data_2HVH
# 
_entry.id   2HVH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HVH         
NDB   PD0844       
RCSB  RCSB038811   
WWPDB D_1000038811 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HHW . unspecified 
PDB 2HHV . unspecified 
PDB 2HHU . unspecified 
PDB 2HHT . unspecified 
PDB 2HHS . unspecified 
PDB 2HHX . unspecified 
PDB 2HHY . unspecified 
PDB 2HHQ . unspecified 
PDB 2HVI . unspecified 
PDB 2HW3 . unspecified 
# 
_pdbx_database_status.entry_id                        2HVH 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Warren, J.J.'   1 
'Forsberg, L.J.' 2 
'Beese, L.S.'    3 
# 
_citation.id                        primary 
_citation.title                     'The structural basis for the mutagenicity of O6-methyl-guanine lesions.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            103 
_citation.page_first                19701 
_citation.page_last                 19706 
_citation.year                      2006 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17179038 
_citation.pdbx_database_id_DOI      10.1073/pnas.0609580103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Warren, J.J.'   1 ? 
primary 'Forsberg, L.J.' 2 ? 
primary 'Beese, L.S.'    3 ? 
# 
_cell.length_a           94.060 
_cell.length_b           109.390 
_cell.length_c           151.310 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2HVH 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         2HVH 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'"            2675.775  2   ?       ? ? 'DNA primer strand'   
2 polymer     syn "5'-D(*CP*A*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'" 4030.650  2   ?       ? ? 'DNA template strand' 
3 polymer     man 'DNA Polymerase I'                                   66202.945 2   2.7.7.7 ? 
'residues 299-876 (analogous to E. coli Klenow fragment)' ?                     
4 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose'  342.297   3   ?       ? ? ?                     
5 non-polymer syn 'MANGANESE (II) ION'                                 54.938    2   ?       ? ? ?                     
6 non-polymer syn 'SULFATE ION'                                        96.063    5   ?       ? ? ?                     
7 non-polymer syn 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
451.158   2   ?       ? ?                                                         ?                     
8 water       nat water                                                18.015    278 ?       ? ? ?                     
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        sucrose 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DC)(DC)(DT)(DG)(DA)(DC)(DT)(DC)(DDG)' CCTGACTCG B,E ? 
2 polydeoxyribonucleotide no yes '(DC)(DA)(DT)(6OG)(DC)(DG)(DA)(DG)(DT)(DC)(DA)(DG)(DG)' CATGCGAGTCAGG C,F ? 
3 'polypeptide(L)'        no no  
;KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DC  n 
1 3   DT  n 
1 4   DG  n 
1 5   DA  n 
1 6   DC  n 
1 7   DT  n 
1 8   DC  n 
1 9   DDG n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   6OG n 
2 5   DC  n 
2 6   DG  n 
2 7   DA  n 
2 8   DG  n 
2 9   DT  n 
2 10  DC  n 
2 11  DA  n 
2 12  DG  n 
2 13  DG  n 
3 1   LYS n 
3 2   LYS n 
3 3   MET n 
3 4   ALA n 
3 5   PHE n 
3 6   THR n 
3 7   LEU n 
3 8   ALA n 
3 9   ASP n 
3 10  ARG n 
3 11  VAL n 
3 12  THR n 
3 13  GLU n 
3 14  GLU n 
3 15  MET n 
3 16  LEU n 
3 17  ALA n 
3 18  ASP n 
3 19  LYS n 
3 20  ALA n 
3 21  ALA n 
3 22  LEU n 
3 23  VAL n 
3 24  VAL n 
3 25  GLU n 
3 26  VAL n 
3 27  VAL n 
3 28  GLU n 
3 29  GLU n 
3 30  ASN n 
3 31  TYR n 
3 32  HIS n 
3 33  ASP n 
3 34  ALA n 
3 35  PRO n 
3 36  ILE n 
3 37  VAL n 
3 38  GLY n 
3 39  ILE n 
3 40  ALA n 
3 41  VAL n 
3 42  VAL n 
3 43  ASN n 
3 44  GLU n 
3 45  HIS n 
3 46  GLY n 
3 47  ARG n 
3 48  PHE n 
3 49  PHE n 
3 50  LEU n 
3 51  ARG n 
3 52  PRO n 
3 53  GLU n 
3 54  THR n 
3 55  ALA n 
3 56  LEU n 
3 57  ALA n 
3 58  ASP n 
3 59  PRO n 
3 60  GLN n 
3 61  PHE n 
3 62  VAL n 
3 63  ALA n 
3 64  TRP n 
3 65  LEU n 
3 66  GLY n 
3 67  ASP n 
3 68  GLU n 
3 69  THR n 
3 70  LYS n 
3 71  LYS n 
3 72  LYS n 
3 73  SER n 
3 74  MET n 
3 75  PHE n 
3 76  ASP n 
3 77  SER n 
3 78  LYS n 
3 79  ARG n 
3 80  ALA n 
3 81  ALA n 
3 82  VAL n 
3 83  ALA n 
3 84  LEU n 
3 85  LYS n 
3 86  TRP n 
3 87  LYS n 
3 88  GLY n 
3 89  ILE n 
3 90  GLU n 
3 91  LEU n 
3 92  CYS n 
3 93  GLY n 
3 94  VAL n 
3 95  SER n 
3 96  PHE n 
3 97  ASP n 
3 98  LEU n 
3 99  LEU n 
3 100 LEU n 
3 101 ALA n 
3 102 ALA n 
3 103 TYR n 
3 104 LEU n 
3 105 LEU n 
3 106 ASP n 
3 107 PRO n 
3 108 ALA n 
3 109 GLN n 
3 110 GLY n 
3 111 VAL n 
3 112 ASP n 
3 113 ASP n 
3 114 VAL n 
3 115 ALA n 
3 116 ALA n 
3 117 ALA n 
3 118 ALA n 
3 119 LYS n 
3 120 MET n 
3 121 LYS n 
3 122 GLN n 
3 123 TYR n 
3 124 GLU n 
3 125 ALA n 
3 126 VAL n 
3 127 ARG n 
3 128 PRO n 
3 129 ASP n 
3 130 GLU n 
3 131 ALA n 
3 132 VAL n 
3 133 TYR n 
3 134 GLY n 
3 135 LYS n 
3 136 GLY n 
3 137 ALA n 
3 138 LYS n 
3 139 ARG n 
3 140 ALA n 
3 141 VAL n 
3 142 PRO n 
3 143 ASP n 
3 144 GLU n 
3 145 PRO n 
3 146 VAL n 
3 147 LEU n 
3 148 ALA n 
3 149 GLU n 
3 150 HIS n 
3 151 LEU n 
3 152 VAL n 
3 153 ARG n 
3 154 LYS n 
3 155 ALA n 
3 156 ALA n 
3 157 ALA n 
3 158 ILE n 
3 159 TRP n 
3 160 GLU n 
3 161 LEU n 
3 162 GLU n 
3 163 ARG n 
3 164 PRO n 
3 165 PHE n 
3 166 LEU n 
3 167 ASP n 
3 168 GLU n 
3 169 LEU n 
3 170 ARG n 
3 171 ARG n 
3 172 ASN n 
3 173 GLU n 
3 174 GLN n 
3 175 ASP n 
3 176 ARG n 
3 177 LEU n 
3 178 LEU n 
3 179 VAL n 
3 180 GLU n 
3 181 LEU n 
3 182 GLU n 
3 183 GLN n 
3 184 PRO n 
3 185 LEU n 
3 186 SER n 
3 187 SER n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 GLU n 
3 192 MET n 
3 193 GLU n 
3 194 PHE n 
3 195 ALA n 
3 196 GLY n 
3 197 VAL n 
3 198 LYS n 
3 199 VAL n 
3 200 ASP n 
3 201 THR n 
3 202 LYS n 
3 203 ARG n 
3 204 LEU n 
3 205 GLU n 
3 206 GLN n 
3 207 MET n 
3 208 GLY n 
3 209 LYS n 
3 210 GLU n 
3 211 LEU n 
3 212 ALA n 
3 213 GLU n 
3 214 GLN n 
3 215 LEU n 
3 216 GLY n 
3 217 THR n 
3 218 VAL n 
3 219 GLU n 
3 220 GLN n 
3 221 ARG n 
3 222 ILE n 
3 223 TYR n 
3 224 GLU n 
3 225 LEU n 
3 226 ALA n 
3 227 GLY n 
3 228 GLN n 
3 229 GLU n 
3 230 PHE n 
3 231 ASN n 
3 232 ILE n 
3 233 ASN n 
3 234 SER n 
3 235 PRO n 
3 236 LYS n 
3 237 GLN n 
3 238 LEU n 
3 239 GLY n 
3 240 VAL n 
3 241 ILE n 
3 242 LEU n 
3 243 PHE n 
3 244 GLU n 
3 245 LYS n 
3 246 LEU n 
3 247 GLN n 
3 248 LEU n 
3 249 PRO n 
3 250 VAL n 
3 251 LEU n 
3 252 LYS n 
3 253 LYS n 
3 254 THR n 
3 255 LYS n 
3 256 THR n 
3 257 GLY n 
3 258 TYR n 
3 259 SER n 
3 260 THR n 
3 261 SER n 
3 262 ALA n 
3 263 ASP n 
3 264 VAL n 
3 265 LEU n 
3 266 GLU n 
3 267 LYS n 
3 268 LEU n 
3 269 ALA n 
3 270 PRO n 
3 271 TYR n 
3 272 HIS n 
3 273 GLU n 
3 274 ILE n 
3 275 VAL n 
3 276 GLU n 
3 277 ASN n 
3 278 ILE n 
3 279 LEU n 
3 280 HIS n 
3 281 TYR n 
3 282 ARG n 
3 283 GLN n 
3 284 LEU n 
3 285 GLY n 
3 286 LYS n 
3 287 LEU n 
3 288 GLN n 
3 289 SER n 
3 290 THR n 
3 291 TYR n 
3 292 ILE n 
3 293 GLU n 
3 294 GLY n 
3 295 LEU n 
3 296 LEU n 
3 297 LYS n 
3 298 VAL n 
3 299 VAL n 
3 300 ARG n 
3 301 PRO n 
3 302 ALA n 
3 303 THR n 
3 304 LYS n 
3 305 LYS n 
3 306 VAL n 
3 307 HIS n 
3 308 THR n 
3 309 ILE n 
3 310 PHE n 
3 311 ASN n 
3 312 GLN n 
3 313 ALA n 
3 314 LEU n 
3 315 THR n 
3 316 GLN n 
3 317 THR n 
3 318 GLY n 
3 319 ARG n 
3 320 LEU n 
3 321 SER n 
3 322 SER n 
3 323 THR n 
3 324 GLU n 
3 325 PRO n 
3 326 ASN n 
3 327 LEU n 
3 328 GLN n 
3 329 ASN n 
3 330 ILE n 
3 331 PRO n 
3 332 ILE n 
3 333 ARG n 
3 334 LEU n 
3 335 GLU n 
3 336 GLU n 
3 337 GLY n 
3 338 ARG n 
3 339 LYS n 
3 340 ILE n 
3 341 ARG n 
3 342 GLN n 
3 343 ALA n 
3 344 PHE n 
3 345 VAL n 
3 346 PRO n 
3 347 SER n 
3 348 GLU n 
3 349 SER n 
3 350 ASP n 
3 351 TRP n 
3 352 LEU n 
3 353 ILE n 
3 354 PHE n 
3 355 ALA n 
3 356 ALA n 
3 357 ASP n 
3 358 TYR n 
3 359 SER n 
3 360 GLN n 
3 361 ILE n 
3 362 GLU n 
3 363 LEU n 
3 364 ARG n 
3 365 VAL n 
3 366 LEU n 
3 367 ALA n 
3 368 HIS n 
3 369 ILE n 
3 370 ALA n 
3 371 GLU n 
3 372 ASP n 
3 373 ASP n 
3 374 ASN n 
3 375 LEU n 
3 376 MET n 
3 377 GLU n 
3 378 ALA n 
3 379 PHE n 
3 380 ARG n 
3 381 ARG n 
3 382 ASP n 
3 383 LEU n 
3 384 ASP n 
3 385 ILE n 
3 386 HIS n 
3 387 THR n 
3 388 LYS n 
3 389 THR n 
3 390 ALA n 
3 391 MET n 
3 392 ASP n 
3 393 ILE n 
3 394 PHE n 
3 395 GLN n 
3 396 VAL n 
3 397 SER n 
3 398 GLU n 
3 399 ASP n 
3 400 GLU n 
3 401 VAL n 
3 402 THR n 
3 403 PRO n 
3 404 ASN n 
3 405 MET n 
3 406 ARG n 
3 407 ARG n 
3 408 GLN n 
3 409 ALA n 
3 410 LYS n 
3 411 ALA n 
3 412 VAL n 
3 413 ASN n 
3 414 TYR n 
3 415 GLY n 
3 416 ILE n 
3 417 VAL n 
3 418 TYR n 
3 419 GLY n 
3 420 ILE n 
3 421 SER n 
3 422 ASP n 
3 423 TYR n 
3 424 GLY n 
3 425 LEU n 
3 426 ALA n 
3 427 GLN n 
3 428 ASN n 
3 429 LEU n 
3 430 ASN n 
3 431 ILE n 
3 432 SER n 
3 433 ARG n 
3 434 LYS n 
3 435 GLU n 
3 436 ALA n 
3 437 ALA n 
3 438 GLU n 
3 439 PHE n 
3 440 ILE n 
3 441 GLU n 
3 442 ARG n 
3 443 TYR n 
3 444 PHE n 
3 445 GLU n 
3 446 SER n 
3 447 PHE n 
3 448 PRO n 
3 449 GLY n 
3 450 VAL n 
3 451 LYS n 
3 452 ARG n 
3 453 TYR n 
3 454 MET n 
3 455 GLU n 
3 456 ASN n 
3 457 ILE n 
3 458 VAL n 
3 459 GLN n 
3 460 GLU n 
3 461 ALA n 
3 462 LYS n 
3 463 GLN n 
3 464 LYS n 
3 465 GLY n 
3 466 TYR n 
3 467 VAL n 
3 468 THR n 
3 469 THR n 
3 470 LEU n 
3 471 LEU n 
3 472 HIS n 
3 473 ARG n 
3 474 ARG n 
3 475 ARG n 
3 476 TYR n 
3 477 LEU n 
3 478 PRO n 
3 479 ASP n 
3 480 ILE n 
3 481 THR n 
3 482 SER n 
3 483 ARG n 
3 484 ASN n 
3 485 PHE n 
3 486 ASN n 
3 487 VAL n 
3 488 ARG n 
3 489 SER n 
3 490 PHE n 
3 491 ALA n 
3 492 GLU n 
3 493 ARG n 
3 494 MET n 
3 495 ALA n 
3 496 MET n 
3 497 ASN n 
3 498 THR n 
3 499 PRO n 
3 500 ILE n 
3 501 GLN n 
3 502 GLY n 
3 503 SER n 
3 504 ALA n 
3 505 ALA n 
3 506 ASP n 
3 507 ILE n 
3 508 ILE n 
3 509 LYS n 
3 510 LYS n 
3 511 ALA n 
3 512 MET n 
3 513 ILE n 
3 514 ASP n 
3 515 LEU n 
3 516 ASN n 
3 517 ALA n 
3 518 ARG n 
3 519 LEU n 
3 520 LYS n 
3 521 GLU n 
3 522 GLU n 
3 523 ARG n 
3 524 LEU n 
3 525 GLN n 
3 526 ALA n 
3 527 HIS n 
3 528 LEU n 
3 529 LEU n 
3 530 LEU n 
3 531 GLN n 
3 532 VAL n 
3 533 HIS n 
3 534 ASP n 
3 535 GLU n 
3 536 LEU n 
3 537 ILE n 
3 538 LEU n 
3 539 GLU n 
3 540 ALA n 
3 541 PRO n 
3 542 LYS n 
3 543 GLU n 
3 544 GLU n 
3 545 MET n 
3 546 GLU n 
3 547 ARG n 
3 548 LEU n 
3 549 CYS n 
3 550 ARG n 
3 551 LEU n 
3 552 VAL n 
3 553 PRO n 
3 554 GLU n 
3 555 VAL n 
3 556 MET n 
3 557 GLU n 
3 558 GLN n 
3 559 ALA n 
3 560 VAL n 
3 561 THR n 
3 562 LEU n 
3 563 ARG n 
3 564 VAL n 
3 565 PRO n 
3 566 LEU n 
3 567 LYS n 
3 568 VAL n 
3 569 ASP n 
3 570 TYR n 
3 571 HIS n 
3 572 TYR n 
3 573 GLY n 
3 574 SER n 
3 575 THR n 
3 576 TRP n 
3 577 TYR n 
3 578 ASP n 
3 579 ALA n 
3 580 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 polA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PUC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP Q5KWC1_GEOKA Q5KWC1 3 300 ? ? 
2 PDB 2HVH         2HVH   1 ?   ? ? 
3 PDB 2HVH         2HVH   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HVH A 2 ? 580 ? Q5KWC1 300 ? 878 ? 298 876 
2 1 2HVH D 2 ? 580 ? Q5KWC1 300 ? 878 ? 298 876 
3 2 2HVH B 1 ? 9   ? 2HVH   21  ? 29  ? 21  29  
4 3 2HVH C 1 ? 13  ? 2HVH   0   ? 12  ? 0   12  
5 2 2HVH E 1 ? 9   ? 2HVH   21  ? 29  ? 21  29  
6 3 2HVH F 1 ? 13  ? 2HVH   0   ? 12  ? 0   12  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6OG 'DNA linking'                 n 
;6-O-METHYL GUANOSINE-5'-MONOPHOSPHATE
;
? 'C11 H16 N5 O7 P'  361.248 
ALA 'L-peptide linking'           y ALANINE                                    ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'           y ARGININE                                   ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                 ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking'           y CYSTEINE                                   ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'                 y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'                 y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'   307.197 
DCT 'DNA linking'                 n 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
? 'C9 H16 N3 O12 P3' 451.158 
DDG 'DNA linking'                 n "2',3'-DIDEOXY-GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'  331.222 
DG  'DNA linking'                 y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'                 y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'  322.208 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose                      ? 'C6 H12 O6'        180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose                      ? 'C6 H12 O6'        180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                  ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'             y GLYCINE                                    ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking'           y HISTIDINE                                  ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                   . WATER                                      ? 'H2 O'             18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                 ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'           y LEUCINE                                    ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'           y LYSINE                                     ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking'           y METHIONINE                                 ? 'C5 H11 N O2 S'    149.211 
MN  non-polymer                   . 'MANGANESE (II) ION'                       ? 'Mn 2'             54.938  
PHE 'L-peptide linking'           y PHENYLALANINE                              ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'           y PROLINE                                    ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking'           y SERINE                                     ? 'C3 H7 N O3'       105.093 
SO4 non-polymer                   . 'SULFATE ION'                              ? 'O4 S -2'          96.063  
THR 'L-peptide linking'           y THREONINE                                  ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'           y TYROSINE                                   ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'           y VALINE                                     ? 'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2HVH 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;55% saturated ammonium sulfate, 100 mM MES, 2.5% MPD, 10mM MnSO4, 10mM MgSO4, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 290K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 'ammonium sulfate' ? ? ? 
1 2  1 MPD                ? ? ? 
1 3  1 MES                ? ? ? 
1 4  1 MnSO4              ? ? ? 
1 5  1 MgSO4              ? ? ? 
1 6  1 H2O                ? ? ? 
1 7  2 MnSO4              ? ? ? 
1 8  2 MgSO4              ? ? ? 
1 9  2 'ammonium sulfate' ? ? ? 
1 10 2 H2O                ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-07-07 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
# 
_reflns.entry_id                     2HVH 
_reflns.d_resolution_high            2.492 
_reflns.d_resolution_low             47.298 
_reflns.number_obs                   54569 
_reflns.pdbx_Rmerge_I_obs            0.135 
_reflns.pdbx_netI_over_sigmaI        11.4 
_reflns.pdbx_Rsym_value              0.135 
_reflns.pdbx_redundancy              5.600 
_reflns.percent_possible_obs         98.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.number_all                   54569 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.492 
_reflns_shell.d_res_low              2.63 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    36059 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.414 
_reflns_shell.meanI_over_sigI_obs    3.2 
_reflns_shell.pdbx_Rsym_value        0.414 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        4.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      7420 
_reflns_shell.percent_possible_all   93.30 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2HVH 
_refine.ls_d_res_high                            2.492 
_refine.ls_d_res_low                             47.298 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    98.750 
_refine.ls_number_reflns_obs                     54529 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          0.204 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_R_factor_R_free                       0.262 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2765 
_refine.B_iso_mean                               31.483 
_refine.aniso_B[1][1]                            -0.880 
_refine.aniso_B[2][2]                            1.040 
_refine.aniso_B[3][3]                            -0.160 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.924 
_refine.correlation_coeff_Fo_to_Fc_free          0.883 
_refine.pdbx_overall_ESU_R                       0.537 
_refine.pdbx_overall_ESU_R_Free                  0.301 
_refine.overall_SU_ML                            0.236 
_refine.overall_SU_B                             10.804 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     54569 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'pdb entry 2HHW' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9310 
_refine_hist.pdbx_number_atoms_nucleic_acid   810 
_refine_hist.pdbx_number_atoms_ligand         150 
_refine_hist.number_atoms_solvent             278 
_refine_hist.number_atoms_total               10548 
_refine_hist.d_res_high                       2.492 
_refine_hist.d_res_low                        47.298 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         10533 0.008  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      14429 1.269  2.091  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1160  3.662  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   459   32.046 24.205 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1752  12.757 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   76    12.650 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1632  0.085  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     7570  0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            4691  0.209  0.300  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          7158  0.316  0.500  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    753   0.212  0.500  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   73    0.199  0.300  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 24    0.262  0.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              5958  0.472  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             9352  0.822  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              5433  1.066  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             5076  1.821  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.492 
_refine_ls_shell.d_res_low                        2.557 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               86.730 
_refine_ls_shell.number_reflns_R_work             3294 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.303 
_refine_ls_shell.R_factor_R_free                  0.349 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             196 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                3490 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HVH 
_struct.title                     'ddCTP:O6MeG pair in the polymerase active site (0 position)' 
_struct.pdbx_descriptor           'DNA polymerase I(E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HVH 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            
'DNA polymerase I, DNA replication, Klenow fragment, Protein-DNA complex, O6-methyl-guanine, Transferase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 7 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 7 ? 
S N N 8 ? 
T N N 8 ? 
U N N 8 ? 
V N N 8 ? 
W N N 8 ? 
X N N 8 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;The asymmetric unit contains two complete biological assemblies, each of which consists of a DNA polymerase, two DNA strands, and an incoming ddCTP + Mn.
;
? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR E 12  ? LEU E 16  ? THR A 308 LEU A 312 5 ? 5  
HELX_P HELX_P2  2  ARG E 51  ? LEU E 56  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  3  ASP E 58  ? ASP E 67  ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P4  4  ASP E 76  ? TRP E 86  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  5  LEU E 98  ? ASP E 106 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  6  PRO E 107 ? GLY E 110 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  7  ASP E 113 ? MET E 120 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  8  ASP E 129 ? GLY E 134 ? ASP A 425 GLY A 430 1 ? 6  
HELX_P HELX_P9  9  LYS E 135 ? ARG E 139 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 10 ASP E 143 ? ASN E 172 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 11 GLN E 174 ? LEU E 181 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P12 12 LEU E 181 ? GLY E 196 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 13 ASP E 200 ? GLY E 227 ? ASP A 496 GLY A 523 1 ? 28 
HELX_P HELX_P14 14 SER E 234 ? GLU E 244 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P15 15 SER E 261 ? LEU E 268 ? SER A 557 LEU A 564 1 ? 8  
HELX_P HELX_P16 16 ALA E 269 ? HIS E 272 ? ALA A 565 HIS A 568 5 ? 4  
HELX_P HELX_P17 17 GLU E 273 ? THR E 290 ? GLU A 569 THR A 586 1 ? 18 
HELX_P HELX_P18 18 ILE E 292 ? VAL E 299 ? ILE A 588 VAL A 595 1 ? 8  
HELX_P HELX_P19 19 LEU E 334 ? LYS E 339 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P20 20 ILE E 340 ? GLN E 342 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P21 21 GLN E 360 ? GLU E 371 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P22 22 ASP E 372 ? ASP E 382 ? ASP A 668 ASP A 678 1 ? 11 
HELX_P HELX_P23 23 ASP E 384 ? GLN E 395 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P24 24 THR E 402 ? ARG E 407 ? THR A 698 ARG A 703 5 ? 6  
HELX_P HELX_P25 25 ALA E 409 ? TYR E 418 ? ALA A 705 TYR A 714 1 ? 10 
HELX_P HELX_P26 26 SER E 421 ? ASN E 430 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P27 27 SER E 432 ? PHE E 447 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P28 28 PHE E 447 ? GLY E 465 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P29 29 PRO E 478 ? SER E 482 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P30 30 ASN E 484 ? GLU E 521 ? ASN A 780 GLU A 817 1 ? 38 
HELX_P HELX_P31 31 GLU E 544 ? ALA E 559 ? GLU A 840 ALA A 855 1 ? 16 
HELX_P HELX_P32 32 THR F 12  ? ALA F 17  ? THR D 308 ALA D 313 5 ? 6  
HELX_P HELX_P33 33 ARG F 51  ? LEU F 56  ? ARG D 347 LEU D 352 1 ? 6  
HELX_P HELX_P34 34 ASP F 58  ? ASP F 67  ? ASP D 354 ASP D 363 1 ? 10 
HELX_P HELX_P35 35 ASP F 76  ? TRP F 86  ? ASP D 372 TRP D 382 1 ? 11 
HELX_P HELX_P36 36 LEU F 98  ? ASP F 106 ? LEU D 394 ASP D 402 1 ? 9  
HELX_P HELX_P37 37 PRO F 107 ? GLY F 110 ? PRO D 403 GLY D 406 5 ? 4  
HELX_P HELX_P38 38 ASP F 113 ? MET F 120 ? ASP D 409 MET D 416 1 ? 8  
HELX_P HELX_P39 39 PRO F 128 ? GLY F 134 ? PRO D 424 GLY D 430 1 ? 7  
HELX_P HELX_P40 40 LYS F 135 ? ARG F 139 ? LYS D 431 ARG D 435 5 ? 5  
HELX_P HELX_P41 41 ASP F 143 ? ASN F 172 ? ASP D 439 ASN D 468 1 ? 30 
HELX_P HELX_P42 42 GLN F 174 ? LEU F 181 ? GLN D 470 LEU D 477 1 ? 8  
HELX_P HELX_P43 43 LEU F 181 ? GLY F 196 ? LEU D 477 GLY D 492 1 ? 16 
HELX_P HELX_P44 44 ASP F 200 ? GLY F 227 ? ASP D 496 GLY D 523 1 ? 28 
HELX_P HELX_P45 45 SER F 234 ? GLU F 244 ? SER D 530 GLU D 540 1 ? 11 
HELX_P HELX_P46 46 SER F 261 ? LEU F 268 ? SER D 557 LEU D 564 1 ? 8  
HELX_P HELX_P47 47 GLU F 273 ? ILE F 292 ? GLU D 569 ILE D 588 1 ? 20 
HELX_P HELX_P48 48 ILE F 292 ? LYS F 297 ? ILE D 588 LYS D 593 1 ? 6  
HELX_P HELX_P49 49 LEU F 334 ? LYS F 339 ? LEU D 630 LYS D 635 1 ? 6  
HELX_P HELX_P50 50 ILE F 340 ? GLN F 342 ? ILE D 636 GLN D 638 5 ? 3  
HELX_P HELX_P51 51 GLN F 360 ? GLU F 371 ? GLN D 656 GLU D 667 1 ? 12 
HELX_P HELX_P52 52 ASP F 372 ? ARG F 381 ? ASP D 668 ARG D 677 1 ? 10 
HELX_P HELX_P53 53 ASP F 384 ? GLN F 395 ? ASP D 680 GLN D 691 1 ? 12 
HELX_P HELX_P54 54 SER F 397 ? VAL F 401 ? SER D 693 VAL D 697 5 ? 5  
HELX_P HELX_P55 55 THR F 402 ? TYR F 418 ? THR D 698 TYR D 714 1 ? 17 
HELX_P HELX_P56 56 SER F 421 ? ASN F 430 ? SER D 717 ASN D 726 1 ? 10 
HELX_P HELX_P57 57 SER F 432 ? PHE F 447 ? SER D 728 PHE D 743 1 ? 16 
HELX_P HELX_P58 58 PHE F 447 ? GLY F 465 ? PHE D 743 GLY D 761 1 ? 19 
HELX_P HELX_P59 59 PRO F 478 ? SER F 482 ? PRO D 774 SER D 778 5 ? 5  
HELX_P HELX_P60 60 ASN F 484 ? GLU F 522 ? ASN D 780 GLU D 818 1 ? 39 
HELX_P HELX_P61 61 GLU F 544 ? GLN F 558 ? GLU D 840 GLN D 854 1 ? 15 
HELX_P HELX_P62 62 THR F 575 ? LYS F 580 ? THR D 871 LYS D 876 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A DC  8   "O3'" ? ? ? 1_555 A DDG 9  P   ? ? B DC  28  B DDG 29  1_555 ? ? ? ? ? ? ?            1.609 ?    
? 
covale2  covale both ? B DT  3   "O3'" ? ? ? 1_555 B 6OG 4  P   ? ? C DT  2   C 6OG 3   1_555 ? ? ? ? ? ? ?            1.599 ?    
? 
covale3  covale one  ? B 6OG 4   "O3'" ? ? ? 1_555 B DC  5  P   ? ? C 6OG 3   C DC  4   1_555 ? ? ? ? ? ? ?            1.599 ?    
? 
covale4  covale both ? C DC  8   "O3'" ? ? ? 1_555 C DDG 9  P   ? ? E DC  28  E DDG 29  1_555 ? ? ? ? ? ? ?            1.605 ?    
? 
covale5  covale both ? D DT  3   "O3'" ? ? ? 1_555 D 6OG 4  P   ? ? F DT  2   F 6OG 3   1_555 ? ? ? ? ? ? ?            1.603 ?    
? 
covale6  covale one  ? D 6OG 4   "O3'" ? ? ? 1_555 D DC  5  P   ? ? F 6OG 3   F DC  4   1_555 ? ? ? ? ? ? ?            1.583 ?    
? 
covale7  covale both ? G GLC .   C1    ? ? ? 1_555 G FRU .  O2  ? ? G GLC 1   G FRU 2   1_555 ? ? ? ? ? ? ?            1.456 sing 
? 
covale8  covale both ? H GLC .   C1    ? ? ? 1_555 H FRU .  O2  ? ? H GLC 1   H FRU 2   1_555 ? ? ? ? ? ? ?            1.472 sing 
? 
covale9  covale both ? I GLC .   C1    ? ? ? 1_555 I FRU .  O2  ? ? I GLC 1   I FRU 2   1_555 ? ? ? ? ? ? ?            1.466 sing 
? 
metalc1  metalc ?    ? E TYR 358 O     ? ? ? 1_555 J MN  .  MN  ? ? A TYR 654 A MN  879 1_555 ? ? ? ? ? ? ?            1.844 ?    
? 
metalc2  metalc ?    ? F ASP 357 OD1   ? ? ? 1_555 O MN  .  MN  ? ? D ASP 653 D MN  878 1_555 ? ? ? ? ? ? ?            2.321 ?    
? 
metalc3  metalc ?    ? F TYR 358 O     ? ? ? 1_555 O MN  .  MN  ? ? D TYR 654 D MN  878 1_555 ? ? ? ? ? ? ?            2.250 ?    
? 
metalc4  metalc ?    ? F ASP 534 OD2   ? ? ? 1_555 O MN  .  MN  ? ? D ASP 830 D MN  878 1_555 ? ? ? ? ? ? ?            2.101 ?    
? 
metalc5  metalc ?    ? O MN  .   MN    ? ? ? 1_555 R DCT .  O2B ? ? D MN  878 D DCT 881 1_555 ? ? ? ? ? ? ?            2.036 ?    
? 
metalc6  metalc ?    ? O MN  .   MN    ? ? ? 1_555 R DCT .  O2A ? ? D MN  878 D DCT 881 1_555 ? ? ? ? ? ? ?            2.206 ?    
? 
metalc7  metalc ?    ? O MN  .   MN    ? ? ? 1_555 R DCT .  O2G ? ? D MN  878 D DCT 881 1_555 ? ? ? ? ? ? ?            2.224 ?    
? 
hydrog1  hydrog ?    ? A DC  1   N3    ? ? ? 1_555 B DG  13 N1  ? ? B DC  21  C DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog2  hydrog ?    ? A DC  1   N4    ? ? ? 1_555 B DG  13 O6  ? ? B DC  21  C DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog3  hydrog ?    ? A DC  1   O2    ? ? ? 1_555 B DG  13 N2  ? ? B DC  21  C DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog4  hydrog ?    ? A DC  2   N3    ? ? ? 1_555 B DG  12 N1  ? ? B DC  22  C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog5  hydrog ?    ? A DC  2   N4    ? ? ? 1_555 B DG  12 O6  ? ? B DC  22  C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog6  hydrog ?    ? A DC  2   O2    ? ? ? 1_555 B DG  12 N2  ? ? B DC  22  C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog7  hydrog ?    ? A DT  3   N3    ? ? ? 1_555 B DA  11 N1  ? ? B DT  23  C DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog8  hydrog ?    ? A DT  3   O4    ? ? ? 1_555 B DA  11 N6  ? ? B DT  23  C DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog9  hydrog ?    ? A DG  4   N1    ? ? ? 1_555 B DC  10 N3  ? ? B DG  24  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog10 hydrog ?    ? A DG  4   N2    ? ? ? 1_555 B DC  10 O2  ? ? B DG  24  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog11 hydrog ?    ? A DG  4   O6    ? ? ? 1_555 B DC  10 N4  ? ? B DG  24  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog12 hydrog ?    ? A DA  5   N1    ? ? ? 1_555 B DT  9  N3  ? ? B DA  25  C DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog13 hydrog ?    ? A DA  5   N6    ? ? ? 1_555 B DT  9  O4  ? ? B DA  25  C DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog14 hydrog ?    ? A DC  6   N3    ? ? ? 1_555 B DG  8  N1  ? ? B DC  26  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog15 hydrog ?    ? A DC  6   N4    ? ? ? 1_555 B DG  8  O6  ? ? B DC  26  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog16 hydrog ?    ? A DC  6   O2    ? ? ? 1_555 B DG  8  N2  ? ? B DC  26  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog17 hydrog ?    ? A DT  7   N3    ? ? ? 1_555 B DA  7  N1  ? ? B DT  27  C DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog18 hydrog ?    ? A DT  7   O4    ? ? ? 1_555 B DA  7  N6  ? ? B DT  27  C DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog19 hydrog ?    ? A DC  8   N3    ? ? ? 1_555 B DG  6  N1  ? ? B DC  28  C DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog20 hydrog ?    ? A DC  8   N4    ? ? ? 1_555 B DG  6  O6  ? ? B DC  28  C DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog21 hydrog ?    ? A DC  8   O2    ? ? ? 1_555 B DG  6  N2  ? ? B DC  28  C DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog22 hydrog ?    ? A DDG 9   N1    ? ? ? 1_555 B DC  5  N3  ? ? B DDG 29  C DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog23 hydrog ?    ? A DDG 9   N2    ? ? ? 1_555 B DC  5  O2  ? ? B DDG 29  C DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog24 hydrog ?    ? A DDG 9   O6    ? ? ? 1_555 B DC  5  N4  ? ? B DDG 29  C DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog25 hydrog ?    ? C DC  1   N3    ? ? ? 1_555 D DG  13 N1  ? ? E DC  21  F DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog26 hydrog ?    ? C DC  1   N4    ? ? ? 1_555 D DG  13 O6  ? ? E DC  21  F DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog27 hydrog ?    ? C DC  1   O2    ? ? ? 1_555 D DG  13 N2  ? ? E DC  21  F DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog28 hydrog ?    ? C DC  2   N3    ? ? ? 1_555 D DG  12 N1  ? ? E DC  22  F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog29 hydrog ?    ? C DC  2   N4    ? ? ? 1_555 D DG  12 O6  ? ? E DC  22  F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog30 hydrog ?    ? C DC  2   O2    ? ? ? 1_555 D DG  12 N2  ? ? E DC  22  F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog31 hydrog ?    ? C DT  3   N3    ? ? ? 1_555 D DA  11 N1  ? ? E DT  23  F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog32 hydrog ?    ? C DT  3   O4    ? ? ? 1_555 D DA  11 N6  ? ? E DT  23  F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog33 hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  10 N3  ? ? E DG  24  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog34 hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  10 O2  ? ? E DG  24  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog35 hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  10 N4  ? ? E DG  24  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog36 hydrog ?    ? C DA  5   N1    ? ? ? 1_555 D DT  9  N3  ? ? E DA  25  F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog37 hydrog ?    ? C DA  5   N6    ? ? ? 1_555 D DT  9  O4  ? ? E DA  25  F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog38 hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  8  N1  ? ? E DC  26  F DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog39 hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  8  O6  ? ? E DC  26  F DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog40 hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  8  N2  ? ? E DC  26  F DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog41 hydrog ?    ? C DT  7   N3    ? ? ? 1_555 D DA  7  N1  ? ? E DT  27  F DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog42 hydrog ?    ? C DT  7   O4    ? ? ? 1_555 D DA  7  N6  ? ? E DT  27  F DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog43 hydrog ?    ? C DC  8   N3    ? ? ? 1_555 D DG  6  N1  ? ? E DC  28  F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog44 hydrog ?    ? C DC  8   N4    ? ? ? 1_555 D DG  6  O6  ? ? E DC  28  F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog45 hydrog ?    ? C DC  8   O2    ? ? ? 1_555 D DG  6  N2  ? ? E DC  28  F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog46 hydrog ?    ? C DDG 9   N1    ? ? ? 1_555 D DC  5  N3  ? ? E DDG 29  F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog47 hydrog ?    ? C DDG 9   N2    ? ? ? 1_555 D DC  5  O2  ? ? E DDG 29  F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
hydrog48 hydrog ?    ? C DDG 9   O6    ? ? ? 1_555 D DC  5  N4  ? ? E DDG 29  F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 324 E . ? GLU 620 A PRO 325 E ? PRO 621 A 1 3.37  
2 GLU 324 F . ? GLU 620 D PRO 325 F ? PRO 621 D 1 -0.88 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
F ? 6 ? 
G ? 3 ? 
H ? 2 ? 
I ? 2 ? 
J ? 4 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? parallel      
F 5 6 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR E 6   ? LEU E 7   ? THR A 302 LEU A 303 
A 2 GLY E 46  ? LEU E 50  ? GLY A 342 LEU A 346 
A 3 ILE E 36  ? ASN E 43  ? ILE A 332 ASN A 339 
A 4 LYS E 19  ? VAL E 26  ? LYS A 315 VAL A 322 
A 5 LYS E 71  ? MET E 74  ? LYS A 367 MET A 370 
A 6 VAL E 94  ? ASP E 97  ? VAL A 390 ASP A 393 
B 1 LYS E 305 ? VAL E 306 ? LYS A 601 VAL A 602 
B 2 VAL E 197 ? VAL E 199 ? VAL A 493 VAL A 495 
B 3 PHE E 344 ? VAL E 345 ? PHE A 640 VAL A 641 
C 1 ILE E 309 ? ASN E 311 ? ILE A 605 ASN A 607 
C 2 SER E 321 ? THR E 323 ? SER A 617 THR A 619 
D 1 HIS E 527 ? GLN E 531 ? HIS A 823 GLN A 827 
D 2 GLU E 535 ? PRO E 541 ? GLU A 831 PRO A 837 
D 3 TRP E 351 ? TYR E 358 ? TRP A 647 TYR A 654 
D 4 VAL E 568 ? GLY E 573 ? VAL A 864 GLY A 869 
E 1 TYR E 466 ? THR E 468 ? TYR A 762 THR A 764 
E 2 ARG E 474 ? TYR E 476 ? ARG A 770 TYR A 772 
F 1 THR F 6   ? ALA F 8   ? THR D 302 ALA D 304 
F 2 GLY F 46  ? LEU F 50  ? GLY D 342 LEU D 346 
F 3 GLY F 38  ? ASN F 43  ? GLY D 334 ASN D 339 
F 4 LYS F 19  ? GLU F 25  ? LYS D 315 GLU D 321 
F 5 LYS F 71  ? MET F 74  ? LYS D 367 MET D 370 
F 6 VAL F 94  ? ASP F 97  ? VAL D 390 ASP D 393 
G 1 LYS F 305 ? VAL F 306 ? LYS D 601 VAL D 602 
G 2 VAL F 197 ? VAL F 199 ? VAL D 493 VAL D 495 
G 3 PHE F 344 ? VAL F 345 ? PHE D 640 VAL D 641 
H 1 LYS F 253 ? THR F 254 ? LYS D 549 THR D 550 
H 2 GLY F 257 ? TYR F 258 ? GLY D 553 TYR D 554 
I 1 ILE F 309 ? ASN F 311 ? ILE D 605 ASN D 607 
I 2 SER F 321 ? THR F 323 ? SER D 617 THR D 619 
J 1 HIS F 527 ? GLN F 531 ? HIS D 823 GLN D 827 
J 2 GLU F 535 ? PRO F 541 ? GLU D 831 PRO D 837 
J 3 TRP F 351 ? TYR F 358 ? TRP D 647 TYR D 654 
J 4 VAL F 568 ? GLY F 573 ? VAL D 864 GLY D 869 
K 1 TYR F 466 ? THR F 468 ? TYR D 762 THR D 764 
K 2 ARG F 474 ? TYR F 476 ? ARG D 770 TYR D 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR E 6   ? N THR A 302 O ARG E 47  ? O ARG A 343 
A 2 3 O LEU E 50  ? O LEU A 346 N ILE E 39  ? N ILE A 335 
A 3 4 O VAL E 42  ? O VAL A 338 N ALA E 21  ? N ALA A 317 
A 4 5 N LEU E 22  ? N LEU A 318 O SER E 73  ? O SER A 369 
A 5 6 N MET E 74  ? N MET A 370 O PHE E 96  ? O PHE A 392 
B 1 2 O VAL E 306 ? O VAL A 602 N VAL E 197 ? N VAL A 493 
B 2 3 N LYS E 198 ? N LYS A 494 O VAL E 345 ? O VAL A 641 
C 1 2 N ILE E 309 ? N ILE A 605 O THR E 323 ? O THR A 619 
D 1 2 N LEU E 529 ? N LEU A 825 O ILE E 537 ? O ILE A 833 
D 2 3 O ALA E 540 ? O ALA A 836 N LEU E 352 ? N LEU A 648 
D 3 4 N ASP E 357 ? N ASP A 653 O ASP E 569 ? O ASP A 865 
E 1 2 N VAL E 467 ? N VAL A 763 O ARG E 475 ? O ARG A 771 
F 1 2 N THR F 6   ? N THR D 302 O ARG F 47  ? O ARG D 343 
F 2 3 O PHE F 48  ? O PHE D 344 N VAL F 41  ? N VAL D 337 
F 3 4 O VAL F 42  ? O VAL D 338 N ALA F 21  ? N ALA D 317 
F 4 5 N LEU F 22  ? N LEU D 318 O SER F 73  ? O SER D 369 
F 5 6 N MET F 74  ? N MET D 370 O PHE F 96  ? O PHE D 392 
G 1 2 O VAL F 306 ? O VAL D 602 N VAL F 197 ? N VAL D 493 
G 2 3 N LYS F 198 ? N LYS D 494 O VAL F 345 ? O VAL D 641 
H 1 2 N THR F 254 ? N THR D 550 O GLY F 257 ? O GLY D 553 
I 1 2 N ILE F 309 ? N ILE D 605 O THR F 323 ? O THR D 619 
J 1 2 N LEU F 529 ? N LEU D 825 O ILE F 537 ? O ILE D 833 
J 2 3 O ALA F 540 ? O ALA D 836 N LEU F 352 ? N LEU D 648 
J 3 4 N ALA F 355 ? N ALA D 651 O HIS F 571 ? O HIS D 867 
K 1 2 N VAL F 467 ? N VAL D 763 O ARG F 475 ? O ARG D 771 
# 
_atom_sites.entry_id                    2HVH 
_atom_sites.fract_transf_matrix[1][1]   0.010632 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009142 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006609 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DC  A 1 1   ? 97.548  -38.786 30.197  1.00 49.01  ? 21  DC  B "O5'" 1 
ATOM   2     C  "C5'" . DC  A 1 1   ? 98.602  -38.097 30.870  1.00 47.91  ? 21  DC  B "C5'" 1 
ATOM   3     C  "C4'" . DC  A 1 1   ? 98.324  -36.603 30.926  1.00 47.05  ? 21  DC  B "C4'" 1 
ATOM   4     O  "O4'" . DC  A 1 1   ? 97.544  -36.310 32.115  1.00 45.58  ? 21  DC  B "O4'" 1 
ATOM   5     C  "C3'" . DC  A 1 1   ? 99.577  -35.726 30.976  1.00 46.63  ? 21  DC  B "C3'" 1 
ATOM   6     O  "O3'" . DC  A 1 1   ? 99.464  -34.611 30.098  1.00 45.88  ? 21  DC  B "O3'" 1 
ATOM   7     C  "C2'" . DC  A 1 1   ? 99.630  -35.259 32.426  1.00 46.49  ? 21  DC  B "C2'" 1 
ATOM   8     C  "C1'" . DC  A 1 1   ? 98.162  -35.268 32.837  1.00 45.75  ? 21  DC  B "C1'" 1 
ATOM   9     N  N1    . DC  A 1 1   ? 97.962  -35.518 34.299  1.00 46.01  ? 21  DC  B N1    1 
ATOM   10    C  C2    . DC  A 1 1   ? 97.202  -34.609 35.055  1.00 46.20  ? 21  DC  B C2    1 
ATOM   11    O  O2    . DC  A 1 1   ? 96.706  -33.611 34.497  1.00 45.88  ? 21  DC  B O2    1 
ATOM   12    N  N3    . DC  A 1 1   ? 97.031  -34.856 36.382  1.00 45.45  ? 21  DC  B N3    1 
ATOM   13    C  C4    . DC  A 1 1   ? 97.577  -35.932 36.944  1.00 45.04  ? 21  DC  B C4    1 
ATOM   14    N  N4    . DC  A 1 1   ? 97.372  -36.113 38.249  1.00 45.17  ? 21  DC  B N4    1 
ATOM   15    C  C5    . DC  A 1 1   ? 98.354  -36.864 36.196  1.00 45.48  ? 21  DC  B C5    1 
ATOM   16    C  C6    . DC  A 1 1   ? 98.520  -36.620 34.891  1.00 45.80  ? 21  DC  B C6    1 
ATOM   17    P  P     . DC  A 1 2   ? 100.752 -33.716 29.774  1.00 45.97  ? 22  DC  B P     1 
ATOM   18    O  OP1   . DC  A 1 2   ? 100.632 -33.310 28.361  1.00 46.52  ? 22  DC  B OP1   1 
ATOM   19    O  OP2   . DC  A 1 2   ? 101.973 -34.418 30.239  1.00 46.06  ? 22  DC  B OP2   1 
ATOM   20    O  "O5'" . DC  A 1 2   ? 100.529 -32.407 30.668  1.00 45.05  ? 22  DC  B "O5'" 1 
ATOM   21    C  "C5'" . DC  A 1 2   ? 99.391  -31.608 30.417  1.00 42.83  ? 22  DC  B "C5'" 1 
ATOM   22    C  "C4'" . DC  A 1 2   ? 99.278  -30.420 31.350  1.00 41.68  ? 22  DC  B "C4'" 1 
ATOM   23    O  "O4'" . DC  A 1 2   ? 98.961  -30.878 32.688  1.00 40.88  ? 22  DC  B "O4'" 1 
ATOM   24    C  "C3'" . DC  A 1 2   ? 100.527 -29.558 31.471  1.00 41.41  ? 22  DC  B "C3'" 1 
ATOM   25    O  "O3'" . DC  A 1 2   ? 100.152 -28.181 31.506  1.00 41.69  ? 22  DC  B "O3'" 1 
ATOM   26    C  "C2'" . DC  A 1 2   ? 101.122 -30.001 32.801  1.00 40.91  ? 22  DC  B "C2'" 1 
ATOM   27    C  "C1'" . DC  A 1 2   ? 99.872  -30.331 33.611  1.00 39.74  ? 22  DC  B "C1'" 1 
ATOM   28    N  N1    . DC  A 1 2   ? 100.086 -31.337 34.698  1.00 39.24  ? 22  DC  B N1    1 
ATOM   29    C  C2    . DC  A 1 2   ? 99.554  -31.073 35.966  1.00 38.95  ? 22  DC  B C2    1 
ATOM   30    O  O2    . DC  A 1 2   ? 98.927  -30.021 36.142  1.00 38.57  ? 22  DC  B O2    1 
ATOM   31    N  N3    . DC  A 1 2   ? 99.738  -31.983 36.962  1.00 38.87  ? 22  DC  B N3    1 
ATOM   32    C  C4    . DC  A 1 2   ? 100.424 -33.106 36.727  1.00 38.82  ? 22  DC  B C4    1 
ATOM   33    N  N4    . DC  A 1 2   ? 100.576 -33.955 37.745  1.00 38.40  ? 22  DC  B N4    1 
ATOM   34    C  C5    . DC  A 1 2   ? 100.982 -33.394 35.439  1.00 38.65  ? 22  DC  B C5    1 
ATOM   35    C  C6    . DC  A 1 2   ? 100.790 -32.493 34.464  1.00 38.58  ? 22  DC  B C6    1 
ATOM   36    P  P     . DT  A 1 3   ? 101.260 -27.048 31.243  1.00 41.41  ? 23  DT  B P     1 
ATOM   37    O  OP1   . DT  A 1 3   ? 100.815 -26.215 30.092  1.00 40.06  ? 23  DT  B OP1   1 
ATOM   38    O  OP2   . DT  A 1 3   ? 102.594 -27.706 31.253  1.00 40.37  ? 23  DT  B OP2   1 
ATOM   39    O  "O5'" . DT  A 1 3   ? 101.131 -26.165 32.563  1.00 37.94  ? 23  DT  B "O5'" 1 
ATOM   40    C  "C5'" . DT  A 1 3   ? 99.874  -25.962 33.189  1.00 33.20  ? 23  DT  B "C5'" 1 
ATOM   41    C  "C4'" . DT  A 1 3   ? 100.127 -25.445 34.594  1.00 30.24  ? 23  DT  B "C4'" 1 
ATOM   42    O  "O4'" . DT  A 1 3   ? 100.332 -26.570 35.490  1.00 27.76  ? 23  DT  B "O4'" 1 
ATOM   43    C  "C3'" . DT  A 1 3   ? 101.373 -24.569 34.726  1.00 29.15  ? 23  DT  B "C3'" 1 
ATOM   44    O  "O3'" . DT  A 1 3   ? 101.055 -23.408 35.516  1.00 28.44  ? 23  DT  B "O3'" 1 
ATOM   45    C  "C2'" . DT  A 1 3   ? 102.413 -25.520 35.350  1.00 27.55  ? 23  DT  B "C2'" 1 
ATOM   46    C  "C1'" . DT  A 1 3   ? 101.525 -26.393 36.228  1.00 25.55  ? 23  DT  B "C1'" 1 
ATOM   47    N  N1    . DT  A 1 3   ? 102.030 -27.751 36.628  1.00 24.96  ? 23  DT  B N1    1 
ATOM   48    C  C2    . DT  A 1 3   ? 101.773 -28.176 37.919  1.00 24.03  ? 23  DT  B C2    1 
ATOM   49    O  O2    . DT  A 1 3   ? 101.182 -27.498 38.729  1.00 23.50  ? 23  DT  B O2    1 
ATOM   50    N  N3    . DT  A 1 3   ? 102.238 -29.428 38.238  1.00 24.03  ? 23  DT  B N3    1 
ATOM   51    C  C4    . DT  A 1 3   ? 102.924 -30.296 37.405  1.00 24.58  ? 23  DT  B C4    1 
ATOM   52    O  O4    . DT  A 1 3   ? 103.294 -31.404 37.791  1.00 24.45  ? 23  DT  B O4    1 
ATOM   53    C  C5    . DT  A 1 3   ? 103.160 -29.801 36.064  1.00 24.02  ? 23  DT  B C5    1 
ATOM   54    C  C7    . DT  A 1 3   ? 103.895 -30.650 35.071  1.00 24.13  ? 23  DT  B C7    1 
ATOM   55    C  C6    . DT  A 1 3   ? 102.706 -28.574 35.740  1.00 24.55  ? 23  DT  B C6    1 
ATOM   56    P  P     . DG  A 1 4   ? 102.080 -22.179 35.666  1.00 29.34  ? 24  DG  B P     1 
ATOM   57    O  OP1   . DG  A 1 4   ? 101.279 -20.930 35.602  1.00 28.53  ? 24  DG  B OP1   1 
ATOM   58    O  OP2   . DG  A 1 4   ? 103.217 -22.363 34.731  1.00 28.72  ? 24  DG  B OP2   1 
ATOM   59    O  "O5'" . DG  A 1 4   ? 102.637 -22.382 37.156  1.00 27.70  ? 24  DG  B "O5'" 1 
ATOM   60    C  "C5'" . DG  A 1 4   ? 101.737 -22.496 38.262  1.00 25.59  ? 24  DG  B "C5'" 1 
ATOM   61    C  "C4'" . DG  A 1 4   ? 102.444 -22.939 39.538  1.00 24.98  ? 24  DG  B "C4'" 1 
ATOM   62    O  "O4'" . DG  A 1 4   ? 102.726 -24.366 39.458  1.00 24.28  ? 24  DG  B "O4'" 1 
ATOM   63    C  "C3'" . DG  A 1 4   ? 103.781 -22.260 39.879  1.00 25.46  ? 24  DG  B "C3'" 1 
ATOM   64    O  "O3'" . DG  A 1 4   ? 103.871 -22.089 41.290  1.00 26.89  ? 24  DG  B "O3'" 1 
ATOM   65    C  "C2'" . DG  A 1 4   ? 104.803 -23.301 39.426  1.00 25.08  ? 24  DG  B "C2'" 1 
ATOM   66    C  "C1'" . DG  A 1 4   ? 104.068 -24.578 39.853  1.00 23.54  ? 24  DG  B "C1'" 1 
ATOM   67    N  N9    . DG  A 1 4   ? 104.590 -25.808 39.264  1.00 23.12  ? 24  DG  B N9    1 
ATOM   68    C  C8    . DG  A 1 4   ? 105.054 -25.975 37.980  1.00 23.12  ? 24  DG  B C8    1 
ATOM   69    N  N7    . DG  A 1 4   ? 105.471 -27.190 37.734  1.00 23.20  ? 24  DG  B N7    1 
ATOM   70    C  C5    . DG  A 1 4   ? 105.272 -27.876 38.929  1.00 22.96  ? 24  DG  B C5    1 
ATOM   71    C  C6    . DG  A 1 4   ? 105.527 -29.233 39.271  1.00 22.89  ? 24  DG  B C6    1 
ATOM   72    O  O6    . DG  A 1 4   ? 106.004 -30.137 38.582  1.00 22.73  ? 24  DG  B O6    1 
ATOM   73    N  N1    . DG  A 1 4   ? 105.182 -29.516 40.586  1.00 23.39  ? 24  DG  B N1    1 
ATOM   74    C  C2    . DG  A 1 4   ? 104.647 -28.598 41.460  1.00 22.81  ? 24  DG  B C2    1 
ATOM   75    N  N2    . DG  A 1 4   ? 104.385 -29.053 42.690  1.00 23.09  ? 24  DG  B N2    1 
ATOM   76    N  N3    . DG  A 1 4   ? 104.399 -27.334 41.155  1.00 22.19  ? 24  DG  B N3    1 
ATOM   77    C  C4    . DG  A 1 4   ? 104.733 -27.036 39.880  1.00 22.59  ? 24  DG  B C4    1 
ATOM   78    P  P     . DA  A 1 5   ? 104.549 -20.824 42.002  1.00 29.58  ? 25  DA  B P     1 
ATOM   79    O  OP1   . DA  A 1 5   ? 103.454 -19.920 42.453  1.00 27.41  ? 25  DA  B OP1   1 
ATOM   80    O  OP2   . DA  A 1 5   ? 105.605 -20.274 41.121  1.00 29.92  ? 25  DA  B OP2   1 
ATOM   81    O  "O5'" . DA  A 1 5   ? 105.333 -21.504 43.241  1.00 28.50  ? 25  DA  B "O5'" 1 
ATOM   82    C  "C5'" . DA  A 1 5   ? 104.708 -22.301 44.232  1.00 28.06  ? 25  DA  B "C5'" 1 
ATOM   83    C  "C4'" . DA  A 1 5   ? 105.501 -23.555 44.598  1.00 28.56  ? 25  DA  B "C4'" 1 
ATOM   84    O  "O4'" . DA  A 1 5   ? 105.536 -24.474 43.472  1.00 28.79  ? 25  DA  B "O4'" 1 
ATOM   85    C  "C3'" . DA  A 1 5   ? 106.988 -23.440 44.937  1.00 28.83  ? 25  DA  B "C3'" 1 
ATOM   86    O  "O3'" . DA  A 1 5   ? 107.275 -22.951 46.268  1.00 28.49  ? 25  DA  B "O3'" 1 
ATOM   87    C  "C2'" . DA  A 1 5   ? 107.437 -24.906 44.802  1.00 29.16  ? 25  DA  B "C2'" 1 
ATOM   88    C  "C1'" . DA  A 1 5   ? 106.478 -25.504 43.777  1.00 27.02  ? 25  DA  B "C1'" 1 
ATOM   89    N  N9    . DA  A 1 5   ? 107.100 -26.008 42.544  1.00 25.68  ? 25  DA  B N9    1 
ATOM   90    C  C8    . DA  A 1 5   ? 107.336 -25.311 41.396  1.00 25.46  ? 25  DA  B C8    1 
ATOM   91    N  N7    . DA  A 1 5   ? 107.884 -26.019 40.433  1.00 25.78  ? 25  DA  B N7    1 
ATOM   92    C  C5    . DA  A 1 5   ? 108.023 -27.282 40.982  1.00 26.06  ? 25  DA  B C5    1 
ATOM   93    C  C6    . DA  A 1 5   ? 108.542 -28.508 40.480  1.00 25.59  ? 25  DA  B C6    1 
ATOM   94    N  N6    . DA  A 1 5   ? 109.035 -28.665 39.249  1.00 25.66  ? 25  DA  B N6    1 
ATOM   95    N  N1    . DA  A 1 5   ? 108.535 -29.586 41.296  1.00 25.56  ? 25  DA  B N1    1 
ATOM   96    C  C2    . DA  A 1 5   ? 108.037 -29.449 42.531  1.00 26.12  ? 25  DA  B C2    1 
ATOM   97    N  N3    . DA  A 1 5   ? 107.519 -28.358 43.115  1.00 27.01  ? 25  DA  B N3    1 
ATOM   98    C  C4    . DA  A 1 5   ? 107.544 -27.288 42.287  1.00 26.57  ? 25  DA  B C4    1 
ATOM   99    P  P     . DC  A 1 6   ? 108.784 -22.512 46.607  1.00 27.43  ? 26  DC  B P     1 
ATOM   100   O  OP1   . DC  A 1 6   ? 108.808 -21.834 47.916  1.00 29.35  ? 26  DC  B OP1   1 
ATOM   101   O  OP2   . DC  A 1 6   ? 109.336 -21.830 45.424  1.00 27.02  ? 26  DC  B OP2   1 
ATOM   102   O  "O5'" . DC  A 1 6   ? 109.548 -23.902 46.795  1.00 28.39  ? 26  DC  B "O5'" 1 
ATOM   103   C  "C5'" . DC  A 1 6   ? 109.466 -24.617 48.016  1.00 28.24  ? 26  DC  B "C5'" 1 
ATOM   104   C  "C4'" . DC  A 1 6   ? 110.181 -25.929 47.843  1.00 29.07  ? 26  DC  B "C4'" 1 
ATOM   105   O  "O4'" . DC  A 1 6   ? 109.793 -26.488 46.561  1.00 30.20  ? 26  DC  B "O4'" 1 
ATOM   106   C  "C3'" . DC  A 1 6   ? 111.690 -25.762 47.775  1.00 29.75  ? 26  DC  B "C3'" 1 
ATOM   107   O  "O3'" . DC  A 1 6   ? 112.314 -26.233 48.967  1.00 30.49  ? 26  DC  B "O3'" 1 
ATOM   108   C  "C2'" . DC  A 1 6   ? 112.113 -26.647 46.615  1.00 30.21  ? 26  DC  B "C2'" 1 
ATOM   109   C  "C1'" . DC  A 1 6   ? 110.843 -27.287 46.060  1.00 29.12  ? 26  DC  B "C1'" 1 
ATOM   110   N  N1    . DC  A 1 6   ? 110.974 -27.187 44.583  1.00 28.38  ? 26  DC  B N1    1 
ATOM   111   C  C2    . DC  A 1 6   ? 111.450 -28.280 43.833  1.00 28.14  ? 26  DC  B C2    1 
ATOM   112   O  O2    . DC  A 1 6   ? 111.707 -29.352 44.400  1.00 27.69  ? 26  DC  B O2    1 
ATOM   113   N  N3    . DC  A 1 6   ? 111.597 -28.138 42.493  1.00 26.89  ? 26  DC  B N3    1 
ATOM   114   C  C4    . DC  A 1 6   ? 111.308 -26.969 41.915  1.00 27.65  ? 26  DC  B C4    1 
ATOM   115   N  N4    . DC  A 1 6   ? 111.452 -26.853 40.591  1.00 27.23  ? 26  DC  B N4    1 
ATOM   116   C  C5    . DC  A 1 6   ? 110.841 -25.852 42.664  1.00 28.13  ? 26  DC  B C5    1 
ATOM   117   C  C6    . DC  A 1 6   ? 110.701 -25.999 43.984  1.00 28.35  ? 26  DC  B C6    1 
ATOM   118   P  P     . DT  A 1 7   ? 113.881 -25.986 49.195  1.00 30.72  ? 27  DT  B P     1 
ATOM   119   O  OP1   . DT  A 1 7   ? 114.121 -26.092 50.658  1.00 31.48  ? 27  DT  B OP1   1 
ATOM   120   O  OP2   . DT  A 1 7   ? 114.256 -24.788 48.400  1.00 29.13  ? 27  DT  B OP2   1 
ATOM   121   O  "O5'" . DT  A 1 7   ? 114.628 -27.211 48.500  1.00 28.98  ? 27  DT  B "O5'" 1 
ATOM   122   C  "C5'" . DT  A 1 7   ? 114.680 -28.496 49.056  1.00 28.35  ? 27  DT  B "C5'" 1 
ATOM   123   C  "C4'" . DT  A 1 7   ? 115.321 -29.410 48.032  1.00 27.86  ? 27  DT  B "C4'" 1 
ATOM   124   O  "O4'" . DT  A 1 7   ? 114.517 -29.440 46.821  1.00 28.23  ? 27  DT  B "O4'" 1 
ATOM   125   C  "C3'" . DT  A 1 7   ? 116.646 -28.922 47.484  1.00 27.60  ? 27  DT  B "C3'" 1 
ATOM   126   O  "O3'" . DT  A 1 7   ? 117.691 -29.082 48.434  1.00 27.17  ? 27  DT  B "O3'" 1 
ATOM   127   C  "C2'" . DT  A 1 7   ? 116.761 -29.847 46.275  1.00 27.64  ? 27  DT  B "C2'" 1 
ATOM   128   C  "C1'" . DT  A 1 7   ? 115.334 -29.814 45.727  1.00 26.56  ? 27  DT  B "C1'" 1 
ATOM   129   N  N1    . DT  A 1 7   ? 115.164 -28.872 44.561  1.00 26.15  ? 27  DT  B N1    1 
ATOM   130   C  C2    . DT  A 1 7   ? 115.398 -29.363 43.299  1.00 25.66  ? 27  DT  B C2    1 
ATOM   131   O  O2    . DT  A 1 7   ? 115.720 -30.516 43.100  1.00 25.88  ? 27  DT  B O2    1 
ATOM   132   N  N3    . DT  A 1 7   ? 115.240 -28.463 42.275  1.00 25.78  ? 27  DT  B N3    1 
ATOM   133   C  C4    . DT  A 1 7   ? 114.880 -27.127 42.379  1.00 26.36  ? 27  DT  B C4    1 
ATOM   134   O  O4    . DT  A 1 7   ? 114.756 -26.401 41.386  1.00 25.17  ? 27  DT  B O4    1 
ATOM   135   C  C5    . DT  A 1 7   ? 114.651 -26.673 43.741  1.00 26.13  ? 27  DT  B C5    1 
ATOM   136   C  C7    . DT  A 1 7   ? 114.255 -25.257 44.010  1.00 26.17  ? 27  DT  B C7    1 
ATOM   137   C  C6    . DT  A 1 7   ? 114.805 -27.550 44.746  1.00 25.97  ? 27  DT  B C6    1 
ATOM   138   P  P     . DC  A 1 8   ? 118.993 -28.152 48.302  1.00 26.64  ? 28  DC  B P     1 
ATOM   139   O  OP1   . DC  A 1 8   ? 119.797 -28.371 49.535  1.00 26.63  ? 28  DC  B OP1   1 
ATOM   140   O  OP2   . DC  A 1 8   ? 118.558 -26.806 47.903  1.00 25.41  ? 28  DC  B OP2   1 
ATOM   141   O  "O5'" . DC  A 1 8   ? 119.787 -28.794 47.059  1.00 26.74  ? 28  DC  B "O5'" 1 
ATOM   142   C  "C5'" . DC  A 1 8   ? 120.425 -30.064 47.260  1.00 26.90  ? 28  DC  B "C5'" 1 
ATOM   143   C  "C4'" . DC  A 1 8   ? 120.901 -30.725 45.982  1.00 26.04  ? 28  DC  B "C4'" 1 
ATOM   144   O  "O4'" . DC  A 1 8   ? 119.836 -30.671 45.004  1.00 27.27  ? 28  DC  B "O4'" 1 
ATOM   145   C  "C3'" . DC  A 1 8   ? 122.032 -30.008 45.275  1.00 26.07  ? 28  DC  B "C3'" 1 
ATOM   146   O  "O3'" . DC  A 1 8   ? 123.328 -30.291 45.826  1.00 24.69  ? 28  DC  B "O3'" 1 
ATOM   147   C  "C2'" . DC  A 1 8   ? 121.869 -30.536 43.849  1.00 26.34  ? 28  DC  B "C2'" 1 
ATOM   148   C  "C1'" . DC  A 1 8   ? 120.355 -30.536 43.692  1.00 24.84  ? 28  DC  B "C1'" 1 
ATOM   149   N  N1    . DC  A 1 8   ? 119.775 -29.320 43.035  1.00 24.24  ? 28  DC  B N1    1 
ATOM   150   C  C2    . DC  A 1 8   ? 119.699 -29.278 41.627  1.00 24.44  ? 28  DC  B C2    1 
ATOM   151   O  O2    . DC  A 1 8   ? 120.119 -30.243 40.966  1.00 23.86  ? 28  DC  B O2    1 
ATOM   152   N  N3    . DC  A 1 8   ? 119.159 -28.182 41.020  1.00 23.34  ? 28  DC  B N3    1 
ATOM   153   C  C4    . DC  A 1 8   ? 118.709 -27.163 41.759  1.00 24.15  ? 28  DC  B C4    1 
ATOM   154   N  N4    . DC  A 1 8   ? 118.187 -26.105 41.111  1.00 23.60  ? 28  DC  B N4    1 
ATOM   155   C  C5    . DC  A 1 8   ? 118.774 -27.192 43.195  1.00 23.36  ? 28  DC  B C5    1 
ATOM   156   C  C6    . DC  A 1 8   ? 119.302 -28.273 43.784  1.00 23.23  ? 28  DC  B C6    1 
HETATM 157   P  P     . DDG A 1 9   ? 124.425 -29.119 45.723  1.00 23.96  ? 29  DDG B P     1 
HETATM 158   O  OP1   . DDG A 1 9   ? 125.493 -29.443 46.690  1.00 24.27  ? 29  DDG B OP1   1 
HETATM 159   O  OP2   . DDG A 1 9   ? 123.719 -27.820 45.804  1.00 22.73  ? 29  DDG B OP2   1 
HETATM 160   O  "O5'" . DDG A 1 9   ? 124.976 -29.293 44.232  1.00 21.08  ? 29  DDG B "O5'" 1 
HETATM 161   C  "C5'" . DDG A 1 9   ? 125.459 -30.558 43.815  1.00 18.75  ? 29  DDG B "C5'" 1 
HETATM 162   C  "C4'" . DDG A 1 9   ? 125.731 -30.530 42.326  1.00 17.70  ? 29  DDG B "C4'" 1 
HETATM 163   O  "O4'" . DDG A 1 9   ? 124.482 -30.430 41.587  1.00 17.29  ? 29  DDG B "O4'" 1 
HETATM 164   C  "C3'" . DDG A 1 9   ? 126.534 -29.343 41.838  1.00 14.88  ? 29  DDG B "C3'" 1 
HETATM 165   C  "C2'" . DDG A 1 9   ? 126.160 -29.355 40.365  1.00 14.89  ? 29  DDG B "C2'" 1 
HETATM 166   C  "C1'" . DDG A 1 9   ? 124.671 -29.660 40.418  1.00 15.52  ? 29  DDG B "C1'" 1 
HETATM 167   N  N9    . DDG A 1 9   ? 123.820 -28.463 40.504  1.00 16.06  ? 29  DDG B N9    1 
HETATM 168   C  C8    . DDG A 1 9   ? 123.351 -27.850 41.644  1.00 15.17  ? 29  DDG B C8    1 
HETATM 169   N  N7    . DDG A 1 9   ? 122.612 -26.810 41.392  1.00 15.80  ? 29  DDG B N7    1 
HETATM 170   C  C5    . DDG A 1 9   ? 122.583 -26.709 39.999  1.00 15.53  ? 29  DDG B C5    1 
HETATM 171   C  C6    . DDG A 1 9   ? 121.935 -25.770 39.137  1.00 15.43  ? 29  DDG B C6    1 
HETATM 172   O  O6    . DDG A 1 9   ? 121.235 -24.791 39.431  1.00 15.21  ? 29  DDG B O6    1 
HETATM 173   N  N1    . DDG A 1 9   ? 122.170 -26.042 37.791  1.00 15.40  ? 29  DDG B N1    1 
HETATM 174   C  C2    . DDG A 1 9   ? 122.936 -27.100 37.341  1.00 15.81  ? 29  DDG B C2    1 
HETATM 175   N  N2    . DDG A 1 9   ? 123.069 -27.218 36.009  1.00 16.45  ? 29  DDG B N2    1 
HETATM 176   N  N3    . DDG A 1 9   ? 123.547 -27.979 38.127  1.00 14.55  ? 29  DDG B N3    1 
HETATM 177   C  C4    . DDG A 1 9   ? 123.325 -27.727 39.441  1.00 15.28  ? 29  DDG B C4    1 
ATOM   178   O  "O5'" . DT  B 2 3   ? 112.447 -16.385 30.797  1.00 57.33  ? 2   DT  C "O5'" 1 
ATOM   179   C  "C5'" . DT  B 2 3   ? 112.751 -15.011 31.048  1.00 58.97  ? 2   DT  C "C5'" 1 
ATOM   180   C  "C4'" . DT  B 2 3   ? 114.156 -14.647 30.569  1.00 59.36  ? 2   DT  C "C4'" 1 
ATOM   181   O  "O4'" . DT  B 2 3   ? 114.111 -13.935 29.301  1.00 60.61  ? 2   DT  C "O4'" 1 
ATOM   182   C  "C3'" . DT  B 2 3   ? 114.971 -13.746 31.499  1.00 58.20  ? 2   DT  C "C3'" 1 
ATOM   183   O  "O3'" . DT  B 2 3   ? 116.350 -14.145 31.504  1.00 53.50  ? 2   DT  C "O3'" 1 
ATOM   184   C  "C2'" . DT  B 2 3   ? 114.800 -12.337 30.925  1.00 60.11  ? 2   DT  C "C2'" 1 
ATOM   185   C  "C1'" . DT  B 2 3   ? 114.235 -12.540 29.514  1.00 62.76  ? 2   DT  C "C1'" 1 
ATOM   186   N  N1    . DT  B 2 3   ? 112.878 -11.911 29.240  1.00 64.38  ? 2   DT  C N1    1 
ATOM   187   C  C2    . DT  B 2 3   ? 112.533 -10.650 29.743  1.00 64.94  ? 2   DT  C C2    1 
ATOM   188   O  O2    . DT  B 2 3   ? 113.260 -9.943  30.438  1.00 64.39  ? 2   DT  C O2    1 
ATOM   189   N  N3    . DT  B 2 3   ? 111.259 -10.235 29.386  1.00 65.41  ? 2   DT  C N3    1 
ATOM   190   C  C4    . DT  B 2 3   ? 110.324 -10.921 28.606  1.00 64.78  ? 2   DT  C C4    1 
ATOM   191   O  O4    . DT  B 2 3   ? 109.211 -10.462 28.347  1.00 64.52  ? 2   DT  C O4    1 
ATOM   192   C  C5    . DT  B 2 3   ? 110.745 -12.218 28.119  1.00 64.61  ? 2   DT  C C5    1 
ATOM   193   C  C7    . DT  B 2 3   ? 109.818 -13.046 27.273  1.00 64.16  ? 2   DT  C C7    1 
ATOM   194   C  C6    . DT  B 2 3   ? 111.979 -12.636 28.454  1.00 64.59  ? 2   DT  C C6    1 
HETATM 195   P  P     . 6OG B 2 4   ? 117.253 -13.931 32.806  1.00 49.75  ? 3   6OG C P     1 
HETATM 196   O  OP1   . 6OG B 2 4   ? 116.420 -14.169 34.004  1.00 49.40  ? 3   6OG C OP1   1 
HETATM 197   O  OP2   . 6OG B 2 4   ? 117.975 -12.656 32.642  1.00 49.66  ? 3   6OG C OP2   1 
HETATM 198   O  "O5'" . 6OG B 2 4   ? 118.336 -15.085 32.709  1.00 47.59  ? 3   6OG C "O5'" 1 
HETATM 199   N  N9    . 6OG B 2 4   ? 120.673 -17.881 34.818  1.00 45.02  ? 3   6OG C N9    1 
HETATM 200   C  C4    . 6OG B 2 4   ? 121.293 -18.808 35.638  1.00 44.96  ? 3   6OG C C4    1 
HETATM 201   N  N3    . 6OG B 2 4   ? 122.328 -19.619 35.267  1.00 45.00  ? 3   6OG C N3    1 
HETATM 202   C  C2    . 6OG B 2 4   ? 122.731 -20.420 36.248  1.00 44.98  ? 3   6OG C C2    1 
HETATM 203   N  N2    . 6OG B 2 4   ? 123.745 -21.282 36.023  1.00 44.60  ? 3   6OG C N2    1 
HETATM 204   N  N1    . 6OG B 2 4   ? 122.148 -20.411 37.503  1.00 45.21  ? 3   6OG C N1    1 
HETATM 205   C  C6    . 6OG B 2 4   ? 121.078 -19.589 37.911  1.00 45.23  ? 3   6OG C C6    1 
HETATM 206   O  O6    . 6OG B 2 4   ? 120.618 -19.665 39.075  1.00 45.12  ? 3   6OG C O6    1 
HETATM 207   C  C5    . 6OG B 2 4   ? 120.645 -18.728 36.856  1.00 44.90  ? 3   6OG C C5    1 
HETATM 208   N  N7    . 6OG B 2 4   ? 119.636 -17.762 36.810  1.00 44.58  ? 3   6OG C N7    1 
HETATM 209   C  C8    . 6OG B 2 4   ? 119.693 -17.289 35.592  1.00 44.64  ? 3   6OG C C8    1 
HETATM 210   C  "C2'" . 6OG B 2 4   ? 120.851 -18.743 32.409  1.00 43.26  ? 3   6OG C "C2'" 1 
HETATM 211   C  "C5'" . 6OG B 2 4   ? 118.041 -16.323 32.085  1.00 45.83  ? 3   6OG C "C5'" 1 
HETATM 212   C  "C4'" . 6OG B 2 4   ? 119.379 -16.988 31.860  1.00 43.97  ? 3   6OG C "C4'" 1 
HETATM 213   O  "O4'" . 6OG B 2 4   ? 120.248 -16.539 32.931  1.00 45.39  ? 3   6OG C "O4'" 1 
HETATM 214   C  "C1'" . 6OG B 2 4   ? 121.038 -17.605 33.414  1.00 44.75  ? 3   6OG C "C1'" 1 
HETATM 215   C  "C3'" . 6OG B 2 4   ? 119.419 -18.500 31.939  1.00 41.74  ? 3   6OG C "C3'" 1 
HETATM 216   O  "O3'" . 6OG B 2 4   ? 119.213 -19.037 30.648  1.00 37.14  ? 3   6OG C "O3'" 1 
HETATM 217   C  C     . 6OG B 2 4   ? 121.140 -20.548 39.989  1.00 44.74  ? 3   6OG C C     1 
