56  557 113 HOH HOH A . 
I 7 HOH 57  558 114 HOH HOH A . 
I 7 HOH 58  559 115 HOH HOH A . 
I 7 HOH 59  560 117 HOH HOH A . 
I 7 HOH 60  561 119 HOH HOH A . 
I 7 HOH 61  562 122 HOH HOH A . 
I 7 HOH 62  563 123 HOH HOH A . 
I 7 HOH 63  564 125 HOH HOH A . 
I 7 HOH 64  565 126 HOH HOH A . 
I 7 HOH 65  566 127 HOH HOH A . 
I 7 HOH 66  567 128 HOH HOH A . 
I 7 HOH 67  568 129 HOH HOH A . 
I 7 HOH 68  569 135 HOH HOH A . 
I 7 HOH 69  570 136 HOH HOH A . 
I 7 HOH 70  571 140 HOH HOH A . 
I 7 HOH 71  572 141 HOH HOH A . 
I 7 HOH 72  573 142 HOH HOH A . 
I 7 HOH 73  574 144 HOH HOH A . 
I 7 HOH 74  575 145 HOH HOH A . 
I 7 HOH 75  576 147 HOH HOH A . 
I 7 HOH 76  577 149 HOH HOH A . 
I 7 HOH 77  578 153 HOH HOH A . 
I 7 HOH 78  579 157 HOH HOH A . 
I 7 HOH 79  580 160 HOH HOH A . 
I 7 HOH 80  581 161 HOH HOH A . 
I 7 HOH 81  582 163 HOH HOH A . 
I 7 HOH 82  583 167 HOH HOH A . 
I 7 HOH 83  584 168 HOH HOH A . 
I 7 HOH 84  585 170 HOH HOH A . 
I 7 HOH 85  586 177 HOH HOH A . 
I 7 HOH 86  587 181 HOH HOH A . 
I 7 HOH 87  588 186 HOH HOH A . 
I 7 HOH 88  589 188 HOH HOH A . 
I 7 HOH 89  590 193 HOH HOH A . 
I 7 HOH 90  591 197 HOH HOH A . 
I 7 HOH 91  592 199 HOH HOH A . 
I 7 HOH 92  593 200 HOH HOH A . 
I 7 HOH 93  594 204 HOH HOH A . 
I 7 HOH 94  595 205 HOH HOH A . 
I 7 HOH 95  596 212 HOH HOH A . 
I 7 HOH 96  597 214 HOH HOH A . 
I 7 HOH 97  598 217 HOH HOH A . 
I 7 HOH 98  599 219 HOH HOH A . 
I 7 HOH 99  600 220 HOH HOH A . 
I 7 HOH 100 601 221 HOH HOH A . 
I 7 HOH 101 602 225 HOH HOH A . 
I 7 HOH 102 603 228 HOH HOH A . 
I 7 HOH 103 604 229 HOH HOH A . 
I 7 HOH 104 605 230 HOH HOH A . 
I 7 HOH 105 606 232 HOH HOH A . 
I 7 HOH 106 607 235 HOH HOH A . 
I 7 HOH 107 608 237 HOH HOH A . 
I 7 HOH 108 609 241 HOH HOH A . 
I 7 HOH 109 610 242 HOH HOH A . 
I 7 HOH 110 611 244 HOH HOH A . 
I 7 HOH 111 612 247 HOH HOH A . 
I 7 HOH 112 613 251 HOH HOH A . 
I 7 HOH 113 614 252 HOH HOH A . 
I 7 HOH 114 615 255 HOH HOH A . 
I 7 HOH 115 616 256 HOH HOH A . 
I 7 HOH 116 617 257 HOH HOH A . 
I 7 HOH 117 618 258 HOH HOH A . 
I 7 HOH 118 619 259 HOH HOH A . 
I 7 HOH 119 620 260 HOH HOH A . 
I 7 HOH 120 621 262 HOH HOH A . 
I 7 HOH 121 622 264 HOH HOH A . 
I 7 HOH 122 623 265 HOH HOH A . 
I 7 HOH 123 624 267 HOH HOH A . 
I 7 HOH 124 625 268 HOH HOH A . 
I 7 HOH 125 626 271 HOH HOH A . 
I 7 HOH 126 627 274 HOH HOH A . 
I 7 HOH 127 628 278 HOH HOH A . 
I 7 HOH 128 629 279 HOH HOH A . 