ATOM   218   P  P     . DC  B 2 5   ? 118.148 -20.211 30.440  1.00 32.19  ? 4   DC  C P     1 
ATOM   219   O  OP1   . DC  B 2 5   ? 117.613 -20.123 29.063  1.00 32.08  ? 4   DC  C OP1   1 
ATOM   220   O  OP2   . DC  B 2 5   ? 117.194 -20.169 31.569  1.00 32.20  ? 4   DC  C OP2   1 
ATOM   221   O  "O5'" . DC  B 2 5   ? 119.099 -21.487 30.592  1.00 31.81  ? 4   DC  C "O5'" 1 
ATOM   222   C  "C5'" . DC  B 2 5   ? 120.319 -21.555 29.865  1.00 30.70  ? 4   DC  C "C5'" 1 
ATOM   223   C  "C4'" . DC  B 2 5   ? 121.127 -22.779 30.268  1.00 30.47  ? 4   DC  C "C4'" 1 
ATOM   224   O  "O4'" . DC  B 2 5   ? 121.701 -22.496 31.567  1.00 31.75  ? 4   DC  C "O4'" 1 
ATOM   225   C  "C3'" . DC  B 2 5   ? 120.378 -24.103 30.437  1.00 29.18  ? 4   DC  C "C3'" 1 
ATOM   226   O  "O3'" . DC  B 2 5   ? 120.430 -24.896 29.264  1.00 26.76  ? 4   DC  C "O3'" 1 
ATOM   227   C  "C2'" . DC  B 2 5   ? 121.193 -24.817 31.505  1.00 30.52  ? 4   DC  C "C2'" 1 
ATOM   228   C  "C1'" . DC  B 2 5   ? 121.809 -23.689 32.321  1.00 31.28  ? 4   DC  C "C1'" 1 
ATOM   229   N  N1    . DC  B 2 5   ? 121.173 -23.497 33.654  1.00 31.15  ? 4   DC  C N1    1 
ATOM   230   C  C2    . DC  B 2 5   ? 121.660 -24.251 34.722  1.00 32.28  ? 4   DC  C C2    1 
ATOM   231   O  O2    . DC  B 2 5   ? 122.593 -25.043 34.503  1.00 32.33  ? 4   DC  C O2    1 
ATOM   232   N  N3    . DC  B 2 5   ? 121.100 -24.088 35.956  1.00 32.06  ? 4   DC  C N3    1 
ATOM   233   C  C4    . DC  B 2 5   ? 120.107 -23.213 36.122  1.00 31.38  ? 4   DC  C C4    1 
ATOM   234   N  N4    . DC  B 2 5   ? 119.596 -23.082 37.347  1.00 31.22  ? 4   DC  C N4    1 
ATOM   235   C  C5    . DC  B 2 5   ? 119.596 -22.432 35.041  1.00 31.45  ? 4   DC  C C5    1 
ATOM   236   C  C6    . DC  B 2 5   ? 120.152 -22.608 33.834  1.00 31.41  ? 4   DC  C C6    1 
ATOM   237   P  P     . DG  B 2 6   ? 119.306 -25.995 28.947  1.00 24.09  ? 5   DG  C P     1 
ATOM   238   O  OP1   . DG  B 2 6   ? 119.570 -26.474 27.567  1.00 22.75  ? 5   DG  C OP1   1 
ATOM   239   O  OP2   . DG  B 2 6   ? 117.998 -25.397 29.262  1.00 22.09  ? 5   DG  C OP2   1 
ATOM   240   O  "O5'" . DG  B 2 6   ? 119.596 -27.149 30.021  1.00 24.19  ? 5   DG  C "O5'" 1 
ATOM   241   C  "C5'" . DG  B 2 6   ? 120.676 -28.053 29.795  1.00 26.78  ? 5   DG  C "C5'" 1 
ATOM   242   C  "C4'" . DG  B 2 6   ? 120.917 -29.044 30.933  1.00 28.00  ? 5   DG  C "C4'" 1 
ATOM   243   O  "O4'" . DG  B 2 6   ? 121.348 -28.347 32.126  1.00 29.69  ? 5   DG  C "O4'" 1 
ATOM   244   C  "C3'" . DG  B 2 6   ? 119.737 -29.882 31.394  1.00 27.32  ? 5   DG  C "C3'" 1 
ATOM   245   O  "O3'" . DG  B 2 6   ? 119.637 -31.041 30.583  1.00 26.41  ? 5   DG  C "O3'" 1 
ATOM   246   C  "C2'" . DG  B 2 6   ? 120.156 -30.266 32.805  1.00 28.46  ? 5   DG  C "C2'" 1 
ATOM   247   C  "C1'" . DG  B 2 6   ? 120.926 -29.040 33.286  1.00 29.48  ? 5   DG  C "C1'" 1 
ATOM   248   N  N9    . DG  B 2 6   ? 120.161 -28.130 34.164  1.00 30.18  ? 5   DG  C N9    1 
ATOM   249   C  C8    . DG  B 2 6   ? 119.479 -26.993 33.792  1.00 29.43  ? 5   DG  C C8    1 
ATOM   250   N  N7    . DG  B 2 6   ? 118.897 -26.391 34.792  1.00 29.82  ? 5   DG  C N7    1 
ATOM   251   C  C5    . DG  B 2 6   ? 119.199 -27.174 35.906  1.00 29.89  ? 5   DG  C C5    1 
ATOM   252   C  C6    . DG  B 2 6   ? 118.841 -27.021 37.276  1.00 29.44  ? 5   DG  C C6    1 
ATOM   253   O  O6    . DG  B 2 6   ? 118.165 -26.132 37.801  1.00 29.11  ? 5   DG  C O6    1 
ATOM   254   N  N1    . DG  B 2 6   ? 119.367 -28.030 38.078  1.00 29.64  ? 5   DG  C N1    1 
ATOM   255   C  C2    . DG  B 2 6   ? 120.140 -29.074 37.617  1.00 29.39  ? 5   DG  C C2    1 
ATOM   256   N  N2    . DG  B 2 6   ? 120.557 -29.961 38.532  1.00 28.97  ? 5   DG  C N2    1 
ATOM   257   N  N3    . DG  B 2 6   ? 120.484 -29.229 36.341  1.00 29.71  ? 5   DG  C N3    1 
ATOM   258   C  C4    . DG  B 2 6   ? 119.982 -28.248 35.538  1.00 30.04  ? 5   DG  C C4    1 
ATOM   259   P  P     . DA  B 2 7   ? 118.237 -31.800 30.438  1.00 24.58  ? 6   DA  C P     1 
ATOM   260   O  OP1   . DA  B 2 7   ? 118.379 -32.664 29.256  1.00 24.78  ? 6   DA  C OP1   1 
ATOM   261   O  OP2   . DA  B 2 7   ? 117.174 -30.772 30.488  1.00 23.50  ? 6   DA  C OP2   1 
ATOM   262   O  "O5'" . DA  B 2 7   ? 118.128 -32.780 31.716  1.00 24.26  ? 6   DA  C "O5'" 1 
ATOM   263   C  "C5'" . DA  B 2 7   ? 117.172 -32.606 32.756  1.00 21.06  ? 6   DA  C "C5'" 1 
ATOM   264   C  "C4'" . DA  B 2 7   ? 117.626 -33.341 33.999  1.00 19.95  ? 6   DA  C "C4'" 1 
ATOM   265   O  "O4'" . DA  B 2 7   ? 118.386 -32.449 34.859  1.00 20.57  ? 6   DA  C "O4'" 1 
ATOM   266   C  "C3'" . DA  B 2 7   ? 116.503 -33.917 34.845  1.00 19.28  ? 6   DA  C "C3'" 1 
ATOM   267   O  "O3'" . DA  B 2 7   ? 116.453 -35.309 34.596  1.00 18.91  ? 6   DA  C "O3'" 1 
ATOM   268   C  "C2'" . DA  B 2 7   ? 116.948 -33.654 36.279  1.00 19.22  ? 6   DA  C "C2'" 1 
ATOM   269   C  "C1'" . DA  B 2 7   ? 117.883 -32.462 36.185  1.00 20.62  ? 6   DA  C "C1'" 1 
ATOM   270   N  N9    . DA  B 2 7   ? 117.198 -31.203 36.511  1.00 21.06  ? 6   DA  C N9    1 
ATOM   271   C  C8    . DA  B 2 7   ? 116.794 -30.206 35.659  1.00 20.78  ? 6   DA  C C8    1 
ATOM   272   N  N7    . DA  B 2 7   ? 116.185 -29.200 36.245  1.00 20.62  ? 6   DA  C N7    1 
ATOM   273   C  C5    . DA  B 2 7   ? 116.182 -29.558 37.580  1.00 20.95  ? 6   DA  C C5    1 
ATOM   274   C  C6    . DA  B 2 7   ? 115.689 -28.919 38.737  1.00 21.00  ? 6   DA  C C6    1 
ATOM   275   N  N6    . DA  B 2 7   ? 115.077 -27.731 38.717  1.00 20.76  ? 6   DA  C N6    1 
ATOM   276   N  N1    . DA  B 2 7   ? 115.856 -29.545 39.924  1.00 20.98  ? 6   DA  C N1    1 
ATOM   277   C  C2    . DA  B 2 7   ? 116.474 -30.733 39.944  1.00 20.91  ? 6   DA  C C2    1 
ATOM   278   N  N3    . DA  B 2 7   ? 116.973 -31.434 38.925  1.00 21.12  ? 6   DA  C N3    1 
ATOM   279   C  C4    . DA  B 2 7   ? 116.799 -30.787 37.761  1.00 21.23  ? 6   DA  C C4    1 
ATOM   280   P  P     . DG  B 2 8   ? 115.097 -36.136 34.785  1.00 18.65  ? 7   DG  C P     1 
ATOM   281   O  OP1   . DG  B 2 8   ? 115.402 -37.551 34.467  1.00 20.22  ? 7   DG  C OP1   1 
ATOM   282   O  OP2   . DG  B 2 8   ? 114.013 -35.465 34.051  1.00 18.10  ? 7   DG  C OP2   1 
ATOM   283   O  "O5'" . DG  B 2 8   ? 114.788 -36.007 36.354  1.00 17.73  ? 7   DG  C "O5'" 1 
ATOM   284   C  "C5'" . DG  B 2 8   ? 115.555 -36.748 37.288  1.00 17.67  ? 7   DG  C "C5'" 1 
ATOM   285   C  "C4'" . DG  B 2 8   ? 114.866 -36.805 38.632  1.00 18.95  ? 7   DG  C "C4'" 1 
ATOM   286   O  "O4'" . DG  B 2 8   ? 114.742 -35.479 39.193  1.00 18.95  ? 7   DG  C "O4'" 1 
ATOM   287   C  "C3'" . DG  B 2 8   ? 113.459 -37.382 38.607  1.00 19.92  ? 7   DG  C "C3'" 1 
ATOM   288   O  "O3'" . DG  B 2 8   ? 113.337 -38.266 39.712  1.00 20.94  ? 7   DG  C "O3'" 1 
ATOM   289   C  "C2'" . DG  B 2 8   ? 112.528 -36.163 38.673  1.00 19.14  ? 7   DG  C "C2'" 1 
ATOM   290   C  "C1'" . DG  B 2 8   ? 113.378 -35.135 39.409  1.00 19.56  ? 7   DG  C "C1'" 1 
ATOM   291   N  N9    . DG  B 2 8   ? 113.171 -33.730 39.005  1.00 20.24  ? 7   DG  C N9    1 
ATOM   292   C  C8    . DG  B 2 8   ? 113.211 -33.191 37.737  1.00 19.58  ? 7   DG  C C8    1 
ATOM   293   N  N7    . DG  B 2 8   ? 112.998 -31.908 37.719  1.00 19.37  ? 7   DG  C N7    1 
ATOM   294   C  C5    . DG  B 2 8   ? 112.805 -31.553 39.052  1.00 19.96  ? 7   DG  C C5    1 
ATOM   295   C  C6    . DG  B 2 8   ? 112.536 -30.291 39.673  1.00 19.58  ? 7   DG  C C6    1 
ATOM   296   O  O6    . DG  B 2 8   ? 112.402 -29.180 39.155  1.00 19.67  ? 7   DG  C O6    1 
ATOM   297   N  N1    . DG  B 2 8   ? 112.413 -30.391 41.054  1.00 19.57  ? 7   DG  C N1    1 
ATOM   298   C  C2    . DG  B 2 8   ? 112.542 -31.574 41.751  1.00 19.41  ? 7   DG  C C2    1 
ATOM   299   N  N2    . DG  B 2 8   ? 112.401 -31.527 43.082  1.00 19.87  ? 7   DG  C N2    1 
ATOM   300   N  N3    . DG  B 2 8   ? 112.786 -32.743 41.191  1.00 19.26  ? 7   DG  C N3    1 
ATOM   301   C  C4    . DG  B 2 8   ? 112.906 -32.669 39.848  1.00 19.74  ? 7   DG  C C4    1 
ATOM   302   P  P     . DT  B 2 9   ? 111.988 -39.093 39.955  1.00 22.30  ? 8   DT  C P     1 
ATOM   303   O  OP1   . DT  B 2 9   ? 112.333 -40.344 40.663  1.00 22.91  ? 8   DT  C OP1   1 
ATOM   304   O  OP2   . DT  B 2 9   ? 111.229 -39.157 38.681  1.00 21.41  ? 8   DT  C OP2   1 
ATOM   305   O  "O5'" . DT  B 2 9   ? 111.234 -38.145 40.992  1.00 21.00  ? 8   DT  C "O5'" 1 
ATOM   306   C  "C5'" . DT  B 2 9   ? 111.783 -37.980 42.294  1.00 20.88  ? 8   DT  C "C5'" 1 
ATOM   307   C  "C4'" . DT  B 2 9   ? 110.807 -37.198 43.137  1.00 21.51  ? 8   DT  C "C4'" 1 
ATOM   308   O  "O4'" . DT  B 2 9   ? 110.753 -35.840 42.640  1.00 21.53  ? 8   DT  C "O4'" 1 
ATOM   309   C  "C3'" . DT  B 2 9   ? 109.373 -37.729 43.100  1.00 22.44  ? 8   DT  C "C3'" 1 
ATOM   310   O  "O3'" . DT  B 2 9   ? 108.837 -37.686 44.421  1.00 24.28  ? 8   DT  C "O3'" 1 
ATOM   311   C  "C2'" . DT  B 2 9   ? 108.652 -36.755 42.168  1.00 22.57  ? 8   DT  C "C2'" 1 
ATOM   312   C  "C1'" . DT  B 2 9   ? 109.395 -35.463 42.492  1.00 21.96  ? 8   DT  C "C1'" 1 
ATOM   313   N  N1    . DT  B 2 9   ? 109.309 -34.394 41.460  1.00 21.66  ? 8   DT  C N1    1 
ATOM   314   C  C2    . DT  B 2 9   ? 109.152 -33.077 41.864  1.00 21.57  ? 8   DT  C C2    1 
ATOM   315   O  O2    . DT  B 2 9   ? 109.065 -32.735 43.026  1.00 22.01  ? 8   DT  C O2    1 
ATOM   316   N  N3    . DT  B 2 9   ? 109.092 -32.151 40.858  1.00 20.48  ? 8   DT  C N3    1 
ATOM   317   C  C4    . DT  B 2 9   ? 109.166 -32.414 39.507  1.00 21.69  ? 8   DT  C C4    1 
ATOM   318   O  O4    . DT  B 2 9   ? 109.102 -31.512 38.679  1.00 21.68  ? 8   DT  C O4    1 
ATOM   319   C  C5    . DT  B 2 9   ? 109.325 -33.811 39.140  1.00 22.23  ? 8   DT  C C5    1 
ATOM   320   C  C7    . DT  B 2 9   ? 109.421 -34.212 37.691  1.00 21.59  ? 8   DT  C C7    1 
ATOM   321   C  C6    . DT  B 2 9   ? 109.392 -34.726 40.124  1.00 21.53  ? 8   DT  C C6    1 
ATOM   322   P  P     . DC  B 2 10  ? 107.687 -38.684 44.937  1.00 24.30  ? 9   DC  C P     1 
ATOM   323   O  OP1   . DC  B 2 10  ? 108.257 -39.533 46.010  1.00 23.32  ? 9   DC  C OP1   1 
ATOM   324   O  OP2   . DC  B 2 10  ? 107.038 -39.318 43.768  1.00 24.01  ? 9   DC  C OP2   1 
ATOM   325   O  "O5'" . DC  B 2 10  ? 106.674 -37.620 45.578  1.00 23.29  ? 9   DC  C "O5'" 1 
ATOM   326   C  "C5'" . DC  B 2 10  ? 107.185 -36.603 46.409  1.00 24.06  ? 9   DC  C "C5'" 1 
ATOM   327   C  "C4'" . DC  B 2 10  ? 106.252 -35.415 46.380  1.00 24.77  ? 9   DC  C "C4'" 1 
ATOM   328   O  "O4'" . DC  B 2 10  ? 106.544 -34.552 45.251  1.00 25.72  ? 9   DC  C "O4'" 1 
ATOM   329   C  "C3'" . DC  B 2 10  ? 104.793 -35.803 46.227  1.00 24.75  ? 9   DC  C "C3'" 1 
ATOM   330   O  "O3'" . DC  B 2 10  ? 104.126 -35.257 47.320  1.00 24.91  ? 9   DC  C "O3'" 1 
ATOM   331   C  "C2'" . DC  B 2 10  ? 104.321 -35.149 44.925  1.00 24.45  ? 9   DC  C "C2'" 1 
ATOM   332   C  "C1'" . DC  B 2 10  ? 105.333 -34.039 44.724  1.00 24.42  ? 9   DC  C "C1'" 1 
ATOM   333   N  N1    . DC  B 2 10  ? 105.526 -33.732 43.282  1.00 24.79  ? 9   DC  C N1    1 
ATOM   334   C  C2    . DC  B 2 10  ? 105.623 -32.399 42.831  1.00 24.86  ? 9   DC  C C2    1 
ATOM   335   O  O2    . DC  B 2 10  ? 105.552 -31.464 43.638  1.00 23.69  ? 9   DC  C O2    1 
ATOM   336   N  N3    . DC  B 2 10  ? 105.793 -32.169 41.505  1.00 24.19  ? 9   DC  C N3    1 
ATOM   337   C  C4    . DC  B 2 10  ? 105.870 -33.197 40.667  1.00 23.30  ? 9   DC  C C4    1 
ATOM   338   N  N4    . DC  B 2 10  ? 106.038 -32.926 39.379  1.00 23.82  ? 9   DC  C N4    1 
ATOM   339   C  C5    . DC  B 2 10  ? 105.773 -34.546 41.100  1.00 23.52  ? 9   DC  C C5    1 
ATOM   340   C  C6    . DC  B 2 10  ? 105.605 -34.769 42.401  1.00 24.08  ? 9   DC  C C6    1 
ATOM   341   P  P     . DA  B 2 11  ? 102.666 -35.761 47.708  1.00 25.99  ? 10  DA  C P     1 
ATOM   342   O  OP1   . DA  B 2 11  ? 102.730 -36.141 49.140  1.00 24.86  ? 10  DA  C OP1   1 
ATOM   343   O  OP2   . DA  B 2 11  ? 102.161 -36.691 46.672  1.00 24.88  ? 10  DA  C OP2   1 
ATOM   344   O  "O5'" . DA  B 2 11  ? 101.820 -34.401 47.582  1.00 25.46  ? 10  DA  C "O5'" 1 
ATOM   345   C  "C5'" . DA  B 2 11  ? 102.308 -33.212 48.188  1.00 22.09  ? 10  DA  C "C5'" 1 
ATOM   346   C  "C4'" . DA  B 2 11  ? 101.354 -32.066 47.943  1.00 21.20  ? 10  DA  C "C4'" 1 
ATOM   347   O  "O4'" . DA  B 2 11  ? 101.645 -31.445 46.668  1.00 21.18  ? 10  DA  C "O4'" 1 
ATOM   348   C  "C3'" . DA  B 2 11  ? 99.880  -32.431 47.913  1.00 21.62  ? 10  DA  C "C3'" 1 
ATOM   349   O  "O3'" . DA  B 2 11  ? 99.196  -31.339 48.540  1.00 23.31  ? 10  DA  C "O3'" 1 
ATOM   350   C  "C2'" . DA  B 2 11  ? 99.579  -32.559 46.421  1.00 21.48  ? 10  DA  C "C2'" 1 
ATOM   351   C  "C1'" . DA  B 2 11  ? 100.560 -31.574 45.772  1.00 19.81  ? 10  DA  C "C1'" 1 
ATOM   352   N  N9    . DA  B 2 11  ? 101.046 -32.075 44.488  1.00 18.83  ? 10  DA  C N9    1 
ATOM   353   C  C8    . DA  B 2 11  ? 101.392 -33.366 44.239  1.00 18.68  ? 10  DA  C C8    1 
ATOM   354   N  N7    . DA  B 2 11  ? 101.776 -33.594 43.009  1.00 19.49  ? 10  DA  C N7    1 
ATOM   355   C  C5    . DA  B 2 11  ? 101.679 -32.363 42.394  1.00 19.02  ? 10  DA  C C5    1 
ATOM   356   C  C6    . DA  B 2 11  ? 101.947 -31.944 41.073  1.00 19.09  ? 10  DA  C C6    1 
ATOM   357   N  N6    . DA  B 2 11  ? 102.390 -32.765 40.115  1.00 18.31  ? 10  DA  C N6    1 
ATOM   358   N  N1    . DA  B 2 11  ? 101.732 -30.637 40.780  1.00 19.43  ? 10  DA  C N1    1 
ATOM   359   C  C2    . DA  B 2 11  ? 101.286 -29.820 41.745  1.00 18.52  ? 10  DA  C C2    1 
ATOM   360   N  N3    . DA  B 2 11  ? 101.005 -30.108 43.016  1.00 18.12  ? 10  DA  C N3    1 
ATOM   361   C  C4    . DA  B 2 11  ? 101.222 -31.408 43.290  1.00 19.05  ? 10  DA  C C4    1 
ATOM   362   P  P     . DG  B 2 12  ? 97.601  -31.177 48.623  1.00 22.71  ? 11  DG  C P     1 
ATOM   363   O  OP1   . DG  B 2 12  ? 97.341  -30.267 49.759  1.00 22.59  ? 11  DG  C OP1   1 
ATOM   364   O  OP2   . DG  B 2 12  ? 96.954  -32.508 48.575  1.00 23.03  ? 11  DG  C OP2   1 
ATOM   365   O  "O5'" . DG  B 2 12  ? 97.257  -30.435 47.246  1.00 22.33  ? 11  DG  C "O5'" 1 
ATOM   366   C  "C5'" . DG  B 2 12  ? 97.272  -29.041 47.215  1.00 24.38  ? 11  DG  C "C5'" 1 
ATOM   367   C  "C4'" . DG  B 2 12  ? 96.929  -28.555 45.824  1.00 26.24  ? 11  DG  C "C4'" 1 
ATOM   368   O  "O4'" . DG  B 2 12  ? 97.599  -29.379 44.846  1.00 25.75  ? 11  DG  C "O4'" 1 
ATOM   369   C  "C3'" . DG  B 2 12  ? 95.448  -28.611 45.473  1.00 27.07  ? 11  DG  C "C3'" 1 
ATOM   370   O  "O3'" . DG  B 2 12  ? 95.024  -27.306 45.092  1.00 28.89  ? 11  DG  C "O3'" 1 
ATOM   371   C  "C2'" . DG  B 2 12  ? 95.369  -29.616 44.321  1.00 25.82  ? 11  DG  C "C2'" 1 
ATOM   372   C  "C1'" . DG  B 2 12  ? 96.759  -29.487 43.722  1.00 24.70  ? 11  DG  C "C1'" 1 
ATOM   373   N  N9    . DG  B 2 12  ? 97.244  -30.676 43.048  1.00 24.14  ? 11  DG  C N9    1 
ATOM   374   C  C8    . DG  B 2 12  ? 97.328  -31.925 43.611  1.00 23.76  ? 11  DG  C C8    1 
ATOM   375   N  N7    . DG  B 2 12  ? 97.821  -32.813 42.803  1.00 23.96  ? 11  DG  C N7    1 
ATOM   376   C  C5    . DG  B 2 12  ? 98.089  -32.105 41.639  1.00 23.64  ? 11  DG  C C5    1 
ATOM   377   C  C6    . DG  B 2 12  ? 98.636  -32.552 40.417  1.00 23.75  ? 11  DG  C C6    1 
ATOM   378   O  O6    . DG  B 2 12  ? 99.001  -33.693 40.115  1.00 23.96  ? 11  DG  C O6    1 
ATOM   379   N  N1    . DG  B 2 12  ? 98.740  -31.520 39.489  1.00 24.03  ? 11  DG  C N1    1 
ATOM   380   C  C2    . DG  B 2 12  ? 98.365  -30.221 39.719  1.00 23.63  ? 11  DG  C C2    1 
ATOM   381   N  N2    . DG  B 2 12  ? 98.551  -29.381 38.698  1.00 23.76  ? 11  DG  C N2    1 
ATOM   382   N  N3    . DG  B 2 12  ? 97.852  -29.784 40.862  1.00 23.14  ? 11  DG  C N3    1 
ATOM   383   C  C4    . DG  B 2 12  ? 97.743  -30.780 41.773  1.00 23.36  ? 11  DG  C C4    1 
ATOM   384   P  P     . DG  B 2 13  ? 93.465  -27.003 44.881  1.00 30.37  ? 12  DG  C P     1 
ATOM   385   O  OP1   . DG  B 2 13  ? 93.195  -25.565 45.172  1.00 31.32  ? 12  DG  C OP1   1 
ATOM   386   O  OP2   . DG  B 2 13  ? 92.702  -28.039 45.608  1.00 29.90  ? 12  DG  C OP2   1 
ATOM   387   O  "O5'" . DG  B 2 13  ? 93.331  -27.224 43.304  1.00 29.16  ? 12  DG  C "O5'" 1 
ATOM   388   C  "C5'" . DG  B 2 13  ? 93.914  -26.282 42.419  1.00 30.56  ? 12  DG  C "C5'" 1 
ATOM   389   C  "C4'" . DG  B 2 13  ? 93.582  -26.651 40.984  1.00 31.73  ? 12  DG  C "C4'" 1 
ATOM   390   O  "O4'" . DG  B 2 13  ? 94.381  -27.810 40.642  1.00 31.63  ? 12  DG  C "O4'" 1 
ATOM   391   C  "C3'" . DG  B 2 13  ? 92.108  -27.028 40.764  1.00 32.04  ? 12  DG  C "C3'" 1 
ATOM   392   O  "O3'" . DG  B 2 13  ? 91.509  -26.304 39.653  1.00 32.35  ? 12  DG  C "O3'" 1 
ATOM   393   C  "C2'" . DG  B 2 13  ? 92.129  -28.544 40.571  1.00 30.84  ? 12  DG  C "C2'" 1 
ATOM   394   C  "C1'" . DG  B 2 13  ? 93.545  -28.787 40.050  1.00 30.56  ? 12  DG  C "C1'" 1 
ATOM   395   N  N9    . DG  B 2 13  ? 94.024  -30.155 40.299  1.00 30.25  ? 12  DG  C N9    1 
ATOM   396   C  C8    . DG  B 2 13  ? 93.811  -30.963 41.398  1.00 30.33  ? 12  DG  C C8    1 
ATOM   397   N  N7    . DG  B 2 13  ? 94.352  -32.148 41.308  1.00 29.71  ? 12  DG  C N7    1 
ATOM   398   C  C5    . DG  B 2 13  ? 94.957  -32.125 40.061  1.00 29.63  ? 12  DG  C C5    1 
ATOM   399   C  C6    . DG  B 2 13  ? 95.693  -33.126 39.397  1.00 30.05  ? 12  DG  C C6    1 
ATOM   400   O  O6    . DG  B 2 13  ? 95.974  -34.264 39.799  1.00 30.09  ? 12  DG  C O6    1 
ATOM   401   N  N1    . DG  B 2 13  ? 96.132  -32.690 38.148  1.00 30.28  ? 12  DG  C N1    1 
ATOM   402   C  C2    . DG  B 2 13  ? 95.885  -31.444 37.607  1.00 30.32  ? 12  DG  C C2    1 
ATOM   403   N  N2    . DG  B 2 13  ? 96.380  -31.198 36.381  1.00 29.99  ? 12  DG  C N2    1 
ATOM   404   N  N3    . DG  B 2 13  ? 95.185  -30.502 38.222  1.00 29.70  ? 12  DG  C N3    1 
ATOM   405   C  C4    . DG  B 2 13  ? 94.760  -30.916 39.434  1.00 29.48  ? 12  DG  C C4    1 
ATOM   406   O  "O5'" . DC  C 1 1   ? 143.287 -29.247 -30.267 1.00 47.14  ? 21  DC  E "O5'" 1 
ATOM   407   C  "C5'" . DC  C 1 1   ? 143.876 -28.295 -29.388 1.00 46.33  ? 21  DC  E "C5'" 1 
ATOM   408   C  "C4'" . DC  C 1 1   ? 143.726 -26.897 -29.960 1.00 45.58  ? 21  DC  E "C4'" 1 
ATOM   409   O  "O4'" . DC  C 1 1   ? 143.494 -26.973 -31.387 1.00 45.72  ? 21  DC  E "O4'" 1 
ATOM   410   C  "C3'" . DC  C 1 1   ? 142.510 -26.110 -29.491 1.00 44.57  ? 21  DC  E "C3'" 1 
ATOM   411   O  "O3'" . DC  C 1 1   ? 142.626 -25.640 -28.133 1.00 43.57  ? 21  DC  E "O3'" 1 
ATOM   412   C  "C2'" . DC  C 1 1   ? 142.504 -24.998 -30.530 1.00 45.01  ? 21  DC  E "C2'" 1 
ATOM   413   C  "C1'" . DC  C 1 1   ? 142.886 -25.758 -31.796 1.00 45.07  ? 21  DC  E "C1'" 1 
ATOM   414   N  N1    . DC  C 1 1   ? 141.738 -25.994 -32.750 1.00 45.02  ? 21  DC  E N1    1 
ATOM   415   C  C2    . DC  C 1 1   ? 141.523 -25.053 -33.769 1.00 45.10  ? 21  DC  E C2    1 
ATOM   416   O  O2    . DC  C 1 1   ? 142.268 -24.059 -33.852 1.00 44.89  ? 21  DC  E O2    1 
ATOM   417   N  N3    . DC  C 1 1   ? 140.504 -25.256 -34.640 1.00 44.41  ? 21  DC  E N3    1 
ATOM   418   C  C4    . DC  C 1 1   ? 139.725 -26.327 -34.525 1.00 44.37  ? 21  DC  E C4    1 
ATOM   419   N  N4    . DC  C 1 1   ? 138.737 -26.458 -35.415 1.00 44.57  ? 21  DC  E N4    1 
ATOM   420   C  C5    . DC  C 1 1   ? 139.924 -27.297 -33.497 1.00 44.33  ? 21  DC  E C5    1 
ATOM   421   C  C6    . DC  C 1 1   ? 140.931 -27.093 -32.640 1.00 44.59  ? 21  DC  E C6    1 
ATOM   422   P  P     . DC  C 1 2   ? 143.562 -24.435 -27.603 1.00 42.50  ? 22  DC  E P     1 
ATOM   423   O  OP1   . DC  C 1 2   ? 144.934 -24.587 -28.137 1.00 42.40  ? 22  DC  E OP1   1 
ATOM   424   O  OP2   . DC  C 1 2   ? 143.356 -24.393 -26.131 1.00 41.93  ? 22  DC  E OP2   1 
ATOM   425   O  "O5'" . DC  C 1 2   ? 142.944 -23.110 -28.263 1.00 39.58  ? 22  DC  E "O5'" 1 
ATOM   426   C  "C5'" . DC  C 1 2   ? 143.826 -22.135 -28.791 1.00 35.17  ? 22  DC  E "C5'" 1 
ATOM   427   C  "C4'" . DC  C 1 2   ? 143.099 -21.013 -29.503 1.00 31.82  ? 22  DC  E "C4'" 1 
ATOM   428   O  "O4'" . DC  C 1 2   ? 142.220 -21.518 -30.546 1.00 29.58  ? 22  DC  E "O4'" 1 
ATOM   429   C  "C3'" . DC  C 1 2   ? 142.249 -20.151 -28.578 1.00 30.18  ? 22  DC  E "C3'" 1 
ATOM   430   O  "O3'" . DC  C 1 2   ? 142.603 -18.815 -28.828 1.00 29.62  ? 22  DC  E "O3'" 1 
ATOM   431   C  "C2'" . DC  C 1 2   ? 140.818 -20.483 -29.001 1.00 29.52  ? 22  DC  E "C2'" 1 
ATOM   432   C  "C1'" . DC  C 1 2   ? 140.990 -20.820 -30.480 1.00 27.47  ? 22  DC  E "C1'" 1 
ATOM   433   N  N1    . DC  C 1 2   ? 140.006 -21.753 -31.059 1.00 25.81  ? 22  DC  E N1    1 
ATOM   434   C  C2    . DC  C 1 2   ? 139.328 -21.434 -32.238 1.00 25.31  ? 22  DC  E C2    1 
ATOM   435   O  O2    . DC  C 1 2   ? 139.519 -20.350 -32.783 1.00 25.51  ? 22  DC  E O2    1 
ATOM   436   N  N3    . DC  C 1 2   ? 138.456 -22.321 -32.764 1.00 25.54  ? 22  DC  E N3    1 
ATOM   437   C  C4    . DC  C 1 2   ? 138.251 -23.484 -32.159 1.00 25.56  ? 22  DC  E C4    1 
ATOM   438   N  N4    . DC  C 1 2   ? 137.375 -24.325 -32.712 1.00 25.60  ? 22  DC  E N4    1 
ATOM   439   C  C5    . DC  C 1 2   ? 138.931 -23.828 -30.961 1.00 25.11  ? 22  DC  E C5    1 
ATOM   440   C  C6    . DC  C 1 2   ? 139.792 -22.946 -30.452 1.00 25.20  ? 22  DC  E C6    1 
ATOM   441   P  P     . DT  C 1 3   ? 142.007 -17.624 -27.936 1.00 33.10  ? 23  DT  E P     1 
ATOM   442   O  OP1   . DT  C 1 3   ? 143.024 -16.548 -27.799 1.00 31.76  ? 23  DT  E OP1   1 
ATOM   443   O  OP2   . DT  C 1 3   ? 141.382 -18.193 -26.714 1.00 32.54  ? 23  DT  E OP2   1 
ATOM   444   O  "O5'" . DT  C 1 3   ? 140.872 -17.074 -28.925 1.00 30.92  ? 23  DT  E "O5'" 1 
ATOM   445   C  "C5'" . DT  C 1 3   ? 141.234 -16.274 -30.033 1.00 26.83  ? 23  DT  E "C5'" 1 
ATOM   446   C  "C4'" . DT  C 1 3   ? 139.985 -15.810 -30.745 1.00 25.23  ? 23  DT  E "C4'" 1 
ATOM   447   O  "O4'" . DT  C 1 3   ? 139.196 -16.949 -31.171 1.00 23.46  ? 23  DT  E "O4'" 1 
ATOM   448   C  "C3'" . DT  C 1 3   ? 139.067 -14.935 -29.900 1.00 24.08  ? 23  DT  E "C3'" 1 
ATOM   449   O  "O3'" . DT  C 1 3   ? 138.795 -13.786 -30.679 1.00 22.96  ? 23  DT  E "O3'" 1 
ATOM   450   C  "C2'" . DT  C 1 3   ? 137.824 -15.797 -29.668 1.00 23.20  ? 23  DT  E "C2'" 1 
ATOM   451   C  "C1'" . DT  C 1 3   ? 137.831 -16.707 -30.899 1.00 22.79  ? 23  DT  E "C1'" 1 
ATOM   452   N  N1    . DT  C 1 3   ? 137.218 -18.076 -30.762 1.00 22.46  ? 23  DT  E N1    1 
ATOM   453   C  C2    . DT  C 1 3   ? 136.359 -18.544 -31.737 1.00 21.91  ? 23  DT  E C2    1 
ATOM   454   O  O2    . DT  C 1 3   ? 136.021 -17.913 -32.721 1.00 22.66  ? 23  DT  E O2    1 
ATOM   455   N  N3    . DT  C 1 3   ? 135.882 -19.805 -31.526 1.00 22.24  ? 23  DT  E N3    1 
ATOM   456   C  C4    . DT  C 1 3   ? 136.169 -20.647 -30.465 1.00 22.66  ? 23  DT  E C4    1 
ATOM   457   O  O4    . DT  C 1 3   ? 135.681 -21.774 -30.381 1.00 22.36  ? 23  DT  E O4    1 
ATOM   458   C  C5    . DT  C 1 3   ? 137.073 -20.099 -29.476 1.00 22.37  ? 23  DT  E C5    1 
ATOM   459   C  C7    . DT  C 1 3   ? 137.461 -20.910 -28.279 1.00 22.10  ? 23  DT  E C7    1 
ATOM   460   C  C6    . DT  C 1 3   ? 137.555 -18.862 -29.675 1.00 22.19  ? 23  DT  E C6    1 
ATOM   461   P  P     . DG  C 1 4   ? 138.098 -12.514 -30.023 1.00 22.84  ? 24  DG  E P     1 
ATOM   462   O  OP1   . DG  C 1 4   ? 138.688 -11.326 -30.667 1.00 23.95  ? 24  DG  E OP1   1 
ATOM   463   O  OP2   . DG  C 1 4   ? 138.139 -12.663 -28.545 1.00 22.38  ? 24  DG  E OP2   1 
ATOM   464   O  "O5'" . DG  C 1 4   ? 136.594 -12.626 -30.552 1.00 21.91  ? 24  DG  E "O5'" 1 
ATOM   465   C  "C5'" . DG  C 1 4   ? 136.332 -12.811 -31.931 1.00 20.04  ? 24  DG  E "C5'" 1 
ATOM   466   C  "C4'" . DG  C 1 4   ? 134.897 -13.265 -32.149 1.00 20.08  ? 24  DG  E "C4'" 1 
ATOM   467   O  "O4'" . DG  C 1 4   ? 134.788 -14.662 -31.793 1.00 18.70  ? 24  DG  E "O4'" 1 
ATOM   468   C  "C3'" . DG  C 1 4   ? 133.800 -12.556 -31.345 1.00 21.00  ? 24  DG  E "C3'" 1 
ATOM   469   O  "O3'" . DG  C 1 4   ? 132.683 -12.334 -32.182 1.00 23.48  ? 24  DG  E "O3'" 1 
ATOM   470   C  "C2'" . DG  C 1 4   ? 133.434 -13.584 -30.281 1.00 18.86  ? 24  DG  E "C2'" 1 
ATOM   471   C  "C1'" . DG  C 1 4   ? 133.575 -14.853 -31.103 1.00 16.62  ? 24  DG  E "C1'" 1 
ATOM   472   N  N9    . DG  C 1 4   ? 133.700 -16.065 -30.309 1.00 16.22  ? 24  DG  E N9    1 
ATOM   473   C  C8    . DG  C 1 4   ? 134.430 -16.196 -29.154 1.00 15.90  ? 24  DG  E C8    1 
ATOM   474   N  N7    . DG  C 1 4   ? 134.368 -17.382 -28.629 1.00 15.40  ? 24  DG  E N7    1 
ATOM   475   C  C5    . DG  C 1 4   ? 133.540 -18.082 -29.489 1.00 15.13  ? 24  DG  E C5    1 
ATOM   476   C  C6    . DG  C 1 4   ? 133.125 -19.426 -29.417 1.00 15.40  ? 24  DG  E C6    1 
ATOM   477   O  O6    . DG  C 1 4   ? 133.423 -20.278 -28.563 1.00 15.32  ? 24  DG  E O6    1 
ATOM   478   N  N1    . DG  C 1 4   ? 132.293 -19.755 -30.479 1.00 15.80  ? 24  DG  E N1    1 
ATOM   479   C  C2    . DG  C 1 4   ? 131.905 -18.896 -31.480 1.00 15.64  ? 24  DG  E C2    1 
ATOM   480   N  N2    . DG  C 1 4   ? 131.086 -19.430 -32.404 1.00 14.95  ? 24  DG  E N2    1 
ATOM   481   N  N3    . DG  C 1 4   ? 132.296 -17.619 -31.560 1.00 14.86  ? 24  DG  E N3    1 
ATOM   482   C  C4    . DG  C 1 4   ? 133.118 -17.291 -30.535 1.00 15.46  ? 24  DG  E C4    1 
ATOM   483   P  P     . DA  C 1 5   ? 131.745 -11.064 -31.951 1.00 25.76  ? 25  DA  E P     1 
ATOM   484   O  OP1   . DA  C 1 5   ? 132.050 -10.095 -33.035 1.00 25.58  ? 25  DA  E OP1   1 
ATOM   485   O  OP2   . DA  C 1 5   ? 131.864 -10.689 -30.515 1.00 24.33  ? 25  DA  E OP2   1 
ATOM   486   O  "O5'" . DA  C 1 5   ? 130.277 -11.588 -32.287 1.00 23.77  ? 25  DA  E "O5'" 1 
ATOM   487   C  "C5'" . DA  C 1 5   ? 129.718 -12.576 -31.462 1.00 23.20  ? 25  DA  E "C5'" 1 
ATOM   488   C  "C4'" . DA  C 1 5   ? 128.949 -13.583 -32.275 1.00 21.62  ? 25  DA  E "C4'" 1 
ATOM   489   O  "O4'" . DA  C 1 5   ? 129.762 -14.780 -32.305 1.00 23.23  ? 25  DA  E "O4'" 1 
ATOM   490   C  "C3'" . DA  C 1 5   ? 127.638 -13.991 -31.630 1.00 21.56  ? 25  DA  E "C3'" 1 
ATOM   491   O  "O3'" . DA  C 1 5   ? 126.553 -13.309 -32.215 1.00 21.62  ? 25  DA  E "O3'" 1 
ATOM   492   C  "C2'" . DA  C 1 5   ? 127.549 -15.479 -31.946 1.00 21.72  ? 25  DA  E "C2'" 1 
ATOM   493   C  "C1'" . DA  C 1 5   ? 129.008 -15.905 -31.869 1.00 20.60  ? 25  DA  E "C1'" 1 
ATOM   494   N  N9    . DA  C 1 5   ? 129.504 -16.325 -30.550 1.00 20.27  ? 25  DA  E N9    1 
ATOM   495   C  C8    . DA  C 1 5   ? 130.220 -15.578 -29.646 1.00 19.75  ? 25  DA  E C8    1 
ATOM   496   N  N7    . DA  C 1 5   ? 130.549 -16.221 -28.553 1.00 19.21  ? 25  DA  E N7    1 
ATOM   497   C  C5    . DA  C 1 5   ? 130.010 -17.486 -28.754 1.00 19.86  ? 25  DA  E C5    1 
ATOM   498   C  C6    . DA  C 1 5   ? 130.005 -18.660 -27.977 1.00 19.87  ? 25  DA  E C6    1 
ATOM   499   N  N6    . DA  C 1 5   ? 130.580 -18.747 -26.777 1.00 19.50  ? 25  DA  E N6    1 
ATOM   500   N  N1    . DA  C 1 5   ? 129.376 -19.752 -28.477 1.00 20.44  ? 25  DA  E N1    1 
ATOM   501   C  C2    . DA  C 1 5   ? 128.787 -19.688 -29.674 1.00 19.09  ? 25  DA  E C2    1 
ATOM   502   N  N3    . DA  C 1 5   ? 128.733 -18.644 -30.489 1.00 19.47  ? 25  DA  E N3    1 
ATOM   503   C  C4    . DA  C 1 5   ? 129.362 -17.569 -29.973 1.00 19.92  ? 25  DA  E C4    1 
ATOM   504   P  P     . DC  C 1 6   ? 125.371 -12.795 -31.271 1.00 21.75  ? 26  DC  E P     1 
ATOM   505   O  OP1   . DC  C 1 6   ? 124.415 -12.015 -32.078 1.00 21.47  ? 26  DC  E OP1   1 
ATOM   506   O  OP2   . DC  C 1 6   ? 126.018 -12.180 -30.078 1.00 21.79  ? 26  DC  E OP2   1 
ATOM   507   O  "O5'" . DC  C 1 6   ? 124.655 -14.156 -30.800 1.00 22.58  ? 26  DC  E "O5'" 1 
ATOM   508   C  "C5'" . DC  C 1 6   ? 123.819 -14.956 -31.631 1.00 20.86  ? 26  DC  E "C5'" 1 
ATOM   509   C  "C4'" . DC  C 1 6   ? 123.517 -16.293 -30.947 1.00 21.43  ? 26  DC  E "C4'" 1 
ATOM   510   O  "O4'" . DC  C 1 6   ? 124.750 -17.021 -30.658 1.00 21.15  ? 26  DC  E "O4'" 1 
ATOM   511   C  "C3'" . DC  C 1 6   ? 122.776 -16.246 -29.616 1.00 20.44  ? 26  DC  E "C3'" 1 
ATOM   512   O  "O3'" . DC  C 1 6   ? 121.384 -16.280 -29.827 1.00 20.74  ? 26  DC  E "O3'" 1 
ATOM   513   C  "C2'" . DC  C 1 6   ? 123.162 -17.584 -29.006 1.00 21.37  ? 26  DC  E "C2'" 1 
ATOM   514   C  "C1'" . DC  C 1 6   ? 124.582 -17.811 -29.492 1.00 20.38  ? 26  DC  E "C1'" 1 
ATOM   515   N  N1    . DC  C 1 6   ? 125.587 -17.462 -28.442 1.00 19.89  ? 26  DC  E N1    1 
ATOM   516   C  C2    . DC  C 1 6   ? 126.026 -18.473 -27.584 1.00 19.77  ? 26  DC  E C2    1 
ATOM   517   O  O2    . DC  C 1 6   ? 125.562 -19.609 -27.736 1.00 19.35  ? 26  DC  E O2    1 
ATOM   518   N  N3    . DC  C 1 6   ? 126.944 -18.172 -26.624 1.00 19.39  ? 26  DC  E N3    1 
ATOM   519   C  C4    . DC  C 1 6   ? 127.407 -16.921 -26.520 1.00 18.99  ? 26  DC  E C4    1 
ATOM   520   N  N4    . DC  C 1 6   ? 128.308 -16.656 -25.579 1.00 18.87  ? 26  DC  E N4    1 
ATOM   521   C  C5    . DC  C 1 6   ? 126.971 -15.877 -27.379 1.00 19.31  ? 26  DC  E C5    1 
ATOM   522   C  C6    . DC  C 1 6   ? 126.069 -16.186 -28.318 1.00 20.22  ? 26  DC  E C6    1 
ATOM   523   P  P     . DT  C 1 7   ? 120.378 -16.088 -28.593 1.00 21.01  ? 27  DT  E P     1 
ATOM   524   O  OP1   . DT  C 1 7   ? 119.022 -15.996 -29.194 1.00 20.36  ? 27  DT  E OP1   1 
ATOM   525   O  OP2   . DT  C 1 7   ? 120.921 -15.013 -27.733 1.00 18.42  ? 27  DT  E OP2   1 
ATOM   526   O  "O5'" . DT  C 1 7   ? 120.494 -17.424 -27.723 1.00 18.04  ? 27  DT  E "O5'" 1 
ATOM   527   C  "C5'" . DT  C 1 7   ? 119.782 -18.607 -28.005 1.00 15.34  ? 27  DT  E "C5'" 1 
ATOM   528   C  "C4'" . DT  C 1 7   ? 120.155 -19.656 -26.958 1.00 14.85  ? 27  DT  E "C4'" 1 
ATOM   529   O  "O4'" . DT  C 1 7   ? 121.583 -19.948 -26.912 1.00 13.18  ? 27  DT  E "O4'" 1 
ATOM   530   C  "C3'" . DT  C 1 7   ? 119.876 -19.247 -25.525 1.00 14.13  ? 27  DT  E "C3'" 1 
ATOM   531   O  "O3'" . DT  C 1 7   ? 118.498 -19.301 -25.308 1.00 14.78  ? 27  DT  E "O3'" 1 
ATOM   532   C  "C2'" . DT  C 1 7   ? 120.618 -20.365 -24.814 1.00 13.05  ? 27  DT  E "C2'" 1 
ATOM   533   C  "C1'" . DT  C 1 7   ? 121.913 -20.373 -25.610 1.00 12.56  ? 27  DT  E "C1'" 1 
ATOM   534   N  N1    . DT  C 1 7   ? 122.938 -19.478 -25.018 1.00 13.10  ? 27  DT  E N1    1 
ATOM   535   C  C2    . DT  C 1 7   ? 123.805 -20.023 -24.103 1.00 12.86  ? 27  DT  E C2    1 
ATOM   536   O  O2    . DT  C 1 7   ? 123.788 -21.192 -23.763 1.00 12.60  ? 27  DT  E O2    1 
ATOM   537   N  N3    . DT  C 1 7   ? 124.712 -19.138 -23.602 1.00 12.87  ? 27  DT  E N3    1 
ATOM   538   C  C4    . DT  C 1 7   ? 124.847 -17.803 -23.890 1.00 12.56  ? 27  DT  E C4    1 
ATOM   539   O  O4    . DT  C 1 7   ? 125.720 -17.119 -23.362 1.00 13.68  ? 27  DT  E O4    1 
ATOM   540   C  C5    . DT  C 1 7   ? 123.910 -17.285 -24.847 1.00 12.72  ? 27  DT  E C5    1 
ATOM   541   C  C7    . DT  C 1 7   ? 123.953 -15.843 -25.249 1.00 11.83  ? 27  DT  E C7    1 
ATOM   542   C  C6    . DT  C 1 7   ? 123.014 -18.139 -25.362 1.00 12.69  ? 27  DT  E C6    1 
ATOM   543   P  P     . DC  C 1 8   ? 117.802 -18.378 -24.220 1.00 13.31  ? 28  DC  E P     1 
ATOM   544   O  OP1   . DC  C 1 8   ? 116.345 -18.583 -24.422 1.00 14.31  ? 28  DC  E OP1   1 
ATOM   545   O  OP2   . DC  C 1 8   ? 118.454 -17.061 -24.334 1.00 15.74  ? 28  DC  E OP2   1 
ATOM   546   O  "O5'" . DC  C 1 8   ? 118.152 -18.990 -22.795 1.00 14.18  ? 28  DC  E "O5'" 1 
ATOM   547   C  "C5'" . DC  C 1 8   ? 117.744 -20.358 -22.530 1.00 15.41  ? 28  DC  E "C5'" 1 
ATOM   548   C  "C4'" . DC  C 1 8   ? 118.504 -20.965 -21.368 1.00 15.07  ? 28  DC  E "C4'" 1 
ATOM   549   O  "O4'" . DC  C 1 8   ? 119.924 -20.863 -21.615 1.00 15.15  ? 28  DC  E "O4'" 1 
ATOM   550   C  "C3'" . DC  C 1 8   ? 118.375 -20.207 -20.065 1.00 14.42  ? 28  DC  E "C3'" 1 
ATOM   551   O  "O3'" . DC  C 1 8   ? 117.184 -20.538 -19.456 1.00 14.06  ? 28  DC  E "O3'" 1 
ATOM   552   C  "C2'" . DC  C 1 8   ? 119.564 -20.774 -19.302 1.00 15.50  ? 28  DC  E "C2'" 1 
ATOM   553   C  "C1'" . DC  C 1 8   ? 120.632 -20.805 -20.386 1.00 15.13  ? 28  DC  E "C1'" 1 
ATOM   554   N  N1    . DC  C 1 8   ? 121.562 -19.633 -20.392 1.00 15.29  ? 28  DC  E N1    1 
ATOM   555   C  C2    . DC  C 1 8   ? 122.682 -19.615 -19.564 1.00 15.48  ? 28  DC  E C2    1 
ATOM   556   O  O2    . DC  C 1 8   ? 122.885 -20.569 -18.813 1.00 16.99  ? 28  DC  E O2    1 
ATOM   557   N  N3    . DC  C 1 8   ? 123.517 -18.548 -19.587 1.00 15.56  ? 28  DC  E N3    1 
ATOM   558   C  C4    . DC  C 1 8   ? 123.273 -17.526 -20.409 1.00 16.07  ? 28  DC  E C4    1 
ATOM   559   N  N4    . DC  C 1 8   ? 124.124 -16.485 -20.413 1.00 16.12  ? 28  DC  E N4    1 
ATOM   560   C  C5    . DC  C 1 8   ? 122.142 -17.525 -21.272 1.00 16.28  ? 28  DC  E C5    1 
ATOM   561   C  C6    . DC  C 1 8   ? 121.330 -18.584 -21.232 1.00 16.45  ? 28  DC  E C6    1 
HETATM 562   P  P     . DDG C 1 9   ? 116.579 -19.609 -18.296 1.00 15.27  ? 29  DDG E P     1 
HETATM 563   O  OP1   . DDG C 1 9   ? 115.198 -20.085 -18.078 1.00 13.60  ? 29  DDG E OP1   1 
HETATM 564   O  OP2   . DDG C 1 9   ? 116.887 -18.208 -18.645 1.00 12.85  ? 29  DDG E OP2   1 
HETATM 565   O  "O5'" . DDG C 1 9   ? 117.458 -19.969 -17.001 1.00 15.17  ? 29  DDG E "O5'" 1 
HETATM 566   C  "C5'" . DDG C 1 9   ? 117.483 -21.248 -16.420 1.00 12.80  ? 29  DDG E "C5'" 1 
HETATM 567   C  "C4'" . DDG C 1 9   ? 118.533 -21.240 -15.331 1.00 13.30  ? 29  DDG E "C4'" 1 
HETATM 568   O  "O4'" . DDG C 1 9   ? 119.832 -20.953 -15.907 1.00 14.65  ? 29  DDG E "O4'" 1 
HETATM 569   C  "C3'" . DDG C 1 9   ? 118.359 -20.148 -14.294 1.00 13.43  ? 29  DDG E "C3'" 1 
HETATM 570   C  "C2'" . DDG C 1 9   ? 119.776 -19.988 -13.755 1.00 13.61  ? 29  DDG E "C2'" 1 
HETATM 571   C  "C1'" . DDG C 1 9   ? 120.626 -20.197 -15.002 1.00 13.64  ? 29  DDG E "C1'" 1 
HETATM 572   N  N9    . DDG C 1 9   ? 121.078 -18.955 -15.653 1.00 13.69  ? 29  DDG E N9    1 
HETATM 573   C  C8    . DDG C 1 9   ? 120.541 -18.360 -16.775 1.00 12.68  ? 29  DDG E C8    1 
HETATM 574   N  N7    . DDG C 1 9   ? 121.170 -17.269 -17.125 1.00 12.64  ? 29  DDG E N7    1 
HETATM 575   C  C5    . DDG C 1 9   ? 122.191 -17.131 -16.193 1.00 13.15  ? 29  DDG E C5    1 
HETATM 576   C  C6    . DDG C 1 9   ? 123.199 -16.143 -16.055 1.00 13.11  ? 29  DDG E C6    1 
HETATM 577   O  O6    . DDG C 1 9   ? 123.395 -15.150 -16.751 1.00 13.52  ? 29  DDG E O6    1 
HETATM 578   N  N1    . DDG C 1 9   ? 124.043 -16.364 -14.969 1.00 13.18  ? 29  DDG E N1    1 
HETATM 579   C  C2    . DDG C 1 9   ? 123.927 -17.427 -14.112 1.00 13.01  ? 29  DDG E C2    1 
HETATM 580   N  N2    . DDG C 1 9   ? 124.823 -17.491 -13.118 1.00 13.10  ? 29  DDG E N2    1 
HETATM 581   N  N3    . DDG C 1 9   ? 122.986 -18.354 -14.226 1.00 13.17  ? 29  DDG E N3    1 
HETATM 582   C  C4    . DDG C 1 9   ? 122.151 -18.156 -15.280 1.00 13.03  ? 29  DDG E C4    1 
ATOM   583   O  "O5'" . DT  D 2 3   ? 136.293 -5.085  -16.923 1.00 51.93  ? 2   DT  F "O5'" 1 
ATOM   584   C  "C5'" . DT  D 2 3   ? 136.431 -4.642  -15.573 1.00 51.86  ? 2   DT  F "C5'" 1 
ATOM   585   C  "C4'" . DT  D 2 3   ? 135.218 -3.832  -15.142 1.00 51.64  ? 2   DT  F "C4'" 1 
ATOM   586   O  "O4'" . DT  D 2 3   ? 135.472 -2.410  -15.327 1.00 53.02  ? 2   DT  F "O4'" 1 
ATOM   587   C  "C3'" . DT  D 2 3   ? 133.928 -4.157  -15.896 1.00 50.16  ? 2   DT  F "C3'" 1 
ATOM   588   O  "O3'" . DT  D 2 3   ? 132.860 -4.407  -14.964 1.00 45.08  ? 2   DT  F "O3'" 1 
ATOM   589   C  "C2'" . DT  D 2 3   ? 133.692 -2.933  -16.783 1.00 52.18  ? 2   DT  F "C2'" 1 
ATOM   590   C  "C1'" . DT  D 2 3   ? 134.394 -1.810  -16.023 1.00 55.19  ? 2   DT  F "C1'" 1 
ATOM   591   N  N1    . DT  D 2 3   ? 134.901 -0.707  -16.936 1.00 57.05  ? 2   DT  F N1    1 
ATOM   592   C  C2    . DT  D 2 3   ? 135.113 0.578   -16.434 1.00 57.45  ? 2   DT  F C2    1 
ATOM   593   O  O2    . DT  D 2 3   ? 134.916 0.896   -15.267 1.00 57.62  ? 2   DT  F O2    1 
ATOM   594   N  N3    . DT  D 2 3   ? 135.574 1.487   -17.367 1.00 57.07  ? 2   DT  F N3    1 
ATOM   595   C  C4    . DT  D 2 3   ? 135.834 1.250   -18.712 1.00 56.80  ? 2   DT  F C4    1 
ATOM   596   O  O4    . DT  D 2 3   ? 136.240 2.141   -19.450 1.00 57.17  ? 2   DT  F O4    1 
ATOM   597   C  C5    . DT  D 2 3   ? 135.597 -0.103  -19.179 1.00 57.26  ? 2   DT  F C5    1 
ATOM   598   C  C7    . DT  D 2 3   ? 135.846 -0.486  -20.614 1.00 56.94  ? 2   DT  F C7    1 
ATOM   599   C  C6    . DT  D 2 3   ? 135.150 -1.001  -18.280 1.00 57.45  ? 2   DT  F C6    1 
HETATM 600   P  P     . 6OG D 2 4   ? 131.316 -4.311  -15.385 1.00 41.13  ? 3   6OG F P     1 
HETATM 601   O  OP1   . 6OG D 2 4   ? 131.161 -4.733  -16.794 1.00 41.00  ? 3   6OG F OP1   1 
HETATM 602   O  OP2   . 6OG D 2 4   ? 130.807 -3.003  -14.915 1.00 40.05  ? 3   6OG F OP2   1 
HETATM 603   O  "O5'" . 6OG D 2 4   ? 130.647 -5.458  -14.508 1.00 38.45  ? 3   6OG F "O5'" 1 
HETATM 604   N  N9    . 6OG D 2 4   ? 127.336 -8.482  -13.945 1.00 29.75  ? 3   6OG F N9    1 
HETATM 605   C  C4    . 6OG D 2 4   ? 126.353 -9.454  -13.996 1.00 29.94  ? 3   6OG F C4    1 
HETATM 606   N  N3    . 6OG D 2 4   ? 126.037 -10.350 -13.019 1.00 29.48  ? 3   6OG F N3    1 
HETATM 607   C  C2    . 6OG D 2 4   ? 125.052 -11.161 -13.377 1.00 29.12  ? 3   6OG F C2    1 
HETATM 608   N  N2    . 6OG D 2 4   ? 124.619 -12.099 -12.522 1.00 28.97  ? 3   6OG F N2    1 
HETATM 609   N  N1    . 6OG D 2 4   ? 124.419 -11.092 -14.597 1.00 29.51  ? 3   6OG F N1    1 
HETATM 610   C  C6    . 6OG D 2 4   ? 124.733 -10.184 -15.625 1.00 30.14  ? 3   6OG F C6    1 
HETATM 611   O  O6    . 6OG D 2 4   ? 124.132 -10.178 -16.724 1.00 29.95  ? 3   6OG F O6    1 
HETATM 612   C  C5    . 6OG D 2 4   ? 125.788 -9.314  -15.247 1.00 29.72  ? 3   6OG F C5    1 
HETATM 613   N  N7    . 6OG D 2 4   ? 126.394 -8.288  -15.966 1.00 29.13  ? 3   6OG F N7    1 
HETATM 614   C  C8    . 6OG D 2 4   ? 127.302 -7.827  -15.157 1.00 29.34  ? 3   6OG F C8    1 
HETATM 615   C  "C2'" . 6OG D 2 4   ? 129.206 -9.342  -12.555 1.00 28.94  ? 3   6OG F "C2'" 1 
HETATM 616   C  "C5'" . 6OG D 2 4   ? 131.109 -6.786  -14.520 1.00 33.36  ? 3   6OG F "C5'" 1 
HETATM 617   C  "C4'" . 6OG D 2 4   ? 130.434 -7.494  -13.360 1.00 31.01  ? 3   6OG F "C4'" 1 
HETATM 618   O  "O4'" . 6OG D 2 4   ? 129.038 -7.114  -13.268 1.00 30.63  ? 3   6OG F "O4'" 1 
HETATM 619   C  "C1'" . 6OG D 2 4   ? 128.245 -8.198  -12.844 1.00 29.41  ? 3   6OG F "C1'" 1 
HETATM 620   C  "C3'" . 6OG D 2 4   ? 130.409 -9.008  -13.432 1.00 28.70  ? 3   6OG F "C3'" 1 
HETATM 621   O  "O3'" . 6OG D 2 4   ? 131.619 -9.433  -12.838 1.00 25.42  ? 3   6OG F "O3'" 1 
HETATM 622   C  C     . 6OG D 2 4   ? 123.111 -11.067 -16.986 1.00 29.63  ? 3   6OG F C     1 
ATOM   623   P  P     . DC  D 2 5   ? 132.444 -10.629 -13.467 1.00 22.64  ? 4   DC  F P     1 
ATOM   624   O  OP1   . DC  D 2 5   ? 133.827 -10.505 -12.966 1.00 22.33  ? 4   DC  F OP1   1 
ATOM   625   O  OP2   . DC  D 2 5   ? 132.195 -10.694 -14.925 1.00 22.72  ? 4   DC  F OP2   1 
ATOM   626   O  "O5'" . DC  D 2 5   ? 131.667 -11.853 -12.782 1.00 21.81  ? 4   DC  F "O5'" 1 
ATOM   627   C  "C5'" . DC  D 2 5   ? 131.645 -12.013 -11.378 1.00 18.95  ? 4   DC  F "C5'" 1 
ATOM   628   C  "C4'" . DC  D 2 5   ? 130.745 -13.173 -11.019 1.00 17.73  ? 4   DC  F "C4'" 1 
ATOM   629   O  "O4'" . DC  D 2 5   ? 129.404 -12.839 -11.421 1.00 18.14  ? 4   DC  F "O4'" 1 
ATOM   630   C  "C3'" . DC  D 2 5   ? 131.009 -14.472 -11.753 1.00 16.87  ? 4   DC  F "C3'" 1 
ATOM   631   O  "O3'" . DC  D 2 5   ? 131.964 -15.222 -11.050 1.00 15.53  ? 4   DC  F "O3'" 1 
ATOM   632   C  "C2'" . DC  D 2 5   ? 129.661 -15.176 -11.677 1.00 17.87  ? 4   DC  F "C2'" 1 
ATOM   633   C  "C1'" . DC  D 2 5   ? 128.673 -14.022 -11.667 1.00 18.78  ? 4   DC  F "C1'" 1 
ATOM   634   N  N1    . DC  D 2 5   ? 128.011 -13.875 -12.968 1.00 19.59  ? 4   DC  F N1    1 
ATOM   635   C  C2    . DC  D 2 5   ? 126.893 -14.652 -13.255 1.00 20.36  ? 4   DC  F C2    1 
ATOM   636   O  O2    . DC  D 2 5   ? 126.472 -15.450 -12.413 1.00 21.88  ? 4   DC  F O2    1 
ATOM   637   N  N3    . DC  D 2 5   ? 126.287 -14.519 -14.454 1.00 20.64  ? 4   DC  F N3    1 
ATOM   638   C  C4    . DC  D 2 5   ? 126.755 -13.649 -15.343 1.00 20.06  ? 4   DC  F C4    1 
ATOM   639   N  N4    . DC  D 2 5   ? 126.107 -13.554 -16.513 1.00 20.39  ? 4   DC  F N4    1 
ATOM   640   C  C5    . DC  D 2 5   ? 127.894 -12.841 -15.065 1.00 21.04  ? 4   DC  F C5    1 
ATOM   641   C  C6    . DC  D 2 5   ? 128.493 -12.985 -13.879 1.00 20.26  ? 4   DC  F C6    1 
ATOM   642   P  P     . DG  D 2 6   ? 132.749 -16.388 -11.813 1.00 15.10  ? 5   DG  F P     1 
ATOM   643   O  OP1   . DG  D 2 6   ? 133.695 -16.949 -10.819 1.00 13.18  ? 5   DG  F OP1   1 
ATOM   644   O  OP2   . DG  D 2 6   ? 133.206 -15.817 -13.105 1.00 13.45  ? 5   DG  F OP2   1 
ATOM   645   O  "O5'" . DG  D 2 6   ? 131.638 -17.487 -12.213 1.00 13.33  ? 5   DG  F "O5'" 1 
ATOM   646   C  "C5'" . DG  D 2 6   ? 131.235 -18.494 -11.315 1.00 13.87  ? 5   DG  F "C5'" 1 
ATOM   647   C  "C4'" . DG  D 2 6   ? 130.114 -19.343 -11.876 1.00 13.56  ? 5   DG  F "C4'" 1 
ATOM   648   O  "O4'" . DG  D 2 6   ? 129.002 -18.518 -12.287 1.00 15.65  ? 5   DG  F "O4'" 1 
ATOM   649   C  "C3'" . DG  D 2 6   ? 130.461 -20.090 -13.150 1.00 13.76  ? 5   DG  F "C3'" 1 
ATOM   650   O  "O3'" . DG  D 2 6   ? 131.256 -21.187 -12.749 1.00 13.03  ? 5   DG  F "O3'" 1 
ATOM   651   C  "C2'" . DG  D 2 6   ? 129.054 -20.499 -13.582 1.00 13.30  ? 5   DG  F "C2'" 1 
ATOM   652   C  "C1'" . DG  D 2 6   ? 128.251 -19.238 -13.260 1.00 13.65  ? 5   DG  F "C1'" 1 
ATOM   653   N  N9    . DG  D 2 6   ? 128.035 -18.400 -14.444 1.00 13.92  ? 5   DG  F N9    1 
ATOM   654   C  C8    . DG  D 2 6   ? 128.701 -17.249 -14.822 1.00 12.75  ? 5   DG  F C8    1 
ATOM   655   N  N7    . DG  D 2 6   ? 128.282 -16.747 -15.946 1.00 11.50  ? 5   DG  F N7    1 
ATOM   656   C  C5    . DG  D 2 6   ? 127.278 -17.611 -16.342 1.00 12.28  ? 5   DG  F C5    1 
ATOM   657   C  C6    . DG  D 2 6   ? 126.460 -17.596 -17.489 1.00 13.24  ? 5   DG  F C6    1 
ATOM   658   O  O6    . DG  D 2 6   ? 126.451 -16.765 -18.404 1.00 13.58  ? 5   DG  F O6    1 
ATOM   659   N  N1    . DG  D 2 6   ? 125.569 -18.671 -17.518 1.00 13.58  ? 5   DG  F N1    1 
ATOM   660   C  C2    . DG  D 2 6   ? 125.482 -19.649 -16.556 1.00 12.98  ? 5   DG  F C2    1 
ATOM   661   N  N2    . DG  D 2 6   ? 124.563 -20.608 -16.741 1.00 12.81  ? 5   DG  F N2    1 
ATOM   662   N  N3    . DG  D 2 6   ? 126.249 -19.678 -15.479 1.00 13.02  ? 5   DG  F N3    1 
ATOM   663   C  C4    . DG  D 2 6   ? 127.119 -18.639 -15.443 1.00 13.36  ? 5   DG  F C4    1 
ATOM   664   P  P     . DA  D 2 7   ? 132.227 -21.999 -13.715 1.00 11.98  ? 6   DA  F P     1 
ATOM   665   O  OP1   . DA  D 2 7   ? 133.055 -22.832 -12.816 1.00 11.24  ? 6   DA  F OP1   1 
ATOM   666   O  OP2   . DA  D 2 7   ? 132.875 -21.063 -14.651 1.00 13.05  ? 6   DA  F OP2   1 
ATOM   667   O  "O5'" . DA  D 2 7   ? 131.213 -22.951 -14.525 1.00 9.64   ? 6   DA  F "O5'" 1 
ATOM   668   C  "C5'" . DA  D 2 7   ? 131.171 -22.943 -15.927 1.00 7.83   ? 6   DA  F "C5'" 1 
ATOM   669   C  "C4'" . DA  D 2 7   ? 129.891 -23.618 -16.356 1.00 8.78   ? 6   DA  F "C4'" 1 
ATOM   670   O  "O4'" . DA  D 2 7   ? 128.847 -22.619 -16.371 1.00 9.15   ? 6   DA  F "O4'" 1 
ATOM   671   C  "C3'" . DA  D 2 7   ? 129.913 -24.244 -17.747 1.00 9.12   ? 6   DA  F "C3'" 1 
ATOM   672   O  "O3'" . DA  D 2 7   ? 130.113 -25.646 -17.651 1.00 8.84   ? 6   DA  F "O3'" 1 
ATOM   673   C  "C2'" . DA  D 2 7   ? 128.527 -23.962 -18.322 1.00 8.45   ? 6   DA  F "C2'" 1 
ATOM   674   C  "C1'" . DA  D 2 7   ? 128.056 -22.753 -17.542 1.00 9.13   ? 6   DA  F "C1'" 1 
ATOM   675   N  N9    . DA  D 2 7   ? 128.177 -21.521 -18.305 1.00 9.23   ? 6   DA  F N9    1 
ATOM   676   C  C8    . DA  D 2 7   ? 129.066 -20.511 -18.089 1.00 8.18   ? 6   DA  F C8    1 
ATOM   677   N  N7    . DA  D 2 7   ? 128.919 -19.528 -18.937 1.00 9.45   ? 6   DA  F N7    1 
ATOM   678   C  C5    . DA  D 2 7   ? 127.869 -19.917 -19.750 1.00 9.05   ? 6   DA  F C5    1 
ATOM   679   C  C6    . DA  D 2 7   ? 127.220 -19.317 -20.848 1.00 8.92   ? 6   DA  F C6    1 
ATOM   680   N  N6    . DA  D 2 7   ? 127.540 -18.118 -21.334 1.00 8.72   ? 6   DA  F N6    1 
ATOM   681   N  N1    . DA  D 2 7   ? 126.200 -19.994 -21.429 1.00 8.99   ? 6   DA  F N1    1 
ATOM   682   C  C2    . DA  D 2 7   ? 125.841 -21.192 -20.954 1.00 8.77   ? 6   DA  F C2    1 
ATOM   683   N  N3    . DA  D 2 7   ? 126.383 -21.853 -19.933 1.00 9.70   ? 6   DA  F N3    1 
ATOM   684   C  C4    . DA  D 2 7   ? 127.395 -21.153 -19.369 1.00 9.46   ? 6   DA  F C4    1 
ATOM   685   P  P     . DG  D 2 8   ? 130.805 -26.376 -18.888 1.00 9.23   ? 7   DG  F P     1 
ATOM   686   O  OP1   . DG  D 2 8   ? 131.016 -27.794 -18.531 1.00 11.06  ? 7   DG  F OP1   1 
ATOM   687   O  OP2   . DG  D 2 8   ? 131.921 -25.523 -19.329 1.00 10.88  ? 7   DG  F OP2   1 
ATOM   688   O  "O5'" . DG  D 2 8   ? 129.707 -26.259 -20.042 1.00 11.34  ? 7   DG  F "O5'" 1 
ATOM   689   C  "C5'" . DG  D 2 8   ? 128.456 -26.948 -20.006 1.00 10.57  ? 7   DG  F "C5'" 1 
ATOM   690   C  "C4'" . DG  D 2 8   ? 127.920 -27.016 -21.423 1.00 10.98  ? 7   DG  F "C4'" 1 
ATOM   691   O  "O4'" . DG  D 2 8   ? 127.558 -25.686 -21.892 1.00 9.56   ? 7   DG  F "O4'" 1 
ATOM   692   C  "C3'" . DG  D 2 8   ? 128.880 -27.581 -22.469 1.00 10.69  ? 7   DG  F "C3'" 1 
ATOM   693   O  "O3'" . DG  D 2 8   ? 128.123 -28.272 -23.415 1.00 12.60  ? 7   DG  F "O3'" 1 
ATOM   694   C  "C2'" . DG  D 2 8   ? 129.440 -26.334 -23.130 1.00 10.04  ? 7   DG  F "C2'" 1 
ATOM   695   C  "C1'" . DG  D 2 8   ? 128.230 -25.409 -23.098 1.00 8.68   ? 7   DG  F "C1'" 1 
ATOM   696   N  N9    . DG  D 2 8   ? 128.650 -24.026 -23.061 1.00 9.17   ? 7   DG  F N9    1 
ATOM   697   C  C8    . DG  D 2 8   ? 129.669 -23.480 -22.312 1.00 8.83   ? 7   DG  F C8    1 
ATOM   698   N  N7    . DG  D 2 8   ? 129.819 -22.199 -22.502 1.00 9.23   ? 7   DG  F N7    1 
ATOM   699   C  C5    . DG  D 2 8   ? 128.836 -21.879 -23.443 1.00 9.46   ? 7   DG  F C5    1 
ATOM   700   C  C6    . DG  D 2 8   ? 128.497 -20.644 -24.054 1.00 8.50   ? 7   DG  F C6    1 
ATOM   701   O  O6    . DG  D 2 8   ? 129.027 -19.551 -23.871 1.00 7.59   ? 7   DG  F O6    1 
ATOM   702   N  N1    . DG  D 2 8   ? 127.433 -20.770 -24.955 1.00 9.12   ? 7   DG  F N1    1 
ATOM   703   C  C2    . DG  D 2 8   ? 126.780 -21.965 -25.231 1.00 8.48   ? 7   DG  F C2    1 
ATOM   704   N  N2    . DG  D 2 8   ? 125.787 -21.968 -26.122 1.00 8.14   ? 7   DG  F N2    1 
ATOM   705   N  N3    . DG  D 2 8   ? 127.098 -23.116 -24.677 1.00 9.00   ? 7   DG  F N3    1 
ATOM   706   C  C4    . DG  D 2 8   ? 128.121 -23.000 -23.797 1.00 9.64   ? 7   DG  F C4    1 
ATOM   707   P  P     . DT  D 2 9   ? 128.807 -29.227 -24.487 1.00 16.07  ? 8   DT  F P     1 
ATOM   708   O  OP1   . DT  D 2 9   ? 128.185 -30.553 -24.324 1.00 17.64  ? 8   DT  F OP1   1 
ATOM   709   O  OP2   . DT  D 2 9   ? 130.279 -29.201 -24.409 1.00 18.16  ? 8   DT  F OP2   1 
ATOM   710   O  "O5'" . DT  D 2 9   ? 128.364 -28.530 -25.852 1.00 14.85  ? 8   DT  F "O5'" 1 
ATOM   711   C  "C5'" . DT  D 2 9   ? 127.030 -28.101 -26.044 1.00 15.35  ? 8   DT  F "C5'" 1 
ATOM   712   C  "C4'" . DT  D 2 9   ? 126.808 -27.547 -27.449 1.00 16.83  ? 8   DT  F "C4'" 1 
ATOM   713   O  "O4'" . DT  D 2 9   ? 127.062 -26.111 -27.526 1.00 17.13  ? 8   DT  F "O4'" 1 
ATOM   714   C  "C3'" . DT  D 2 9   ? 127.654 -28.166 -28.555 1.00 16.26  ? 8   DT  F "C3'" 1 
ATOM   715   O  "O3'" . DT  D 2 9   ? 126.794 -28.221 -29.678 1.00 16.77  ? 8   DT  F "O3'" 1 
ATOM   716   C  "C2'" . DT  D 2 9   ? 128.824 -27.187 -28.719 1.00 16.08  ? 8   DT  F "C2'" 1 
ATOM   717   C  "C1'" . DT  D 2 9   ? 128.144 -25.847 -28.415 1.00 17.29  ? 8   DT  F "C1'" 1 
ATOM   718   N  N1    . DT  D 2 9   ? 128.939 -24.751 -27.765 1.00 16.95  ? 8   DT  F N1    1 
ATOM   719   C  C2    . DT  D 2 9   ? 128.632 -23.465 -28.147 1.00 17.90  ? 8   DT  F C2    1 
ATOM   720   O  O2    . DT  D 2 9   ? 127.792 -23.203 -28.987 1.00 18.39  ? 8   DT  F O2    1 
ATOM   721   N  N3    . DT  D 2 9   ? 129.346 -22.474 -27.529 1.00 18.21  ? 8   DT  F N3    1 
ATOM   722   C  C4    . DT  D 2 9   ? 130.323 -22.646 -26.575 1.00 18.25  ? 8   DT  F C4    1 
ATOM   723   O  O4    . DT  D 2 9   ? 130.902 -21.688 -26.074 1.00 18.65  ? 8   DT  F O4    1 
ATOM   724   C  C5    . DT  D 2 9   ? 130.605 -24.012 -26.217 1.00 17.63  ? 8   DT  F C5    1 
ATOM   725   C  C7    . DT  D 2 9   ? 131.651 -24.282 -25.180 1.00 17.59  ? 8   DT  F C7    1 
ATOM   726   C  C6    . DT  D 2 9   ? 129.904 -24.993 -26.809 1.00 16.84  ? 8   DT  F C6    1 
ATOM   727   P  P     . DC  D 2 10  ? 127.240 -28.964 -31.027 1.00 15.74  ? 9   DC  F P     1 
ATOM   728   O  OP1   . DC  D 2 10  ? 126.134 -29.796 -31.528 1.00 15.84  ? 9   DC  F OP1   1 
ATOM   729   O  OP2   . DC  D 2 10  ? 128.542 -29.611 -30.803 1.00 17.30  ? 9   DC  F OP2   1 
ATOM   730   O  "O5'" . DC  D 2 10  ? 127.470 -27.698 -31.965 1.00 17.55  ? 9   DC  F "O5'" 1 
ATOM   731   C  "C5'" . DC  D 2 10  ? 126.413 -26.938 -32.559 1.00 18.28  ? 9   DC  F "C5'" 1 
ATOM   732   C  "C4'" . DC  D 2 10  ? 127.043 -25.701 -33.192 1.00 19.04  ? 9   DC  F "C4'" 1 
ATOM   733   O  "O4'" . DC  D 2 10  ? 127.785 -24.981 -32.171 1.00 18.76  ? 9   DC  F "O4'" 1 
ATOM   734   C  "C3'" . DC  D 2 10  ? 128.058 -25.994 -34.288 1.00 19.19  ? 9   DC  F "C3'" 1 
ATOM   735   O  "O3'" . DC  D 2 10  ? 127.658 -25.374 -35.475 1.00 22.56  ? 9   DC  F "O3'" 1 
ATOM   736   C  "C2'" . DC  D 2 10  ? 129.371 -25.382 -33.805 1.00 18.93  ? 9   DC  F "C2'" 1 
ATOM   737   C  "C1'" . DC  D 2 10  ? 128.915 -24.385 -32.757 1.00 17.61  ? 9   DC  F "C1'" 1 
ATOM   738   N  N1    . DC  D 2 10  ? 129.965 -24.026 -31.717 1.00 16.56  ? 9   DC  F N1    1 
ATOM   739   C  C2    . DC  D 2 10  ? 130.230 -22.664 -31.485 1.00 16.99  ? 9   DC  F C2    1 
ATOM   740   O  O2    . DC  D 2 10  ? 129.596 -21.806 -32.118 1.00 16.33  ? 9   DC  F O2    1 
ATOM   741   N  N3    . DC  D 2 10  ? 131.168 -22.310 -30.570 1.00 15.97  ? 9   DC  F N3    1 
ATOM   742   C  C4    . DC  D 2 10  ? 131.826 -23.254 -29.923 1.00 15.69  ? 9   DC  F C4    1 
ATOM   743   N  N4    . DC  D 2 10  ? 132.726 -22.837 -29.043 1.00 16.23  ? 9   DC  F N4    1 
ATOM   744   C  C5    . DC  D 2 10  ? 131.582 -24.643 -30.140 1.00 15.19  ? 9   DC  F C5    1 
ATOM   745   C  C6    . DC  D 2 10  ? 130.658 -24.980 -31.040 1.00 14.85  ? 9   DC  F C6    1 
ATOM   746   P  P     . DA  D 2 11  ? 128.141 -25.925 -36.910 1.00 22.82  ? 10  DA  F P     1 
ATOM   747   O  OP1   . DA  D 2 11  ? 127.080 -26.850 -37.379 1.00 22.67  ? 10  DA  F OP1   1 
ATOM   748   O  OP2   . DA  D 2 11  ? 129.552 -26.358 -36.820 1.00 23.63  ? 10  DA  F OP2   1 
ATOM   749   O  "O5'" . DA  D 2 11  ? 128.176 -24.597 -37.804 1.00 22.92  ? 10  DA  F "O5'" 1 
ATOM   750   C  "C5'" . DA  D 2 11  ? 127.802 -23.341 -37.270 1.00 21.79  ? 10  DA  F "C5'" 1 
ATOM   751   C  "C4'" . DA  D 2 11  ? 128.652 -22.233 -37.861 1.00 21.71  ? 10  DA  F "C4'" 1 
ATOM   752   O  "O4'" . DA  D 2 11  ? 129.577 -21.742 -36.859 1.00 22.58  ? 10  DA  F "O4'" 1 
ATOM   753   C  "C3'" . DA  D 2 11  ? 129.491 -22.608 -39.066 1.00 21.82  ? 10  DA  F "C3'" 1 
ATOM   754   O  "O3'" . DA  D 2 11  ? 129.473 -21.507 -39.943 1.00 23.46  ? 10  DA  F "O3'" 1 
ATOM   755   C  "C2'" . DA  D 2 11  ? 130.875 -22.845 -38.473 1.00 21.86  ? 10  DA  F "C2'" 1 
ATOM   756   C  "C1'" . DA  D 2 11  ? 130.909 -21.884 -37.288 1.00 21.38  ? 10  DA  F "C1'" 1 
ATOM   757   N  N9    . DA  D 2 11  ? 131.623 -22.439 -36.161 1.00 20.83  ? 10  DA  F N9    1 
ATOM   758   C  C8    . DA  D 2 11  ? 131.634 -23.753 -35.820 1.00 20.92  ? 10  DA  F C8    1 
ATOM   759   N  N7    . DA  D 2 11  ? 132.354 -24.004 -34.751 1.00 21.84  ? 10  DA  F N7    1 
ATOM   760   C  C5    . DA  D 2 11  ? 132.855 -22.774 -34.368 1.00 20.78  ? 10  DA  F C5    1 
ATOM   761   C  C6    . DA  D 2 11  ? 133.691 -22.380 -33.304 1.00 21.35  ? 10  DA  F C6    1 
ATOM   762   N  N6    . DA  D 2 11  ? 134.192 -23.234 -32.395 1.00 20.81  ? 10  DA  F N6    1 
ATOM   763   N  N1    . DA  D 2 11  ? 133.992 -21.060 -33.207 1.00 21.48  ? 10  DA  F N1    1 
ATOM   764   C  C2    . DA  D 2 11  ? 133.495 -20.217 -34.122 1.00 21.14  ? 10  DA  F C2    1 
ATOM   765   N  N3    . DA  D 2 11  ? 132.695 -20.480 -35.157 1.00 21.24  ? 10  DA  F N3    1 
ATOM   766   C  C4    . DA  D 2 11  ? 132.405 -21.790 -35.228 1.00 21.36  ? 10  DA  F C4    1 
ATOM   767   P  P     . DG  D 2 12  ? 130.350 -21.453 -41.292 1.00 25.79  ? 11  DG  F P     1 
ATOM   768   O  OP1   . DG  D 2 12  ? 129.536 -20.656 -42.253 1.00 24.65  ? 11  DG  F OP1   1 
ATOM   769   O  OP2   . DG  D 2 12  ? 130.767 -22.834 -41.653 1.00 25.15  ? 11  DG  F OP2   1 
ATOM   770   O  "O5'" . DG  D 2 12  ? 131.681 -20.641 -40.886 1.00 23.11  ? 11  DG  F "O5'" 1 
ATOM   771   C  "C5'" . DG  D 2 12  ? 131.646 -19.253 -40.642 1.00 22.64  ? 11  DG  F "C5'" 1 
ATOM   772   C  "C4'" . DG  D 2 12  ? 132.990 -18.777 -40.133 1.00 22.79  ? 11  DG  F "C4'" 1 
ATOM   773   O  "O4'" . DG  D 2 12  ? 133.390 -19.681 -39.087 1.00 22.85  ? 11  DG  F "O4'" 1 
ATOM   774   C  "C3'" . DG  D 2 12  ? 134.148 -18.822 -41.130 1.00 24.25  ? 11  DG  F "C3'" 1 
ATOM   775   O  "O3'" . DG  D 2 12  ? 134.828 -17.550 -41.152 1.00 26.34  ? 11  DG  F "O3'" 1 
ATOM   776   C  "C2'" . DG  D 2 12  ? 135.034 -19.974 -40.631 1.00 21.52  ? 11  DG  F "C2'" 1 
ATOM   777   C  "C1'" . DG  D 2 12  ? 134.790 -19.825 -39.143 1.00 20.48  ? 11  DG  F "C1'" 1 
ATOM   778   N  N9    . DG  D 2 12  ? 135.001 -20.989 -38.317 1.00 19.79  ? 11  DG  F N9    1 
ATOM   779   C  C8    . DG  D 2 12  ? 134.430 -22.214 -38.542 1.00 19.53  ? 11  DG  F C8    1 
ATOM   780   N  N7    . DG  D 2 12  ? 134.743 -23.095 -37.643 1.00 19.65  ? 11  DG  F N7    1 
ATOM   781   C  C5    . DG  D 2 12  ? 135.564 -22.407 -36.756 1.00 19.57  ? 11  DG  F C5    1 
ATOM   782   C  C6    . DG  D 2 12  ? 136.201 -22.865 -35.577 1.00 19.36  ? 11  DG  F C6    1 
ATOM   783   O  O6    . DG  D 2 12  ? 136.156 -24.000 -35.091 1.00 19.99  ? 11  DG  F O6    1 
ATOM   784   N  N1    . DG  D 2 12  ? 136.942 -21.870 -34.951 1.00 19.20  ? 11  DG  F N1    1 
ATOM   785   C  C2    . DG  D 2 12  ? 137.047 -20.583 -35.429 1.00 19.41  ? 11  DG  F C2    1 
ATOM   786   N  N2    . DG  D 2 12  ? 137.806 -19.762 -34.701 1.00 19.72  ? 11  DG  F N2    1 
ATOM   787   N  N3    . DG  D 2 12  ? 136.456 -20.131 -36.535 1.00 19.32  ? 11  DG  F N3    1 
ATOM   788   C  C4    . DG  D 2 12  ? 135.728 -21.097 -37.153 1.00 19.60  ? 11  DG  F C4    1 
ATOM   789   P  P     . DG  D 2 13  ? 135.796 -17.203 -42.385 1.00 27.74  ? 12  DG  F P     1 
ATOM   790   O  OP1   . DG  D 2 13  ? 135.459 -15.868 -42.949 1.00 26.64  ? 12  DG  F OP1   1 
ATOM   791   O  OP2   . DG  D 2 13  ? 135.773 -18.362 -43.308 1.00 27.59  ? 12  DG  F OP2   1 
ATOM   792   O  "O5'" . DG  D 2 13  ? 137.218 -17.174 -41.643 1.00 27.08  ? 12  DG  F "O5'" 1 
ATOM   793   C  "C5'" . DG  D 2 13  ? 137.413 -16.473 -40.426 1.00 27.18  ? 12  DG  F "C5'" 1 
ATOM   794   C  "C4'" . DG  D 2 13  ? 138.745 -16.836 -39.776 1.00 27.34  ? 12  DG  F "C4'" 1 
ATOM   795   O  "O4'" . DG  D 2 13  ? 138.562 -18.042 -38.976 1.00 26.69  ? 12  DG  F "O4'" 1 
ATOM   796   C  "C3'" . DG  D 2 13  ? 139.932 -17.087 -40.727 1.00 27.90  ? 12  DG  F "C3'" 1 
ATOM   797   O  "O3'" . DG  D 2 13  ? 141.143 -16.334 -40.343 1.00 27.81  ? 12  DG  F "O3'" 1 
ATOM   798   C  "C2'" . DG  D 2 13  ? 140.084 -18.617 -40.672 1.00 26.39  ? 12  DG  F "C2'" 1 
ATOM   799   C  "C1'" . DG  D 2 13  ? 139.616 -18.954 -39.249 1.00 24.53  ? 12  DG  F "C1'" 1 
ATOM   800   N  N9    . DG  D 2 13  ? 139.151 -20.335 -39.056 1.00 23.43  ? 12  DG  F N9    1 
ATOM   801   C  C8    . DG  D 2 13  ? 138.345 -21.046 -39.912 1.00 23.38  ? 12  DG  F C8    1 
ATOM   802   N  N7    . DG  D 2 13  ? 138.080 -22.266 -39.516 1.00 23.62  ? 12  DG  F N7    1 
ATOM   803   C  C5    . DG  D 2 13  ? 138.759 -22.379 -38.311 1.00 23.05  ? 12  DG  F C5    1 
ATOM   804   C  C6    . DG  D 2 13  ? 138.833 -23.477 -37.428 1.00 22.82  ? 12  DG  F C6    1 
ATOM   805   O  O6    . DG  D 2 13  ? 138.305 -24.593 -37.542 1.00 22.98  ? 12  DG  F O6    1 
ATOM   806   N  N1    . DG  D 2 13  ? 139.619 -23.190 -36.319 1.00 22.91  ? 12  DG  F N1    1 
ATOM   807   C  C2    . DG  D 2 13  ? 140.245 -21.988 -36.090 1.00 23.38  ? 12  DG  F C2    1 
ATOM   808   N  N2    . DG  D 2 13  ? 140.961 -21.916 -34.959 1.00 23.03  ? 12  DG  F N2    1 
ATOM   809   N  N3    . DG  D 2 13  ? 140.190 -20.944 -36.916 1.00 23.25  ? 12  DG  F N3    1 
ATOM   810   C  C4    . DG  D 2 13  ? 139.429 -21.204 -38.012 1.00 23.29  ? 12  DG  F C4    1 
ATOM   811   N  N     . LYS E 3 1   ? 108.403 -57.096 6.012   1.00 64.11  ? 297 LYS A N     1 
ATOM   812   C  CA    . LYS E 3 1   ? 107.645 -57.693 7.146   1.00 64.30  ? 297 LYS A CA    1 
ATOM   813   C  C     . LYS E 3 1   ? 107.457 -59.202 6.960   1.00 64.50  ? 297 LYS A C     1 
ATOM   814   O  O     . LYS E 3 1   ? 106.360 -59.662 6.623   1.00 64.57  ? 297 LYS A O     1 
ATOM   815   C  CB    . LYS E 3 1   ? 106.295 -56.992 7.318   1.00 64.19  ? 297 LYS A CB    1 
ATOM   816   N  N     . LYS E 3 2   ? 108.537 -59.958 7.183   1.00 64.54  ? 298 LYS A N     1 
ATOM   817   C  CA    . LYS E 3 2   ? 108.545 -61.426 7.076   1.00 64.53  ? 298 LYS A CA    1 
ATOM   818   C  C     . LYS E 3 2   ? 109.862 -62.003 7.626   1.00 64.10  ? 298 LYS A C     1 
ATOM   819   O  O     . LYS E 3 2   ? 110.898 -61.936 6.959   1.00 64.24  ? 298 LYS A O     1 
ATOM   820   C  CB    . LYS E 3 2   ? 108.352 -61.856 5.613   1.00 64.62  ? 298 LYS A CB    1 
ATOM   821   C  CG    . LYS E 3 2   ? 108.389 -63.365 5.383   1.00 65.03  ? 298 LYS A CG    1 
ATOM   822   C  CD    . LYS E 3 2   ? 108.393 -63.689 3.896   1.00 65.15  ? 298 LYS A CD    1 
ATOM   823   C  CE    . LYS E 3 2   ? 108.504 -65.186 3.664   1.00 66.28  ? 298 LYS A CE    1 
ATOM   824   N  NZ    . LYS E 3 2   ? 107.415 -65.917 4.378   1.00 67.00  ? 298 LYS A NZ    1 
ATOM   825   N  N     . MET E 3 3   ? 109.834 -62.572 8.830   1.00 63.44  ? 299 MET A N     1 
ATOM   826   C  CA    . MET E 3 3   ? 111.071 -63.079 9.442   1.00 62.82  ? 299 MET A CA    1 
ATOM   827   C  C     . MET E 3 3   ? 111.039 -64.489 10.011  1.00 62.20  ? 299 MET A C     1 
ATOM   828   O  O     . MET E 3 3   ? 110.092 -64.888 10.680  1.00 62.09  ? 299 MET A O     1 
ATOM   829   C  CB    . MET E 3 3   ? 111.592 -62.121 10.509  1.00 62.83  ? 299 MET A CB    1 
ATOM   830   C  CG    . MET E 3 3   ? 112.503 -61.040 9.961   1.00 63.22  ? 299 MET A CG    1 
ATOM   831   S  SD    . MET E 3 3   ? 113.264 -60.088 11.286  1.00 63.09  ? 299 MET A SD    1 
ATOM   832   C  CE    . MET E 3 3   ? 113.784 -61.412 12.361  1.00 62.87  ? 299 MET A CE    1 
ATOM   833   N  N     . ALA E 3 4   ? 112.117 -65.221 9.756   1.00 61.55  ? 300 ALA A N     1 
ATOM   834   C  CA    . ALA E 3 4   ? 112.253 -66.593 10.206  1.00 60.85  ? 300 ALA A CA    1 
ATOM   835   C  C     . ALA E 3 4   ? 113.074 -66.688 11.487  1.00 60.35  ? 300 ALA A C     1 
ATOM   836   O  O     . ALA E 3 4   ? 114.181 -66.159 11.572  1.00 60.14  ? 300 ALA A O     1 
ATOM   837   C  CB    . ALA E 3 4   ? 112.881 -67.447 9.104   1.00 60.86  ? 300 ALA A CB    1 
ATOM   838   N  N     . PHE E 3 5   ? 112.514 -67.364 12.483  1.00 59.87  ? 301 PHE A N     1 
ATOM   839   C  CA    . PHE E 3 5   ? 113.204 -67.604 13.744  1.00 59.44  ? 301 PHE A CA    1 
ATOM   840   C  C     . PHE E 3 5   ? 112.781 -68.952 14.316  1.00 59.26  ? 301 PHE A C     1 
ATOM   841   O  O     . PHE E 3 5   ? 111.752 -69.503 13.934  1.00 58.97  ? 301 PHE A O     1 
ATOM   842   C  CB    . PHE E 3 5   ? 112.922 -66.481 14.754  1.00 59.36  ? 301 PHE A CB    1 
ATOM   843   C  CG    . PHE E 3 5   ? 111.482 -66.403 15.202  1.00 58.81  ? 301 PHE A CG    1 
ATOM   844   C  CD1   . PHE E 3 5   ? 111.041 -67.127 16.301  1.00 58.15  ? 301 PHE A CD1   1 
ATOM   845   C  CD2   . PHE E 3 5   ? 110.575 -65.598 14.528  1.00 58.14  ? 301 PHE A CD2   1 
ATOM   846   C  CE1   . PHE E 3 5   ? 109.723 -67.060 16.709  1.00 58.33  ? 301 PHE A CE1   1 
ATOM   847   C  CE2   . PHE E 3 5   ? 109.255 -65.523 14.933  1.00 58.07  ? 301 PHE A CE2   1 
ATOM   848   C  CZ    . PHE E 3 5   ? 108.827 -66.254 16.025  1.00 58.50  ? 301 PHE A CZ    1 
ATOM   849   N  N     . THR E 3 6   ? 113.573 -69.473 15.245  1.00 59.28  ? 302 THR A N     1 
ATOM   850   C  CA    . THR E 3 6   ? 113.254 -70.739 15.884  1.00 59.44  ? 302 THR A CA    1 
ATOM   851   C  C     . THR E 3 6   ? 112.868 -70.525 17.343  1.00 59.30  ? 302 THR A C     1 
ATOM   852   O  O     . THR E 3 6   ? 113.674 -70.058 18.144  1.00 59.17  ? 302 THR A O     1 
ATOM   853   C  CB    . THR E 3 6   ? 114.442 -71.723 15.826  1.00 59.55  ? 302 THR A CB    1 
ATOM   854   O  OG1   . THR E 3 6   ? 115.003 -71.734 14.506  1.00 60.18  ? 302 THR A OG1   1 
ATOM   855   C  CG2   . THR E 3 6   ? 113.993 -73.128 16.202  1.00 59.45  ? 302 THR A CG2   1 
ATOM   856   N  N     . LEU E 3 7   ? 111.630 -70.868 17.677  1.00 59.33  ? 303 LEU A N     1 
ATOM   857   C  CA    . LEU E 3 7   ? 111.153 -70.790 19.050  1.00 59.32  ? 303 LEU A CA    1 
ATOM   858   C  C     . LEU E 3 7   ? 111.719 -72.023 19.759  1.00 59.31  ? 303 LEU A C     1 
ATOM   859   O  O     . LEU E 3 7   ? 111.130 -73.102 19.719  1.00 59.17  ? 303 LEU A O     1 
ATOM   860   C  CB    . LEU E 3 7   ? 109.623 -70.781 19.058  1.00 59.37  ? 303 LEU A CB    1 
ATOM   861   C  CG    . LEU E 3 7   ? 108.852 -70.148 20.220  1.00 59.46  ? 303 LEU A CG    1 
ATOM   862   C  CD1   . LEU E 3 7   ? 107.375 -69.995 19.853  1.00 59.46  ? 303 LEU A CD1   1 
ATOM   863   C  CD2   . LEU E 3 7   ? 109.015 -70.940 21.515  1.00 59.51  ? 303 LEU A CD2   1 
ATOM   864   N  N     . ALA E 3 8   ? 112.872 -71.843 20.401  1.00 59.36  ? 304 ALA A N     1 
ATOM   865   C  CA    . ALA E 3 8   ? 113.655 -72.953 20.956  1.00 59.49  ? 304 ALA A CA    1 
ATOM   866   C  C     . ALA E 3 8   ? 113.171 -73.565 22.270  1.00 59.65  ? 304 ALA A C     1 
ATOM   867   O  O     . ALA E 3 8   ? 112.634 -72.874 23.140  1.00 59.82  ? 304 ALA A O     1 
ATOM   868   C  CB    . ALA E 3 8   ? 115.119 -72.550 21.079  1.00 59.50  ? 304 ALA A CB    1 
ATOM   869   N  N     . ASP E 3 9   ? 113.391 -74.873 22.399  1.00 59.72  ? 305 ASP A N     1 
ATOM   870   C  CA    . ASP E 3 9   ? 113.035 -75.620 23.600  1.00 59.77  ? 305 ASP A CA    1 
ATOM   871   C  C     . ASP E 3 9   ? 114.228 -75.703 24.537  1.00 59.74  ? 305 ASP A C     1 
ATOM   872   O  O     . ASP E 3 9   ? 114.064 -75.706 25.753  1.00 59.69  ? 305 ASP A O     1 
ATOM   873   C  CB    . ASP E 3 9   ? 112.585 -77.038 23.247  1.00 59.93  ? 305 ASP A CB    1 
ATOM   874   C  CG    . ASP E 3 9   ? 111.293 -77.066 22.470  1.00 60.21  ? 305 ASP A CG    1 
ATOM   875   O  OD1   . ASP E 3 9   ? 110.645 -76.006 22.340  1.00 60.68  ? 305 ASP A OD1   1 
ATOM   876   O  OD2   . ASP E 3 9   ? 110.924 -78.156 21.989  1.00 60.84  ? 305 ASP A OD2   1 
ATOM   877   N  N     . ARG E 3 10  ? 115.424 -75.790 23.961  1.00 59.64  ? 306 ARG A N     1 
ATOM   878   C  CA    . ARG E 3 10  ? 116.649 -75.868 24.742  1.00 59.61  ? 306 ARG A CA    1 
ATOM   879   C  C     . ARG E 3 10  ? 117.733 -75.050 24.061  1.00 59.20  ? 306 ARG A C     1 
ATOM   880   O  O     . ARG E 3 10  ? 117.607 -74.689 22.888  1.00 59.12  ? 306 ARG A O     1 
ATOM   881   C  CB    . ARG E 3 10  ? 117.112 -77.325 24.888  1.00 59.89  ? 306 ARG A CB    1 
ATOM   882   C  CG    . ARG E 3 10  ? 117.779 -77.882 23.639  1.00 60.94  ? 306 ARG A CG    1 
ATOM   883   C  CD    . ARG E 3 10  ? 117.842 -79.403 23.618  1.00 62.92  ? 306 ARG A CD    1 
ATOM   884   N  NE    . ARG E 3 10  ? 117.997 -79.887 22.244  1.00 64.37  ? 306 ARG A NE    1 
ATOM   885   C  CZ    . ARG E 3 10  ? 116.988 -80.044 21.385  1.00 64.99  ? 306 ARG A CZ    1 
ATOM   886   N  NH1   . ARG E 3 10  ? 115.742 -79.763 21.753  1.00 65.20  ? 306 ARG A NH1   1 
ATOM   887   N  NH2   . ARG E 3 10  ? 117.217 -80.481 20.154  1.00 65.32  ? 306 ARG A NH2   1 
ATOM   888   N  N     . VAL E 3 11  ? 118.795 -74.764 24.807  1.00 58.81  ? 307 VAL A N     1 
ATOM   889   C  CA    . VAL E 3 11  ? 119.942 -74.051 24.276  1.00 58.47  ? 307 VAL A CA    1 
ATOM   890   C  C     . VAL E 3 11  ? 120.741 -75.010 23.411  1.00 58.29  ? 307 VAL A C     1 
ATOM   891   O  O     . VAL E 3 11  ? 121.028 -76.130 23.829  1.00 58.21  ? 307 VAL A O     1 
ATOM   892   C  CB    . VAL E 3 11  ? 120.852 -73.521 25.405  1.00 58.37  ? 307 VAL A CB    1 
ATOM   893   C  CG1   . VAL E 3 11  ? 122.120 -72.907 24.836  1.00 58.31  ? 307 VAL A CG1   1 
ATOM   894   C  CG2   . VAL E 3 11  ? 120.113 -72.510 26.249  1.00 58.58  ? 307 VAL A CG2   1 
ATOM   895   N  N     . THR E 3 12  ? 121.075 -74.577 22.200  1.00 58.10  ? 308 THR A N     1 
ATOM   896   C  CA    . THR E 3 12  ? 121.887 -75.384 21.296  1.00 57.89  ? 308 THR A CA    1 
ATOM   897   C  C     . THR E 3 12  ? 123.217 -74.684 21.041  1.00 57.69  ? 308 THR A C     1 
ATOM   898   O  O     . THR E 3 12  ? 123.386 -73.516 21.388  1.00 57.59  ? 308 THR A O     1 
ATOM   899   C  CB    . THR E 3 12  ? 121.173 -75.666 19.962  1.00 57.88  ? 308 THR A CB    1 
ATOM   900   O  OG1   . THR E 3 12  ? 121.108 -74.464 19.184  1.00 58.24  ? 308 THR A OG1   1 
ATOM   901   C  CG2   . THR E 3 12  ? 119.769 -76.202 20.208  1.00 57.71  ? 308 THR A CG2   1 
ATOM   902   N  N     . GLU E 3 13  ? 124.159 -75.403 20.438  1.00 57.56  ? 309 GLU A N     1 
ATOM   903   C  CA    . GLU E 3 13  ? 125.503 -74.877 20.209  1.00 57.32  ? 309 GLU A CA    1 
ATOM   904   C  C     . GLU E 3 13  ? 125.530 -73.676 19.261  1.00 56.82  ? 309 GLU A C     1 
ATOM   905   O  O     . GLU E 3 13  ? 126.274 -72.718 19.486  1.00 56.67  ? 309 GLU A O     1 
ATOM   906   C  CB    . GLU E 3 13  ? 126.444 -75.982 19.705  1.00 57.51  ? 309 GLU A CB    1 
ATOM   907   C  CG    . GLU E 3 13  ? 127.896 -75.534 19.531  1.00 58.49  ? 309 GLU A CG    1 
ATOM   908   C  CD    . GLU E 3 13  ? 128.455 -74.869 20.787  1.00 59.76  ? 309 GLU A CD    1 
ATOM   909   O  OE1   . GLU E 3 13  ? 128.199 -75.378 21.902  1.00 60.01  ? 309 GLU A OE1   1 
ATOM   910   O  OE2   . GLU E 3 13  ? 129.152 -73.838 20.658  1.00 59.87  ? 309 GLU A OE2   1 
ATOM   911   N  N     . GLU E 3 14  ? 124.705 -73.724 18.218  1.00 56.13  ? 310 GLU A N     1 
ATOM   912   C  CA    . GLU E 3 14  ? 124.696 -72.666 17.215  1.00 55.48  ? 310 GLU A CA    1 
ATOM   913   C  C     . GLU E 3 14  ? 124.232 -71.313 17.746  1.00 54.82  ? 310 GLU A C     1 
ATOM   914   O  O     . GLU E 3 14  ? 124.404 -70.295 17.074  1.00 54.68  ? 310 GLU A O     1 
ATOM   915   C  CB    . GLU E 3 14  ? 123.887 -73.076 15.986  1.00 55.50  ? 310 GLU A CB    1 
ATOM   916   C  CG    . GLU E 3 14  ? 122.493 -73.587 16.289  1.00 56.01  ? 310 GLU A CG    1 
ATOM   917   C  CD    . GLU E 3 14  ? 121.724 -73.952 15.030  1.00 56.04  ? 310 GLU A CD    1 
ATOM   918   O  OE1   . GLU E 3 14  ? 122.276 -73.791 13.916  1.00 56.30  ? 310 GLU A OE1   1 
ATOM   919   O  OE2   . GLU E 3 14  ? 120.564 -74.400 15.160  1.00 56.78  ? 310 GLU A OE2   1 
ATOM   920   N  N     . MET E 3 15  ? 123.659 -71.291 18.947  1.00 53.99  ? 311 MET A N     1 
ATOM   921   C  CA    . MET E 3 15  ? 123.248 -70.014 19.536  1.00 53.25  ? 311 MET A CA    1 
ATOM   922   C  C     . MET E 3 15  ? 124.305 -69.379 20.459  1.00 52.40  ? 311 MET A C     1 
ATOM   923   O  O     . MET E 3 15  ? 124.208 -68.204 20.804  1.00 52.12  ? 311 MET A O     1 
ATOM   924   C  CB    . MET E 3 15  ? 121.846 -70.088 20.173  1.00 53.24  ? 311 MET A CB    1 
ATOM   925   C  CG    . MET E 3 15  ? 121.571 -71.277 21.080  1.00 53.32  ? 311 MET A CG    1 
ATOM   926   S  SD    . MET E 3 15  ? 119.812 -71.462 21.517  1.00 53.81  ? 311 MET A SD    1 
ATOM   927   C  CE    . MET E 3 15  ? 119.080 -71.933 19.951  1.00 51.82  ? 311 MET A CE    1 
ATOM   928   N  N     . LEU E 3 16  ? 125.334 -70.147 20.811  1.00 51.64  ? 312 LEU A N     1 
ATOM   929   C  CA    . LEU E 3 16  ? 126.423 -69.643 21.652  1.00 50.99  ? 312 LEU A CA    1 
ATOM   930   C  C     . LEU E 3 16  ? 127.618 -69.131 20.830  1.00 50.52  ? 312 LEU A C     1 
ATOM   931   O  O     . LEU E 3 16  ? 128.773 -69.370 21.184  1.00 50.38  ? 312 LEU A O     1 
ATOM   932   C  CB    . LEU E 3 16  ? 126.895 -70.718 22.637  1.00 51.00  ? 312 LEU A CB    1 
ATOM   933   C  CG    . LEU E 3 16  ? 125.878 -71.411 23.545  1.00 50.94  ? 312 LEU A CG    1 
ATOM   934   C  CD1   . LEU E 3 16  ? 126.608 -72.189 24.630  1.00 51.25  ? 312 LEU A CD1   1 
ATOM   935   C  CD2   . LEU E 3 16  ? 124.935 -70.405 24.172  1.00 51.06  ? 312 LEU A CD2   1 
ATOM   936   N  N     . ALA E 3 17  ? 127.329 -68.412 19.746  1.00 49.99  ? 313 ALA A N     1 
ATOM   937   C  CA    . ALA E 3 17  ? 128.362 -67.882 18.848  1.00 49.36  ? 313 ALA A CA    1 
ATOM   938   C  C     . ALA E 3 17  ? 129.192 -66.751 19.456  1.00 48.86  ? 313 ALA A C     1 
ATOM   939   O  O     . ALA E 3 17  ? 128.763 -66.076 20.397  1.00 48.85  ? 313 ALA A O     1 
ATOM   940   C  CB    . ALA E 3 17  ? 127.742 -67.431 17.531  1.00 49.49  ? 313 ALA A CB    1 
ATOM   941   N  N     . ASP E 3 18  ? 130.372 -66.540 18.881  1.00 48.11  ? 314 ASP A N     1 
ATOM   942   C  CA    . ASP E 3 18  ? 131.332 -65.554 19.372  1.00 47.53  ? 314 ASP A CA    1 
ATOM   943   C  C     . ASP E 3 18  ? 130.861 -64.101 19.225  1.00 46.81  ? 314 ASP A C     1 
ATOM   944   O  O     . ASP E 3 18  ? 131.366 -63.207 19.901  1.00 46.76  ? 314 ASP A O     1 
ATOM   945   C  CB    . ASP E 3 18  ? 132.682 -65.751 18.672  1.00 47.63  ? 314 ASP A CB    1 
ATOM   946   C  CG    . ASP E 3 18  ? 133.117 -67.206 18.652  1.00 48.67  ? 314 ASP A CG    1 
ATOM   947   O  OD1   . ASP E 3 18  ? 132.419 -68.024 18.004  1.00 50.10  ? 314 ASP A OD1   1 
ATOM   948   O  OD2   . ASP E 3 18  ? 134.157 -67.533 19.271  1.00 48.72  ? 314 ASP A OD2   1 
ATOM   949   N  N     . LYS E 3 19  ? 129.899 -63.871 18.340  1.00 45.89  ? 315 LYS A N     1 
ATOM   950   C  CA    . LYS E 3 19  ? 129.368 -62.534 18.116  1.00 45.08  ? 315 LYS A CA    1 
ATOM   951   C  C     . LYS E 3 19  ? 127.872 -62.650 17.896  1.00 44.47  ? 315 LYS A C     1 
ATOM   952   O  O     . LYS E 3 19  ? 127.424 -63.433 17.056  1.00 44.74  ? 315 LYS A O     1 
ATOM   953   C  CB    . LYS E 3 19  ? 130.047 -61.884 16.907  1.00 45.06  ? 315 LYS A CB    1 
ATOM   954   C  CG    . LYS E 3 19  ? 129.439 -60.557 16.449  1.00 45.17  ? 315 LYS A CG    1 
ATOM   955   C  CD    . LYS E 3 19  ? 129.673 -59.419 17.434  1.00 45.59  ? 315 LYS A CD    1 
ATOM   956   C  CE    . LYS E 3 19  ? 129.201 -58.093 16.841  1.00 45.33  ? 315 LYS A CE    1 
ATOM   957   N  NZ    . LYS E 3 19  ? 129.549 -56.923 17.695  1.00 44.88  ? 315 LYS A NZ    1 
ATOM   958   N  N     . ALA E 3 20  ? 127.092 -61.890 18.656  1.00 43.57  ? 316 ALA A N     1 
ATOM   959   C  CA    . ALA E 3 20  ? 125.645 -61.957 18.514  1.00 42.69  ? 316 ALA A CA    1 
ATOM   960   C  C     . ALA E 3 20  ? 124.930 -60.714 18.996  1.00 42.03  ? 316 ALA A C     1 
ATOM   961   O  O     . ALA E 3 20  ? 125.491 -59.891 19.719  1.00 42.13  ? 316 ALA A O     1 
ATOM   962   C  CB    . ALA E 3 20  ? 125.092 -63.183 19.248  1.00 42.82  ? 316 ALA A CB    1 
ATOM   963   N  N     . ALA E 3 21  ? 123.681 -60.586 18.570  1.00 41.06  ? 317 ALA A N     1 
ATOM   964   C  CA    . ALA E 3 21  ? 122.800 -59.573 19.099  1.00 40.09  ? 317 ALA A CA    1 
ATOM   965   C  C     . ALA E 3 21  ? 122.030 -60.257 20.221  1.00 39.35  ? 317 ALA A C     1 
ATOM   966   O  O     . ALA E 3 21  ? 121.620 -61.410 20.084  1.00 39.29  ? 317 ALA A O     1 
ATOM   967   C  CB    . ALA E 3 21  ? 121.868 -59.085 18.036  1.00 40.22  ? 317 ALA A CB    1 
ATOM   968   N  N     . LEU E 3 22  ? 121.863 -59.562 21.339  1.00 38.54  ? 318 LEU A N     1 
ATOM   969   C  CA    . LEU E 3 22  ? 121.163 -60.126 22.488  1.00 37.73  ? 318 LEU A CA    1 
ATOM   970   C  C     . LEU E 3 22  ? 120.071 -59.202 23.041  1.00 37.46  ? 318 LEU A C     1 
ATOM   971   O  O     . LEU E 3 22  ? 120.262 -57.983 23.183  1.00 37.45  ? 318 LEU A O     1 
ATOM   972   C  CB    . LEU E 3 22  ? 122.157 -60.507 23.595  1.00 37.75  ? 318 LEU A CB    1 
ATOM   973   C  CG    . LEU E 3 22  ? 121.593 -61.042 24.923  1.00 37.52  ? 318 LEU A CG    1 
ATOM   974   C  CD1   . LEU E 3 22  ? 120.775 -62.319 24.737  1.00 36.60  ? 318 LEU A CD1   1 
ATOM   975   C  CD2   . LEU E 3 22  ? 122.707 -61.264 25.922  1.00 37.29  ? 318 LEU A CD2   1 
ATOM   976   N  N     . VAL E 3 23  ? 118.924 -59.802 23.339  1.00 36.72  ? 319 VAL A N     1 
ATOM   977   C  CA    . VAL E 3 23  ? 117.799 -59.106 23.931  1.00 36.06  ? 319 VAL A CA    1 
ATOM   978   C  C     . VAL E 3 23  ? 117.408 -59.866 25.198  1.00 35.89  ? 319 VAL A C     1 
ATOM   979   O  O     . VAL E 3 23  ? 117.052 -61.038 25.135  1.00 35.90  ? 319 VAL A O     1 
ATOM   980   C  CB    . VAL E 3 23  ? 116.592 -59.047 22.959  1.00 36.14  ? 319 VAL A CB    1 
ATOM   981   C  CG1   . VAL E 3 23  ? 115.354 -58.513 23.658  1.00 35.92  ? 319 VAL A CG1   1 
ATOM   982   C  CG2   . VAL E 3 23  ? 116.919 -58.222 21.711  1.00 35.50  ? 319 VAL A CG2   1 
ATOM   983   N  N     . VAL E 3 24  ? 117.520 -59.209 26.349  1.00 35.50  ? 320 VAL A N     1 
ATOM   984   C  CA    . VAL E 3 24  ? 117.089 -59.781 27.616  1.00 35.04  ? 320 VAL A CA    1 
ATOM   985   C  C     . VAL E 3 24  ? 115.979 -58.858 28.056  1.00 35.01  ? 320 VAL A C     1 
ATOM   986   O  O     . VAL E 3 24  ? 116.203 -57.906 28.794  1.00 34.97  ? 320 VAL A O     1 
ATOM   987   C  CB    . VAL E 3 24  ? 118.213 -59.791 28.661  1.00 35.00  ? 320 VAL A CB    1 
ATOM   988   C  CG1   . VAL E 3 24  ? 117.759 -60.496 29.916  1.00 34.66  ? 320 VAL A CG1   1 
ATOM   989   C  CG2   . VAL E 3 24  ? 119.446 -60.476 28.100  1.00 34.70  ? 320 VAL A CG2   1 
ATOM   990   N  N     . GLU E 3 25  ? 114.780 -59.144 27.568  1.00 35.17  ? 321 GLU A N     1 
ATOM   991   C  CA    . GLU E 3 25  ? 113.635 -58.258 27.724  1.00 35.47  ? 321 GLU A CA    1 
ATOM   992   C  C     . GLU E 3 25  ? 113.133 -58.078 29.150  1.00 35.59  ? 321 GLU A C     1 
ATOM   993   O  O     . GLU E 3 25  ? 112.745 -59.042 29.815  1.00 35.77  ? 321 GLU A O     1 
ATOM   994   C  CB    . GLU E 3 25  ? 112.480 -58.721 26.828  1.00 35.45  ? 321 GLU A CB    1 
ATOM   995   C  CG    . GLU E 3 25  ? 111.360 -57.705 26.692  1.00 35.76  ? 321 GLU A CG    1 
ATOM   996   C  CD    . GLU E 3 25  ? 111.790 -56.426 25.962  1.00 35.65  ? 321 GLU A CD    1 
ATOM   997   O  OE1   . GLU E 3 25  ? 112.868 -56.428 25.335  1.00 35.51  ? 321 GLU A OE1   1 
ATOM   998   O  OE2   . GLU E 3 25  ? 111.040 -55.423 25.999  1.00 34.83  ? 321 GLU A OE2   1 
ATOM   999   N  N     . VAL E 3 26  ? 113.136 -56.829 29.600  1.00 35.47  ? 322 VAL A N     1 
ATOM   1000  C  CA    . VAL E 3 26  ? 112.581 -56.479 30.893  1.00 35.54  ? 322 VAL A CA    1 
ATOM   1001  C  C     . VAL E 3 26  ? 111.576 -55.357 30.657  1.00 35.73  ? 322 VAL A C     1 
ATOM   1002  O  O     . VAL E 3 26  ? 111.959 -54.250 30.300  1.00 35.88  ? 322 VAL A O     1 
ATOM   1003  C  CB    . VAL E 3 26  ? 113.675 -56.035 31.878  1.00 35.60  ? 322 VAL A CB    1 
ATOM   1004  C  CG1   . VAL E 3 26  ? 113.073 -55.752 33.237  1.00 35.32  ? 322 VAL A CG1   1 
ATOM   1005  C  CG2   . VAL E 3 26  ? 114.764 -57.099 31.985  1.00 34.95  ? 322 VAL A CG2   1 
ATOM   1006  N  N     . VAL E 3 27  ? 110.295 -55.655 30.849  1.00 36.04  ? 323 VAL A N     1 
ATOM   1007  C  CA    . VAL E 3 27  ? 109.199 -54.722 30.547  1.00 36.32  ? 323 VAL A CA    1 
ATOM   1008  C  C     . VAL E 3 27  ? 108.990 -53.585 31.561  1.00 36.70  ? 323 VAL A C     1 
ATOM   1009  O  O     . VAL E 3 27  ? 108.717 -52.445 31.170  1.00 36.77  ? 323 VAL A O     1 
ATOM   1010  C  CB    . VAL E 3 27  ? 107.869 -55.491 30.319  1.00 36.19  ? 323 VAL A CB    1 
ATOM   1011  C  CG1   . VAL E 3 27  ? 106.664 -54.585 30.488  1.00 36.78  ? 323 VAL A CG1   1 
ATOM   1012  C  CG2   . VAL E 3 27  ? 107.857 -56.122 28.954  1.00 36.02  ? 323 VAL A CG2   1 
ATOM   1013  N  N     . GLU E 3 28  ? 109.111 -53.889 32.852  1.00 36.86  ? 324 GLU A N     1 
ATOM   1014  C  CA    . GLU E 3 28  ? 108.937 -52.873 33.890  1.00 37.15  ? 324 GLU A CA    1 
ATOM   1015  C  C     . GLU E 3 28  ? 109.989 -51.772 33.770  1.00 37.04  ? 324 GLU A C     1 
ATOM   1016  O  O     . GLU E 3 28  ? 111.181 -52.051 33.632  1.00 37.03  ? 324 GLU A O     1 
ATOM   1017  C  CB    . GLU E 3 28  ? 108.970 -53.514 35.277  1.00 37.37  ? 324 GLU A CB    1 
ATOM   1018  C  CG    . GLU E 3 28  ? 107.905 -54.586 35.456  1.00 39.39  ? 324 GLU A CG    1 
ATOM   1019  C  CD    . GLU E 3 28  ? 107.749 -55.054 36.893  1.00 42.32  ? 324 GLU A CD    1 
ATOM   1020  O  OE1   . GLU E 3 28  ? 108.439 -54.510 37.787  1.00 43.55  ? 324 GLU A OE1   1 
ATOM   1021  O  OE2   . GLU E 3 28  ? 106.925 -55.972 37.125  1.00 42.91  ? 324 GLU A OE2   1 
ATOM   1022  N  N     . GLU E 3 29  ? 109.544 -50.519 33.808  1.00 36.93  ? 325 GLU A N     1 
ATOM   1023  C  CA    . GLU E 3 29  ? 110.461 -49.387 33.616  1.00 36.69  ? 325 GLU A CA    1 
ATOM   1024  C  C     . GLU E 3 29  ? 111.536 -49.281 34.688  1.00 35.84  ? 325 GLU A C     1 
ATOM   1025  O  O     . GLU E 3 29  ? 112.671 -48.911 34.396  1.00 35.97  ? 325 GLU A O     1 
ATOM   1026  C  CB    . GLU E 3 29  ? 109.707 -48.078 33.360  1.00 36.77  ? 325 GLU A CB    1 
ATOM   1027  C  CG    . GLU E 3 29  ? 109.247 -48.005 31.899  1.00 38.92  ? 325 GLU A CG    1 
ATOM   1028  C  CD    . GLU E 3 29  ? 108.082 -47.055 31.670  1.00 41.66  ? 325 GLU A CD    1 
ATOM   1029  O  OE1   . GLU E 3 29  ? 108.008 -46.029 32.385  1.00 43.11  ? 325 GLU A OE1   1 
ATOM   1030  O  OE2   . GLU E 3 29  ? 107.245 -47.338 30.773  1.00 41.54  ? 325 GLU A OE2   1 
ATOM   1031  N  N     . ASN E 3 30  ? 111.188 -49.617 35.920  1.00 34.89  ? 326 ASN A N     1 
ATOM   1032  C  CA    . ASN E 3 30  ? 112.202 -49.752 36.944  1.00 34.11  ? 326 ASN A CA    1 
ATOM   1033  C  C     . ASN E 3 30  ? 112.643 -51.215 36.913  1.00 33.76  ? 326 ASN A C     1 
ATOM   1034  O  O     . ASN E 3 30  ? 111.917 -52.098 37.351  1.00 33.80  ? 326 ASN A O     1 
ATOM   1035  C  CB    . ASN E 3 30  ? 111.636 -49.373 38.303  1.00 33.97  ? 326 ASN A CB    1 
ATOM   1036  C  CG    . ASN E 3 30  ? 112.622 -49.590 39.426  1.00 33.23  ? 326 ASN A CG    1 
ATOM   1037  O  OD1   . ASN E 3 30  ? 113.546 -50.389 39.315  1.00 32.61  ? 326 ASN A OD1   1 
ATOM   1038  N  ND2   . ASN E 3 30  ? 112.414 -48.892 40.532  1.00 33.19  ? 326 ASN A ND2   1 
ATOM   1039  N  N     . TYR E 3 31  ? 113.832 -51.470 36.387  1.00 33.26  ? 327 TYR A N     1 
ATOM   1040  C  CA    . TYR E 3 31  ? 114.299 -52.851 36.182  1.00 32.78  ? 327 TYR A CA    1 
ATOM   1041  C  C     . TYR E 3 31  ? 114.871 -53.578 37.409  1.00 33.04  ? 327 TYR A C     1 
ATOM   1042  O  O     . TYR E 3 31  ? 115.166 -54.774 37.329  1.00 32.75  ? 327 TYR A O     1 
ATOM   1043  C  CB    . TYR E 3 31  ? 115.308 -52.908 35.026  1.00 31.93  ? 327 TYR A CB    1 
ATOM   1044  C  CG    . TYR E 3 31  ? 116.384 -51.857 35.117  1.00 31.01  ? 327 TYR A CG    1 
ATOM   1045  C  CD1   . TYR E 3 31  ? 117.476 -52.029 35.952  1.00 30.24  ? 327 TYR A CD1   1 
ATOM   1046  C  CD2   . TYR E 3 31  ? 116.304 -50.686 34.370  1.00 29.74  ? 327 TYR A CD2   1 
ATOM   1047  C  CE1   . TYR E 3 31  ? 118.463 -51.066 36.043  1.00 30.67  ? 327 TYR A CE1   1 
ATOM   1048  C  CE2   . TYR E 3 31  ? 117.288 -49.722 34.453  1.00 29.91  ? 327 TYR A CE2   1 
ATOM   1049  C  CZ    . TYR E 3 31  ? 118.367 -49.916 35.290  1.00 30.53  ? 327 TYR A CZ    1 
ATOM   1050  O  OH    . TYR E 3 31  ? 119.358 -48.966 35.388  1.00 30.50  ? 327 TYR A OH    1 
ATOM   1051  N  N     . HIS E 3 32  ? 115.038 -52.867 38.525  1.00 33.47  ? 328 HIS A N     1 
ATOM   1052  C  CA    . HIS E 3 32  ? 115.570 -53.472 39.752  1.00 33.81  ? 328 HIS A CA    1 
ATOM   1053  C  C     . HIS E 3 32  ? 114.676 -54.603 40.249  1.00 34.35  ? 328 HIS A C     1 
ATOM   1054  O  O     . HIS E 3 32  ? 113.499 -54.399 40.530  1.00 34.41  ? 328 HIS A O     1 
ATOM   1055  C  CB    . HIS E 3 32  ? 115.762 -52.429 40.850  1.00 33.42  ? 328 HIS A CB    1 
ATOM   1056  C  CG    . HIS E 3 32  ? 116.980 -51.578 40.673  1.00 32.90  ? 328 HIS A CG    1 
ATOM   1057  N  ND1   . HIS E 3 32  ? 118.257 -52.058 40.862  1.00 32.37  ? 328 HIS A ND1   1 
ATOM   1058  C  CD2   . HIS E 3 32  ? 117.116 -50.267 40.357  1.00 33.14  ? 328 HIS A CD2   1 
ATOM   1059  C  CE1   . HIS E 3 32  ? 119.127 -51.086 40.658  1.00 32.64  ? 328 HIS A CE1   1 
ATOM   1060  N  NE2   . HIS E 3 32  ? 118.461 -49.988 40.348  1.00 32.92  ? 328 HIS A NE2   1 
ATOM   1061  N  N     . ASP E 3 33  ? 115.257 -55.796 40.334  1.00 35.18  ? 329 ASP A N     1 
ATOM   1062  C  CA    . ASP E 3 33  ? 114.549 -57.023 40.709  1.00 35.88  ? 329 ASP A CA    1 
ATOM   1063  C  C     . ASP E 3 33  ? 113.269 -57.212 39.894  1.00 36.02  ? 329 ASP A C     1 
ATOM   1064  O  O     . ASP E 3 33  ? 112.232 -57.579 40.446  1.00 36.34  ? 329 ASP A O     1 
ATOM   1065  C  CB    . ASP E 3 33  ? 114.219 -57.015 42.201  1.00 36.13  ? 329 ASP A CB    1 
ATOM   1066  C  CG    . ASP E 3 33  ? 114.151 -58.409 42.791  1.00 37.17  ? 329 ASP A CG    1 
ATOM   1067  O  OD1   . ASP E 3 33  ? 115.222 -59.022 42.989  1.00 38.01  ? 329 ASP A OD1   1 
ATOM   1068  O  OD2   . ASP E 3 33  ? 113.034 -58.882 43.085  1.00 38.20  ? 329 ASP A OD2   1 
ATOM   1069  N  N     . ALA E 3 34  ? 113.338 -56.956 38.588  1.00 36.03  ? 330 ALA A N     1 
ATOM   1070  C  CA    . ALA E 3 34  ? 112.157 -57.042 37.721  1.00 36.09  ? 330 ALA A CA    1 
ATOM   1071  C  C     . ALA E 3 34  ? 112.147 -58.310 36.881  1.00 36.13  ? 330 ALA A C     1 
ATOM   1072  O  O     . ALA E 3 34  ? 113.202 -58.851 36.567  1.00 36.15  ? 330 ALA A O     1 
ATOM   1073  C  CB    . ALA E 3 34  ? 112.061 -55.811 36.816  1.00 35.99  ? 330 ALA A CB    1 
ATOM   1074  N  N     . PRO E 3 35  ? 110.947 -58.795 36.526  1.00 36.30  ? 331 PRO A N     1 
ATOM   1075  C  CA    . PRO E 3 35  ? 110.802 -59.983 35.685  1.00 36.55  ? 331 PRO A CA    1 
ATOM   1076  C  C     . PRO E 3 35  ? 111.459 -59.875 34.303  1.00 36.72  ? 331 PRO A C     1 
ATOM   1077  O  O     . PRO E 3 35  ? 111.230 -58.909 33.567  1.00 36.40  ? 331 PRO A O     1 
ATOM   1078  C  CB    . PRO E 3 35  ? 109.276 -60.116 35.520  1.00 36.51  ? 331 PRO A CB    1 
ATOM   1079  C  CG    . PRO E 3 35  ? 108.698 -59.386 36.683  1.00 36.40  ? 331 PRO A CG    1 
ATOM   1080  C  CD    . PRO E 3 35  ? 109.641 -58.254 36.948  1.00 36.37  ? 331 PRO A CD    1 
ATOM   1081  N  N     . ILE E 3 36  ? 112.279 -60.872 33.982  1.00 36.95  ? 332 ILE A N     1 
ATOM   1082  C  CA    . ILE E 3 36  ? 112.848 -61.031 32.655  1.00 37.27  ? 332 ILE A CA    1 
ATOM   1083  C  C     . ILE E 3 36  ? 111.849 -61.911 31.914  1.00 37.76  ? 332 ILE A C     1 
ATOM   1084  O  O     . ILE E 3 36  ? 111.642 -63.062 32.278  1.00 37.94  ? 332 ILE A O     1 
ATOM   1085  C  CB    . ILE E 3 36  ? 114.231 -61.704 32.716  1.00 37.15  ? 332 ILE A CB    1 
ATOM   1086  C  CG1   . ILE E 3 36  ? 115.244 -60.750 33.356  1.00 36.39  ? 332 ILE A CG1   1 
ATOM   1087  C  CG2   . ILE E 3 36  ? 114.685 -62.128 31.328  1.00 36.79  ? 332 ILE A CG2   1 
ATOM   1088  C  CD1   . ILE E 3 36  ? 116.613 -61.333 33.534  1.00 36.17  ? 332 ILE A CD1   1 
ATOM   1089  N  N     . VAL E 3 37  ? 111.224 -61.359 30.883  1.00 38.24  ? 333 VAL A N     1 
ATOM   1090  C  CA    . VAL E 3 37  ? 110.080 -62.013 30.263  1.00 38.94  ? 333 VAL A CA    1 
ATOM   1091  C  C     . VAL E 3 37  ? 110.351 -62.723 28.948  1.00 39.52  ? 333 VAL A C     1 
ATOM   1092  O  O     . VAL E 3 37  ? 109.426 -63.282 28.346  1.00 39.62  ? 333 VAL A O     1 
ATOM   1093  C  CB    . VAL E 3 37  ? 108.960 -60.993 30.003  1.00 39.11  ? 333 VAL A CB    1 
ATOM   1094  C  CG1   . VAL E 3 37  ? 108.494 -60.364 31.312  1.00 38.78  ? 333 VAL A CG1   1 
ATOM   1095  C  CG2   . VAL E 3 37  ? 109.444 -59.919 29.018  1.00 39.27  ? 333 VAL A CG2   1 
ATOM   1096  N  N     . GLY E 3 38  ? 111.599 -62.687 28.486  1.00 40.04  ? 334 GLY A N     1 
ATOM   1097  C  CA    . GLY E 3 38  ? 111.947 -63.308 27.210  1.00 40.28  ? 334 GLY A CA    1 
ATOM   1098  C  C     . GLY E 3 38  ? 113.363 -63.028 26.762  1.00 40.64  ? 334 GLY A C     1 
ATOM   1099  O  O     . GLY E 3 38  ? 113.938 -61.999 27.099  1.00 40.58  ? 334 GLY A O     1 
ATOM   1100  N  N     . ILE E 3 39  ? 113.921 -63.958 25.994  1.00 41.07  ? 335 ILE A N     1 
ATOM   1101  C  CA    . ILE E 3 39  ? 115.298 -63.858 25.524  1.00 41.37  ? 335 ILE A CA    1 
ATOM   1102  C  C     . ILE E 3 39  ? 115.376 -64.174 24.035  1.00 41.53  ? 335 ILE A C     1 
ATOM   1103  O  O     . ILE E 3 39  ? 114.724 -65.102 23.561  1.00 41.98  ? 335 ILE A O     1 
ATOM   1104  C  CB    . ILE E 3 39  ? 116.227 -64.815 26.313  1.00 41.46  ? 335 ILE A CB    1 
ATOM   1105  C  CG1   . ILE E 3 39  ? 116.247 -64.428 27.791  1.00 41.44  ? 335 ILE A CG1   1 
ATOM   1106  C  CG2   . ILE E 3 39  ? 117.640 -64.803 25.745  1.00 41.26  ? 335 ILE A CG2   1 
ATOM   1107  C  CD1   . ILE E 3 39  ? 117.109 -65.309 28.637  1.00 42.59  ? 335 ILE A CD1   1 
ATOM   1108  N  N     . ALA E 3 40  ? 116.161 -63.390 23.301  1.00 41.48  ? 336 ALA A N     1 
ATOM   1109  C  CA    . ALA E 3 40  ? 116.349 -63.596 21.872  1.00 41.23  ? 336 ALA A CA    1 
ATOM   1110  C  C     . ALA E 3 40  ? 117.824 -63.491 21.530  1.00 41.25  ? 336 ALA A C     1 
ATOM   1111  O  O     . ALA E 3 40  ? 118.560 -62.749 22.175  1.00 41.35  ? 336 ALA A O     1 
ATOM   1112  C  CB    . ALA E 3 40  ? 115.552 -62.578 21.080  1.00 41.20  ? 336 ALA A CB    1 
ATOM   1113  N  N     . VAL E 3 41  ? 118.259 -64.245 20.526  1.00 41.34  ? 337 VAL A N     1 
ATOM   1114  C  CA    . VAL E 3 41  ? 119.646 -64.183 20.066  1.00 41.37  ? 337 VAL A CA    1 
ATOM   1115  C  C     . VAL E 3 41  ? 119.730 -64.224 18.539  1.00 41.60  ? 337 VAL A C     1 
ATOM   1116  O  O     . VAL E 3 41  ? 119.078 -65.049 17.890  1.00 41.30  ? 337 VAL A O     1 
ATOM   1117  C  CB    . VAL E 3 41  ? 120.520 -65.316 20.672  1.00 41.24  ? 337 VAL A CB    1 
ATOM   1118  C  CG1   . VAL E 3 41  ? 121.866 -65.385 19.982  1.00 40.96  ? 337 VAL A CG1   1 
ATOM   1119  C  CG2   . VAL E 3 41  ? 120.719 -65.109 22.162  1.00 41.27  ? 337 VAL A CG2   1 
ATOM   1120  N  N     . VAL E 3 42  ? 120.516 -63.311 17.974  1.00 41.93  ? 338 VAL A N     1 
ATOM   1121  C  CA    . VAL E 3 42  ? 120.781 -63.320 16.541  1.00 42.55  ? 338 VAL A CA    1 
ATOM   1122  C  C     . VAL E 3 42  ? 122.275 -63.298 16.275  1.00 43.09  ? 338 VAL A C     1 
ATOM   1123  O  O     . VAL E 3 42  ? 122.992 -62.436 16.774  1.00 43.11  ? 338 VAL A O     1 
ATOM   1124  C  CB    . VAL E 3 42  ? 120.096 -62.162 15.794  1.00 42.55  ? 338 VAL A CB    1 
ATOM   1125  C  CG1   . VAL E 3 42  ? 120.622 -62.058 14.358  1.00 42.20  ? 338 VAL A CG1   1 
ATOM   1126  C  CG2   . VAL E 3 42  ? 118.586 -62.358 15.799  1.00 42.70  ? 338 VAL A CG2   1 
ATOM   1127  N  N     . ASN E 3 43  ? 122.729 -64.270 15.491  1.00 43.85  ? 339 ASN A N     1 
ATOM   1128  C  CA    . ASN E 3 43  ? 124.123 -64.375 15.089  1.00 44.51  ? 339 ASN A CA    1 
ATOM   1129  C  C     . ASN E 3 43  ? 124.198 -64.857 13.646  1.00 45.30  ? 339 ASN A C     1 
ATOM   1130  O  O     . ASN E 3 43  ? 123.168 -64.971 12.967  1.00 45.31  ? 339 ASN A O     1 
ATOM   1131  C  CB    . ASN E 3 43  ? 124.864 -65.351 16.000  1.00 44.32  ? 339 ASN A CB    1 
ATOM   1132  C  CG    . ASN E 3 43  ? 124.147 -66.687 16.126  1.00 43.87  ? 339 ASN A CG    1 
ATOM   1133  O  OD1   . ASN E 3 43  ? 123.459 -67.129 15.204  1.00 42.85  ? 339 ASN A OD1   1 
ATOM   1134  N  ND2   . ASN E 3 43  ? 124.302 -67.334 17.273  1.00 43.33  ? 339 ASN A ND2   1 
ATOM   1135  N  N     . GLU E 3 44  ? 125.416 -65.153 13.196  1.00 46.07  ? 340 GLU A N     1 
ATOM   1136  C  CA    . GLU E 3 44  ? 125.670 -65.649 11.849  1.00 46.87  ? 340 GLU A CA    1 
ATOM   1137  C  C     . GLU E 3 44  ? 124.837 -66.877 11.488  1.00 46.89  ? 340 GLU A C     1 
ATOM   1138  O  O     . GLU E 3 44  ? 124.375 -67.003 10.353  1.00 46.85  ? 340 GLU A O     1 
ATOM   1139  C  CB    . GLU E 3 44  ? 127.155 -65.974 11.683  1.00 46.73  ? 340 GLU A CB    1 
ATOM   1140  C  CG    . GLU E 3 44  ? 127.746 -66.799 12.824  1.00 47.86  ? 340 GLU A CG    1 
ATOM   1141  C  CD    . GLU E 3 44  ? 129.102 -67.423 12.481  1.00 48.33  ? 340 GLU A CD    1 
ATOM   1142  O  OE1   . GLU E 3 44  ? 129.987 -67.464 13.376  1.00 50.22  ? 340 GLU A OE1   1 
ATOM   1143  O  OE2   . GLU E 3 44  ? 129.281 -67.876 11.323  1.00 49.41  ? 340 GLU A OE2   1 
ATOM   1144  N  N     . HIS E 3 45  ? 124.623 -67.762 12.459  1.00 47.14  ? 341 HIS A N     1 
ATOM   1145  C  CA    . HIS E 3 45  ? 123.940 -69.028 12.205  1.00 47.53  ? 341 HIS A CA    1 
ATOM   1146  C  C     . HIS E 3 45  ? 122.416 -68.979 12.169  1.00 47.65  ? 341 HIS A C     1 
ATOM   1147  O  O     . HIS E 3 45  ? 121.797 -69.849 11.556  1.00 47.72  ? 341 HIS A O     1 
ATOM   1148  C  CB    . HIS E 3 45  ? 124.409 -70.098 13.187  1.00 47.65  ? 341 HIS A CB    1 
ATOM   1149  C  CG    . HIS E 3 45  ? 125.896 -70.201 13.289  1.00 48.63  ? 341 HIS A CG    1 
ATOM   1150  N  ND1   . HIS E 3 45  ? 126.582 -69.950 14.460  1.00 49.28  ? 341 HIS A ND1   1 
ATOM   1151  C  CD2   . HIS E 3 45  ? 126.835 -70.491 12.357  1.00 49.56  ? 341 HIS A CD2   1 
ATOM   1152  C  CE1   . HIS E 3 45  ? 127.878 -70.103 14.251  1.00 49.89  ? 341 HIS A CE1   1 
ATOM   1153  N  NE2   . HIS E 3 45  ? 128.059 -70.429 12.982  1.00 50.39  ? 341 HIS A NE2   1 
ATOM   1154  N  N     . GLY E 3 46  ? 121.807 -67.991 12.824  1.00 47.79  ? 342 GLY A N     1 
ATOM   1155  C  CA    . GLY E 3 46  ? 120.344 -67.879 12.803  1.00 47.90  ? 342 GLY A CA    1 
ATOM   1156  C  C     . GLY E 3 46  ? 119.683 -66.927 13.788  1.00 48.03  ? 342 GLY A C     1 
ATOM   1157  O  O     . GLY E 3 46  ? 120.341 -66.080 14.401  1.00 47.89  ? 342 GLY A O     1 
ATOM   1158  N  N     . ARG E 3 47  ? 118.365 -67.073 13.921  1.00 48.18  ? 343 ARG A N     1 
ATOM   1159  C  CA    . ARG E 3 47  ? 117.548 -66.259 14.820  1.00 48.29  ? 343 ARG A CA    1 
ATOM   1160  C  C     . ARG E 3 47  ? 116.835 -67.152 15.814  1.00 48.38  ? 343 ARG A C     1 
ATOM   1161  O  O     . ARG E 3 47  ? 116.139 -68.084 15.424  1.00 48.49  ? 343 ARG A O     1 
ATOM   1162  C  CB    . ARG E 3 47  ? 116.518 -65.454 14.033  1.00 48.28  ? 343 ARG A CB    1 
ATOM   1163  C  CG    . ARG E 3 47  ? 117.134 -64.477 13.062  1.00 48.16  ? 343 ARG A CG    1 
ATOM   1164  C  CD    . ARG E 3 47  ? 116.087 -63.653 12.366  1.00 48.26  ? 343 ARG A CD    1 
ATOM   1165  N  NE    . ARG E 3 47  ? 116.626 -63.098 11.132  1.00 49.07  ? 343 ARG A NE    1 
ATOM   1166  C  CZ    . ARG E 3 47  ? 116.562 -63.709 9.954   1.00 49.20  ? 343 ARG A CZ    1 
ATOM   1167  N  NH1   . ARG E 3 47  ? 115.959 -64.888 9.842   1.00 48.69  ? 343 ARG A NH1   1 
ATOM   1168  N  NH2   . ARG E 3 47  ? 117.095 -63.138 8.885   1.00 49.28  ? 343 ARG A NH2   1 
ATOM   1169  N  N     . PHE E 3 48  ? 116.992 -66.852 17.098  1.00 48.57  ? 344 PHE A N     1 
ATOM   1170  C  CA    . PHE E 3 48  ? 116.426 -67.695 18.138  1.00 48.73  ? 344 PHE A CA    1 
ATOM   1171  C  C     . PHE E 3 48  ? 115.646 -66.945 19.207  1.00 48.71  ? 344 PHE A C     1 
ATOM   1172  O  O     . PHE E 3 48  ? 115.932 -65.787 19.508  1.00 48.55  ? 344 PHE A O     1 
ATOM   1173  C  CB    . PHE E 3 48  ? 117.541 -68.485 18.824  1.00 48.98  ? 344 PHE A CB    1 
ATOM   1174  C  CG    . PHE E 3 48  ? 118.472 -69.177 17.869  1.00 49.57  ? 344 PHE A CG    1 
ATOM   1175  C  CD1   . PHE E 3 48  ? 118.069 -70.319 17.187  1.00 49.75  ? 344 PHE A CD1   1 
ATOM   1176  C  CD2   . PHE E 3 48  ? 119.755 -68.692 17.659  1.00 49.91  ? 344 PHE A CD2   1 
ATOM   1177  C  CE1   . PHE E 3 48  ? 118.931 -70.963 16.310  1.00 49.91  ? 344 PHE A CE1   1 
ATOM   1178  C  CE2   . PHE E 3 48  ? 120.620 -69.329 16.783  1.00 50.05  ? 344 PHE A CE2   1 
ATOM   1179  C  CZ    . PHE E 3 48  ? 120.209 -70.467 16.108  1.00 49.83  ? 344 PHE A CZ    1 
ATOM   1180  N  N     . PHE E 3 49  ? 114.654 -67.628 19.771  1.00 48.80  ? 345 PHE A N     1 
ATOM   1181  C  CA    . PHE E 3 49  ? 113.918 -67.139 20.932  1.00 48.95  ? 345 PHE A CA    1 
ATOM   1182  C  C     . PHE E 3 49  ? 113.955 -68.205 22.019  1.00 49.06  ? 345 PHE A C     1 
ATOM   1183  O  O     . PHE E 3 49  ? 113.852 -69.399 21.740  1.00 49.12  ? 345 PHE A O     1 
ATOM   1184  C  CB    . PHE E 3 49  ? 112.467 -66.788 20.590  1.00 48.91  ? 345 PHE A CB    1 
ATOM   1185  C  CG    . PHE E 3 49  ? 111.631 -66.455 21.793  1.00 48.75  ? 345 PHE A CG    1 
ATOM   1186  C  CD1   . PHE E 3 49  ? 111.668 -65.191 22.350  1.00 48.88  ? 345 PHE A CD1   1 
ATOM   1187  C  CD2   . PHE E 3 49  ? 110.816 -67.415 22.378  1.00 49.09  ? 345 PHE A CD2   1 
ATOM   1188  C  CE1   . PHE E 3 49  ? 110.898 -64.883 23.466  1.00 48.97  ? 345 PHE A CE1   1 
ATOM   1189  C  CE2   . PHE E 3 49  ? 110.047 -67.117 23.494  1.00 48.57  ? 345 PHE A CE2   1 
ATOM   1190  C  CZ    . PHE E 3 49  ? 110.090 -65.850 24.037  1.00 48.63  ? 345 PHE A CZ    1 
ATOM   1191  N  N     . LEU E 3 50  ? 114.097 -67.764 23.258  1.00 49.19  ? 346 LEU A N     1 
ATOM   1192  C  CA    . LEU E 3 50  ? 114.153 -68.664 24.391  1.00 49.32  ? 346 LEU A CA    1 
ATOM   1193  C  C     . LEU E 3 50  ? 113.279 -68.152 25.522  1.00 49.68  ? 346 LEU A C     1 
ATOM   1194  O  O     . LEU E 3 50  ? 113.158 -66.941 25.736  1.00 49.82  ? 346 LEU A O     1 
ATOM   1195  C  CB    . LEU E 3 50  ? 115.589 -68.774 24.877  1.00 49.16  ? 346 LEU A CB    1 
ATOM   1196  C  CG    . LEU E 3 50  ? 116.547 -69.561 23.987  1.00 49.34  ? 346 LEU A CG    1 
ATOM   1197  C  CD1   . LEU E 3 50  ? 117.969 -69.053 24.131  1.00 49.23  ? 346 LEU A CD1   1 
ATOM   1198  C  CD2   . LEU E 3 50  ? 116.461 -71.045 24.307  1.00 49.74  ? 346 LEU A CD2   1 
ATOM   1199  N  N     . ARG E 3 51  ? 112.649 -69.078 26.234  1.00 49.92  ? 347 ARG A N     1 
ATOM   1200  C  CA    . ARG E 3 51  ? 111.901 -68.723 27.425  1.00 50.12  ? 347 ARG A CA    1 
ATOM   1201  C  C     . ARG E 3 51  ? 112.956 -68.542 28.518  1.00 50.31  ? 347 ARG A C     1 
ATOM   1202  O  O     . ARG E 3 51  ? 113.977 -69.234 28.513  1.00 50.34  ? 347 ARG A O     1 
ATOM   1203  C  CB    . ARG E 3 51  ? 110.901 -69.820 27.782  1.00 50.11  ? 347 ARG A CB    1 
ATOM   1204  C  CG    . ARG E 3 51  ? 109.806 -70.022 26.760  1.00 49.98  ? 347 ARG A CG    1 
ATOM   1205  C  CD    . ARG E 3 51  ? 109.060 -71.309 27.045  1.00 50.91  ? 347 ARG A CD    1 
ATOM   1206  N  NE    . ARG E 3 51  ? 108.011 -71.571 26.063  1.00 52.52  ? 347 ARG A NE    1 
ATOM   1207  C  CZ    . ARG E 3 51  ? 108.202 -72.191 24.898  1.00 53.12  ? 347 ARG A CZ    1 
ATOM   1208  N  NH1   . ARG E 3 51  ? 109.413 -72.607 24.545  1.00 53.06  ? 347 ARG A NH1   1 
ATOM   1209  N  NH2   . ARG E 3 51  ? 107.177 -72.383 24.075  1.00 53.52  ? 347 ARG A NH2   1 
ATOM   1210  N  N     . PRO E 3 52  ? 112.718 -67.615 29.459  1.00 50.45  ? 348 PRO A N     1 
ATOM   1211  C  CA    . PRO E 3 52  ? 113.756 -67.277 30.433  1.00 50.59  ? 348 PRO A CA    1 
ATOM   1212  C  C     . PRO E 3 52  ? 114.063 -68.416 31.389  1.00 50.78  ? 348 PRO A C     1 
ATOM   1213  O  O     . PRO E 3 52  ? 115.234 -68.704 31.646  1.00 50.67  ? 348 PRO A O     1 
ATOM   1214  C  CB    . PRO E 3 52  ? 113.162 -66.083 31.192  1.00 50.61  ? 348 PRO A CB    1 
ATOM   1215  C  CG    . PRO E 3 52  ? 111.976 -65.640 30.381  1.00 50.86  ? 348 PRO A CG    1 
ATOM   1216  C  CD    . PRO E 3 52  ? 111.479 -66.854 29.683  1.00 50.46  ? 348 PRO A CD    1 
ATOM   1217  N  N     . GLU E 3 53  ? 113.018 -69.065 31.896  1.00 51.02  ? 349 GLU A N     1 
ATOM   1218  C  CA    . GLU E 3 53  ? 113.182 -70.187 32.816  1.00 51.24  ? 349 GLU A CA    1 
ATOM   1219  C  C     . GLU E 3 53  ? 114.008 -71.318 32.196  1.00 51.29  ? 349 GLU A C     1 
ATOM   1220  O  O     . GLU E 3 53  ? 114.590 -72.136 32.912  1.00 51.28  ? 349 GLU A O     1 
ATOM   1221  C  CB    . GLU E 3 53  ? 111.826 -70.705 33.320  1.00 51.42  ? 349 GLU A CB    1 
ATOM   1222  C  CG    . GLU E 3 53  ? 110.921 -71.359 32.271  1.00 51.27  ? 349 GLU A CG    1 
ATOM   1223  C  CD    . GLU E 3 53  ? 110.090 -70.367 31.469  1.00 50.67  ? 349 GLU A CD    1 
ATOM   1224  O  OE1   . GLU E 3 53  ? 110.181 -69.146 31.717  1.00 49.92  ? 349 GLU A OE1   1 
ATOM   1225  O  OE2   . GLU E 3 53  ? 109.334 -70.824 30.585  1.00 50.66  ? 349 GLU A OE2   1 
ATOM   1226  N  N     . THR E 3 54  ? 114.068 -71.349 30.868  1.00 51.32  ? 350 THR A N     1 
ATOM   1227  C  CA    . THR E 3 54  ? 114.895 -72.323 30.167  1.00 51.45  ? 350 THR A CA    1 
ATOM   1228  C  C     . THR E 3 54  ? 116.334 -71.827 30.090  1.00 51.32  ? 350 THR A C     1 
ATOM   1229  O  O     . THR E 3 54  ? 117.248 -72.440 30.642  1.00 51.27  ? 350 THR A O     1 
ATOM   1230  C  CB    . THR E 3 54  ? 114.404 -72.556 28.729  1.00 51.48  ? 350 THR A CB    1 
ATOM   1231  O  OG1   . THR E 3 54  ? 112.973 -72.604 28.704  1.00 51.86  ? 350 THR A OG1   1 
ATOM   1232  C  CG2   . THR E 3 54  ? 114.981 -73.849 28.181  1.00 51.31  ? 350 THR A CG2   1 
ATOM   1233  N  N     . ALA E 3 55  ? 116.516 -70.700 29.412  1.00 51.33  ? 351 ALA A N     1 
ATOM   1234  C  CA    . ALA E 3 55  ? 117.843 -70.136 29.170  1.00 51.55  ? 351 ALA A CA    1 
ATOM   1235  C  C     . ALA E 3 55  ? 118.643 -69.752 30.425  1.00 51.57  ? 351 ALA A C     1 
ATOM   1236  O  O     . ALA E 3 55  ? 119.859 -69.952 30.476  1.00 51.65  ? 351 ALA A O     1 
ATOM   1237  C  CB    . ALA E 3 55  ? 117.742 -68.947 28.215  1.00 51.43  ? 351 ALA A CB    1 
ATOM   1238  N  N     . LEU E 3 56  ? 117.970 -69.209 31.433  1.00 51.48  ? 352 LEU A N     1 
ATOM   1239  C  CA    . LEU E 3 56  ? 118.673 -68.752 32.631  1.00 51.49  ? 352 LEU A CA    1 
ATOM   1240  C  C     . LEU E 3 56  ? 119.019 -69.877 33.611  1.00 51.50  ? 352 LEU A C     1 
ATOM   1241  O  O     . LEU E 3 56  ? 119.787 -69.679 34.554  1.00 51.50  ? 352 LEU A O     1 
ATOM   1242  C  CB    . LEU E 3 56  ? 117.897 -67.621 33.316  1.00 51.48  ? 352 LEU A CB    1 
ATOM   1243  C  CG    . LEU E 3 56  ? 117.627 -66.404 32.422  1.00 51.41  ? 352 LEU A CG    1 
ATOM   1244  C  CD1   . LEU E 3 56  ? 116.777 -65.368 33.129  1.00 51.51  ? 352 LEU A CD1   1 
ATOM   1245  C  CD2   . LEU E 3 56  ? 118.929 -65.787 31.943  1.00 51.63  ? 352 LEU A CD2   1 
ATOM   1246  N  N     . ALA E 3 57  ? 118.459 -71.060 33.378  1.00 51.49  ? 353 ALA A N     1 
ATOM   1247  C  CA    . ALA E 3 57  ? 118.774 -72.226 34.194  1.00 51.47  ? 353 ALA A CA    1 
ATOM   1248  C  C     . ALA E 3 57  ? 119.850 -73.086 33.512  1.00 51.47  ? 353 ALA A C     1 
ATOM   1249  O  O     . ALA E 3 57  ? 120.666 -73.723 34.186  1.00 51.50  ? 353 ALA A O     1 
ATOM   1250  C  CB    . ALA E 3 57  ? 117.515 -73.042 34.474  1.00 51.56  ? 353 ALA A CB    1 
ATOM   1251  N  N     . ASP E 3 58  ? 119.840 -73.091 32.177  1.00 51.28  ? 354 ASP A N     1 
ATOM   1252  C  CA    . ASP E 3 58  ? 120.826 -73.816 31.377  1.00 51.10  ? 354 ASP A CA    1 
ATOM   1253  C  C     . ASP E 3 58  ? 122.196 -73.202 31.614  1.00 50.96  ? 354 ASP A C     1 
ATOM   1254  O  O     . ASP E 3 58  ? 122.447 -72.075 31.177  1.00 51.11  ? 354 ASP A O     1 
ATOM   1255  C  CB    . ASP E 3 58  ? 120.468 -73.726 29.891  1.00 51.18  ? 354 ASP A CB    1 
ATOM   1256  C  CG    . ASP E 3 58  ? 121.285 -74.674 29.030  1.00 51.25  ? 354 ASP A CG    1 
ATOM   1257  O  OD1   . ASP E 3 58  ? 120.695 -75.299 28.123  1.00 51.63  ? 354 ASP A OD1   1 
ATOM   1258  O  OD2   . ASP E 3 58  ? 122.506 -74.813 29.263  1.00 51.12  ? 354 ASP A OD2   1 
ATOM   1259  N  N     . PRO E 3 59  ? 123.100 -73.956 32.272  1.00 50.72  ? 355 PRO A N     1 
ATOM   1260  C  CA    . PRO E 3 59  ? 124.405 -73.444 32.701  1.00 50.54  ? 355 PRO A CA    1 
ATOM   1261  C  C     . PRO E 3 59  ? 125.303 -72.983 31.556  1.00 50.59  ? 355 PRO A C     1 
ATOM   1262  O  O     . PRO E 3 59  ? 126.206 -72.170 31.778  1.00 50.72  ? 355 PRO A O     1 
ATOM   1263  C  CB    . PRO E 3 59  ? 125.035 -74.640 33.426  1.00 50.44  ? 355 PRO A CB    1 
ATOM   1264  C  CG    . PRO E 3 59  ? 124.331 -75.824 32.902  1.00 50.36  ? 355 PRO A CG    1 
ATOM   1265  C  CD    . PRO E 3 59  ? 122.933 -75.378 32.621  1.00 50.57  ? 355 PRO A CD    1 
ATOM   1266  N  N     . GLN E 3 60  ? 125.056 -73.499 30.353  1.00 50.36  ? 356 GLN A N     1 
ATOM   1267  C  CA    . GLN E 3 60  ? 125.856 -73.154 29.182  1.00 50.27  ? 356 GLN A CA    1 
ATOM   1268  C  C     . GLN E 3 60  ? 125.503 -71.768 28.670  1.00 49.65  ? 356 GLN A C     1 
ATOM   1269  O  O     . GLN E 3 60  ? 126.360 -71.039 28.168  1.00 49.76  ? 356 GLN A O     1 
ATOM   1270  C  CB    . GLN E 3 60  ? 125.663 -74.186 28.066  1.00 50.40  ? 356 GLN A CB    1 
ATOM   1271  C  CG    . GLN E 3 60  ? 126.222 -75.571 28.377  1.00 51.00  ? 356 GLN A CG    1 
ATOM   1272  C  CD    . GLN E 3 60  ? 126.198 -76.498 27.165  1.00 51.30  ? 356 GLN A CD    1 
ATOM   1273  O  OE1   . GLN E 3 60  ? 125.300 -76.418 26.314  1.00 52.46  ? 356 GLN A OE1   1 
ATOM   1274  N  NE2   . GLN E 3 60  ? 127.188 -77.387 27.082  1.00 51.94  ? 356 GLN A NE2   1 
ATOM   1275  N  N     . PHE E 3 61  ? 124.232 -71.409 28.793  1.00 48.94  ? 357 PHE A N     1 
ATOM   1276  C  CA    . PHE E 3 61  ? 123.780 -70.099 28.365  1.00 48.18  ? 357 PHE A CA    1 
ATOM   1277  C  C     . PHE E 3 61  ? 124.352 -69.069 29.333  1.00 47.59  ? 357 PHE A C     1 
ATOM   1278  O  O     . PHE E 3 61  ? 124.893 -68.040 28.931  1.00 47.43  ? 357 PHE A O     1 
ATOM   1279  C  CB    . PHE E 3 61  ? 122.249 -70.053 28.347  1.00 48.28  ? 357 PHE A CB    1 
ATOM   1280  C  CG    . PHE E 3 61  ? 121.683 -68.859 27.632  1.00 48.14  ? 357 PHE A CG    1 
ATOM   1281  C  CD1   . PHE E 3 61  ? 121.487 -68.886 26.263  1.00 47.99  ? 357 PHE A CD1   1 
ATOM   1282  C  CD2   . PHE E 3 61  ? 121.339 -67.712 28.328  1.00 48.12  ? 357 PHE A CD2   1 
ATOM   1283  C  CE1   . PHE E 3 61  ? 120.968 -67.791 25.600  1.00 48.27  ? 357 PHE A CE1   1 
ATOM   1284  C  CE2   . PHE E 3 61  ? 120.817 -66.615 27.670  1.00 48.19  ? 357 PHE A CE2   1 
ATOM   1285  C  CZ    . PHE E 3 61  ? 120.633 -66.655 26.303  1.00 48.48  ? 357 PHE A CZ    1 
ATOM   1286  N  N     . VAL E 3 62  ? 124.248 -69.382 30.618  1.00 46.89  ? 358 VAL A N     1 
ATOM   1287  C  CA    . VAL E 3 62  ? 124.754 -68.527 31.677  1.00 46.17  ? 358 VAL A CA    1 
ATOM   1288  C  C     . VAL E 3 62  ? 126.260 -68.343 31.513  1.00 45.91  ? 358 VAL A C     1 
ATOM   1289  O  O     . VAL E 3 62  ? 126.795 -67.263 31.763  1.00 45.86  ? 358 VAL A O     1 
ATOM   1290  C  CB    . VAL E 3 62  ? 124.421 -69.139 33.057  1.00 46.01  ? 358 VAL A CB    1 
ATOM   1291  C  CG1   . VAL E 3 62  ? 125.042 -68.339 34.186  1.00 45.83  ? 358 VAL A CG1   1 
ATOM   1292  C  CG2   . VAL E 3 62  ? 122.915 -69.243 33.232  1.00 45.65  ? 358 VAL A CG2   1 
ATOM   1293  N  N     . ALA E 3 63  ? 126.932 -69.403 31.069  1.00 45.66  ? 359 ALA A N     1 
ATOM   1294  C  CA    . ALA E 3 63  ? 128.381 -69.377 30.867  1.00 45.35  ? 359 ALA A CA    1 
ATOM   1295  C  C     . ALA E 3 63  ? 128.751 -68.549 29.642  1.00 45.00  ? 359 ALA A C     1 
ATOM   1296  O  O     . ALA E 3 63  ? 129.811 -67.920 29.601  1.00 44.90  ? 359 ALA A O     1 
ATOM   1297  C  CB    . ALA E 3 63  ? 128.928 -70.791 30.739  1.00 45.35  ? 359 ALA A CB    1 
ATOM   1298  N  N     . TRP E 3 64  ? 127.871 -68.564 28.645  1.00 44.63  ? 360 TRP A N     1 
ATOM   1299  C  CA    . TRP E 3 64  ? 128.063 -67.777 27.427  1.00 44.23  ? 360 TRP A CA    1 
ATOM   1300  C  C     . TRP E 3 64  ? 127.824 -66.285 27.717  1.00 43.64  ? 360 TRP A C     1 
ATOM   1301  O  O     . TRP E 3 64  ? 128.575 -65.432 27.256  1.00 43.61  ? 360 TRP A O     1 
ATOM   1302  C  CB    . TRP E 3 64  ? 127.153 -68.300 26.309  1.00 44.24  ? 360 TRP A CB    1 
ATOM   1303  C  CG    . TRP E 3 64  ? 127.160 -67.473 25.053  1.00 44.89  ? 360 TRP A CG    1 
ATOM   1304  C  CD1   . TRP E 3 64  ? 128.039 -67.564 24.012  1.00 44.57  ? 360 TRP A CD1   1 
ATOM   1305  C  CD2   . TRP E 3 64  ? 126.228 -66.436 24.701  1.00 45.44  ? 360 TRP A CD2   1 
ATOM   1306  N  NE1   . TRP E 3 64  ? 127.721 -66.643 23.043  1.00 44.52  ? 360 TRP A NE1   1 
ATOM   1307  C  CE2   . TRP E 3 64  ? 126.614 -65.940 23.441  1.00 44.59  ? 360 TRP A CE2   1 
ATOM   1308  C  CE3   . TRP E 3 64  ? 125.108 -65.877 25.336  1.00 45.23  ? 360 TRP A CE3   1 
ATOM   1309  C  CZ2   . TRP E 3 64  ? 125.919 -64.918 22.799  1.00 44.47  ? 360 TRP A CZ2   1 
ATOM   1310  C  CZ3   . TRP E 3 64  ? 124.423 -64.863 24.697  1.00 44.42  ? 360 TRP A CZ3   1 
ATOM   1311  C  CH2   . TRP E 3 64  ? 124.828 -64.396 23.440  1.00 44.47  ? 360 TRP A CH2   1 
ATOM   1312  N  N     . LEU E 3 65  ? 126.794 -65.980 28.500  1.00 42.89  ? 361 LEU A N     1 
ATOM   1313  C  CA    . LEU E 3 65  ? 126.531 -64.606 28.903  1.00 42.20  ? 361 LEU A CA    1 
ATOM   1314  C  C     . LEU E 3 65  ? 127.709 -64.034 29.706  1.00 42.10  ? 361 LEU A C     1 
ATOM   1315  O  O     . LEU E 3 65  ? 128.080 -62.866 29.538  1.00 41.75  ? 361 LEU A O     1 
ATOM   1316  C  CB    . LEU E 3 65  ? 125.258 -64.535 29.743  1.00 41.96  ? 361 LEU A CB    1 
ATOM   1317  C  CG    . LEU E 3 65  ? 123.917 -64.923 29.121  1.00 41.16  ? 361 LEU A CG    1 
ATOM   1318  C  CD1   . LEU E 3 65  ? 122.904 -65.108 30.216  1.00 40.20  ? 361 LEU A CD1   1 
ATOM   1319  C  CD2   . LEU E 3 65  ? 123.439 -63.889 28.126  1.00 40.54  ? 361 LEU A CD2   1 
ATOM   1320  N  N     . GLY E 3 66  ? 128.298 -64.872 30.560  1.00 41.90  ? 362 GLY A N     1 
ATOM   1321  C  CA    . GLY E 3 66  ? 129.389 -64.459 31.438  1.00 41.87  ? 362 GLY A CA    1 
ATOM   1322  C  C     . GLY E 3 66  ? 130.766 -64.379 30.802  1.00 41.96  ? 362 GLY A C     1 
ATOM   1323  O  O     . GLY E 3 66  ? 131.691 -63.807 31.383  1.00 41.87  ? 362 GLY A O     1 
ATOM   1324  N  N     . ASP E 3 67  ? 130.901 -64.943 29.605  1.00 42.07  ? 363 ASP A N     1 
ATOM   1325  C  CA    . ASP E 3 67  ? 132.178 -64.975 28.884  1.00 42.24  ? 363 ASP A CA    1 
ATOM   1326  C  C     . ASP E 3 67  ? 132.387 -63.704 28.046  1.00 42.25  ? 363 ASP A C     1 
ATOM   1327  O  O     . ASP E 3 67  ? 131.681 -63.481 27.057  1.00 42.40  ? 363 ASP A O     1 
ATOM   1328  C  CB    . ASP E 3 67  ? 132.225 -66.229 27.992  1.00 42.24  ? 363 ASP A CB    1 
ATOM   1329  C  CG    . ASP E 3 67  ? 133.595 -66.463 27.344  1.00 42.57  ? 363 ASP A CG    1 
ATOM   1330  O  OD1   . ASP E 3 67  ? 134.475 -65.573 27.395  1.00 41.82  ? 363 ASP A OD1   1 
ATOM   1331  O  OD2   . ASP E 3 67  ? 133.787 -67.557 26.766  1.00 43.34  ? 363 ASP A OD2   1 
ATOM   1332  N  N     . GLU E 3 68  ? 133.369 -62.886 28.419  1.00 42.03  ? 364 GLU A N     1 
ATOM   1333  C  CA    . GLU E 3 68  ? 133.609 -61.635 27.702  1.00 41.99  ? 364 GLU A CA    1 
ATOM   1334  C  C     . GLU E 3 68  ? 134.317 -61.802 26.351  1.00 41.56  ? 364 GLU A C     1 
ATOM   1335  O  O     . GLU E 3 68  ? 134.650 -60.813 25.704  1.00 41.67  ? 364 GLU A O     1 
ATOM   1336  C  CB    . GLU E 3 68  ? 134.358 -60.625 28.568  1.00 42.07  ? 364 GLU A CB    1 
ATOM   1337  C  CG    . GLU E 3 68  ? 135.783 -61.031 28.889  1.00 44.15  ? 364 GLU A CG    1 
ATOM   1338  C  CD    . GLU E 3 68  ? 136.662 -59.842 29.264  1.00 46.81  ? 364 GLU A CD    1 
ATOM   1339  O  OE1   . GLU E 3 68  ? 136.183 -58.686 29.216  1.00 47.83  ? 364 GLU A OE1   1 
ATOM   1340  O  OE2   . GLU E 3 68  ? 137.844 -60.063 29.598  1.00 48.04  ? 364 GLU A OE2   1 
ATOM   1341  N  N     . THR E 3 69  ? 134.557 -63.039 25.930  1.00 41.01  ? 365 THR A N     1 
ATOM   1342  C  CA    . THR E 3 69  ? 135.120 -63.280 24.603  1.00 40.40  ? 365 THR A CA    1 
ATOM   1343  C  C     . THR E 3 69  ? 133.981 -63.575 23.645  1.00 40.00  ? 365 THR A C     1 
ATOM   1344  O  O     . THR E 3 69  ? 134.170 -63.636 22.433  1.00 40.03  ? 365 THR A O     1 
ATOM   1345  C  CB    . THR E 3 69  ? 136.122 -64.443 24.576  1.00 40.33  ? 365 THR A CB    1 
ATOM   1346  O  OG1   . THR E 3 69  ? 135.556 -65.563 25.259  1.00 40.71  ? 365 THR A OG1   1 
ATOM   1347  C  CG2   . THR E 3 69  ? 137.430 -64.051 25.248  1.00 40.07  ? 365 THR A CG2   1 
ATOM   1348  N  N     . LYS E 3 70  ? 132.796 -63.783 24.200  1.00 39.54  ? 366 LYS A N     1 
ATOM   1349  C  CA    . LYS E 3 70  ? 131.597 -63.936 23.388  1.00 39.23  ? 366 LYS A CA    1 
ATOM   1350  C  C     . LYS E 3 70  ? 130.938 -62.557 23.347  1.00 38.54  ? 366 LYS A C     1 
ATOM   1351  O  O     . LYS E 3 70  ? 130.292 -62.140 24.306  1.00 38.47  ? 366 LYS A O     1 
ATOM   1352  C  CB    . LYS E 3 70  ? 130.670 -64.996 23.984  1.00 39.49  ? 366 LYS A CB    1 
ATOM   1353  C  CG    . LYS E 3 70  ? 131.338 -66.368 24.194  1.00 40.10  ? 366 LYS A CG    1 
ATOM   1354  C  CD    . LYS E 3 70  ? 131.673 -67.062 22.869  1.00 40.98  ? 366 LYS A CD    1 
ATOM   1355  C  CE    . LYS E 3 70  ? 132.138 -68.509 23.082  1.00 40.77  ? 366 LYS A CE    1 
ATOM   1356  N  NZ    . LYS E 3 70  ? 132.332 -69.244 21.792  1.00 40.76  ? 366 LYS A NZ    1 
ATOM   1357  N  N     . LYS E 3 71  ? 131.133 -61.847 22.239  1.00 37.74  ? 367 LYS A N     1 
ATOM   1358  C  CA    . LYS E 3 71  ? 130.728 -60.443 22.117  1.00 36.89  ? 367 LYS A CA    1 
ATOM   1359  C  C     . LYS E 3 71  ? 129.249 -60.194 21.839  1.00 36.40  ? 367 LYS A C     1 
ATOM   1360  O  O     . LYS E 3 71  ? 128.695 -60.702 20.865  1.00 36.11  ? 367 LYS A O     1 
ATOM   1361  C  CB    . LYS E 3 71  ? 131.581 -59.752 21.056  1.00 36.89  ? 367 LYS A CB    1 
ATOM   1362  C  CG    . LYS E 3 71  ? 133.070 -59.791 21.347  1.00 36.78  ? 367 LYS A CG    1 
ATOM   1363  C  CD    . LYS E 3 71  ? 133.390 -59.123 22.674  1.00 36.66  ? 367 LYS A CD    1 
ATOM   1364  C  CE    . LYS E 3 71  ? 134.875 -59.158 22.942  1.00 36.54  ? 367 LYS A CE    1 
ATOM   1365  N  NZ    . LYS E 3 71  ? 135.212 -58.491 24.223  1.00 36.48  ? 367 LYS A NZ    1 
ATOM   1366  N  N     . LYS E 3 72  ? 128.628 -59.379 22.691  1.00 35.93  ? 368 LYS A N     1 
ATOM   1367  C  CA    . LYS E 3 72  ? 127.202 -59.063 22.556  1.00 35.34  ? 368 LYS A CA    1 
ATOM   1368  C  C     . LYS E 3 72  ? 126.902 -57.640 22.107  1.00 34.86  ? 368 LYS A C     1 
ATOM   1369  O  O     . LYS E 3 72  ? 127.537 -56.677 22.548  1.00 34.82  ? 368 LYS A O     1 
ATOM   1370  C  CB    . LYS E 3 72  ? 126.438 -59.323 23.859  1.00 35.18  ? 368 LYS A CB    1 
ATOM   1371  C  CG    . LYS E 3 72  ? 126.371 -60.773 24.296  1.00 35.12  ? 368 LYS A CG    1 
ATOM   1372  C  CD    . LYS E 3 72  ? 127.566 -61.149 25.146  1.00 35.20  ? 368 LYS A CD    1 
ATOM   1373  C  CE    . LYS E 3 72  ? 127.407 -62.523 25.768  1.00 34.88  ? 368 LYS A CE    1 
ATOM   1374  N  NZ    . LYS E 3 72  ? 128.607 -62.843 26.594  1.00 36.11  ? 368 LYS A NZ    1 
ATOM   1375  N  N     . SER E 3 73  ? 125.908 -57.524 21.235  1.00 34.15  ? 369 SER A N     1 
ATOM   1376  C  CA    . SER E 3 73  ? 125.405 -56.228 20.821  1.00 33.63  ? 369 SER A CA    1 
ATOM   1377  C  C     . SER E 3 73  ? 124.010 -56.078 21.417  1.00 33.15  ? 369 SER A C     1 
ATOM   1378  O  O     . SER E 3 73  ? 123.168 -56.973 21.286  1.00 32.74  ? 369 SER A O     1 
ATOM   1379  C  CB    . SER E 3 73  ? 125.379 -56.122 19.302  1.00 33.68  ? 369 SER A CB    1 
ATOM   1380  O  OG    . SER E 3 73  ? 126.698 -56.180 18.791  1.00 34.17  ? 369 SER A OG    1 
ATOM   1381  N  N     . MET E 3 74  ? 123.768 -54.960 22.095  1.00 32.51  ? 370 MET A N     1 
ATOM   1382  C  CA    . MET E 3 74  ? 122.511 -54.802 22.812  1.00 32.21  ? 370 MET A CA    1 
ATOM   1383  C  C     . MET E 3 74  ? 121.951 -53.392 22.771  1.00 32.05  ? 370 MET A C     1 
ATOM   1384  O  O     . MET E 3 74  ? 122.636 -52.453 22.367  1.00 31.94  ? 370 MET A O     1 
ATOM   1385  C  CB    . MET E 3 74  ? 122.694 -55.198 24.281  1.00 32.15  ? 370 MET A CB    1 
ATOM   1386  C  CG    . MET E 3 74  ? 123.408 -56.516 24.497  1.00 31.66  ? 370 MET A CG    1 
ATOM   1387  S  SD    . MET E 3 74  ? 123.272 -57.082 26.192  1.00 31.95  ? 370 MET A SD    1 
ATOM   1388  C  CE    . MET E 3 74  ? 121.494 -57.366 26.287  1.00 31.25  ? 370 MET A CE    1 
ATOM   1389  N  N     . PHE E 3 75  ? 120.694 -53.269 23.192  1.00 31.68  ? 371 PHE A N     1 
ATOM   1390  C  CA    . PHE E 3 75  ? 120.054 -51.980 23.372  1.00 31.54  ? 371 PHE A CA    1 
ATOM   1391  C  C     . PHE E 3 75  ? 119.796 -51.818 24.866  1.00 31.54  ? 371 PHE A C     1 
ATOM   1392  O  O     . PHE E 3 75  ? 118.998 -52.557 25.438  1.00 31.39  ? 371 PHE A O     1 
ATOM   1393  C  CB    . PHE E 3 75  ? 118.738 -51.911 22.592  1.00 31.37  ? 371 PHE A CB    1 
ATOM   1394  C  CG    . PHE E 3 75  ? 118.041 -50.577 22.693  1.00 31.28  ? 371 PHE A CG    1 
ATOM   1395  C  CD1   . PHE E 3 75  ? 118.224 -49.610 21.716  1.00 30.55  ? 371 PHE A CD1   1 
ATOM   1396  C  CD2   . PHE E 3 75  ? 117.210 -50.283 23.775  1.00 30.96  ? 371 PHE A CD2   1 
ATOM   1397  C  CE1   . PHE E 3 75  ? 117.586 -48.378 21.810  1.00 30.30  ? 371 PHE A CE1   1 
ATOM   1398  C  CE2   . PHE E 3 75  ? 116.570 -49.050 23.873  1.00 30.29  ? 371 PHE A CE2   1 
ATOM   1399  C  CZ    . PHE E 3 75  ? 116.762 -48.098 22.892  1.00 30.45  ? 371 PHE A CZ    1 
ATOM   1400  N  N     . ASP E 3 76  ? 120.465 -50.851 25.490  1.00 31.72  ? 372 ASP A N     1 
ATOM   1401  C  CA    . ASP E 3 76  ? 120.352 -50.624 26.942  1.00 31.74  ? 372 ASP A CA    1 
ATOM   1402  C  C     . ASP E 3 76  ? 120.844 -51.865 27.701  1.00 31.37  ? 372 ASP A C     1 
ATOM   1403  O  O     . ASP E 3 76  ? 120.051 -52.653 28.235  1.00 31.36  ? 372 ASP A O     1 
ATOM   1404  C  CB    . ASP E 3 76  ? 118.912 -50.242 27.349  1.00 31.84  ? 372 ASP A CB    1 
ATOM   1405  C  CG    . ASP E 3 76  ? 118.810 -49.738 28.791  1.00 32.49  ? 372 ASP A CG    1 
ATOM   1406  O  OD1   . ASP E 3 76  ? 119.860 -49.497 29.427  1.00 32.93  ? 372 ASP A OD1   1 
ATOM   1407  O  OD2   . ASP E 3 76  ? 117.672 -49.574 29.291  1.00 33.18  ? 372 ASP A OD2   1 
ATOM   1408  N  N     . SER E 3 77  ? 122.163 -52.023 27.736  1.00 30.97  ? 373 SER A N     1 
ATOM   1409  C  CA    . SER E 3 77  ? 122.785 -53.176 28.380  1.00 30.59  ? 373 SER A CA    1 
ATOM   1410  C  C     . SER E 3 77  ? 122.849 -53.050 29.900  1.00 30.14  ? 373 SER A C     1 
ATOM   1411  O  O     . SER E 3 77  ? 123.004 -54.050 30.604  1.00 30.08  ? 373 SER A O     1 
ATOM   1412  C  CB    . SER E 3 77  ? 124.178 -53.433 27.799  1.00 30.44  ? 373 SER A CB    1 
ATOM   1413  O  OG    . SER E 3 77  ? 125.038 -52.345 28.068  1.00 30.80  ? 373 SER A OG    1 
ATOM   1414  N  N     . LYS E 3 78  ? 122.726 -51.829 30.406  1.00 29.79  ? 374 LYS A N     1 
ATOM   1415  C  CA    . LYS E 3 78  ? 122.699 -51.625 31.852  1.00 29.74  ? 374 LYS A CA    1 
ATOM   1416  C  C     . LYS E 3 78  ? 121.430 -52.266 32.444  1.00 29.88  ? 374 LYS A C     1 
ATOM   1417  O  O     . LYS E 3 78  ? 121.488 -52.915 33.494  1.00 29.69  ? 374 LYS A O     1 
ATOM   1418  C  CB    . LYS E 3 78  ? 122.836 -50.135 32.204  1.00 29.59  ? 374 LYS A CB    1 
ATOM   1419  C  CG    . LYS E 3 78  ? 122.705 -49.819 33.692  1.00 29.75  ? 374 LYS A CG    1 
ATOM   1420  C  CD    . LYS E 3 78  ? 123.263 -48.433 34.081  1.00 29.26  ? 374 LYS A CD    1 
ATOM   1421  C  CE    . LYS E 3 78  ? 122.515 -47.287 33.426  1.00 27.21  ? 374 LYS A CE    1 
ATOM   1422  N  NZ    . LYS E 3 78  ? 121.067 -47.265 33.772  1.00 27.30  ? 374 LYS A NZ    1 
ATOM   1423  N  N     . ARG E 3 79  ? 120.304 -52.113 31.738  1.00 29.87  ? 375 ARG A N     1 
ATOM   1424  C  CA    . ARG E 3 79  ? 119.030 -52.710 32.143  1.00 29.87  ? 375 ARG A CA    1 
ATOM   1425  C  C     . ARG E 3 79  ? 119.142 -54.220 32.237  1.00 30.29  ? 375 ARG A C     1 
ATOM   1426  O  O     . ARG E 3 79  ? 118.651 -54.840 33.183  1.00 30.27  ? 375 ARG A O     1 
ATOM   1427  C  CB    . ARG E 3 79  ? 117.929 -52.358 31.147  1.00 29.61  ? 375 ARG A CB    1 
ATOM   1428  C  CG    . ARG E 3 79  ? 116.698 -53.265 31.223  1.00 29.19  ? 375 ARG A CG    1 
ATOM   1429  C  CD    . ARG E 3 79  ? 115.608 -52.794 30.277  1.00 29.67  ? 375 ARG A CD    1 
ATOM   1430  N  NE    . ARG E 3 79  ? 115.238 -51.422 30.605  1.00 29.84  ? 375 ARG A NE    1 
ATOM   1431  C  CZ    . ARG E 3 79  ? 114.136 -51.077 31.256  1.00 29.71  ? 375 ARG A CZ    1 
ATOM   1432  N  NH1   . ARG E 3 79  ? 113.253 -52.001 31.611  1.00 29.88  ? 375 ARG A NH1   1 
ATOM   1433  N  NH2   . ARG E 3 79  ? 113.909 -49.803 31.528  1.00 29.98  ? 375 ARG A NH2   1 
ATOM   1434  N  N     . ALA E 3 80  ? 119.776 -54.808 31.233  1.00 30.59  ? 376 ALA A N     1 