I 7 HOH 129 630 281 HOH HOH A . 
I 7 HOH 130 631 282 HOH HOH A . 
I 7 HOH 131 632 283 HOH HOH A . 
I 7 HOH 132 633 284 HOH HOH A . 
I 7 HOH 133 634 285 HOH HOH A . 
I 7 HOH 134 635 287 HOH HOH A . 
I 7 HOH 135 636 288 HOH HOH A . 
I 7 HOH 136 637 290 HOH HOH A . 
I 7 HOH 137 638 292 HOH HOH A . 
I 7 HOH 138 639 293 HOH HOH A . 
I 7 HOH 139 640 294 HOH HOH A . 
I 7 HOH 140 641 295 HOH HOH A . 
I 7 HOH 141 642 298 HOH HOH A . 
I 7 HOH 142 643 299 HOH HOH A . 
I 7 HOH 143 644 300 HOH HOH A . 
I 7 HOH 144 645 304 HOH HOH A . 
I 7 HOH 145 646 305 HOH HOH A . 
I 7 HOH 146 647 308 HOH HOH A . 
I 7 HOH 147 648 311 HOH HOH A . 
I 7 HOH 148 649 315 HOH HOH A . 
I 7 HOH 149 650 317 HOH HOH A . 
I 7 HOH 150 651 318 HOH HOH A . 
I 7 HOH 151 652 324 HOH HOH A . 
I 7 HOH 152 653 327 HOH HOH A . 
I 7 HOH 153 654 328 HOH HOH A . 
I 7 HOH 154 655 330 HOH HOH A . 
I 7 HOH 155 656 331 HOH HOH A . 
I 7 HOH 156 657 332 HOH HOH A . 
I 7 HOH 157 658 333 HOH HOH A . 
I 7 HOH 158 659 335 HOH HOH A . 
I 7 HOH 159 660 339 HOH HOH A . 
I 7 HOH 160 661 340 HOH HOH A . 
I 7 HOH 161 662 341 HOH HOH A . 
I 7 HOH 162 663 343 HOH HOH A . 
I 7 HOH 163 664 344 HOH HOH A . 
I 7 HOH 164 665 345 HOH HOH A . 
I 7 HOH 165 666 347 HOH HOH A . 
I 7 HOH 166 667 351 HOH HOH A . 
I 7 HOH 167 668 354 HOH HOH A . 
I 7 HOH 168 669 355 HOH HOH A . 
I 7 HOH 169 670 356 HOH HOH A . 
I 7 HOH 170 671 360 HOH HOH A . 
I 7 HOH 171 672 361 HOH HOH A . 
I 7 HOH 172 673 362 HOH HOH A . 
I 7 HOH 173 674 363 HOH HOH A . 
I 7 HOH 174 675 365 HOH HOH A . 
I 7 HOH 175 676 367 HOH HOH A . 
I 7 HOH 176 677 369 HOH HOH A . 
I 7 HOH 177 678 371 HOH HOH A . 
I 7 HOH 178 679 372 HOH HOH A . 
I 7 HOH 179 680 374 HOH HOH A . 
I 7 HOH 180 681 375 HOH HOH A . 
J 7 HOH 1   403 5   HOH HOH B . 
J 7 HOH 2   404 7   HOH HOH B . 
J 7 HOH 3   405 11  HOH HOH B . 
J 7 HOH 4   406 14  HOH HOH B . 
J 7 HOH 5   407 16  HOH HOH B . 
J 7 HOH 6   408 18  HOH HOH B . 
J 7 HOH 7   409 31  HOH HOH B . 
J 7 HOH 8   410 38  HOH HOH B . 
J 7 HOH 9   411 39  HOH HOH B . 
J 7 HOH 10  412 47  HOH HOH B . 
J 7 HOH 11  413 57  HOH HOH B . 
J 7 HOH 12  414 74  HOH HOH B . 
J 7 HOH 13  415 78  HOH HOH B . 
J 7 HOH 14  416 83  HOH HOH B . 
J 7 HOH 15  417 87  HOH HOH B . 
J 7 HOH 16  418 89  HOH HOH B . 
J 7 HOH 17  419 91  HOH HOH B . 
J 7 HOH 18  420 96  HOH HOH B . 
J 7 HOH 19  421 97  HOH HOH B . 
J 7 HOH 20  422 105 HOH HOH B . 