ATOM   1435  C  CA    . ALA E 3 80  ? 119.943 -56.244 31.179  1.00 30.95  ? 376 ALA A CA    1 
ATOM   1436  C  C     . ALA E 3 80  ? 120.839 -56.741 32.325  1.00 31.13  ? 376 ALA A C     1 
ATOM   1437  O  O     . ALA E 3 80  ? 120.428 -57.592 33.107  1.00 30.99  ? 376 ALA A O     1 
ATOM   1438  C  CB    . ALA E 3 80  ? 120.507 -56.650 29.824  1.00 30.84  ? 376 ALA A CB    1 
ATOM   1439  N  N     . ALA E 3 81  ? 122.047 -56.190 32.424  1.00 31.30  ? 377 ALA A N     1 
ATOM   1440  C  CA    . ALA E 3 81  ? 123.004 -56.591 33.449  1.00 31.51  ? 377 ALA A CA    1 
ATOM   1441  C  C     . ALA E 3 81  ? 122.403 -56.541 34.853  1.00 31.94  ? 377 ALA A C     1 
ATOM   1442  O  O     . ALA E 3 81  ? 122.540 -57.491 35.637  1.00 31.99  ? 377 ALA A O     1 
ATOM   1443  C  CB    . ALA E 3 81  ? 124.250 -55.715 33.379  1.00 31.40  ? 377 ALA A CB    1 
ATOM   1444  N  N     . VAL E 3 82  ? 121.733 -55.432 35.163  1.00 32.24  ? 378 VAL A N     1 
ATOM   1445  C  CA    . VAL E 3 82  ? 121.149 -55.235 36.487  1.00 32.34  ? 378 VAL A CA    1 
ATOM   1446  C  C     . VAL E 3 82  ? 120.032 -56.236 36.768  1.00 32.39  ? 378 VAL A C     1 
ATOM   1447  O  O     . VAL E 3 82  ? 120.046 -56.908 37.800  1.00 32.07  ? 378 VAL A O     1 
ATOM   1448  C  CB    . VAL E 3 82  ? 120.675 -53.783 36.697  1.00 32.20  ? 378 VAL A CB    1 
ATOM   1449  C  CG1   . VAL E 3 82  ? 120.000 -53.633 38.044  1.00 31.97  ? 378 VAL A CG1   1 
ATOM   1450  C  CG2   . VAL E 3 82  ? 121.859 -52.845 36.618  1.00 32.32  ? 378 VAL A CG2   1 
ATOM   1451  N  N     . ALA E 3 83  ? 119.094 -56.353 35.833  1.00 32.60  ? 379 ALA A N     1 
ATOM   1452  C  CA    . ALA E 3 83  ? 118.016 -57.326 35.937  1.00 33.01  ? 379 ALA A CA    1 
ATOM   1453  C  C     . ALA E 3 83  ? 118.566 -58.754 36.002  1.00 33.51  ? 379 ALA A C     1 
ATOM   1454  O  O     . ALA E 3 83  ? 117.857 -59.668 36.413  1.00 33.97  ? 379 ALA A O     1 
ATOM   1455  C  CB    . ALA E 3 83  ? 117.075 -57.185 34.783  1.00 32.72  ? 379 ALA A CB    1 
ATOM   1456  N  N     . LEU E 3 84  ? 119.826 -58.937 35.602  1.00 33.72  ? 380 LEU A N     1 
ATOM   1457  C  CA    . LEU E 3 84  ? 120.484 -60.236 35.678  1.00 33.94  ? 380 LEU A CA    1 
ATOM   1458  C  C     . LEU E 3 84  ? 121.219 -60.432 37.006  1.00 34.35  ? 380 LEU A C     1 
ATOM   1459  O  O     . LEU E 3 84  ? 121.294 -61.560 37.517  1.00 34.56  ? 380 LEU A O     1 
ATOM   1460  C  CB    . LEU E 3 84  ? 121.431 -60.469 34.489  1.00 33.63  ? 380 LEU A CB    1 
ATOM   1461  C  CG    . LEU E 3 84  ? 120.802 -60.890 33.155  1.00 33.47  ? 380 LEU A CG    1 
ATOM   1462  C  CD1   . LEU E 3 84  ? 121.821 -60.885 32.001  1.00 32.12  ? 380 LEU A CD1   1 
ATOM   1463  C  CD2   . LEU E 3 84  ? 120.109 -62.252 33.272  1.00 32.73  ? 380 LEU A CD2   1 
ATOM   1464  N  N     . LYS E 3 85  ? 121.766 -59.348 37.559  1.00 34.65  ? 381 LYS A N     1 
ATOM   1465  C  CA    . LYS E 3 85  ? 122.426 -59.422 38.864  1.00 34.97  ? 381 LYS A CA    1 
ATOM   1466  C  C     . LYS E 3 85  ? 121.391 -59.776 39.930  1.00 35.42  ? 381 LYS A C     1 
ATOM   1467  O  O     . LYS E 3 85  ? 121.729 -60.357 40.951  1.00 35.66  ? 381 LYS A O     1 
ATOM   1468  C  CB    . LYS E 3 85  ? 123.108 -58.099 39.233  1.00 34.94  ? 381 LYS A CB    1 
ATOM   1469  C  CG    . LYS E 3 85  ? 124.318 -57.687 38.402  1.00 34.89  ? 381 LYS A CG    1 
ATOM   1470  C  CD    . LYS E 3 85  ? 124.749 -56.269 38.791  1.00 34.52  ? 381 LYS A CD    1 
ATOM   1471  C  CE    . LYS E 3 85  ? 125.773 -55.662 37.841  1.00 33.98  ? 381 LYS A CE    1 
ATOM   1472  N  NZ    . LYS E 3 85  ? 127.183 -56.048 38.140  1.00 34.23  ? 381 LYS A NZ    1 
ATOM   1473  N  N     . TRP E 3 86  ? 120.133 -59.408 39.688  1.00 36.04  ? 382 TRP A N     1 
ATOM   1474  C  CA    . TRP E 3 86  ? 119.033 -59.700 40.614  1.00 36.82  ? 382 TRP A CA    1 
ATOM   1475  C  C     . TRP E 3 86  ? 118.563 -61.138 40.457  1.00 37.21  ? 382 TRP A C     1 
ATOM   1476  O  O     . TRP E 3 86  ? 117.824 -61.666 41.302  1.00 37.32  ? 382 TRP A O     1 
ATOM   1477  C  CB    . TRP E 3 86  ? 117.863 -58.728 40.425  1.00 36.86  ? 382 TRP A CB    1 
ATOM   1478  C  CG    . TRP E 3 86  ? 118.145 -57.360 40.968  1.00 37.31  ? 382 TRP A CG    1 
ATOM   1479  C  CD1   . TRP E 3 86  ? 118.562 -56.270 40.265  1.00 37.66  ? 382 TRP A CD1   1 
ATOM   1480  C  CD2   . TRP E 3 86  ? 118.035 -56.935 42.335  1.00 38.27  ? 382 TRP A CD2   1 
ATOM   1481  N  NE1   . TRP E 3 86  ? 118.716 -55.190 41.102  1.00 37.78  ? 382 TRP A NE1   1 
ATOM   1482  C  CE2   . TRP E 3 86  ? 118.404 -55.569 42.378  1.00 37.51  ? 382 TRP A CE2   1 
ATOM   1483  C  CE3   . TRP E 3 86  ? 117.660 -57.573 43.526  1.00 37.73  ? 382 TRP A CE3   1 
ATOM   1484  C  CZ2   . TRP E 3 86  ? 118.413 -54.833 43.561  1.00 36.84  ? 382 TRP A CZ2   1 
ATOM   1485  C  CZ3   . TRP E 3 86  ? 117.670 -56.837 44.702  1.00 37.55  ? 382 TRP A CZ3   1 
ATOM   1486  C  CH2   . TRP E 3 86  ? 118.045 -55.480 44.708  1.00 37.25  ? 382 TRP A CH2   1 
ATOM   1487  N  N     . LYS E 3 87  ? 118.994 -61.754 39.360  1.00 37.42  ? 383 LYS A N     1 
ATOM   1488  C  CA    . LYS E 3 87  ? 118.739 -63.155 39.099  1.00 37.52  ? 383 LYS A CA    1 
ATOM   1489  C  C     . LYS E 3 87  ? 120.005 -63.950 39.411  1.00 37.38  ? 383 LYS A C     1 
ATOM   1490  O  O     . LYS E 3 87  ? 120.073 -65.158 39.160  1.00 37.21  ? 383 LYS A O     1 
ATOM   1491  C  CB    . LYS E 3 87  ? 118.325 -63.363 37.645  1.00 37.78  ? 383 LYS A CB    1 
ATOM   1492  C  CG    . LYS E 3 87  ? 116.962 -62.795 37.295  1.00 38.86  ? 383 LYS A CG    1 
ATOM   1493  C  CD    . LYS E 3 87  ? 115.852 -63.519 38.029  1.00 39.84  ? 383 LYS A CD    1 
ATOM   1494  C  CE    . LYS E 3 87  ? 114.500 -63.066 37.529  1.00 40.54  ? 383 LYS A CE    1 
ATOM   1495  N  NZ    . LYS E 3 87  ? 113.416 -63.818 38.200  1.00 40.95  ? 383 LYS A NZ    1 
ATOM   1496  N  N     . GLY E 3 88  ? 121.001 -63.265 39.967  1.00 37.11  ? 384 GLY A N     1 
ATOM   1497  C  CA    . GLY E 3 88  ? 122.263 -63.898 40.317  1.00 37.02  ? 384 GLY A CA    1 
ATOM   1498  C  C     . GLY E 3 88  ? 123.001 -64.435 39.105  1.00 36.98  ? 384 GLY A C     1 
ATOM   1499  O  O     . GLY E 3 88  ? 123.508 -65.555 39.126  1.00 37.05  ? 384 GLY A O     1 
ATOM   1500  N  N     . ILE E 3 89  ? 123.037 -63.637 38.041  1.00 36.81  ? 385 ILE A N     1 
ATOM   1501  C  CA    . ILE E 3 89  ? 123.737 -63.990 36.802  1.00 36.39  ? 385 ILE A CA    1 
ATOM   1502  C  C     . ILE E 3 89  ? 124.573 -62.794 36.339  1.00 36.51  ? 385 ILE A C     1 
ATOM   1503  O  O     . ILE E 3 89  ? 124.081 -61.660 36.321  1.00 36.25  ? 385 ILE A O     1 
ATOM   1504  C  CB    . ILE E 3 89  ? 122.745 -64.406 35.691  1.00 36.31  ? 385 ILE A CB    1 
ATOM   1505  C  CG1   . ILE E 3 89  ? 122.139 -65.776 36.002  1.00 36.15  ? 385 ILE A CG1   1 
ATOM   1506  C  CG2   . ILE E 3 89  ? 123.430 -64.457 34.343  1.00 35.67  ? 385 ILE A CG2   1 
ATOM   1507  C  CD1   . ILE E 3 89  ? 121.138 -66.263 34.972  1.00 35.96  ? 385 ILE A CD1   1 
ATOM   1508  N  N     . GLU E 3 90  ? 125.833 -63.041 35.981  1.00 36.41  ? 386 GLU A N     1 
ATOM   1509  C  CA    . GLU E 3 90  ? 126.716 -61.960 35.525  1.00 36.85  ? 386 GLU A CA    1 
ATOM   1510  C  C     . GLU E 3 90  ? 126.797 -61.856 34.002  1.00 36.30  ? 386 GLU A C     1 
ATOM   1511  O  O     . GLU E 3 90  ? 126.974 -62.861 33.313  1.00 36.64  ? 386 GLU A O     1 
ATOM   1512  C  CB    . GLU E 3 90  ? 128.124 -62.111 36.104  1.00 36.71  ? 386 GLU A CB    1 
ATOM   1513  C  CG    . GLU E 3 90  ? 129.024 -60.898 35.843  1.00 38.00  ? 386 GLU A CG    1 
ATOM   1514  C  CD    . GLU E 3 90  ? 130.501 -61.160 36.143  1.00 38.33  ? 386 GLU A CD    1 
ATOM   1515  O  OE1   . GLU E 3 90  ? 130.885 -62.346 36.289  1.00 39.99  ? 386 GLU A OE1   1 
ATOM   1516  O  OE2   . GLU E 3 90  ? 131.284 -60.180 36.219  1.00 39.90  ? 386 GLU A OE2   1 
ATOM   1517  N  N     . LEU E 3 91  ? 126.679 -60.631 33.491  1.00 35.81  ? 387 LEU A N     1 
ATOM   1518  C  CA    . LEU E 3 91  ? 126.741 -60.365 32.053  1.00 34.89  ? 387 LEU A CA    1 
ATOM   1519  C  C     . LEU E 3 91  ? 128.075 -59.740 31.660  1.00 34.78  ? 387 LEU A C     1 
ATOM   1520  O  O     . LEU E 3 91  ? 128.512 -58.769 32.275  1.00 34.62  ? 387 LEU A O     1 
ATOM   1521  C  CB    . LEU E 3 91  ? 125.614 -59.417 31.652  1.00 34.67  ? 387 LEU A CB    1 
ATOM   1522  C  CG    . LEU E 3 91  ? 125.506 -59.054 30.176  1.00 33.32  ? 387 LEU A CG    1 
ATOM   1523  C  CD1   . LEU E 3 91  ? 125.160 -60.294 29.380  1.00 32.09  ? 387 LEU A CD1   1 
ATOM   1524  C  CD2   . LEU E 3 91  ? 124.453 -57.989 29.982  1.00 31.63  ? 387 LEU A CD2   1 
ATOM   1525  N  N     . CYS E 3 92  ? 128.714 -60.293 30.630  1.00 34.41  ? 388 CYS A N     1 
ATOM   1526  C  CA    . CYS E 3 92  ? 129.992 -59.774 30.155  1.00 34.15  ? 388 CYS A CA    1 
ATOM   1527  C  C     . CYS E 3 92  ? 130.085 -59.791 28.630  1.00 33.92  ? 388 CYS A C     1 
ATOM   1528  O  O     . CYS E 3 92  ? 129.323 -60.494 27.951  1.00 33.77  ? 388 CYS A O     1 
ATOM   1529  C  CB    . CYS E 3 92  ? 131.153 -60.576 30.739  1.00 34.17  ? 388 CYS A CB    1 
ATOM   1530  S  SG    . CYS E 3 92  ? 131.261 -60.571 32.539  1.00 34.87  ? 388 CYS A SG    1 
ATOM   1531  N  N     . GLY E 3 93  ? 131.023 -59.008 28.098  1.00 33.32  ? 389 GLY A N     1 
ATOM   1532  C  CA    . GLY E 3 93  ? 131.259 -58.955 26.655  1.00 32.74  ? 389 GLY A CA    1 
ATOM   1533  C  C     . GLY E 3 93  ? 130.288 -58.146 25.805  1.00 32.18  ? 389 GLY A C     1 
ATOM   1534  O  O     . GLY E 3 93  ? 129.964 -58.540 24.671  1.00 32.00  ? 389 GLY A O     1 
ATOM   1535  N  N     . VAL E 3 94  ? 129.808 -57.027 26.346  1.00 31.38  ? 390 VAL A N     1 
ATOM   1536  C  CA    . VAL E 3 94  ? 128.976 -56.106 25.570  1.00 30.68  ? 390 VAL A CA    1 
ATOM   1537  C  C     . VAL E 3 94  ? 129.894 -55.137 24.804  1.00 30.04  ? 390 VAL A C     1 
ATOM   1538  O  O     . VAL E 3 94  ? 130.571 -54.320 25.421  1.00 29.66  ? 390 VAL A O     1 
ATOM   1539  C  CB    . VAL E 3 94  ? 127.973 -55.339 26.468  1.00 30.78  ? 390 VAL A CB    1 
ATOM   1540  C  CG1   . VAL E 3 94  ? 127.320 -54.177 25.710  1.00 30.83  ? 390 VAL A CG1   1 
ATOM   1541  C  CG2   . VAL E 3 94  ? 126.908 -56.291 27.003  1.00 30.67  ? 390 VAL A CG2   1 
ATOM   1542  N  N     . SER E 3 95  ? 129.937 -55.251 23.471  1.00 29.21  ? 391 SER A N     1 
ATOM   1543  C  CA    . SER E 3 95  ? 130.801 -54.385 22.649  1.00 28.51  ? 391 SER A CA    1 
ATOM   1544  C  C     . SER E 3 95  ? 130.035 -53.267 21.932  1.00 28.00  ? 391 SER A C     1 
ATOM   1545  O  O     . SER E 3 95  ? 130.633 -52.306 21.448  1.00 27.88  ? 391 SER A O     1 
ATOM   1546  C  CB    . SER E 3 95  ? 131.623 -55.195 21.635  1.00 28.57  ? 391 SER A CB    1 
ATOM   1547  O  OG    . SER E 3 95  ? 130.884 -55.502 20.459  1.00 28.73  ? 391 SER A OG    1 
ATOM   1548  N  N     . PHE E 3 96  ? 128.716 -53.392 21.868  1.00 27.44  ? 392 PHE A N     1 
ATOM   1549  C  CA    . PHE E 3 96  ? 127.894 -52.364 21.242  1.00 26.91  ? 392 PHE A CA    1 
ATOM   1550  C  C     . PHE E 3 96  ? 126.584 -52.118 21.985  1.00 26.47  ? 392 PHE A C     1 
ATOM   1551  O  O     . PHE E 3 96  ? 125.803 -53.052 22.201  1.00 26.60  ? 392 PHE A O     1 
ATOM   1552  C  CB    . PHE E 3 96  ? 127.593 -52.731 19.781  1.00 26.95  ? 392 PHE A CB    1 
ATOM   1553  C  CG    . PHE E 3 96  ? 126.851 -51.657 19.026  1.00 26.54  ? 392 PHE A CG    1 
ATOM   1554  C  CD1   . PHE E 3 96  ? 127.489 -50.482 18.662  1.00 25.79  ? 392 PHE A CD1   1 
ATOM   1555  C  CD2   . PHE E 3 96  ? 125.518 -51.824 18.686  1.00 26.34  ? 392 PHE A CD2   1 
ATOM   1556  C  CE1   . PHE E 3 96  ? 126.819 -49.499 17.971  1.00 26.21  ? 392 PHE A CE1   1 
ATOM   1557  C  CE2   . PHE E 3 96  ? 124.835 -50.835 17.992  1.00 26.24  ? 392 PHE A CE2   1 
ATOM   1558  C  CZ    . PHE E 3 96  ? 125.489 -49.674 17.628  1.00 26.38  ? 392 PHE A CZ    1 
ATOM   1559  N  N     . ASP E 3 97  ? 126.347 -50.862 22.368  1.00 25.83  ? 393 ASP A N     1 
ATOM   1560  C  CA    . ASP E 3 97  ? 125.071 -50.477 22.967  1.00 25.35  ? 393 ASP A CA    1 
ATOM   1561  C  C     . ASP E 3 97  ? 124.364 -49.453 22.085  1.00 24.71  ? 393 ASP A C     1 
ATOM   1562  O  O     . ASP E 3 97  ? 124.721 -48.282 22.077  1.00 25.02  ? 393 ASP A O     1 
ATOM   1563  C  CB    . ASP E 3 97  ? 125.256 -49.929 24.390  1.00 25.82  ? 393 ASP A CB    1 
ATOM   1564  C  CG    . ASP E 3 97  ? 123.939 -49.845 25.170  1.00 25.73  ? 393 ASP A CG    1 
ATOM   1565  O  OD1   . ASP E 3 97  ? 122.879 -49.541 24.573  1.00 25.13  ? 393 ASP A OD1   1 
ATOM   1566  O  OD2   . ASP E 3 97  ? 123.969 -50.085 26.394  1.00 27.09  ? 393 ASP A OD2   1 
ATOM   1567  N  N     . LEU E 3 98  ? 123.350 -49.904 21.358  1.00 23.93  ? 394 LEU A N     1 
ATOM   1568  C  CA    . LEU E 3 98  ? 122.603 -49.060 20.418  1.00 23.05  ? 394 LEU A CA    1 
ATOM   1569  C  C     . LEU E 3 98  ? 121.986 -47.805 21.059  1.00 23.11  ? 394 LEU A C     1 
ATOM   1570  O  O     . LEU E 3 98  ? 121.892 -46.748 20.421  1.00 23.00  ? 394 LEU A O     1 
ATOM   1571  C  CB    . LEU E 3 98  ? 121.522 -49.902 19.733  1.00 22.70  ? 394 LEU A CB    1 
ATOM   1572  C  CG    . LEU E 3 98  ? 120.695 -49.374 18.565  1.00 22.39  ? 394 LEU A CG    1 
ATOM   1573  C  CD1   . LEU E 3 98  ? 121.561 -48.886 17.395  1.00 21.54  ? 394 LEU A CD1   1 
ATOM   1574  C  CD2   . LEU E 3 98  ? 119.755 -50.476 18.100  1.00 22.49  ? 394 LEU A CD2   1 
ATOM   1575  N  N     . LEU E 3 99  ? 121.568 -47.924 22.316  1.00 22.85  ? 395 LEU A N     1 
ATOM   1576  C  CA    . LEU E 3 99  ? 120.958 -46.808 23.017  1.00 22.41  ? 395 LEU A CA    1 
ATOM   1577  C  C     . LEU E 3 99  ? 121.957 -45.679 23.173  1.00 22.65  ? 395 LEU A C     1 
ATOM   1578  O  O     . LEU E 3 99  ? 121.648 -44.521 22.882  1.00 22.98  ? 395 LEU A O     1 
ATOM   1579  C  CB    . LEU E 3 99  ? 120.441 -47.234 24.394  1.00 22.42  ? 395 LEU A CB    1 
ATOM   1580  C  CG    . LEU E 3 99  ? 119.999 -46.110 25.340  1.00 21.33  ? 395 LEU A CG    1 
ATOM   1581  C  CD1   . LEU E 3 99  ? 118.803 -45.368 24.787  1.00 19.93  ? 395 LEU A CD1   1 
ATOM   1582  C  CD2   . LEU E 3 99  ? 119.702 -46.637 26.735  1.00 21.73  ? 395 LEU A CD2   1 
ATOM   1583  N  N     . LEU E 3 100 ? 123.155 -46.016 23.630  1.00 22.57  ? 396 LEU A N     1 
ATOM   1584  C  CA    . LEU E 3 100 ? 124.178 -45.011 23.863  1.00 22.39  ? 396 LEU A CA    1 
ATOM   1585  C  C     . LEU E 3 100 ? 124.686 -44.487 22.540  1.00 22.28  ? 396 LEU A C     1 
ATOM   1586  O  O     . LEU E 3 100 ? 124.931 -43.288 22.397  1.00 22.45  ? 396 LEU A O     1 
ATOM   1587  C  CB    . LEU E 3 100 ? 125.306 -45.565 24.738  1.00 22.27  ? 396 LEU A CB    1 
ATOM   1588  C  CG    . LEU E 3 100 ? 124.862 -45.938 26.162  1.00 22.83  ? 396 LEU A CG    1 
ATOM   1589  C  CD1   . LEU E 3 100 ? 126.010 -46.521 26.981  1.00 23.24  ? 396 LEU A CD1   1 
ATOM   1590  C  CD2   . LEU E 3 100 ? 124.251 -44.733 26.886  1.00 22.75  ? 396 LEU A CD2   1 
ATOM   1591  N  N     . ALA E 3 101 ? 124.800 -45.379 21.560  1.00 22.22  ? 397 ALA A N     1 
ATOM   1592  C  CA    . ALA E 3 101 ? 125.235 -44.986 20.219  1.00 22.34  ? 397 ALA A CA    1 
ATOM   1593  C  C     . ALA E 3 101 ? 124.311 -43.914 19.643  1.00 22.17  ? 397 ALA A C     1 
ATOM   1594  O  O     . ALA E 3 101 ? 124.781 -42.927 19.095  1.00 22.12  ? 397 ALA A O     1 
ATOM   1595  C  CB    . ALA E 3 101 ? 125.309 -46.195 19.300  1.00 22.34  ? 397 ALA A CB    1 
ATOM   1596  N  N     . ALA E 3 102 ? 123.003 -44.104 19.816  1.00 22.41  ? 398 ALA A N     1 
ATOM   1597  C  CA    . ALA E 3 102 ? 121.970 -43.174 19.329  1.00 22.63  ? 398 ALA A CA    1 
ATOM   1598  C  C     . ALA E 3 102 ? 121.931 -41.852 20.092  1.00 23.01  ? 398 ALA A C     1 
ATOM   1599  O  O     . ALA E 3 102 ? 121.681 -40.793 19.513  1.00 23.28  ? 398 ALA A O     1 
ATOM   1600  C  CB    . ALA E 3 102 ? 120.605 -43.841 19.366  1.00 22.30  ? 398 ALA A CB    1 
ATOM   1601  N  N     . TYR E 3 103 ? 122.177 -41.926 21.395  1.00 23.39  ? 399 TYR A N     1 
ATOM   1602  C  CA    . TYR E 3 103 ? 122.214 -40.753 22.269  1.00 23.52  ? 399 TYR A CA    1 
ATOM   1603  C  C     . TYR E 3 103 ? 123.410 -39.852 21.946  1.00 23.87  ? 399 TYR A C     1 
ATOM   1604  O  O     . TYR E 3 103 ? 123.339 -38.628 22.059  1.00 24.21  ? 399 TYR A O     1 
ATOM   1605  C  CB    . TYR E 3 103 ? 122.284 -41.225 23.721  1.00 23.27  ? 399 TYR A CB    1 
ATOM   1606  C  CG    . TYR E 3 103 ? 122.518 -40.148 24.760  1.00 22.52  ? 399 TYR A CG    1 
ATOM   1607  C  CD1   . TYR E 3 103 ? 121.557 -39.161 25.001  1.00 23.09  ? 399 TYR A CD1   1 
ATOM   1608  C  CD2   . TYR E 3 103 ? 123.676 -40.144 25.533  1.00 20.09  ? 399 TYR A CD2   1 
ATOM   1609  C  CE1   . TYR E 3 103 ? 121.763 -38.182 25.960  1.00 22.26  ? 399 TYR A CE1   1 
ATOM   1610  C  CE2   . TYR E 3 103 ? 123.884 -39.185 26.495  1.00 20.74  ? 399 TYR A CE2   1 
ATOM   1611  C  CZ    . TYR E 3 103 ? 122.926 -38.202 26.703  1.00 21.85  ? 399 TYR A CZ    1 
ATOM   1612  O  OH    . TYR E 3 103 ? 123.122 -37.242 27.662  1.00 21.83  ? 399 TYR A OH    1 
ATOM   1613  N  N     . LEU E 3 104 ? 124.521 -40.457 21.558  1.00 24.04  ? 400 LEU A N     1 
ATOM   1614  C  CA    . LEU E 3 104 ? 125.662 -39.663 21.156  1.00 24.17  ? 400 LEU A CA    1 
ATOM   1615  C  C     . LEU E 3 104 ? 125.412 -39.010 19.787  1.00 24.34  ? 400 LEU A C     1 
ATOM   1616  O  O     . LEU E 3 104 ? 125.764 -37.849 19.583  1.00 23.73  ? 400 LEU A O     1 
ATOM   1617  C  CB    . LEU E 3 104 ? 126.944 -40.489 21.179  1.00 23.85  ? 400 LEU A CB    1 
ATOM   1618  C  CG    . LEU E 3 104 ? 127.332 -40.993 22.571  1.00 23.62  ? 400 LEU A CG    1 
ATOM   1619  C  CD1   . LEU E 3 104 ? 128.566 -41.888 22.486  1.00 23.47  ? 400 LEU A CD1   1 
ATOM   1620  C  CD2   . LEU E 3 104 ? 127.551 -39.845 23.558  1.00 22.45  ? 400 LEU A CD2   1 
ATOM   1621  N  N     . LEU E 3 105 ? 124.764 -39.736 18.878  1.00 25.09  ? 401 LEU A N     1 
ATOM   1622  C  CA    . LEU E 3 105 ? 124.461 -39.180 17.554  1.00 26.05  ? 401 LEU A CA    1 
ATOM   1623  C  C     . LEU E 3 105 ? 123.513 -37.989 17.619  1.00 26.91  ? 401 LEU A C     1 
ATOM   1624  O  O     . LEU E 3 105 ? 123.668 -37.053 16.852  1.00 27.57  ? 401 LEU A O     1 
ATOM   1625  C  CB    . LEU E 3 105 ? 123.941 -40.237 16.579  1.00 25.62  ? 401 LEU A CB    1 
ATOM   1626  C  CG    . LEU E 3 105 ? 124.986 -41.261 16.110  1.00 25.56  ? 401 LEU A CG    1 
ATOM   1627  C  CD1   . LEU E 3 105 ? 124.362 -42.263 15.154  1.00 25.78  ? 401 LEU A CD1   1 
ATOM   1628  C  CD2   . LEU E 3 105 ? 126.185 -40.594 15.469  1.00 23.79  ? 401 LEU A CD2   1 
ATOM   1629  N  N     . ASP E 3 106 ? 122.544 -38.022 18.532  1.00 27.94  ? 402 ASP A N     1 
ATOM   1630  C  CA    . ASP E 3 106 ? 121.630 -36.896 18.743  1.00 28.74  ? 402 ASP A CA    1 
ATOM   1631  C  C     . ASP E 3 106 ? 120.768 -37.049 20.005  1.00 29.16  ? 402 ASP A C     1 
ATOM   1632  O  O     . ASP E 3 106 ? 119.737 -37.730 19.987  1.00 29.27  ? 402 ASP A O     1 
ATOM   1633  C  CB    . ASP E 3 106 ? 120.726 -36.661 17.524  1.00 28.95  ? 402 ASP A CB    1 
ATOM   1634  C  CG    . ASP E 3 106 ? 119.871 -35.405 17.672  1.00 29.76  ? 402 ASP A CG    1 
ATOM   1635  O  OD1   . ASP E 3 106 ? 120.149 -34.596 18.584  1.00 30.69  ? 402 ASP A OD1   1 
ATOM   1636  O  OD2   . ASP E 3 106 ? 118.922 -35.221 16.886  1.00 30.35  ? 402 ASP A OD2   1 
ATOM   1637  N  N     . PRO E 3 107 ? 121.173 -36.385 21.096  1.00 29.48  ? 403 PRO A N     1 
ATOM   1638  C  CA    . PRO E 3 107 ? 120.456 -36.430 22.371  1.00 29.79  ? 403 PRO A CA    1 
ATOM   1639  C  C     . PRO E 3 107 ? 118.985 -35.993 22.277  1.00 30.31  ? 403 PRO A C     1 
ATOM   1640  O  O     . PRO E 3 107 ? 118.171 -36.441 23.070  1.00 30.51  ? 403 PRO A O     1 
ATOM   1641  C  CB    . PRO E 3 107 ? 121.242 -35.452 23.253  1.00 29.64  ? 403 PRO A CB    1 
ATOM   1642  C  CG    . PRO E 3 107 ? 122.575 -35.349 22.633  1.00 29.26  ? 403 PRO A CG    1 
ATOM   1643  C  CD    . PRO E 3 107 ? 122.375 -35.537 21.165  1.00 29.51  ? 403 PRO A CD    1 
ATOM   1644  N  N     . ALA E 3 108 ? 118.646 -35.142 21.313  1.00 30.98  ? 404 ALA A N     1 
ATOM   1645  C  CA    . ALA E 3 108 ? 117.272 -34.647 21.172  1.00 31.71  ? 404 ALA A CA    1 
ATOM   1646  C  C     . ALA E 3 108 ? 116.262 -35.694 20.714  1.00 32.43  ? 404 ALA A C     1 
ATOM   1647  O  O     . ALA E 3 108 ? 115.070 -35.552 21.000  1.00 32.39  ? 404 ALA A O     1 
ATOM   1648  C  CB    . ALA E 3 108 ? 117.214 -33.429 20.256  1.00 31.37  ? 404 ALA A CB    1 
ATOM   1649  N  N     . GLN E 3 109 ? 116.721 -36.725 20.004  1.00 33.25  ? 405 GLN A N     1 
ATOM   1650  C  CA    . GLN E 3 109 ? 115.816 -37.786 19.536  1.00 34.49  ? 405 GLN A CA    1 
ATOM   1651  C  C     . GLN E 3 109 ? 115.068 -38.442 20.690  1.00 34.66  ? 405 GLN A C     1 
ATOM   1652  O  O     . GLN E 3 109 ? 113.942 -38.889 20.528  1.00 34.45  ? 405 GLN A O     1 
ATOM   1653  C  CB    . GLN E 3 109 ? 116.566 -38.858 18.733  1.00 34.91  ? 405 GLN A CB    1 
ATOM   1654  C  CG    . GLN E 3 109 ? 117.233 -38.333 17.478  1.00 36.64  ? 405 GLN A CG    1 
ATOM   1655  C  CD    . GLN E 3 109 ? 116.271 -37.524 16.630  1.00 38.93  ? 405 GLN A CD    1 
ATOM   1656  O  OE1   . GLN E 3 109 ? 115.279 -38.049 16.118  1.00 40.23  ? 405 GLN A OE1   1 
ATOM   1657  N  NE2   . GLN E 3 109 ? 116.553 -36.237 16.486  1.00 39.33  ? 405 GLN A NE2   1 
ATOM   1658  N  N     . GLY E 3 110 ? 115.708 -38.491 21.854  1.00 35.41  ? 406 GLY A N     1 
ATOM   1659  C  CA    . GLY E 3 110 ? 115.105 -39.070 23.048  1.00 36.05  ? 406 GLY A CA    1 
ATOM   1660  C  C     . GLY E 3 110 ? 114.705 -40.504 22.797  1.00 36.46  ? 406 GLY A C     1 
ATOM   1661  O  O     . GLY E 3 110 ? 113.579 -40.911 23.072  1.00 36.49  ? 406 GLY A O     1 
ATOM   1662  N  N     . VAL E 3 111 ? 115.639 -41.266 22.251  1.00 37.01  ? 407 VAL A N     1 
ATOM   1663  C  CA    . VAL E 3 111 ? 115.408 -42.660 21.946  1.00 37.38  ? 407 VAL A CA    1 
ATOM   1664  C  C     . VAL E 3 111 ? 115.152 -43.450 23.232  1.00 37.76  ? 407 VAL A C     1 
ATOM   1665  O  O     . VAL E 3 111 ? 115.825 -43.246 24.246  1.00 37.85  ? 407 VAL A O     1 
ATOM   1666  C  CB    . VAL E 3 111 ? 116.591 -43.215 21.157  1.00 37.26  ? 407 VAL A CB    1 
ATOM   1667  C  CG1   . VAL E 3 111 ? 116.414 -44.707 20.873  1.00 37.75  ? 407 VAL A CG1   1 
ATOM   1668  C  CG2   . VAL E 3 111 ? 116.736 -42.432 19.862  1.00 37.12  ? 407 VAL A CG2   1 
ATOM   1669  N  N     . ASP E 3 112 ? 114.141 -44.314 23.195  1.00 38.28  ? 408 ASP A N     1 
ATOM   1670  C  CA    . ASP E 3 112 ? 113.786 -45.145 24.346  1.00 38.80  ? 408 ASP A CA    1 
ATOM   1671  C  C     . ASP E 3 112 ? 113.600 -46.606 23.965  1.00 38.64  ? 408 ASP A C     1 
ATOM   1672  O  O     . ASP E 3 112 ? 113.574 -47.474 24.833  1.00 38.99  ? 408 ASP A O     1 
ATOM   1673  C  CB    . ASP E 3 112 ? 112.540 -44.610 25.065  1.00 38.95  ? 408 ASP A CB    1 
ATOM   1674  C  CG    . ASP E 3 112 ? 111.364 -44.381 24.121  1.00 40.08  ? 408 ASP A CG    1 
ATOM   1675  O  OD1   . ASP E 3 112 ? 111.509 -44.612 22.897  1.00 40.03  ? 408 ASP A OD1   1 
ATOM   1676  O  OD2   . ASP E 3 112 ? 110.292 -43.955 24.612  1.00 41.33  ? 408 ASP A OD2   1 
ATOM   1677  N  N     . ASP E 3 113 ? 113.450 -46.880 22.674  1.00 38.32  ? 409 ASP A N     1 
ATOM   1678  C  CA    . ASP E 3 113 ? 113.371 -48.263 22.213  1.00 38.08  ? 409 ASP A CA    1 
ATOM   1679  C  C     . ASP E 3 113 ? 114.071 -48.433 20.873  1.00 37.80  ? 409 ASP A C     1 
ATOM   1680  O  O     . ASP E 3 113 ? 114.436 -47.448 20.232  1.00 37.64  ? 409 ASP A O     1 
ATOM   1681  C  CB    . ASP E 3 113 ? 111.929 -48.781 22.174  1.00 38.26  ? 409 ASP A CB    1 
ATOM   1682  C  CG    . ASP E 3 113 ? 111.032 -47.967 21.267  1.00 39.06  ? 409 ASP A CG    1 
ATOM   1683  O  OD1   . ASP E 3 113 ? 109.814 -48.249 21.238  1.00 38.82  ? 409 ASP A OD1   1 
ATOM   1684  O  OD2   . ASP E 3 113 ? 111.533 -47.042 20.587  1.00 41.11  ? 409 ASP A OD2   1 
ATOM   1685  N  N     . VAL E 3 114 ? 114.263 -49.685 20.469  1.00 37.52  ? 410 VAL A N     1 
ATOM   1686  C  CA    . VAL E 3 114 ? 114.964 -50.010 19.231  1.00 37.33  ? 410 VAL A CA    1 
ATOM   1687  C  C     . VAL E 3 114 ? 114.304 -49.373 18.001  1.00 37.51  ? 410 VAL A C     1 
ATOM   1688  O  O     . VAL E 3 114 ? 114.996 -48.893 17.101  1.00 37.66  ? 410 VAL A O     1 
ATOM   1689  C  CB    . VAL E 3 114 ? 115.106 -51.545 19.046  1.00 37.26  ? 410 VAL A CB    1 
ATOM   1690  C  CG1   . VAL E 3 114 ? 115.839 -51.873 17.755  1.00 36.88  ? 410 VAL A CG1   1 
ATOM   1691  C  CG2   . VAL E 3 114 ? 115.838 -52.154 20.227  1.00 36.60  ? 410 VAL A CG2   1 
ATOM   1692  N  N     . ALA E 3 115 ? 112.973 -49.349 17.976  1.00 37.68  ? 411 ALA A N     1 
ATOM   1693  C  CA    . ALA E 3 115 ? 112.234 -48.774 16.843  1.00 37.73  ? 411 ALA A CA    1 
ATOM   1694  C  C     . ALA E 3 115 ? 112.624 -47.327 16.557  1.00 37.73  ? 411 ALA A C     1 
ATOM   1695  O  O     . ALA E 3 115 ? 112.814 -46.949 15.402  1.00 37.77  ? 411 ALA A O     1 
ATOM   1696  C  CB    . ALA E 3 115 ? 110.748 -48.887 17.065  1.00 37.58  ? 411 ALA A CB    1 
ATOM   1697  N  N     . ALA E 3 116 ? 112.764 -46.530 17.613  1.00 37.85  ? 412 ALA A N     1 
ATOM   1698  C  CA    . ALA E 3 116 ? 113.131 -45.116 17.477  1.00 37.95  ? 412 ALA A CA    1 
ATOM   1699  C  C     . ALA E 3 116 ? 114.587 -44.919 17.045  1.00 38.08  ? 412 ALA A C     1 
ATOM   1700  O  O     . ALA E 3 116 ? 114.925 -43.898 16.444  1.00 38.16  ? 412 ALA A O     1 
ATOM   1701  C  CB    . ALA E 3 116 ? 112.845 -44.356 18.774  1.00 37.67  ? 412 ALA A CB    1 
ATOM   1702  N  N     . ALA E 3 117 ? 115.450 -45.881 17.363  1.00 38.13  ? 413 ALA A N     1 
ATOM   1703  C  CA    . ALA E 3 117 ? 116.848 -45.789 16.963  1.00 38.31  ? 413 ALA A CA    1 
ATOM   1704  C  C     . ALA E 3 117 ? 116.958 -46.191 15.502  1.00 38.59  ? 413 ALA A C     1 
ATOM   1705  O  O     . ALA E 3 117 ? 117.716 -45.598 14.735  1.00 38.38  ? 413 ALA A O     1 
ATOM   1706  C  CB    . ALA E 3 117 ? 117.715 -46.673 17.829  1.00 38.30  ? 413 ALA A CB    1 
ATOM   1707  N  N     . ALA E 3 118 ? 116.173 -47.198 15.127  1.00 38.95  ? 414 ALA A N     1 
ATOM   1708  C  CA    . ALA E 3 118 ? 116.121 -47.681 13.758  1.00 39.25  ? 414 ALA A CA    1 
ATOM   1709  C  C     . ALA E 3 118 ? 115.563 -46.584 12.852  1.00 39.55  ? 414 ALA A C     1 
ATOM   1710  O  O     . ALA E 3 118 ? 115.963 -46.454 11.692  1.00 39.64  ? 414 ALA A O     1 
ATOM   1711  C  CB    . ALA E 3 118 ? 115.270 -48.937 13.681  1.00 38.99  ? 414 ALA A CB    1 
ATOM   1712  N  N     . LYS E 3 119 ? 114.651 -45.790 13.407  1.00 40.03  ? 415 LYS A N     1 
ATOM   1713  C  CA    . LYS E 3 119 ? 114.050 -44.643 12.720  1.00 40.41  ? 415 LYS A CA    1 
ATOM   1714  C  C     . LYS E 3 119 ? 115.131 -43.761 12.088  1.00 40.24  ? 415 LYS A C     1 
ATOM   1715  O  O     . LYS E 3 119 ? 114.973 -43.279 10.970  1.00 40.26  ? 415 LYS A O     1 
ATOM   1716  C  CB    . LYS E 3 119 ? 113.233 -43.823 13.727  1.00 40.58  ? 415 LYS A CB    1 
ATOM   1717  C  CG    . LYS E 3 119 ? 112.277 -42.788 13.142  1.00 41.91  ? 415 LYS A CG    1 
ATOM   1718  C  CD    . LYS E 3 119 ? 111.943 -41.712 14.196  1.00 43.51  ? 415 LYS A CD    1 
ATOM   1719  C  CE    . LYS E 3 119 ? 110.718 -40.864 13.824  1.00 44.72  ? 415 LYS A CE    1 
ATOM   1720  N  NZ    . LYS E 3 119 ? 110.818 -40.153 12.508  1.00 44.74  ? 415 LYS A NZ    1 
ATOM   1721  N  N     . MET E 3 120 ? 116.242 -43.584 12.799  1.00 40.24  ? 416 MET A N     1 
ATOM   1722  C  CA    . MET E 3 120 ? 117.341 -42.728 12.338  1.00 40.16  ? 416 MET A CA    1 
ATOM   1723  C  C     . MET E 3 120 ? 118.103 -43.279 11.141  1.00 40.63  ? 416 MET A C     1 
ATOM   1724  O  O     . MET E 3 120 ? 118.969 -42.595 10.605  1.00 40.83  ? 416 MET A O     1 
ATOM   1725  C  CB    . MET E 3 120 ? 118.339 -42.485 13.473  1.00 39.92  ? 416 MET A CB    1 
ATOM   1726  C  CG    . MET E 3 120 ? 117.715 -41.952 14.742  1.00 39.52  ? 416 MET A CG    1 
ATOM   1727  S  SD    . MET E 3 120 ? 118.837 -42.006 16.147  1.00 39.29  ? 416 MET A SD    1 
ATOM   1728  C  CE    . MET E 3 120 ? 119.943 -40.640 15.796  1.00 38.67  ? 416 MET A CE    1 
ATOM   1729  N  N     . LYS E 3 121 ? 117.808 -44.515 10.741  1.00 41.10  ? 417 LYS A N     1 
ATOM   1730  C  CA    . LYS E 3 121 ? 118.505 -45.146 9.622   1.00 41.46  ? 417 LYS A CA    1 
ATOM   1731  C  C     . LYS E 3 121 ? 117.546 -45.740 8.602   1.00 41.75  ? 417 LYS A C     1 
ATOM   1732  O  O     . LYS E 3 121 ? 117.938 -46.576 7.786   1.00 41.67  ? 417 LYS A O     1 
ATOM   1733  C  CB    . LYS E 3 121 ? 119.476 -46.226 10.107  1.00 41.47  ? 417 LYS A CB    1 
ATOM   1734  C  CG    . LYS E 3 121 ? 120.644 -45.713 10.935  1.00 41.89  ? 417 LYS A CG    1 
ATOM   1735  C  CD    . LYS E 3 121 ? 121.527 -44.768 10.147  1.00 41.94  ? 417 LYS A CD    1 
ATOM   1736  C  CE    . LYS E 3 121 ? 122.687 -44.287 10.994  1.00 42.32  ? 417 LYS A CE    1 
ATOM   1737  N  NZ    . LYS E 3 121 ? 123.552 -43.332 10.242  1.00 42.12  ? 417 LYS A NZ    1 
ATOM   1738  N  N     . GLN E 3 122 ? 116.289 -45.316 8.654   1.00 42.13  ? 418 GLN A N     1 
ATOM   1739  C  CA    . GLN E 3 122 ? 115.296 -45.764 7.681   1.00 42.55  ? 418 GLN A CA    1 
ATOM   1740  C  C     . GLN E 3 122 ? 114.867 -47.223 7.897   1.00 42.70  ? 418 GLN A C     1 
ATOM   1741  O  O     . GLN E 3 122 ? 113.923 -47.690 7.267   1.00 42.79  ? 418 GLN A O     1 
ATOM   1742  C  CB    . GLN E 3 122 ? 115.805 -45.540 6.239   1.00 42.71  ? 418 GLN A CB    1 
ATOM   1743  C  CG    . GLN E 3 122 ? 115.817 -44.077 5.763   1.00 42.55  ? 418 GLN A CG    1 
ATOM   1744  C  CD    . GLN E 3 122 ? 116.767 -43.187 6.553   1.00 42.66  ? 418 GLN A CD    1 
ATOM   1745  O  OE1   . GLN E 3 122 ? 117.981 -43.376 6.535   1.00 42.22  ? 418 GLN A OE1   1 
ATOM   1746  N  NE2   . GLN E 3 122 ? 116.210 -42.204 7.245   1.00 42.61  ? 418 GLN A NE2   1 
ATOM   1747  N  N     . TYR E 3 123 ? 115.556 -47.929 8.791   1.00 43.00  ? 419 TYR A N     1 
ATOM   1748  C  CA    . TYR E 3 123 ? 115.235 -49.315 9.126   1.00 43.31  ? 419 TYR A CA    1 
ATOM   1749  C  C     . TYR E 3 123 ? 113.824 -49.402 9.722   1.00 43.89  ? 419 TYR A C     1 
ATOM   1750  O  O     . TYR E 3 123 ? 113.592 -48.941 10.841  1.00 43.90  ? 419 TYR A O     1 
ATOM   1751  C  CB    . TYR E 3 123 ? 116.256 -49.844 10.128  1.00 43.02  ? 419 TYR A CB    1 
ATOM   1752  C  CG    . TYR E 3 123 ? 116.174 -51.331 10.361  1.00 42.98  ? 419 TYR A CG    1 
ATOM   1753  C  CD1   . TYR E 3 123 ? 117.081 -52.198 9.754   1.00 43.02  ? 419 TYR A CD1   1 
ATOM   1754  C  CD2   . TYR E 3 123 ? 115.189 -51.874 11.183  1.00 42.52  ? 419 TYR A CD2   1 
ATOM   1755  C  CE1   . TYR E 3 123 ? 117.009 -53.568 9.957   1.00 43.09  ? 419 TYR A CE1   1 
ATOM   1756  C  CE2   . TYR E 3 123 ? 115.104 -53.239 11.388  1.00 43.04  ? 419 TYR A CE2   1 
ATOM   1757  C  CZ    . TYR E 3 123 ? 116.018 -54.079 10.774  1.00 43.17  ? 419 TYR A CZ    1 
ATOM   1758  O  OH    . TYR E 3 123 ? 115.940 -55.429 10.982  1.00 43.17  ? 419 TYR A OH    1 
ATOM   1759  N  N     . GLU E 3 124 ? 112.895 -50.014 8.986   1.00 44.42  ? 420 GLU A N     1 
ATOM   1760  C  CA    . GLU E 3 124 ? 111.476 -50.028 9.386   1.00 44.99  ? 420 GLU A CA    1 
ATOM   1761  C  C     . GLU E 3 124 ? 110.888 -51.393 9.787   1.00 44.68  ? 420 GLU A C     1 
ATOM   1762  O  O     . GLU E 3 124 ? 109.680 -51.511 9.971   1.00 44.74  ? 420 GLU A O     1 
ATOM   1763  C  CB    . GLU E 3 124 ? 110.611 -49.410 8.270   1.00 45.05  ? 420 GLU A CB    1 
ATOM   1764  C  CG    . GLU E 3 124 ? 110.725 -47.880 8.101   1.00 45.96  ? 420 GLU A CG    1 
ATOM   1765  C  CD    . GLU E 3 124 ? 110.018 -47.365 6.838   1.00 46.01  ? 420 GLU A CD    1 
ATOM   1766  O  OE1   . GLU E 3 124 ? 110.607 -47.456 5.735   1.00 46.04  ? 420 GLU A OE1   1 
ATOM   1767  O  OE2   . GLU E 3 124 ? 108.875 -46.859 6.952   1.00 47.69  ? 420 GLU A OE2   1 
ATOM   1768  N  N     . ALA E 3 125 ? 111.729 -52.409 9.944   1.00 44.52  ? 421 ALA A N     1 
ATOM   1769  C  CA    . ALA E 3 125 ? 111.245 -53.764 10.236  1.00 44.29  ? 421 ALA A CA    1 
ATOM   1770  C  C     . ALA E 3 125 ? 111.100 -54.119 11.723  1.00 44.16  ? 421 ALA A C     1 
ATOM   1771  O  O     . ALA E 3 125 ? 111.374 -55.258 12.120  1.00 43.86  ? 421 ALA A O     1 
ATOM   1772  C  CB    . ALA E 3 125 ? 112.125 -54.798 9.530   1.00 44.30  ? 421 ALA A CB    1 
ATOM   1773  N  N     . VAL E 3 126 ? 110.657 -53.162 12.538  1.00 44.05  ? 422 VAL A N     1 
ATOM   1774  C  CA    . VAL E 3 126 ? 110.478 -53.408 13.975  1.00 44.00  ? 422 VAL A CA    1 
ATOM   1775  C  C     . VAL E 3 126 ? 109.454 -52.458 14.589  1.00 43.97  ? 422 VAL A C     1 
ATOM   1776  O  O     . VAL E 3 126 ? 109.487 -51.252 14.346  1.00 44.10  ? 422 VAL A O     1 
ATOM   1777  C  CB    . VAL E 3 126 ? 111.824 -53.322 14.742  1.00 44.04  ? 422 VAL A CB    1 
ATOM   1778  C  CG1   . VAL E 3 126 ? 112.422 -51.919 14.633  1.00 43.94  ? 422 VAL A CG1   1 
ATOM   1779  C  CG2   . VAL E 3 126 ? 111.657 -53.740 16.198  1.00 43.95  ? 422 VAL A CG2   1 
ATOM   1780  N  N     . ARG E 3 127 ? 108.540 -53.012 15.378  1.00 44.02  ? 423 ARG A N     1 
ATOM   1781  C  CA    . ARG E 3 127 ? 107.492 -52.222 16.021  1.00 43.97  ? 423 ARG A CA    1 
ATOM   1782  C  C     . ARG E 3 127 ? 107.989 -51.597 17.318  1.00 43.61  ? 423 ARG A C     1 
ATOM   1783  O  O     . ARG E 3 127 ? 108.809 -52.192 18.019  1.00 43.37  ? 423 ARG A O     1 
ATOM   1784  C  CB    . ARG E 3 127 ? 106.267 -53.092 16.314  1.00 44.12  ? 423 ARG A CB    1 
ATOM   1785  C  CG    . ARG E 3 127 ? 105.656 -53.752 15.087  1.00 45.30  ? 423 ARG A CG    1 
ATOM   1786  C  CD    . ARG E 3 127 ? 104.373 -54.487 15.448  1.00 47.19  ? 423 ARG A CD    1 
ATOM   1787  N  NE    . ARG E 3 127 ? 103.269 -53.566 15.709  1.00 48.50  ? 423 ARG A NE    1 
ATOM   1788  C  CZ    . ARG E 3 127 ? 102.134 -53.910 16.311  1.00 49.03  ? 423 ARG A CZ    1 
ATOM   1789  N  NH1   . ARG E 3 127 ? 101.957 -55.154 16.736  1.00 49.22  ? 423 ARG A NH1   1 
ATOM   1790  N  NH2   . ARG E 3 127 ? 101.180 -53.005 16.500  1.00 49.13  ? 423 ARG A NH2   1 
ATOM   1791  N  N     . PRO E 3 128 ? 107.504 -50.381 17.633  1.00 43.39  ? 424 PRO A N     1 
ATOM   1792  C  CA    . PRO E 3 128 ? 107.863 -49.752 18.904  1.00 43.14  ? 424 PRO A CA    1 
ATOM   1793  C  C     . PRO E 3 128 ? 107.253 -50.500 20.082  1.00 42.93  ? 424 PRO A C     1 
ATOM   1794  O  O     . PRO E 3 128 ? 106.199 -51.116 19.947  1.00 42.82  ? 424 PRO A O     1 
ATOM   1795  C  CB    . PRO E 3 128 ? 107.272 -48.339 18.788  1.00 43.08  ? 424 PRO A CB    1 
ATOM   1796  C  CG    . PRO E 3 128 ? 106.212 -48.439 17.760  1.00 43.13  ? 424 PRO A CG    1 
ATOM   1797  C  CD    . PRO E 3 128 ? 106.623 -49.528 16.813  1.00 43.18  ? 424 PRO A CD    1 
ATOM   1798  N  N     . ASP E 3 129 ? 107.923 -50.439 21.225  1.00 42.96  ? 425 ASP A N     1 
ATOM   1799  C  CA    . ASP E 3 129 ? 107.487 -51.131 22.433  1.00 43.13  ? 425 ASP A CA    1 
ATOM   1800  C  C     . ASP E 3 129 ? 106.033 -50.879 22.878  1.00 43.31  ? 425 ASP A C     1 
ATOM   1801  O  O     . ASP E 3 129 ? 105.367 -51.808 23.340  1.00 43.35  ? 425 ASP A O     1 
ATOM   1802  C  CB    . ASP E 3 129 ? 108.467 -50.866 23.587  1.00 42.97  ? 425 ASP A CB    1 
ATOM   1803  C  CG    . ASP E 3 129 ? 109.787 -51.604 23.416  1.00 43.00  ? 425 ASP A CG    1 
ATOM   1804  O  OD1   . ASP E 3 129 ? 109.916 -52.365 22.438  1.00 43.89  ? 425 ASP A OD1   1 
ATOM   1805  O  OD2   . ASP E 3 129 ? 110.695 -51.438 24.259  1.00 41.90  ? 425 ASP A OD2   1 
ATOM   1806  N  N     . GLU E 3 130 ? 105.539 -49.647 22.738  1.00 43.50  ? 426 GLU A N     1 
ATOM   1807  C  CA    . GLU E 3 130 ? 104.174 -49.320 23.197  1.00 43.97  ? 426 GLU A CA    1 
ATOM   1808  C  C     . GLU E 3 130 ? 103.056 -49.910 22.338  1.00 43.88  ? 426 GLU A C     1 
ATOM   1809  O  O     . GLU E 3 130 ? 101.957 -50.163 22.832  1.00 43.80  ? 426 GLU A O     1 
ATOM   1810  C  CB    . GLU E 3 130 ? 103.976 -47.811 23.370  1.00 43.94  ? 426 GLU A CB    1 
ATOM   1811  C  CG    . GLU E 3 130 ? 104.683 -47.229 24.591  1.00 44.46  ? 426 GLU A CG    1 
ATOM   1812  C  CD    . GLU E 3 130 ? 104.468 -45.725 24.752  1.00 44.60  ? 426 GLU A CD    1 
ATOM   1813  O  OE1   . GLU E 3 130 ? 105.163 -45.130 25.614  1.00 45.32  ? 426 GLU A OE1   1 
ATOM   1814  O  OE2   . GLU E 3 130 ? 103.615 -45.145 24.026  1.00 44.15  ? 426 GLU A OE2   1 
ATOM   1815  N  N     . ALA E 3 131 ? 103.348 -50.140 21.061  1.00 44.09  ? 427 ALA A N     1 
ATOM   1816  C  CA    . ALA E 3 131 ? 102.388 -50.741 20.134  1.00 44.23  ? 427 ALA A CA    1 
ATOM   1817  C  C     . ALA E 3 131 ? 102.331 -52.265 20.301  1.00 44.32  ? 427 ALA A C     1 
ATOM   1818  O  O     . ALA E 3 131 ? 101.482 -52.938 19.713  1.00 44.12  ? 427 ALA A O     1 
ATOM   1819  C  CB    . ALA E 3 131 ? 102.732 -50.365 18.699  1.00 44.15  ? 427 ALA A CB    1 
ATOM   1820  N  N     . VAL E 3 132 ? 103.239 -52.795 21.115  1.00 44.46  ? 428 VAL A N     1 
ATOM   1821  C  CA    . VAL E 3 132 ? 103.285 -54.219 21.395  1.00 44.77  ? 428 VAL A CA    1 
ATOM   1822  C  C     . VAL E 3 132 ? 102.846 -54.513 22.832  1.00 45.12  ? 428 VAL A C     1 
ATOM   1823  O  O     . VAL E 3 132 ? 102.035 -55.408 23.059  1.00 45.23  ? 428 VAL A O     1 
ATOM   1824  C  CB    . VAL E 3 132 ? 104.699 -54.806 21.142  1.00 44.77  ? 428 VAL A CB    1 
ATOM   1825  C  CG1   . VAL E 3 132 ? 104.731 -56.304 21.433  1.00 44.36  ? 428 VAL A CG1   1 
ATOM   1826  C  CG2   . VAL E 3 132 ? 105.148 -54.528 19.711  1.00 44.73  ? 428 VAL A CG2   1 
ATOM   1827  N  N     . TYR E 3 133 ? 103.363 -53.756 23.797  1.00 45.45  ? 429 TYR A N     1 
ATOM   1828  C  CA    . TYR E 3 133 ? 103.071 -54.033 25.206  1.00 45.94  ? 429 TYR A CA    1 
ATOM   1829  C  C     . TYR E 3 133 ? 101.837 -53.335 25.772  1.00 46.59  ? 429 TYR A C     1 
ATOM   1830  O  O     . TYR E 3 133 ? 101.252 -53.799 26.758  1.00 46.78  ? 429 TYR A O     1 
ATOM   1831  C  CB    . TYR E 3 133 ? 104.277 -53.729 26.093  1.00 45.70  ? 429 TYR A CB    1 
ATOM   1832  C  CG    . TYR E 3 133 ? 105.490 -54.569 25.784  1.00 45.68  ? 429 TYR A CG    1 
ATOM   1833  C  CD1   . TYR E 3 133 ? 106.700 -53.975 25.455  1.00 45.88  ? 429 TYR A CD1   1 
ATOM   1834  C  CD2   . TYR E 3 133 ? 105.423 -55.956 25.806  1.00 45.72  ? 429 TYR A CD2   1 
ATOM   1835  C  CE1   . TYR E 3 133 ? 107.814 -54.736 25.168  1.00 45.96  ? 429 TYR A CE1   1 
ATOM   1836  C  CE2   . TYR E 3 133 ? 106.530 -56.727 25.515  1.00 45.64  ? 429 TYR A CE2   1 
ATOM   1837  C  CZ    . TYR E 3 133 ? 107.723 -56.110 25.195  1.00 45.55  ? 429 TYR A CZ    1 
ATOM   1838  O  OH    . TYR E 3 133 ? 108.829 -56.866 24.905  1.00 45.18  ? 429 TYR A OH    1 
ATOM   1839  N  N     . GLY E 3 134 ? 101.446 -52.220 25.161  1.00 47.05  ? 430 GLY A N     1 
ATOM   1840  C  CA    . GLY E 3 134 ? 100.303 -51.451 25.648  1.00 47.41  ? 430 GLY A CA    1 
ATOM   1841  C  C     . GLY E 3 134 ? 100.743 -50.232 26.434  1.00 47.67  ? 430 GLY A C     1 
ATOM   1842  O  O     . GLY E 3 134 ? 101.931 -50.061 26.713  1.00 47.64  ? 430 GLY A O     1 
ATOM   1843  N  N     . LYS E 3 135 ? 99.784  -49.383 26.795  1.00 47.93  ? 431 LYS A N     1 
ATOM   1844  C  CA    . LYS E 3 135 ? 100.089 -48.151 27.513  1.00 48.35  ? 431 LYS A CA    1 
ATOM   1845  C  C     . LYS E 3 135 ? 99.408  -48.113 28.875  1.00 48.38  ? 431 LYS A C     1 
ATOM   1846  O  O     . LYS E 3 135 ? 98.233  -48.461 28.997  1.00 48.60  ? 431 LYS A O     1 
ATOM   1847  C  CB    . LYS E 3 135 ? 99.658  -46.935 26.685  1.00 48.48  ? 431 LYS A CB    1 
ATOM   1848  C  CG    . LYS E 3 135 ? 100.194 -46.932 25.258  1.00 49.48  ? 431 LYS A CG    1 
ATOM   1849  C  CD    . LYS E 3 135 ? 99.408  -45.976 24.372  1.00 50.89  ? 431 LYS A CD    1 
ATOM   1850  C  CE    . LYS E 3 135 ? 99.655  -46.261 22.894  1.00 51.05  ? 431 LYS A CE    1 
ATOM   1851  N  NZ    . LYS E 3 135 ? 98.700  -45.495 22.054  1.00 51.01  ? 431 LYS A NZ    1 
ATOM   1852  N  N     . GLY E 3 136 ? 100.157 -47.684 29.890  1.00 48.43  ? 432 GLY A N     1 
ATOM   1853  C  CA    . GLY E 3 136 ? 99.648  -47.538 31.252  1.00 48.47  ? 432 GLY A CA    1 
ATOM   1854  C  C     . GLY E 3 136 ? 98.959  -48.761 31.834  1.00 48.71  ? 432 GLY A C     1 
ATOM   1855  O  O     . GLY E 3 136 ? 99.555  -49.829 31.962  1.00 48.68  ? 432 GLY A O     1 
ATOM   1856  N  N     . ALA E 3 137 ? 97.685  -48.606 32.171  1.00 48.86  ? 433 ALA A N     1 
ATOM   1857  C  CA    . ALA E 3 137 ? 96.926  -49.673 32.806  1.00 49.01  ? 433 ALA A CA    1 
ATOM   1858  C  C     . ALA E 3 137 ? 96.552  -50.791 31.844  1.00 49.12  ? 433 ALA A C     1 
ATOM   1859  O  O     . ALA E 3 137 ? 95.794  -51.686 32.203  1.00 49.29  ? 433 ALA A O     1 
ATOM   1860  C  CB    . ALA E 3 137 ? 95.685  -49.107 33.486  1.00 49.03  ? 433 ALA A CB    1 
ATOM   1861  N  N     . LYS E 3 138 ? 97.088  -50.736 30.628  1.00 49.36  ? 434 LYS A N     1 
ATOM   1862  C  CA    . LYS E 3 138 ? 96.859  -51.769 29.620  1.00 49.53  ? 434 LYS A CA    1 
ATOM   1863  C  C     . LYS E 3 138 ? 98.155  -52.532 29.343  1.00 49.79  ? 434 LYS A C     1 
ATOM   1864  O  O     . LYS E 3 138 ? 98.163  -53.521 28.604  1.00 49.61  ? 434 LYS A O     1 
ATOM   1865  C  CB    . LYS E 3 138 ? 96.331  -51.136 28.337  1.00 49.45  ? 434 LYS A CB    1 
ATOM   1866  C  CG    . LYS E 3 138 ? 94.898  -50.645 28.436  1.00 49.74  ? 434 LYS A CG    1 
ATOM   1867  C  CD    . LYS E 3 138 ? 94.681  -49.361 27.627  1.00 50.35  ? 434 LYS A CD    1 
ATOM   1868  C  CE    . LYS E 3 138 ? 94.886  -49.544 26.128  1.00 50.43  ? 434 LYS A CE    1 
ATOM   1869  N  NZ    . LYS E 3 138 ? 93.795  -50.348 25.516  1.00 50.78  ? 434 LYS A NZ    1 
ATOM   1870  N  N     . ARG E 3 139 ? 99.242  -52.069 29.961  1.00 50.21  ? 435 ARG A N     1 
ATOM   1871  C  CA    . ARG E 3 139 ? 100.574 -52.635 29.755  1.00 50.64  ? 435 ARG A CA    1 
ATOM   1872  C  C     . ARG E 3 139 ? 100.532 -54.129 30.011  1.00 50.44  ? 435 ARG A C     1 
ATOM   1873  O  O     . ARG E 3 139 ? 100.436 -54.576 31.154  1.00 50.65  ? 435 ARG A O     1 
ATOM   1874  C  CB    . ARG E 3 139 ? 101.611 -51.944 30.656  1.00 50.57  ? 435 ARG A CB    1 
ATOM   1875  C  CG    . ARG E 3 139 ? 103.018 -51.859 30.064  1.00 51.01  ? 435 ARG A CG    1 
ATOM   1876  C  CD    . ARG E 3 139 ? 103.928 -50.936 30.881  1.00 51.53  ? 435 ARG A CD    1 
ATOM   1877  N  NE    . ARG E 3 139 ? 104.533 -51.594 32.047  1.00 53.69  ? 435 ARG A NE    1 
ATOM   1878  C  CZ    . ARG E 3 139 ? 105.099 -50.955 33.077  1.00 54.33  ? 435 ARG A CZ    1 
ATOM   1879  N  NH1   . ARG E 3 139 ? 105.127 -49.628 33.120  1.00 54.53  ? 435 ARG A NH1   1 
ATOM   1880  N  NH2   . ARG E 3 139 ? 105.628 -51.643 34.084  1.00 54.36  ? 435 ARG A NH2   1 
ATOM   1881  N  N     . ALA E 3 140 ? 100.579 -54.900 28.931  1.00 50.39  ? 436 ALA A N     1 
ATOM   1882  C  CA    . ALA E 3 140 ? 100.514 -56.350 29.035  1.00 50.28  ? 436 ALA A CA    1 
ATOM   1883  C  C     . ALA E 3 140 ? 101.487 -57.044 28.092  1.00 50.12  ? 436 ALA A C     1 
ATOM   1884  O  O     . ALA E 3 140 ? 101.562 -56.712 26.905  1.00 50.15  ? 436 ALA A O     1 
ATOM   1885  C  CB    . ALA E 3 140 ? 99.083  -56.838 28.774  1.00 50.20  ? 436 ALA A CB    1 
ATOM   1886  N  N     . VAL E 3 141 ? 102.245 -57.993 28.634  1.00 49.91  ? 437 VAL A N     1 
ATOM   1887  C  CA    . VAL E 3 141 ? 103.084 -58.852 27.819  1.00 49.72  ? 437 VAL A CA    1 
ATOM   1888  C  C     . VAL E 3 141 ? 102.100 -59.689 27.009  1.00 49.83  ? 437 VAL A C     1 
ATOM   1889  O  O     . VAL E 3 141 ? 101.243 -60.357 27.587  1.00 49.94  ? 437 VAL A O     1 
ATOM   1890  C  CB    . VAL E 3 141 ? 103.944 -59.801 28.685  1.00 49.68  ? 437 VAL A CB    1 
ATOM   1891  C  CG1   . VAL E 3 141 ? 104.785 -60.715 27.807  1.00 49.15  ? 437 VAL A CG1   1 
ATOM   1892  C  CG2   . VAL E 3 141 ? 104.825 -59.013 29.638  1.00 49.61  ? 437 VAL A CG2   1 
ATOM   1893  N  N     . PRO E 3 142 ? 102.196 -59.643 25.670  1.00 49.77  ? 438 PRO A N     1 
ATOM   1894  C  CA    . PRO E 3 142 ? 101.252 -60.398 24.839  1.00 49.73  ? 438 PRO A CA    1 
ATOM   1895  C  C     . PRO E 3 142 ? 101.517 -61.910 24.849  1.00 49.69  ? 438 PRO A C     1 
ATOM   1896  O  O     . PRO E 3 142 ? 102.338 -62.391 25.636  1.00 49.39  ? 438 PRO A O     1 
ATOM   1897  C  CB    . PRO E 3 142 ? 101.491 -59.823 23.440  1.00 49.67  ? 438 PRO A CB    1 
ATOM   1898  C  CG    . PRO E 3 142 ? 102.916 -59.403 23.463  1.00 49.56  ? 438 PRO A CG    1 
ATOM   1899  C  CD    . PRO E 3 142 ? 103.177 -58.902 24.859  1.00 49.68  ? 438 PRO A CD    1 
ATOM   1900  N  N     . ASP E 3 143 ? 100.819 -62.648 23.984  1.00 49.78  ? 439 ASP A N     1 
ATOM   1901  C  CA    . ASP E 3 143 ? 101.016 -64.094 23.886  1.00 49.64  ? 439 ASP A CA    1 
ATOM   1902  C  C     . ASP E 3 143 ? 102.364 -64.387 23.238  1.00 49.25  ? 439 ASP A C     1 
ATOM   1903  O  O     . ASP E 3 143 ? 102.789 -63.688 22.312  1.00 49.45  ? 439 ASP A O     1 
ATOM   1904  C  CB    . ASP E 3 143 ? 99.884  -64.758 23.096  1.00 49.98  ? 439 ASP A CB    1 
ATOM   1905  C  CG    . ASP E 3 143 ? 99.901  -66.288 23.206  1.00 51.23  ? 439 ASP A CG    1 
ATOM   1906  O  OD1   . ASP E 3 143 ? 100.277 -66.815 24.281  1.00 52.23  ? 439 ASP A OD1   1 
ATOM   1907  O  OD2   . ASP E 3 143 ? 99.527  -66.965 22.219  1.00 52.10  ? 439 ASP A OD2   1 
ATOM   1908  N  N     . GLU E 3 144 ? 103.022 -65.427 23.739  1.00 48.66  ? 440 GLU A N     1 
ATOM   1909  C  CA    . GLU E 3 144 ? 104.358 -65.832 23.299  1.00 48.03  ? 440 GLU A CA    1 
ATOM   1910  C  C     . GLU E 3 144 ? 104.699 -65.599 21.816  1.00 47.42  ? 440 GLU A C     1 
ATOM   1911  O  O     . GLU E 3 144 ? 105.664 -64.897 21.523  1.00 47.43  ? 440 GLU A O     1 
ATOM   1912  C  CB    . GLU E 3 144 ? 104.626 -67.286 23.694  1.00 48.14  ? 440 GLU A CB    1 
ATOM   1913  C  CG    . GLU E 3 144 ? 106.059 -67.713 23.509  1.00 48.58  ? 440 GLU A CG    1 
ATOM   1914  C  CD    . GLU E 3 144 ? 106.278 -69.164 23.879  1.00 49.33  ? 440 GLU A CD    1 
ATOM   1915  O  OE1   . GLU E 3 144 ? 105.675 -70.038 23.218  1.00 49.56  ? 440 GLU A OE1   1 
ATOM   1916  O  OE2   . GLU E 3 144 ? 107.062 -69.423 24.821  1.00 48.98  ? 440 GLU A OE2   1 
ATOM   1917  N  N     . PRO E 3 145 ? 103.919 -66.184 20.880  1.00 46.73  ? 441 PRO A N     1 
ATOM   1918  C  CA    . PRO E 3 145 ? 104.237 -66.006 19.461  1.00 46.10  ? 441 PRO A CA    1 
ATOM   1919  C  C     . PRO E 3 145 ? 104.432 -64.546 19.061  1.00 45.43  ? 441 PRO A C     1 
ATOM   1920  O  O     . PRO E 3 145 ? 105.285 -64.246 18.218  1.00 45.10  ? 441 PRO A O     1 
ATOM   1921  C  CB    . PRO E 3 145 ? 103.009 -66.591 18.756  1.00 46.06  ? 441 PRO A CB    1 
ATOM   1922  C  CG    . PRO E 3 145 ? 102.518 -67.617 19.677  1.00 46.32  ? 441 PRO A CG    1 
ATOM   1923  C  CD    . PRO E 3 145 ? 102.730 -67.039 21.054  1.00 46.73  ? 441 PRO A CD    1 
ATOM   1924  N  N     . VAL E 3 146 ? 103.644 -63.656 19.663  1.00 44.73  ? 442 VAL A N     1 
ATOM   1925  C  CA    . VAL E 3 146 ? 103.762 -62.222 19.406  1.00 43.93  ? 442 VAL A CA    1 
ATOM   1926  C  C     . VAL E 3 146 ? 105.008 -61.682 20.110  1.00 43.35  ? 442 VAL A C     1 
ATOM   1927  O  O     . VAL E 3 146 ? 105.815 -60.968 19.500  1.00 43.24  ? 442 VAL A O     1 
ATOM   1928  C  CB    . VAL E 3 146 ? 102.512 -61.460 19.869  1.00 43.98  ? 442 VAL A CB    1 
ATOM   1929  C  CG1   . VAL E 3 146 ? 102.614 -59.987 19.501  1.00 43.83  ? 442 VAL A CG1   1 
ATOM   1930  C  CG2   . VAL E 3 146 ? 101.270 -62.077 19.247  1.00 44.05  ? 442 VAL A CG2   1 
ATOM   1931  N  N     . LEU E 3 147 ? 105.166 -62.048 21.382  1.00 42.41  ? 443 LEU A N     1 
ATOM   1932  C  CA    . LEU E 3 147 ? 106.328 -61.641 22.161  1.00 41.49  ? 443 LEU A CA    1 
ATOM   1933  C  C     . LEU E 3 147 ? 107.626 -62.061 21.476  1.00 41.24  ? 443 LEU A C     1 
ATOM   1934  O  O     . LEU E 3 147 ? 108.521 -61.241 21.257  1.00 41.27  ? 443 LEU A O     1 
ATOM   1935  C  CB    . LEU E 3 147 ? 106.266 -62.241 23.560  1.00 41.35  ? 443 LEU A CB    1 
ATOM   1936  C  CG    . LEU E 3 147 ? 107.517 -62.051 24.419  1.00 41.22  ? 443 LEU A CG    1 
ATOM   1937  C  CD1   . LEU E 3 147 ? 107.753 -60.573 24.700  1.00 40.75  ? 443 LEU A CD1   1 
ATOM   1938  C  CD2   . LEU E 3 147 ? 107.419 -62.846 25.718  1.00 41.23  ? 443 LEU A CD2   1 
ATOM   1939  N  N     . ALA E 3 148 ? 107.719 -63.340 21.134  1.00 40.77  ? 444 ALA A N     1 
ATOM   1940  C  CA    . ALA E 3 148 ? 108.908 -63.881 20.484  1.00 40.24  ? 444 ALA A CA    1 
ATOM   1941  C  C     . ALA E 3 148 ? 109.280 -63.100 19.233  1.00 39.83  ? 444 ALA A C     1 
ATOM   1942  O  O     . ALA E 3 148 ? 110.381 -62.560 19.145  1.00 39.64  ? 444 ALA A O     1 
ATOM   1943  C  CB    . ALA E 3 148 ? 108.711 -65.345 20.150  1.00 40.31  ? 444 ALA A CB    1 
ATOM   1944  N  N     . GLU E 3 149 ? 108.350 -63.016 18.284  1.00 39.42  ? 445 GLU A N     1 
ATOM   1945  C  CA    . GLU E 3 149 ? 108.617 -62.345 17.017  1.00 39.00  ? 445 GLU A CA    1 
ATOM   1946  C  C     . GLU E 3 149 ? 109.209 -60.977 17.273  1.00 38.88  ? 445 GLU A C     1 
ATOM   1947  O  O     . GLU E 3 149 ? 110.276 -60.642 16.749  1.00 38.95  ? 445 GLU A O     1 
ATOM   1948  C  CB    . GLU E 3 149 ? 107.353 -62.201 16.176  1.00 38.97  ? 445 GLU A CB    1 
ATOM   1949  C  CG    . GLU E 3 149 ? 107.654 -61.826 14.739  1.00 39.05  ? 445 GLU A CG    1 
ATOM   1950  C  CD    . GLU E 3 149 ? 106.538 -61.041 14.076  1.00 39.13  ? 445 GLU A CD    1 
ATOM   1951  O  OE1   . GLU E 3 149 ? 105.445 -60.913 14.669  1.00 39.32  ? 445 GLU A OE1   1 
ATOM   1952  O  OE2   . GLU E 3 149 ? 106.764 -60.538 12.956  1.00 38.29  ? 445 GLU A OE2   1 
ATOM   1953  N  N     . HIS E 3 150 ? 108.522 -60.197 18.101  1.00 38.56  ? 446 HIS A N     1 
ATOM   1954  C  CA    . HIS E 3 150 ? 108.978 -58.854 18.427  1.00 38.15  ? 446 HIS A CA    1 
ATOM   1955  C  C     . HIS E 3 150 ? 110.428 -58.831 18.921  1.00 37.96  ? 446 HIS A C     1 
ATOM   1956  O  O     . HIS E 3 150 ? 111.253 -58.093 18.377  1.00 37.99  ? 446 HIS A O     1 
ATOM   1957  C  CB    . HIS E 3 150 ? 108.032 -58.177 19.421  1.00 38.14  ? 446 HIS A CB    1 
ATOM   1958  C  CG    . HIS E 3 150 ? 108.484 -56.814 19.847  1.00 38.11  ? 446 HIS A CG    1 
ATOM   1959  N  ND1   . HIS E 3 150 ? 108.670 -55.779 18.955  1.00 37.95  ? 446 HIS A ND1   1 
ATOM   1960  C  CD2   . HIS E 3 150 ? 108.789 -56.318 21.071  1.00 37.61  ? 446 HIS A CD2   1 
ATOM   1961  C  CE1   . HIS E 3 150 ? 109.077 -54.707 19.613  1.00 38.37  ? 446 HIS A CE1   1 
ATOM   1962  N  NE2   . HIS E 3 150 ? 109.156 -55.007 20.897  1.00 37.60  ? 446 HIS A NE2   1 
ATOM   1963  N  N     . LEU E 3 151 ? 110.739 -59.652 19.924  1.00 37.60  ? 447 LEU A N     1 
ATOM   1964  C  CA    . LEU E 3 151 ? 112.097 -59.699 20.476  1.00 37.22  ? 447 LEU A CA    1 
ATOM   1965  C  C     . LEU E 3 151 ? 113.128 -60.083 19.421  1.00 36.95  ? 447 LEU A C     1 
ATOM   1966  O  O     . LEU E 3 151 ? 114.194 -59.470 19.344  1.00 36.85  ? 447 LEU A O     1 
ATOM   1967  C  CB    . LEU E 3 151 ? 112.188 -60.645 21.676  1.00 37.29  ? 447 LEU A CB    1 
ATOM   1968  C  CG    . LEU E 3 151 ? 111.327 -60.325 22.907  1.00 37.64  ? 447 LEU A CG    1 
ATOM   1969  C  CD1   . LEU E 3 151 ? 111.718 -61.210 24.085  1.00 38.25  ? 447 LEU A CD1   1 
ATOM   1970  C  CD2   . LEU E 3 151 ? 111.429 -58.865 23.300  1.00 37.65  ? 447 LEU A CD2   1 
ATOM   1971  N  N     . VAL E 3 152 ? 112.806 -61.090 18.607  1.00 36.48  ? 448 VAL A N     1 
ATOM   1972  C  CA    . VAL E 3 152 ? 113.689 -61.489 17.509  1.00 35.72  ? 448 VAL A CA    1 
ATOM   1973  C  C     . VAL E 3 152 ? 113.889 -60.299 16.567  1.00 35.45  ? 448 VAL A C     1 
ATOM   1974  O  O     . VAL E 3 152 ? 115.018 -60.000 16.174  1.00 35.50  ? 448 VAL A O     1 
ATOM   1975  C  CB    . VAL E 3 152 ? 113.160 -62.709 16.720  1.00 35.55  ? 448 VAL A CB    1 
ATOM   1976  C  CG1   . VAL E 3 152 ? 114.075 -63.016 15.553  1.00 34.92  ? 448 VAL A CG1   1 
ATOM   1977  C  CG2   . VAL E 3 152 ? 113.059 -63.921 17.620  1.00 35.40  ? 448 VAL A CG2   1 
ATOM   1978  N  N     . ARG E 3 153 ? 112.800 -59.608 16.233  1.00 34.80  ? 449 ARG A N     1 
ATOM   1979  C  CA    . ARG E 3 153 ? 112.890 -58.425 15.385  1.00 34.19  ? 449 ARG A CA    1 
ATOM   1980  C  C     . ARG E 3 153 ? 113.774 -57.348 16.005  1.00 33.52  ? 449 ARG A C     1 
ATOM   1981  O  O     . ARG E 3 153 ? 114.485 -56.656 15.291  1.00 33.23  ? 449 ARG A O     1 
ATOM   1982  C  CB    . ARG E 3 153 ? 111.506 -57.868 15.050  1.00 34.42  ? 449 ARG A CB    1 
ATOM   1983  C  CG    . ARG E 3 153 ? 110.714 -58.782 14.157  1.00 35.61  ? 449 ARG A CG    1 
ATOM   1984  C  CD    . ARG E 3 153 ? 109.483 -58.116 13.592  1.00 38.18  ? 449 ARG A CD    1 
ATOM   1985  N  NE    . ARG E 3 153 ? 108.827 -58.995 12.624  1.00 40.11  ? 449 ARG A NE    1 
ATOM   1986  C  CZ    . ARG E 3 153 ? 109.120 -59.038 11.324  1.00 40.89  ? 449 ARG A CZ    1 
ATOM   1987  N  NH1   . ARG E 3 153 ? 110.057 -58.244 10.823  1.00 40.96  ? 449 ARG A NH1   1 
ATOM   1988  N  NH2   . ARG E 3 153 ? 108.472 -59.879 10.523  1.00 40.92  ? 449 ARG A NH2   1 
ATOM   1989  N  N     . LYS E 3 154 ? 113.740 -57.210 17.329  1.00 32.88  ? 450 LYS A N     1 
ATOM   1990  C  CA    . LYS E 3 154 ? 114.615 -56.240 17.984  1.00 32.42  ? 450 LYS A CA    1 
ATOM   1991  C  C     . LYS E 3 154 ? 116.095 -56.620 17.863  1.00 32.21  ? 450 LYS A C     1 
ATOM   1992  O  O     . LYS E 3 154 ? 116.942 -55.764 17.611  1.00 31.64  ? 450 LYS A O     1 
ATOM   1993  C  CB    . LYS E 3 154 ? 114.213 -55.986 19.437  1.00 32.21  ? 450 LYS A CB    1 
ATOM   1994  C  CG    . LYS E 3 154 ? 112.937 -55.181 19.560  1.00 32.18  ? 450 LYS A CG    1 
ATOM   1995  C  CD    . LYS E 3 154 ? 112.842 -54.452 20.888  1.00 31.90  ? 450 LYS A CD    1 
ATOM   1996  C  CE    . LYS E 3 154 ? 112.836 -55.391 22.063  1.00 32.54  ? 450 LYS A CE    1 
ATOM   1997  N  NZ    . LYS E 3 154 ? 112.472 -54.656 23.305  1.00 32.83  ? 450 LYS A NZ    1 
ATOM   1998  N  N     . ALA E 3 155 ? 116.390 -57.909 18.022  1.00 32.27  ? 451 ALA A N     1 
ATOM   1999  C  CA    . ALA E 3 155 ? 117.749 -58.410 17.851  1.00 32.20  ? 451 ALA A CA    1 
ATOM   2000  C  C     . ALA E 3 155 ? 118.198 -58.177 16.413  1.00 32.19  ? 451 ALA A C     1 
ATOM   2001  O  O     . ALA E 3 155 ? 119.256 -57.574 16.169  1.00 32.28  ? 451 ALA A O     1 
ATOM   2002  C  CB    . ALA E 3 155 ? 117.822 -59.881 18.198  1.00 32.05  ? 451 ALA A CB    1 
ATOM   2003  N  N     . ALA E 3 156 ? 117.368 -58.627 15.473  1.00 31.82  ? 452 ALA A N     1 
ATOM   2004  C  CA    . ALA E 3 156 ? 117.632 -58.486 14.043  1.00 31.61  ? 452 ALA A CA    1 
ATOM   2005  C  C     . ALA E 3 156 ? 117.997 -57.055 13.682  1.00 31.56  ? 452 ALA A C     1 
ATOM   2006  O  O     . ALA E 3 156 ? 118.912 -56.822 12.884  1.00 31.74  ? 452 ALA A O     1 
ATOM   2007  C  CB    . ALA E 3 156 ? 116.434 -58.942 13.239  1.00 31.35  ? 452 ALA A CB    1 
ATOM   2008  N  N     . ALA E 3 157 ? 117.275 -56.108 14.279  1.00 31.45  ? 453 ALA A N     1 
ATOM   2009  C  CA    . ALA E 3 157 ? 117.504 -54.689 14.059  1.00 31.48  ? 453 ALA A CA    1 
ATOM   2010  C  C     . ALA E 3 157 ? 118.850 -54.266 14.651  1.00 31.83  ? 453 ALA A C     1 
ATOM   2011  O  O     . ALA E 3 157 ? 119.658 -53.632 13.970  1.00 31.90  ? 453 ALA A O     1 
ATOM   2012  C  CB    . ALA E 3 157 ? 116.376 -53.876 14.654  1.00 31.28  ? 453 ALA A CB    1 
ATOM   2013  N  N     . ILE E 3 158 ? 119.090 -54.624 15.912  1.00 32.05  ? 454 ILE A N     1 
ATOM   2014  C  CA    . ILE E 3 158 ? 120.368 -54.349 16.566  1.00 32.36  ? 454 ILE A CA    1 
ATOM   2015  C  C     . ILE E 3 158 ? 121.493 -54.936 15.718  1.00 32.73  ? 454 ILE A C     1 
ATOM   2016  O  O     . ILE E 3 158 ? 122.526 -54.304 15.510  1.00 32.66  ? 454 ILE A O     1 
ATOM   2017  C  CB    . ILE E 3 158 ? 120.423 -54.972 17.985  1.00 32.61  ? 454 ILE A CB    1 
ATOM   2018  C  CG1   . ILE E 3 158 ? 119.449 -54.263 18.935  1.00 32.58  ? 454 ILE A CG1   1 
ATOM   2019  C  CG2   . ILE E 3 158 ? 121.854 -54.956 18.546  1.00 32.00  ? 454 ILE A CG2   1 
ATOM   2020  C  CD1   . ILE E 3 158 ? 119.326 -54.934 20.294  1.00 32.47  ? 454 ILE A CD1   1 
ATOM   2021  N  N     . TRP E 3 159 ? 121.254 -56.148 15.219  1.00 33.13  ? 455 TRP A N     1 
ATOM   2022  C  CA    . TRP E 3 159 ? 122.196 -56.870 14.366  1.00 33.33  ? 455 TRP A CA    1 
ATOM   2023  C  C     . TRP E 3 159 ? 122.513 -56.148 13.051  1.00 33.32  ? 455 TRP A C     1 
ATOM   2024  O  O     . TRP E 3 159 ? 123.667 -56.080 12.640  1.00 33.14  ? 455 TRP A O     1 
ATOM   2025  C  CB    . TRP E 3 159 ? 121.655 -58.274 14.078  1.00 33.37  ? 455 TRP A CB    1 
ATOM   2026  C  CG    . TRP E 3 159 ? 122.571 -59.112 13.252  1.00 33.65  ? 455 TRP A CG    1 
ATOM   2027  C  CD1   . TRP E 3 159 ? 122.437 -59.412 11.926  1.00 33.26  ? 455 TRP A CD1   1 
ATOM   2028  C  CD2   . TRP E 3 159 ? 123.780 -59.747 13.692  1.00 33.19  ? 455 TRP A CD2   1 
ATOM   2029  N  NE1   . TRP E 3 159 ? 123.487 -60.196 11.516  1.00 33.54  ? 455 TRP A NE1   1 
ATOM   2030  C  CE2   . TRP E 3 159 ? 124.323 -60.418 12.580  1.00 33.00  ? 455 TRP A CE2   1 
ATOM   2031  C  CE3   . TRP E 3 159 ? 124.452 -59.812 14.917  1.00 32.68  ? 455 TRP A CE3   1 
ATOM   2032  C  CZ2   . TRP E 3 159 ? 125.505 -61.151 12.656  1.00 33.40  ? 455 TRP A CZ2   1 
ATOM   2033  C  CZ3   . TRP E 3 159 ? 125.626 -60.539 14.995  1.00 33.36  ? 455 TRP A CZ3   1 
ATOM   2034  C  CH2   . TRP E 3 159 ? 126.140 -61.205 13.872  1.00 33.73  ? 455 TRP A CH2   1 
ATOM   2035  N  N     . GLU E 3 160 ? 121.488 -55.615 12.395  1.00 33.58  ? 456 GLU A N     1 
ATOM   2036  C  CA    . GLU E 3 160 ? 121.680 -54.894 11.129  1.00 33.87  ? 456 GLU A CA    1 
ATOM   2037  C  C     . GLU E 3 160 ? 122.163 -53.457 11.279  1.00 33.41  ? 456 GLU A C     1 
ATOM   2038  O  O     . GLU E 3 160 ? 122.703 -52.899 10.336  1.00 33.64  ? 456 GLU A O     1 
ATOM   2039  C  CB    . GLU E 3 160 ? 120.382 -54.858 10.313  1.00 34.09  ? 456 GLU A CB    1 
ATOM   2040  C  CG    . GLU E 3 160 ? 119.878 -56.207 9.848   1.00 35.68  ? 456 GLU A CG    1 
ATOM   2041  C  CD    . GLU E 3 160 ? 120.747 -56.828 8.777   1.00 36.53  ? 456 GLU A CD    1 
ATOM   2042  O  OE1   . GLU E 3 160 ? 120.386 -57.926 8.303   1.00 36.69  ? 456 GLU A OE1   1 
ATOM   2043  O  OE2   . GLU E 3 160 ? 121.781 -56.224 8.406   1.00 37.39  ? 456 GLU A OE2   1 