J 7 HOH 21  423 106 HOH HOH B . 
J 7 HOH 22  424 116 HOH HOH B . 
J 7 HOH 23  425 118 HOH HOH B . 
J 7 HOH 24  426 120 HOH HOH B . 
J 7 HOH 25  427 130 HOH HOH B . 
J 7 HOH 26  428 131 HOH HOH B . 
J 7 HOH 27  429 134 HOH HOH B . 
J 7 HOH 28  430 143 HOH HOH B . 
J 7 HOH 29  431 151 HOH HOH B . 
J 7 HOH 30  432 158 HOH HOH B . 
J 7 HOH 31  433 159 HOH HOH B . 
J 7 HOH 32  434 164 HOH HOH B . 
J 7 HOH 33  435 165 HOH HOH B . 
J 7 HOH 34  436 166 HOH HOH B . 
J 7 HOH 35  437 169 HOH HOH B . 
J 7 HOH 36  438 171 HOH HOH B . 
J 7 HOH 37  439 173 HOH HOH B . 
J 7 HOH 38  440 175 HOH HOH B . 
J 7 HOH 39  441 178 HOH HOH B . 
J 7 HOH 40  442 180 HOH HOH B . 
J 7 HOH 41  443 182 HOH HOH B . 
J 7 HOH 42  444 185 HOH HOH B . 
J 7 HOH 43  445 192 HOH HOH B . 
J 7 HOH 44  446 201 HOH HOH B . 
J 7 HOH 45  447 208 HOH HOH B . 
J 7 HOH 46  448 211 HOH HOH B . 
J 7 HOH 47  449 213 HOH HOH B . 
J 7 HOH 48  450 215 HOH HOH B . 
J 7 HOH 49  451 216 HOH HOH B . 
J 7 HOH 50  452 223 HOH HOH B . 
J 7 HOH 51  453 227 HOH HOH B . 
J 7 HOH 52  454 231 HOH HOH B . 
J 7 HOH 53  455 239 HOH HOH B . 
J 7 HOH 54  456 240 HOH HOH B . 
J 7 HOH 55  457 243 HOH HOH B . 
J 7 HOH 56  458 246 HOH HOH B . 
J 7 HOH 57  459 248 HOH HOH B . 
J 7 HOH 58  460 253 HOH HOH B . 
J 7 HOH 59  461 254 HOH HOH B . 
J 7 HOH 60  462 266 HOH HOH B . 
J 7 HOH 61  463 270 HOH HOH B . 
J 7 HOH 62  464 280 HOH HOH B . 
J 7 HOH 63  465 286 HOH HOH B . 
J 7 HOH 64  466 291 HOH HOH B . 
J 7 HOH 65  467 301 HOH HOH B . 
J 7 HOH 66  468 303 HOH HOH B . 
J 7 HOH 67  469 310 HOH HOH B . 
J 7 HOH 68  470 316 HOH HOH B . 
J 7 HOH 69  471 319 HOH HOH B . 
J 7 HOH 70  472 320 HOH HOH B . 
J 7 HOH 71  473 321 HOH HOH B . 
J 7 HOH 72  474 323 HOH HOH B . 
J 7 HOH 73  475 325 HOH HOH B . 
J 7 HOH 74  476 337 HOH HOH B . 
J 7 HOH 75  477 342 HOH HOH B . 
J 7 HOH 76  478 348 HOH HOH B . 
J 7 HOH 77  479 349 HOH HOH B . 
J 7 HOH 78  480 350 HOH HOH B . 
J 7 HOH 79  481 353 HOH HOH B . 
J 7 HOH 80  482 357 HOH HOH B . 
J 7 HOH 81  483 364 HOH HOH B . 
J 7 HOH 82  484 368 HOH HOH B . 
J 7 HOH 83  485 370 HOH HOH B . 
K 7 HOH 1   503 6   HOH HOH C . 
K 7 HOH 2   504 8   HOH HOH C . 
K 7 HOH 3   505 10  HOH HOH C . 
K 7 HOH 4   506 12  HOH HOH C . 
K 7 HOH 5   507 19  HOH HOH C . 
K 7 HOH 6   508 24  HOH HOH C . 
K 7 HOH 7   509 25  HOH HOH C . 
K 7 HOH 8   510 26  HOH HOH C . 
K 7 HOH 9   511 28  HOH HOH C . 
K 7 HOH 10  512 29  HOH HOH C . 