ATOM   2044  N  N     . LEU E 3 161 ? 121.961 -52.850 12.442  1.00 32.90  ? 457 LEU A N     1 
ATOM   2045  C  CA    . LEU E 3 161 ? 122.285 -51.437 12.593  1.00 32.71  ? 457 LEU A CA    1 
ATOM   2046  C  C     . LEU E 3 161 ? 123.602 -51.150 13.300  1.00 32.78  ? 457 LEU A C     1 
ATOM   2047  O  O     . LEU E 3 161 ? 124.026 -49.994 13.351  1.00 32.65  ? 457 LEU A O     1 
ATOM   2048  C  CB    . LEU E 3 161 ? 121.152 -50.698 13.308  1.00 32.73  ? 457 LEU A CB    1 
ATOM   2049  C  CG    . LEU E 3 161 ? 119.766 -50.823 12.678  1.00 32.04  ? 457 LEU A CG    1 
ATOM   2050  C  CD1   . LEU E 3 161 ? 118.693 -50.366 13.643  1.00 30.96  ? 457 LEU A CD1   1 
ATOM   2051  C  CD2   . LEU E 3 161 ? 119.707 -50.061 11.382  1.00 31.90  ? 457 LEU A CD2   1 
ATOM   2052  N  N     . GLU E 3 162 ? 124.251 -52.180 13.844  1.00 32.71  ? 458 GLU A N     1 
ATOM   2053  C  CA    . GLU E 3 162 ? 125.512 -51.953 14.543  1.00 32.50  ? 458 GLU A CA    1 
ATOM   2054  C  C     . GLU E 3 162 ? 126.469 -51.136 13.686  1.00 32.55  ? 458 GLU A C     1 
ATOM   2055  O  O     . GLU E 3 162 ? 126.842 -50.012 14.047  1.00 32.35  ? 458 GLU A O     1 
ATOM   2056  C  CB    . GLU E 3 162 ? 126.184 -53.260 14.982  1.00 32.30  ? 458 GLU A CB    1 
ATOM   2057  C  CG    . GLU E 3 162 ? 127.549 -53.016 15.647  1.00 32.19  ? 458 GLU A CG    1 
ATOM   2058  C  CD    . GLU E 3 162 ? 128.192 -54.269 16.212  1.00 32.41  ? 458 GLU A CD    1 
ATOM   2059  O  OE1   . GLU E 3 162 ? 129.191 -54.152 16.947  1.00 33.44  ? 458 GLU A OE1   1 
ATOM   2060  O  OE2   . GLU E 3 162 ? 127.705 -55.376 15.937  1.00 33.31  ? 458 GLU A OE2   1 
ATOM   2061  N  N     . ARG E 3 163 ? 126.837 -51.704 12.541  1.00 32.74  ? 459 ARG A N     1 
ATOM   2062  C  CA    . ARG E 3 163 ? 127.804 -51.090 11.648  1.00 33.00  ? 459 ARG A CA    1 
ATOM   2063  C  C     . ARG E 3 163 ? 127.428 -49.660 11.193  1.00 32.68  ? 459 ARG A C     1 
ATOM   2064  O  O     . ARG E 3 163 ? 128.234 -48.743 11.368  1.00 33.04  ? 459 ARG A O     1 
ATOM   2065  C  CB    . ARG E 3 163 ? 128.124 -52.015 10.474  1.00 33.36  ? 459 ARG A CB    1 
ATOM   2066  C  CG    . ARG E 3 163 ? 129.455 -51.723 9.816   1.00 35.26  ? 459 ARG A CG    1 
ATOM   2067  C  CD    . ARG E 3 163 ? 129.553 -52.446 8.502   1.00 39.37  ? 459 ARG A CD    1 
ATOM   2068  N  NE    . ARG E 3 163 ? 130.722 -52.034 7.728   1.00 43.09  ? 459 ARG A NE    1 
ATOM   2069  C  CZ    . ARG E 3 163 ? 130.908 -52.335 6.444   1.00 44.27  ? 459 ARG A CZ    1 
ATOM   2070  N  NH1   . ARG E 3 163 ? 129.990 -53.045 5.790   1.00 45.12  ? 459 ARG A NH1   1 
ATOM   2071  N  NH2   . ARG E 3 163 ? 132.005 -51.919 5.811   1.00 44.19  ? 459 ARG A NH2   1 
ATOM   2072  N  N     . PRO E 3 164 ? 126.222 -49.460 10.616  1.00 32.19  ? 460 PRO A N     1 
ATOM   2073  C  CA    . PRO E 3 164 ? 125.794 -48.108 10.241  1.00 31.88  ? 460 PRO A CA    1 
ATOM   2074  C  C     . PRO E 3 164 ? 125.974 -47.067 11.348  1.00 31.78  ? 460 PRO A C     1 
ATOM   2075  O  O     . PRO E 3 164 ? 126.489 -45.980 11.086  1.00 31.92  ? 460 PRO A O     1 
ATOM   2076  C  CB    . PRO E 3 164 ? 124.303 -48.280 9.943   1.00 31.79  ? 460 PRO A CB    1 
ATOM   2077  C  CG    . PRO E 3 164 ? 124.175 -49.658 9.486   1.00 31.95  ? 460 PRO A CG    1 
ATOM   2078  C  CD    . PRO E 3 164 ? 125.213 -50.464 10.238  1.00 32.33  ? 460 PRO A CD    1 
ATOM   2079  N  N     . PHE E 3 165 ? 125.544 -47.390 12.565  1.00 31.50  ? 461 PHE A N     1 
ATOM   2080  C  CA    . PHE E 3 165 ? 125.690 -46.475 13.698  1.00 31.11  ? 461 PHE A CA    1 
ATOM   2081  C  C     . PHE E 3 165 ? 127.156 -46.220 14.010  1.00 31.29  ? 461 PHE A C     1 
ATOM   2082  O  O     . PHE E 3 165 ? 127.551 -45.069 14.221  1.00 31.15  ? 461 PHE A O     1 
ATOM   2083  C  CB    . PHE E 3 165 ? 124.959 -46.999 14.940  1.00 30.81  ? 461 PHE A CB    1 
ATOM   2084  C  CG    . PHE E 3 165 ? 123.512 -46.591 15.016  1.00 30.10  ? 461 PHE A CG    1 
ATOM   2085  C  CD1   . PHE E 3 165 ? 122.550 -47.222 14.245  1.00 30.06  ? 461 PHE A CD1   1 
ATOM   2086  C  CD2   . PHE E 3 165 ? 123.110 -45.584 15.878  1.00 29.34  ? 461 PHE A CD2   1 
ATOM   2087  C  CE1   . PHE E 3 165 ? 121.206 -46.843 14.326  1.00 29.23  ? 461 PHE A CE1   1 
ATOM   2088  C  CE2   . PHE E 3 165 ? 121.781 -45.202 15.956  1.00 28.69  ? 461 PHE A CE2   1 
ATOM   2089  C  CZ    . PHE E 3 165 ? 120.830 -45.837 15.183  1.00 29.13  ? 461 PHE A CZ    1 
ATOM   2090  N  N     . LEU E 3 166 ? 127.957 -47.290 14.035  1.00 31.49  ? 462 LEU A N     1 
ATOM   2091  C  CA    . LEU E 3 166 ? 129.409 -47.155 14.218  1.00 31.81  ? 462 LEU A CA    1 
ATOM   2092  C  C     . LEU E 3 166 ? 130.043 -46.405 13.044  1.00 32.21  ? 462 LEU A C     1 
ATOM   2093  O  O     . LEU E 3 166 ? 130.945 -45.585 13.240  1.00 32.33  ? 462 LEU A O     1 
ATOM   2094  C  CB    . LEU E 3 166 ? 130.106 -48.509 14.392  1.00 31.80  ? 462 LEU A CB    1 
ATOM   2095  C  CG    . LEU E 3 166 ? 130.018 -49.312 15.693  1.00 31.53  ? 462 LEU A CG    1 
ATOM   2096  C  CD1   . LEU E 3 166 ? 131.038 -50.443 15.654  1.00 31.62  ? 462 LEU A CD1   1 
ATOM   2097  C  CD2   . LEU E 3 166 ? 130.258 -48.428 16.903  1.00 31.07  ? 462 LEU A CD2   1 
ATOM   2098  N  N     . ASP E 3 167 ? 129.581 -46.679 11.827  1.00 32.52  ? 463 ASP A N     1 
ATOM   2099  C  CA    . ASP E 3 167 ? 130.104 -45.945 10.682  1.00 33.25  ? 463 ASP A CA    1 
ATOM   2100  C  C     . ASP E 3 167 ? 129.857 -44.457 10.814  1.00 33.17  ? 463 ASP A C     1 
ATOM   2101  O  O     . ASP E 3 167 ? 130.775 -43.674 10.583  1.00 33.47  ? 463 ASP A O     1 
ATOM   2102  C  CB    . ASP E 3 167 ? 129.568 -46.466 9.354   1.00 33.60  ? 463 ASP A CB    1 
ATOM   2103  C  CG    . ASP E 3 167 ? 130.268 -47.728 8.914   1.00 35.02  ? 463 ASP A CG    1 
ATOM   2104  O  OD1   . ASP E 3 167 ? 130.966 -48.340 9.769   1.00 36.23  ? 463 ASP A OD1   1 
ATOM   2105  O  OD2   . ASP E 3 167 ? 130.118 -48.103 7.724   1.00 35.41  ? 463 ASP A OD2   1 
ATOM   2106  N  N     . GLU E 3 168 ? 128.646 -44.064 11.210  1.00 32.97  ? 464 GLU A N     1 
ATOM   2107  C  CA    . GLU E 3 168 ? 128.359 -42.641 11.400  1.00 33.00  ? 464 GLU A CA    1 
ATOM   2108  C  C     . GLU E 3 168 ? 129.179 -42.028 12.546  1.00 32.71  ? 464 GLU A C     1 
ATOM   2109  O  O     . GLU E 3 168 ? 129.676 -40.910 12.416  1.00 32.56  ? 464 GLU A O     1 
ATOM   2110  C  CB    . GLU E 3 168 ? 126.860 -42.361 11.574  1.00 32.76  ? 464 GLU A CB    1 
ATOM   2111  C  CG    . GLU E 3 168 ? 126.524 -40.869 11.444  1.00 33.33  ? 464 GLU A CG    1 
ATOM   2112  C  CD    . GLU E 3 168 ? 125.045 -40.539 11.642  1.00 33.95  ? 464 GLU A CD    1 
ATOM   2113  O  OE1   . GLU E 3 168 ? 124.753 -39.419 12.127  1.00 33.97  ? 464 GLU A OE1   1 
ATOM   2114  O  OE2   . GLU E 3 168 ? 124.176 -41.387 11.314  1.00 35.51  ? 464 GLU A OE2   1 
ATOM   2115  N  N     . LEU E 3 169 ? 129.332 -42.770 13.647  1.00 32.75  ? 465 LEU A N     1 
ATOM   2116  C  CA    . LEU E 3 169 ? 130.113 -42.312 14.798  1.00 32.65  ? 465 LEU A CA    1 
ATOM   2117  C  C     . LEU E 3 169 ? 131.581 -42.071 14.469  1.00 33.10  ? 465 LEU A C     1 
ATOM   2118  O  O     . LEU E 3 169 ? 132.193 -41.163 15.024  1.00 32.98  ? 465 LEU A O     1 
ATOM   2119  C  CB    . LEU E 3 169 ? 130.002 -43.291 15.964  1.00 32.61  ? 465 LEU A CB    1 
ATOM   2120  C  CG    . LEU E 3 169 ? 128.711 -43.295 16.786  1.00 32.16  ? 465 LEU A CG    1 
ATOM   2121  C  CD1   . LEU E 3 169 ? 128.660 -44.518 17.666  1.00 31.13  ? 465 LEU A CD1   1 
ATOM   2122  C  CD2   . LEU E 3 169 ? 128.568 -42.037 17.620  1.00 31.03  ? 465 LEU A CD2   1 
ATOM   2123  N  N     . ARG E 3 170 ? 132.144 -42.883 13.575  1.00 33.74  ? 466 ARG A N     1 
ATOM   2124  C  CA    . ARG E 3 170 ? 133.527 -42.698 13.123  1.00 34.40  ? 466 ARG A CA    1 
ATOM   2125  C  C     . ARG E 3 170 ? 133.724 -41.392 12.356  1.00 34.46  ? 466 ARG A C     1 
ATOM   2126  O  O     . ARG E 3 170 ? 134.758 -40.742 12.499  1.00 34.56  ? 466 ARG A O     1 
ATOM   2127  C  CB    . ARG E 3 170 ? 133.992 -43.867 12.250  1.00 34.62  ? 466 ARG A CB    1 
ATOM   2128  C  CG    . ARG E 3 170 ? 134.284 -45.144 13.001  1.00 36.21  ? 466 ARG A CG    1 
ATOM   2129  C  CD    . ARG E 3 170 ? 134.848 -46.204 12.061  1.00 39.24  ? 466 ARG A CD    1 
ATOM   2130  N  NE    . ARG E 3 170 ? 135.004 -47.500 12.724  1.00 41.06  ? 466 ARG A NE    1 
ATOM   2131  C  CZ    . ARG E 3 170 ? 134.104 -48.480 12.681  1.00 41.39  ? 466 ARG A CZ    1 
ATOM   2132  N  NH1   . ARG E 3 170 ? 132.974 -48.327 11.998  1.00 40.85  ? 466 ARG A NH1   1 
ATOM   2133  N  NH2   . ARG E 3 170 ? 134.339 -49.618 13.322  1.00 42.03  ? 466 ARG A NH2   1 
ATOM   2134  N  N     . ARG E 3 171 ? 132.741 -41.015 11.539  1.00 34.70  ? 467 ARG A N     1 
ATOM   2135  C  CA    . ARG E 3 171 ? 132.807 -39.762 10.772  1.00 35.17  ? 467 ARG A CA    1 
ATOM   2136  C  C     . ARG E 3 171 ? 132.840 -38.540 11.676  1.00 35.12  ? 467 ARG A C     1 
ATOM   2137  O  O     . ARG E 3 171 ? 133.559 -37.586 11.400  1.00 35.37  ? 467 ARG A O     1 
ATOM   2138  C  CB    . ARG E 3 171 ? 131.625 -39.636 9.814   1.00 35.25  ? 467 ARG A CB    1 
ATOM   2139  C  CG    . ARG E 3 171 ? 131.432 -40.848 8.974   1.00 36.36  ? 467 ARG A CG    1 
ATOM   2140  C  CD    . ARG E 3 171 ? 130.273 -40.734 8.011   1.00 38.66  ? 467 ARG A CD    1 
ATOM   2141  N  NE    . ARG E 3 171 ? 130.103 -42.019 7.337   1.00 41.51  ? 467 ARG A NE    1 
ATOM   2142  C  CZ    . ARG E 3 171 ? 130.959 -42.507 6.436   1.00 43.18  ? 467 ARG A CZ    1 
ATOM   2143  N  NH1   . ARG E 3 171 ? 132.043 -41.802 6.091   1.00 42.70  ? 467 ARG A NH1   1 
ATOM   2144  N  NH2   . ARG E 3 171 ? 130.737 -43.697 5.877   1.00 42.48  ? 467 ARG A NH2   1 
ATOM   2145  N  N     . ASN E 3 172 ? 132.055 -38.574 12.751  1.00 35.22  ? 468 ASN A N     1 
ATOM   2146  C  CA    . ASN E 3 172 ? 131.995 -37.466 13.702  1.00 35.15  ? 468 ASN A CA    1 
ATOM   2147  C  C     . ASN E 3 172 ? 133.109 -37.517 14.739  1.00 35.01  ? 468 ASN A C     1 
ATOM   2148  O  O     . ASN E 3 172 ? 133.149 -36.677 15.636  1.00 35.40  ? 468 ASN A O     1 
ATOM   2149  C  CB    . ASN E 3 172 ? 130.661 -37.476 14.454  1.00 35.16  ? 468 ASN A CB    1 
ATOM   2150  C  CG    . ASN E 3 172 ? 129.458 -37.407 13.541  1.00 34.93  ? 468 ASN A CG    1 
ATOM   2151  O  OD1   . ASN E 3 172 ? 129.553 -37.034 12.375  1.00 35.46  ? 468 ASN A OD1   1 
ATOM   2152  N  ND2   . ASN E 3 172 ? 128.307 -37.762 14.081  1.00 35.08  ? 468 ASN A ND2   1 
ATOM   2153  N  N     . GLU E 3 173 ? 134.004 -38.492 14.625  1.00 34.72  ? 469 GLU A N     1 
ATOM   2154  C  CA    . GLU E 3 173 ? 135.023 -38.715 15.646  1.00 34.93  ? 469 GLU A CA    1 
ATOM   2155  C  C     . GLU E 3 173 ? 134.371 -38.857 17.026  1.00 34.70  ? 469 GLU A C     1 
ATOM   2156  O  O     . GLU E 3 173 ? 134.760 -38.188 17.983  1.00 34.90  ? 469 GLU A O     1 
ATOM   2157  C  CB    . GLU E 3 173 ? 136.071 -37.597 15.666  1.00 34.95  ? 469 GLU A CB    1 
ATOM   2158  C  CG    . GLU E 3 173 ? 137.107 -37.636 14.549  1.00 35.15  ? 469 GLU A CG    1 
ATOM   2159  C  CD    . GLU E 3 173 ? 138.184 -36.565 14.728  1.00 35.60  ? 469 GLU A CD    1 
ATOM   2160  O  OE1   . GLU E 3 173 ? 137.858 -35.349 14.706  1.00 35.38  ? 469 GLU A OE1   1 
ATOM   2161  O  OE2   . GLU E 3 173 ? 139.365 -36.943 14.886  1.00 36.72  ? 469 GLU A OE2   1 
ATOM   2162  N  N     . GLN E 3 174 ? 133.370 -39.729 17.111  1.00 34.48  ? 470 GLN A N     1 
ATOM   2163  C  CA    . GLN E 3 174 ? 132.664 -40.000 18.364  1.00 33.89  ? 470 GLN A CA    1 
ATOM   2164  C  C     . GLN E 3 174 ? 132.737 -41.477 18.748  1.00 34.22  ? 470 GLN A C     1 
ATOM   2165  O  O     . GLN E 3 174 ? 132.147 -41.883 19.746  1.00 34.03  ? 470 GLN A O     1 
ATOM   2166  C  CB    . GLN E 3 174 ? 131.189 -39.600 18.253  1.00 33.85  ? 470 GLN A CB    1 
ATOM   2167  C  CG    . GLN E 3 174 ? 130.905 -38.118 18.229  1.00 32.53  ? 470 GLN A CG    1 
ATOM   2168  C  CD    . GLN E 3 174 ? 129.432 -37.827 18.064  1.00 32.48  ? 470 GLN A CD    1 
ATOM   2169  O  OE1   . GLN E 3 174 ? 128.823 -38.209 17.070  1.00 31.77  ? 470 GLN A OE1   1 
ATOM   2170  N  NE2   . GLN E 3 174 ? 128.853 -37.134 19.030  1.00 30.33  ? 470 GLN A NE2   1 
ATOM   2171  N  N     . ASP E 3 175 ? 133.449 -42.277 17.956  1.00 34.45  ? 471 ASP A N     1 
ATOM   2172  C  CA    . ASP E 3 175 ? 133.533 -43.720 18.210  1.00 34.87  ? 471 ASP A CA    1 
ATOM   2173  C  C     . ASP E 3 175 ? 134.260 -44.069 19.514  1.00 35.04  ? 471 ASP A C     1 
ATOM   2174  O  O     . ASP E 3 175 ? 133.835 -44.955 20.253  1.00 35.08  ? 471 ASP A O     1 
ATOM   2175  C  CB    . ASP E 3 175 ? 134.150 -44.472 17.017  1.00 34.97  ? 471 ASP A CB    1 
ATOM   2176  C  CG    . ASP E 3 175 ? 135.560 -43.986 16.663  1.00 35.54  ? 471 ASP A CG    1 
ATOM   2177  O  OD1   . ASP E 3 175 ? 135.840 -42.765 16.737  1.00 36.14  ? 471 ASP A OD1   1 
ATOM   2178  O  OD2   . ASP E 3 175 ? 136.385 -44.840 16.288  1.00 35.01  ? 471 ASP A OD2   1 
ATOM   2179  N  N     . ARG E 3 176 ? 135.351 -43.370 19.802  1.00 35.35  ? 472 ARG A N     1 
ATOM   2180  C  CA    . ARG E 3 176 ? 136.084 -43.626 21.034  1.00 35.53  ? 472 ARG A CA    1 
ATOM   2181  C  C     . ARG E 3 176 ? 135.269 -43.193 22.247  1.00 34.84  ? 472 ARG A C     1 
ATOM   2182  O  O     . ARG E 3 176 ? 135.363 -43.820 23.297  1.00 35.46  ? 472 ARG A O     1 
ATOM   2183  C  CB    . ARG E 3 176 ? 137.480 -42.992 20.997  1.00 35.59  ? 472 ARG A CB    1 
ATOM   2184  C  CG    . ARG E 3 176 ? 138.473 -43.801 20.143  1.00 36.89  ? 472 ARG A CG    1 
ATOM   2185  C  CD    . ARG E 3 176 ? 139.748 -43.034 19.819  1.00 37.13  ? 472 ARG A CD    1 
ATOM   2186  N  NE    . ARG E 3 176 ? 140.426 -42.537 21.015  1.00 40.93  ? 472 ARG A NE    1 
ATOM   2187  C  CZ    . ARG E 3 176 ? 141.368 -41.594 20.998  1.00 42.11  ? 472 ARG A CZ    1 
ATOM   2188  N  NH1   . ARG E 3 176 ? 141.729 -41.047 19.840  1.00 41.97  ? 472 ARG A NH1   1 
ATOM   2189  N  NH2   . ARG E 3 176 ? 141.940 -41.185 22.133  1.00 41.92  ? 472 ARG A NH2   1 
ATOM   2190  N  N     . LEU E 3 177 ? 134.453 -42.146 22.094  1.00 33.60  ? 473 LEU A N     1 
ATOM   2191  C  CA    . LEU E 3 177 ? 133.540 -41.712 23.152  1.00 32.50  ? 473 LEU A CA    1 
ATOM   2192  C  C     . LEU E 3 177 ? 132.559 -42.838 23.524  1.00 32.08  ? 473 LEU A C     1 
ATOM   2193  O  O     . LEU E 3 177 ? 132.241 -43.045 24.699  1.00 32.18  ? 473 LEU A O     1 
ATOM   2194  C  CB    . LEU E 3 177 ? 132.778 -40.453 22.725  1.00 32.39  ? 473 LEU A CB    1 
ATOM   2195  C  CG    . LEU E 3 177 ? 131.803 -39.778 23.701  1.00 32.54  ? 473 LEU A CG    1 
ATOM   2196  C  CD1   . LEU E 3 177 ? 132.512 -39.184 24.910  1.00 31.19  ? 473 LEU A CD1   1 
ATOM   2197  C  CD2   . LEU E 3 177 ? 131.038 -38.695 22.985  1.00 32.21  ? 473 LEU A CD2   1 
ATOM   2198  N  N     . LEU E 3 178 ? 132.087 -43.571 22.525  1.00 31.27  ? 474 LEU A N     1 
ATOM   2199  C  CA    . LEU E 3 178 ? 131.188 -44.684 22.777  1.00 30.80  ? 474 LEU A CA    1 
ATOM   2200  C  C     . LEU E 3 178 ? 131.897 -45.873 23.433  1.00 30.81  ? 474 LEU A C     1 
ATOM   2201  O  O     . LEU E 3 178 ? 131.522 -46.307 24.523  1.00 30.89  ? 474 LEU A O     1 
ATOM   2202  C  CB    . LEU E 3 178 ? 130.537 -45.149 21.478  1.00 30.46  ? 474 LEU A CB    1 
ATOM   2203  C  CG    . LEU E 3 178 ? 129.666 -46.401 21.635  1.00 30.36  ? 474 LEU A CG    1 
ATOM   2204  C  CD1   . LEU E 3 178 ? 128.405 -46.103 22.446  1.00 29.91  ? 474 LEU A CD1   1 
ATOM   2205  C  CD2   . LEU E 3 178 ? 129.320 -47.027 20.288  1.00 29.83  ? 474 LEU A CD2   1 
ATOM   2206  N  N     . VAL E 3 179 ? 132.926 -46.380 22.760  1.00 30.52  ? 475 VAL A N     1 
ATOM   2207  C  CA    . VAL E 3 179 ? 133.612 -47.607 23.153  1.00 30.49  ? 475 VAL A CA    1 
ATOM   2208  C  C     . VAL E 3 179 ? 134.490 -47.498 24.416  1.00 30.75  ? 475 VAL A C     1 
ATOM   2209  O  O     . VAL E 3 179 ? 134.555 -48.442 25.228  1.00 30.20  ? 475 VAL A O     1 
ATOM   2210  C  CB    . VAL E 3 179 ? 134.420 -48.174 21.942  1.00 30.43  ? 475 VAL A CB    1 
ATOM   2211  C  CG1   . VAL E 3 179 ? 135.362 -49.277 22.359  1.00 30.32  ? 475 VAL A CG1   1 
ATOM   2212  C  CG2   . VAL E 3 179 ? 133.473 -48.671 20.864  1.00 30.16  ? 475 VAL A CG2   1 
ATOM   2213  N  N     . GLU E 3 180 ? 135.137 -46.344 24.587  1.00 30.79  ? 476 GLU A N     1 
ATOM   2214  C  CA    . GLU E 3 180 ? 136.079 -46.140 25.692  1.00 30.97  ? 476 GLU A CA    1 
ATOM   2215  C  C     . GLU E 3 180 ? 135.559 -45.335 26.879  1.00 31.02  ? 476 GLU A C     1 
ATOM   2216  O  O     . GLU E 3 180 ? 136.093 -45.456 27.983  1.00 31.14  ? 476 GLU A O     1 
ATOM   2217  C  CB    . GLU E 3 180 ? 137.371 -45.516 25.177  1.00 30.92  ? 476 GLU A CB    1 
ATOM   2218  C  CG    . GLU E 3 180 ? 138.141 -46.405 24.219  1.00 31.77  ? 476 GLU A CG    1 
ATOM   2219  C  CD    . GLU E 3 180 ? 139.210 -45.640 23.464  1.00 33.33  ? 476 GLU A CD    1 
ATOM   2220  O  OE1   . GLU E 3 180 ? 139.470 -45.984 22.289  1.00 34.01  ? 476 GLU A OE1   1 
ATOM   2221  O  OE2   . GLU E 3 180 ? 139.765 -44.671 24.032  1.00 33.80  ? 476 GLU A OE2   1 
ATOM   2222  N  N     . LEU E 3 181 ? 134.547 -44.501 26.663  1.00 31.07  ? 477 LEU A N     1 
ATOM   2223  C  CA    . LEU E 3 181 ? 133.951 -43.760 27.773  1.00 31.15  ? 477 LEU A CA    1 
ATOM   2224  C  C     . LEU E 3 181 ? 132.563 -44.285 28.156  1.00 31.33  ? 477 LEU A C     1 
ATOM   2225  O  O     . LEU E 3 181 ? 132.406 -44.975 29.170  1.00 31.23  ? 477 LEU A O     1 
ATOM   2226  C  CB    . LEU E 3 181 ? 133.857 -42.271 27.462  1.00 31.31  ? 477 LEU A CB    1 
ATOM   2227  C  CG    . LEU E 3 181 ? 133.584 -41.465 28.724  1.00 31.22  ? 477 LEU A CG    1 
ATOM   2228  C  CD1   . LEU E 3 181 ? 134.875 -41.351 29.483  1.00 32.30  ? 477 LEU A CD1   1 
ATOM   2229  C  CD2   . LEU E 3 181 ? 133.059 -40.097 28.396  1.00 31.86  ? 477 LEU A CD2   1 
ATOM   2230  N  N     . GLU E 3 182 ? 131.563 -43.972 27.334  1.00 31.13  ? 478 GLU A N     1 
ATOM   2231  C  CA    . GLU E 3 182 ? 130.191 -44.353 27.648  1.00 30.94  ? 478 GLU A CA    1 
ATOM   2232  C  C     . GLU E 3 182 ? 129.977 -45.828 27.975  1.00 30.86  ? 478 GLU A C     1 
ATOM   2233  O  O     . GLU E 3 182 ? 129.464 -46.139 29.052  1.00 30.86  ? 478 GLU A O     1 
ATOM   2234  C  CB    . GLU E 3 182 ? 129.205 -43.880 26.572  1.00 30.99  ? 478 GLU A CB    1 
ATOM   2235  C  CG    . GLU E 3 182 ? 129.082 -42.353 26.443  1.00 30.67  ? 478 GLU A CG    1 
ATOM   2236  C  CD    . GLU E 3 182 ? 128.636 -41.641 27.729  1.00 29.92  ? 478 GLU A CD    1 
ATOM   2237  O  OE1   . GLU E 3 182 ? 128.342 -42.309 28.744  1.00 29.20  ? 478 GLU A OE1   1 
ATOM   2238  O  OE2   . GLU E 3 182 ? 128.572 -40.395 27.714  1.00 28.76  ? 478 GLU A OE2   1 
ATOM   2239  N  N     . GLN E 3 183 ? 130.373 -46.729 27.075  1.00 30.74  ? 479 GLN A N     1 
ATOM   2240  C  CA    . GLN E 3 183 ? 130.130 -48.177 27.291  1.00 30.51  ? 479 GLN A CA    1 
ATOM   2241  C  C     . GLN E 3 183 ? 130.777 -48.791 28.555  1.00 30.38  ? 479 GLN A C     1 
ATOM   2242  O  O     . GLN E 3 183 ? 130.093 -49.481 29.310  1.00 30.40  ? 479 GLN A O     1 
ATOM   2243  C  CB    . GLN E 3 183 ? 130.380 -49.012 26.025  1.00 30.19  ? 479 GLN A CB    1 
ATOM   2244  C  CG    . GLN E 3 183 ? 129.288 -48.820 24.970  1.00 30.42  ? 479 GLN A CG    1 
ATOM   2245  C  CD    . GLN E 3 183 ? 129.607 -49.455 23.619  1.00 30.67  ? 479 GLN A CD    1 
ATOM   2246  O  OE1   . GLN E 3 183 ? 128.748 -49.525 22.737  1.00 31.61  ? 479 GLN A OE1   1 
ATOM   2247  N  NE2   . GLN E 3 183 ? 130.835 -49.922 23.455  1.00 30.58  ? 479 GLN A NE2   1 
ATOM   2248  N  N     . PRO E 3 184 ? 132.081 -48.547 28.793  1.00 30.09  ? 480 PRO A N     1 
ATOM   2249  C  CA    . PRO E 3 184 ? 132.659 -48.988 30.065  1.00 29.89  ? 480 PRO A CA    1 
ATOM   2250  C  C     . PRO E 3 184 ? 131.946 -48.389 31.284  1.00 29.72  ? 480 PRO A C     1 
ATOM   2251  O  O     . PRO E 3 184 ? 131.820 -49.068 32.308  1.00 29.92  ? 480 PRO A O     1 
ATOM   2252  C  CB    . PRO E 3 184 ? 134.092 -48.445 30.010  1.00 29.67  ? 480 PRO A CB    1 
ATOM   2253  C  CG    . PRO E 3 184 ? 134.384 -48.303 28.589  1.00 29.91  ? 480 PRO A CG    1 
ATOM   2254  C  CD    . PRO E 3 184 ? 133.091 -47.913 27.933  1.00 30.11  ? 480 PRO A CD    1 
ATOM   2255  N  N     . LEU E 3 185 ? 131.495 -47.135 31.178  1.00 29.39  ? 481 LEU A N     1 
ATOM   2256  C  CA    . LEU E 3 185 ? 130.809 -46.461 32.284  1.00 28.97  ? 481 LEU A CA    1 
ATOM   2257  C  C     . LEU E 3 185 ? 129.472 -47.136 32.590  1.00 28.58  ? 481 LEU A C     1 
ATOM   2258  O  O     . LEU E 3 185 ? 129.080 -47.289 33.750  1.00 28.70  ? 481 LEU A O     1 
ATOM   2259  C  CB    . LEU E 3 185 ? 130.585 -44.977 31.978  1.00 29.04  ? 481 LEU A CB    1 
ATOM   2260  C  CG    . LEU E 3 185 ? 129.908 -44.181 33.110  1.00 29.23  ? 481 LEU A CG    1 
ATOM   2261  C  CD1   . LEU E 3 185 ? 130.881 -43.925 34.267  1.00 28.33  ? 481 LEU A CD1   1 
ATOM   2262  C  CD2   . LEU E 3 185 ? 129.318 -42.871 32.612  1.00 29.04  ? 481 LEU A CD2   1 
ATOM   2263  N  N     . SER E 3 186 ? 128.783 -47.545 31.537  1.00 28.10  ? 482 SER A N     1 
ATOM   2264  C  CA    . SER E 3 186 ? 127.518 -48.247 31.665  1.00 27.69  ? 482 SER A CA    1 
ATOM   2265  C  C     . SER E 3 186 ? 127.608 -49.393 32.680  1.00 27.58  ? 482 SER A C     1 
ATOM   2266  O  O     . SER E 3 186 ? 126.722 -49.552 33.510  1.00 27.52  ? 482 SER A O     1 
ATOM   2267  C  CB    . SER E 3 186 ? 127.095 -48.769 30.296  1.00 27.49  ? 482 SER A CB    1 
ATOM   2268  O  OG    . SER E 3 186 ? 125.820 -49.359 30.343  1.00 27.87  ? 482 SER A OG    1 
ATOM   2269  N  N     . SER E 3 187 ? 128.684 -50.177 32.612  1.00 27.54  ? 483 SER A N     1 
ATOM   2270  C  CA    . SER E 3 187 ? 128.902 -51.304 33.525  1.00 27.56  ? 483 SER A CA    1 
ATOM   2271  C  C     . SER E 3 187 ? 129.193 -50.898 34.962  1.00 27.53  ? 483 SER A C     1 
ATOM   2272  O  O     . SER E 3 187 ? 128.865 -51.627 35.901  1.00 27.42  ? 483 SER A O     1 
ATOM   2273  C  CB    . SER E 3 187 ? 130.030 -52.200 33.019  1.00 27.50  ? 483 SER A CB    1 
ATOM   2274  O  OG    . SER E 3 187 ? 129.560 -53.031 31.973  1.00 27.97  ? 483 SER A OG    1 
ATOM   2275  N  N     . ILE E 3 188 ? 129.832 -49.748 35.121  1.00 27.47  ? 484 ILE A N     1 
ATOM   2276  C  CA    . ILE E 3 188 ? 130.142 -49.227 36.430  1.00 27.75  ? 484 ILE A CA    1 
ATOM   2277  C  C     . ILE E 3 188 ? 128.852 -48.767 37.104  1.00 28.04  ? 484 ILE A C     1 
ATOM   2278  O  O     . ILE E 3 188 ? 128.586 -49.092 38.271  1.00 27.96  ? 484 ILE A O     1 
ATOM   2279  C  CB    . ILE E 3 188 ? 131.135 -48.064 36.317  1.00 27.96  ? 484 ILE A CB    1 
ATOM   2280  C  CG1   . ILE E 3 188 ? 132.491 -48.603 35.837  1.00 27.76  ? 484 ILE A CG1   1 
ATOM   2281  C  CG2   . ILE E 3 188 ? 131.242 -47.293 37.649  1.00 27.25  ? 484 ILE A CG2   1 
ATOM   2282  C  CD1   . ILE E 3 188 ? 133.486 -47.523 35.417  1.00 27.40  ? 484 ILE A CD1   1 
ATOM   2283  N  N     . LEU E 3 189 ? 128.046 -48.021 36.354  1.00 28.23  ? 485 LEU A N     1 
ATOM   2284  C  CA    . LEU E 3 189 ? 126.755 -47.548 36.850  1.00 28.33  ? 485 LEU A CA    1 
ATOM   2285  C  C     . LEU E 3 189 ? 125.872 -48.729 37.278  1.00 28.62  ? 485 LEU A C     1 
ATOM   2286  O  O     . LEU E 3 189 ? 125.209 -48.662 38.315  1.00 28.60  ? 485 LEU A O     1 
ATOM   2287  C  CB    . LEU E 3 189 ? 126.052 -46.672 35.800  1.00 28.05  ? 485 LEU A CB    1 
ATOM   2288  C  CG    . LEU E 3 189 ? 126.741 -45.360 35.407  1.00 27.09  ? 485 LEU A CG    1 
ATOM   2289  C  CD1   . LEU E 3 189 ? 126.030 -44.686 34.241  1.00 26.39  ? 485 LEU A CD1   1 
ATOM   2290  C  CD2   . LEU E 3 189 ? 126.807 -44.433 36.595  1.00 26.33  ? 485 LEU A CD2   1 
ATOM   2291  N  N     . ALA E 3 190 ? 125.891 -49.810 36.494  1.00 28.75  ? 486 ALA A N     1 
ATOM   2292  C  CA    . ALA E 3 190 ? 125.126 -51.024 36.806  1.00 29.05  ? 486 ALA A CA    1 
ATOM   2293  C  C     . ALA E 3 190 ? 125.538 -51.627 38.160  1.00 29.32  ? 486 ALA A C     1 
ATOM   2294  O  O     . ALA E 3 190 ? 124.706 -52.198 38.864  1.00 29.46  ? 486 ALA A O     1 
ATOM   2295  C  CB    . ALA E 3 190 ? 125.261 -52.062 35.678  1.00 28.59  ? 486 ALA A CB    1 
ATOM   2296  N  N     . GLU E 3 191 ? 126.815 -51.498 38.518  1.00 29.39  ? 487 GLU A N     1 
ATOM   2297  C  CA    . GLU E 3 191 ? 127.300 -51.980 39.806  1.00 29.90  ? 487 GLU A CA    1 
ATOM   2298  C  C     . GLU E 3 191 ? 126.768 -51.108 40.932  1.00 29.35  ? 487 GLU A C     1 
ATOM   2299  O  O     . GLU E 3 191 ? 126.111 -51.606 41.849  1.00 29.56  ? 487 GLU A O     1 
ATOM   2300  C  CB    . GLU E 3 191 ? 128.829 -52.015 39.849  1.00 29.65  ? 487 GLU A CB    1 
ATOM   2301  C  CG    . GLU E 3 191 ? 129.441 -53.205 39.143  1.00 31.12  ? 487 GLU A CG    1 
ATOM   2302  C  CD    . GLU E 3 191 ? 130.975 -53.168 39.117  1.00 32.16  ? 487 GLU A CD    1 
ATOM   2303  O  OE1   . GLU E 3 191 ? 131.577 -54.092 38.511  1.00 34.86  ? 487 GLU A OE1   1 
ATOM   2304  O  OE2   . GLU E 3 191 ? 131.581 -52.221 39.691  1.00 34.55  ? 487 GLU A OE2   1 
ATOM   2305  N  N     . MET E 3 192 ? 127.059 -49.811 40.858  1.00 28.85  ? 488 MET A N     1 
ATOM   2306  C  CA    . MET E 3 192 ? 126.586 -48.847 41.843  1.00 28.31  ? 488 MET A CA    1 
ATOM   2307  C  C     . MET E 3 192 ? 125.075 -48.986 42.064  1.00 28.59  ? 488 MET A C     1 
ATOM   2308  O  O     . MET E 3 192 ? 124.586 -48.961 43.202  1.00 28.64  ? 488 MET A O     1 
ATOM   2309  C  CB    . MET E 3 192 ? 126.928 -47.433 41.382  1.00 28.35  ? 488 MET A CB    1 
ATOM   2310  C  CG    . MET E 3 192 ? 128.420 -47.197 41.131  1.00 28.27  ? 488 MET A CG    1 
ATOM   2311  S  SD    . MET E 3 192 ? 128.753 -45.761 40.082  1.00 27.19  ? 488 MET A SD    1 
ATOM   2312  C  CE    . MET E 3 192 ? 127.986 -44.462 41.044  1.00 27.38  ? 488 MET A CE    1 
ATOM   2313  N  N     . GLU E 3 193 ? 124.338 -49.151 40.974  1.00 28.41  ? 489 GLU A N     1 
ATOM   2314  C  CA    . GLU E 3 193 ? 122.905 -49.322 41.072  1.00 28.71  ? 489 GLU A CA    1 
ATOM   2315  C  C     . GLU E 3 193 ? 122.580 -50.555 41.908  1.00 28.84  ? 489 GLU A C     1 
ATOM   2316  O  O     . GLU E 3 193 ? 121.783 -50.490 42.836  1.00 28.94  ? 489 GLU A O     1 
ATOM   2317  C  CB    . GLU E 3 193 ? 122.257 -49.403 39.677  1.00 28.62  ? 489 GLU A CB    1 
ATOM   2318  C  CG    . GLU E 3 193 ? 122.149 -48.051 38.960  1.00 28.34  ? 489 GLU A CG    1 
ATOM   2319  C  CD    . GLU E 3 193 ? 121.623 -48.151 37.533  1.00 28.75  ? 489 GLU A CD    1 
ATOM   2320  O  OE1   . GLU E 3 193 ? 121.699 -47.137 36.813  1.00 29.14  ? 489 GLU A OE1   1 
ATOM   2321  O  OE2   . GLU E 3 193 ? 121.132 -49.226 37.121  1.00 28.64  ? 489 GLU A OE2   1 
ATOM   2322  N  N     . PHE E 3 194 ? 123.230 -51.669 41.597  1.00 29.10  ? 490 PHE A N     1 
ATOM   2323  C  CA    . PHE E 3 194 ? 122.936 -52.939 42.266  1.00 29.42  ? 490 PHE A CA    1 
ATOM   2324  C  C     . PHE E 3 194 ? 123.387 -52.978 43.735  1.00 29.42  ? 490 PHE A C     1 
ATOM   2325  O  O     . PHE E 3 194 ? 122.679 -53.502 44.598  1.00 29.36  ? 490 PHE A O     1 
ATOM   2326  C  CB    . PHE E 3 194 ? 123.535 -54.106 41.472  1.00 29.31  ? 490 PHE A CB    1 
ATOM   2327  C  CG    . PHE E 3 194 ? 123.153 -55.460 41.995  1.00 30.21  ? 490 PHE A CG    1 
ATOM   2328  C  CD1   . PHE E 3 194 ? 121.854 -55.947 41.824  1.00 30.52  ? 490 PHE A CD1   1 
ATOM   2329  C  CD2   . PHE E 3 194 ? 124.090 -56.256 42.656  1.00 30.14  ? 490 PHE A CD2   1 
ATOM   2330  C  CE1   . PHE E 3 194 ? 121.491 -57.195 42.310  1.00 29.59  ? 490 PHE A CE1   1 
ATOM   2331  C  CE2   . PHE E 3 194 ? 123.737 -57.502 43.143  1.00 28.97  ? 490 PHE A CE2   1 
ATOM   2332  C  CZ    . PHE E 3 194 ? 122.438 -57.974 42.967  1.00 29.83  ? 490 PHE A CZ    1 
ATOM   2333  N  N     . ALA E 3 195 ? 124.556 -52.411 44.012  1.00 29.43  ? 491 ALA A N     1 
ATOM   2334  C  CA    . ALA E 3 195 ? 125.084 -52.387 45.366  1.00 29.57  ? 491 ALA A CA    1 
ATOM   2335  C  C     . ALA E 3 195 ? 124.134 -51.625 46.283  1.00 29.84  ? 491 ALA A C     1 
ATOM   2336  O  O     . ALA E 3 195 ? 123.936 -51.999 47.436  1.00 29.67  ? 491 ALA A O     1 
ATOM   2337  C  CB    . ALA E 3 195 ? 126.464 -51.765 45.385  1.00 29.52  ? 491 ALA A CB    1 
ATOM   2338  N  N     . GLY E 3 196 ? 123.549 -50.554 45.750  1.00 30.28  ? 492 GLY A N     1 
ATOM   2339  C  CA    . GLY E 3 196 ? 122.601 -49.731 46.487  1.00 30.28  ? 492 GLY A CA    1 
ATOM   2340  C  C     . GLY E 3 196 ? 123.275 -48.870 47.528  1.00 30.37  ? 492 GLY A C     1 
ATOM   2341  O  O     . GLY E 3 196 ? 124.500 -48.860 47.641  1.00 30.26  ? 492 GLY A O     1 
ATOM   2342  N  N     . VAL E 3 197 ? 122.469 -48.125 48.275  1.00 30.72  ? 493 VAL A N     1 
ATOM   2343  C  CA    . VAL E 3 197 ? 122.967 -47.301 49.371  1.00 31.10  ? 493 VAL A CA    1 
ATOM   2344  C  C     . VAL E 3 197 ? 122.183 -47.681 50.619  1.00 31.38  ? 493 VAL A C     1 
ATOM   2345  O  O     . VAL E 3 197 ? 120.958 -47.797 50.558  1.00 31.26  ? 493 VAL A O     1 
ATOM   2346  C  CB    . VAL E 3 197 ? 122.767 -45.807 49.099  1.00 30.89  ? 493 VAL A CB    1 
ATOM   2347  C  CG1   . VAL E 3 197 ? 123.564 -44.985 50.106  1.00 31.32  ? 493 VAL A CG1   1 
ATOM   2348  C  CG2   . VAL E 3 197 ? 123.194 -45.467 47.693  1.00 31.23  ? 493 VAL A CG2   1 
ATOM   2349  N  N     . LYS E 3 198 ? 122.864 -47.864 51.749  1.00 31.83  ? 494 LYS A N     1 
ATOM   2350  C  CA    . LYS E 3 198 ? 122.149 -48.254 52.956  1.00 32.40  ? 494 LYS A CA    1 
ATOM   2351  C  C     . LYS E 3 198 ? 121.576 -47.059 53.709  1.00 32.70  ? 494 LYS A C     1 
ATOM   2352  O  O     . LYS E 3 198 ? 122.233 -46.028 53.860  1.00 32.65  ? 494 LYS A O     1 
ATOM   2353  C  CB    . LYS E 3 198 ? 122.997 -49.149 53.855  1.00 32.60  ? 494 LYS A CB    1 
ATOM   2354  C  CG    . LYS E 3 198 ? 122.158 -49.948 54.867  1.00 33.07  ? 494 LYS A CG    1 
ATOM   2355  C  CD    . LYS E 3 198 ? 122.842 -51.249 55.254  1.00 34.42  ? 494 LYS A CD    1 
ATOM   2356  C  CE    . LYS E 3 198 ? 122.175 -51.914 56.445  1.00 35.56  ? 494 LYS A CE    1 
ATOM   2357  N  NZ    . LYS E 3 198 ? 122.313 -51.107 57.698  1.00 36.43  ? 494 LYS A NZ    1 
ATOM   2358  N  N     . VAL E 3 199 ? 120.334 -47.210 54.162  1.00 33.10  ? 495 VAL A N     1 
ATOM   2359  C  CA    . VAL E 3 199 ? 119.603 -46.133 54.820  1.00 33.65  ? 495 VAL A CA    1 
ATOM   2360  C  C     . VAL E 3 199 ? 119.164 -46.487 56.240  1.00 34.28  ? 495 VAL A C     1 
ATOM   2361  O  O     . VAL E 3 199 ? 118.653 -47.584 56.496  1.00 34.15  ? 495 VAL A O     1 
ATOM   2362  C  CB    . VAL E 3 199 ? 118.360 -45.720 53.982  1.00 33.45  ? 495 VAL A CB    1 
ATOM   2363  C  CG1   . VAL E 3 199 ? 117.397 -44.874 54.789  1.00 32.83  ? 495 VAL A CG1   1 
ATOM   2364  C  CG2   . VAL E 3 199 ? 118.787 -44.983 52.718  1.00 33.77  ? 495 VAL A CG2   1 
ATOM   2365  N  N     . ASP E 3 200 ? 119.383 -45.543 57.153  1.00 35.06  ? 496 ASP A N     1 
ATOM   2366  C  CA    . ASP E 3 200 ? 118.926 -45.641 58.535  1.00 35.92  ? 496 ASP A CA    1 
ATOM   2367  C  C     . ASP E 3 200 ? 117.453 -45.215 58.592  1.00 36.30  ? 496 ASP A C     1 
ATOM   2368  O  O     . ASP E 3 200 ? 117.139 -44.021 58.629  1.00 36.30  ? 496 ASP A O     1 
ATOM   2369  C  CB    . ASP E 3 200 ? 119.777 -44.723 59.411  1.00 35.97  ? 496 ASP A CB    1 
ATOM   2370  C  CG    . ASP E 3 200 ? 119.629 -45.012 60.891  1.00 37.04  ? 496 ASP A CG    1 
ATOM   2371  O  OD1   . ASP E 3 200 ? 118.518 -45.338 61.362  1.00 37.51  ? 496 ASP A OD1   1 
ATOM   2372  O  OD2   . ASP E 3 200 ? 120.646 -44.894 61.599  1.00 38.97  ? 496 ASP A OD2   1 
ATOM   2373  N  N     . THR E 3 201 ? 116.554 -46.194 58.588  1.00 36.98  ? 497 THR A N     1 
ATOM   2374  C  CA    . THR E 3 201 ? 115.119 -45.922 58.592  1.00 37.61  ? 497 THR A CA    1 
ATOM   2375  C  C     . THR E 3 201 ? 114.661 -45.445 59.960  1.00 38.26  ? 497 THR A C     1 
ATOM   2376  O  O     . THR E 3 201 ? 113.842 -44.523 60.061  1.00 38.29  ? 497 THR A O     1 
ATOM   2377  C  CB    . THR E 3 201 ? 114.288 -47.156 58.170  1.00 37.65  ? 497 THR A CB    1 
ATOM   2378  O  OG1   . THR E 3 201 ? 114.596 -48.267 59.020  1.00 37.70  ? 497 THR A OG1   1 
ATOM   2379  C  CG2   . THR E 3 201 ? 114.584 -47.536 56.731  1.00 37.73  ? 497 THR A CG2   1 
ATOM   2380  N  N     . LYS E 3 202 ? 115.197 -46.064 61.013  1.00 38.94  ? 498 LYS A N     1 
ATOM   2381  C  CA    . LYS E 3 202 ? 114.857 -45.667 62.377  1.00 39.41  ? 498 LYS A CA    1 
ATOM   2382  C  C     . LYS E 3 202 ? 114.998 -44.160 62.512  1.00 39.58  ? 498 LYS A C     1 
ATOM   2383  O  O     . LYS E 3 202 ? 114.068 -43.487 62.959  1.00 39.59  ? 498 LYS A O     1 
ATOM   2384  C  CB    . LYS E 3 202 ? 115.712 -46.402 63.420  1.00 39.64  ? 498 LYS A CB    1 
ATOM   2385  C  CG    . LYS E 3 202 ? 115.403 -47.908 63.537  1.00 40.11  ? 498 LYS A CG    1 
ATOM   2386  C  CD    . LYS E 3 202 ? 116.097 -48.564 64.737  1.00 39.64  ? 498 LYS A CD    1 
ATOM   2387  C  CE    . LYS E 3 202 ? 115.875 -50.084 64.755  1.00 40.01  ? 498 LYS A CE    1 
ATOM   2388  N  NZ    . LYS E 3 202 ? 114.422 -50.453 64.756  1.00 39.59  ? 498 LYS A NZ    1 
ATOM   2389  N  N     . ARG E 3 203 ? 116.149 -43.639 62.081  1.00 39.80  ? 499 ARG A N     1 
ATOM   2390  C  CA    . ARG E 3 203 ? 116.432 -42.205 62.134  1.00 39.99  ? 499 ARG A CA    1 
ATOM   2391  C  C     . ARG E 3 203 ? 115.492 -41.407 61.235  1.00 39.68  ? 499 ARG A C     1 
ATOM   2392  O  O     . ARG E 3 203 ? 115.020 -40.331 61.605  1.00 39.77  ? 499 ARG A O     1 
ATOM   2393  C  CB    . ARG E 3 203 ? 117.884 -41.923 61.736  1.00 40.18  ? 499 ARG A CB    1 
ATOM   2394  C  CG    . ARG E 3 203 ? 118.315 -40.487 62.012  1.00 41.65  ? 499 ARG A CG    1 
ATOM   2395  C  CD    . ARG E 3 203 ? 119.836 -40.352 62.046  1.00 44.03  ? 499 ARG A CD    1 
ATOM   2396  N  NE    . ARG E 3 203 ? 120.262 -39.452 63.121  1.00 45.42  ? 499 ARG A NE    1 
ATOM   2397  C  CZ    . ARG E 3 203 ? 121.529 -39.204 63.459  1.00 46.74  ? 499 ARG A CZ    1 
ATOM   2398  N  NH1   . ARG E 3 203 ? 122.533 -39.771 62.795  1.00 47.16  ? 499 ARG A NH1   1 
ATOM   2399  N  NH2   . ARG E 3 203 ? 121.794 -38.374 64.464  1.00 47.04  ? 499 ARG A NH2   1 
ATOM   2400  N  N     . LEU E 3 204 ? 115.218 -41.953 60.058  1.00 39.35  ? 500 LEU A N     1 
ATOM   2401  C  CA    . LEU E 3 204 ? 114.421 -41.259 59.060  1.00 38.96  ? 500 LEU A CA    1 
ATOM   2402  C  C     . LEU E 3 204 ? 112.974 -41.098 59.512  1.00 38.86  ? 500 LEU A C     1 
ATOM   2403  O  O     . LEU E 3 204 ? 112.367 -40.057 59.293  1.00 38.44  ? 500 LEU A O     1 
ATOM   2404  C  CB    . LEU E 3 204 ? 114.515 -42.001 57.728  1.00 38.71  ? 500 LEU A CB    1 
ATOM   2405  C  CG    . LEU E 3 204 ? 114.444 -41.179 56.445  1.00 38.46  ? 500 LEU A CG    1 
ATOM   2406  C  CD1   . LEU E 3 204 ? 115.393 -39.997 56.502  1.00 38.59  ? 500 LEU A CD1   1 
ATOM   2407  C  CD2   . LEU E 3 204 ? 114.781 -42.052 55.260  1.00 37.68  ? 500 LEU A CD2   1 
ATOM   2408  N  N     . GLU E 3 205 ? 112.442 -42.129 60.165  1.00 39.32  ? 501 GLU A N     1 
ATOM   2409  C  CA    . GLU E 3 205 ? 111.075 -42.121 60.701  1.00 39.70  ? 501 GLU A CA    1 
ATOM   2410  C  C     . GLU E 3 205 ? 110.921 -41.189 61.905  1.00 40.03  ? 501 GLU A C     1 
ATOM   2411  O  O     . GLU E 3 205 ? 109.857 -40.612 62.132  1.00 39.76  ? 501 GLU A O     1 
ATOM   2412  C  CB    . GLU E 3 205 ? 110.657 -43.540 61.077  1.00 39.45  ? 501 GLU A CB    1 
ATOM   2413  C  CG    . GLU E 3 205 ? 110.523 -44.438 59.868  1.00 39.62  ? 501 GLU A CG    1 
ATOM   2414  C  CD    . GLU E 3 205 ? 110.386 -45.912 60.202  1.00 39.99  ? 501 GLU A CD    1 
ATOM   2415  O  OE1   . GLU E 3 205 ? 110.585 -46.320 61.370  1.00 39.20  ? 501 GLU A OE1   1 
ATOM   2416  O  OE2   . GLU E 3 205 ? 110.083 -46.674 59.266  1.00 40.94  ? 501 GLU A OE2   1 
ATOM   2417  N  N     . GLN E 3 206 ? 111.997 -41.055 62.669  1.00 40.75  ? 502 GLN A N     1 
ATOM   2418  C  CA    . GLN E 3 206 ? 112.033 -40.185 63.830  1.00 41.79  ? 502 GLN A CA    1 
ATOM   2419  C  C     . GLN E 3 206 ? 111.931 -38.716 63.404  1.00 42.01  ? 502 GLN A C     1 
ATOM   2420  O  O     . GLN E 3 206 ? 111.234 -37.916 64.027  1.00 41.90  ? 502 GLN A O     1 
ATOM   2421  C  CB    . GLN E 3 206 ? 113.331 -40.432 64.614  1.00 42.01  ? 502 GLN A CB    1 
ATOM   2422  C  CG    . GLN E 3 206 ? 113.508 -39.563 65.860  1.00 43.90  ? 502 GLN A CG    1 
ATOM   2423  C  CD    . GLN E 3 206 ? 112.438 -39.812 66.924  1.00 46.09  ? 502 GLN A CD    1 
ATOM   2424  O  OE1   . GLN E 3 206 ? 112.238 -40.947 67.367  1.00 47.82  ? 502 GLN A OE1   1 
ATOM   2425  N  NE2   . GLN E 3 206 ? 111.754 -38.746 67.345  1.00 46.24  ? 502 GLN A NE2   1 
ATOM   2426  N  N     . MET E 3 207 ? 112.625 -38.381 62.323  1.00 42.46  ? 503 MET A N     1 
ATOM   2427  C  CA    . MET E 3 207 ? 112.670 -37.020 61.811  1.00 43.06  ? 503 MET A CA    1 
ATOM   2428  C  C     . MET E 3 207 ? 111.334 -36.560 61.212  1.00 43.06  ? 503 MET A C     1 
ATOM   2429  O  O     . MET E 3 207 ? 110.910 -35.420 61.429  1.00 42.87  ? 503 MET A O     1 
ATOM   2430  C  CB    . MET E 3 207 ? 113.778 -36.922 60.773  1.00 43.00  ? 503 MET A CB    1 
ATOM   2431  C  CG    . MET E 3 207 ? 114.236 -35.519 60.467  1.00 43.29  ? 503 MET A CG    1 
ATOM   2432  S  SD    . MET E 3 207 ? 115.598 -35.583 59.288  1.00 44.33  ? 503 MET A SD    1 
ATOM   2433  C  CE    . MET E 3 207 ? 116.776 -36.653 60.147  1.00 43.75  ? 503 MET A CE    1 
ATOM   2434  N  N     . GLY E 3 208 ? 110.691 -37.449 60.453  1.00 43.24  ? 504 GLY A N     1 
ATOM   2435  C  CA    . GLY E 3 208 ? 109.389 -37.178 59.848  1.00 43.48  ? 504 GLY A CA    1 
ATOM   2436  C  C     . GLY E 3 208 ? 108.346 -36.928 60.916  1.00 43.85  ? 504 GLY A C     1 
ATOM   2437  O  O     . GLY E 3 208 ? 107.437 -36.113 60.734  1.00 43.83  ? 504 GLY A O     1 
ATOM   2438  N  N     . LYS E 3 209 ? 108.483 -37.646 62.028  1.00 44.19  ? 505 LYS A N     1 
ATOM   2439  C  CA    . LYS E 3 209 ? 107.646 -37.465 63.209  1.00 44.74  ? 505 LYS A CA    1 
ATOM   2440  C  C     . LYS E 3 209 ? 107.866 -36.050 63.767  1.00 44.81  ? 505 LYS A C     1 
ATOM   2441  O  O     . LYS E 3 209 ? 106.911 -35.299 63.978  1.00 44.54  ? 505 LYS A O     1 
ATOM   2442  C  CB    . LYS E 3 209 ? 107.986 -38.549 64.247  1.00 45.02  ? 505 LYS A CB    1 
ATOM   2443  C  CG    . LYS E 3 209 ? 107.582 -38.276 65.694  1.00 45.67  ? 505 LYS A CG    1 
ATOM   2444  C  CD    . LYS E 3 209 ? 106.158 -38.704 66.010  1.00 47.36  ? 505 LYS A CD    1 
ATOM   2445  C  CE    . LYS E 3 209 ? 105.866 -38.456 67.491  1.00 48.55  ? 505 LYS A CE    1 
ATOM   2446  N  NZ    . LYS E 3 209 ? 104.589 -39.068 67.967  1.00 49.31  ? 505 LYS A NZ    1 
ATOM   2447  N  N     . GLU E 3 210 ? 109.127 -35.683 63.982  1.00 45.00  ? 506 GLU A N     1 
ATOM   2448  C  CA    . GLU E 3 210 ? 109.452 -34.339 64.440  1.00 45.45  ? 506 GLU A CA    1 
ATOM   2449  C  C     . GLU E 3 210 ? 109.026 -33.285 63.423  1.00 45.60  ? 506 GLU A C     1 
ATOM   2450  O  O     . GLU E 3 210 ? 108.456 -32.261 63.795  1.00 45.41  ? 506 GLU A O     1 
ATOM   2451  C  CB    . GLU E 3 210 ? 110.929 -34.234 64.799  1.00 45.42  ? 506 GLU A CB    1 
ATOM   2452  C  CG    . GLU E 3 210 ? 111.218 -34.838 66.163  1.00 46.86  ? 506 GLU A CG    1 
ATOM   2453  C  CD    . GLU E 3 210 ? 112.634 -35.370 66.309  1.00 48.95  ? 506 GLU A CD    1 
ATOM   2454  O  OE1   . GLU E 3 210 ? 113.320 -35.560 65.276  1.00 50.57  ? 506 GLU A OE1   1 
ATOM   2455  O  OE2   . GLU E 3 210 ? 113.054 -35.621 67.462  1.00 49.12  ? 506 GLU A OE2   1 
ATOM   2456  N  N     . LEU E 3 211 ? 109.274 -33.551 62.142  1.00 45.96  ? 507 LEU A N     1 
ATOM   2457  C  CA    . LEU E 3 211 ? 108.831 -32.647 61.077  1.00 46.40  ? 507 LEU A CA    1 
ATOM   2458  C  C     . LEU E 3 211 ? 107.327 -32.371 61.109  1.00 46.45  ? 507 LEU A C     1 
ATOM   2459  O  O     . LEU E 3 211 ? 106.909 -31.229 60.936  1.00 46.52  ? 507 LEU A O     1 
ATOM   2460  C  CB    . LEU E 3 211 ? 109.266 -33.140 59.689  1.00 46.45  ? 507 LEU A CB    1 
ATOM   2461  C  CG    . LEU E 3 211 ? 110.720 -32.822 59.316  1.00 46.78  ? 507 LEU A CG    1 
ATOM   2462  C  CD1   . LEU E 3 211 ? 111.131 -33.498 58.017  1.00 46.82  ? 507 LEU A CD1   1 
ATOM   2463  C  CD2   . LEU E 3 211 ? 110.949 -31.313 59.238  1.00 46.40  ? 507 LEU A CD2   1 
ATOM   2464  N  N     . ALA E 3 212 ? 106.525 -33.407 61.344  1.00 46.67  ? 508 ALA A N     1 
ATOM   2465  C  CA    . ALA E 3 212 ? 105.070 -33.251 61.417  1.00 47.12  ? 508 ALA A CA    1 
ATOM   2466  C  C     . ALA E 3 212 ? 104.643 -32.327 62.557  1.00 47.56  ? 508 ALA A C     1 
ATOM   2467  O  O     . ALA E 3 212 ? 103.689 -31.552 62.414  1.00 47.56  ? 508 ALA A O     1 
ATOM   2468  C  CB    . ALA E 3 212 ? 104.388 -34.601 61.552  1.00 46.94  ? 508 ALA A CB    1 
ATOM   2469  N  N     . GLU E 3 213 ? 105.354 -32.414 63.683  1.00 48.00  ? 509 GLU A N     1 
ATOM   2470  C  CA    . GLU E 3 213 ? 105.056 -31.588 64.853  1.00 48.33  ? 509 GLU A CA    1 
ATOM   2471  C  C     . GLU E 3 213 ? 105.305 -30.119 64.509  1.00 47.84  ? 509 GLU A C     1 
ATOM   2472  O  O     . GLU E 3 213 ? 104.514 -29.248 64.872  1.00 47.84  ? 509 GLU A O     1 
ATOM   2473  C  CB    . GLU E 3 213 ? 105.878 -32.033 66.088  1.00 48.39  ? 509 GLU A CB    1 
ATOM   2474  C  CG    . GLU E 3 213 ? 107.265 -31.363 66.253  1.00 49.38  ? 509 GLU A CG    1 
ATOM   2475  C  CD    . GLU E 3 213 ? 108.186 -32.067 67.262  1.00 49.51  ? 509 GLU A CD    1 
ATOM   2476  O  OE1   . GLU E 3 213 ? 107.909 -33.231 67.636  1.00 50.88  ? 509 GLU A OE1   1 
ATOM   2477  O  OE2   . GLU E 3 213 ? 109.206 -31.457 67.667  1.00 50.37  ? 509 GLU A OE2   1 
ATOM   2478  N  N     . GLN E 3 214 ? 106.386 -29.859 63.775  1.00 47.40  ? 510 GLN A N     1 
ATOM   2479  C  CA    . GLN E 3 214 ? 106.750 -28.497 63.418  1.00 47.05  ? 510 GLN A CA    1 
ATOM   2480  C  C     . GLN E 3 214 ? 105.851 -27.957 62.314  1.00 46.61  ? 510 GLN A C     1 
ATOM   2481  O  O     . GLN E 3 214 ? 105.530 -26.768 62.299  1.00 46.52  ? 510 GLN A O     1 
ATOM   2482  C  CB    . GLN E 3 214 ? 108.222 -28.410 63.021  1.00 47.19  ? 510 GLN A CB    1 
ATOM   2483  C  CG    . GLN E 3 214 ? 108.747 -26.983 62.969  1.00 48.04  ? 510 GLN A CG    1 
ATOM   2484  C  CD    . GLN E 3 214 ? 110.262 -26.914 62.886  1.00 49.53  ? 510 GLN A CD    1 
ATOM   2485  O  OE1   . GLN E 3 214 ? 110.941 -27.939 62.828  1.00 50.39  ? 510 GLN A OE1   1 
ATOM   2486  N  NE2   . GLN E 3 214 ? 110.800 -25.697 62.888  1.00 49.85  ? 510 GLN A NE2   1 
ATOM   2487  N  N     . LEU E 3 215 ? 105.440 -28.836 61.404  1.00 46.03  ? 511 LEU A N     1 
ATOM   2488  C  CA    . LEU E 3 215 ? 104.523 -28.453 60.333  1.00 45.66  ? 511 LEU A CA    1 
ATOM   2489  C  C     . LEU E 3 215 ? 103.185 -27.924 60.856  1.00 45.56  ? 511 LEU A C     1 
ATOM   2490  O  O     . LEU E 3 215 ? 102.692 -26.898 60.384  1.00 45.50  ? 511 LEU A O     1 
ATOM   2491  C  CB    . LEU E 3 215 ? 104.300 -29.607 59.353  1.00 45.45  ? 511 LEU A CB    1 
ATOM   2492  C  CG    . LEU E 3 215 ? 105.337 -29.719 58.235  1.00 45.09  ? 511 LEU A CG    1 
ATOM   2493  C  CD1   . LEU E 3 215 ? 105.179 -31.022 57.503  1.00 44.80  ? 511 LEU A CD1   1 
ATOM   2494  C  CD2   . LEU E 3 215 ? 105.208 -28.560 57.273  1.00 44.51  ? 511 LEU A CD2   1 
ATOM   2495  N  N     . GLY E 3 216 ? 102.604 -28.628 61.826  1.00 45.45  ? 512 GLY A N     1 
ATOM   2496  C  CA    . GLY E 3 216 ? 101.340 -28.209 62.439  1.00 44.93  ? 512 GLY A CA    1 
ATOM   2497  C  C     . GLY E 3 216 ? 101.497 -26.881 63.157  1.00 44.53  ? 512 GLY A C     1 
ATOM   2498  O  O     . GLY E 3 216 ? 100.596 -26.047 63.138  1.00 44.73  ? 512 GLY A O     1 
ATOM   2499  N  N     . THR E 3 217 ? 102.654 -26.691 63.786  1.00 44.10  ? 513 THR A N     1 
ATOM   2500  C  CA    . THR E 3 217 ? 102.984 -25.434 64.450  1.00 43.66  ? 513 THR A CA    1 
ATOM   2501  C  C     . THR E 3 217 ? 102.962 -24.275 63.445  1.00 43.43  ? 513 THR A C     1 
ATOM   2502  O  O     . THR E 3 217 ? 102.132 -23.367 63.556  1.00 43.47  ? 513 THR A O     1 
ATOM   2503  C  CB    . THR E 3 217 ? 104.371 -25.509 65.142  1.00 43.65  ? 513 THR A CB    1 
ATOM   2504  O  OG1   . THR E 3 217 ? 104.374 -26.568 66.107  1.00 43.21  ? 513 THR A OG1   1 
ATOM   2505  C  CG2   . THR E 3 217 ? 104.710 -24.200 65.834  1.00 43.39  ? 513 THR A CG2   1 
ATOM   2506  N  N     . VAL E 3 218 ? 103.856 -24.328 62.457  1.00 42.90  ? 514 VAL A N     1 
ATOM   2507  C  CA    . VAL E 3 218 ? 103.973 -23.261 61.457  1.00 42.53  ? 514 VAL A CA    1 
ATOM   2508  C  C     . VAL E 3 218 ? 102.637 -23.013 60.761  1.00 42.18  ? 514 VAL A C     1 
ATOM   2509  O  O     . VAL E 3 218 ? 102.259 -21.869 60.498  1.00 41.65  ? 514 VAL A O     1 
ATOM   2510  C  CB    . VAL E 3 218 ? 105.074 -23.576 60.410  1.00 42.59  ? 514 VAL A CB    1 
ATOM   2511  C  CG1   . VAL E 3 218 ? 105.168 -22.471 59.354  1.00 42.35  ? 514 VAL A CG1   1 
ATOM   2512  C  CG2   . VAL E 3 218 ? 106.414 -23.757 61.095  1.00 42.54  ? 514 VAL A CG2   1 
ATOM   2513  N  N     . GLU E 3 219 ? 101.926 -24.102 60.495  1.00 41.97  ? 515 GLU A N     1 
ATOM   2514  C  CA    . GLU E 3 219 ? 100.633 -24.064 59.825  1.00 41.96  ? 515 GLU A CA    1 
ATOM   2515  C  C     . GLU E 3 219 ? 99.604  -23.225 60.585  1.00 42.12  ? 515 GLU A C     1 
ATOM   2516  O  O     . GLU E 3 219 ? 98.928  -22.380 59.986  1.00 41.93  ? 515 GLU A O     1 
ATOM   2517  C  CB    . GLU E 3 219 ? 100.120 -25.486 59.645  1.00 41.86  ? 515 GLU A CB    1 
ATOM   2518  C  CG    . GLU E 3 219 ? 98.773  -25.607 59.008  1.00 41.57  ? 515 GLU A CG    1 
ATOM   2519  C  CD    . GLU E 3 219 ? 98.257  -27.029 59.056  1.00 42.20  ? 515 GLU A CD    1 
ATOM   2520  O  OE1   . GLU E 3 219 ? 97.044  -27.232 58.847  1.00 42.30  ? 515 GLU A OE1   1 
ATOM   2521  O  OE2   . GLU E 3 219 ? 99.066  -27.949 59.308  1.00 42.46  ? 515 GLU A OE2   1 
ATOM   2522  N  N     . GLN E 3 220 ? 99.487  -23.461 61.895  1.00 42.15  ? 516 GLN A N     1 
ATOM   2523  C  CA    . GLN E 3 220 ? 98.538  -22.712 62.717  1.00 42.21  ? 516 GLN A CA    1 
ATOM   2524  C  C     . GLN E 3 220 ? 98.891  -21.251 62.646  1.00 41.96  ? 516 GLN A C     1 
ATOM   2525  O  O     . GLN E 3 220 ? 98.021  -20.402 62.451  1.00 41.88  ? 516 GLN A O     1 
ATOM   2526  C  CB    . GLN E 3 220 ? 98.553  -23.163 64.185  1.00 42.48  ? 516 GLN A CB    1 
ATOM   2527  C  CG    . GLN E 3 220 ? 98.207  -24.622 64.409  1.00 43.53  ? 516 GLN A CG    1 
ATOM   2528  C  CD    . GLN E 3 220 ? 96.957  -25.036 63.667  1.00 45.12  ? 516 GLN A CD    1 
ATOM   2529  O  OE1   . GLN E 3 220 ? 95.927  -24.355 63.724  1.00 45.36  ? 516 GLN A OE1   1 
ATOM   2530  N  NE2   . GLN E 3 220 ? 97.038  -26.160 62.959  1.00 45.29  ? 516 GLN A NE2   1 
ATOM   2531  N  N     . ARG E 3 221 ? 100.184 -20.972 62.798  1.00 41.78  ? 517 ARG A N     1 
ATOM   2532  C  CA    . ARG E 3 221 ? 100.687 -19.614 62.754  1.00 41.71  ? 517 ARG A CA    1 
ATOM   2533  C  C     . ARG E 3 221 ? 100.243 -18.957 61.450  1.00 41.34  ? 517 ARG A C     1 
ATOM   2534  O  O     . ARG E 3 221 ? 99.801  -17.808 61.449  1.00 41.24  ? 517 ARG A O     1 
ATOM   2535  C  CB    . ARG E 3 221 ? 102.213 -19.603 62.893  1.00 41.88  ? 517 ARG A CB    1 
ATOM   2536  C  CG    . ARG E 3 221 ? 102.841 -18.209 63.039  1.00 43.37  ? 517 ARG A CG    1 
ATOM   2537  C  CD    . ARG E 3 221 ? 102.707 -17.645 64.453  1.00 45.59  ? 517 ARG A CD    1 
ATOM   2538  N  NE    . ARG E 3 221 ? 103.038 -16.218 64.540  1.00 46.80  ? 517 ARG A NE    1 
ATOM   2539  C  CZ    . ARG E 3 221 ? 102.138 -15.234 64.599  1.00 46.75  ? 517 ARG A CZ    1 
ATOM   2540  N  NH1   . ARG E 3 221 ? 100.838 -15.503 64.585  1.00 46.61  ? 517 ARG A NH1   1 
ATOM   2541  N  NH2   . ARG E 3 221 ? 102.537 -13.973 64.676  1.00 46.45  ? 517 ARG A NH2   1 
ATOM   2542  N  N     . ILE E 3 222 ? 100.329 -19.707 60.349  1.00 41.02  ? 518 ILE A N     1 
ATOM   2543  C  CA    . ILE E 3 222 ? 99.967  -19.177 59.034  1.00 40.48  ? 518 ILE A CA    1 
ATOM   2544  C  C     . ILE E 3 222 ? 98.480  -18.789 58.947  1.00 40.53  ? 518 ILE A C     1 
ATOM   2545  O  O     . ILE E 3 222 ? 98.135  -17.758 58.374  1.00 40.24  ? 518 ILE A O     1 
ATOM   2546  C  CB    . ILE E 3 222 ? 100.410 -20.117 57.875  1.00 40.47  ? 518 ILE A CB    1 
ATOM   2547  C  CG1   . ILE E 3 222 ? 101.937 -20.254 57.863  1.00 40.36  ? 518 ILE A CG1   1 
ATOM   2548  C  CG2   . ILE E 3 222 ? 99.940  -19.575 56.527  1.00 39.82  ? 518 ILE A CG2   1 
ATOM   2549  C  CD1   . ILE E 3 222 ? 102.482 -21.284 56.888  1.00 39.90  ? 518 ILE A CD1   1 
ATOM   2550  N  N     . TYR E 3 223 ? 97.613  -19.599 59.547  1.00 40.56  ? 519 TYR A N     1 
ATOM   2551  C  CA    . TYR E 3 223 ? 96.180  -19.323 59.513  1.00 40.68  ? 519 TYR A CA    1 
ATOM   2552  C  C     . TYR E 3 223 ? 95.817  -18.111 60.344  1.00 40.69  ? 519 TYR A C     1 
ATOM   2553  O  O     . TYR E 3 223 ? 94.862  -17.400 60.042  1.00 40.32  ? 519 TYR A O     1 
ATOM   2554  C  CB    . TYR E 3 223 ? 95.376  -20.526 59.993  1.00 40.58  ? 519 TYR A CB    1 
ATOM   2555  C  CG    . TYR E 3 223 ? 95.583  -21.748 59.150  1.00 41.09  ? 519 TYR A CG    1 
ATOM   2556  C  CD1   . TYR E 3 223 ? 95.741  -21.641 57.769  1.00 40.96  ? 519 TYR A CD1   1 
ATOM   2557  C  CD2   . TYR E 3 223 ? 95.584  -23.019 59.720  1.00 40.51  ? 519 TYR A CD2   1 
ATOM   2558  C  CE1   . TYR E 3 223 ? 95.922  -22.759 56.983  1.00 40.61  ? 519 TYR A CE1   1 
ATOM   2559  C  CE2   . TYR E 3 223 ? 95.756  -24.138 58.941  1.00 40.03  ? 519 TYR A CE2   1 
ATOM   2560  C  CZ    . TYR E 3 223 ? 95.929  -24.002 57.575  1.00 40.54  ? 519 TYR A CZ    1 
ATOM   2561  O  OH    . TYR E 3 223 ? 96.115  -25.113 56.791  1.00 41.42  ? 519 TYR A OH    1 
ATOM   2562  N  N     . GLU E 3 224 ? 96.593  -17.894 61.395  1.00 41.04  ? 520 GLU A N     1 
ATOM   2563  C  CA    . GLU E 3 224 ? 96.375  -16.792 62.305  1.00 41.55  ? 520 GLU A CA    1 
ATOM   2564  C  C     . GLU E 3 224 ? 96.697  -15.483 61.606  1.00 41.11  ? 520 GLU A C     1 
ATOM   2565  O  O     . GLU E 3 224 ? 95.886  -14.564 61.598  1.00 41.23  ? 520 GLU A O     1 
ATOM   2566  C  CB    . GLU E 3 224 ? 97.250  -16.971 63.539  1.00 42.01  ? 520 GLU A CB    1 
ATOM   2567  C  CG    . GLU E 3 224 ? 96.806  -16.171 64.742  1.00 44.57  ? 520 GLU A CG    1 
ATOM   2568  C  CD    . GLU E 3 224 ? 97.406  -16.707 66.032  1.00 48.60  ? 520 GLU A CD    1 
ATOM   2569  O  OE1   . GLU E 3 224 ? 96.778  -16.521 67.103  1.00 50.17  ? 520 GLU A OE1   1 
ATOM   2570  O  OE2   . GLU E 3 224 ? 98.494  -17.335 65.972  1.00 50.40  ? 520 GLU A OE2   1 
ATOM   2571  N  N     . LEU E 3 225 ? 97.876  -15.416 60.998  1.00 40.80  ? 521 LEU A N     1 
ATOM   2572  C  CA    . LEU E 3 225 ? 98.304  -14.230 60.258  1.00 40.35  ? 521 LEU A CA    1 
ATOM   2573  C  C     . LEU E 3 225 ? 97.358  -13.933 59.101  1.00 39.98  ? 521 LEU A C     1 
ATOM   2574  O  O     . LEU E 3 225 ? 97.068  -12.768 58.813  1.00 40.14  ? 521 LEU A O     1 
ATOM   2575  C  CB    . LEU E 3 225 ? 99.729  -14.412 59.731  1.00 40.34  ? 521 LEU A CB    1 
ATOM   2576  C  CG    . LEU E 3 225 ? 100.779 -14.733 60.793  1.00 40.52  ? 521 LEU A CG    1 
ATOM   2577  C  CD1   . LEU E 3 225 ? 102.101 -15.126 60.161  1.00 40.31  ? 521 LEU A CD1   1 
ATOM   2578  C  CD2   . LEU E 3 225 ? 100.946 -13.559 61.744  1.00 40.85  ? 521 LEU A CD2   1 
ATOM   2579  N  N     . ALA E 3 226 ? 96.870  -14.990 58.457  1.00 39.34  ? 522 ALA A N     1 
ATOM   2580  C  CA    . ALA E 3 226 ? 95.976  -14.852 57.316  1.00 38.98  ? 522 ALA A CA    1 
ATOM   2581  C  C     . ALA E 3 226 ? 94.542  -14.631 57.753  1.00 38.79  ? 522 ALA A C     1 
ATOM   2582  O  O     . ALA E 3 226 ? 93.731  -14.129 56.983  1.00 38.57  ? 522 ALA A O     1 
ATOM   2583  C  CB    . ALA E 3 226 ? 96.062  -16.073 56.417  1.00 38.86  ? 522 ALA A CB    1 
ATOM   2584  N  N     . GLY E 3 227 ? 94.235  -15.028 58.987  1.00 38.87  ? 523 GLY A N     1 
ATOM   2585  C  CA    . GLY E 3 227 ? 92.883  -14.909 59.539  1.00 38.48  ? 523 GLY A CA    1 
ATOM   2586  C  C     . GLY E 3 227 ? 91.881  -15.851 58.897  1.00 38.37  ? 523 GLY A C     1 
ATOM   2587  O  O     . GLY E 3 227 ? 90.702  -15.520 58.784  1.00 38.31  ? 523 GLY A O     1 
ATOM   2588  N  N     . GLN E 3 228 ? 92.346  -17.034 58.496  1.00 38.34  ? 524 GLN A N     1 
ATOM   2589  C  CA    . GLN E 3 228 ? 91.504  -18.013 57.799  1.00 38.30  ? 524 GLN A CA    1 
ATOM   2590  C  C     . GLN E 3 228 ? 92.273  -19.309 57.504  1.00 38.08  ? 524 GLN A C     1 
ATOM   2591  O  O     . GLN E 3 228 ? 93.495  -19.359 57.625  1.00 38.23  ? 524 GLN A O     1 
ATOM   2592  C  CB    . GLN E 3 228 ? 91.013  -17.400 56.487  1.00 38.35  ? 524 GLN A CB    1 
ATOM   2593  C  CG    . GLN E 3 228 ? 90.210  -18.313 55.596  1.00 39.18  ? 524 GLN A CG    1 
ATOM   2594  C  CD    . GLN E 3 228 ? 89.999  -17.711 54.228  1.00 40.91  ? 524 GLN A CD    1 
ATOM   2595  O  OE1   . GLN E 3 228 ? 90.275  -16.529 54.010  1.00 41.48  ? 524 GLN A OE1   1 
ATOM   2596  N  NE2   . GLN E 3 228 ? 89.516  -18.520 53.292  1.00 41.64  ? 524 GLN A NE2   1 
ATOM   2597  N  N     . GLU E 3 229 ? 91.552  -20.360 57.135  1.00 37.67  ? 525 GLU A N     1 
ATOM   2598  C  CA    . GLU E 3 229 ? 92.183  -21.599 56.708  1.00 37.20  ? 525 GLU A CA    1 
ATOM   2599  C  C     . GLU E 3 229 ? 92.077  -21.729 55.196  1.00 36.66  ? 525 GLU A C     1 
ATOM   2600  O  O     . GLU E 3 229 ? 91.066  -21.357 54.589  1.00 36.65  ? 525 GLU A O     1 
ATOM   2601  C  CB    . GLU E 3 229 ? 91.561  -22.821 57.385  1.00 37.17  ? 525 GLU A CB    1 
ATOM   2602  C  CG    . GLU E 3 229 ? 91.970  -23.025 58.843  1.00 37.19  ? 525 GLU A CG    1 
ATOM   2603  C  CD    . GLU E 3 229 ? 91.561  -24.401 59.386  1.00 37.82  ? 525 GLU A CD    1 
ATOM   2604  O  OE1   . GLU E 3 229 ? 91.007  -25.221 58.608  1.00 37.77  ? 525 GLU A OE1   1 
ATOM   2605  O  OE2   . GLU E 3 229 ? 91.798  -24.663 60.591  1.00 38.11  ? 525 GLU A OE2   1 
ATOM   2606  N  N     . PHE E 3 230 ? 93.136  -22.255 54.597  1.00 35.92  ? 526 PHE A N     1 
ATOM   2607  C  CA    . PHE E 3 230 ? 93.201  -22.472 53.159  1.00 35.16  ? 526 PHE A CA    1 
ATOM   2608  C  C     . PHE E 3 230 ? 94.240  -23.570 52.966  1.00 34.77  ? 526 PHE A C     1 
ATOM   2609  O  O     . PHE E 3 230 ? 94.841  -24.030 53.944  1.00 34.70  ? 526 PHE A O     1 
ATOM   2610  C  CB    . PHE E 3 230 ? 93.589  -21.178 52.422  1.00 34.90  ? 526 PHE A CB    1 
ATOM   2611  C  CG    . PHE E 3 230 ? 94.959  -20.646 52.795  1.00 35.30  ? 526 PHE A CG    1 
ATOM   2612  C  CD1   . PHE E 3 230 ? 95.171  -20.004 54.013  1.00 34.50  ? 526 PHE A CD1   1 
ATOM   2613  C  CD2   . PHE E 3 230 ? 96.043  -20.792 51.922  1.00 35.52  ? 526 PHE A CD2   1 
ATOM   2614  C  CE1   . PHE E 3 230 ? 96.431  -19.527 54.355  1.00 34.32  ? 526 PHE A CE1   1 
ATOM   2615  C  CE2   . PHE E 3 230 ? 97.313  -20.316 52.266  1.00 34.12  ? 526 PHE A CE2   1 
ATOM   2616  C  CZ    . PHE E 3 230 ? 97.501  -19.683 53.479  1.00 34.20  ? 526 PHE A CZ    1 
ATOM   2617  N  N     . ASN E 3 231 ? 94.433  -24.009 51.726  1.00 34.18  ? 527 ASN A N     1 
ATOM   2618  C  CA    . ASN E 3 231 ? 95.436  -25.018 51.426  1.00 33.72  ? 527 ASN A CA    1 
ATOM   2619  C  C     . ASN E 3 231 ? 96.717  -24.301 51.043  1.00 33.61  ? 527 ASN A C     1 
ATOM   2620  O  O     . ASN E 3 231 ? 96.814  -23.724 49.962  1.00 33.53  ? 527 ASN A O     1 
ATOM   2621  C  CB    . ASN E 3 231 ? 94.964  -25.943 50.293  1.00 33.58  ? 527 ASN A CB    1 
ATOM   2622  C  CG    . ASN E 3 231 ? 95.880  -27.146 50.089  1.00 32.90  ? 527 ASN A CG    1 
ATOM   2623  O  OD1   . ASN E 3 231 ? 97.107  -27.040 50.132  1.00 31.94  ? 527 ASN A OD1   1 
ATOM   2624  N  ND2   . ASN E 3 231 ? 95.277  -28.297 49.861  1.00 32.91  ? 527 ASN A ND2   1 
ATOM   2625  N  N     . ILE E 3 232 ? 97.699  -24.334 51.932  1.00 33.46  ? 528 ILE A N     1 
ATOM   2626  C  CA    . ILE E 3 232 ? 98.945  -23.623 51.694  1.00 33.70  ? 528 ILE A CA    1 
ATOM   2627  C  C     . ILE E 3 232 ? 99.643  -24.153 50.443  1.00 34.24  ? 528 ILE A C     1 
ATOM   2628  O  O     . ILE E 3 232 ? 100.221 -23.383 49.671  1.00 34.34  ? 528 ILE A O     1 
ATOM   2629  C  CB    . ILE E 3 232 ? 99.871  -23.695 52.919  1.00 33.52  ? 528 ILE A CB    1 
ATOM   2630  C  CG1   . ILE E 3 232 ? 99.093  -23.319 54.183  1.00 33.57  ? 528 ILE A CG1   1 
ATOM   2631  C  CG2   . ILE E 3 232 ? 101.069 -22.785 52.740  1.00 33.08  ? 528 ILE A CG2   1 
ATOM   2632  C  CD1   . ILE E 3 232 ? 99.763  -23.738 55.470  1.00 33.43  ? 528 ILE A CD1   1 
ATOM   2633  N  N     . ASN E 3 233 ? 99.556  -25.463 50.223  1.00 34.67  ? 529 ASN A N     1 
ATOM   2634  C  CA    . ASN E 3 233 ? 100.177 -26.072 49.061  1.00 34.99  ? 529 ASN A CA    1 
ATOM   2635  C  C     . ASN E 3 233 ? 99.396  -25.853 47.771  1.00 35.30  ? 529 ASN A C     1 
ATOM   2636  O  O     . ASN E 3 233 ? 99.731  -26.430 46.743  1.00 35.55  ? 529 ASN A O     1 
ATOM   2637  C  CB    . ASN E 3 233 ? 100.393 -27.550 49.303  1.00 35.21  ? 529 ASN A CB    1 
ATOM   2638  C  CG    . ASN E 3 233 ? 101.253 -27.811 50.514  1.00 36.22  ? 529 ASN A CG    1 
ATOM   2639  O  OD1   . ASN E 3 233 ? 102.196 -27.073 50.793  1.00 37.76  ? 529 ASN A OD1   1 
ATOM   2640  N  ND2   . ASN E 3 233 ? 100.938 -28.872 51.242  1.00 37.35  ? 529 ASN A ND2   1 
ATOM   2641  N  N     . SER E 3 234 ? 98.357  -25.024 47.822  1.00 35.56  ? 530 SER A N     1 
ATOM   2642  C  CA    . SER E 3 234 ? 97.605  -24.675 46.623  1.00 35.77  ? 530 SER A CA    1 
ATOM   2643  C  C     . SER E 3 234 ? 97.940  -23.254 46.217  1.00 36.23  ? 530 SER A C     1 
ATOM   2644  O  O     . SER E 3 234 ? 97.466  -22.310 46.830  1.00 36.27  ? 530 SER A O     1 
ATOM   2645  C  CB    . SER E 3 234 ? 96.099  -24.789 46.851  1.00 35.74  ? 530 SER A CB    1 
ATOM   2646  O  OG    . SER E 3 234 ? 95.383  -24.272 45.735  1.00 34.59  ? 530 SER A OG    1 
ATOM   2647  N  N     . PRO E 3 235 ? 98.765  -23.093 45.178  1.00 36.89  ? 531 PRO A N     1 
ATOM   2648  C  CA    . PRO E 3 235 ? 99.144  -21.747 44.741  1.00 37.14  ? 531 PRO A CA    1 
ATOM   2649  C  C     . PRO E 3 235 ? 97.941  -20.859 44.379  1.00 37.06  ? 531 PRO A C     1 
ATOM   2650  O  O     . PRO E 3 235 ? 98.002  -19.635 44.522  1.00 36.92  ? 531 PRO A O     1 
ATOM   2651  C  CB    . PRO E 3 235 ? 100.040 -22.016 43.521  1.00 37.33  ? 531 PRO A CB    1 