K 7 HOH 11  513 35  HOH HOH C . 
K 7 HOH 12  514 36  HOH HOH C . 
K 7 HOH 13  515 46  HOH HOH C . 
K 7 HOH 14  516 48  HOH HOH C . 
K 7 HOH 15  517 51  HOH HOH C . 
K 7 HOH 16  518 52  HOH HOH C . 
K 7 HOH 17  519 53  HOH HOH C . 
K 7 HOH 18  520 54  HOH HOH C . 
K 7 HOH 19  521 55  HOH HOH C . 
K 7 HOH 20  522 59  HOH HOH C . 
K 7 HOH 21  523 61  HOH HOH C . 
K 7 HOH 22  524 62  HOH HOH C . 
K 7 HOH 23  525 64  HOH HOH C . 
K 7 HOH 24  526 71  HOH HOH C . 
K 7 HOH 25  527 72  HOH HOH C . 
K 7 HOH 26  528 73  HOH HOH C . 
K 7 HOH 27  529 80  HOH HOH C . 
K 7 HOH 28  530 81  HOH HOH C . 
K 7 HOH 29  531 86  HOH HOH C . 
K 7 HOH 30  532 94  HOH HOH C . 
K 7 HOH 31  533 99  HOH HOH C . 
K 7 HOH 32  534 100 HOH HOH C . 
K 7 HOH 33  535 101 HOH HOH C . 
K 7 HOH 34  536 109 HOH HOH C . 
K 7 HOH 35  537 112 HOH HOH C . 
K 7 HOH 36  538 121 HOH HOH C . 
K 7 HOH 37  539 124 HOH HOH C . 
K 7 HOH 38  540 132 HOH HOH C . 
K 7 HOH 39  541 133 HOH HOH C . 
K 7 HOH 40  542 137 HOH HOH C . 
K 7 HOH 41  543 138 HOH HOH C . 
K 7 HOH 42  544 139 HOH HOH C . 
K 7 HOH 43  545 146 HOH HOH C . 
K 7 HOH 44  546 148 HOH HOH C . 
K 7 HOH 45  547 150 HOH HOH C . 
K 7 HOH 46  548 154 HOH HOH C . 
K 7 HOH 47  549 155 HOH HOH C . 
K 7 HOH 48  550 156 HOH HOH C . 
K 7 HOH 49  551 162 HOH HOH C . 
K 7 HOH 50  552 174 HOH HOH C . 
K 7 HOH 51  553 176 HOH HOH C . 
K 7 HOH 52  554 179 HOH HOH C . 
K 7 HOH 53  555 183 HOH HOH C . 
K 7 HOH 54  556 184 HOH HOH C . 
K 7 HOH 55  557 187 HOH HOH C . 
K 7 HOH 56  558 189 HOH HOH C . 
K 7 HOH 57  559 191 HOH HOH C . 
K 7 HOH 58  560 194 HOH HOH C . 
K 7 HOH 59  561 195 HOH HOH C . 
K 7 HOH 60  562 196 HOH HOH C . 
K 7 HOH 61  563 198 HOH HOH C . 
K 7 HOH 62  564 202 HOH HOH C . 
K 7 HOH 63  565 203 HOH HOH C . 
K 7 HOH 64  566 206 HOH HOH C . 
K 7 HOH 65  567 207 HOH HOH C . 
K 7 HOH 66  568 209 HOH HOH C . 
K 7 HOH 67  569 210 HOH HOH C . 
K 7 HOH 68  570 218 HOH HOH C . 
K 7 HOH 69  571 222 HOH HOH C . 
K 7 HOH 70  572 224 HOH HOH C . 
K 7 HOH 71  573 233 HOH HOH C . 
K 7 HOH 72  574 234 HOH HOH C . 
K 7 HOH 73  575 236 HOH HOH C . 
K 7 HOH 74  576 238 HOH HOH C . 
K 7 HOH 75  577 245 HOH HOH C . 
K 7 HOH 76  578 249 HOH HOH C . 
K 7 HOH 77  579 250 HOH HOH C . 
K 7 HOH 78  580 261 HOH HOH C . 
K 7 HOH 79  581 263 HOH HOH C . 
K 7 HOH 80  582 272 HOH HOH C . 
K 7 HOH 81  583 273 HOH HOH C . 
K 7 HOH 82  584 275 HOH HOH C . 