ATOM   2652  C  CG    . PRO E 3 235 ? 100.595 -23.401 43.771  1.00 37.32  ? 531 PRO A CG    1 
ATOM   2653  C  CD    . PRO E 3 235 ? 99.428  -24.140 44.377  1.00 37.13  ? 531 PRO A CD    1 
ATOM   2654  N  N     . LYS E 3 236 ? 96.851  -21.479 43.951  1.00 37.12  ? 532 LYS A N     1 
ATOM   2655  C  CA    . LYS E 3 236 ? 95.656  -20.739 43.567  1.00 37.04  ? 532 LYS A CA    1 
ATOM   2656  C  C     . LYS E 3 236 ? 94.987  -20.120 44.791  1.00 36.73  ? 532 LYS A C     1 
ATOM   2657  O  O     . LYS E 3 236 ? 94.635  -18.944 44.777  1.00 36.89  ? 532 LYS A O     1 
ATOM   2658  C  CB    . LYS E 3 236 ? 94.696  -21.669 42.828  1.00 37.38  ? 532 LYS A CB    1 
ATOM   2659  C  CG    . LYS E 3 236 ? 93.788  -20.994 41.826  1.00 38.74  ? 532 LYS A CG    1 
ATOM   2660  C  CD    . LYS E 3 236 ? 93.327  -22.008 40.793  1.00 40.75  ? 532 LYS A CD    1 
ATOM   2661  C  CE    . LYS E 3 236 ? 92.431  -21.388 39.738  1.00 41.30  ? 532 LYS A CE    1 
ATOM   2662  N  NZ    . LYS E 3 236 ? 92.028  -22.432 38.757  1.00 41.55  ? 532 LYS A NZ    1 
ATOM   2663  N  N     . GLN E 3 237 ? 94.826  -20.909 45.850  1.00 36.22  ? 533 GLN A N     1 
ATOM   2664  C  CA    . GLN E 3 237 ? 94.211  -20.428 47.083  1.00 35.86  ? 533 GLN A CA    1 
ATOM   2665  C  C     . GLN E 3 237 ? 95.153  -19.486 47.836  1.00 35.75  ? 533 GLN A C     1 
ATOM   2666  O  O     . GLN E 3 237 ? 94.730  -18.468 48.392  1.00 35.52  ? 533 GLN A O     1 
ATOM   2667  C  CB    . GLN E 3 237 ? 93.831  -21.602 47.983  1.00 35.96  ? 533 GLN A CB    1 
ATOM   2668  C  CG    . GLN E 3 237 ? 92.959  -22.646 47.320  1.00 35.53  ? 533 GLN A CG    1 
ATOM   2669  C  CD    . GLN E 3 237 ? 92.520  -23.717 48.285  1.00 34.68  ? 533 GLN A CD    1 
ATOM   2670  O  OE1   . GLN E 3 237 ? 92.654  -23.567 49.496  1.00 34.37  ? 533 GLN A OE1   1 
ATOM   2671  N  NE2   . GLN E 3 237 ? 91.986  -24.808 47.753  1.00 35.53  ? 533 GLN A NE2   1 
ATOM   2672  N  N     . LEU E 3 238 ? 96.434  -19.843 47.858  1.00 35.51  ? 534 LEU A N     1 
ATOM   2673  C  CA    . LEU E 3 238 ? 97.458  -18.991 48.448  1.00 35.27  ? 534 LEU A CA    1 
ATOM   2674  C  C     . LEU E 3 238 ? 97.468  -17.636 47.743  1.00 34.56  ? 534 LEU A C     1 
ATOM   2675  O  O     . LEU E 3 238 ? 97.565  -16.597 48.387  1.00 34.55  ? 534 LEU A O     1 
ATOM   2676  C  CB    . LEU E 3 238 ? 98.832  -19.650 48.340  1.00 35.20  ? 534 LEU A CB    1 
ATOM   2677  C  CG    . LEU E 3 238 ? 99.998  -18.821 48.880  1.00 35.94  ? 534 LEU A CG    1 
ATOM   2678  C  CD1   . LEU E 3 238 ? 99.759  -18.491 50.345  1.00 36.10  ? 534 LEU A CD1   1 
ATOM   2679  C  CD2   . LEU E 3 238 ? 101.334 -19.548 48.686  1.00 35.83  ? 534 LEU A CD2   1 
ATOM   2680  N  N     . GLY E 3 239 ? 97.357  -17.656 46.419  1.00 33.87  ? 535 GLY A N     1 
ATOM   2681  C  CA    . GLY E 3 239 ? 97.308  -16.424 45.638  1.00 33.50  ? 535 GLY A CA    1 
ATOM   2682  C  C     . GLY E 3 239 ? 96.137  -15.531 46.014  1.00 33.15  ? 535 GLY A C     1 
ATOM   2683  O  O     . GLY E 3 239 ? 96.262  -14.308 46.045  1.00 32.79  ? 535 GLY A O     1 
ATOM   2684  N  N     . VAL E 3 240 ? 94.994  -16.147 46.300  1.00 32.88  ? 536 VAL A N     1 
ATOM   2685  C  CA    . VAL E 3 240 ? 93.819  -15.402 46.718  1.00 32.70  ? 536 VAL A CA    1 
ATOM   2686  C  C     . VAL E 3 240 ? 94.085  -14.755 48.069  1.00 32.50  ? 536 VAL A C     1 
ATOM   2687  O  O     . VAL E 3 240 ? 93.792  -13.578 48.258  1.00 32.67  ? 536 VAL A O     1 
ATOM   2688  C  CB    . VAL E 3 240 ? 92.553  -16.291 46.777  1.00 32.88  ? 536 VAL A CB    1 
ATOM   2689  C  CG1   . VAL E 3 240 ? 91.410  -15.571 47.492  1.00 32.82  ? 536 VAL A CG1   1 
ATOM   2690  C  CG2   . VAL E 3 240 ? 92.129  -16.703 45.377  1.00 32.53  ? 536 VAL A CG2   1 
ATOM   2691  N  N     . ILE E 3 241 ? 94.660  -15.515 48.997  1.00 32.16  ? 537 ILE A N     1 
ATOM   2692  C  CA    . ILE E 3 241 ? 94.992  -14.983 50.318  1.00 31.83  ? 537 ILE A CA    1 
ATOM   2693  C  C     . ILE E 3 241 ? 95.964  -13.813 50.243  1.00 31.77  ? 537 ILE A C     1 
ATOM   2694  O  O     . ILE E 3 241 ? 95.669  -12.723 50.724  1.00 31.70  ? 537 ILE A O     1 
ATOM   2695  C  CB    . ILE E 3 241 ? 95.599  -16.064 51.232  1.00 32.04  ? 537 ILE A CB    1 
ATOM   2696  C  CG1   . ILE E 3 241 ? 94.536  -17.094 51.626  1.00 31.23  ? 537 ILE A CG1   1 
ATOM   2697  C  CG2   . ILE E 3 241 ? 96.250  -15.422 52.479  1.00 31.67  ? 537 ILE A CG2   1 
ATOM   2698  C  CD1   . ILE E 3 241 ? 93.432  -16.535 52.503  1.00 31.61  ? 537 ILE A CD1   1 
ATOM   2699  N  N     . LEU E 3 242 ? 97.118  -14.038 49.623  1.00 31.63  ? 538 LEU A N     1 
ATOM   2700  C  CA    . LEU E 3 242 ? 98.151  -13.013 49.564  1.00 31.57  ? 538 LEU A CA    1 
ATOM   2701  C  C     . LEU E 3 242 ? 97.744  -11.751 48.806  1.00 31.67  ? 538 LEU A C     1 
ATOM   2702  O  O     . LEU E 3 242 ? 97.824  -10.655 49.344  1.00 31.72  ? 538 LEU A O     1 
ATOM   2703  C  CB    . LEU E 3 242 ? 99.443  -13.572 48.973  1.00 31.25  ? 538 LEU A CB    1 
ATOM   2704  C  CG    . LEU E 3 242 ? 100.103 -14.712 49.750  1.00 30.88  ? 538 LEU A CG    1 
ATOM   2705  C  CD1   . LEU E 3 242 ? 101.457 -15.053 49.134  1.00 29.87  ? 538 LEU A CD1   1 
ATOM   2706  C  CD2   . LEU E 3 242 ? 100.238 -14.390 51.241  1.00 29.07  ? 538 LEU A CD2   1 
ATOM   2707  N  N     . PHE E 3 243 ? 97.285  -11.911 47.570  1.00 31.78  ? 539 PHE A N     1 
ATOM   2708  C  CA    . PHE E 3 243 ? 97.026  -10.763 46.701  1.00 31.76  ? 539 PHE A CA    1 
ATOM   2709  C  C     . PHE E 3 243 ? 95.594  -10.228 46.698  1.00 31.98  ? 539 PHE A C     1 
ATOM   2710  O  O     . PHE E 3 243 ? 95.370  -9.088  46.311  1.00 31.95  ? 539 PHE A O     1 
ATOM   2711  C  CB    . PHE E 3 243 ? 97.508  -11.053 45.276  1.00 31.52  ? 539 PHE A CB    1 
ATOM   2712  C  CG    . PHE E 3 243 ? 98.913  -11.611 45.216  1.00 31.38  ? 539 PHE A CG    1 
ATOM   2713  C  CD1   . PHE E 3 243 ? 100.008 -10.816 45.539  1.00 31.35  ? 539 PHE A CD1   1 
ATOM   2714  C  CD2   . PHE E 3 243 ? 99.135  -12.929 44.845  1.00 30.25  ? 539 PHE A CD2   1 
ATOM   2715  C  CE1   . PHE E 3 243 ? 101.294 -11.322 45.492  1.00 31.11  ? 539 PHE A CE1   1 
ATOM   2716  C  CE2   . PHE E 3 243 ? 100.412 -13.442 44.794  1.00 30.59  ? 539 PHE A CE2   1 
ATOM   2717  C  CZ    . PHE E 3 243 ? 101.498 -12.636 45.119  1.00 31.22  ? 539 PHE A CZ    1 
ATOM   2718  N  N     . GLU E 3 244 ? 94.629  -11.030 47.131  1.00 32.44  ? 540 GLU A N     1 
ATOM   2719  C  CA    . GLU E 3 244 ? 93.247  -10.551 47.180  1.00 33.04  ? 540 GLU A CA    1 
ATOM   2720  C  C     . GLU E 3 244 ? 92.787  -10.190 48.594  1.00 33.44  ? 540 GLU A C     1 
ATOM   2721  O  O     . GLU E 3 244 ? 92.365  -9.059  48.838  1.00 34.03  ? 540 GLU A O     1 
ATOM   2722  C  CB    . GLU E 3 244 ? 92.292  -11.525 46.488  1.00 33.08  ? 540 GLU A CB    1 
ATOM   2723  C  CG    . GLU E 3 244 ? 92.436  -11.519 44.966  1.00 33.24  ? 540 GLU A CG    1 
ATOM   2724  C  CD    . GLU E 3 244 ? 91.689  -12.653 44.309  1.00 33.87  ? 540 GLU A CD    1 
ATOM   2725  O  OE1   . GLU E 3 244 ? 92.041  -13.026 43.166  1.00 35.06  ? 540 GLU A OE1   1 
ATOM   2726  O  OE2   . GLU E 3 244 ? 90.759  -13.191 44.943  1.00 34.02  ? 540 GLU A OE2   1 
ATOM   2727  N  N     . LYS E 3 245 ? 92.885  -11.124 49.530  1.00 33.38  ? 541 LYS A N     1 
ATOM   2728  C  CA    . LYS E 3 245 ? 92.516  -10.805 50.898  1.00 33.52  ? 541 LYS A CA    1 
ATOM   2729  C  C     . LYS E 3 245 ? 93.526  -9.873  51.562  1.00 33.83  ? 541 LYS A C     1 
ATOM   2730  O  O     . LYS E 3 245 ? 93.137  -8.842  52.109  1.00 34.25  ? 541 LYS A O     1 
ATOM   2731  C  CB    . LYS E 3 245 ? 92.335  -12.063 51.736  1.00 33.52  ? 541 LYS A CB    1 
ATOM   2732  C  CG    . LYS E 3 245 ? 91.910  -11.775 53.159  1.00 33.44  ? 541 LYS A CG    1 
ATOM   2733  C  CD    . LYS E 3 245 ? 91.778  -13.051 53.963  1.00 33.84  ? 541 LYS A CD    1 
ATOM   2734  C  CE    . LYS E 3 245 ? 91.196  -12.769 55.347  1.00 34.49  ? 541 LYS A CE    1 
ATOM   2735  N  NZ    . LYS E 3 245 ? 92.034  -11.803 56.125  1.00 34.69  ? 541 LYS A NZ    1 
ATOM   2736  N  N     . LEU E 3 246 ? 94.816  -10.209 51.501  1.00 33.78  ? 542 LEU A N     1 
ATOM   2737  C  CA    . LEU E 3 246 ? 95.849  -9.391  52.162  1.00 33.59  ? 542 LEU A CA    1 
ATOM   2738  C  C     . LEU E 3 246 ? 96.261  -8.150  51.377  1.00 33.75  ? 542 LEU A C     1 
ATOM   2739  O  O     . LEU E 3 246 ? 96.945  -7.274  51.919  1.00 34.04  ? 542 LEU A O     1 
ATOM   2740  C  CB    . LEU E 3 246 ? 97.095  -10.214 52.513  1.00 33.34  ? 542 LEU A CB    1 
ATOM   2741  C  CG    . LEU E 3 246 ? 96.942  -11.355 53.518  1.00 33.07  ? 542 LEU A CG    1 
ATOM   2742  C  CD1   . LEU E 3 246 ? 98.306  -11.815 53.973  1.00 31.74  ? 542 LEU A CD1   1 
ATOM   2743  C  CD2   . LEU E 3 246 ? 96.089  -10.943 54.716  1.00 32.19  ? 542 LEU A CD2   1 
ATOM   2744  N  N     . GLN E 3 247 ? 95.869  -8.088  50.105  1.00 33.67  ? 543 GLN A N     1 
ATOM   2745  C  CA    . GLN E 3 247 ? 96.138  -6.923  49.251  1.00 33.70  ? 543 GLN A CA    1 
ATOM   2746  C  C     . GLN E 3 247 ? 97.610  -6.677  48.889  1.00 33.46  ? 543 GLN A C     1 
ATOM   2747  O  O     . GLN E 3 247 ? 97.932  -5.661  48.265  1.00 33.53  ? 543 GLN A O     1 
ATOM   2748  C  CB    . GLN E 3 247 ? 95.536  -5.651  49.869  1.00 33.90  ? 543 GLN A CB    1 
ATOM   2749  C  CG    . GLN E 3 247 ? 94.021  -5.509  49.740  1.00 34.93  ? 543 GLN A CG    1 
ATOM   2750  C  CD    . GLN E 3 247 ? 93.571  -5.052  48.357  1.00 36.55  ? 543 GLN A CD    1 
ATOM   2751  O  OE1   . GLN E 3 247 ? 94.218  -5.326  47.342  1.00 36.51  ? 543 GLN A OE1   1 
ATOM   2752  N  NE2   . GLN E 3 247 ? 92.447  -4.349  48.316  1.00 37.85  ? 543 GLN A NE2   1 
ATOM   2753  N  N     . LEU E 3 248 ? 98.496  -7.591  49.276  1.00 33.00  ? 544 LEU A N     1 
ATOM   2754  C  CA    . LEU E 3 248 ? 99.913  -7.471  48.958  1.00 32.74  ? 544 LEU A CA    1 
ATOM   2755  C  C     . LEU E 3 248 ? 100.095 -7.217  47.465  1.00 32.73  ? 544 LEU A C     1 
ATOM   2756  O  O     . LEU E 3 248 ? 99.327  -7.737  46.653  1.00 32.73  ? 544 LEU A O     1 
ATOM   2757  C  CB    . LEU E 3 248 ? 100.658 -8.742  49.368  1.00 32.62  ? 544 LEU A CB    1 
ATOM   2758  C  CG    . LEU E 3 248 ? 100.565 -9.133  50.844  1.00 32.53  ? 544 LEU A CG    1 
ATOM   2759  C  CD1   . LEU E 3 248 ? 101.171 -10.507 51.077  1.00 32.57  ? 544 LEU A CD1   1 
ATOM   2760  C  CD2   . LEU E 3 248 ? 101.240 -8.102  51.715  1.00 32.68  ? 544 LEU A CD2   1 
ATOM   2761  N  N     . PRO E 3 249 ? 101.115 -6.420  47.094  1.00 32.70  ? 545 PRO A N     1 
ATOM   2762  C  CA    . PRO E 3 249 ? 101.340 -6.066  45.684  1.00 32.69  ? 545 PRO A CA    1 
ATOM   2763  C  C     . PRO E 3 249 ? 101.622 -7.278  44.807  1.00 32.59  ? 545 PRO A C     1 
ATOM   2764  O  O     . PRO E 3 249 ? 102.196 -8.255  45.270  1.00 32.81  ? 545 PRO A O     1 
ATOM   2765  C  CB    . PRO E 3 249 ? 102.583 -5.171  45.734  1.00 32.51  ? 545 PRO A CB    1 
ATOM   2766  C  CG    . PRO E 3 249 ? 102.685 -4.718  47.146  1.00 32.70  ? 545 PRO A CG    1 
ATOM   2767  C  CD    . PRO E 3 249 ? 102.122 -5.814  47.983  1.00 32.63  ? 545 PRO A CD    1 
ATOM   2768  N  N     . VAL E 3 250 ? 101.218 -7.208  43.546  1.00 32.50  ? 546 VAL A N     1 
ATOM   2769  C  CA    . VAL E 3 250 ? 101.456 -8.295  42.612  1.00 32.32  ? 546 VAL A CA    1 
ATOM   2770  C  C     . VAL E 3 250 ? 102.743 -8.011  41.857  1.00 32.24  ? 546 VAL A C     1 
ATOM   2771  O  O     . VAL E 3 250 ? 102.781 -7.107  41.026  1.00 31.91  ? 546 VAL A O     1 
ATOM   2772  C  CB    . VAL E 3 250 ? 100.294 -8.417  41.615  1.00 32.62  ? 546 VAL A CB    1 
ATOM   2773  C  CG1   . VAL E 3 250 ? 100.556 -9.544  40.597  1.00 32.21  ? 546 VAL A CG1   1 
ATOM   2774  C  CG2   . VAL E 3 250 ? 98.972  -8.620  42.366  1.00 31.93  ? 546 VAL A CG2   1 
ATOM   2775  N  N     . LEU E 3 251 ? 103.797 -8.775  42.149  1.00 32.30  ? 547 LEU A N     1 
ATOM   2776  C  CA    . LEU E 3 251 ? 105.097 -8.547  41.510  1.00 32.38  ? 547 LEU A CA    1 
ATOM   2777  C  C     . LEU E 3 251 ? 105.264 -9.328  40.217  1.00 32.77  ? 547 LEU A C     1 
ATOM   2778  O  O     . LEU E 3 251 ? 106.128 -9.017  39.400  1.00 32.80  ? 547 LEU A O     1 
ATOM   2779  C  CB    . LEU E 3 251 ? 106.244 -8.924  42.444  1.00 32.02  ? 547 LEU A CB    1 
ATOM   2780  C  CG    . LEU E 3 251 ? 106.235 -8.424  43.883  1.00 31.60  ? 547 LEU A CG    1 
ATOM   2781  C  CD1   . LEU E 3 251 ? 107.371 -9.091  44.648  1.00 30.18  ? 547 LEU A CD1   1 
ATOM   2782  C  CD2   . LEU E 3 251 ? 106.334 -6.912  43.954  1.00 30.56  ? 547 LEU A CD2   1 
ATOM   2783  N  N     . LYS E 3 252 ? 104.457 -10.361 40.034  1.00 33.36  ? 548 LYS A N     1 
ATOM   2784  C  CA    . LYS E 3 252 ? 104.592 -11.196 38.847  1.00 33.85  ? 548 LYS A CA    1 
ATOM   2785  C  C     . LYS E 3 252 ? 103.405 -12.117 38.680  1.00 33.78  ? 548 LYS A C     1 
ATOM   2786  O  O     . LYS E 3 252 ? 102.834 -12.605 39.653  1.00 33.45  ? 548 LYS A O     1 
ATOM   2787  C  CB    . LYS E 3 252 ? 105.897 -12.010 38.922  1.00 33.94  ? 548 LYS A CB    1 
ATOM   2788  C  CG    . LYS E 3 252 ? 106.072 -13.083 37.863  1.00 34.31  ? 548 LYS A CG    1 
ATOM   2789  C  CD    . LYS E 3 252 ? 107.482 -13.687 37.906  1.00 34.33  ? 548 LYS A CD    1 
ATOM   2790  C  CE    . LYS E 3 252 ? 107.730 -14.613 36.698  1.00 34.48  ? 548 LYS A CE    1 
ATOM   2791  N  NZ    . LYS E 3 252 ? 109.179 -14.786 36.404  1.00 32.81  ? 548 LYS A NZ    1 
ATOM   2792  N  N     . LYS E 3 253 ? 103.024 -12.323 37.428  1.00 34.37  ? 549 LYS A N     1 
ATOM   2793  C  CA    . LYS E 3 253 ? 101.995 -13.286 37.093  1.00 34.93  ? 549 LYS A CA    1 
ATOM   2794  C  C     . LYS E 3 253 ? 102.630 -14.405 36.286  1.00 35.28  ? 549 LYS A C     1 
ATOM   2795  O  O     . LYS E 3 253 ? 103.772 -14.282 35.826  1.00 35.35  ? 549 LYS A O     1 
ATOM   2796  C  CB    . LYS E 3 253 ? 100.882 -12.647 36.263  1.00 34.76  ? 549 LYS A CB    1 
ATOM   2797  C  CG    . LYS E 3 253 ? 99.866  -11.824 37.030  1.00 34.76  ? 549 LYS A CG    1 
ATOM   2798  C  CD    . LYS E 3 253 ? 98.850  -11.249 36.033  1.00 36.12  ? 549 LYS A CD    1 
ATOM   2799  C  CE    . LYS E 3 253 ? 97.817  -10.337 36.687  1.00 36.45  ? 549 LYS A CE    1 
ATOM   2800  N  NZ    . LYS E 3 253 ? 97.060  -9.556  35.670  1.00 36.07  ? 549 LYS A NZ    1 
ATOM   2801  N  N     . THR E 3 254 ? 101.892 -15.505 36.151  1.00 35.73  ? 550 THR A N     1 
ATOM   2802  C  CA    . THR E 3 254 ? 102.258 -16.593 35.246  1.00 36.02  ? 550 THR A CA    1 
ATOM   2803  C  C     . THR E 3 254 ? 101.139 -16.709 34.211  1.00 36.02  ? 550 THR A C     1 
ATOM   2804  O  O     . THR E 3 254 ? 100.272 -15.829 34.136  1.00 35.67  ? 550 THR A O     1 
ATOM   2805  C  CB    . THR E 3 254 ? 102.493 -17.943 35.969  1.00 36.12  ? 550 THR A CB    1 
ATOM   2806  O  OG1   . THR E 3 254 ? 101.369 -18.270 36.802  1.00 36.73  ? 550 THR A OG1   1 
ATOM   2807  C  CG2   . THR E 3 254 ? 103.747 -17.882 36.815  1.00 36.27  ? 550 THR A CG2   1 
ATOM   2808  N  N     . LYS E 3 255 ? 101.151 -17.774 33.413  1.00 36.01  ? 551 LYS A N     1 
ATOM   2809  C  CA    . LYS E 3 255 ? 100.103 -17.945 32.409  1.00 35.98  ? 551 LYS A CA    1 
ATOM   2810  C  C     . LYS E 3 255 ? 98.795  -18.468 33.021  1.00 35.52  ? 551 LYS A C     1 
ATOM   2811  O  O     . LYS E 3 255 ? 97.753  -18.443 32.366  1.00 35.33  ? 551 LYS A O     1 
ATOM   2812  C  CB    . LYS E 3 255 ? 100.567 -18.821 31.237  1.00 36.09  ? 551 LYS A CB    1 
ATOM   2813  C  CG    . LYS E 3 255 ? 100.932 -20.245 31.615  1.00 37.21  ? 551 LYS A CG    1 
ATOM   2814  C  CD    . LYS E 3 255 ? 100.765 -21.186 30.426  1.00 39.13  ? 551 LYS A CD    1 
ATOM   2815  C  CE    . LYS E 3 255 ? 100.846 -22.652 30.861  1.00 39.53  ? 551 LYS A CE    1 
ATOM   2816  N  NZ    . LYS E 3 255 ? 100.322 -23.595 29.821  1.00 39.68  ? 551 LYS A NZ    1 
ATOM   2817  N  N     . THR E 3 256 ? 98.850  -18.922 34.273  1.00 35.06  ? 552 THR A N     1 
ATOM   2818  C  CA    . THR E 3 256 ? 97.655  -19.427 34.957  1.00 34.74  ? 552 THR A CA    1 
ATOM   2819  C  C     . THR E 3 256 ? 97.258  -18.584 36.157  1.00 34.43  ? 552 THR A C     1 
ATOM   2820  O  O     . THR E 3 256 ? 96.313  -18.924 36.864  1.00 34.34  ? 552 THR A O     1 
ATOM   2821  C  CB    . THR E 3 256 ? 97.811  -20.894 35.441  1.00 34.68  ? 552 THR A CB    1 
ATOM   2822  O  OG1   . THR E 3 256 ? 98.899  -20.985 36.362  1.00 34.88  ? 552 THR A OG1   1 
ATOM   2823  C  CG2   . THR E 3 256 ? 98.067  -21.836 34.279  1.00 34.91  ? 552 THR A CG2   1 
ATOM   2824  N  N     . GLY E 3 257 ? 97.988  -17.501 36.411  1.00 34.22  ? 553 GLY A N     1 
ATOM   2825  C  CA    . GLY E 3 257 ? 97.640  -16.626 37.532  1.00 34.00  ? 553 GLY A CA    1 
ATOM   2826  C  C     . GLY E 3 257 ? 98.774  -15.909 38.244  1.00 33.73  ? 553 GLY A C     1 
ATOM   2827  O  O     . GLY E 3 257 ? 99.814  -15.627 37.647  1.00 33.49  ? 553 GLY A O     1 
ATOM   2828  N  N     . TYR E 3 258 ? 98.544  -15.593 39.522  1.00 33.52  ? 554 TYR A N     1 
ATOM   2829  C  CA    . TYR E 3 258 ? 99.517  -14.897 40.364  1.00 33.16  ? 554 TYR A CA    1 
ATOM   2830  C  C     . TYR E 3 258 ? 100.673 -15.815 40.678  1.00 32.72  ? 554 TYR A C     1 
ATOM   2831  O  O     . TYR E 3 258 ? 100.476 -17.012 40.874  1.00 32.68  ? 554 TYR A O     1 
ATOM   2832  C  CB    . TYR E 3 258 ? 98.927  -14.555 41.729  1.00 33.41  ? 554 TYR A CB    1 
ATOM   2833  C  CG    . TYR E 3 258 ? 97.622  -13.795 41.781  1.00 33.93  ? 554 TYR A CG    1 
ATOM   2834  C  CD1   . TYR E 3 258 ? 96.501  -14.354 42.404  1.00 33.65  ? 554 TYR A CD1   1 
ATOM   2835  C  CD2   . TYR E 3 258 ? 97.519  -12.497 41.267  1.00 34.17  ? 554 TYR A CD2   1 
ATOM   2836  C  CE1   . TYR E 3 258 ? 95.304  -13.652 42.492  1.00 34.06  ? 554 TYR A CE1   1 
ATOM   2837  C  CE2   . TYR E 3 258 ? 96.325  -11.789 41.343  1.00 33.79  ? 554 TYR A CE2   1 
ATOM   2838  C  CZ    . TYR E 3 258 ? 95.226  -12.371 41.959  1.00 34.13  ? 554 TYR A CZ    1 
ATOM   2839  O  OH    . TYR E 3 258 ? 94.046  -11.670 42.037  1.00 34.79  ? 554 TYR A OH    1 
ATOM   2840  N  N     . SER E 3 259 ? 101.871 -15.255 40.773  1.00 32.21  ? 555 SER A N     1 
ATOM   2841  C  CA    . SER E 3 259 ? 103.031 -16.039 41.184  1.00 31.61  ? 555 SER A CA    1 
ATOM   2842  C  C     . SER E 3 259 ? 103.225 -16.020 42.717  1.00 31.37  ? 555 SER A C     1 
ATOM   2843  O  O     . SER E 3 259 ? 102.912 -15.038 43.384  1.00 31.07  ? 555 SER A O     1 
ATOM   2844  C  CB    . SER E 3 259 ? 104.283 -15.551 40.458  1.00 31.37  ? 555 SER A CB    1 
ATOM   2845  O  OG    . SER E 3 259 ? 105.436 -16.254 40.883  1.00 31.36  ? 555 SER A OG    1 
ATOM   2846  N  N     . THR E 3 260 ? 103.698 -17.134 43.268  1.00 31.45  ? 556 THR A N     1 
ATOM   2847  C  CA    . THR E 3 260 ? 104.050 -17.228 44.691  1.00 31.50  ? 556 THR A CA    1 
ATOM   2848  C  C     . THR E 3 260 ? 105.363 -17.987 44.821  1.00 31.56  ? 556 THR A C     1 
ATOM   2849  O  O     . THR E 3 260 ? 105.580 -18.701 45.801  1.00 31.52  ? 556 THR A O     1 
ATOM   2850  C  CB    . THR E 3 260 ? 102.990 -17.963 45.561  1.00 31.34  ? 556 THR A CB    1 
ATOM   2851  O  OG1   . THR E 3 260 ? 102.716 -19.255 45.005  1.00 31.23  ? 556 THR A OG1   1 
ATOM   2852  C  CG2   . THR E 3 260 ? 101.698 -17.166 45.667  1.00 31.54  ? 556 THR A CG2   1 
ATOM   2853  N  N     . SER E 3 261 ? 106.230 -17.845 43.822  1.00 31.56  ? 557 SER A N     1 
ATOM   2854  C  CA    . SER E 3 261 ? 107.517 -18.504 43.852  1.00 31.86  ? 557 SER A CA    1 
ATOM   2855  C  C     . SER E 3 261 ? 108.297 -17.940 45.015  1.00 32.26  ? 557 SER A C     1 
ATOM   2856  O  O     . SER E 3 261 ? 108.032 -16.824 45.455  1.00 32.21  ? 557 SER A O     1 
ATOM   2857  C  CB    . SER E 3 261 ? 108.284 -18.228 42.573  1.00 31.84  ? 557 SER A CB    1 
ATOM   2858  O  OG    . SER E 3 261 ? 108.549 -16.843 42.453  1.00 31.40  ? 557 SER A OG    1 
ATOM   2859  N  N     . ALA E 3 262 ? 109.264 -18.712 45.498  1.00 32.77  ? 558 ALA A N     1 
ATOM   2860  C  CA    . ALA E 3 262 ? 110.109 -18.304 46.619  1.00 33.22  ? 558 ALA A CA    1 
ATOM   2861  C  C     . ALA E 3 262 ? 110.695 -16.916 46.392  1.00 33.46  ? 558 ALA A C     1 
ATOM   2862  O  O     . ALA E 3 262 ? 110.777 -16.107 47.313  1.00 33.47  ? 558 ALA A O     1 
ATOM   2863  C  CB    . ALA E 3 262 ? 111.219 -19.333 46.853  1.00 32.72  ? 558 ALA A CB    1 
ATOM   2864  N  N     . ASP E 3 263 ? 111.074 -16.654 45.147  1.00 34.20  ? 559 ASP A N     1 
ATOM   2865  C  CA    . ASP E 3 263 ? 111.666 -15.386 44.729  1.00 35.01  ? 559 ASP A CA    1 
ATOM   2866  C  C     . ASP E 3 263 ? 110.710 -14.210 44.977  1.00 34.67  ? 559 ASP A C     1 
ATOM   2867  O  O     . ASP E 3 263 ? 111.121 -13.176 45.508  1.00 34.77  ? 559 ASP A O     1 
ATOM   2868  C  CB    . ASP E 3 263 ? 112.059 -15.482 43.250  1.00 35.50  ? 559 ASP A CB    1 
ATOM   2869  C  CG    . ASP E 3 263 ? 113.280 -14.635 42.903  1.00 38.27  ? 559 ASP A CG    1 
ATOM   2870  O  OD1   . ASP E 3 263 ? 114.368 -15.227 42.659  1.00 40.26  ? 559 ASP A OD1   1 
ATOM   2871  O  OD2   . ASP E 3 263 ? 113.158 -13.382 42.872  1.00 40.92  ? 559 ASP A OD2   1 
ATOM   2872  N  N     . VAL E 3 264 ? 109.439 -14.387 44.609  1.00 34.21  ? 560 VAL A N     1 
ATOM   2873  C  CA    . VAL E 3 264 ? 108.398 -13.376 44.829  1.00 33.68  ? 560 VAL A CA    1 
ATOM   2874  C  C     . VAL E 3 264 ? 108.077 -13.211 46.317  1.00 33.39  ? 560 VAL A C     1 
ATOM   2875  O  O     . VAL E 3 264 ? 107.813 -12.109 46.784  1.00 33.27  ? 560 VAL A O     1 
ATOM   2876  C  CB    . VAL E 3 264 ? 107.098 -13.711 44.033  1.00 33.78  ? 560 VAL A CB    1 
ATOM   2877  C  CG1   . VAL E 3 264 ? 105.925 -12.855 44.491  1.00 33.08  ? 560 VAL A CG1   1 
ATOM   2878  C  CG2   . VAL E 3 264 ? 107.328 -13.534 42.526  1.00 33.88  ? 560 VAL A CG2   1 
ATOM   2879  N  N     . LEU E 3 265 ? 108.118 -14.307 47.064  1.00 32.99  ? 561 LEU A N     1 
ATOM   2880  C  CA    . LEU E 3 265 ? 107.815 -14.258 48.486  1.00 32.78  ? 561 LEU A CA    1 
ATOM   2881  C  C     . LEU E 3 265 ? 108.860 -13.524 49.306  1.00 32.83  ? 561 LEU A C     1 
ATOM   2882  O  O     . LEU E 3 265 ? 108.525 -12.807 50.258  1.00 32.84  ? 561 LEU A O     1 
ATOM   2883  C  CB    . LEU E 3 265 ? 107.587 -15.657 49.050  1.00 32.76  ? 561 LEU A CB    1 
ATOM   2884  C  CG    . LEU E 3 265 ? 106.124 -16.069 49.207  1.00 32.37  ? 561 LEU A CG    1 
ATOM   2885  C  CD1   . LEU E 3 265 ? 105.322 -15.802 47.951  1.00 31.41  ? 561 LEU A CD1   1 
ATOM   2886  C  CD2   . LEU E 3 265 ? 106.038 -17.526 49.627  1.00 32.21  ? 561 LEU A CD2   1 
ATOM   2887  N  N     . GLU E 3 266 ? 110.123 -13.688 48.942  1.00 32.55  ? 562 GLU A N     1 
ATOM   2888  C  CA    . GLU E 3 266 ? 111.179 -12.982 49.648  1.00 32.55  ? 562 GLU A CA    1 
ATOM   2889  C  C     . GLU E 3 266 ? 111.106 -11.487 49.416  1.00 31.97  ? 562 GLU A C     1 
ATOM   2890  O  O     . GLU E 3 266 ? 111.395 -10.719 50.321  1.00 31.94  ? 562 GLU A O     1 
ATOM   2891  C  CB    . GLU E 3 266 ? 112.540 -13.543 49.280  1.00 32.81  ? 562 GLU A CB    1 
ATOM   2892  C  CG    . GLU E 3 266 ? 112.788 -14.856 49.983  1.00 34.90  ? 562 GLU A CG    1 
ATOM   2893  C  CD    . GLU E 3 266 ? 113.878 -15.673 49.346  1.00 37.18  ? 562 GLU A CD    1 
ATOM   2894  O  OE1   . GLU E 3 266 ? 114.690 -15.092 48.586  1.00 37.79  ? 562 GLU A OE1   1 
ATOM   2895  O  OE2   . GLU E 3 266 ? 113.914 -16.898 49.614  1.00 38.24  ? 562 GLU A OE2   1 
ATOM   2896  N  N     . LYS E 3 267 ? 110.686 -11.087 48.215  1.00 31.48  ? 563 LYS A N     1 
ATOM   2897  C  CA    . LYS E 3 267 ? 110.509 -9.676  47.863  1.00 31.17  ? 563 LYS A CA    1 
ATOM   2898  C  C     . LYS E 3 267 ? 109.260 -9.025  48.462  1.00 31.05  ? 563 LYS A C     1 
ATOM   2899  O  O     . LYS E 3 267 ? 109.117 -7.808  48.414  1.00 31.32  ? 563 LYS A O     1 
ATOM   2900  C  CB    . LYS E 3 267 ? 110.485 -9.500  46.351  1.00 31.03  ? 563 LYS A CB    1 
ATOM   2901  C  CG    . LYS E 3 267 ? 111.807 -9.797  45.690  1.00 31.67  ? 563 LYS A CG    1 
ATOM   2902  C  CD    . LYS E 3 267 ? 111.673 -9.872  44.183  1.00 32.43  ? 563 LYS A CD    1 
ATOM   2903  C  CE    . LYS E 3 267 ? 113.036 -10.057 43.550  1.00 33.63  ? 563 LYS A CE    1 
ATOM   2904  N  NZ    . LYS E 3 267 ? 113.814 -11.123 44.253  1.00 34.15  ? 563 LYS A NZ    1 
ATOM   2905  N  N     . LEU E 3 268 ? 108.355 -9.828  49.011  1.00 30.70  ? 564 LEU A N     1 
ATOM   2906  C  CA    . LEU E 3 268 ? 107.145 -9.297  49.614  1.00 30.28  ? 564 LEU A CA    1 
ATOM   2907  C  C     . LEU E 3 268 ? 107.282 -9.204  51.124  1.00 30.50  ? 564 LEU A C     1 
ATOM   2908  O  O     . LEU E 3 268 ? 106.390 -8.705  51.804  1.00 30.55  ? 564 LEU A O     1 
ATOM   2909  C  CB    . LEU E 3 268 ? 105.937 -10.157 49.242  1.00 30.09  ? 564 LEU A CB    1 
ATOM   2910  C  CG    . LEU E 3 268 ? 105.413 -9.998  47.814  1.00 29.20  ? 564 LEU A CG    1 
ATOM   2911  C  CD1   . LEU E 3 268 ? 104.349 -11.017 47.549  1.00 28.10  ? 564 LEU A CD1   1 
ATOM   2912  C  CD2   . LEU E 3 268 ? 104.874 -8.586  47.570  1.00 29.42  ? 564 LEU A CD2   1 
ATOM   2913  N  N     . ALA E 3 269 ? 108.426 -9.650  51.633  1.00 30.76  ? 565 ALA A N     1 
ATOM   2914  C  CA    . ALA E 3 269 ? 108.695 -9.693  53.072  1.00 30.94  ? 565 ALA A CA    1 
ATOM   2915  C  C     . ALA E 3 269 ? 108.498 -8.396  53.861  1.00 31.23  ? 565 ALA A C     1 
ATOM   2916  O  O     . ALA E 3 269 ? 108.006 -8.441  54.987  1.00 31.19  ? 565 ALA A O     1 
ATOM   2917  C  CB    . ALA E 3 269 ? 110.073 -10.292 53.346  1.00 30.83  ? 565 ALA A CB    1 
ATOM   2918  N  N     . PRO E 3 270 ? 108.887 -7.238  53.293  1.00 31.48  ? 566 PRO A N     1 
ATOM   2919  C  CA    . PRO E 3 270 ? 108.683 -6.012  54.070  1.00 31.96  ? 566 PRO A CA    1 
ATOM   2920  C  C     . PRO E 3 270 ? 107.222 -5.720  54.402  1.00 32.33  ? 566 PRO A C     1 
ATOM   2921  O  O     . PRO E 3 270 ? 106.942 -5.099  55.426  1.00 32.92  ? 566 PRO A O     1 
ATOM   2922  C  CB    . PRO E 3 270 ? 109.229 -4.907  53.149  1.00 31.74  ? 566 PRO A CB    1 
ATOM   2923  C  CG    . PRO E 3 270 ? 110.128 -5.602  52.205  1.00 31.57  ? 566 PRO A CG    1 
ATOM   2924  C  CD    . PRO E 3 270 ? 109.536 -6.959  51.999  1.00 31.45  ? 566 PRO A CD    1 
ATOM   2925  N  N     . TYR E 3 271 ? 106.308 -6.193  53.558  1.00 32.50  ? 567 TYR A N     1 
ATOM   2926  C  CA    . TYR E 3 271 ? 104.878 -5.887  53.674  1.00 32.35  ? 567 TYR A CA    1 
ATOM   2927  C  C     . TYR E 3 271 ? 104.071 -6.691  54.706  1.00 32.32  ? 567 TYR A C     1 
ATOM   2928  O  O     . TYR E 3 271 ? 103.038 -6.222  55.180  1.00 32.61  ? 567 TYR A O     1 
ATOM   2929  C  CB    . TYR E 3 271 ? 104.208 -6.040  52.298  1.00 32.32  ? 567 TYR A CB    1 
ATOM   2930  C  CG    . TYR E 3 271 ? 104.726 -5.102  51.223  1.00 31.91  ? 567 TYR A CG    1 
ATOM   2931  C  CD1   . TYR E 3 271 ? 105.755 -5.487  50.379  1.00 31.89  ? 567 TYR A CD1   1 
ATOM   2932  C  CD2   . TYR E 3 271 ? 104.177 -3.838  51.048  1.00 31.30  ? 567 TYR A CD2   1 
ATOM   2933  C  CE1   . TYR E 3 271 ? 106.229 -4.636  49.395  1.00 32.20  ? 567 TYR A CE1   1 
ATOM   2934  C  CE2   . TYR E 3 271 ? 104.646 -2.980  50.067  1.00 31.29  ? 567 TYR A CE2   1 
ATOM   2935  C  CZ    . TYR E 3 271 ? 105.671 -3.382  49.240  1.00 31.94  ? 567 TYR A CZ    1 
ATOM   2936  O  OH    . TYR E 3 271 ? 106.150 -2.534  48.252  1.00 31.90  ? 567 TYR A OH    1 
ATOM   2937  N  N     . HIS E 3 272 ? 104.517 -7.896  55.045  1.00 32.19  ? 568 HIS A N     1 
ATOM   2938  C  CA    . HIS E 3 272 ? 103.733 -8.771  55.921  1.00 31.94  ? 568 HIS A CA    1 
ATOM   2939  C  C     . HIS E 3 272 ? 104.562 -9.990  56.297  1.00 32.19  ? 568 HIS A C     1 
ATOM   2940  O  O     . HIS E 3 272 ? 105.261 -10.550 55.456  1.00 32.04  ? 568 HIS A O     1 
ATOM   2941  C  CB    . HIS E 3 272 ? 102.474 -9.238  55.191  1.00 31.57  ? 568 HIS A CB    1 
ATOM   2942  C  CG    . HIS E 3 272 ? 101.372 -9.688  56.097  1.00 31.15  ? 568 HIS A CG    1 
ATOM   2943  N  ND1   . HIS E 3 272 ? 101.487 -10.779 56.930  1.00 30.79  ? 568 HIS A ND1   1 
ATOM   2944  C  CD2   . HIS E 3 272 ? 100.120 -9.207  56.281  1.00 30.24  ? 568 HIS A CD2   1 
ATOM   2945  C  CE1   . HIS E 3 272 ? 100.359 -10.943 57.597  1.00 30.11  ? 568 HIS A CE1   1 
ATOM   2946  N  NE2   . HIS E 3 272 ? 99.512  -10.004 57.220  1.00 29.81  ? 568 HIS A NE2   1 
ATOM   2947  N  N     . GLU E 3 273 ? 104.461 -10.427 57.546  1.00 32.36  ? 569 GLU A N     1 
ATOM   2948  C  CA    . GLU E 3 273 ? 105.294 -11.537 58.017  1.00 32.90  ? 569 GLU A CA    1 
ATOM   2949  C  C     . GLU E 3 273 ? 104.780 -12.957 57.727  1.00 32.47  ? 569 GLU A C     1 
ATOM   2950  O  O     . GLU E 3 273 ? 105.397 -13.938 58.151  1.00 32.84  ? 569 GLU A O     1 
ATOM   2951  C  CB    . GLU E 3 273 ? 105.617 -11.371 59.505  1.00 32.69  ? 569 GLU A CB    1 
ATOM   2952  C  CG    . GLU E 3 273 ? 104.404 -11.182 60.393  1.00 33.70  ? 569 GLU A CG    1 
ATOM   2953  C  CD    . GLU E 3 273 ? 104.789 -10.895 61.838  1.00 34.52  ? 569 GLU A CD    1 
ATOM   2954  O  OE1   . GLU E 3 273 ? 106.004 -10.945 62.157  1.00 37.08  ? 569 GLU A OE1   1 
ATOM   2955  O  OE2   . GLU E 3 273 ? 103.880 -10.625 62.657  1.00 36.36  ? 569 GLU A OE2   1 
ATOM   2956  N  N     . ILE E 3 274 ? 103.671 -13.077 57.003  1.00 31.86  ? 570 ILE A N     1 
ATOM   2957  C  CA    . ILE E 3 274 ? 103.148 -14.396 56.673  1.00 31.17  ? 570 ILE A CA    1 
ATOM   2958  C  C     . ILE E 3 274 ? 103.955 -15.033 55.540  1.00 31.24  ? 570 ILE A C     1 
ATOM   2959  O  O     . ILE E 3 274 ? 104.019 -16.254 55.421  1.00 31.47  ? 570 ILE A O     1 
ATOM   2960  C  CB    . ILE E 3 274 ? 101.647 -14.347 56.309  1.00 31.11  ? 570 ILE A CB    1 
ATOM   2961  C  CG1   . ILE E 3 274 ? 101.012 -15.730 56.440  1.00 30.94  ? 570 ILE A CG1   1 
ATOM   2962  C  CG2   . ILE E 3 274 ? 101.417 -13.747 54.916  1.00 30.63  ? 570 ILE A CG2   1 
ATOM   2963  C  CD1   . ILE E 3 274 ? 99.569  -15.754 56.008  1.00 31.39  ? 570 ILE A CD1   1 
ATOM   2964  N  N     . VAL E 3 275 ? 104.596 -14.202 54.724  1.00 30.96  ? 571 VAL A N     1 
ATOM   2965  C  CA    . VAL E 3 275 ? 105.335 -14.699 53.576  1.00 30.70  ? 571 VAL A CA    1 
ATOM   2966  C  C     . VAL E 3 275 ? 106.536 -15.565 53.976  1.00 30.77  ? 571 VAL A C     1 
ATOM   2967  O  O     . VAL E 3 275 ? 106.795 -16.603 53.362  1.00 30.74  ? 571 VAL A O     1 
ATOM   2968  C  CB    . VAL E 3 275 ? 105.750 -13.558 52.626  1.00 30.63  ? 571 VAL A CB    1 
ATOM   2969  C  CG1   . VAL E 3 275 ? 104.531 -12.964 51.958  1.00 30.59  ? 571 VAL A CG1   1 
ATOM   2970  C  CG2   . VAL E 3 275 ? 106.521 -12.490 53.366  1.00 30.52  ? 571 VAL A CG2   1 
ATOM   2971  N  N     . GLU E 3 276 ? 107.244 -15.151 55.024  1.00 30.81  ? 572 GLU A N     1 
ATOM   2972  C  CA    . GLU E 3 276 ? 108.415 -15.881 55.491  1.00 30.61  ? 572 GLU A CA    1 
ATOM   2973  C  C     . GLU E 3 276 ? 107.976 -17.217 56.062  1.00 30.24  ? 572 GLU A C     1 
ATOM   2974  O  O     . GLU E 3 276 ? 108.666 -18.226 55.892  1.00 30.02  ? 572 GLU A O     1 
ATOM   2975  C  CB    . GLU E 3 276 ? 109.170 -15.079 56.548  1.00 31.00  ? 572 GLU A CB    1 
ATOM   2976  C  CG    . GLU E 3 276 ? 109.171 -13.573 56.299  1.00 32.57  ? 572 GLU A CG    1 
ATOM   2977  C  CD    . GLU E 3 276 ? 110.322 -12.857 56.988  1.00 34.22  ? 572 GLU A CD    1 
ATOM   2978  O  OE1   . GLU E 3 276 ? 110.100 -11.737 57.517  1.00 35.37  ? 572 GLU A OE1   1 
ATOM   2979  O  OE2   . GLU E 3 276 ? 111.446 -13.410 56.991  1.00 34.29  ? 572 GLU A OE2   1 
ATOM   2980  N  N     . ASN E 3 277 ? 106.814 -17.218 56.718  1.00 29.76  ? 573 ASN A N     1 
ATOM   2981  C  CA    . ASN E 3 277 ? 106.257 -18.432 57.292  1.00 29.64  ? 573 ASN A CA    1 
ATOM   2982  C  C     . ASN E 3 277 ? 105.804 -19.417 56.244  1.00 29.33  ? 573 ASN A C     1 
ATOM   2983  O  O     . ASN E 3 277 ? 105.876 -20.625 56.452  1.00 29.25  ? 573 ASN A O     1 
ATOM   2984  C  CB    . ASN E 3 277 ? 105.117 -18.118 58.249  1.00 29.82  ? 573 ASN A CB    1 
ATOM   2985  C  CG    . ASN E 3 277 ? 105.603 -17.457 59.506  1.00 31.05  ? 573 ASN A CG    1 
ATOM   2986  O  OD1   . ASN E 3 277 ? 106.597 -16.730 59.485  1.00 33.70  ? 573 ASN A OD1   1 
ATOM   2987  N  ND2   . ASN E 3 277 ? 104.923 -17.709 60.617  1.00 31.39  ? 573 ASN A ND2   1 
ATOM   2988  N  N     . ILE E 3 278 ? 105.335 -18.904 55.115  1.00 29.04  ? 574 ILE A N     1 
ATOM   2989  C  CA    . ILE E 3 278 ? 104.937 -19.775 54.020  1.00 28.88  ? 574 ILE A CA    1 
ATOM   2990  C  C     . ILE E 3 278 ? 106.173 -20.470 53.456  1.00 28.98  ? 574 ILE A C     1 
ATOM   2991  O  O     . ILE E 3 278 ? 106.199 -21.699 53.298  1.00 28.68  ? 574 ILE A O     1 
ATOM   2992  C  CB    . ILE E 3 278 ? 104.169 -18.995 52.934  1.00 28.96  ? 574 ILE A CB    1 
ATOM   2993  C  CG1   . ILE E 3 278 ? 102.809 -18.559 53.498  1.00 27.67  ? 574 ILE A CG1   1 
ATOM   2994  C  CG2   . ILE E 3 278 ? 104.007 -19.855 51.674  1.00 27.99  ? 574 ILE A CG2   1 
ATOM   2995  C  CD1   . ILE E 3 278 ? 102.200 -17.379 52.819  1.00 25.75  ? 574 ILE A CD1   1 
ATOM   2996  N  N     . LEU E 3 279 ? 107.206 -19.676 53.190  1.00 29.27  ? 575 LEU A N     1 
ATOM   2997  C  CA    . LEU E 3 279 ? 108.476 -20.197 52.688  1.00 29.66  ? 575 LEU A CA    1 
ATOM   2998  C  C     . LEU E 3 279 ? 108.964 -21.345 53.553  1.00 29.68  ? 575 LEU A C     1 
ATOM   2999  O  O     . LEU E 3 279 ? 109.258 -22.430 53.051  1.00 30.03  ? 575 LEU A O     1 
ATOM   3000  C  CB    . LEU E 3 279 ? 109.529 -19.088 52.652  1.00 29.72  ? 575 LEU A CB    1 
ATOM   3001  C  CG    . LEU E 3 279 ? 109.334 -18.004 51.594  1.00 30.12  ? 575 LEU A CG    1 
ATOM   3002  C  CD1   . LEU E 3 279 ? 110.234 -16.825 51.872  1.00 30.59  ? 575 LEU A CD1   1 
ATOM   3003  C  CD2   . LEU E 3 279 ? 109.616 -18.567 50.216  1.00 31.52  ? 575 LEU A CD2   1 
ATOM   3004  N  N     . HIS E 3 280 ? 109.023 -21.092 54.857  1.00 29.80  ? 576 HIS A N     1 
ATOM   3005  C  CA    . HIS E 3 280 ? 109.469 -22.068 55.839  1.00 30.07  ? 576 HIS A CA    1 
ATOM   3006  C  C     . HIS E 3 280 ? 108.583 -23.312 55.853  1.00 29.99  ? 576 HIS A C     1 
ATOM   3007  O  O     . HIS E 3 280 ? 109.074 -24.426 56.017  1.00 29.69  ? 576 HIS A O     1 
ATOM   3008  C  CB    . HIS E 3 280 ? 109.527 -21.423 57.230  1.00 30.28  ? 576 HIS A CB    1 
ATOM   3009  C  CG    . HIS E 3 280 ? 110.072 -22.324 58.294  1.00 31.50  ? 576 HIS A CG    1 
ATOM   3010  N  ND1   . HIS E 3 280 ? 111.306 -22.933 58.196  1.00 32.52  ? 576 HIS A ND1   1 
ATOM   3011  C  CD2   . HIS E 3 280 ? 109.563 -22.701 59.491  1.00 33.23  ? 576 HIS A CD2   1 
ATOM   3012  C  CE1   . HIS E 3 280 ? 111.527 -23.658 59.278  1.00 32.84  ? 576 HIS A CE1   1 
ATOM   3013  N  NE2   . HIS E 3 280 ? 110.484 -23.537 60.079  1.00 33.83  ? 576 HIS A NE2   1 
ATOM   3014  N  N     . TYR E 3 281 ? 107.281 -23.113 55.676  1.00 30.33  ? 577 TYR A N     1 
ATOM   3015  C  CA    . TYR E 3 281 ? 106.334 -24.219 55.644  1.00 30.77  ? 577 TYR A CA    1 
ATOM   3016  C  C     . TYR E 3 281 ? 106.567 -25.097 54.413  1.00 30.92  ? 577 TYR A C     1 
ATOM   3017  O  O     . TYR E 3 281 ? 106.632 -26.321 54.512  1.00 30.78  ? 577 TYR A O     1 
ATOM   3018  C  CB    . TYR E 3 281 ? 104.897 -23.691 55.662  1.00 31.01  ? 577 TYR A CB    1 
ATOM   3019  C  CG    . TYR E 3 281 ? 103.839 -24.767 55.528  1.00 31.12  ? 577 TYR A CG    1 
ATOM   3020  C  CD1   . TYR E 3 281 ? 103.310 -25.395 56.654  1.00 31.23  ? 577 TYR A CD1   1 
ATOM   3021  C  CD2   . TYR E 3 281 ? 103.369 -25.155 54.272  1.00 30.52  ? 577 TYR A CD2   1 
ATOM   3022  C  CE1   . TYR E 3 281 ? 102.343 -26.380 56.534  1.00 31.44  ? 577 TYR A CE1   1 
ATOM   3023  C  CE2   . TYR E 3 281 ? 102.410 -26.139 54.139  1.00 30.92  ? 577 TYR A CE2   1 
ATOM   3024  C  CZ    . TYR E 3 281 ? 101.896 -26.748 55.272  1.00 31.68  ? 577 TYR A CZ    1 
ATOM   3025  O  OH    . TYR E 3 281 ? 100.932 -27.725 55.143  1.00 31.59  ? 577 TYR A OH    1 
ATOM   3026  N  N     . ARG E 3 282 ? 106.688 -24.458 53.257  1.00 31.29  ? 578 ARG A N     1 
ATOM   3027  C  CA    . ARG E 3 282 ? 106.950 -25.160 52.009  1.00 31.71  ? 578 ARG A CA    1 
ATOM   3028  C  C     . ARG E 3 282 ? 108.246 -25.953 52.063  1.00 32.09  ? 578 ARG A C     1 
ATOM   3029  O  O     . ARG E 3 282 ? 108.338 -27.039 51.488  1.00 32.20  ? 578 ARG A O     1 
ATOM   3030  C  CB    . ARG E 3 282 ? 107.045 -24.163 50.870  1.00 31.73  ? 578 ARG A CB    1 
ATOM   3031  C  CG    . ARG E 3 282 ? 105.734 -23.533 50.473  1.00 31.34  ? 578 ARG A CG    1 
ATOM   3032  C  CD    . ARG E 3 282 ? 106.031 -22.430 49.491  1.00 30.49  ? 578 ARG A CD    1 
ATOM   3033  N  NE    . ARG E 3 282 ? 104.899 -22.140 48.632  1.00 29.41  ? 578 ARG A NE    1 
ATOM   3034  C  CZ    . ARG E 3 282 ? 104.920 -21.222 47.680  1.00 28.78  ? 578 ARG A CZ    1 
ATOM   3035  N  NH1   . ARG E 3 282 ? 106.017 -20.506 47.469  1.00 27.88  ? 578 ARG A NH1   1 
ATOM   3036  N  NH2   . ARG E 3 282 ? 103.839 -21.016 46.949  1.00 30.01  ? 578 ARG A NH2   1 
ATOM   3037  N  N     . GLN E 3 283 ? 109.252 -25.393 52.733  1.00 32.30  ? 579 GLN A N     1 
ATOM   3038  C  CA    . GLN E 3 283 ? 110.526 -26.076 52.922  1.00 32.76  ? 579 GLN A CA    1 
ATOM   3039  C  C     . GLN E 3 283 ? 110.319 -27.399 53.652  1.00 31.99  ? 579 GLN A C     1 
ATOM   3040  O  O     . GLN E 3 283 ? 110.742 -28.461 53.183  1.00 31.88  ? 579 GLN A O     1 
ATOM   3041  C  CB    . GLN E 3 283 ? 111.486 -25.193 53.725  1.00 32.85  ? 579 GLN A CB    1 
ATOM   3042  C  CG    . GLN E 3 283 ? 112.783 -25.896 54.150  1.00 34.25  ? 579 GLN A CG    1 
ATOM   3043  C  CD    . GLN E 3 283 ? 113.545 -25.174 55.271  1.00 34.74  ? 579 GLN A CD    1 
ATOM   3044  O  OE1   . GLN E 3 283 ? 113.224 -24.030 55.630  1.00 37.06  ? 579 GLN A OE1   1 
ATOM   3045  N  NE2   . GLN E 3 283 ? 114.565 -25.847 55.826  1.00 36.00  ? 579 GLN A NE2   1 
ATOM   3046  N  N     . LEU E 3 284 ? 109.659 -27.323 54.804  1.00 31.60  ? 580 LEU A N     1 
ATOM   3047  C  CA    . LEU E 3 284 ? 109.422 -28.497 55.639  1.00 31.35  ? 580 LEU A CA    1 
ATOM   3048  C  C     . LEU E 3 284 ? 108.522 -29.527 54.947  1.00 31.21  ? 580 LEU A C     1 
ATOM   3049  O  O     . LEU E 3 284 ? 108.777 -30.728 55.021  1.00 30.82  ? 580 LEU A O     1 
ATOM   3050  C  CB    . LEU E 3 284 ? 108.829 -28.074 56.987  1.00 31.31  ? 580 LEU A CB    1 
ATOM   3051  C  CG    . LEU E 3 284 ? 109.635 -27.071 57.818  1.00 30.79  ? 580 LEU A CG    1 
ATOM   3052  C  CD1   . LEU E 3 284 ? 108.787 -26.472 58.939  1.00 31.46  ? 580 LEU A CD1   1 
ATOM   3053  C  CD2   . LEU E 3 284 ? 110.896 -27.696 58.370  1.00 29.85  ? 580 LEU A CD2   1 
ATOM   3054  N  N     . GLY E 3 285 ? 107.484 -29.039 54.266  1.00 31.34  ? 581 GLY A N     1 
ATOM   3055  C  CA    . GLY E 3 285 ? 106.534 -29.891 53.547  1.00 31.38  ? 581 GLY A CA    1 
ATOM   3056  C  C     . GLY E 3 285 ? 107.211 -30.757 52.506  1.00 31.39  ? 581 GLY A C     1 
ATOM   3057  O  O     . GLY E 3 285 ? 106.894 -31.936 52.360  1.00 31.20  ? 581 GLY A O     1 
ATOM   3058  N  N     . LYS E 3 286 ? 108.153 -30.155 51.786  1.00 31.48  ? 582 LYS A N     1 
ATOM   3059  C  CA    . LYS E 3 286 ? 108.923 -30.853 50.776  1.00 31.55  ? 582 LYS A CA    1 
ATOM   3060  C  C     . LYS E 3 286 ? 109.805 -31.921 51.423  1.00 31.52  ? 582 LYS A C     1 
ATOM   3061  O  O     . LYS E 3 286 ? 109.879 -33.051 50.921  1.00 31.43  ? 582 LYS A O     1 
ATOM   3062  C  CB    . LYS E 3 286 ? 109.767 -29.855 49.979  1.00 31.75  ? 582 LYS A CB    1 
ATOM   3063  C  CG    . LYS E 3 286 ? 110.637 -30.466 48.879  1.00 32.59  ? 582 LYS A CG    1 
ATOM   3064  C  CD    . LYS E 3 286 ? 109.811 -31.040 47.724  1.00 32.93  ? 582 LYS A CD    1 
ATOM   3065  C  CE    . LYS E 3 286 ? 110.717 -31.649 46.645  1.00 32.44  ? 582 LYS A CE    1 
ATOM   3066  N  NZ    . LYS E 3 286 ? 109.930 -32.215 45.524  1.00 31.36  ? 582 LYS A NZ    1 
ATOM   3067  N  N     . LEU E 3 287 ? 110.454 -31.569 52.537  1.00 31.40  ? 583 LEU A N     1 
ATOM   3068  C  CA    . LEU E 3 287 ? 111.338 -32.502 53.242  1.00 31.51  ? 583 LEU A CA    1 
ATOM   3069  C  C     . LEU E 3 287 ? 110.580 -33.744 53.660  1.00 31.69  ? 583 LEU A C     1 
ATOM   3070  O  O     . LEU E 3 287 ? 111.065 -34.875 53.515  1.00 31.52  ? 583 LEU A O     1 
ATOM   3071  C  CB    . LEU E 3 287 ? 111.943 -31.862 54.491  1.00 31.64  ? 583 LEU A CB    1 
ATOM   3072  C  CG    . LEU E 3 287 ? 113.016 -30.778 54.344  1.00 32.37  ? 583 LEU A CG    1 
ATOM   3073  C  CD1   . LEU E 3 287 ? 113.572 -30.396 55.712  1.00 31.44  ? 583 LEU A CD1   1 
ATOM   3074  C  CD2   . LEU E 3 287 ? 114.136 -31.243 53.424  1.00 32.43  ? 583 LEU A CD2   1 
ATOM   3075  N  N     . GLN E 3 288 ? 109.382 -33.510 54.181  1.00 31.72  ? 584 GLN A N     1 
ATOM   3076  C  CA    . GLN E 3 288 ? 108.525 -34.561 54.674  1.00 32.10  ? 584 GLN A CA    1 
ATOM   3077  C  C     . GLN E 3 288 ? 108.025 -35.451 53.542  1.00 31.95  ? 584 GLN A C     1 
ATOM   3078  O  O     . GLN E 3 288 ? 108.189 -36.672 53.586  1.00 31.84  ? 584 GLN A O     1 
ATOM   3079  C  CB    . GLN E 3 288 ? 107.333 -33.943 55.412  1.00 32.37  ? 584 GLN A CB    1 
ATOM   3080  C  CG    . GLN E 3 288 ? 106.427 -34.939 56.130  1.00 33.77  ? 584 GLN A CG    1 
ATOM   3081  C  CD    . GLN E 3 288 ? 105.043 -34.349 56.390  1.00 36.95  ? 584 GLN A CD    1 
ATOM   3082  O  OE1   . GLN E 3 288 ? 104.480 -33.660 55.519  1.00 37.99  ? 584 GLN A OE1   1 
ATOM   3083  N  NE2   . GLN E 3 288 ? 104.489 -34.602 57.585  1.00 35.48  ? 584 GLN A NE2   1 
ATOM   3084  N  N     . SER E 3 289 ? 107.430 -34.837 52.522  1.00 31.68  ? 585 SER A N     1 
ATOM   3085  C  CA    . SER E 3 289 ? 106.789 -35.604 51.461  1.00 31.67  ? 585 SER A CA    1 
ATOM   3086  C  C     . SER E 3 289 ? 107.783 -36.341 50.573  1.00 31.67  ? 585 SER A C     1 
ATOM   3087  O  O     . SER E 3 289 ? 107.582 -37.508 50.231  1.00 31.49  ? 585 SER A O     1 
ATOM   3088  C  CB    . SER E 3 289 ? 105.897 -34.705 50.604  1.00 31.41  ? 585 SER A CB    1 
ATOM   3089  O  OG    . SER E 3 289 ? 106.668 -33.758 49.895  1.00 31.61  ? 585 SER A OG    1 
ATOM   3090  N  N     . THR E 3 290 ? 108.856 -35.651 50.208  1.00 31.70  ? 586 THR A N     1 
ATOM   3091  C  CA    . THR E 3 290 ? 109.805 -36.194 49.249  1.00 31.58  ? 586 THR A CA    1 
ATOM   3092  C  C     . THR E 3 290 ? 110.955 -36.923 49.921  1.00 31.55  ? 586 THR A C     1 
ATOM   3093  O  O     . THR E 3 290 ? 111.262 -38.064 49.571  1.00 31.59  ? 586 THR A O     1 
ATOM   3094  C  CB    . THR E 3 290 ? 110.357 -35.085 48.319  1.00 31.54  ? 586 THR A CB    1 
ATOM   3095  O  OG1   . THR E 3 290 ? 109.266 -34.321 47.798  1.00 31.98  ? 586 THR A OG1   1 
ATOM   3096  C  CG2   . THR E 3 290 ? 111.173 -35.673 47.166  1.00 30.72  ? 586 THR A CG2   1 
ATOM   3097  N  N     . TYR E 3 291 ? 111.575 -36.279 50.900  1.00 31.29  ? 587 TYR A N     1 
ATOM   3098  C  CA    . TYR E 3 291 ? 112.778 -36.845 51.485  1.00 31.30  ? 587 TYR A CA    1 
ATOM   3099  C  C     . TYR E 3 291 ? 112.571 -37.742 52.706  1.00 31.22  ? 587 TYR A C     1 
ATOM   3100  O  O     . TYR E 3 291 ? 113.519 -38.345 53.197  1.00 31.22  ? 587 TYR A O     1 
ATOM   3101  C  CB    . TYR E 3 291 ? 113.808 -35.747 51.726  1.00 31.40  ? 587 TYR A CB    1 
ATOM   3102  C  CG    . TYR E 3 291 ? 114.112 -34.978 50.460  1.00 31.54  ? 587 TYR A CG    1 
ATOM   3103  C  CD1   . TYR E 3 291 ? 113.572 -33.709 50.245  1.00 31.12  ? 587 TYR A CD1   1 
ATOM   3104  C  CD2   . TYR E 3 291 ? 114.911 -35.532 49.461  1.00 31.28  ? 587 TYR A CD2   1 
ATOM   3105  C  CE1   . TYR E 3 291 ? 113.833 -33.000 49.081  1.00 31.02  ? 587 TYR A CE1   1 
ATOM   3106  C  CE2   . TYR E 3 291 ? 115.179 -34.832 48.292  1.00 32.10  ? 587 TYR A CE2   1 
ATOM   3107  C  CZ    . TYR E 3 291 ? 114.639 -33.562 48.111  1.00 31.83  ? 587 TYR A CZ    1 
ATOM   3108  O  OH    . TYR E 3 291 ? 114.904 -32.860 46.955  1.00 32.21  ? 587 TYR A OH    1 
ATOM   3109  N  N     . ILE E 3 292 ? 111.341 -37.838 53.192  1.00 31.03  ? 588 ILE A N     1 
ATOM   3110  C  CA    . ILE E 3 292 ? 111.049 -38.805 54.240  1.00 31.02  ? 588 ILE A CA    1 
ATOM   3111  C  C     . ILE E 3 292 ? 110.076 -39.859 53.694  1.00 31.37  ? 588 ILE A C     1 
ATOM   3112  O  O     . ILE E 3 292 ? 110.408 -41.041 53.619  1.00 31.21  ? 588 ILE A O     1 
ATOM   3113  C  CB    . ILE E 3 292 ? 110.457 -38.152 55.508  1.00 30.90  ? 588 ILE A CB    1 
ATOM   3114  C  CG1   . ILE E 3 292 ? 111.383 -37.071 56.062  1.00 30.26  ? 588 ILE A CG1   1 
ATOM   3115  C  CG2   . ILE E 3 292 ? 110.186 -39.217 56.567  1.00 30.84  ? 588 ILE A CG2   1 
ATOM   3116  C  CD1   . ILE E 3 292 ? 112.586 -37.608 56.767  1.00 29.43  ? 588 ILE A CD1   1 
ATOM   3117  N  N     . GLU E 3 293 ? 108.888 -39.411 53.291  1.00 31.86  ? 589 GLU A N     1 
ATOM   3118  C  CA    . GLU E 3 293 ? 107.828 -40.292 52.794  1.00 32.47  ? 589 GLU A CA    1 
ATOM   3119  C  C     . GLU E 3 293 ? 108.127 -40.912 51.434  1.00 32.42  ? 589 GLU A C     1 
ATOM   3120  O  O     . GLU E 3 293 ? 107.811 -42.081 51.201  1.00 32.43  ? 589 GLU A O     1 
ATOM   3121  C  CB    . GLU E 3 293 ? 106.487 -39.556 52.752  1.00 32.56  ? 589 GLU A CB    1 
ATOM   3122  C  CG    . GLU E 3 293 ? 105.938 -39.211 54.131  1.00 33.24  ? 589 GLU A CG    1 
ATOM   3123  C  CD    . GLU E 3 293 ? 104.649 -38.423 54.063  1.00 33.25  ? 589 GLU A CD    1 
ATOM   3124  O  OE1   . GLU E 3 293 ? 104.238 -38.056 52.939  1.00 35.22  ? 589 GLU A OE1   1 
ATOM   3125  O  OE2   . GLU E 3 293 ? 104.054 -38.162 55.131  1.00 33.91  ? 589 GLU A OE2   1 
ATOM   3126  N  N     . GLY E 3 294 ? 108.724 -40.130 50.540  1.00 32.42  ? 590 GLY A N     1 
ATOM   3127  C  CA    . GLY E 3 294 ? 109.120 -40.649 49.240  1.00 32.22  ? 590 GLY A CA    1 
ATOM   3128  C  C     . GLY E 3 294 ? 110.234 -41.665 49.422  1.00 32.17  ? 590 GLY A C     1 
ATOM   3129  O  O     . GLY E 3 294 ? 110.175 -42.770 48.897  1.00 32.10  ? 590 GLY A O     1 
ATOM   3130  N  N     . LEU E 3 295 ? 111.235 -41.293 50.208  1.00 32.22  ? 591 LEU A N     1 
ATOM   3131  C  CA    . LEU E 3 295 ? 112.409 -42.129 50.414  1.00 32.48  ? 591 LEU A CA    1 
ATOM   3132  C  C     . LEU E 3 295 ? 112.096 -43.479 51.070  1.00 32.98  ? 591 LEU A C     1 
ATOM   3133  O  O     . LEU E 3 295 ? 112.614 -44.510 50.646  1.00 33.02  ? 591 LEU A O     1 
ATOM   3134  C  CB    . LEU E 3 295 ? 113.451 -41.358 51.217  1.00 32.12  ? 591 LEU A CB    1 
ATOM   3135  C  CG    . LEU E 3 295 ? 114.883 -41.882 51.210  1.00 32.21  ? 591 LEU A CG    1 
ATOM   3136  C  CD1   . LEU E 3 295 ? 115.385 -42.153 49.791  1.00 30.75  ? 591 LEU A CD1   1 
ATOM   3137  C  CD2   . LEU E 3 295 ? 115.786 -40.880 51.914  1.00 32.30  ? 591 LEU A CD2   1 
ATOM   3138  N  N     . LEU E 3 296 ? 111.236 -43.469 52.090  1.00 33.65  ? 592 LEU A N     1 
ATOM   3139  C  CA    . LEU E 3 296 ? 110.844 -44.699 52.788  1.00 33.70  ? 592 LEU A CA    1 
ATOM   3140  C  C     . LEU E 3 296 ? 109.993 -45.638 51.924  1.00 33.83  ? 592 LEU A C     1 
ATOM   3141  O  O     . LEU E 3 296 ? 109.965 -46.841 52.178  1.00 34.12  ? 592 LEU A O     1 
ATOM   3142  C  CB    . LEU E 3 296 ? 110.114 -44.391 54.104  1.00 33.68  ? 592 LEU A CB    1 
ATOM   3143  C  CG    . LEU E 3 296 ? 110.853 -43.639 55.221  1.00 33.76  ? 592 LEU A CG    1 
ATOM   3144  C  CD1   . LEU E 3 296 ? 109.897 -43.275 56.358  1.00 32.69  ? 592 LEU A CD1   1 
ATOM   3145  C  CD2   . LEU E 3 296 ? 112.045 -44.416 55.745  1.00 33.38  ? 592 LEU A CD2   1 
ATOM   3146  N  N     . LYS E 3 297 ? 109.305 -45.100 50.917  1.00 33.66  ? 593 LYS A N     1 
ATOM   3147  C  CA    . LYS E 3 297 ? 108.494 -45.934 50.033  1.00 33.78  ? 593 LYS A CA    1 
ATOM   3148  C  C     . LYS E 3 297 ? 109.344 -46.780 49.104  1.00 33.40  ? 593 LYS A C     1 
ATOM   3149  O  O     . LYS E 3 297 ? 108.887 -47.823 48.642  1.00 33.29  ? 593 LYS A O     1 
ATOM   3150  C  CB    . LYS E 3 297 ? 107.492 -45.115 49.211  1.00 33.74  ? 593 LYS A CB    1 
ATOM   3151  C  CG    . LYS E 3 297 ? 106.238 -44.733 49.973  1.00 34.68  ? 593 LYS A CG    1 
ATOM   3152  C  CD    . LYS E 3 297 ? 105.156 -44.163 49.059  1.00 34.97  ? 593 LYS A CD    1 
ATOM   3153  C  CE    . LYS E 3 297 ? 103.860 -43.928 49.850  1.00 37.57  ? 593 LYS A CE    1 
ATOM   3154  N  NZ    . LYS E 3 297 ? 102.727 -43.407 49.015  1.00 38.65  ? 593 LYS A NZ    1 
ATOM   3155  N  N     . VAL E 3 298 ? 110.570 -46.333 48.831  1.00 33.20  ? 594 VAL A N     1 
ATOM   3156  C  CA    . VAL E 3 298 ? 111.461 -47.076 47.930  1.00 33.07  ? 594 VAL A CA    1 
ATOM   3157  C  C     . VAL E 3 298 ? 112.601 -47.860 48.600  1.00 33.15  ? 594 VAL A C     1 
ATOM   3158  O  O     . VAL E 3 298 ? 113.350 -48.555 47.916  1.00 32.90  ? 594 VAL A O     1 
ATOM   3159  C  CB    . VAL E 3 298 ? 112.006 -46.218 46.754  1.00 32.73  ? 594 VAL A CB    1 
ATOM   3160  C  CG1   . VAL E 3 298 ? 110.870 -45.821 45.819  1.00 32.98  ? 594 VAL A CG1   1 
ATOM   3161  C  CG2   . VAL E 3 298 ? 112.769 -45.012 47.260  1.00 32.49  ? 594 VAL A CG2   1 
ATOM   3162  N  N     . VAL E 3 299 ? 112.741 -47.757 49.919  1.00 33.37  ? 595 VAL A N     1 
ATOM   3163  C  CA    . VAL E 3 299 ? 113.714 -48.604 50.610  1.00 33.63  ? 595 VAL A CA    1 
ATOM   3164  C  C     . VAL E 3 299 ? 113.250 -50.064 50.504  1.00 33.66  ? 595 VAL A C     1 
ATOM   3165  O  O     . VAL E 3 299 ? 112.050 -50.339 50.561  1.00 33.39  ? 595 VAL A O     1 
ATOM   3166  C  CB    . VAL E 3 299 ? 113.834 -48.270 52.105  1.00 33.60  ? 595 VAL A CB    1 
ATOM   3167  C  CG1   . VAL E 3 299 ? 115.100 -48.884 52.663  1.00 33.89  ? 595 VAL A CG1   1 
ATOM   3168  C  CG2   . VAL E 3 299 ? 113.848 -46.781 52.336  1.00 34.05  ? 595 VAL A CG2   1 
ATOM   3169  N  N     . ARG E 3 300 ? 114.192 -50.988 50.325  1.00 33.94  ? 596 ARG A N     1 
ATOM   3170  C  CA    . ARG E 3 300 ? 113.881 -52.421 50.322  1.00 34.22  ? 596 ARG A CA    1 
ATOM   3171  C  C     . ARG E 3 300 ? 114.012 -52.889 51.766  1.00 34.23  ? 596 ARG A C     1 
ATOM   3172  O  O     . ARG E 3 300 ? 115.120 -52.903 52.319  1.00 34.36  ? 596 ARG A O     1 
ATOM   3173  C  CB    . ARG E 3 300 ? 114.831 -53.186 49.411  1.00 34.08  ? 596 ARG A CB    1 
ATOM   3174  C  CG    . ARG E 3 300 ? 114.884 -52.620 48.023  1.00 34.94  ? 596 ARG A CG    1 
ATOM   3175  C  CD    . ARG E 3 300 ? 115.591 -53.553 47.086  1.00 36.80  ? 596 ARG A CD    1 
ATOM   3176  N  NE    . ARG E 3 300 ? 114.800 -54.747 46.811  1.00 38.19  ? 596 ARG A NE    1 
ATOM   3177  C  CZ    . ARG E 3 300 ? 113.889 -54.827 45.846  1.00 39.18  ? 596 ARG A CZ    1 
ATOM   3178  N  NH1   . ARG E 3 300 ? 113.649 -53.774 45.061  1.00 38.92  ? 596 ARG A NH1   1 
ATOM   3179  N  NH2   . ARG E 3 300 ? 113.223 -55.963 45.661  1.00 39.66  ? 596 ARG A NH2   1 
ATOM   3180  N  N     . PRO E 3 301 ? 112.877 -53.253 52.385  1.00 34.19  ? 597 PRO A N     1 
ATOM   3181  C  CA    . PRO E 3 301 ? 112.774 -53.520 53.822  1.00 34.19  ? 597 PRO A CA    1 
ATOM   3182  C  C     . PRO E 3 301 ? 113.804 -54.503 54.398  1.00 34.47  ? 597 PRO A C     1 
ATOM   3183  O  O     . PRO E 3 301 ? 114.380 -54.239 55.458  1.00 34.33  ? 597 PRO A O     1 
ATOM   3184  C  CB    . PRO E 3 301 ? 111.342 -54.035 53.973  1.00 34.04  ? 597 PRO A CB    1 
ATOM   3185  C  CG    . PRO E 3 301 ? 110.601 -53.387 52.859  1.00 34.06  ? 597 PRO A CG    1 
ATOM   3186  C  CD    . PRO E 3 301 ? 111.579 -53.434 51.710  1.00 34.27  ? 597 PRO A CD    1 
ATOM   3187  N  N     . ALA E 3 302 ? 114.057 -55.598 53.685  1.00 34.65  ? 598 ALA A N     1 
ATOM   3188  C  CA    . ALA E 3 302 ? 114.981 -56.635 54.155  1.00 34.73  ? 598 ALA A CA    1 
ATOM   3189  C  C     . ALA E 3 302 ? 116.433 -56.182 54.329  1.00 34.82  ? 598 ALA A C     1 
ATOM   3190  O  O     . ALA E 3 302 ? 117.129 -56.676 55.215  1.00 34.95  ? 598 ALA A O     1 
ATOM   3191  C  CB    . ALA E 3 302 ? 114.919 -57.861 53.236  1.00 34.73  ? 598 ALA A CB    1 
ATOM   3192  N  N     . THR E 3 303 ? 116.901 -55.258 53.487  1.00 34.76  ? 599 THR A N     1 
ATOM   3193  C  CA    . THR E 3 303 ? 118.312 -54.840 53.540  1.00 34.39  ? 599 THR A CA    1 
ATOM   3194  C  C     . THR E 3 303 ? 118.515 -53.366 53.877  1.00 34.02  ? 599 THR A C     1 
ATOM   3195  O  O     . THR E 3 303 ? 119.645 -52.927 54.101  1.00 33.82  ? 599 THR A O     1 
ATOM   3196  C  CB    . THR E 3 303 ? 119.036 -55.137 52.224  1.00 34.34  ? 599 THR A CB    1 
ATOM   3197  O  OG1   . THR E 3 303 ? 118.529 -54.275 51.201  1.00 35.08  ? 599 THR A OG1   1 
ATOM   3198  C  CG2   . THR E 3 303 ? 118.829 -56.591 51.810  1.00 34.77  ? 599 THR A CG2   1 
ATOM   3199  N  N     . LYS E 3 304 ? 117.416 -52.618 53.900  1.00 33.76  ? 600 LYS A N     1 
ATOM   3200  C  CA    . LYS E 3 304 ? 117.429 -51.192 54.215  1.00 33.54  ? 600 LYS A CA    1 
ATOM   3201  C  C     . LYS E 3 304 ? 118.268 -50.384 53.238  1.00 33.01  ? 600 LYS A C     1 
ATOM   3202  O  O     . LYS E 3 304 ? 118.994 -49.471 53.628  1.00 33.30  ? 600 LYS A O     1 
ATOM   3203  C  CB    . LYS E 3 304 ? 117.875 -50.944 55.661  1.00 33.90  ? 600 LYS A CB    1 
ATOM   3204  C  CG    . LYS E 3 304 ? 116.890 -51.462 56.709  1.00 35.01  ? 600 LYS A CG    1 
ATOM   3205  C  CD    . LYS E 3 304 ? 117.219 -50.909 58.092  1.00 37.25  ? 600 LYS A CD    1 
ATOM   3206  C  CE    . LYS E 3 304 ? 116.225 -51.384 59.154  1.00 37.97  ? 600 LYS A CE    1 
ATOM   3207  N  NZ    . LYS E 3 304 ? 116.419 -52.824 59.492  1.00 38.45  ? 600 LYS A NZ    1 
ATOM   3208  N  N     . LYS E 3 305 ? 118.153 -50.723 51.962  1.00 32.28  ? 601 LYS A N     1 
ATOM   3209  C  CA    . LYS E 3 305 ? 118.906 -50.047 50.925  1.00 31.58  ? 601 LYS A CA    1 
ATOM   3210  C  C     . LYS E 3 305 ? 117.984 -49.426 49.904  1.00 30.93  ? 601 LYS A C     1 
ATOM   3211  O  O     . LYS E 3 305 ? 116.873 -49.908 49.695  1.00 31.26  ? 601 LYS A O     1 
ATOM   3212  C  CB    . LYS E 3 305 ? 119.819 -51.032 50.197  1.00 31.74  ? 601 LYS A CB    1 
ATOM   3213  C  CG    . LYS E 3 305 ? 121.152 -51.321 50.864  1.00 32.21  ? 601 LYS A CG    1 
ATOM   3214  C  CD    . LYS E 3 305 ? 121.892 -52.367 50.040  1.00 33.57  ? 601 LYS A CD    1 
ATOM   3215  C  CE    . LYS E 3 305 ? 123.326 -52.563 50.483  1.00 34.53  ? 601 LYS A CE    1 
ATOM   3216  N  NZ    . LYS E 3 305 ? 123.983 -53.603 49.640  1.00 35.85  ? 601 LYS A NZ    1 
ATOM   3217  N  N     . VAL E 3 306 ? 118.449 -48.355 49.269  1.00 30.05  ? 602 VAL A N     1 
ATOM   3218  C  CA    . VAL E 3 306 ? 117.733 -47.771 48.136  1.00 29.13  ? 602 VAL A CA    1 
ATOM   3219  C  C     . VAL E 3 306 ? 118.564 -48.001 46.880  1.00 28.58  ? 602 VAL A C     1 
ATOM   3220  O  O     . VAL E 3 306 ? 119.797 -47.927 46.923  1.00 28.21  ? 602 VAL A O     1 
ATOM   3221  C  CB    . VAL E 3 306 ? 117.432 -46.265 48.309  1.00 28.94  ? 602 VAL A CB    1 
ATOM   3222  C  CG1   . VAL E 3 306 ? 116.474 -46.054 49.467  1.00 29.02  ? 602 VAL A CG1   1 
ATOM   3223  C  CG2   . VAL E 3 306 ? 118.724 -45.453 48.485  1.00 28.37  ? 602 VAL A CG2   1 
ATOM   3224  N  N     . HIS E 3 307 ? 117.885 -48.303 45.777  1.00 27.86  ? 603 HIS A N     1 
ATOM   3225  C  CA    . HIS E 3 307 ? 118.557 -48.541 44.510  1.00 27.41  ? 603 HIS A CA    1 
ATOM   3226  C  C     . HIS E 3 307 ? 118.054 -47.578 43.444  1.00 26.73  ? 603 HIS A C     1 
ATOM   3227  O  O     . HIS E 3 307 ? 116.983 -47.764 42.868  1.00 26.64  ? 603 HIS A O     1 
ATOM   3228  C  CB    . HIS E 3 307 ? 118.339 -49.984 44.046  1.00 27.88  ? 603 HIS A CB    1 
ATOM   3229  C  CG    . HIS E 3 307 ? 118.806 -51.022 45.024  1.00 28.73  ? 603 HIS A CG    1 
ATOM   3230  N  ND1   . HIS E 3 307 ? 120.043 -51.626 44.938  1.00 28.94  ? 603 HIS A ND1   1 
ATOM   3231  C  CD2   . HIS E 3 307 ? 118.192 -51.577 46.098  1.00 29.34  ? 603 HIS A CD2   1 
ATOM   3232  C  CE1   . HIS E 3 307 ? 120.172 -52.503 45.919  1.00 29.34  ? 603 HIS A CE1   1 
ATOM   3233  N  NE2   . HIS E 3 307 ? 119.063 -52.494 46.637  1.00 29.30  ? 603 HIS A NE2   1 
ATOM   3234  N  N     . THR E 3 308 ? 118.828 -46.534 43.186  1.00 26.10  ? 604 THR A N     1 
ATOM   3235  C  CA    . THR E 3 308 ? 118.472 -45.577 42.149  1.00 25.15  ? 604 THR A CA    1 
ATOM   3236  C  C     . THR E 3 308 ? 118.833 -46.091 40.763  1.00 24.70  ? 604 THR A C     1 
ATOM   3237  O  O     . THR E 3 308 ? 119.609 -47.022 40.606  1.00 24.33  ? 604 THR A O     1 
ATOM   3238  C  CB    . THR E 3 308 ? 119.197 -44.239 42.338  1.00 24.91  ? 604 THR A CB    1 
ATOM   3239  O  OG1   . THR E 3 308 ? 118.630 -43.265 41.460  1.00 24.59  ? 604 THR A OG1   1 
ATOM   3240  C  CG2   . THR E 3 308 ? 120.661 -44.380 42.010  1.00 24.99  ? 604 THR A CG2   1 
ATOM   3241  N  N     . ILE E 3 309 ? 118.244 -45.474 39.754  1.00 24.68  ? 605 ILE A N     1 
ATOM   3242  C  CA    . ILE E 3 309 ? 118.608 -45.745 38.380  1.00 24.35  ? 605 ILE A CA    1 
ATOM   3243  C  C     . ILE E 3 309 ? 119.262 -44.488 37.826  1.00 24.48  ? 605 ILE A C     1 
ATOM   3244  O  O     . ILE E 3 309 ? 118.734 -43.395 37.967  1.00 24.18  ? 605 ILE A O     1 
ATOM   3245  C  CB    . ILE E 3 309 ? 117.391 -46.139 37.557  1.00 24.31  ? 605 ILE A CB    1 
ATOM   3246  C  CG1   . ILE E 3 309 ? 116.919 -47.531 38.004  1.00 24.47  ? 605 ILE A CG1   1 
ATOM   3247  C  CG2   . ILE E 3 309 ? 117.714 -46.104 36.066  1.00 23.77  ? 605 ILE A CG2   1 
ATOM   3248  C  CD1   . ILE E 3 309 ? 115.614 -47.985 37.380  1.00 24.56  ? 605 ILE A CD1   1 
ATOM   3249  N  N     . PHE E 3 310 ? 120.448 -44.643 37.251  1.00 24.94  ? 606 PHE A N     1 
ATOM   3250  C  CA    . PHE E 3 310 ? 121.137 -43.525 36.633  1.00 25.27  ? 606 PHE A CA    1 
ATOM   3251  C  C     . PHE E 3 310 ? 120.813 -43.546 35.153  1.00 25.50  ? 606 PHE A C     1 
ATOM   3252  O  O     . PHE E 3 310 ? 121.378 -44.350 34.411  1.00 25.91  ? 606 PHE A O     1 
ATOM   3253  C  CB    . PHE E 3 310 ? 122.651 -43.638 36.828  1.00 25.15  ? 606 PHE A CB    1 
ATOM   3254  C  CG    . PHE E 3 310 ? 123.110 -43.333 38.226  1.00 25.31  ? 606 PHE A CG    1 
ATOM   3255  C  CD1   . PHE E 3 310 ? 123.233 -42.020 38.657  1.00 25.74  ? 606 PHE A CD1   1 
ATOM   3256  C  CD2   . PHE E 3 310 ? 123.431 -44.359 39.108  1.00 25.25  ? 606 PHE A CD2   1 
ATOM   3257  C  CE1   . PHE E 3 310 ? 123.656 -41.732 39.945  1.00 25.69  ? 606 PHE A CE1   1 
ATOM   3258  C  CE2   . PHE E 3 310 ? 123.856 -44.083 40.394  1.00 24.83  ? 606 PHE A CE2   1 
ATOM   3259  C  CZ    . PHE E 3 310 ? 123.969 -42.771 40.815  1.00 25.62  ? 606 PHE A CZ    1 
ATOM   3260  N  N     . ASN E 3 311 ? 119.896 -42.686 34.720  1.00 25.40  ? 607 ASN A N     1 