K 7 HOH 83  585 276 HOH HOH C . 
K 7 HOH 84  586 277 HOH HOH C . 
K 7 HOH 85  587 289 HOH HOH C . 
K 7 HOH 86  588 296 HOH HOH C . 
K 7 HOH 87  589 297 HOH HOH C . 
K 7 HOH 88  590 302 HOH HOH C . 
K 7 HOH 89  591 306 HOH HOH C . 
K 7 HOH 90  592 307 HOH HOH C . 
K 7 HOH 91  593 309 HOH HOH C . 
K 7 HOH 92  594 312 HOH HOH C . 
K 7 HOH 93  595 313 HOH HOH C . 
K 7 HOH 94  596 322 HOH HOH C . 
K 7 HOH 95  597 326 HOH HOH C . 
K 7 HOH 96  598 334 HOH HOH C . 
K 7 HOH 97  599 338 HOH HOH C . 
K 7 HOH 98  600 346 HOH HOH C . 
K 7 HOH 99  601 352 HOH HOH C . 
K 7 HOH 100 602 358 HOH HOH C . 
K 7 HOH 101 603 359 HOH HOH C . 
K 7 HOH 102 604 366 HOH HOH C . 
K 7 HOH 103 605 373 HOH HOH C . 
K 7 HOH 104 606 376 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric  3 
2 software_defined_assembly            PISA hexameric 6 
3 software_defined_assembly            PISA hexameric 6 
4 software_defined_assembly            PISA hexameric 6 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I,J,K 
2 1,2 A,B,C,D,E,F,G,H,I,J,K 
3 3,4 C,H,K                 
3 1,2 A,B,D,E,F,G,I,J       
4 5,6 A,D,E,I               
4 1,7 B,C,F,G,H,J,K         
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8100  ? 
1 MORE         -85   ? 
1 'SSA (A^2)'  16220 ? 
2 'ABSA (A^2)' 16770 ? 
2 MORE         -271  ? 
2 'SSA (A^2)'  32060 ? 
3 'ABSA (A^2)' 7640  ? 
3 MORE         -185  ? 
3 'SSA (A^2)'  41190 ? 
4 'ABSA (A^2)' 13930 ? 
4 MORE         -233  ? 
4 'SSA (A^2)'  34900 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z              1.0000000000  0.0000000000  0.0000000000 0.0000000000    0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 5_554 x-y,-y,-z-1/3      1.0000000000  0.0000000000  0.0000000000 0.0000000000    0.0000000000  
-1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 -36.8920000000 
3 'crystal symmetry operation' 2_564 -y,x-y+1,z-2/3     -0.5000000000 -0.8660254038 0.0000000000 -47.8745000000  0.8660254038  
-0.5000000000 0.0000000000 82.9210663870  0.0000000000 0.0000000000 1.0000000000  -73.7840000000 
4 'crystal symmetry operation' 6_445 -x-1,-x+y-1,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 -47.8745000000  -0.8660254038 
0.5000000000  0.0000000000 -82.9210663870 0.0000000000 0.0000000000 -1.0000000000 36.8920000000  
5 'crystal symmetry operation' 3_455 -x+y-1,-x,z+2/3    -0.5000000000 0.8660254038  0.0000000000 -95.7490000000  -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  73.7840000000  
6 'crystal symmetry operation' 6_455 -x-1,-x+y,-z+1/3   -0.5000000000 -0.8660254038 0.0000000000 -95.7490000000  -0.8660254038 
0.5000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 36.8920000000  
7 'crystal symmetry operation' 4_466 y-1,x+1,-z+1       -0.5000000000 0.8660254038  0.0000000000 -143.6235000000 0.8660254038  
0.5000000000  0.0000000000 82.9210663870  0.0000000000 0.0000000000 -1.0000000000 110.6760000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     672 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   I 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 140 ? A HIS 134 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 140 ? A HIS 134 ? 5_554 108.6 ? 
2 NE2 ? A HIS 140 ? A HIS 134 ? 1_555 ZN ? D ZN . ? A ZN 403 ? 1_555 O   ? I HOH .   ? A HOH 558 ? 1_555 119.9 ? 
3 NE2 ? A HIS 140 ? A HIS 134 ? 5_554 ZN ? D ZN . ? A ZN 403 ? 1_555 O   ? I HOH .   ? A HOH 558 ? 1_555 117.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-11-21 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-24 
5 'Structure model' 1 4 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Structure summary'         
5 5 'Structure model' 'Database references'       
6 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' audit_author                 
2 5 'Structure model' database_2                   
3 5 'Structure model' pdbx_struct_conn_angle       
4 5 'Structure model' pdbx_struct_special_symmetry 
5 5 'Structure model' struct_conn                  
6 5 'Structure model' struct_ref_seq_dif           
7 5 'Structure model' struct_site                  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_audit_author.name'                          
2  5 'Structure model' '_database_2.pdbx_DOI'                        
3  5 'Structure model' '_database_2.pdbx_database_accession'         
4  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry'      
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry'      
18 5 'Structure model' '_pdbx_struct_conn_angle.value'               
19 5 'Structure model' '_struct_conn.pdbx_dist_value'                
20 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
21 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
22 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
23 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
24 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
25 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
26 5 'Structure model' '_struct_conn.ptnr1_symmetry'                 
27 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
28 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
29 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
30 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
31 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
32 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
33 5 'Structure model' '_struct_conn.ptnr2_symmetry'                 
34 5 'Structure model' '_struct_ref_seq_dif.details'                 
35 5 'Structure model' '_struct_site.pdbx_auth_asym_id'              
36 5 'Structure model' '_struct_site.pdbx_auth_comp_id'              
37 5 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASER phasing          . ? 1 
REFMAC refinement       . ? 2 
d*TREK 'data reduction' . ? 3 
d*TREK 'data scaling'   . ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
An Ala at position 102 agrees with the database reference 
GB P84233
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    133 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    458 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     632 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     423 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_565 
_pdbx_validate_symm_contact.dist              0.63 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              39 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              39 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              39 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                116.63 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.67 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP B 81  ? B 42.33 72.96   
2 1 GLU B 133 ? ? 52.91 -151.25 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 156 ? CG  ? A GLU 162 CG  
2  1 Y 1 A GLU 156 ? CD  ? A GLU 162 CD  
3  1 Y 1 A GLU 156 ? OE1 ? A GLU 162 OE1 
4  1 Y 1 A GLU 156 ? OE2 ? A GLU 162 OE2 
5  1 Y 1 B ARG 134 ? CG  ? B ARG 76  CG  
6  1 Y 1 B ARG 134 ? CD  ? B ARG 76  CD  
7  1 Y 1 B ARG 134 ? NE  ? B ARG 76  NE  
8  1 Y 1 B ARG 134 ? CZ  ? B ARG 76  CZ  
9  1 Y 1 B ARG 134 ? NH1 ? B ARG 76  NH1 
10 1 Y 1 B ARG 134 ? NH2 ? B ARG 76  NH2 
11 1 Y 1 C TYR 98  ? CG  ? C TYR 80  CG  
12 1 Y 1 C TYR 98  ? CD1 ? C TYR 80  CD1 
13 1 Y 1 C TYR 98  ? CD2 ? C TYR 80  CD2 
14 1 Y 1 C TYR 98  ? CE1 ? C TYR 80  CE1 
15 1 Y 1 C TYR 98  ? CE2 ? C TYR 80  CE2 
16 1 Y 1 C TYR 98  ? CZ  ? C TYR 80  CZ  
17 1 Y 1 C TYR 98  ? OH  ? C TYR 80  OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO -5  ? A PRO 1   
2  1 Y 1 A LEU -4  ? A LEU 2   
3  1 Y 1 A GLY -3  ? A GLY 3   
4  1 Y 1 A SER -2  ? A SER 4   
5  1 Y 1 A PRO -1  ? A PRO 5   
6  1 Y 1 A ASN 0   ? A ASN 6   
7  1 Y 1 A GLU 165 ? A GLU 171 
8  1 Y 1 A GLN 166 ? A GLN 172 
9  1 Y 1 A PRO 167 ? A PRO 173 
10 1 Y 1 A GLY 168 ? A GLY 174 
11 1 Y 1 A VAL 169 ? A VAL 175 
12 1 Y 1 B MET 59  ? B MET 1   
13 1 Y 1 B ALA 135 ? B ALA 77  
14 1 Y 1 C MET 19  ? C MET 1   
15 1 Y 1 C GLY 102 ? C GLY 84  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'    ZN  
5 GLYCEROL      GOL 
6 'SULFATE ION' SO4 
7 water         HOH 
#