ATOM   3261  C  CA    . ASN E 3 311 ? 119.573 -42.621 33.304  1.00 25.53  ? 607 ASN A CA    1 
ATOM   3262  C  C     . ASN E 3 311 ? 120.740 -42.008 32.509  1.00 25.15  ? 607 ASN A C     1 
ATOM   3263  O  O     . ASN E 3 311 ? 121.033 -40.809 32.606  1.00 25.19  ? 607 ASN A O     1 
ATOM   3264  C  CB    . ASN E 3 311 ? 118.270 -41.872 33.073  1.00 25.83  ? 607 ASN A CB    1 
ATOM   3265  C  CG    . ASN E 3 311 ? 117.699 -42.126 31.694  1.00 28.15  ? 607 ASN A CG    1 
ATOM   3266  O  OD1   . ASN E 3 311 ? 118.444 -42.282 30.707  1.00 30.43  ? 607 ASN A OD1   1 
ATOM   3267  N  ND2   . ASN E 3 311 ? 116.367 -42.185 31.607  1.00 28.99  ? 607 ASN A ND2   1 
ATOM   3268  N  N     . GLN E 3 312 ? 121.411 -42.854 31.731  1.00 24.43  ? 608 GLN A N     1 
ATOM   3269  C  CA    . GLN E 3 312 ? 122.618 -42.450 31.018  1.00 23.32  ? 608 GLN A CA    1 
ATOM   3270  C  C     . GLN E 3 312 ? 122.344 -41.754 29.673  1.00 22.82  ? 608 GLN A C     1 
ATOM   3271  O  O     . GLN E 3 312 ? 123.126 -40.904 29.234  1.00 22.47  ? 608 GLN A O     1 
ATOM   3272  C  CB    . GLN E 3 312 ? 123.520 -43.671 30.818  1.00 23.09  ? 608 GLN A CB    1 
ATOM   3273  C  CG    . GLN E 3 312 ? 124.989 -43.350 30.581  1.00 22.86  ? 608 GLN A CG    1 
ATOM   3274  C  CD    . GLN E 3 312 ? 125.820 -44.593 30.401  1.00 23.05  ? 608 GLN A CD    1 
ATOM   3275  O  OE1   . GLN E 3 312 ? 125.325 -45.701 30.545  1.00 23.28  ? 608 GLN A OE1   1 
ATOM   3276  N  NE2   . GLN E 3 312 ? 127.089 -44.418 30.078  1.00 22.68  ? 608 GLN A NE2   1 
ATOM   3277  N  N     . ALA E 3 313 ? 121.235 -42.110 29.030  1.00 22.04  ? 609 ALA A N     1 
ATOM   3278  C  CA    . ALA E 3 313 ? 120.913 -41.582 27.712  1.00 21.60  ? 609 ALA A CA    1 
ATOM   3279  C  C     . ALA E 3 313 ? 119.729 -40.635 27.728  1.00 21.58  ? 609 ALA A C     1 
ATOM   3280  O  O     . ALA E 3 313 ? 118.753 -40.882 27.016  1.00 21.99  ? 609 ALA A O     1 
ATOM   3281  C  CB    . ALA E 3 313 ? 120.628 -42.731 26.767  1.00 21.26  ? 609 ALA A CB    1 
ATOM   3282  N  N     . LEU E 3 314 ? 119.797 -39.555 28.511  1.00 21.14  ? 610 LEU A N     1 
ATOM   3283  C  CA    . LEU E 3 314 ? 118.632 -38.668 28.651  1.00 20.70  ? 610 LEU A CA    1 
ATOM   3284  C  C     . LEU E 3 314 ? 118.931 -37.170 28.577  1.00 20.56  ? 610 LEU A C     1 
ATOM   3285  O  O     . LEU E 3 314 ? 118.307 -36.470 27.803  1.00 21.13  ? 610 LEU A O     1 
ATOM   3286  C  CB    . LEU E 3 314 ? 117.853 -39.015 29.927  1.00 20.67  ? 610 LEU A CB    1 
ATOM   3287  C  CG    . LEU E 3 314 ? 116.575 -38.268 30.327  1.00 21.06  ? 610 LEU A CG    1 
ATOM   3288  C  CD1   . LEU E 3 314 ? 115.689 -39.155 31.197  1.00 20.28  ? 610 LEU A CD1   1 
ATOM   3289  C  CD2   . LEU E 3 314 ? 116.847 -36.935 31.030  1.00 20.50  ? 610 LEU A CD2   1 
ATOM   3290  N  N     . THR E 3 315 ? 119.882 -36.677 29.359  1.00 20.32  ? 611 THR A N     1 
ATOM   3291  C  CA    . THR E 3 315 ? 120.163 -35.246 29.398  1.00 20.40  ? 611 THR A CA    1 
ATOM   3292  C  C     . THR E 3 315 ? 120.739 -34.732 28.087  1.00 20.75  ? 611 THR A C     1 
ATOM   3293  O  O     . THR E 3 315 ? 121.382 -35.473 27.359  1.00 21.07  ? 611 THR A O     1 
ATOM   3294  C  CB    . THR E 3 315 ? 121.102 -34.849 30.581  1.00 20.54  ? 611 THR A CB    1 
ATOM   3295  O  OG1   . THR E 3 315 ? 122.450 -35.245 30.304  1.00 20.35  ? 611 THR A OG1   1 
ATOM   3296  C  CG2   . THR E 3 315 ? 120.638 -35.476 31.893  1.00 20.08  ? 611 THR A CG2   1 
ATOM   3297  N  N     . GLN E 3 316 ? 120.514 -33.453 27.797  1.00 21.00  ? 612 GLN A N     1 
ATOM   3298  C  CA    . GLN E 3 316 ? 120.986 -32.840 26.553  1.00 21.15  ? 612 GLN A CA    1 
ATOM   3299  C  C     . GLN E 3 316 ? 122.449 -32.397 26.610  1.00 21.03  ? 612 GLN A C     1 
ATOM   3300  O  O     . GLN E 3 316 ? 123.056 -32.136 25.574  1.00 21.24  ? 612 GLN A O     1 
ATOM   3301  C  CB    . GLN E 3 316 ? 120.096 -31.646 26.175  1.00 21.20  ? 612 GLN A CB    1 
ATOM   3302  C  CG    . GLN E 3 316 ? 118.638 -32.021 25.939  1.00 21.89  ? 612 GLN A CG    1 
ATOM   3303  C  CD    . GLN E 3 316 ? 118.461 -32.924 24.731  1.00 23.43  ? 612 GLN A CD    1 
ATOM   3304  O  OE1   . GLN E 3 316 ? 118.631 -32.491 23.582  1.00 24.65  ? 612 GLN A OE1   1 
ATOM   3305  N  NE2   . GLN E 3 316 ? 118.112 -34.179 24.979  1.00 22.00  ? 612 GLN A NE2   1 
ATOM   3306  N  N     . THR E 3 317 ? 123.011 -32.297 27.809  1.00 20.83  ? 613 THR A N     1 
ATOM   3307  C  CA    . THR E 3 317 ? 124.388 -31.827 27.960  1.00 20.79  ? 613 THR A CA    1 
ATOM   3308  C  C     . THR E 3 317 ? 125.388 -32.947 28.205  1.00 20.60  ? 613 THR A C     1 
ATOM   3309  O  O     . THR E 3 317 ? 126.584 -32.748 28.055  1.00 20.90  ? 613 THR A O     1 
ATOM   3310  C  CB    . THR E 3 317 ? 124.531 -30.793 29.093  1.00 20.71  ? 613 THR A CB    1 
ATOM   3311  O  OG1   . THR E 3 317 ? 124.045 -31.354 30.314  1.00 21.24  ? 613 THR A OG1   1 
ATOM   3312  C  CG2   . THR E 3 317 ? 123.739 -29.553 28.776  1.00 21.23  ? 613 THR A CG2   1 
ATOM   3313  N  N     . GLY E 3 318 ? 124.911 -34.118 28.593  1.00 20.53  ? 614 GLY A N     1 
ATOM   3314  C  CA    . GLY E 3 318 ? 125.810 -35.237 28.797  1.00 20.59  ? 614 GLY A CA    1 
ATOM   3315  C  C     . GLY E 3 318 ? 125.856 -35.691 30.234  1.00 20.72  ? 614 GLY A C     1 
ATOM   3316  O  O     . GLY E 3 318 ? 126.457 -36.715 30.550  1.00 20.71  ? 614 GLY A O     1 
ATOM   3317  N  N     . ARG E 3 319 ? 125.231 -34.921 31.114  1.00 20.72  ? 615 ARG A N     1 
ATOM   3318  C  CA    . ARG E 3 319 ? 125.106 -35.341 32.496  1.00 20.70  ? 615 ARG A CA    1 
ATOM   3319  C  C     . ARG E 3 319 ? 124.319 -36.641 32.593  1.00 20.65  ? 615 ARG A C     1 
ATOM   3320  O  O     . ARG E 3 319 ? 123.781 -37.137 31.597  1.00 20.51  ? 615 ARG A O     1 
ATOM   3321  C  CB    . ARG E 3 319 ? 124.383 -34.279 33.306  1.00 20.47  ? 615 ARG A CB    1 
ATOM   3322  C  CG    . ARG E 3 319 ? 125.219 -33.060 33.577  1.00 21.21  ? 615 ARG A CG    1 
ATOM   3323  C  CD    . ARG E 3 319 ? 124.533 -32.191 34.594  1.00 21.98  ? 615 ARG A CD    1 
ATOM   3324  N  NE    . ARG E 3 319 ? 125.423 -31.165 35.119  1.00 22.52  ? 615 ARG A NE    1 
ATOM   3325  C  CZ    . ARG E 3 319 ? 125.089 -30.328 36.090  1.00 22.35  ? 615 ARG A CZ    1 
ATOM   3326  N  NH1   . ARG E 3 319 ? 123.881 -30.405 36.643  1.00 21.71  ? 615 ARG A NH1   1 
ATOM   3327  N  NH2   . ARG E 3 319 ? 125.961 -29.424 36.506  1.00 23.24  ? 615 ARG A NH2   1 
ATOM   3328  N  N     . LEU E 3 320 ? 124.270 -37.191 33.800  1.00 20.56  ? 616 LEU A N     1 
ATOM   3329  C  CA    . LEU E 3 320 ? 123.411 -38.319 34.094  1.00 20.39  ? 616 LEU A CA    1 
ATOM   3330  C  C     . LEU E 3 320 ? 122.243 -37.750 34.878  1.00 20.53  ? 616 LEU A C     1 
ATOM   3331  O  O     . LEU E 3 320 ? 122.326 -36.641 35.395  1.00 20.03  ? 616 LEU A O     1 
ATOM   3332  C  CB    . LEU E 3 320 ? 124.131 -39.324 34.988  1.00 20.50  ? 616 LEU A CB    1 
ATOM   3333  C  CG    . LEU E 3 320 ? 125.442 -39.945 34.540  1.00 19.63  ? 616 LEU A CG    1 
ATOM   3334  C  CD1   . LEU E 3 320 ? 126.001 -40.746 35.685  1.00 18.36  ? 616 LEU A CD1   1 
ATOM   3335  C  CD2   . LEU E 3 320 ? 125.210 -40.820 33.329  1.00 19.66  ? 616 LEU A CD2   1 
ATOM   3336  N  N     . SER E 3 321 ? 121.154 -38.509 34.958  1.00 20.86  ? 617 SER A N     1 
ATOM   3337  C  CA    . SER E 3 321 ? 120.042 -38.159 35.832  1.00 21.01  ? 617 SER A CA    1 
ATOM   3338  C  C     . SER E 3 321 ? 119.821 -39.339 36.779  1.00 21.16  ? 617 SER A C     1 
ATOM   3339  O  O     . SER E 3 321 ? 120.258 -40.453 36.497  1.00 21.51  ? 617 SER A O     1 
ATOM   3340  C  CB    . SER E 3 321 ? 118.775 -37.825 35.039  1.00 20.91  ? 617 SER A CB    1 
ATOM   3341  O  OG    . SER E 3 321 ? 118.160 -38.985 34.509  1.00 21.23  ? 617 SER A OG    1 
ATOM   3342  N  N     . SER E 3 322 ? 119.161 -39.095 37.903  1.00 21.25  ? 618 SER A N     1 
ATOM   3343  C  CA    . SER E 3 322 ? 118.933 -40.139 38.892  1.00 21.27  ? 618 SER A CA    1 
ATOM   3344  C  C     . SER E 3 322 ? 117.461 -40.257 39.237  1.00 21.58  ? 618 SER A C     1 
ATOM   3345  O  O     . SER E 3 322 ? 116.840 -39.272 39.643  1.00 20.90  ? 618 SER A O     1 
ATOM   3346  C  CB    . SER E 3 322 ? 119.723 -39.847 40.163  1.00 21.08  ? 618 SER A CB    1 
ATOM   3347  O  OG    . SER E 3 322 ? 119.347 -40.757 41.185  1.00 21.37  ? 618 SER A OG    1 
ATOM   3348  N  N     . THR E 3 323 ? 116.906 -41.462 39.085  1.00 22.08  ? 619 THR A N     1 
ATOM   3349  C  CA    . THR E 3 323 ? 115.482 -41.670 39.361  1.00 23.05  ? 619 THR A CA    1 
ATOM   3350  C  C     . THR E 3 323 ? 115.115 -42.825 40.298  1.00 23.45  ? 619 THR A C     1 
ATOM   3351  O  O     . THR E 3 323 ? 115.803 -43.855 40.375  1.00 23.21  ? 619 THR A O     1 
ATOM   3352  C  CB    . THR E 3 323 ? 114.640 -41.807 38.060  1.00 22.97  ? 619 THR A CB    1 
ATOM   3353  O  OG1   . THR E 3 323 ? 115.206 -42.827 37.233  1.00 24.37  ? 619 THR A OG1   1 
ATOM   3354  C  CG2   . THR E 3 323 ? 114.621 -40.497 37.287  1.00 23.01  ? 619 THR A CG2   1 
ATOM   3355  N  N     . GLU E 3 324 ? 114.021 -42.591 41.024  1.00 23.88  ? 620 GLU A N     1 
ATOM   3356  C  CA    . GLU E 3 324 ? 113.340 -43.579 41.846  1.00 24.34  ? 620 GLU A CA    1 
ATOM   3357  C  C     . GLU E 3 324 ? 114.206 -44.346 42.861  1.00 23.72  ? 620 GLU A C     1 
ATOM   3358  O  O     . GLU E 3 324 ? 114.254 -45.576 42.817  1.00 23.83  ? 620 GLU A O     1 
ATOM   3359  C  CB    . GLU E 3 324 ? 112.602 -44.542 40.904  1.00 24.43  ? 620 GLU A CB    1 
ATOM   3360  C  CG    . GLU E 3 324 ? 111.528 -45.415 41.558  1.00 26.25  ? 620 GLU A CG    1 
ATOM   3361  C  CD    . GLU E 3 324 ? 110.620 -46.083 40.537  1.00 26.31  ? 620 GLU A CD    1 
ATOM   3362  O  OE1   . GLU E 3 324 ? 110.669 -45.695 39.340  1.00 30.08  ? 620 GLU A OE1   1 
ATOM   3363  O  OE2   . GLU E 3 324 ? 109.853 -46.989 40.937  1.00 28.40  ? 620 GLU A OE2   1 
ATOM   3364  N  N     . PRO E 3 325 ? 114.841 -43.635 43.821  1.00 23.31  ? 621 PRO A N     1 
ATOM   3365  C  CA    . PRO E 3 325 ? 114.782 -42.201 44.097  1.00 23.02  ? 621 PRO A CA    1 
ATOM   3366  C  C     . PRO E 3 325 ? 115.837 -41.360 43.384  1.00 22.96  ? 621 PRO A C     1 
ATOM   3367  O  O     . PRO E 3 325 ? 116.826 -41.893 42.874  1.00 22.57  ? 621 PRO A O     1 
ATOM   3368  C  CB    . PRO E 3 325 ? 115.074 -42.138 45.600  1.00 22.97  ? 621 PRO A CB    1 
ATOM   3369  C  CG    . PRO E 3 325 ? 116.021 -43.275 45.840  1.00 23.00  ? 621 PRO A CG    1 
ATOM   3370  C  CD    . PRO E 3 325 ? 115.722 -44.331 44.783  1.00 23.14  ? 621 PRO A CD    1 
ATOM   3371  N  N     . ASN E 3 326 ? 115.618 -40.043 43.368  1.00 22.60  ? 622 ASN A N     1 
ATOM   3372  C  CA    . ASN E 3 326 ? 116.621 -39.124 42.883  1.00 22.12  ? 622 ASN A CA    1 
ATOM   3373  C  C     . ASN E 3 326 ? 117.604 -38.942 44.024  1.00 21.98  ? 622 ASN A C     1 
ATOM   3374  O  O     . ASN E 3 326 ? 117.253 -38.402 45.071  1.00 21.92  ? 622 ASN A O     1 
ATOM   3375  C  CB    . ASN E 3 326 ? 115.986 -37.790 42.488  1.00 22.11  ? 622 ASN A CB    1 
ATOM   3376  C  CG    . ASN E 3 326 ? 116.996 -36.788 41.912  1.00 22.97  ? 622 ASN A CG    1 
ATOM   3377  O  OD1   . ASN E 3 326 ? 118.223 -36.938 42.043  1.00 22.66  ? 622 ASN A OD1   1 
ATOM   3378  N  ND2   . ASN E 3 326 ? 116.471 -35.744 41.279  1.00 23.76  ? 622 ASN A ND2   1 
ATOM   3379  N  N     . LEU E 3 327 ? 118.827 -39.423 43.845  1.00 21.83  ? 623 LEU A N     1 
ATOM   3380  C  CA    . LEU E 3 327 ? 119.835 -39.254 44.882  1.00 21.93  ? 623 LEU A CA    1 
ATOM   3381  C  C     . LEU E 3 327 ? 120.833 -38.148 44.536  1.00 22.20  ? 623 LEU A C     1 
ATOM   3382  O  O     . LEU E 3 327 ? 121.849 -37.971 45.213  1.00 22.15  ? 623 LEU A O     1 
ATOM   3383  C  CB    . LEU E 3 327 ? 120.534 -40.581 45.180  1.00 21.87  ? 623 LEU A CB    1 
ATOM   3384  C  CG    . LEU E 3 327 ? 119.608 -41.676 45.725  1.00 21.36  ? 623 LEU A CG    1 
ATOM   3385  C  CD1   . LEU E 3 327 ? 120.316 -43.015 45.876  1.00 20.32  ? 623 LEU A CD1   1 
ATOM   3386  C  CD2   . LEU E 3 327 ? 118.986 -41.251 47.039  1.00 20.81  ? 623 LEU A CD2   1 
ATOM   3387  N  N     . GLN E 3 328 ? 120.533 -37.393 43.483  1.00 22.52  ? 624 GLN A N     1 
ATOM   3388  C  CA    . GLN E 3 328 ? 121.399 -36.290 43.072  1.00 22.56  ? 624 GLN A CA    1 
ATOM   3389  C  C     . GLN E 3 328 ? 120.852 -34.931 43.516  1.00 23.02  ? 624 GLN A C     1 
ATOM   3390  O  O     . GLN E 3 328 ? 121.411 -33.878 43.152  1.00 22.76  ? 624 GLN A O     1 
ATOM   3391  C  CB    . GLN E 3 328 ? 121.609 -36.296 41.566  1.00 22.22  ? 624 GLN A CB    1 
ATOM   3392  C  CG    . GLN E 3 328 ? 122.479 -37.406 41.072  1.00 21.24  ? 624 GLN A CG    1 
ATOM   3393  C  CD    . GLN E 3 328 ? 122.675 -37.347 39.566  1.00 20.18  ? 624 GLN A CD    1 
ATOM   3394  O  OE1   . GLN E 3 328 ? 121.775 -36.944 38.824  1.00 18.81  ? 624 GLN A OE1   1 
ATOM   3395  N  NE2   . GLN E 3 328 ? 123.855 -37.758 39.107  1.00 18.97  ? 624 GLN A NE2   1 
ATOM   3396  N  N     . ASN E 3 329 ? 119.769 -34.960 44.300  1.00 23.45  ? 625 ASN A N     1 
ATOM   3397  C  CA    . ASN E 3 329 ? 119.151 -33.726 44.815  1.00 23.80  ? 625 ASN A CA    1 
ATOM   3398  C  C     . ASN E 3 329 ? 118.753 -33.772 46.292  1.00 24.27  ? 625 ASN A C     1 
ATOM   3399  O  O     . ASN E 3 329 ? 117.783 -33.122 46.706  1.00 24.36  ? 625 ASN A O     1 
ATOM   3400  C  CB    . ASN E 3 329 ? 117.977 -33.253 43.950  1.00 23.32  ? 625 ASN A CB    1 
ATOM   3401  C  CG    . ASN E 3 329 ? 116.726 -34.086 44.136  1.00 23.76  ? 625 ASN A CG    1 
ATOM   3402  O  OD1   . ASN E 3 329 ? 116.755 -35.183 44.716  1.00 24.67  ? 625 ASN A OD1   1 
ATOM   3403  N  ND2   . ASN E 3 329 ? 115.607 -33.568 43.638  1.00 22.32  ? 625 ASN A ND2   1 
ATOM   3404  N  N     . ILE E 3 330 ? 119.500 -34.560 47.063  1.00 24.54  ? 626 ILE A N     1 
ATOM   3405  C  CA    . ILE E 3 330 ? 119.338 -34.635 48.506  1.00 24.84  ? 626 ILE A CA    1 
ATOM   3406  C  C     . ILE E 3 330 ? 119.777 -33.291 49.099  1.00 25.26  ? 626 ILE A C     1 
ATOM   3407  O  O     . ILE E 3 330 ? 120.840 -32.785 48.758  1.00 25.22  ? 626 ILE A O     1 
ATOM   3408  C  CB    . ILE E 3 330 ? 120.202 -35.775 49.096  1.00 24.90  ? 626 ILE A CB    1 
ATOM   3409  C  CG1   . ILE E 3 330 ? 119.924 -37.102 48.367  1.00 24.56  ? 626 ILE A CG1   1 
ATOM   3410  C  CG2   . ILE E 3 330 ? 119.995 -35.902 50.618  1.00 24.40  ? 626 ILE A CG2   1 
ATOM   3411  C  CD1   . ILE E 3 330 ? 118.491 -37.629 48.500  1.00 23.13  ? 626 ILE A CD1   1 
ATOM   3412  N  N     . PRO E 3 331 ? 118.950 -32.707 49.978  1.00 25.84  ? 627 PRO A N     1 
ATOM   3413  C  CA    . PRO E 3 331 ? 119.219 -31.417 50.630  1.00 26.38  ? 627 PRO A CA    1 
ATOM   3414  C  C     . PRO E 3 331 ? 120.605 -31.284 51.264  1.00 26.88  ? 627 PRO A C     1 
ATOM   3415  O  O     . PRO E 3 331 ? 121.146 -32.255 51.794  1.00 26.79  ? 627 PRO A O     1 
ATOM   3416  C  CB    . PRO E 3 331 ? 118.165 -31.359 51.745  1.00 26.13  ? 627 PRO A CB    1 
ATOM   3417  C  CG    . PRO E 3 331 ? 117.070 -32.253 51.305  1.00 25.56  ? 627 PRO A CG    1 
ATOM   3418  C  CD    . PRO E 3 331 ? 117.656 -33.284 50.391  1.00 25.85  ? 627 PRO A CD    1 
ATOM   3419  N  N     . ILE E 3 332 ? 121.161 -30.078 51.205  1.00 27.78  ? 628 ILE A N     1 
ATOM   3420  C  CA    . ILE E 3 332 ? 122.423 -29.766 51.875  1.00 28.67  ? 628 ILE A CA    1 
ATOM   3421  C  C     . ILE E 3 332 ? 122.508 -28.282 52.170  1.00 29.19  ? 628 ILE A C     1 
ATOM   3422  O  O     . ILE E 3 332 ? 123.228 -27.872 53.070  1.00 29.37  ? 628 ILE A O     1 
ATOM   3423  C  CB    . ILE E 3 332 ? 123.676 -30.152 51.036  1.00 28.91  ? 628 ILE A CB    1 
ATOM   3424  C  CG1   . ILE E 3 332 ? 124.945 -30.048 51.891  1.00 28.48  ? 628 ILE A CG1   1 
ATOM   3425  C  CG2   . ILE E 3 332 ? 123.812 -29.265 49.791  1.00 29.12  ? 628 ILE A CG2   1 
ATOM   3426  C  CD1   . ILE E 3 332 ? 126.212 -30.337 51.141  1.00 28.59  ? 628 ILE A CD1   1 
ATOM   3427  N  N     . ARG E 3 333 ? 121.755 -27.488 51.413  1.00 30.03  ? 629 ARG A N     1 
ATOM   3428  C  CA    . ARG E 3 333 ? 121.838 -26.023 51.482  1.00 30.71  ? 629 ARG A CA    1 
ATOM   3429  C  C     . ARG E 3 333 ? 121.348 -25.385 52.780  1.00 31.35  ? 629 ARG A C     1 
ATOM   3430  O  O     . ARG E 3 333 ? 121.971 -24.445 53.274  1.00 31.55  ? 629 ARG A O     1 
ATOM   3431  C  CB    . ARG E 3 333 ? 121.181 -25.385 50.249  1.00 30.32  ? 629 ARG A CB    1 
ATOM   3432  C  CG    . ARG E 3 333 ? 121.958 -25.705 48.983  1.00 30.57  ? 629 ARG A CG    1 
ATOM   3433  C  CD    . ARG E 3 333 ? 121.344 -25.129 47.715  1.00 30.75  ? 629 ARG A CD    1 
ATOM   3434  N  NE    . ARG E 3 333 ? 122.149 -25.470 46.541  1.00 29.49  ? 629 ARG A NE    1 
ATOM   3435  C  CZ    . ARG E 3 333 ? 121.739 -25.330 45.286  1.00 28.80  ? 629 ARG A CZ    1 
ATOM   3436  N  NH1   . ARG E 3 333 ? 120.534 -24.858 45.041  1.00 29.34  ? 629 ARG A NH1   1 
ATOM   3437  N  NH2   . ARG E 3 333 ? 122.525 -25.670 44.276  1.00 28.72  ? 629 ARG A NH2   1 
ATOM   3438  N  N     . LEU E 3 334 ? 120.242 -25.886 53.322  1.00 32.17  ? 630 LEU A N     1 
ATOM   3439  C  CA    . LEU E 3 334 ? 119.710 -25.386 54.592  1.00 33.13  ? 630 LEU A CA    1 
ATOM   3440  C  C     . LEU E 3 334 ? 119.872 -26.451 55.666  1.00 33.92  ? 630 LEU A C     1 
ATOM   3441  O  O     . LEU E 3 334 ? 119.390 -27.579 55.504  1.00 34.41  ? 630 LEU A O     1 
ATOM   3442  C  CB    . LEU E 3 334 ? 118.232 -25.040 54.461  1.00 33.16  ? 630 LEU A CB    1 
ATOM   3443  C  CG    . LEU E 3 334 ? 117.831 -24.007 53.416  1.00 32.96  ? 630 LEU A CG    1 
ATOM   3444  C  CD1   . LEU E 3 334 ? 116.325 -24.088 53.178  1.00 32.78  ? 630 LEU A CD1   1 
ATOM   3445  C  CD2   . LEU E 3 334 ? 118.278 -22.611 53.845  1.00 33.21  ? 630 LEU A CD2   1 
ATOM   3446  N  N     . GLU E 3 335 ? 120.529 -26.085 56.765  1.00 34.53  ? 631 GLU A N     1 
ATOM   3447  C  CA    . GLU E 3 335 ? 120.825 -27.017 57.857  1.00 35.34  ? 631 GLU A CA    1 
ATOM   3448  C  C     . GLU E 3 335 ? 119.710 -28.037 58.200  1.00 35.23  ? 631 GLU A C     1 
ATOM   3449  O  O     . GLU E 3 335 ? 119.991 -29.221 58.371  1.00 35.26  ? 631 GLU A O     1 
ATOM   3450  C  CB    . GLU E 3 335 ? 121.310 -26.247 59.098  1.00 35.69  ? 631 GLU A CB    1 
ATOM   3451  C  CG    . GLU E 3 335 ? 121.770 -27.129 60.269  1.00 37.93  ? 631 GLU A CG    1 
ATOM   3452  C  CD    . GLU E 3 335 ? 122.851 -28.141 59.880  1.00 41.21  ? 631 GLU A CD    1 
ATOM   3453  O  OE1   . GLU E 3 335 ? 123.791 -27.775 59.126  1.00 42.68  ? 631 GLU A OE1   1 
ATOM   3454  O  OE2   . GLU E 3 335 ? 122.764 -29.303 60.345  1.00 41.93  ? 631 GLU A OE2   1 
ATOM   3455  N  N     . GLU E 3 336 ? 118.460 -27.587 58.286  1.00 35.33  ? 632 GLU A N     1 
ATOM   3456  C  CA    . GLU E 3 336 ? 117.331 -28.491 58.549  1.00 35.47  ? 632 GLU A CA    1 
ATOM   3457  C  C     . GLU E 3 336 ? 117.250 -29.648 57.545  1.00 35.13  ? 632 GLU A C     1 
ATOM   3458  O  O     . GLU E 3 336 ? 117.128 -30.807 57.940  1.00 35.22  ? 632 GLU A O     1 
ATOM   3459  C  CB    . GLU E 3 336 ? 116.006 -27.735 58.528  1.00 35.74  ? 632 GLU A CB    1 
ATOM   3460  C  CG    . GLU E 3 336 ? 115.973 -26.470 59.360  1.00 37.42  ? 632 GLU A CG    1 
ATOM   3461  C  CD    . GLU E 3 336 ? 114.550 -26.030 59.643  1.00 39.95  ? 632 GLU A CD    1 
ATOM   3462  O  OE1   . GLU E 3 336 ? 114.223 -24.844 59.392  1.00 40.41  ? 632 GLU A OE1   1 
ATOM   3463  O  OE2   . GLU E 3 336 ? 113.753 -26.888 60.094  1.00 40.01  ? 632 GLU A OE2   1 
ATOM   3464  N  N     . GLY E 3 337 ? 117.298 -29.326 56.253  1.00 34.63  ? 633 GLY A N     1 
ATOM   3465  C  CA    . GLY E 3 337 ? 117.284 -30.341 55.204  1.00 33.84  ? 633 GLY A CA    1 
ATOM   3466  C  C     . GLY E 3 337 ? 118.546 -31.193 55.213  1.00 33.49  ? 633 GLY A C     1 
ATOM   3467  O  O     . GLY E 3 337 ? 118.472 -32.420 55.137  1.00 33.17  ? 633 GLY A O     1 
ATOM   3468  N  N     . ARG E 3 338 ? 119.704 -30.542 55.324  1.00 32.92  ? 634 ARG A N     1 
ATOM   3469  C  CA    . ARG E 3 338 ? 121.002 -31.226 55.344  1.00 32.69  ? 634 ARG A CA    1 
ATOM   3470  C  C     . ARG E 3 338 ? 121.039 -32.430 56.304  1.00 32.58  ? 634 ARG A C     1 
ATOM   3471  O  O     . ARG E 3 338 ? 121.816 -33.364 56.105  1.00 32.34  ? 634 ARG A O     1 
ATOM   3472  C  CB    . ARG E 3 338 ? 122.100 -30.221 55.702  1.00 32.82  ? 634 ARG A CB    1 
ATOM   3473  C  CG    . ARG E 3 338 ? 123.543 -30.676 55.483  1.00 32.63  ? 634 ARG A CG    1 
ATOM   3474  C  CD    . ARG E 3 338 ? 124.500 -29.521 55.788  1.00 32.68  ? 634 ARG A CD    1 
ATOM   3475  N  NE    . ARG E 3 338 ? 125.877 -29.798 55.390  1.00 34.27  ? 634 ARG A NE    1 
ATOM   3476  C  CZ    . ARG E 3 338 ? 126.825 -28.865 55.268  1.00 35.69  ? 634 ARG A CZ    1 
ATOM   3477  N  NH1   . ARG E 3 338 ? 126.538 -27.587 55.508  1.00 36.66  ? 634 ARG A NH1   1 
ATOM   3478  N  NH2   . ARG E 3 338 ? 128.058 -29.200 54.894  1.00 34.92  ? 634 ARG A NH2   1 
ATOM   3479  N  N     . LYS E 3 339 ? 120.184 -32.409 57.327  1.00 32.33  ? 635 LYS A N     1 
ATOM   3480  C  CA    . LYS E 3 339 ? 120.103 -33.496 58.314  1.00 32.38  ? 635 LYS A CA    1 
ATOM   3481  C  C     . LYS E 3 339 ? 119.704 -34.849 57.718  1.00 31.80  ? 635 LYS A C     1 
ATOM   3482  O  O     . LYS E 3 339 ? 120.153 -35.896 58.193  1.00 31.47  ? 635 LYS A O     1 
ATOM   3483  C  CB    . LYS E 3 339 ? 119.138 -33.123 59.448  1.00 32.87  ? 635 LYS A CB    1 
ATOM   3484  C  CG    . LYS E 3 339 ? 119.610 -31.959 60.312  1.00 33.23  ? 635 LYS A CG    1 
ATOM   3485  C  CD    . LYS E 3 339 ? 120.655 -32.403 61.322  1.00 33.92  ? 635 LYS A CD    1 
ATOM   3486  C  CE    . LYS E 3 339 ? 121.211 -31.207 62.083  1.00 34.94  ? 635 LYS A CE    1 
ATOM   3487  N  NZ    . LYS E 3 339 ? 120.126 -30.289 62.553  1.00 35.49  ? 635 LYS A NZ    1 
ATOM   3488  N  N     . ILE E 3 340 ? 118.863 -34.816 56.683  1.00 31.36  ? 636 ILE A N     1 
ATOM   3489  C  CA    . ILE E 3 340 ? 118.431 -36.025 55.967  1.00 30.77  ? 636 ILE A CA    1 
ATOM   3490  C  C     . ILE E 3 340 ? 119.621 -36.933 55.672  1.00 30.35  ? 636 ILE A C     1 
ATOM   3491  O  O     . ILE E 3 340 ? 119.484 -38.158 55.667  1.00 30.44  ? 636 ILE A O     1 
ATOM   3492  C  CB    . ILE E 3 340 ? 117.712 -35.677 54.621  1.00 30.92  ? 636 ILE A CB    1 
ATOM   3493  C  CG1   . ILE E 3 340 ? 116.470 -34.795 54.852  1.00 30.55  ? 636 ILE A CG1   1 
ATOM   3494  C  CG2   . ILE E 3 340 ? 117.348 -36.938 53.832  1.00 30.50  ? 636 ILE A CG2   1 
ATOM   3495  C  CD1   . ILE E 3 340 ? 115.296 -35.492 55.483  1.00 30.29  ? 636 ILE A CD1   1 
ATOM   3496  N  N     . ARG E 3 341 ? 120.788 -36.326 55.460  1.00 29.79  ? 637 ARG A N     1 
ATOM   3497  C  CA    . ARG E 3 341 ? 122.003 -37.061 55.108  1.00 29.54  ? 637 ARG A CA    1 
ATOM   3498  C  C     . ARG E 3 341 ? 122.578 -37.952 56.213  1.00 29.53  ? 637 ARG A C     1 
ATOM   3499  O  O     . ARG E 3 341 ? 123.357 -38.873 55.929  1.00 29.10  ? 637 ARG A O     1 
ATOM   3500  C  CB    . ARG E 3 341 ? 123.070 -36.115 54.558  1.00 29.34  ? 637 ARG A CB    1 
ATOM   3501  C  CG    . ARG E 3 341 ? 122.641 -35.462 53.270  1.00 29.55  ? 637 ARG A CG    1 
ATOM   3502  C  CD    . ARG E 3 341 ? 123.776 -34.842 52.483  1.00 28.93  ? 637 ARG A CD    1 
ATOM   3503  N  NE    . ARG E 3 341 ? 123.265 -34.309 51.220  1.00 28.41  ? 637 ARG A NE    1 
ATOM   3504  C  CZ    . ARG E 3 341 ? 124.017 -33.836 50.230  1.00 27.60  ? 637 ARG A CZ    1 
ATOM   3505  N  NH1   . ARG E 3 341 ? 125.335 -33.821 50.335  1.00 27.46  ? 637 ARG A NH1   1 
ATOM   3506  N  NH2   . ARG E 3 341 ? 123.442 -33.379 49.127  1.00 26.55  ? 637 ARG A NH2   1 
ATOM   3507  N  N     . GLN E 3 342 ? 122.185 -37.694 57.459  1.00 29.53  ? 638 GLN A N     1 
ATOM   3508  C  CA    . GLN E 3 342 ? 122.643 -38.516 58.577  1.00 29.81  ? 638 GLN A CA    1 
ATOM   3509  C  C     . GLN E 3 342 ? 122.100 -39.924 58.428  1.00 29.97  ? 638 GLN A C     1 
ATOM   3510  O  O     . GLN E 3 342 ? 122.697 -40.872 58.928  1.00 30.40  ? 638 GLN A O     1 
ATOM   3511  C  CB    . GLN E 3 342 ? 122.207 -37.933 59.927  1.00 29.85  ? 638 GLN A CB    1 
ATOM   3512  C  CG    . GLN E 3 342 ? 122.710 -36.508 60.219  1.00 29.96  ? 638 GLN A CG    1 
ATOM   3513  C  CD    . GLN E 3 342 ? 122.146 -35.913 61.522  1.00 30.05  ? 638 GLN A CD    1 
ATOM   3514  O  OE1   . GLN E 3 342 ? 121.099 -36.338 62.022  1.00 29.32  ? 638 GLN A OE1   1 
ATOM   3515  N  NE2   . GLN E 3 342 ? 122.844 -34.917 62.065  1.00 30.16  ? 638 GLN A NE2   1 
ATOM   3516  N  N     . ALA E 3 343 ? 120.970 -40.053 57.732  1.00 30.20  ? 639 ALA A N     1 
ATOM   3517  C  CA    . ALA E 3 343 ? 120.325 -41.351 57.494  1.00 30.46  ? 639 ALA A CA    1 
ATOM   3518  C  C     . ALA E 3 343 ? 120.961 -42.182 56.370  1.00 30.76  ? 639 ALA A C     1 
ATOM   3519  O  O     . ALA E 3 343 ? 120.619 -43.355 56.185  1.00 30.71  ? 639 ALA A O     1 
ATOM   3520  C  CB    . ALA E 3 343 ? 118.855 -41.167 57.236  1.00 30.58  ? 639 ALA A CB    1 
ATOM   3521  N  N     . PHE E 3 344 ? 121.872 -41.569 55.618  1.00 31.11  ? 640 PHE A N     1 
ATOM   3522  C  CA    . PHE E 3 344 ? 122.618 -42.283 54.596  1.00 31.50  ? 640 PHE A CA    1 
ATOM   3523  C  C     . PHE E 3 344 ? 123.920 -42.736 55.222  1.00 31.87  ? 640 PHE A C     1 
ATOM   3524  O  O     . PHE E 3 344 ? 124.728 -41.922 55.671  1.00 31.85  ? 640 PHE A O     1 
ATOM   3525  C  CB    . PHE E 3 344 ? 122.835 -41.410 53.359  1.00 31.73  ? 640 PHE A CB    1 
ATOM   3526  C  CG    . PHE E 3 344 ? 121.564 -41.092 52.629  1.00 31.75  ? 640 PHE A CG    1 
ATOM   3527  C  CD1   . PHE E 3 344 ? 121.080 -41.948 51.650  1.00 31.87  ? 640 PHE A CD1   1 
ATOM   3528  C  CD2   . PHE E 3 344 ? 120.834 -39.954 52.940  1.00 32.35  ? 640 PHE A CD2   1 
ATOM   3529  C  CE1   . PHE E 3 344 ? 119.897 -41.670 50.985  1.00 31.85  ? 640 PHE A CE1   1 
ATOM   3530  C  CE2   . PHE E 3 344 ? 119.645 -39.671 52.277  1.00 32.62  ? 640 PHE A CE2   1 
ATOM   3531  C  CZ    . PHE E 3 344 ? 119.180 -40.532 51.298  1.00 31.82  ? 640 PHE A CZ    1 
ATOM   3532  N  N     . VAL E 3 345 ? 124.105 -44.051 55.265  1.00 32.40  ? 641 VAL A N     1 
ATOM   3533  C  CA    . VAL E 3 345 ? 125.195 -44.644 56.019  1.00 33.07  ? 641 VAL A CA    1 
ATOM   3534  C  C     . VAL E 3 345 ? 125.950 -45.710 55.231  1.00 33.94  ? 641 VAL A C     1 
ATOM   3535  O  O     . VAL E 3 345 ? 125.550 -46.060 54.116  1.00 34.22  ? 641 VAL A O     1 
ATOM   3536  C  CB    . VAL E 3 345 ? 124.644 -45.296 57.314  1.00 33.05  ? 641 VAL A CB    1 
ATOM   3537  C  CG1   . VAL E 3 345 ? 124.098 -44.240 58.264  1.00 32.95  ? 641 VAL A CG1   1 
ATOM   3538  C  CG2   . VAL E 3 345 ? 123.575 -46.342 56.987  1.00 32.78  ? 641 VAL A CG2   1 
ATOM   3539  N  N     . PRO E 3 346 ? 127.074 -46.206 55.790  1.00 34.52  ? 642 PRO A N     1 
ATOM   3540  C  CA    . PRO E 3 346 ? 127.777 -47.321 55.168  1.00 35.16  ? 642 PRO A CA    1 
ATOM   3541  C  C     . PRO E 3 346 ? 126.985 -48.624 55.292  1.00 35.79  ? 642 PRO A C     1 
ATOM   3542  O  O     . PRO E 3 346 ? 126.226 -48.796 56.240  1.00 35.57  ? 642 PRO A O     1 
ATOM   3543  C  CB    . PRO E 3 346 ? 129.095 -47.384 55.956  1.00 35.19  ? 642 PRO A CB    1 
ATOM   3544  C  CG    . PRO E 3 346 ? 129.212 -46.018 56.614  1.00 34.64  ? 642 PRO A CG    1 
ATOM   3545  C  CD    . PRO E 3 346 ? 127.805 -45.711 56.968  1.00 34.39  ? 642 PRO A CD    1 
ATOM   3546  N  N     . SER E 3 347 ? 127.155 -49.520 54.324  1.00 36.89  ? 643 SER A N     1 
ATOM   3547  C  CA    . SER E 3 347 ? 126.407 -50.780 54.291  1.00 37.97  ? 643 SER A CA    1 
ATOM   3548  C  C     . SER E 3 347 ? 126.994 -51.871 55.184  1.00 38.96  ? 643 SER A C     1 
ATOM   3549  O  O     . SER E 3 347 ? 126.302 -52.826 55.525  1.00 39.17  ? 643 SER A O     1 
ATOM   3550  C  CB    . SER E 3 347 ? 126.293 -51.306 52.858  1.00 37.82  ? 643 SER A CB    1 
ATOM   3551  O  OG    . SER E 3 347 ? 127.570 -51.597 52.322  1.00 36.75  ? 643 SER A OG    1 
ATOM   3552  N  N     . GLU E 3 348 ? 128.266 -51.732 55.544  1.00 40.07  ? 644 GLU A N     1 
ATOM   3553  C  CA    . GLU E 3 348 ? 128.942 -52.714 56.384  1.00 41.25  ? 644 GLU A CA    1 
ATOM   3554  C  C     . GLU E 3 348 ? 129.175 -52.224 57.811  1.00 41.85  ? 644 GLU A C     1 
ATOM   3555  O  O     . GLU E 3 348 ? 128.661 -51.186 58.221  1.00 41.84  ? 644 GLU A O     1 
ATOM   3556  C  CB    . GLU E 3 348 ? 130.269 -53.146 55.763  1.00 41.39  ? 644 GLU A CB    1 
ATOM   3557  C  CG    . GLU E 3 348 ? 130.161 -53.988 54.502  1.00 42.40  ? 644 GLU A CG    1 
ATOM   3558  C  CD    . GLU E 3 348 ? 129.891 -55.458 54.791  1.00 44.22  ? 644 GLU A CD    1 
ATOM   3559  O  OE1   . GLU E 3 348 ? 130.825 -56.273 54.593  1.00 44.57  ? 644 GLU A OE1   1 
ATOM   3560  O  OE2   . GLU E 3 348 ? 128.762 -55.794 55.229  1.00 44.24  ? 644 GLU A OE2   1 
ATOM   3561  N  N     . SER E 3 349 ? 129.988 -52.975 58.546  1.00 42.91  ? 645 SER A N     1 
ATOM   3562  C  CA    . SER E 3 349 ? 130.175 -52.766 59.988  1.00 43.57  ? 645 SER A CA    1 
ATOM   3563  C  C     . SER E 3 349 ? 131.058 -51.574 60.371  1.00 43.67  ? 645 SER A C     1 
ATOM   3564  O  O     . SER E 3 349 ? 130.609 -50.645 61.059  1.00 43.51  ? 645 SER A O     1 
ATOM   3565  C  CB    . SER E 3 349 ? 130.717 -54.060 60.617  1.00 43.63  ? 645 SER A CB    1 
ATOM   3566  O  OG    . SER E 3 349 ? 130.665 -54.015 62.030  1.00 44.82  ? 645 SER A OG    1 
ATOM   3567  N  N     . ASP E 3 350 ? 132.313 -51.607 59.936  1.00 43.76  ? 646 ASP A N     1 
ATOM   3568  C  CA    . ASP E 3 350 ? 133.255 -50.554 60.286  1.00 43.86  ? 646 ASP A CA    1 
ATOM   3569  C  C     . ASP E 3 350 ? 133.652 -49.759 59.057  1.00 43.70  ? 646 ASP A C     1 
ATOM   3570  O  O     . ASP E 3 350 ? 134.805 -49.338 58.915  1.00 43.86  ? 646 ASP A O     1 
ATOM   3571  C  CB    . ASP E 3 350 ? 134.483 -51.154 60.968  1.00 44.13  ? 646 ASP A CB    1 
ATOM   3572  C  CG    . ASP E 3 350 ? 134.266 -51.389 62.454  1.00 45.15  ? 646 ASP A CG    1 
ATOM   3573  O  OD1   . ASP E 3 350 ? 134.533 -50.452 63.244  1.00 46.77  ? 646 ASP A OD1   1 
ATOM   3574  O  OD2   . ASP E 3 350 ? 133.845 -52.507 62.832  1.00 44.79  ? 646 ASP A OD2   1 
ATOM   3575  N  N     . TRP E 3 351 ? 132.684 -49.552 58.170  1.00 42.99  ? 647 TRP A N     1 
ATOM   3576  C  CA    . TRP E 3 351 ? 132.930 -48.839 56.929  1.00 42.17  ? 647 TRP A CA    1 
ATOM   3577  C  C     . TRP E 3 351 ? 132.609 -47.355 57.064  1.00 41.61  ? 647 TRP A C     1 
ATOM   3578  O  O     . TRP E 3 351 ? 131.924 -46.949 57.995  1.00 41.44  ? 647 TRP A O     1 
ATOM   3579  C  CB    . TRP E 3 351 ? 132.151 -49.498 55.794  1.00 42.28  ? 647 TRP A CB    1 
ATOM   3580  C  CG    . TRP E 3 351 ? 132.736 -50.815 55.378  1.00 42.09  ? 647 TRP A CG    1 
ATOM   3581  C  CD1   . TRP E 3 351 ? 133.296 -51.754 56.193  1.00 42.03  ? 647 TRP A CD1   1 
ATOM   3582  C  CD2   . TRP E 3 351 ? 132.787 -51.357 54.050  1.00 42.68  ? 647 TRP A CD2   1 
ATOM   3583  N  NE1   . TRP E 3 351 ? 133.710 -52.835 55.457  1.00 42.15  ? 647 TRP A NE1   1 
ATOM   3584  C  CE2   . TRP E 3 351 ? 133.406 -52.621 54.139  1.00 42.39  ? 647 TRP A CE2   1 
ATOM   3585  C  CE3   . TRP E 3 351 ? 132.370 -50.898 52.794  1.00 42.78  ? 647 TRP A CE3   1 
ATOM   3586  C  CZ2   . TRP E 3 351 ? 133.622 -53.430 53.021  1.00 42.05  ? 647 TRP A CZ2   1 
ATOM   3587  C  CZ3   . TRP E 3 351 ? 132.587 -51.705 51.683  1.00 42.30  ? 647 TRP A CZ3   1 
ATOM   3588  C  CH2   . TRP E 3 351 ? 133.208 -52.954 51.806  1.00 42.19  ? 647 TRP A CH2   1 
ATOM   3589  N  N     . LEU E 3 352 ? 133.140 -46.542 56.155  1.00 40.95  ? 648 LEU A N     1 
ATOM   3590  C  CA    . LEU E 3 352 ? 132.894 -45.098 56.188  1.00 40.10  ? 648 LEU A CA    1 
ATOM   3591  C  C     . LEU E 3 352 ? 132.498 -44.573 54.801  1.00 39.62  ? 648 LEU A C     1 
ATOM   3592  O  O     . LEU E 3 352 ? 132.654 -45.271 53.801  1.00 39.41  ? 648 LEU A O     1 
ATOM   3593  C  CB    . LEU E 3 352 ? 134.118 -44.354 56.741  1.00 40.00  ? 648 LEU A CB    1 
ATOM   3594  C  CG    . LEU E 3 352 ? 134.604 -44.631 58.176  1.00 39.20  ? 648 LEU A CG    1 
ATOM   3595  C  CD1   . LEU E 3 352 ? 136.010 -44.111 58.375  1.00 38.67  ? 648 LEU A CD1   1 
ATOM   3596  C  CD2   . LEU E 3 352 ? 133.684 -44.050 59.237  1.00 37.78  ? 648 LEU A CD2   1 
ATOM   3597  N  N     . ILE E 3 353 ? 131.965 -43.353 54.759  1.00 39.19  ? 649 ILE A N     1 
ATOM   3598  C  CA    . ILE E 3 353 ? 131.534 -42.714 53.506  1.00 38.53  ? 649 ILE A CA    1 
ATOM   3599  C  C     . ILE E 3 353 ? 132.545 -41.665 53.049  1.00 38.18  ? 649 ILE A C     1 
ATOM   3600  O  O     . ILE E 3 353 ? 132.762 -40.664 53.730  1.00 37.92  ? 649 ILE A O     1 
ATOM   3601  C  CB    . ILE E 3 353 ? 130.148 -42.009 53.653  1.00 38.65  ? 649 ILE A CB    1 
ATOM   3602  C  CG1   . ILE E 3 353 ? 129.045 -43.002 54.052  1.00 38.39  ? 649 ILE A CG1   1 
ATOM   3603  C  CG2   . ILE E 3 353 ? 129.776 -41.260 52.375  1.00 38.07  ? 649 ILE A CG2   1 
ATOM   3604  C  CD1   . ILE E 3 353 ? 128.790 -44.099 53.047  1.00 37.99  ? 649 ILE A CD1   1 
ATOM   3605  N  N     . PHE E 3 354 ? 133.165 -41.897 51.896  1.00 37.69  ? 650 PHE A N     1 
ATOM   3606  C  CA    . PHE E 3 354 ? 134.116 -40.937 51.352  1.00 37.26  ? 650 PHE A CA    1 
ATOM   3607  C  C     . PHE E 3 354 ? 133.448 -40.108 50.255  1.00 36.79  ? 650 PHE A C     1 
ATOM   3608  O  O     . PHE E 3 354 ? 132.766 -40.646 49.381  1.00 36.47  ? 650 PHE A O     1 
ATOM   3609  C  CB    . PHE E 3 354 ? 135.359 -41.651 50.829  1.00 37.35  ? 650 PHE A CB    1 
ATOM   3610  C  CG    . PHE E 3 354 ? 136.496 -40.728 50.499  1.00 38.35  ? 650 PHE A CG    1 
ATOM   3611  C  CD1   . PHE E 3 354 ? 137.431 -40.384 51.468  1.00 38.59  ? 650 PHE A CD1   1 
ATOM   3612  C  CD2   . PHE E 3 354 ? 136.647 -40.213 49.215  1.00 38.85  ? 650 PHE A CD2   1 
ATOM   3613  C  CE1   . PHE E 3 354 ? 138.492 -39.541 51.168  1.00 37.88  ? 650 PHE A CE1   1 
ATOM   3614  C  CE2   . PHE E 3 354 ? 137.708 -39.359 48.913  1.00 38.49  ? 650 PHE A CE2   1 
ATOM   3615  C  CZ    . PHE E 3 354 ? 138.629 -39.029 49.891  1.00 37.87  ? 650 PHE A CZ    1 
ATOM   3616  N  N     . ALA E 3 355 ? 133.645 -38.795 50.315  1.00 36.32  ? 651 ALA A N     1 
ATOM   3617  C  CA    . ALA E 3 355 ? 133.028 -37.884 49.358  1.00 35.91  ? 651 ALA A CA    1 
ATOM   3618  C  C     . ALA E 3 355 ? 134.022 -36.866 48.796  1.00 35.76  ? 651 ALA A C     1 
ATOM   3619  O  O     . ALA E 3 355 ? 134.435 -35.936 49.484  1.00 35.80  ? 651 ALA A O     1 
ATOM   3620  C  CB    . ALA E 3 355 ? 131.838 -37.181 49.993  1.00 35.68  ? 651 ALA A CB    1 
ATOM   3621  N  N     . ALA E 3 356 ? 134.397 -37.058 47.535  1.00 35.49  ? 652 ALA A N     1 
ATOM   3622  C  CA    . ALA E 3 356 ? 135.318 -36.170 46.841  1.00 35.09  ? 652 ALA A CA    1 
ATOM   3623  C  C     . ALA E 3 356 ? 134.530 -35.215 45.968  1.00 34.89  ? 652 ALA A C     1 
ATOM   3624  O  O     . ALA E 3 356 ? 133.490 -35.584 45.444  1.00 34.69  ? 652 ALA A O     1 
ATOM   3625  C  CB    . ALA E 3 356 ? 136.272 -36.972 46.002  1.00 35.25  ? 652 ALA A CB    1 
ATOM   3626  N  N     . ASP E 3 357 ? 135.061 -34.012 45.763  1.00 34.89  ? 653 ASP A N     1 
ATOM   3627  C  CA    . ASP E 3 357 ? 134.310 -32.927 45.138  1.00 34.67  ? 653 ASP A CA    1 
ATOM   3628  C  C     . ASP E 3 357 ? 135.182 -31.959 44.316  1.00 34.32  ? 653 ASP A C     1 
ATOM   3629  O  O     . ASP E 3 357 ? 136.128 -31.385 44.836  1.00 34.59  ? 653 ASP A O     1 
ATOM   3630  C  CB    . ASP E 3 357 ? 133.616 -32.184 46.281  1.00 34.84  ? 653 ASP A CB    1 
ATOM   3631  C  CG    . ASP E 3 357 ? 133.083 -30.837 45.879  1.00 36.02  ? 653 ASP A CG    1 
ATOM   3632  O  OD1   . ASP E 3 357 ? 132.067 -30.791 45.145  1.00 36.64  ? 653 ASP A OD1   1 
ATOM   3633  O  OD2   . ASP E 3 357 ? 133.664 -29.824 46.341  1.00 36.64  ? 653 ASP A OD2   1 
ATOM   3634  N  N     . TYR E 3 358 ? 134.866 -31.767 43.037  1.00 33.80  ? 654 TYR A N     1 
ATOM   3635  C  CA    . TYR E 3 358 ? 135.636 -30.840 42.185  1.00 33.13  ? 654 TYR A CA    1 
ATOM   3636  C  C     . TYR E 3 358 ? 135.457 -29.371 42.580  1.00 33.30  ? 654 TYR A C     1 
ATOM   3637  O  O     . TYR E 3 358 ? 134.339 -28.930 42.837  1.00 33.41  ? 654 TYR A O     1 
ATOM   3638  C  CB    . TYR E 3 358 ? 135.239 -30.991 40.716  1.00 32.66  ? 654 TYR A CB    1 
ATOM   3639  C  CG    . TYR E 3 358 ? 135.867 -32.149 39.987  1.00 31.88  ? 654 TYR A CG    1 
ATOM   3640  C  CD1   . TYR E 3 358 ? 135.096 -33.214 39.541  1.00 31.19  ? 654 TYR A CD1   1 
ATOM   3641  C  CD2   . TYR E 3 358 ? 137.231 -32.165 39.720  1.00 31.28  ? 654 TYR A CD2   1 
ATOM   3642  C  CE1   . TYR E 3 358 ? 135.665 -34.266 38.862  1.00 30.54  ? 654 TYR A CE1   1 
ATOM   3643  C  CE2   . TYR E 3 358 ? 137.810 -33.212 39.048  1.00 31.00  ? 654 TYR A CE2   1 
ATOM   3644  C  CZ    . TYR E 3 358 ? 137.022 -34.258 38.624  1.00 31.34  ? 654 TYR A CZ    1 
ATOM   3645  O  OH    . TYR E 3 358 ? 137.601 -35.301 37.953  1.00 32.03  ? 654 TYR A OH    1 
ATOM   3646  N  N     . SER E 3 359 ? 136.543 -28.604 42.587  1.00 33.30  ? 655 SER A N     1 
ATOM   3647  C  CA    . SER E 3 359 ? 136.481 -27.196 42.987  1.00 33.43  ? 655 SER A CA    1 
ATOM   3648  C  C     . SER E 3 359 ? 136.351 -26.211 41.811  1.00 33.57  ? 655 SER A C     1 
ATOM   3649  O  O     . SER E 3 359 ? 137.336 -25.890 41.147  1.00 33.83  ? 655 SER A O     1 
ATOM   3650  C  CB    . SER E 3 359 ? 137.695 -26.835 43.863  1.00 33.47  ? 655 SER A CB    1 
ATOM   3651  O  OG    . SER E 3 359 ? 137.736 -25.448 44.160  1.00 32.60  ? 655 SER A OG    1 
ATOM   3652  N  N     . GLN E 3 360 ? 135.133 -25.732 41.575  1.00 33.45  ? 656 GLN A N     1 
ATOM   3653  C  CA    . GLN E 3 360 ? 134.843 -24.739 40.534  1.00 33.71  ? 656 GLN A CA    1 
ATOM   3654  C  C     . GLN E 3 360 ? 135.007 -25.320 39.135  1.00 33.72  ? 656 GLN A C     1 
ATOM   3655  O  O     . GLN E 3 360 ? 135.423 -24.607 38.212  1.00 33.73  ? 656 GLN A O     1 
ATOM   3656  C  CB    . GLN E 3 360 ? 135.742 -23.508 40.699  1.00 34.19  ? 656 GLN A CB    1 
ATOM   3657  C  CG    . GLN E 3 360 ? 135.680 -22.822 42.072  1.00 34.38  ? 656 GLN A CG    1 
ATOM   3658  C  CD    . GLN E 3 360 ? 137.050 -22.358 42.525  1.00 34.55  ? 656 GLN A CD    1 
ATOM   3659  O  OE1   . GLN E 3 360 ? 137.886 -23.173 42.909  1.00 34.20  ? 656 GLN A OE1   1 
ATOM   3660  N  NE2   . GLN E 3 360 ? 137.287 -21.050 42.488  1.00 35.03  ? 656 GLN A NE2   1 
ATOM   3661  N  N     . ILE E 3 361 ? 134.640 -26.597 38.979  1.00 33.44  ? 657 ILE A N     1 
ATOM   3662  C  CA    . ILE E 3 361 ? 134.909 -27.346 37.749  1.00 33.24  ? 657 ILE A CA    1 
ATOM   3663  C  C     . ILE E 3 361 ? 134.431 -26.703 36.463  1.00 33.19  ? 657 ILE A C     1 
ATOM   3664  O  O     . ILE E 3 361 ? 135.096 -26.812 35.433  1.00 33.51  ? 657 ILE A O     1 
ATOM   3665  C  CB    . ILE E 3 361 ? 134.422 -28.820 37.797  1.00 33.44  ? 657 ILE A CB    1 
ATOM   3666  C  CG1   . ILE E 3 361 ? 134.963 -29.573 36.582  1.00 33.22  ? 657 ILE A CG1   1 
ATOM   3667  C  CG2   . ILE E 3 361 ? 132.895 -28.913 37.858  1.00 33.50  ? 657 ILE A CG2   1 
ATOM   3668  C  CD1   . ILE E 3 361 ? 134.702 -31.040 36.603  1.00 35.01  ? 657 ILE A CD1   1 
ATOM   3669  N  N     . GLU E 3 362 ? 133.290 -26.036 36.496  1.00 32.84  ? 658 GLU A N     1 
ATOM   3670  C  CA    . GLU E 3 362 ? 132.806 -25.459 35.256  1.00 32.59  ? 658 GLU A CA    1 
ATOM   3671  C  C     . GLU E 3 362 ? 133.507 -24.141 34.942  1.00 32.23  ? 658 GLU A C     1 
ATOM   3672  O  O     . GLU E 3 362 ? 133.667 -23.773 33.775  1.00 31.80  ? 658 GLU A O     1 
ATOM   3673  C  CB    . GLU E 3 362 ? 131.277 -25.389 35.232  1.00 32.50  ? 658 GLU A CB    1 
ATOM   3674  C  CG    . GLU E 3 362 ? 130.645 -26.787 35.170  1.00 33.33  ? 658 GLU A CG    1 
ATOM   3675  C  CD    . GLU E 3 362 ? 129.147 -26.756 34.933  1.00 34.36  ? 658 GLU A CD    1 
ATOM   3676  O  OE1   . GLU E 3 362 ? 128.491 -27.823 35.015  1.00 33.16  ? 658 GLU A OE1   1 
ATOM   3677  O  OE2   . GLU E 3 362 ? 128.621 -25.647 34.688  1.00 35.88  ? 658 GLU A OE2   1 
ATOM   3678  N  N     . LEU E 3 363 ? 133.960 -23.456 35.991  1.00 32.07  ? 659 LEU A N     1 
ATOM   3679  C  CA    . LEU E 3 363 ? 134.716 -22.217 35.835  1.00 31.95  ? 659 LEU A CA    1 
ATOM   3680  C  C     . LEU E 3 363 ? 136.110 -22.504 35.303  1.00 32.33  ? 659 LEU A C     1 
ATOM   3681  O  O     . LEU E 3 363 ? 136.696 -21.675 34.625  1.00 32.28  ? 659 LEU A O     1 
ATOM   3682  C  CB    . LEU E 3 363 ? 134.803 -21.455 37.151  1.00 31.37  ? 659 LEU A CB    1 
ATOM   3683  C  CG    . LEU E 3 363 ? 133.492 -20.781 37.525  1.00 31.04  ? 659 LEU A CG    1 
ATOM   3684  C  CD1   . LEU E 3 363 ? 133.617 -20.052 38.852  1.00 29.94  ? 659 LEU A CD1   1 
ATOM   3685  C  CD2   . LEU E 3 363 ? 133.062 -19.832 36.419  1.00 30.76  ? 659 LEU A CD2   1 
ATOM   3686  N  N     . ARG E 3 364 ? 136.638 -23.686 35.610  1.00 33.05  ? 660 ARG A N     1 
ATOM   3687  C  CA    . ARG E 3 364 ? 137.940 -24.092 35.093  1.00 33.55  ? 660 ARG A CA    1 
ATOM   3688  C  C     . ARG E 3 364 ? 137.806 -24.540 33.630  1.00 33.87  ? 660 ARG A C     1 
ATOM   3689  O  O     . ARG E 3 364 ? 138.653 -24.217 32.792  1.00 34.33  ? 660 ARG A O     1 
ATOM   3690  C  CB    . ARG E 3 364 ? 138.551 -25.180 35.971  1.00 33.58  ? 660 ARG A CB    1 
ATOM   3691  C  CG    . ARG E 3 364 ? 138.738 -24.743 37.417  1.00 34.18  ? 660 ARG A CG    1 
ATOM   3692  C  CD    . ARG E 3 364 ? 139.340 -25.854 38.256  1.00 35.50  ? 660 ARG A CD    1 
ATOM   3693  N  NE    . ARG E 3 364 ? 139.384 -25.510 39.675  1.00 37.64  ? 660 ARG A NE    1 
ATOM   3694  C  CZ    . ARG E 3 364 ? 140.371 -24.837 40.265  1.00 38.63  ? 660 ARG A CZ    1 
ATOM   3695  N  NH1   . ARG E 3 364 ? 141.418 -24.412 39.567  1.00 39.10  ? 660 ARG A NH1   1 
ATOM   3696  N  NH2   . ARG E 3 364 ? 140.313 -24.584 41.564  1.00 38.98  ? 660 ARG A NH2   1 
ATOM   3697  N  N     . VAL E 3 365 ? 136.734 -25.268 33.324  1.00 33.87  ? 661 VAL A N     1 
ATOM   3698  C  CA    . VAL E 3 365 ? 136.433 -25.646 31.947  1.00 33.88  ? 661 VAL A CA    1 
ATOM   3699  C  C     . VAL E 3 365 ? 136.287 -24.394 31.076  1.00 34.26  ? 661 VAL A C     1 
ATOM   3700  O  O     . VAL E 3 365 ? 136.856 -24.317 29.988  1.00 34.39  ? 661 VAL A O     1 
ATOM   3701  C  CB    . VAL E 3 365 ? 135.161 -26.512 31.866  1.00 33.80  ? 661 VAL A CB    1 
ATOM   3702  C  CG1   . VAL E 3 365 ? 134.584 -26.498 30.473  1.00 33.11  ? 661 VAL A CG1   1 
ATOM   3703  C  CG2   . VAL E 3 365 ? 135.463 -27.931 32.311  1.00 33.42  ? 661 VAL A CG2   1 
ATOM   3704  N  N     . LEU E 3 366 ? 135.543 -23.404 31.561  1.00 34.67  ? 662 LEU A N     1 
ATOM   3705  C  CA    . LEU E 3 366 ? 135.410 -22.146 30.834  1.00 35.17  ? 662 LEU A CA    1 
ATOM   3706  C  C     . LEU E 3 366 ? 136.785 -21.507 30.605  1.00 35.80  ? 662 LEU A C     1 
ATOM   3707  O  O     . LEU E 3 366 ? 137.087 -21.018 29.512  1.00 35.77  ? 662 LEU A O     1 
ATOM   3708  C  CB    . LEU E 3 366 ? 134.484 -21.190 31.585  1.00 34.93  ? 662 LEU A CB    1 
ATOM   3709  C  CG    . LEU E 3 366 ? 134.260 -19.787 31.011  1.00 34.46  ? 662 LEU A CG    1 
ATOM   3710  C  CD1   . LEU E 3 366 ? 133.760 -19.793 29.571  1.00 33.22  ? 662 LEU A CD1   1 
ATOM   3711  C  CD2   . LEU E 3 366 ? 133.288 -19.076 31.889  1.00 33.33  ? 662 LEU A CD2   1 
ATOM   3712  N  N     . ALA E 3 367 ? 137.622 -21.533 31.637  1.00 36.64  ? 663 ALA A N     1 
ATOM   3713  C  CA    . ALA E 3 367 ? 138.969 -20.986 31.539  1.00 37.47  ? 663 ALA A CA    1 
ATOM   3714  C  C     . ALA E 3 367 ? 139.773 -21.697 30.452  1.00 38.03  ? 663 ALA A C     1 
ATOM   3715  O  O     . ALA E 3 367 ? 140.364 -21.037 29.594  1.00 38.20  ? 663 ALA A O     1 
ATOM   3716  C  CB    . ALA E 3 367 ? 139.685 -21.067 32.879  1.00 37.41  ? 663 ALA A CB    1 
ATOM   3717  N  N     . HIS E 3 368 ? 139.783 -23.032 30.484  1.00 38.49  ? 664 HIS A N     1 
ATOM   3718  C  CA    . HIS E 3 368 ? 140.498 -23.821 29.480  1.00 38.96  ? 664 HIS A CA    1 
ATOM   3719  C  C     . HIS E 3 368 ? 139.960 -23.585 28.074  1.00 39.70  ? 664 HIS A C     1 
ATOM   3720  O  O     . HIS E 3 368 ? 140.725 -23.395 27.134  1.00 39.96  ? 664 HIS A O     1 
ATOM   3721  C  CB    . HIS E 3 368 ? 140.439 -25.317 29.802  1.00 38.79  ? 664 HIS A CB    1 
ATOM   3722  C  CG    . HIS E 3 368 ? 140.879 -26.197 28.671  1.00 38.80  ? 664 HIS A CG    1 
ATOM   3723  N  ND1   . HIS E 3 368 ? 142.187 -26.598 28.502  1.00 38.90  ? 664 HIS A ND1   1 
ATOM   3724  C  CD2   . HIS E 3 368 ? 140.185 -26.743 27.643  1.00 38.77  ? 664 HIS A CD2   1 
ATOM   3725  C  CE1   . HIS E 3 368 ? 142.280 -27.358 27.425  1.00 38.58  ? 664 HIS A CE1   1 
ATOM   3726  N  NE2   . HIS E 3 368 ? 141.080 -27.458 26.882  1.00 38.89  ? 664 HIS A NE2   1 
ATOM   3727  N  N     . ILE E 3 369 ? 138.644 -23.595 27.925  1.00 40.46  ? 665 ILE A N     1 
ATOM   3728  C  CA    . ILE E 3 369 ? 138.063 -23.481 26.601  1.00 41.44  ? 665 ILE A CA    1 
ATOM   3729  C  C     . ILE E 3 369 ? 138.167 -22.074 26.018  1.00 42.36  ? 665 ILE A C     1 
ATOM   3730  O  O     . ILE E 3 369 ? 138.456 -21.909 24.832  1.00 42.30  ? 665 ILE A O     1 
ATOM   3731  C  CB    . ILE E 3 369 ? 136.614 -24.014 26.574  1.00 41.36  ? 665 ILE A CB    1 
ATOM   3732  C  CG1   . ILE E 3 369 ? 136.628 -25.515 26.872  1.00 41.25  ? 665 ILE A CG1   1 
ATOM   3733  C  CG2   . ILE E 3 369 ? 135.950 -23.738 25.231  1.00 40.83  ? 665 ILE A CG2   1 
ATOM   3734  C  CD1   . ILE E 3 369 ? 135.261 -26.182 26.853  1.00 41.38  ? 665 ILE A CD1   1 
ATOM   3735  N  N     . ALA E 3 370 ? 137.962 -21.062 26.852  1.00 43.42  ? 666 ALA A N     1 
ATOM   3736  C  CA    . ALA E 3 370 ? 137.992 -19.689 26.372  1.00 44.66  ? 666 ALA A CA    1 
ATOM   3737  C  C     . ALA E 3 370 ? 139.406 -19.102 26.321  1.00 45.58  ? 666 ALA A C     1 
ATOM   3738  O  O     . ALA E 3 370 ? 139.610 -18.024 25.759  1.00 45.61  ? 666 ALA A O     1 
ATOM   3739  C  CB    . ALA E 3 370 ? 137.076 -18.816 27.218  1.00 44.61  ? 666 ALA A CB    1 
ATOM   3740  N  N     . GLU E 3 371 ? 140.365 -19.807 26.925  1.00 46.79  ? 667 GLU A N     1 
ATOM   3741  C  CA    . GLU E 3 371 ? 141.778 -19.386 26.982  1.00 48.15  ? 667 GLU A CA    1 
ATOM   3742  C  C     . GLU E 3 371 ? 142.028 -17.982 27.550  1.00 48.70  ? 667 GLU A C     1 
ATOM   3743  O  O     . GLU E 3 371 ? 143.036 -17.340 27.229  1.00 48.54  ? 667 GLU A O     1 
ATOM   3744  C  CB    . GLU E 3 371 ? 142.440 -19.515 25.611  1.00 48.41  ? 667 GLU A CB    1 
ATOM   3745  C  CG    . GLU E 3 371 ? 142.667 -20.938 25.182  1.00 49.75  ? 667 GLU A CG    1 
ATOM   3746  C  CD    . GLU E 3 371 ? 143.506 -21.033 23.928  1.00 51.78  ? 667 GLU A CD    1 
ATOM   3747  O  OE1   . GLU E 3 371 ? 144.336 -21.965 23.855  1.00 53.00  ? 667 GLU A OE1   1 
ATOM   3748  O  OE2   . GLU E 3 371 ? 143.346 -20.175 23.026  1.00 52.16  ? 667 GLU A OE2   1 
ATOM   3749  N  N     . ASP E 3 372 ? 141.110 -17.531 28.401  1.00 49.58  ? 668 ASP A N     1 
ATOM   3750  C  CA    . ASP E 3 372 ? 141.179 -16.212 29.028  1.00 50.20  ? 668 ASP A CA    1 
ATOM   3751  C  C     . ASP E 3 372 ? 142.363 -16.082 29.982  1.00 50.80  ? 668 ASP A C     1 
ATOM   3752  O  O     . ASP E 3 372 ? 142.524 -16.885 30.902  1.00 50.79  ? 668 ASP A O     1 
ATOM   3753  C  CB    . ASP E 3 372 ? 139.866 -15.915 29.756  1.00 50.01  ? 668 ASP A CB    1 
ATOM   3754  C  CG    . ASP E 3 372 ? 139.845 -14.542 30.372  1.00 49.68  ? 668 ASP A CG    1 
ATOM   3755  O  OD1   . ASP E 3 372 ? 140.454 -14.367 31.447  1.00 49.21  ? 668 ASP A OD1   1 
ATOM   3756  O  OD2   . ASP E 3 372 ? 139.201 -13.644 29.789  1.00 49.60  ? 668 ASP A OD2   1 
ATOM   3757  N  N     . ASP E 3 373 ? 143.178 -15.054 29.757  1.00 51.65  ? 669 ASP A N     1 
ATOM   3758  C  CA    . ASP E 3 373 ? 144.386 -14.814 30.553  1.00 52.41  ? 669 ASP A CA    1 
ATOM   3759  C  C     . ASP E 3 373 ? 144.130 -14.589 32.033  1.00 52.66  ? 669 ASP A C     1 
ATOM   3760  O  O     . ASP E 3 373 ? 144.635 -15.338 32.874  1.00 52.60  ? 669 ASP A O     1 
ATOM   3761  C  CB    . ASP E 3 373 ? 145.174 -13.629 29.994  1.00 52.61  ? 669 ASP A CB    1 
ATOM   3762  C  CG    . ASP E 3 373 ? 146.049 -14.015 28.827  1.00 53.59  ? 669 ASP A CG    1 
ATOM   3763  O  OD1   . ASP E 3 373 ? 146.514 -15.178 28.796  1.00 55.03  ? 669 ASP A OD1   1 
ATOM   3764  O  OD2   . ASP E 3 373 ? 146.281 -13.154 27.950  1.00 54.55  ? 669 ASP A OD2   1 
ATOM   3765  N  N     . ASN E 3 374 ? 143.357 -13.550 32.344  1.00 53.09  ? 670 ASN A N     1 
ATOM   3766  C  CA    . ASN E 3 374 ? 143.060 -13.204 33.730  1.00 53.62  ? 670 ASN A CA    1 
ATOM   3767  C  C     . ASN E 3 374 ? 142.370 -14.349 34.472  1.00 53.77  ? 670 ASN A C     1 
ATOM   3768  O  O     . ASN E 3 374 ? 142.577 -14.535 35.672  1.00 53.82  ? 670 ASN A O     1 
ATOM   3769  C  CB    . ASN E 3 374 ? 142.239 -11.909 33.807  1.00 53.61  ? 670 ASN A CB    1 
ATOM   3770  C  CG    . ASN E 3 374 ? 142.022 -11.431 35.245  1.00 54.49  ? 670 ASN A CG    1 
ATOM   3771  O  OD1   . ASN E 3 374 ? 142.860 -11.662 36.133  1.00 55.12  ? 670 ASN A OD1   1 
ATOM   3772  N  ND2   . ASN E 3 374 ? 140.897 -10.751 35.478  1.00 54.36  ? 670 ASN A ND2   1 
ATOM   3773  N  N     . LEU E 3 375 ? 141.574 -15.133 33.752  1.00 54.20  ? 671 LEU A N     1 
ATOM   3774  C  CA    . LEU E 3 375 ? 140.906 -16.273 34.365  1.00 54.72  ? 671 LEU A CA    1 
ATOM   3775  C  C     . LEU E 3 375 ? 141.865 -17.441 34.588  1.00 55.09  ? 671 LEU A C     1 
ATOM   3776  O  O     . LEU E 3 375 ? 141.844 -18.054 35.652  1.00 55.26  ? 671 LEU A O     1 
ATOM   3777  C  CB    . LEU E 3 375 ? 139.678 -16.713 33.560  1.00 54.61  ? 671 LEU A CB    1 
ATOM   3778  C  CG    . LEU E 3 375 ? 138.716 -17.676 34.262  1.00 54.31  ? 671 LEU A CG    1 
ATOM   3779  C  CD1   . LEU E 3 375 ? 138.297 -17.144 35.625  1.00 54.37  ? 671 LEU A CD1   1 
ATOM   3780  C  CD2   . LEU E 3 375 ? 137.498 -17.934 33.396  1.00 54.73  ? 671 LEU A CD2   1 
ATOM   3781  N  N     . MET E 3 376 ? 142.701 -17.750 33.598  1.00 55.62  ? 672 MET A N     1 
ATOM   3782  C  CA    . MET E 3 376 ? 143.673 -18.843 33.746  1.00 56.35  ? 672 MET A CA    1 
ATOM   3783  C  C     . MET E 3 376 ? 144.704 -18.557 34.839  1.00 56.81  ? 672 MET A C     1 
ATOM   3784  O  O     . MET E 3 376 ? 145.135 -19.466 35.551  1.00 56.57  ? 672 MET A O     1 
ATOM   3785  C  CB    . MET E 3 376 ? 144.395 -19.144 32.427  1.00 56.26  ? 672 MET A CB    1 
ATOM   3786  C  CG    . MET E 3 376 ? 143.597 -19.957 31.424  1.00 56.38  ? 672 MET A CG    1 
ATOM   3787  S  SD    . MET E 3 376 ? 144.624 -20.597 30.081  1.00 56.53  ? 672 MET A SD    1 
ATOM   3788  C  CE    . MET E 3 376 ? 145.107 -19.076 29.270  1.00 56.88  ? 672 MET A CE    1 
ATOM   3789  N  N     . GLU E 3 377 ? 145.093 -17.288 34.956  1.00 57.50  ? 673 GLU A N     1 
ATOM   3790  C  CA    . GLU E 3 377 ? 146.079 -16.866 35.943  1.00 58.27  ? 673 GLU A CA    1 
ATOM   3791  C  C     . GLU E 3 377 ? 145.541 -17.047 37.353  1.00 58.40  ? 673 GLU A C     1 
ATOM   3792  O  O     . GLU E 3 377 ? 146.191 -17.669 38.199  1.00 58.47  ? 673 GLU A O     1 
ATOM   3793  C  CB    . GLU E 3 377 ? 146.487 -15.403 35.724  1.00 58.46  ? 673 GLU A CB    1 
ATOM   3794  C  CG    . GLU E 3 377 ? 147.740 -14.998 36.498  1.00 59.61  ? 673 GLU A CG    1 
ATOM   3795  C  CD    . GLU E 3 377 ? 148.954 -15.846 36.121  1.00 61.53  ? 673 GLU A CD    1 
ATOM   3796  O  OE1   . GLU E 3 377 ? 149.257 -15.938 34.904  1.00 61.82  ? 673 GLU A OE1   1 
ATOM   3797  O  OE2   . GLU E 3 377 ? 149.603 -16.416 37.038  1.00 61.69  ? 673 GLU A OE2   1 
ATOM   3798  N  N     . ALA E 3 378 ? 144.350 -16.504 37.592  1.00 58.68  ? 674 ALA A N     1 
ATOM   3799  C  CA    . ALA E 3 378 ? 143.692 -16.593 38.895  1.00 58.86  ? 674 ALA A CA    1 
ATOM   3800  C  C     . ALA E 3 378 ? 143.676 -18.021 39.430  1.00 58.95  ? 674 ALA A C     1 
ATOM   3801  O  O     . ALA E 3 378 ? 143.901 -18.242 40.622  1.00 59.00  ? 674 ALA A O     1 
ATOM   3802  C  CB    . ALA E 3 378 ? 142.280 -16.034 38.817  1.00 58.79  ? 674 ALA A CB    1 
ATOM   3803  N  N     . PHE E 3 379 ? 143.426 -18.985 38.548  1.00 59.10  ? 675 PHE A N     1 
ATOM   3804  C  CA    . PHE E 3 379 ? 143.409 -20.389 38.949  1.00 59.42  ? 675 PHE A CA    1 
ATOM   3805  C  C     . PHE E 3 379 ? 144.802 -20.955 39.189  1.00 59.88  ? 675 PHE A C     1 
ATOM   3806  O  O     . PHE E 3 379 ? 144.971 -21.849 40.012  1.00 59.88  ? 675 PHE A O     1 
ATOM   3807  C  CB    . PHE E 3 379 ? 142.646 -21.260 37.943  1.00 59.11  ? 675 PHE A CB    1 
ATOM   3808  C  CG    . PHE E 3 379 ? 141.148 -21.171 38.071  1.00 58.76  ? 675 PHE A CG    1 
ATOM   3809  C  CD1   . PHE E 3 379 ? 140.369 -20.772 37.001  1.00 58.10  ? 675 PHE A CD1   1 
ATOM   3810  C  CD2   . PHE E 3 379 ? 140.520 -21.476 39.271  1.00 58.48  ? 675 PHE A CD2   1 
ATOM   3811  C  CE1   . PHE E 3 379 ? 138.994 -20.691 37.122  1.00 57.76  ? 675 PHE A CE1   1 
ATOM   3812  C  CE2   . PHE E 3 379 ? 139.148 -21.395 39.395  1.00 58.05  ? 675 PHE A CE2   1 
ATOM   3813  C  CZ    . PHE E 3 379 ? 138.386 -20.999 38.320  1.00 57.87  ? 675 PHE A CZ    1 
ATOM   3814  N  N     . ARG E 3 380 ? 145.794 -20.436 38.471  1.00 60.64  ? 676 ARG A N     1 
ATOM   3815  C  CA    . ARG E 3 380 ? 147.170 -20.911 38.617  1.00 61.36  ? 676 ARG A CA    1 
ATOM   3816  C  C     . ARG E 3 380 ? 147.796 -20.513 39.943  1.00 61.92  ? 676 ARG A C     1 
ATOM   3817  O  O     . ARG E 3 380 ? 148.647 -21.221 40.465  1.00 61.93  ? 676 ARG A O     1 
ATOM   3818  C  CB    . ARG E 3 380 ? 148.038 -20.471 37.437  1.00 61.29  ? 676 ARG A CB    1 
ATOM   3819  C  CG    . ARG E 3 380 ? 148.044 -21.481 36.312  1.00 61.34  ? 676 ARG A CG    1 
ATOM   3820  C  CD    . ARG E 3 380 ? 148.282 -20.836 34.964  1.00 61.48  ? 676 ARG A CD    1 
ATOM   3821  N  NE    . ARG E 3 380 ? 148.382 -21.849 33.919  1.00 61.39  ? 676 ARG A NE    1 
ATOM   3822  C  CZ    . ARG E 3 380 ? 148.189 -21.621 32.625  1.00 60.97  ? 676 ARG A CZ    1 
ATOM   3823  N  NH1   . ARG E 3 380 ? 147.857 -20.413 32.198  1.00 60.86  ? 676 ARG A NH1   1 
ATOM   3824  N  NH2   . ARG E 3 380 ? 148.305 -22.615 31.758  1.00 60.95  ? 676 ARG A NH2   1 
ATOM   3825  N  N     . ARG E 3 381 ? 147.367 -19.382 40.488  1.00 62.87  ? 677 ARG A N     1 
ATOM   3826  C  CA    . ARG E 3 381 ? 147.839 -18.953 41.797  1.00 63.85  ? 677 ARG A CA    1 
ATOM   3827  C  C     . ARG E 3 381 ? 147.003 -19.611 42.889  1.00 64.62  ? 677 ARG A C     1 
ATOM   3828  O  O     . ARG E 3 381 ? 147.422 -19.691 44.041  1.00 64.74  ? 677 ARG A O     1 
ATOM   3829  C  CB    . ARG E 3 381 ? 147.763 -17.440 41.920  1.00 63.76  ? 677 ARG A CB    1 
ATOM   3830  C  CG    . ARG E 3 381 ? 148.548 -16.706 40.865  1.00 63.85  ? 677 ARG A CG    1 
ATOM   3831  C  CD    . ARG E 3 381 ? 148.409 -15.214 41.046  1.00 63.67  ? 677 ARG A CD    1 
ATOM   3832  N  NE    . ARG E 3 381 ? 149.166 -14.491 40.033  1.00 63.68  ? 677 ARG A NE    1 
ATOM   3833  C  CZ    . ARG E 3 381 ? 149.320 -13.173 40.018  1.00 63.38  ? 677 ARG A CZ    1 
ATOM   3834  N  NH1   . ARG E 3 381 ? 148.768 -12.431 40.968  1.00 62.97  ? 677 ARG A NH1   1 
ATOM   3835  N  NH2   . ARG E 3 381 ? 150.028 -12.600 39.054  1.00 63.58  ? 677 ARG A NH2   1 
ATOM   3836  N  N     . ASP E 3 382 ? 145.817 -20.076 42.505  1.00 65.67  ? 678 ASP A N     1 
ATOM   3837  C  CA    . ASP E 3 382 ? 144.895 -20.778 43.394  1.00 66.54  ? 678 ASP A CA    1 
ATOM   3838  C  C     . ASP E 3 382 ? 143.973 -19.812 44.153  1.00 67.20  ? 678 ASP A C     1 
ATOM   3839  O  O     . ASP E 3 382 ? 143.667 -20.022 45.327  1.00 67.26  ? 678 ASP A O     1 
ATOM   3840  C  CB    . ASP E 3 382 ? 145.655 -21.717 44.348  1.00 66.49  ? 678 ASP A CB    1 
ATOM   3841  C  CG    . ASP E 3 382 ? 144.839 -22.935 44.753  1.00 66.59  ? 678 ASP A CG    1 
ATOM   3842  O  OD1   . ASP E 3 382 ? 143.619 -22.960 44.495  1.00 66.57  ? 678 ASP A OD1   1 
ATOM   3843  O  OD2   . ASP E 3 382 ? 145.426 -23.879 45.324  1.00 66.75  ? 678 ASP A OD2   1 
ATOM   3844  N  N     . LEU E 3 383 ? 143.538 -18.752 43.474  1.00 68.03  ? 679 LEU A N     1 
ATOM   3845  C  CA    . LEU E 3 383 ? 142.549 -17.832 44.033  1.00 68.89  ? 679 LEU A CA    1 
ATOM   3846  C  C     . LEU E 3 383 ? 141.196 -18.517 44.037  1.00 69.61  ? 679 LEU A C     1 
ATOM   3847  O  O     . LEU E 3 383 ? 140.936 -19.389 43.210  1.00 69.70  ? 679 LEU A O     1 
ATOM   3848  C  CB    . LEU E 3 383 ? 142.428 -16.574 43.183  1.00 68.76  ? 679 LEU A CB    1 
ATOM   3849  C  CG    . LEU E 3 383 ? 143.452 -15.454 43.313  1.00 69.08  ? 679 LEU A CG    1 
ATOM   3850  C  CD1   . LEU E 3 383 ? 144.846 -15.934 42.962  1.00 69.11  ? 679 LEU A CD1   1 
ATOM   3851  C  CD2   . LEU E 3 383 ? 143.041 -14.292 42.422  1.00 68.85  ? 679 LEU A CD2   1 
ATOM   3852  N  N     . ASP E 3 384 ? 140.326 -18.133 44.959  1.00 70.52  ? 680 ASP A N     1 
ATOM   3853  C  CA    . ASP E 3 384 ? 138.980 -18.686 44.946  1.00 71.43  ? 680 ASP A CA    1 
ATOM   3854  C  C     . ASP E 3 384 ? 138.059 -17.637 44.336  1.00 71.94  ? 680 ASP A C     1 
ATOM   3855  O  O     . ASP E 3 384 ? 137.799 -16.601 44.944  1.00 71.93  ? 680 ASP A O     1 
ATOM   3856  C  CB    . ASP E 3 384 ? 138.534 -19.119 46.349  1.00 71.43  ? 680 ASP A CB    1 
ATOM   3857  C  CG    . ASP E 3 384 ? 137.277 -19.988 46.328  1.00 71.64  ? 680 ASP A CG    1 
ATOM   3858  O  OD1   . ASP E 3 384 ? 136.203 -19.484 45.939  1.00 71.58  ? 680 ASP A OD1   1 
ATOM   3859  O  OD2   . ASP E 3 384 ? 137.360 -21.175 46.724  1.00 71.77  ? 680 ASP A OD2   1 
ATOM   3860  N  N     . ILE E 3 385 ? 137.596 -17.913 43.118  1.00 72.70  ? 681 ILE A N     1 
ATOM   3861  C  CA    . ILE E 3 385 ? 136.746 -16.992 42.363  1.00 73.49  ? 681 ILE A CA    1 
ATOM   3862  C  C     . ILE E 3 385 ? 135.368 -16.773 42.998  1.00 74.24  ? 681 ILE A C     1 
ATOM   3863  O  O     . ILE E 3 385 ? 134.862 -15.649 43.001  1.00 74.24  ? 681 ILE A O     1 
ATOM   3864  C  CB    . ILE E 3 385 ? 136.622 -17.424 40.885  1.00 73.39  ? 681 ILE A CB    1 
ATOM   3865  C  CG1   . ILE E 3 385 ? 138.004 -17.463 40.235  1.00 73.24  ? 681 ILE A CG1   1 
ATOM   3866  C  CG2   . ILE E 3 385 ? 135.724 -16.470 40.109  1.00 73.57  ? 681 ILE A CG2   1 
ATOM   3867  C  CD1   . ILE E 3 385 ? 138.756 -16.147 40.313  1.00 72.97  ? 681 ILE A CD1   1 
ATOM   3868  N  N     . HIS E 3 386 ? 134.768 -17.840 43.531  1.00 75.23  ? 682 HIS A N     1 
ATOM   3869  C  CA    . HIS E 3 386 ? 133.509 -17.721 44.267  1.00 76.14  ? 682 HIS A CA    1 
ATOM   3870  C  C     . HIS E 3 386 ? 133.729 -16.813 45.470  1.00 77.11  ? 682 HIS A C     1 
ATOM   3871  O  O     . HIS E 3 386 ? 132.875 -15.991 45.800  1.00 77.33  ? 682 HIS A O     1 
ATOM   3872  C  CB    . HIS E 3 386 ? 133.007 -19.076 44.772  1.00 75.95  ? 682 HIS A CB    1 
ATOM   3873  C  CG    . HIS E 3 386 ? 132.637 -20.039 43.690  1.00 75.49  ? 682 HIS A CG    1 
ATOM   3874  N  ND1   . HIS E 3 386 ? 131.991 -19.653 42.536  1.00 74.99  ? 682 HIS A ND1   1 
ATOM   3875  C  CD2   . HIS E 3 386 ? 132.771 -21.384 43.616  1.00 74.96  ? 682 HIS A CD2   1 
ATOM   3876  C  CE1   . HIS E 3 386 ? 131.775 -20.716 41.781  1.00 74.79  ? 682 HIS A CE1   1 
ATOM   3877  N  NE2   . HIS E 3 386 ? 132.235 -21.779 42.415  1.00 74.64  ? 682 HIS A NE2   1 
ATOM   3878  N  N     . THR E 3 387 ? 134.877 -16.985 46.128  1.00 78.22  ? 683 THR A N     1 
ATOM   3879  C  CA    . THR E 3 387 ? 135.273 -16.155 47.265  1.00 79.16  ? 683 THR A CA    1 
ATOM   3880  C  C     . THR E 3 387 ? 135.757 -14.784 46.778  1.00 79.86  ? 683 THR A C     1 
ATOM   3881  O  O     . THR E 3 387 ? 135.698 -13.805 47.519  1.00 80.17  ? 683 THR A O     1 
ATOM   3882  C  CB    . THR E 3 387 ? 136.349 -16.857 48.125  1.00 79.11  ? 683 THR A CB    1 
ATOM   3883  O  OG1   . THR E 3 387 ? 135.810 -18.076 48.650  1.00 78.98  ? 683 THR A OG1   1 
ATOM   3884  C  CG2   . THR E 3 387 ? 136.803 -15.975 49.286  1.00 79.36  ? 683 THR A CG2   1 
ATOM   3885  N  N     . LYS E 3 388 ? 136.223 -14.718 45.532  1.00 80.64  ? 684 LYS A N     1 
ATOM   3886  C  CA    . LYS E 3 388 ? 136.602 -13.447 44.915  1.00 81.48  ? 684 LYS A CA    1 
ATOM   3887  C  C     . LYS E 3 388 ? 135.331 -12.690 44.494  1.00 82.22  ? 684 LYS A C     1 
ATOM   3888  O  O     . LYS E 3 388 ? 135.356 -11.466 44.342  1.00 82.47  ? 684 LYS A O     1 
ATOM   3889  C  CB    . LYS E 3 388 ? 137.566 -13.671 43.733  1.00 81.45  ? 684 LYS A CB    1 
ATOM   3890  C  CG    . LYS E 3 388 ? 137.896 -12.437 42.882  1.00 81.29  ? 684 LYS A CG    1 
ATOM   3891  C  CD    . LYS E 3 388 ? 138.503 -11.309 43.703  1.00 80.96  ? 684 LYS A CD    1 
ATOM   3892  C  CE    . LYS E 3 388 ? 138.526 -10.011 42.913  1.00 80.95  ? 684 LYS A CE    1 
ATOM   3893  N  NZ    . LYS E 3 388 ? 138.985 -8.855  43.744  1.00 80.77  ? 684 LYS A NZ    1 
ATOM   3894  N  N     . THR E 3 389 ? 134.222 -13.416 44.328  1.00 83.01  ? 685 THR A N     1 
ATOM   3895  C  CA    . THR E 3 389 ? 132.915 -12.805 44.004  1.00 83.80  ? 685 THR A CA    1 
ATOM   3896  C  C     . THR E 3 389 ? 132.057 -12.592 45.267  1.00 84.31  ? 685 THR A C     1 
ATOM   3897  O  O     . THR E 3 389 ? 131.195 -11.710 45.303  1.00 84.33  ? 685 THR A O     1 
ATOM   3898  C  CB    . THR E 3 389 ? 132.114 -13.645 42.965  1.00 83.81  ? 685 THR A CB    1 
ATOM   3899  O  OG1   . THR E 3 389 ? 132.963 -13.988 41.864  1.00 84.04  ? 685 THR A OG1   1 
ATOM   3900  C  CG2   . THR E 3 389 ? 130.891 -12.877 42.443  1.00 83.44  ? 685 THR A CG2   1 
ATOM   3901  N  N     . ALA E 3 390 ? 132.300 -13.407 46.293  1.00 84.93  ? 686 ALA A N     1 
ATOM   3902  C  CA    . ALA E 3 390 ? 131.592 -13.294 47.561  1.00 85.63  ? 686 ALA A CA    1 
ATOM   3903  C  C     . ALA E 3 390 ? 131.794 -11.897 48.126  1.00 86.22  ? 686 ALA A C     1 
ATOM   3904  O  O     . ALA E 3 390 ? 130.837 -11.214 48.486  1.00 86.29  ? 686 ALA A O     1 
ATOM   3905  C  CB    . ALA E 3 390 ? 132.092 -14.340 48.538  1.00 85.57  ? 686 ALA A CB    1 
ATOM   3906  N  N     . MET E 3 391 ? 133.055 -11.483 48.180  1.00 86.95  ? 687 MET A N     1 
ATOM   3907  C  CA    . MET E 3 391 ? 133.434 -10.156 48.653  1.00 87.78  ? 687 MET A CA    1 
ATOM   3908  C  C     . MET E 3 391 ? 132.787 -9.067  47.794  1.00 87.96  ? 687 MET A C     1 
ATOM   3909  O  O     . MET E 3 391 ? 132.099 -8.175  48.303  1.00 88.06  ? 687 MET A O     1 
ATOM   3910  C  CB    . MET E 3 391 ? 134.962 -10.014 48.606  1.00 87.70  ? 687 MET A CB    1 
ATOM   3911  C  CG    . MET E 3 391 ? 135.716 -11.033 49.463  1.00 88.18  ? 687 MET A CG    1 
ATOM   3912  S  SD    . MET E 3 391 ? 137.495 -11.144 49.134  1.00 88.65  ? 687 MET A SD    1 
ATOM   3913  C  CE    . MET E 3 391 ? 138.030 -9.448  49.419  1.00 88.96  ? 687 MET A CE    1 
ATOM   3914  N  N     . ASP E 3 392 ? 133.001 -9.187  46.484  1.00 88.26  ? 688 ASP A N     1 
ATOM   3915  C  CA    . ASP E 3 392 ? 132.565 -8.224  45.467  1.00 88.39  ? 688 ASP A CA    1 
ATOM   3916  C  C     . ASP E 3 392 ? 131.066 -7.881  45.527  1.00 88.45  ? 688 ASP A C     1 
ATOM   3917  O  O     . ASP E 3 392 ? 130.655 -6.789  45.114  1.00 88.30  ? 688 ASP A O     1 
ATOM   3918  C  CB    . ASP E 3 392 ? 132.941 -8.774  44.083  1.00 88.43  ? 688 ASP A CB    1 
ATOM   3919  C  CG    . ASP E 3 392 ? 133.444 -7.702  43.134  1.00 88.54  ? 688 ASP A CG    1 
ATOM   3920  O  OD1   . ASP E 3 392 ? 134.406 -7.993  42.387  1.00 88.41  ? 688 ASP A OD1   1 
ATOM   3921  O  OD2   . ASP E 3 392 ? 132.892 -6.578  43.137  1.00 88.71  ? 688 ASP A OD2   1 
ATOM   3922  N  N     . ILE E 3 393 ? 130.262 -8.815  46.039  1.00 88.59  ? 689 ILE A N     1 
ATOM   3923  C  CA    . ILE E 3 393 ? 128.816 -8.612  46.176  1.00 88.79  ? 689 ILE A CA    1 
ATOM   3924  C  C     . ILE E 3 393 ? 128.444 -8.278  47.623  1.00 88.94  ? 689 ILE A C     1 
ATOM   3925  O  O     . ILE E 3 393 ? 127.691 -7.336  47.881  1.00 88.95  ? 689 ILE A O     1 
ATOM   3926  C  CB    . ILE E 3 393 ? 127.990 -9.861  45.724  1.00 88.80  ? 689 ILE A CB    1 
ATOM   3927  C  CG1   . ILE E 3 393 ? 128.438 -10.366 44.350  1.00 88.67  ? 689 ILE A CG1   1 
ATOM   3928  C  CG2   . ILE E 3 393 ? 126.492 -9.546  45.716  1.00 88.53  ? 689 ILE A CG2   1 
ATOM   3929  C  CD1   . ILE E 3 393 ? 127.856 -11.708 43.993  1.00 88.59  ? 689 ILE A CD1   1 
ATOM   3930  N  N     . PHE E 3 394 ? 128.984 -9.049  48.563  1.00 89.05  ? 690 PHE A N     1 
ATOM   3931  C  CA    . PHE E 3 394 ? 128.643 -8.881  49.971  1.00 89.21  ? 690 PHE A CA    1 
ATOM   3932  C  C     . PHE E 3 394 ? 129.504 -7.863  50.700  1.00 89.33  ? 690 PHE A C     1 
ATOM   3933  O  O     . PHE E 3 394 ? 129.539 -7.850  51.931  1.00 89.50  ? 690 PHE A O     1 
ATOM   3934  C  CB    . PHE E 3 394 ? 128.669 -10.226 50.697  1.00 89.19  ? 690 PHE A CB    1 
ATOM   3935  C  CG    . PHE E 3 394 ? 127.702 -11.221 50.138  1.00 89.33  ? 690 PHE A CG    1 
ATOM   3936  C  CD1   . PHE E 3 394 ? 126.355 -11.143 50.451  1.00 89.30  ? 690 PHE A CD1   1 
ATOM   3937  C  CD2   . PHE E 3 394 ? 128.137 -12.231 49.288  1.00 89.47  ? 690 PHE A CD2   1 
ATOM   3938  C  CE1   . PHE E 3 394 ? 125.458 -12.058 49.931  1.00 89.57  ? 690 PHE A CE1   1 
ATOM   3939  C  CE2   . PHE E 3 394 ? 127.250 -13.150 48.761  1.00 89.31  ? 690 PHE A CE2   1 
ATOM   3940  C  CZ    . PHE E 3 394 ? 125.907 -13.066 49.084  1.00 89.56  ? 690 PHE A CZ    1 
ATOM   3941  N  N     . GLN E 3 395 ? 130.190 -7.012  49.935  1.00 89.40  ? 691 GLN A N     1 
ATOM   3942  C  CA    . GLN E 3 395 ? 131.006 -5.914  50.471  1.00 89.31  ? 691 GLN A CA    1 
ATOM   3943  C  C     . GLN E 3 395 ? 132.058 -6.382  51.474  1.00 89.31  ? 691 GLN A C     1 
ATOM   3944  O  O     . GLN E 3 395 ? 132.859 -5.587  51.961  1.00 89.26  ? 691 GLN A O     1 
ATOM   3945  C  CB    . GLN E 3 395 ? 130.113 -4.848  51.131  1.00 89.29  ? 691 GLN A CB    1 
ATOM   3946  C  CG    . GLN E 3 395 ? 128.902 -4.389  50.309  1.00 89.13  ? 691 GLN A CG    1 
ATOM   3947  C  CD    . GLN E 3 395 ? 129.253 -3.435  49.176  1.00 88.94  ? 691 GLN A CD    1 
ATOM   3948  O  OE1   . GLN E 3 395 ? 130.391 -3.385  48.706  1.00 88.65  ? 691 GLN A OE1   1 
ATOM   3949  N  NE2   . GLN E 3 395 ? 128.262 -2.672  48.728  1.00 88.70  ? 691 GLN A NE2   1 
ATOM   3950  N  N     . VAL E 3 396 ? 132.051 -7.677  51.773  1.00 89.37  ? 692 VAL A N     1 
ATOM   3951  C  CA    . VAL E 3 396 ? 132.933 -8.245  52.783  1.00 89.47  ? 692 VAL A CA    1 
ATOM   3952  C  C     . VAL E 3 396 ? 134.377 -8.432  52.313  1.00 89.67  ? 692 VAL A C     1 
ATOM   3953  O  O     . VAL E 3 396 ? 134.745 -8.040  51.201  1.00 89.54  ? 692 VAL A O     1 
ATOM   3954  C  CB    . VAL E 3 396 ? 132.375 -9.592  53.335  1.00 89.43  ? 692 VAL A CB    1 
ATOM   3955  C  CG1   . VAL E 3 396 ? 131.189 -9.349  54.254  1.00 89.27  ? 692 VAL A CG1   1 
ATOM   3956  C  CG2   . VAL E 3 396 ? 132.001 -10.540 52.201  1.00 89.35  ? 692 VAL A CG2   1 
ATOM   3957  N  N     . SER E 3 397 ? 135.193 -9.004  53.196  1.00 89.97  ? 693 SER A N     1 
ATOM   3958  C  CA    . SER E 3 397 ? 136.580 -9.341  52.898  1.00 90.16  ? 693 SER A CA    1 
ATOM   3959  C  C     . SER E 3 397 ? 136.712 -10.864 52.916  1.00 90.33  ? 693 SER A C     1 
ATOM   3960  O  O     . SER E 3 397 ? 135.760 -11.567 53.255  1.00 90.37  ? 693 SER A O     1 
ATOM   3961  C  CB    . SER E 3 397 ? 137.531 -8.703  53.918  1.00 90.10  ? 693 SER A CB    1 
ATOM   3962  O  OG    . SER E 3 397 ? 137.306 -9.213  55.221  1.00 89.71  ? 693 SER A OG    1 
ATOM   3963  N  N     . GLU E 3 398 ? 137.886 -11.370 52.549  1.00 90.48  ? 694 GLU A N     1 
ATOM   3964  C  CA    . GLU E 3 398 ? 138.134 -12.807 52.516  1.00 90.61  ? 694 GLU A CA    1 
ATOM   3965  C  C     . GLU E 3 398 ? 138.013 -13.437 53.903  1.00 90.57  ? 694 GLU A C     1 
ATOM   3966  O  O     . GLU E 3 398 ? 137.533 -14.561 54.044  1.00 90.51  ? 694 GLU A O     1 
ATOM   3967  C  CB    . GLU E 3 398 ? 139.533 -13.081 51.966  1.00 90.68  ? 694 GLU A CB    1 
ATOM   3968  C  CG    . GLU E 3 398 ? 139.898 -14.553 51.928  1.00 91.17  ? 694 GLU A CG    1 
ATOM   3969  C  CD    . GLU E 3 398 ? 141.377 -14.792 52.145  1.00 91.87  ? 694 GLU A CD    1 
ATOM   3970  O  OE1   . GLU E 3 398 ? 142.134 -13.806 52.294  1.00 92.15  ? 694 GLU A OE1   1 
ATOM   3971  O  OE2   . GLU E 3 398 ? 141.781 -15.974 52.181  1.00 92.04  ? 694 GLU A OE2   1 
ATOM   3972  N  N     . ASP E 3 399 ? 138.440 -12.687 54.915  1.00 90.64  ? 695 ASP A N     1 
ATOM   3973  C  CA    . ASP E 3 399 ? 138.501 -13.145 56.310  1.00 90.67  ? 695 ASP A CA    1 
ATOM   3974  C  C     . ASP E 3 399 ? 137.175 -13.641 56.906  1.00 90.53  ? 695 ASP A C     1 
ATOM   3975  O  O     . ASP E 3 399 ? 137.173 -14.523 57.767  1.00 90.59  ? 695 ASP A O     1 
ATOM   3976  C  CB    . ASP E 3 399 ? 139.104 -12.041 57.186  1.00 90.77  ? 695 ASP A CB    1 
ATOM   3977  C  CG    . ASP E 3 399 ? 140.380 -11.453 56.589  1.00 91.08  ? 695 ASP A CG    1 
ATOM   3978  O  OD1   . ASP E 3 399 ? 141.112 -12.186 55.888  1.00 91.33  ? 695 ASP A OD1   1 
ATOM   3979  O  OD2   . ASP E 3 399 ? 140.651 -10.257 56.819  1.00 91.32  ? 695 ASP A OD2   1 
ATOM   3980  N  N     . GLU E 3 400 ? 136.056 -13.074 56.461  1.00 90.31  ? 696 GLU A N     1 
ATOM   3981  C  CA    . GLU E 3 400 ? 134.743 -13.530 56.918  1.00 90.07  ? 696 GLU A CA    1 
ATOM   3982  C  C     . GLU E 3 400 ? 133.744 -13.715 55.769  1.00 89.87  ? 696 GLU A C     1 
ATOM   3983  O  O     . GLU E 3 400 ? 133.036 -12.784 55.377  1.00 89.89  ? 696 GLU A O     1 
ATOM   3984  C  CB    . GLU E 3 400 ? 134.175 -12.621 58.022  1.00 90.16  ? 696 GLU A CB    1 
ATOM   3985  C  CG    . GLU E 3 400 ? 134.808 -12.841 59.407  1.00 90.22  ? 696 GLU A CG    1 
ATOM   3986  C  CD    . GLU E 3 400 ? 134.078 -12.118 60.536  1.00 89.99  ? 696 GLU A CD    1 
ATOM   3987  O  OE1   . GLU E 3 400 ? 134.391 -12.393 61.714  1.00 89.49  ? 696 GLU A OE1   1 
ATOM   3988  O  OE2   . GLU E 3 400 ? 133.193 -11.283 60.251  1.00 89.84  ? 696 GLU A OE2   1 
ATOM   3989  N  N     . VAL E 3 401 ? 133.722 -14.929 55.224  1.00 89.54  ? 697 VAL A N     1 
ATOM   3990  C  CA    . VAL E 3 401 ? 132.788 -15.321 54.173  1.00 89.22  ? 697 VAL A CA    1 
ATOM   3991  C  C     . VAL E 3 401 ? 132.224 -16.685 54.565  1.00 89.05  ? 697 VAL A C     1 
ATOM   3992  O  O     . VAL E 3 401 ? 132.877 -17.710 54.357  1.00 89.06  ? 697 VAL A O     1 
ATOM   3993  C  CB    . VAL E 3 401 ? 133.478 -15.429 52.781  1.00 89.21  ? 697 VAL A CB    1 
ATOM   3994  C  CG1   . VAL E 3 401 ? 132.526 -16.020 51.745  1.00 89.24  ? 697 VAL A CG1   1 
ATOM   3995  C  CG2   . VAL E 3 401 ? 133.984 -14.077 52.314  1.00 89.03  ? 697 VAL A CG2   1 
ATOM   3996  N  N     . THR E 3 402 ? 131.028 -16.695 55.156  1.00 88.78  ? 698 THR A N     1 
ATOM   3997  C  CA    . THR E 3 402 ? 130.395 -17.945 55.601  1.00 88.44  ? 698 THR A CA    1 
ATOM   3998  C  C     . THR E 3 402 ? 130.003 -18.827 54.413  1.00 88.06  ? 698 THR A C     1 
ATOM   3999  O  O     . THR E 3 402 ? 129.678 -18.309 53.341  1.00 87.95  ? 698 THR A O     1 
ATOM   4000  C  CB    . THR E 3 402 ? 129.153 -17.686 56.491  1.00 88.53  ? 698 THR A CB    1 
ATOM   4001  O  OG1   . THR E 3 402 ? 128.237 -16.826 55.801  1.00 88.66  ? 698 THR A OG1   1 
ATOM   4002  C  CG2   . THR E 3 402 ? 129.560 -17.053 57.820  1.00 88.45  ? 698 THR A CG2   1 
ATOM   4003  N  N     . PRO E 3 403 ? 130.041 -20.163 54.598  1.00 87.70  ? 699 PRO A N     1 
ATOM   4004  C  CA    . PRO E 3 403 ? 129.713 -21.095 53.515  1.00 87.41  ? 699 PRO A CA    1 
ATOM   4005  C  C     . PRO E 3 403 ? 128.389 -20.755 52.826  1.00 87.09  ? 699 PRO A C     1 
ATOM   4006  O  O     . PRO E 3 403 ? 128.234 -20.990 51.624  1.00 86.98  ? 699 PRO A O     1 
ATOM   4007  C  CB    . PRO E 3 403 ? 129.621 -22.446 54.232  1.00 87.42  ? 699 PRO A CB    1 
ATOM   4008  C  CG    . PRO E 3 403 ? 130.521 -22.303 55.408  1.00 87.53  ? 699 PRO A CG    1 
ATOM   4009  C  CD    . PRO E 3 403 ? 130.399 -20.870 55.844  1.00 87.64  ? 699 PRO A CD    1 
ATOM   4010  N  N     . ASN E 3 404 ? 127.455 -20.195 53.592  1.00 86.72  ? 700 ASN A N     1 
ATOM   4011  C  CA    . ASN E 3 404 ? 126.155 -19.784 53.071  1.00 86.36  ? 700 ASN A CA    1 
ATOM   4012  C  C     . ASN E 3 404 ? 126.272 -18.760 51.938  1.00 86.00  ? 700 ASN A C     1 
ATOM   4013  O  O     . ASN E 3 404 ? 125.604 -18.879 50.908  1.00 85.98  ? 700 ASN A O     1 
ATOM   4014  C  CB    . ASN E 3 404 ? 125.284 -19.225 54.208  1.00 86.45  ? 700 ASN A CB    1 
ATOM   4015  C  CG    . ASN E 3 404 ? 123.969 -18.625 53.710  1.00 86.50  ? 700 ASN A CG    1 
ATOM   4016  O  OD1   . ASN E 3 404 ? 123.588 -17.520 54.106  1.00 86.56  ? 700 ASN A OD1   1 
ATOM   4017  N  ND2   . ASN E 3 404 ? 123.278 -19.348 52.833  1.00 86.28  ? 700 ASN A ND2   1 
ATOM   4018  N  N     . MET E 3 405 ? 127.136 -17.766 52.126  1.00 85.44  ? 701 MET A N     1 
ATOM   4019  C  CA    . MET E 3 405 ? 127.278 -16.687 51.150  1.00 84.99  ? 701 MET A CA    1 
ATOM   4020  C  C     . MET E 3 405 ? 128.395 -16.903 50.105  1.00 84.16  ? 701 MET A C     1 
ATOM   4021  O  O     . MET E 3 405 ? 128.707 -16.001 49.320  1.00 84.19  ? 701 MET A O     1 
ATOM   4022  C  CB    . MET E 3 405 ? 127.339 -15.330 51.868  1.00 84.97  ? 701 MET A CB    1 
ATOM   4023  C  CG    . MET E 3 405 ? 126.017 -15.036 52.603  1.00 85.42  ? 701 MET A CG    1 
ATOM   4024  S  SD    . MET E 3 405 ? 125.982 -13.671 53.792  1.00 85.98  ? 701 MET A SD    1 
ATOM   4025  C  CE    . MET E 3 405 ? 124.322 -13.828 54.469  1.00 85.30  ? 701 MET A CE    1 
ATOM   4026  N  N     . ARG E 3 406 ? 128.975 -18.105 50.093  1.00 83.05  ? 702 ARG A N     1 
ATOM   4027  C  CA    . ARG E 3 406 ? 129.906 -18.507 49.039  1.00 81.93  ? 702 ARG A CA    1 
ATOM   4028  C  C     . ARG E 3 406 ? 129.078 -19.269 48.002  1.00 81.40  ? 702 ARG A C     1 
ATOM   4029  O  O     . ARG E 3 406 ? 129.537 -19.557 46.895  1.00 81.26  ? 702 ARG A O     1 
ATOM   4030  C  CB    . ARG E 3 406 ? 131.023 -19.401 49.586  1.00 81.85  ? 702 ARG A CB    1 
ATOM   4031  C  CG    . ARG E 3 406 ? 132.086 -19.778 48.551  1.00 80.99  ? 702 ARG A CG    1 
ATOM   4032  C  CD    . ARG E 3 406 ? 132.879 -21.012 48.971  1.00 80.11  ? 702 ARG A CD    1 
ATOM   4033  N  NE    . ARG E 3 406 ? 133.798 -21.470 47.928  1.00 78.99  ? 702 ARG A NE    1 
ATOM   4034  C  CZ    . ARG E 3 406 ? 133.490 -22.360 46.988  1.00 78.41  ? 702 ARG A CZ    1 
ATOM   4035  N  NH1   . ARG E 3 406 ? 132.281 -22.898 46.947  1.00 78.07  ? 702 ARG A NH1   1 
ATOM   4036  N  NH2   . ARG E 3 406 ? 134.393 -22.711 46.083  1.00 78.00  ? 702 ARG A NH2   1 
ATOM   4037  N  N     . ARG E 3 407 ? 127.844 -19.584 48.385  1.00 80.60  ? 703 ARG A N     1 
ATOM   4038  C  CA    . ARG E 3 407 ? 126.893 -20.269 47.521  1.00 79.78  ? 703 ARG A CA    1 
ATOM   4039  C  C     . ARG E 3 407 ? 126.043 -19.257 46.764  1.00 78.96  ? 703 ARG A C     1 
ATOM   4040  O  O     . ARG E 3 407 ? 125.572 -19.530 45.659  1.00 78.87  ? 703 ARG A O     1 
ATOM   4041  C  CB    . ARG E 3 407 ? 126.000 -21.187 48.356  1.00 80.01  ? 703 ARG A CB    1 
ATOM   4042  C  CG    . ARG E 3 407 ? 124.853 -21.840 47.599  1.00 80.52  ? 703 ARG A CG    1 
ATOM   4043  C  CD    . ARG E 3 407 ? 124.103 -22.816 48.482  1.00 81.29  ? 703 ARG A CD    1 
ATOM   4044  N  NE    . ARG E 3 407 ? 124.854 -24.052 48.706  1.00 82.12  ? 703 ARG A NE    1 
ATOM   4045  C  CZ    . ARG E 3 407 ? 125.614 -24.303 49.771  1.00 82.33  ? 703 ARG A CZ    1 
ATOM   4046  N  NH1   . ARG E 3 407 ? 125.741 -23.399 50.738  1.00 82.21  ? 703 ARG A NH1   1 
ATOM   4047  N  NH2   . ARG E 3 407 ? 126.249 -25.466 49.872  1.00 81.99  ? 703 ARG A NH2   1 
ATOM   4048  N  N     . GLN E 3 408 ? 125.851 -18.085 47.364  1.00 77.95  ? 704 GLN A N     1 
ATOM   4049  C  CA    . GLN E 3 408 ? 125.064 -17.025 46.738  1.00 76.98  ? 704 GLN A CA    1 
ATOM   4050  C  C     . GLN E 3 408 ? 125.893 -16.192 45.750  1.00 76.09  ? 704 GLN A C     1 
ATOM   4051  O  O     . GLN E 3 408 ? 125.340 -15.558 44.853  1.00 76.06  ? 704 GLN A O     1 
ATOM   4052  C  CB    . GLN E 3 408 ? 124.393 -16.150 47.798  1.00 76.94  ? 704 GLN A CB    1 
ATOM   4053  C  CG    . GLN E 3 408 ? 123.521 -16.942 48.767  1.00 77.06  ? 704 GLN A CG    1 
ATOM   4054  C  CD    . GLN E 3 408 ? 122.880 -16.072 49.837  1.00 77.34  ? 704 GLN A CD    1 
ATOM   4055  O  OE1   . GLN E 3 408 ? 122.518 -14.920 49.584  1.00 77.86  ? 704 GLN A OE1   1 
ATOM   4056  N  NE2   . GLN E 3 408 ? 122.729 -16.624 51.039  1.00 77.29  ? 704 GLN A NE2   1 
ATOM   4057  N  N     . ALA E 3 409 ? 127.215 -16.200 45.914  1.00 74.97  ? 705 ALA A N     1 
ATOM   4058  C  CA    . ALA E 3 409 ? 128.115 -15.525 44.976  1.00 73.81  ? 705 ALA A CA    1 
ATOM   4059  C  C     . ALA E 3 409 ? 128.618 -16.516 43.919  1.00 72.94  ? 705 ALA A C     1 
ATOM   4060  O  O     . ALA E 3 409 ? 129.136 -16.117 42.868  1.00 72.60  ? 705 ALA A O     1 
ATOM   4061  C  CB    . ALA E 3 409 ? 129.265 -14.891 45.711  1.00 73.93  ? 705 ALA A CB    1 
ATOM   4062  N  N     . LYS E 3 410 ? 128.454 -17.805 44.229  1.00 71.86  ? 706 LYS A N     1 
ATOM   4063  C  CA    . LYS E 3 410 ? 128.737 -18.928 43.324  1.00 70.87  ? 706 LYS A CA    1 
ATOM   4064  C  C     . LYS E 3 410 ? 127.762 -18.924 42.131  1.00 70.06  ? 706 LYS A C     1 
ATOM   4065  O  O     . LYS E 3 410 ? 128.155 -19.157 40.976  1.00 69.81  ? 706 LYS A O     1 
ATOM   4066  C  CB    . LYS E 3 410 ? 128.592 -20.254 44.092  1.00 70.88  ? 706 LYS A CB    1 
ATOM   4067  C  CG    . LYS E 3 410 ? 128.834 -21.527 43.267  1.00 71.10  ? 706 LYS A CG    1 
ATOM   4068  C  CD    . LYS E 3 410 ? 128.066 -22.745 43.808  1.00 71.02  ? 706 LYS A CD    1 
ATOM   4069  C  CE    . LYS E 3 410 ? 128.437 -23.101 45.246  1.00 71.55  ? 706 LYS A CE    1 
ATOM   4070  N  NZ    . LYS E 3 410 ? 129.843 -23.567 45.377  1.00 71.66  ? 706 LYS A NZ    1 
ATOM   4071  N  N     . ALA E 3 411 ? 126.488 -18.659 42.435  1.00 68.88  ? 707 ALA A N     1 
ATOM   4072  C  CA    . ALA E 3 411 ? 125.419 -18.589 41.441  1.00 67.50  ? 707 ALA A CA    1 
ATOM   4073  C  C     . ALA E 3 411 ? 125.469 -17.297 40.602  1.00 66.61  ? 707 ALA A C     1 
ATOM   4074  O  O     . ALA E 3 411 ? 124.714 -17.156 39.634  1.00 66.67  ? 707 ALA A O     1 
ATOM   4075  C  CB    . ALA E 3 411 ? 124.059 -18.746 42.119  1.00 67.36  ? 707 ALA A CB    1 
ATOM   4076  N  N     . VAL E 3 412 ? 126.344 -16.358 40.974  1.00 65.14  ? 708 VAL A N     1 
ATOM   4077  C  CA    . VAL E 3 412 ? 126.520 -15.125 40.203  1.00 63.59  ? 708 VAL A CA    1 
ATOM   4078  C  C     . VAL E 3 412 ? 127.598 -15.316 39.140  1.00 62.71  ? 708 VAL A C     1 
ATOM   4079  O  O     . VAL E 3 412 ? 127.398 -14.953 37.981  1.00 62.62  ? 708 VAL A O     1 
ATOM   4080  C  CB    . VAL E 3 412 ? 126.824 -13.917 41.099  1.00 63.59  ? 708 VAL A CB    1 
ATOM   4081  C  CG1   . VAL E 3 412 ? 127.231 -12.714 40.265  1.00 63.16  ? 708 VAL A CG1   1 
ATOM   4082  C  CG2   . VAL E 3 412 ? 125.608 -13.589 41.936  1.00 63.42  ? 708 VAL A CG2   1 
ATOM   4083  N  N     . ASN E 3 413 ? 128.733 -15.893 39.537  1.00 61.43  ? 709 ASN A N     1 
ATOM   4084  C  CA    . ASN E 3 413 ? 129.794 -16.238 38.591  1.00 60.00  ? 709 ASN A CA    1 
ATOM   4085  C  C     . ASN E 3 413 ? 129.227 -17.094 37.479  1.00 59.10  ? 709 ASN A C     1 
ATOM   4086  O  O     . ASN E 3 413 ? 129.354 -16.761 36.305  1.00 58.94  ? 709 ASN A O     1 
ATOM   4087  C  CB    . ASN E 3 413 ? 130.906 -17.032 39.278  1.00 60.00  ? 709 ASN A CB    1 
ATOM   4088  C  CG    . ASN E 3 413 ? 131.992 -16.156 39.847  1.00 59.80  ? 709 ASN A CG    1 
ATOM   4089  O  OD1   . ASN E 3 413 ? 132.397 -16.331 40.998  1.00 59.88  ? 709 ASN A OD1   1 
ATOM   4090  N  ND2   . ASN E 3 413 ? 132.484 -15.213 39.045  1.00 59.04  ? 709 ASN A ND2   1 
ATOM   4091  N  N     . TYR E 3 414 ? 128.594 -18.196 37.873  1.00 57.94  ? 710 TYR A N     1 
ATOM   4092  C  CA    . TYR E 3 414 ? 127.998 -19.134 36.934  1.00 56.95  ? 710 TYR A CA    1 
ATOM   4093  C  C     . TYR E 3 414 ? 126.877 -18.506 36.115  1.00 56.18  ? 710 TYR A C     1 
ATOM   4094  O  O     . TYR E 3 414 ? 126.755 -18.761 34.922  1.00 55.97  ? 710 TYR A O     1 
ATOM   4095  C  CB    . TYR E 3 414 ? 127.517 -20.401 37.656  1.00 57.02  ? 710 TYR A CB    1 
ATOM   4096  C  CG    . TYR E 3 414 ? 128.639 -21.369 37.966  1.00 56.78  ? 710 TYR A CG    1 
ATOM   4097  C  CD1   . TYR E 3 414 ? 129.351 -21.971 36.937  1.00 56.85  ? 710 TYR A CD1   1 
ATOM   4098  C  CD2   . TYR E 3 414 ? 128.985 -21.687 39.277  1.00 56.83  ? 710 TYR A CD2   1 
ATOM   4099  C  CE1   . TYR E 3 414 ? 130.385 -22.847 37.195  1.00 56.94  ? 710 TYR A CE1   1 
ATOM   4100  C  CE2   . TYR E 3 414 ? 130.021 -22.578 39.548  1.00 57.06  ? 710 TYR A CE2   1 
ATOM   4101  C  CZ    . TYR E 3 414 ? 130.718 -23.152 38.494  1.00 57.14  ? 710 TYR A CZ    1 
ATOM   4102  O  OH    . TYR E 3 414 ? 131.747 -24.040 38.718  1.00 57.04  ? 710 TYR A OH    1 
ATOM   4103  N  N     . GLY E 3 415 ? 126.070 -17.674 36.758  1.00 55.38  ? 711 GLY A N     1 
ATOM   4104  C  CA    . GLY E 3 415 ? 124.982 -17.007 36.076  1.00 54.32  ? 711 GLY A CA    1 
ATOM   4105  C  C     . GLY E 3 415 ? 125.511 -16.162 34.942  1.00 53.72  ? 711 GLY A C     1 
ATOM   4106  O  O     . GLY E 3 415 ? 125.021 -16.236 33.817  1.00 53.60  ? 711 GLY A O     1 
ATOM   4107  N  N     . ILE E 3 416 ? 126.530 -15.369 35.244  1.00 53.24  ? 712 ILE A N     1 
ATOM   4108  C  CA    . ILE E 3 416 ? 127.109 -14.457 34.272  1.00 52.99  ? 712 ILE A CA    1 
ATOM   4109  C  C     . ILE E 3 416 ? 127.690 -15.203 33.071  1.00 52.75  ? 712 ILE A C     1 
ATOM   4110  O  O     . ILE E 3 416 ? 127.431 -14.857 31.922  1.00 52.80  ? 712 ILE A O     1 
ATOM   4111  C  CB    . ILE E 3 416 ? 128.160 -13.532 34.933  1.00 53.06  ? 712 ILE A CB    1 
ATOM   4112  C  CG1   . ILE E 3 416 ? 127.494 -12.697 36.044  1.00 53.09  ? 712 ILE A CG1   1 
ATOM   4113  C  CG2   . ILE E 3 416 ? 128.820 -12.641 33.878  1.00 52.75  ? 712 ILE A CG2   1 
ATOM   4114  C  CD1   . ILE E 3 416 ? 128.454 -11.981 36.992  1.00 53.05  ? 712 ILE A CD1   1 
ATOM   4115  N  N     . VAL E 3 417 ? 128.444 -16.255 33.343  1.00 52.50  ? 713 VAL A N     1 
ATOM   4116  C  CA    . VAL E 3 417 ? 129.048 -17.035 32.274  1.00 52.18  ? 713 VAL A CA    1 
ATOM   4117  C  C     . VAL E 3 417 ? 128.008 -17.745 31.404  1.00 51.74  ? 713 VAL A C     1 
ATOM   4118  O  O     . VAL E 3 417 ? 128.340 -18.235 30.330  1.00 51.85  ? 713 VAL A O     1 
ATOM   4119  C  CB    . VAL E 3 417 ? 130.080 -18.060 32.819  1.00 52.32  ? 713 VAL A CB    1 
ATOM   4120  C  CG1   . VAL E 3 417 ? 131.014 -17.388 33.826  1.00 52.32  ? 713 VAL A CG1   1 
ATOM   4121  C  CG2   . VAL E 3 417 ? 129.394 -19.263 33.449  1.00 51.99  ? 713 VAL A CG2   1 
ATOM   4122  N  N     . TYR E 3 418 ? 126.759 -17.793 31.861  1.00 51.07  ? 714 TYR A N     1 
ATOM   4123  C  CA    . TYR E 3 418 ? 125.700 -18.468 31.108  1.00 50.47  ? 714 TYR A CA    1 
ATOM   4124  C  C     . TYR E 3 418 ? 124.563 -17.557 30.639  1.00 49.63  ? 714 TYR A C     1 
ATOM   4125  O  O     . TYR E 3 418 ? 123.383 -17.913 30.729  1.00 49.59  ? 714 TYR A O     1 
ATOM   4126  C  CB    . TYR E 3 418 ? 125.154 -19.665 31.883  1.00 50.85  ? 714 TYR A CB    1 
ATOM   4127  C  CG    . TYR E 3 418 ? 126.218 -20.680 32.199  1.00 51.66  ? 714 TYR A CG    1 
ATOM   4128  C  CD1   . TYR E 3 418 ? 127.145 -21.067 31.231  1.00 52.20  ? 714 TYR A CD1   1 
ATOM   4129  C  CD2   . TYR E 3 418 ? 126.285 -21.280 33.456  1.00 52.67  ? 714 TYR A CD2   1 
ATOM   4130  C  CE1   . TYR E 3 418 ? 128.133 -22.003 31.510  1.00 52.75  ? 714 TYR A CE1   1 
ATOM   4131  C  CE2   . TYR E 3 418 ? 127.265 -22.221 33.750  1.00 52.92  ? 714 TYR A CE2   1 
ATOM   4132  C  CZ    . TYR E 3 418 ? 128.185 -22.583 32.772  1.00 52.73  ? 714 TYR A CZ    1 
ATOM   4133  O  OH    . TYR E 3 418 ? 129.154 -23.521 33.059  1.00 52.18  ? 714 TYR A OH    1 
ATOM   4134  N  N     . GLY E 3 419 ? 124.936 -16.382 30.140  1.00 48.49  ? 715 GLY A N     1 
ATOM   4135  C  CA    . GLY E 3 419 ? 123.993 -15.448 29.540  1.00 46.90  ? 715 GLY A CA    1 
ATOM   4136  C  C     . GLY E 3 419 ? 122.881 -14.909 30.411  1.00 45.78  ? 715 GLY A C     1 
ATOM   4137  O  O     . GLY E 3 419 ? 121.771 -14.702 29.932  1.00 45.84  ? 715 GLY A O     1 
ATOM   4138  N  N     . ILE E 3 420 ? 123.154 -14.691 31.690  1.00 44.73  ? 716 ILE A N     1 
ATOM   4139  C  CA    . ILE E 3 420 ? 122.164 -14.045 32.538  1.00 43.56  ? 716 ILE A CA    1 
ATOM   4140  C  C     . ILE E 3 420 ? 122.142 -12.578 32.116  1.00 43.12  ? 716 ILE A C     1 
ATOM   4141  O  O     . ILE E 3 420 ? 123.193 -11.975 31.899  1.00 43.14  ? 716 ILE A O     1 
ATOM   4142  C  CB    . ILE E 3 420 ? 122.480 -14.209 34.058  1.00 43.55  ? 716 ILE A CB    1 
ATOM   4143  C  CG1   . ILE E 3 420 ? 121.240 -13.936 34.911  1.00 43.09  ? 716 ILE A CG1   1 
ATOM   4144  C  CG2   . ILE E 3 420 ? 123.650 -13.338 34.491  1.00 42.87  ? 716 ILE A CG2   1 
ATOM   4145  C  CD1   . ILE E 3 420 ? 121.491 -14.034 36.405  1.00 43.30  ? 716 ILE A CD1   1 
ATOM   4146  N  N     . SER E 3 421 ? 120.952 -12.019 31.938  1.00 42.43  ? 717 SER A N     1 
ATOM   4147  C  CA    . SER E 3 421 ? 120.837 -10.617 31.573  1.00 41.94  ? 717 SER A CA    1 
ATOM   4148  C  C     . SER E 3 421 ? 120.807 -9.807  32.864  1.00 41.49  ? 717 SER A C     1 
ATOM   4149  O  O     . SER E 3 421 ? 120.715 -10.387 33.950  1.00 41.42  ? 717 SER A O     1 
ATOM   4150  C  CB    . SER E 3 421 ? 119.577 -10.375 30.742  1.00 42.09  ? 717 SER A CB    1 
ATOM   4151  O  OG    . SER E 3 421 ? 118.410 -10.601 31.514  1.00 42.35  ? 717 SER A OG    1 
ATOM   4152  N  N     . ASP E 3 422 ? 120.885 -8.481  32.761  1.00 40.89  ? 718 ASP A N     1 
ATOM   4153  C  CA    . ASP E 3 422 ? 120.889 -7.635  33.958  1.00 40.39  ? 718 ASP A CA    1 
ATOM   4154  C  C     . ASP E 3 422 ? 119.576 -7.704  34.733  1.00 40.14  ? 718 ASP A C     1 
ATOM   4155  O  O     . ASP E 3 422 ? 119.553 -7.551  35.948  1.00 40.07  ? 718 ASP A O     1 
ATOM   4156  C  CB    . ASP E 3 422 ? 121.285 -6.191  33.629  1.00 40.39  ? 718 ASP A CB    1 
ATOM   4157  C  CG    . ASP E 3 422 ? 120.488 -5.606  32.482  1.00 40.15  ? 718 ASP A CG    1 
ATOM   4158  O  OD1   . ASP E 3 422 ? 121.080 -5.393  31.405  1.00 39.70  ? 718 ASP A OD1   1 
ATOM   4159  O  OD2   . ASP E 3 422 ? 119.275 -5.366  32.650  1.00 39.68  ? 718 ASP A OD2   1 
ATOM   4160  N  N     . TYR E 3 423 ? 118.484 -7.953  34.027  1.00 40.09  ? 719 TYR A N     1 
ATOM   4161  C  CA    . TYR E 3 423 ? 117.205 -8.150  34.685  1.00 39.98  ? 719 TYR A CA    1 
ATOM   4162  C  C     . TYR E 3 423 ? 117.267 -9.362  35.612  1.00 39.84  ? 719 TYR A C     1 
ATOM   4163  O  O     . TYR E 3 423 ? 116.810 -9.299  36.758  1.00 40.00  ? 719 TYR A O     1 
ATOM   4164  C  CB    . TYR E 3 423 ? 116.074 -8.334  33.671  1.00 40.07  ? 719 TYR A CB    1 
ATOM   4165  C  CG    . TYR E 3 423 ? 114.740 -8.529  34.345  1.00 40.15  ? 719 TYR A CG    1 
ATOM   4166  C  CD1   . TYR E 3 423 ? 114.006 -7.432  34.789  1.00 40.26  ? 719 TYR A CD1   1 
ATOM   4167  C  CD2   . TYR E 3 423 ? 114.225 -9.805  34.568  1.00 39.89  ? 719 TYR A CD2   1 
ATOM   4168  C  CE1   . TYR E 3 423 ? 112.797 -7.593  35.424  1.00 40.01  ? 719 TYR A CE1   1 
ATOM   4169  C  CE2   . TYR E 3 423 ? 113.012 -9.980  35.206  1.00 39.92  ? 719 TYR A CE2   1 
ATOM   4170  C  CZ    . TYR E 3 423 ? 112.305 -8.868  35.627  1.00 40.33  ? 719 TYR A CZ    1 
ATOM   4171  O  OH    . TYR E 3 423 ? 111.098 -9.017  36.257  1.00 40.99  ? 719 TYR A OH    1 
ATOM   4172  N  N     . GLY E 3 424 ? 117.824 -10.461 35.106  1.00 39.49  ? 720 GLY A N     1 
ATOM   4173  C  CA    . GLY E 3 424 ? 117.958 -11.686 35.880  1.00 39.30  ? 720 GLY A CA    1 
ATOM   4174  C  C     . GLY E 3 424 ? 118.801 -11.464 37.115  1.00 39.34  ? 720 GLY A C     1 
ATOM   4175  O  O     . GLY E 3 424 ? 118.380 -11.775 38.227  1.00 39.15  ? 720 GLY A O     1 
ATOM   4176  N  N     . LEU E 3 425 ? 119.986 -10.892 36.912  1.00 39.50  ? 721 LEU A N     1 
ATOM   4177  C  CA    . LEU E 3 425 ? 120.923 -10.632 37.995  1.00 39.75  ? 721 LEU A CA    1 
ATOM   4178  C  C     . LEU E 3 425 ? 120.355 -9.715  39.086  1.00 40.25  ? 721 LEU A C     1 
ATOM   4179  O  O     . LEU E 3 425 ? 120.484 -10.016 40.273  1.00 40.53  ? 721 LEU A O     1 
ATOM   4180  C  CB    . LEU E 3 425 ? 122.240 -10.086 37.445  1.00 39.39  ? 721 LEU A CB    1 
ATOM   4181  C  CG    . LEU E 3 425 ? 123.392 -9.955  38.443  1.00 39.30  ? 721 LEU A CG    1 
ATOM   4182  C  CD1   . LEU E 3 425 ? 123.653 -11.258 39.190  1.00 38.58  ? 721 LEU A CD1   1 
ATOM   4183  C  CD2   . LEU E 3 425 ? 124.658 -9.482  37.744  1.00 39.68  ? 721 LEU A CD2   1 
ATOM   4184  N  N     . ALA E 3 426 ? 119.729 -8.607  38.688  1.00 40.66  ? 722 ALA A N     1 
ATOM   4185  C  CA    . ALA E 3 426 ? 119.122 -7.684  39.647  1.00 41.02  ? 722 ALA A CA    1 
ATOM   4186  C  C     . ALA E 3 426 ? 117.994 -8.358  40.418  1.00 41.40  ? 722 ALA A C     1 
ATOM   4187  O  O     . ALA E 3 426 ? 117.851 -8.150  41.623  1.00 41.47  ? 722 ALA A O     1 
ATOM   4188  C  CB    . ALA E 3 426 ? 118.615 -6.427  38.950  1.00 40.91  ? 722 ALA A CB    1 
ATOM   4189  N  N     . GLN E 3 427 ? 117.208 -9.179  39.721  1.00 41.92  ? 723 GLN A N     1 
ATOM   4190  C  CA    . GLN E 3 427 ? 116.092 -9.899  40.339  1.00 42.26  ? 723 GLN A CA    1 
ATOM   4191  C  C     . GLN E 3 427 ? 116.521 -11.075 41.202  1.00 42.57  ? 723 GLN A C     1 
ATOM   4192  O  O     . GLN E 3 427 ? 115.678 -11.725 41.819  1.00 42.95  ? 723 GLN A O     1 
ATOM   4193  C  CB    . GLN E 3 427 ? 115.096 -10.382 39.282  1.00 42.19  ? 723 GLN A CB    1 
ATOM   4194  C  CG    . GLN E 3 427 ? 114.334 -9.265  38.588  1.00 42.40  ? 723 GLN A CG    1 
ATOM   4195  C  CD    . GLN E 3 427 ? 113.510 -8.420  39.545  1.00 42.50  ? 723 GLN A CD    1 
ATOM   4196  O  OE1   . GLN E 3 427 ? 113.060 -8.893  40.588  1.00 43.74  ? 723 GLN A OE1   1 
ATOM   4197  N  NE2   . GLN E 3 427 ? 113.299 -7.164  39.186  1.00 41.91  ? 723 GLN A NE2   1 
ATOM   4198  N  N     . ASN E 3 428 ? 117.818 -11.366 41.226  1.00 42.92  ? 724 ASN A N     1 
ATOM   4199  C  CA    . ASN E 3 428 ? 118.349 -12.443 42.059  1.00 43.32  ? 724 ASN A CA    1 
ATOM   4200  C  C     . ASN E 3 428 ? 119.030 -11.908 43.301  1.00 43.55  ? 724 ASN A C     1 
ATOM   4201  O  O     . ASN E 3 428 ? 119.063 -12.574 44.335  1.00 43.61  ? 724 ASN A O     1 
ATOM   4202  C  CB    . ASN E 3 428 ? 119.335 -13.312 41.280  1.00 43.44  ? 724 ASN A CB    1 
ATOM   4203  C  CG    . ASN E 3 428 ? 118.645 -14.262 40.319  1.00 44.01  ? 724 ASN A CG    1 
ATOM   4204  O  OD1   . ASN E 3 428 ? 117.435 -14.470 40.392  1.00 43.78  ? 724 ASN A OD1   1 
ATOM   4205  N  ND2   . ASN E 3 428 ? 119.419 -14.851 39.413  1.00 45.53  ? 724 ASN A ND2   1 
ATOM   4206  N  N     . LEU E 3 429 ? 119.569 -10.699 43.188  1.00 43.74  ? 725 LEU A N     1 
ATOM   4207  C  CA    . LEU E 3 429 ? 120.303 -10.074 44.275  1.00 44.14  ? 725 LEU A CA    1 
ATOM   4208  C  C     . LEU E 3 429 ? 119.544 -8.920  44.935  1.00 44.57  ? 725 LEU A C     1 
ATOM   4209  O  O     . LEU E 3 429 ? 120.052 -8.312  45.880  1.00 44.61  ? 725 LEU A O     1 
ATOM   4210  C  CB    . LEU E 3 429 ? 121.651 -9.552  43.763  1.00 43.97  ? 725 LEU A CB    1 
ATOM   4211  C  CG    . LEU E 3 429 ? 122.686 -10.473 43.109  1.00 44.00  ? 725 LEU A CG    1 
ATOM   4212  C  CD1   . LEU E 3 429 ? 123.877 -9.634  42.661  1.00 43.83  ? 725 LEU A CD1   1 
ATOM   4213  C  CD2   . LEU E 3 429 ? 123.144 -11.618 44.023  1.00 43.27  ? 725 LEU A CD2   1 
ATOM   4214  N  N     . ASN E 3 430 ? 118.343 -8.617  44.436  1.00 45.01  ? 726 ASN A N     1 
ATOM   4215  C  CA    . ASN E 3 430 ? 117.559 -7.473  44.917  1.00 45.34  ? 726 ASN A CA    1 
ATOM   4216  C  C     . ASN E 3 430 ? 118.317 -6.164  44.828  1.00 45.57  ? 726 ASN A C     1 
ATOM   4217  O  O     . ASN E 3 430 ? 118.255 -5.333  45.741  1.00 45.76  ? 726 ASN A O     1 
ATOM   4218  C  CB    . ASN E 3 430 ? 117.063 -7.681  46.350  1.00 45.38  ? 726 ASN A CB    1 
ATOM   4219  C  CG    . ASN E 3 430 ? 115.684 -8.258  46.394  1.00 45.72  ? 726 ASN A CG    1 
ATOM   4220  O  OD1   . ASN E 3 430 ? 114.943 -8.178  45.415  1.00 46.02  ? 726 ASN A OD1   1 
ATOM   4221  N  ND2   . ASN E 3 430 ? 115.316 -8.838  47.529  1.00 46.44  ? 726 ASN A ND2   1 
ATOM   4222  N  N     . ILE E 3 431 ? 119.042 -5.988  43.732  1.00 45.58  ? 727 ILE A N     1 
ATOM   4223  C  CA    . ILE E 3 431 ? 119.839 -4.793  43.556  1.00 45.60  ? 727 ILE A CA    1 
ATOM   4224  C  C     . ILE E 3 431 ? 119.306 -3.975  42.410  1.00 45.79  ? 727 ILE A C     1 
ATOM   4225  O  O     . ILE E 3 431 ? 118.358 -4.370  41.735  1.00 45.72  ? 727 ILE A O     1 
ATOM   4226  C  CB    . ILE E 3 431 ? 121.317 -5.122  43.276  1.00 45.74  ? 727 ILE A CB    1 
ATOM   4227  C  CG1   . ILE E 3 431 ? 121.458 -5.850  41.931  1.00 45.27  ? 727 ILE A CG1   1 
ATOM   4228  C  CG2   . ILE E 3 431 ? 121.915 -5.921  44.446  1.00 45.77  ? 727 ILE A CG2   1 
ATOM   4229  C  CD1   . ILE E 3 431 ? 122.877 -6.001  41.445  1.00 44.58  ? 727 ILE A CD1   1 
ATOM   4230  N  N     . SER E 3 432 ? 119.935 -2.827  42.204  1.00 46.02  ? 728 SER A N     1 
ATOM   4231  C  CA    . SER E 3 432 ? 119.573 -1.927  41.138  1.00 46.38  ? 728 SER A CA    1 
ATOM   4232  C  C     . SER E 3 432 ? 119.874 -2.581  39.799  1.00 46.58  ? 728 SER A C     1 
ATOM   4233  O  O     . SER E 3 432 ? 120.902 -3.245  39.638  1.00 46.64  ? 728 SER A O     1 
ATOM   4234  C  CB    . SER E 3 432 ? 120.374 -0.637  41.286  1.00 46.45  ? 728 SER A CB    1 
ATOM   4235  O  OG    . SER E 3 432 ? 119.948 0.340   40.366  1.00 47.14  ? 728 SER A OG    1 
ATOM   4236  N  N     . ARG E 3 433 ? 118.968 -2.403  38.842  1.00 46.92  ? 729 ARG A N     1 
ATOM   4237  C  CA    . ARG E 3 433 ? 119.157 -2.954  37.496  1.00 46.95  ? 729 ARG A CA    1 
ATOM   4238  C  C     . ARG E 3 433 ? 120.285 -2.219  36.753  1.00 47.03  ? 729 ARG A C     1 
ATOM   4239  O  O     . ARG E 3 433 ? 120.916 -2.784  35.863  1.00 46.93  ? 729 ARG A O     1 
ATOM   4240  C  CB    . ARG E 3 433 ? 117.845 -2.935  36.703  1.00 46.92  ? 729 ARG A CB    1 
ATOM   4241  C  CG    . ARG E 3 433 ? 117.874 -3.788  35.454  1.00 46.84  ? 729 ARG A CG    1 
ATOM   4242  C  CD    . ARG E 3 433 ? 116.550 -3.787  34.707  1.00 46.71  ? 729 ARG A CD    1 
ATOM   4243  N  NE    . ARG E 3 433 ? 116.704 -4.487  33.436  1.00 46.62  ? 729 ARG A NE    1 
ATOM   4244  C  CZ    . ARG E 3 433 ? 115.739 -4.675  32.544  1.00 46.31  ? 729 ARG A CZ    1 
ATOM   4245  N  NH1   . ARG E 3 433 ? 114.519 -4.219  32.773  1.00 46.75  ? 729 ARG A NH1   1 
ATOM   4246  N  NH2   . ARG E 3 433 ? 115.999 -5.326  31.418  1.00 46.43  ? 729 ARG A NH2   1 
ATOM   4247  N  N     . LYS E 3 434 ? 120.538 -0.966  37.132  1.00 47.12  ? 730 LYS A N     1 
ATOM   4248  C  CA    . LYS E 3 434 ? 121.675 -0.215  36.597  1.00 47.50  ? 730 LYS A CA    1 
ATOM   4249  C  C     . LYS E 3 434 ? 122.968 -0.816  37.147  1.00 47.27  ? 730 LYS A C     1 
ATOM   4250  O  O     . LYS E 3 434 ? 123.951 -0.968  36.427  1.00 46.95  ? 730 LYS A O     1 
ATOM   4251  C  CB    . LYS E 3 434 ? 121.580 1.275   36.966  1.00 47.50  ? 730 LYS A CB    1 
ATOM   4252  C  CG    . LYS E 3 434 ? 120.349 1.992   36.386  1.00 48.54  ? 730 LYS A CG    1 
ATOM   4253  C  CD    . LYS E 3 434 ? 120.217 3.470   36.803  1.00 48.36  ? 730 LYS A CD    1 
ATOM   4254  C  CE    . LYS E 3 434 ? 121.223 4.408   36.118  1.00 50.33  ? 730 LYS A CE    1 
ATOM   4255  N  NZ    . LYS E 3 434 ? 120.858 4.773   34.704  1.00 51.00  ? 730 LYS A NZ    1 
ATOM   4256  N  N     . GLU E 3 435 ? 122.945 -1.166  38.430  1.00 47.46  ? 731 GLU A N     1 
ATOM   4257  C  CA    . GLU E 3 435 ? 124.093 -1.763  39.099  1.00 47.93  ? 731 GLU A CA    1 
ATOM   4258  C  C     . GLU E 3 435 ? 124.346 -3.173  38.609  1.00 47.69  ? 731 GLU A C     1 
ATOM   4259  O  O     . GLU E 3 435 ? 125.496 -3.602  38.510  1.00 47.69  ? 731 GLU A O     1 
ATOM   4260  C  CB    . GLU E 3 435 ? 123.907 -1.757  40.615  1.00 47.87  ? 731 GLU A CB    1 
ATOM   4261  C  CG    . GLU E 3 435 ? 124.152 -0.391  41.248  1.00 48.97  ? 731 GLU A CG    1 
ATOM   4262  C  CD    . GLU E 3 435 ? 123.897 -0.371  42.749  1.00 49.12  ? 731 GLU A CD    1 
ATOM   4263  O  OE1   . GLU E 3 435 ? 123.030 -1.142  43.229  1.00 50.65  ? 731 GLU A OE1   1 
ATOM   4264  O  OE2   . GLU E 3 435 ? 124.560 0.432   43.446  1.00 50.61  ? 731 GLU A OE2   1 
ATOM   4265  N  N     . ALA E 3 436 ? 123.267 -3.890  38.312  1.00 47.64  ? 732 ALA A N     1 
ATOM   4266  C  CA    . ALA E 3 436 ? 123.371 -5.227  37.750  1.00 47.64  ? 732 ALA A CA    1 
ATOM   4267  C  C     . ALA E 3 436 ? 124.125 -5.149  36.429  1.00 47.69  ? 732 ALA A C     1 
ATOM   4268  O  O     . ALA E 3 436 ? 125.083 -5.879  36.209  1.00 47.52  ? 732 ALA A O     1 
ATOM   4269  C  CB    . ALA E 3 436 ? 121.999 -5.818  37.547  1.00 47.56  ? 732 ALA A CB    1 
ATOM   4270  N  N     . ALA E 3 437 ? 123.692 -4.238  35.566  1.00 48.04  ? 733 ALA A N     1 
ATOM   4271  C  CA    . ALA E 3 437 ? 124.339 -4.005  34.287  1.00 48.69  ? 733 ALA A CA    1 
ATOM   4272  C  C     . ALA E 3 437 ? 125.826 -3.709  34.464  1.00 49.20  ? 733 ALA A C     1 
ATOM   4273  O  O     . ALA E 3 437 ? 126.666 -4.286  33.768  1.00 49.13  ? 733 ALA A O     1 
ATOM   4274  C  CB    . ALA E 3 437 ? 123.654 -2.864  33.556  1.00 48.74  ? 733 ALA A CB    1 
ATOM   4275  N  N     . GLU E 3 438 ? 126.141 -2.814  35.399  1.00 49.77  ? 734 GLU A N     1 
ATOM   4276  C  CA    . GLU E 3 438 ? 127.527 -2.458  35.704  1.00 50.54  ? 734 GLU A CA    1 
ATOM   4277  C  C     . GLU E 3 438 ? 128.384 -3.674  36.045  1.00 50.47  ? 734 GLU A C     1 
ATOM   4278  O  O     . GLU E 3 438 ? 129.495 -3.798  35.532  1.00 50.53  ? 734 GLU A O     1 
ATOM   4279  C  CB    . GLU E 3 438 ? 127.597 -1.447  36.850  1.00 50.58  ? 734 GLU A CB    1 
ATOM   4280  C  CG    . GLU E 3 438 ? 127.150 -0.034  36.495  1.00 51.27  ? 734 GLU A CG    1 
ATOM   4281  C  CD    . GLU E 3 438 ? 127.157 0.900   37.704  1.00 51.68  ? 734 GLU A CD    1 
ATOM   4282  O  OE1   . GLU E 3 438 ? 127.942 0.660   38.657  1.00 52.77  ? 734 GLU A OE1   1 
ATOM   4283  O  OE2   . GLU E 3 438 ? 126.378 1.881   37.700  1.00 53.33  ? 734 GLU A OE2   1 
ATOM   4284  N  N     . PHE E 3 439 ? 127.871 -4.555  36.908  1.00 50.60  ? 735 PHE A N     1 
ATOM   4285  C  CA    . PHE E 3 439 ? 128.583 -5.781  37.288  1.00 50.71  ? 735 PHE A CA    1 
ATOM   4286  C  C     . PHE E 3 439 ? 129.004 -6.575  36.064  1.00 50.59  ? 735 PHE A C     1 
ATOM   4287  O  O     . PHE E 3 439 ? 130.177 -6.887  35.882  1.00 50.45  ? 735 PHE A O     1 
ATOM   4288  C  CB    . PHE E 3 439 ? 127.713 -6.682  38.167  1.00 50.89  ? 735 PHE A CB    1 
ATOM   4289  C  CG    . PHE E 3 439 ? 127.709 -6.308  39.614  1.00 51.32  ? 735 PHE A CG    1 
ATOM   4290  C  CD1   . PHE E 3 439 ? 126.526 -5.973  40.256  1.00 51.90  ? 735 PHE A CD1   1 
ATOM   4291  C  CD2   . PHE E 3 439 ? 128.889 -6.303  40.346  1.00 52.47  ? 735 PHE A CD2   1 
ATOM   4292  C  CE1   . PHE E 3 439 ? 126.513 -5.631  41.613  1.00 52.04  ? 735 PHE A CE1   1 
ATOM   4293  C  CE2   . PHE E 3 439 ? 128.887 -5.955  41.705  1.00 52.98  ? 735 PHE A CE2   1 
ATOM   4294  C  CZ    . PHE E 3 439 ? 127.694 -5.620  42.336  1.00 51.95  ? 735 PHE A CZ    1 
ATOM   4295  N  N     . ILE E 3 440 ? 128.021 -6.894  35.233  1.00 50.63  ? 736 ILE A N     1 
ATOM   4296  C  CA    . ILE E 3 440 ? 128.230 -7.673  34.029  1.00 50.73  ? 736 ILE A CA    1 
ATOM   4297  C  C     . ILE E 3 440 ? 129.222 -6.984  33.110  1.00 51.17  ? 736 ILE A C     1 
ATOM   4298  O  O     . ILE E 3 440 ? 130.241 -7.565  32.749  1.00 51.31  ? 736 ILE A O     1 
ATOM   4299  C  CB    . ILE E 3 440 ? 126.899 -7.901  33.286  1.00 50.51  ? 736 ILE A CB    1 
ATOM   4300  C  CG1   . ILE E 3 440 ? 125.901 -8.609  34.204  1.00 49.87  ? 736 ILE A CG1   1 
ATOM   4301  C  CG2   . ILE E 3 440 ? 127.125 -8.695  32.005  1.00 50.40  ? 736 ILE A CG2   1 
ATOM   4302  C  CD1   . ILE E 3 440 ? 124.479 -8.589  33.709  1.00 48.75  ? 736 ILE A CD1   1 
ATOM   4303  N  N     . GLU E 3 441 ? 128.925 -5.739  32.753  1.00 51.67  ? 737 GLU A N     1 
ATOM   4304  C  CA    . GLU E 3 441 ? 129.773 -4.957  31.856  1.00 52.26  ? 737 GLU A CA    1 
ATOM   4305  C  C     . GLU E 3 441 ? 131.230 -4.927  32.331  1.00 52.32  ? 737 GLU A C     1 
ATOM   4306  O  O     . GLU E 3 441 ? 132.158 -4.959  31.519  1.00 52.41  ? 737 GLU A O     1 
ATOM   4307  C  CB    . GLU E 3 441 ? 129.219 -3.537  31.713  1.00 52.20  ? 737 GLU A CB    1 
ATOM   4308  C  CG    . GLU E 3 441 ? 129.849 -2.723  30.597  1.00 52.78  ? 737 GLU A CG    1 
ATOM   4309  C  CD    . GLU E 3 441 ? 129.396 -1.269  30.596  1.00 52.89  ? 737 GLU A CD    1 
ATOM   4310  O  OE1   . GLU E 3 441 ? 128.227 -0.992  30.940  1.00 53.50  ? 737 GLU A OE1   1 
ATOM   4311  O  OE2   . GLU E 3 441 ? 130.218 -0.398  30.245  1.00 54.15  ? 737 GLU A OE2   1 
ATOM   4312  N  N     . ARG E 3 442 ? 131.419 -4.879  33.646  1.00 52.40  ? 738 ARG A N     1 
ATOM   4313  C  CA    . ARG E 3 442 ? 132.753 -4.891  34.234  1.00 52.71  ? 738 ARG A CA    1 
ATOM   4314  C  C     . ARG E 3 442 ? 133.380 -6.278  34.072  1.00 52.54  ? 738 ARG A C     1 
ATOM   4315  O  O     . ARG E 3 442 ? 134.542 -6.401  33.680  1.00 52.70  ? 738 ARG A O     1 
ATOM   4316  C  CB    . ARG E 3 442 ? 132.694 -4.483  35.713  1.00 52.64  ? 738 ARG A CB    1 
ATOM   4317  C  CG    . ARG E 3 442 ? 134.053 -4.265  36.385  1.00 53.27  ? 738 ARG A CG    1 
ATOM   4318  C  CD    . ARG E 3 442 ? 133.904 -4.017  37.889  1.00 53.32  ? 738 ARG A CD    1 
ATOM   4319  N  NE    . ARG E 3 442 ? 133.214 -5.126  38.548  1.00 54.55  ? 738 ARG A NE    1 
ATOM   4320  C  CZ    . ARG E 3 442 ? 132.935 -5.177  39.846  1.00 54.48  ? 738 ARG A CZ    1 
ATOM   4321  N  NH1   . ARG E 3 442 ? 133.288 -4.177  40.642  1.00 54.57  ? 738 ARG A NH1   1 
ATOM   4322  N  NH2   . ARG E 3 442 ? 132.301 -6.232  40.345  1.00 53.69  ? 738 ARG A NH2   1 
ATOM   4323  N  N     . TYR E 3 443 ? 132.588 -7.311  34.352  1.00 52.40  ? 739 TYR A N     1 
ATOM   4324  C  CA    . TYR E 3 443 ? 133.016 -8.708  34.259  1.00 52.33  ? 739 TYR A CA    1 
ATOM   4325  C  C     . TYR E 3 443 ? 133.591 -9.039  32.880  1.00 52.41  ? 739 TYR A C     1 
ATOM   4326  O  O     . TYR E 3 443 ? 134.608 -9.720  32.775  1.00 52.25  ? 739 TYR A O     1 
ATOM   4327  C  CB    . TYR E 3 443 ? 131.819 -9.620  34.538  1.00 52.19  ? 739 TYR A CB    1 
ATOM   4328  C  CG    . TYR E 3 443 ? 132.147 -11.036 34.971  1.00 51.99  ? 739 TYR A CG    1 
ATOM   4329  C  CD1   . TYR E 3 443 ? 132.098 -11.388 36.314  1.00 51.76  ? 739 TYR A CD1   1 
ATOM   4330  C  CD2   . TYR E 3 443 ? 132.475 -12.024 34.043  1.00 51.55  ? 739 TYR A CD2   1 
ATOM   4331  C  CE1   . TYR E 3 443 ? 132.375 -12.672 36.735  1.00 51.63  ? 739 TYR A CE1   1 
ATOM   4332  C  CE2   . TYR E 3 443 ? 132.762 -13.318 34.453  1.00 51.64  ? 739 TYR A CE2   1 
ATOM   4333  C  CZ    . TYR E 3 443 ? 132.707 -13.636 35.809  1.00 52.05  ? 739 TYR A CZ    1 
ATOM   4334  O  OH    . TYR E 3 443 ? 132.977 -14.913 36.261  1.00 52.17  ? 739 TYR A OH    1 
ATOM   4335  N  N     . PHE E 3 444 ? 132.935 -8.553  31.829  1.00 52.66  ? 740 PHE A N     1 
ATOM   4336  C  CA    . PHE E 3 444 ? 133.355 -8.841  30.455  1.00 52.89  ? 740 PHE A CA    1 
ATOM   4337  C  C     . PHE E 3 444 ? 134.505 -7.979  29.943  1.00 52.91  ? 740 PHE A C     1 
ATOM   4338  O  O     . PHE E 3 444 ? 135.068 -8.240  28.874  1.00 53.01  ? 740 PHE A O     1 
ATOM   4339  C  CB    . PHE E 3 444 ? 132.168 -8.798  29.483  1.00 53.02  ? 740 PHE A CB    1 
ATOM   4340  C  CG    . PHE E 3 444 ? 131.211 -9.949  29.646  1.00 53.23  ? 740 PHE A CG    1 
ATOM   4341  C  CD1   . PHE E 3 444 ? 131.666 -11.190 30.084  1.00 53.64  ? 740 PHE A CD1   1 
ATOM   4342  C  CD2   . PHE E 3 444 ? 129.870 -9.805  29.322  1.00 53.57  ? 740 PHE A CD2   1 
ATOM   4343  C  CE1   . PHE E 3 444 ? 130.797 -12.258 30.231  1.00 54.14  ? 740 PHE A CE1   1 
ATOM   4344  C  CE2   . PHE E 3 444 ? 128.990 -10.870 29.461  1.00 53.94  ? 740 PHE A CE2   1 
ATOM   4345  C  CZ    . PHE E 3 444 ? 129.453 -12.100 29.915  1.00 53.99  ? 740 PHE A CZ    1 
ATOM   4346  N  N     . GLU E 3 445 ? 134.846 -6.944  30.699  1.00 52.78  ? 741 GLU A N     1 
ATOM   4347  C  CA    . GLU E 3 445 ? 135.988 -6.113  30.361  1.00 52.45  ? 741 GLU A CA    1 
ATOM   4348  C  C     . GLU E 3 445 ? 137.185 -6.623  31.153  1.00 51.81  ? 741 GLU A C     1 
ATOM   4349  O  O     . GLU E 3 445 ? 138.332 -6.510  30.725  1.00 51.81  ? 741 GLU A O     1 
ATOM   4350  C  CB    . GLU E 3 445 ? 135.680 -4.647  30.653  1.00 52.61  ? 741 GLU A CB    1 
ATOM   4351  C  CG    . GLU E 3 445 ? 134.638 -4.075  29.694  1.00 53.68  ? 741 GLU A CG    1 
ATOM   4352  C  CD    . GLU E 3 445 ? 134.138 -2.693  30.092  1.00 54.93  ? 741 GLU A CD    1 
ATOM   4353  O  OE1   . GLU E 3 445 ? 133.994 -2.424  31.308  1.00 55.32  ? 741 GLU A OE1   1 
ATOM   4354  O  OE2   . GLU E 3 445 ? 133.870 -1.880  29.181  1.00 55.05  ? 741 GLU A OE2   1 
ATOM   4355  N  N     . SER E 3 446 ? 136.888 -7.225  32.297  1.00 50.93  ? 742 SER A N     1 
ATOM   4356  C  CA    . SER E 3 446 ? 137.899 -7.806  33.159  1.00 50.29  ? 742 SER A CA    1 
ATOM   4357  C  C     . SER E 3 446 ? 138.333 -9.172  32.635  1.00 49.72  ? 742 SER A C     1 
ATOM   4358  O  O     . SER E 3 446 ? 139.466 -9.589  32.839  1.00 49.66  ? 742 SER A O     1 
ATOM   4359  C  CB    . SER E 3 446 ? 137.330 -7.955  34.562  1.00 50.47  ? 742 SER A CB    1 
ATOM   4360  O  OG    . SER E 3 446 ? 136.532 -6.826  34.877  1.00 50.76  ? 742 SER A OG    1 
ATOM   4361  N  N     . PHE E 3 447 ? 137.414 -9.872  31.978  1.00 49.07  ? 743 PHE A N     1 
ATOM   4362  C  CA    . PHE E 3 447 ? 137.707 -11.157 31.362  1.00 48.37  ? 743 PHE A CA    1 
ATOM   4363  C  C     . PHE E 3 447 ? 137.328 -11.052 29.892  1.00 48.14  ? 743 PHE A C     1 
ATOM   4364  O  O     . PHE E 3 447 ? 136.311 -11.616 29.473  1.00 48.42  ? 743 PHE A O     1 
ATOM   4365  C  CB    . PHE E 3 447 ? 136.891 -12.280 32.006  1.00 48.29  ? 743 PHE A CB    1 
ATOM   4366  C  CG    . PHE E 3 447 ? 137.146 -12.469 33.478  1.00 48.30  ? 743 PHE A CG    1 
ATOM   4367  C  CD1   . PHE E 3 447 ? 138.208 -13.240 33.919  1.00 48.13  ? 743 PHE A CD1   1 
ATOM   4368  C  CD2   . PHE E 3 447 ? 136.301 -11.901 34.423  1.00 48.98  ? 743 PHE A CD2   1 
ATOM   4369  C  CE1   . PHE E 3 447 ? 138.438 -13.428 35.279  1.00 48.59  ? 743 PHE A CE1   1 
ATOM   4370  C  CE2   . PHE E 3 447 ? 136.525 -12.081 35.782  1.00 48.77  ? 743 PHE A CE2   1 
ATOM   4371  C  CZ    . PHE E 3 447 ? 137.594 -12.846 36.210  1.00 48.46  ? 743 PHE A CZ    1 
ATOM   4372  N  N     . PRO E 3 448 ? 138.139 -10.331 29.093  1.00 47.70  ? 744 PRO A N     1 
ATOM   4373  C  CA    . PRO E 3 448 ? 137.767 -10.127 27.688  1.00 47.20  ? 744 PRO A CA    1 
ATOM   4374  C  C     . PRO E 3 448 ? 137.755 -11.430 26.897  1.00 46.71  ? 744 PRO A C     1 
ATOM   4375  O  O     . PRO E 3 448 ? 136.994 -11.560 25.934  1.00 46.65  ? 744 PRO A O     1 
ATOM   4376  C  CB    . PRO E 3 448 ? 138.851 -9.181  27.160  1.00 47.19  ? 744 PRO A CB    1 
ATOM   4377  C  CG    . PRO E 3 448 ? 140.006 -9.354  28.090  1.00 47.49  ? 744 PRO A CG    1 
ATOM   4378  C  CD    . PRO E 3 448 ? 139.427 -9.693  29.429  1.00 47.72  ? 744 PRO A CD    1 
ATOM   4379  N  N     . GLY E 3 449 ? 138.589 -12.382 27.311  1.00 45.97  ? 745 GLY A N     1 
ATOM   4380  C  CA    . GLY E 3 449 ? 138.653 -13.674 26.660  1.00 45.08  ? 745 GLY A CA    1 
ATOM   4381  C  C     . GLY E 3 449 ? 137.336 -14.415 26.764  1.00 44.61  ? 745 GLY A C     1 
ATOM   4382  O  O     . GLY E 3 449 ? 136.871 -14.997 25.784  1.00 44.70  ? 745 GLY A O     1 
ATOM   4383  N  N     . VAL E 3 450 ? 136.723 -14.387 27.945  1.00 44.00  ? 746 VAL A N     1 
ATOM   4384  C  CA    . VAL E 3 450 ? 135.463 -15.102 28.156  1.00 43.36  ? 746 VAL A CA    1 
ATOM   4385  C  C     . VAL E 3 450 ? 134.348 -14.490 27.317  1.00 43.14  ? 746 VAL A C     1 
ATOM   4386  O  O     . VAL E 3 450 ? 133.551 -15.212 26.723  1.00 42.90  ? 746 VAL A O     1 
ATOM   4387  C  CB    . VAL E 3 450 ? 135.069 -15.181 29.646  1.00 43.22  ? 746 VAL A CB    1 
ATOM   4388  C  CG1   . VAL E 3 450 ? 133.708 -15.845 29.803  1.00 42.91  ? 746 VAL A CG1   1 
ATOM   4389  C  CG2   . VAL E 3 450 ? 136.112 -15.965 30.419  1.00 42.57  ? 746 VAL A CG2   1 
ATOM   4390  N  N     . LYS E 3 451 ? 134.329 -13.160 27.266  1.00 43.05  ? 747 LYS A N     1 
ATOM   4391  C  CA    . LYS E 3 451 ? 133.399 -12.382 26.443  1.00 43.04  ? 747 LYS A CA    1 
ATOM   4392  C  C     . LYS E 3 451 ? 133.454 -12.764 24.956  1.00 43.12  ? 747 LYS A C     1 
ATOM   4393  O  O     . LYS E 3 451 ? 132.411 -12.898 24.300  1.00 42.86  ? 747 LYS A O     1 
ATOM   4394  C  CB    . LYS E 3 451 ? 133.723 -10.894 26.604  1.00 43.11  ? 747 LYS A CB    1 
ATOM   4395  C  CG    . LYS E 3 451 ? 133.149 -9.959  25.541  1.00 43.52  ? 747 LYS A CG    1 
ATOM   4396  C  CD    . LYS E 3 451 ? 131.676 -9.675  25.769  1.00 45.00  ? 747 LYS A CD    1 
ATOM   4397  C  CE    . LYS E 3 451 ? 131.219 -8.459  24.965  1.00 45.99  ? 747 LYS A CE    1 
ATOM   4398  N  NZ    . LYS E 3 451 ? 129.863 -7.990  25.397  1.00 46.09  ? 747 LYS A NZ    1 
ATOM   4399  N  N     . ARG E 3 452 ? 134.670 -12.930 24.429  1.00 43.16  ? 748 ARG A N     1 
ATOM   4400  C  CA    . ARG E 3 452 ? 134.846 -13.289 23.021  1.00 43.30  ? 748 ARG A CA    1 
ATOM   4401  C  C     . ARG E 3 452 ? 134.523 -14.762 22.790  1.00 42.83  ? 748 ARG A C     1 
ATOM   4402  O  O     . ARG E 3 452 ? 134.118 -15.141 21.696  1.00 42.65  ? 748 ARG A O     1 
ATOM   4403  C  CB    . ARG E 3 452 ? 136.237 -12.898 22.469  1.00 43.27  ? 748 ARG A CB    1 
ATOM   4404  C  CG    . ARG E 3 452 ? 137.429 -13.708 23.002  1.00 44.16  ? 748 ARG A CG    1 
ATOM   4405  C  CD    . ARG E 3 452 ? 138.759 -13.348 22.314  1.00 44.14  ? 748 ARG A CD    1 
ATOM   4406  N  NE    . ARG E 3 452 ? 139.167 -11.949 22.509  1.00 45.74  ? 748 ARG A NE    1 
ATOM   4407  C  CZ    . ARG E 3 452 ? 140.079 -11.531 23.389  1.00 45.93  ? 748 ARG A CZ    1 
ATOM   4408  N  NH1   . ARG E 3 452 ? 140.704 -12.397 24.182  1.00 45.33  ? 748 ARG A NH1   1 
ATOM   4409  N  NH2   . ARG E 3 452 ? 140.372 -10.237 23.475  1.00 45.55  ? 748 ARG A NH2   1 
ATOM   4410  N  N     . TYR E 3 453 ? 134.683 -15.590 23.817  1.00 42.55  ? 749 TYR A N     1 
ATOM   4411  C  CA    . TYR E 3 453 ? 134.268 -16.974 23.695  1.00 42.47  ? 749 TYR A CA    1 
ATOM   4412  C  C     . TYR E 3 453 ? 132.761 -17.025 23.484  1.00 42.43  ? 749 TYR A C     1 
ATOM   4413  O  O     . TYR E 3 453 ? 132.276 -17.798 22.663  1.00 42.50  ? 749 TYR A O     1 
ATOM   4414  C  CB    . TYR E 3 453 ? 134.631 -17.802 24.922  1.00 42.69  ? 749 TYR A CB    1 
ATOM   4415  C  CG    . TYR E 3 453 ? 133.966 -19.162 24.884  1.00 42.73  ? 749 TYR A CG    1 
ATOM   4416  C  CD1   . TYR E 3 453 ? 134.444 -20.164 24.047  1.00 42.59  ? 749 TYR A CD1   1 
ATOM   4417  C  CD2   . TYR E 3 453 ? 132.843 -19.434 25.660  1.00 42.18  ? 749 TYR A CD2   1 
ATOM   4418  C  CE1   . TYR E 3 453 ? 133.833 -21.401 23.991  1.00 42.94  ? 749 TYR A CE1   1 
ATOM   4419  C  CE2   . TYR E 3 453 ? 132.222 -20.667 25.611  1.00 42.43  ? 749 TYR A CE2   1 
ATOM   4420  C  CZ    . TYR E 3 453 ? 132.722 -21.648 24.773  1.00 43.28  ? 749 TYR A CZ    1 
ATOM   4421  O  OH    . TYR E 3 453 ? 132.112 -22.880 24.709  1.00 43.67  ? 749 TYR A OH    1 
ATOM   4422  N  N     . MET E 3 454 ? 132.037 -16.195 24.230  1.00 42.29  ? 750 MET A N     1 
ATOM   4423  C  CA    . MET E 3 454 ? 130.585 -16.089 24.124  1.00 42.44  ? 750 MET A CA    1 
ATOM   4424  C  C     . MET E 3 454 ? 130.124 -15.676 22.732  1.00 41.84  ? 750 MET A C     1 
ATOM   4425  O  O     . MET E 3 454 ? 129.247 -16.309 22.164  1.00 41.75  ? 750 MET A O     1 
ATOM   4426  C  CB    . MET E 3 454 ? 130.051 -15.091 25.147  1.00 43.03  ? 750 MET A CB    1 
ATOM   4427  C  CG    . MET E 3 454 ? 130.342 -15.436 26.600  1.00 45.07  ? 750 MET A CG    1 
ATOM   4428  S  SD    . MET E 3 454 ? 129.326 -16.764 27.280  1.00 50.77  ? 750 MET A SD    1 
ATOM   4429  C  CE    . MET E 3 454 ? 130.200 -18.268 26.846  1.00 48.54  ? 750 MET A CE    1 
ATOM   4430  N  N     . GLU E 3 455 ? 130.702 -14.601 22.200  1.00 41.52  ? 751 GLU A N     1 
ATOM   4431  C  CA    . GLU E 3 455 ? 130.399 -14.144 20.841  1.00 41.14  ? 751 GLU A CA    1 
ATOM   4432  C  C     . GLU E 3 455 ? 130.693 -15.234 19.811  1.00 40.58  ? 751 GLU A C     1 
ATOM   4433  O  O     . GLU E 3 455 ? 129.897 -15.469 18.894  1.00 40.39  ? 751 GLU A O     1 
ATOM   4434  C  CB    . GLU E 3 455 ? 131.269 -12.952 20.471  1.00 41.35  ? 751 GLU A CB    1 
ATOM   4435  C  CG    . GLU E 3 455 ? 131.107 -11.703 21.293  1.00 42.98  ? 751 GLU A CG    1 
ATOM   4436  C  CD    . GLU E 3 455 ? 132.271 -10.743 21.059  1.00 45.39  ? 751 GLU A CD    1 
ATOM   4437  O  OE1   . GLU E 3 455 ? 133.421 -11.225 20.912  1.00 45.67  ? 751 GLU A OE1   1 
ATOM   4438  O  OE2   . GLU E 3 455 ? 132.045 -9.515  21.025  1.00 46.22  ? 751 GLU A OE2   1 
ATOM   4439  N  N     . ASN E 3 456 ? 131.850 -15.884 19.978  1.00 39.75  ? 752 ASN A N     1 
ATOM   4440  C  CA    . ASN E 3 456 ? 132.353 -16.884 19.037  1.00 39.02  ? 752 ASN A CA    1 
ATOM   4441  C  C     . ASN E 3 456 ? 131.543 -18.165 18.925  1.00 38.57  ? 752 ASN A C     1 
ATOM   4442  O  O     . ASN E 3 456 ? 131.214 -18.592 17.816  1.00 38.33  ? 752 ASN A O     1 
ATOM   4443  C  CB    . ASN E 3 456 ? 133.823 -17.200 19.326  1.00 39.05  ? 752 ASN A CB    1 
ATOM   4444  C  CG    . ASN E 3 456 ? 134.755 -16.082 18.884  1.00 39.07  ? 752 ASN A CG    1 
ATOM   4445  O  OD1   . ASN E 3 456 ? 134.452 -15.344 17.951  1.00 39.70  ? 752 ASN A OD1   1 
ATOM   4446  N  ND2   . ASN E 3 456 ? 135.898 -15.957 19.550  1.00 39.68  ? 752 ASN A ND2   1 
ATOM   4447  N  N     . ILE E 3 457 ? 131.228 -18.774 20.069  1.00 38.06  ? 753 ILE A N     1 
ATOM   4448  C  CA    . ILE E 3 457 ? 130.477 -20.031 20.099  1.00 37.27  ? 753 ILE A CA    1 
ATOM   4449  C  C     . ILE E 3 457 ? 129.045 -19.865 19.592  1.00 36.96  ? 753 ILE A C     1 
ATOM   4450  O  O     . ILE E 3 457 ? 128.443 -20.816 19.108  1.00 36.90  ? 753 ILE A O     1 
ATOM   4451  C  CB    . ILE E 3 457 ? 130.502 -20.694 21.498  1.00 37.21  ? 753 ILE A CB    1 
ATOM   4452  C  CG1   . ILE E 3 457 ? 129.985 -22.140 21.426  1.00 37.07  ? 753 ILE A CG1   1 
ATOM   4453  C  CG2   . ILE E 3 457 ? 129.734 -19.853 22.515  1.00 37.19  ? 753 ILE A CG2   1 
ATOM   4454  C  CD1   . ILE E 3 457 ? 130.887 -23.113 20.657  1.00 37.07  ? 753 ILE A CD1   1 
ATOM   4455  N  N     . VAL E 3 458 ? 128.503 -18.657 19.693  1.00 36.69  ? 754 VAL A N     1 
ATOM   4456  C  CA    . VAL E 3 458 ? 127.191 -18.387 19.111  1.00 36.49  ? 754 VAL A CA    1 
ATOM   4457  C  C     . VAL E 3 458 ? 127.326 -18.291 17.589  1.00 36.73  ? 754 VAL A C     1 
ATOM   4458  O  O     . VAL E 3 458 ? 126.480 -18.796 16.851  1.00 36.71  ? 754 VAL A O     1 
ATOM   4459  C  CB    . VAL E 3 458 ? 126.541 -17.109 19.689  1.00 36.31  ? 754 VAL A CB    1 
ATOM   4460  C  CG1   . VAL E 3 458 ? 125.303 -16.732 18.898  1.00 35.26  ? 754 VAL A CG1   1 
ATOM   4461  C  CG2   . VAL E 3 458 ? 126.194 -17.315 21.155  1.00 35.77  ? 754 VAL A CG2   1 
ATOM   4462  N  N     . GLN E 3 459 ? 128.410 -17.662 17.134  1.00 36.91  ? 755 GLN A N     1 
ATOM   4463  C  CA    . GLN E 3 459 ? 128.696 -17.521 15.707  1.00 37.15  ? 755 GLN A CA    1 
ATOM   4464  C  C     . GLN E 3 459 ? 128.906 -18.893 15.088  1.00 36.78  ? 755 GLN A C     1 
ATOM   4465  O  O     . GLN E 3 459 ? 128.353 -19.211 14.032  1.00 36.76  ? 755 GLN A O     1 
ATOM   4466  C  CB    . GLN E 3 459 ? 129.955 -16.675 15.495  1.00 37.50  ? 755 GLN A CB    1 
ATOM   4467  C  CG    . GLN E 3 459 ? 130.424 -16.612 14.049  1.00 39.39  ? 755 GLN A CG    1 
ATOM   4468  C  CD    . GLN E 3 459 ? 129.825 -15.440 13.294  1.00 42.40  ? 755 GLN A CD    1 
ATOM   4469  O  OE1   . GLN E 3 459 ? 130.338 -14.321 13.367  1.00 43.85  ? 755 GLN A OE1   1 
ATOM   4470  N  NE2   . GLN E 3 459 ? 128.746 -15.691 12.549  1.00 43.31  ? 755 GLN A NE2   1 
ATOM   4471  N  N     . GLU E 3 460 ? 129.706 -19.702 15.769  1.00 36.43  ? 756 GLU A N     1 
ATOM   4472  C  CA    . GLU E 3 460 ? 130.034 -21.043 15.322  1.00 36.24  ? 756 GLU A CA    1 
ATOM   4473  C  C     . GLU E 3 460 ? 128.811 -21.969 15.291  1.00 35.40  ? 756 GLU A C     1 
ATOM   4474  O  O     . GLU E 3 460 ? 128.677 -22.812 14.403  1.00 35.23  ? 756 GLU A O     1 
ATOM   4475  C  CB    . GLU E 3 460 ? 131.116 -21.628 16.226  1.00 36.52  ? 756 GLU A CB    1 
ATOM   4476  C  CG    . GLU E 3 460 ? 131.509 -23.034 15.861  1.00 38.95  ? 756 GLU A CG    1 
ATOM   4477  C  CD    . GLU E 3 460 ? 132.281 -23.719 16.957  1.00 42.43  ? 756 GLU A CD    1 
ATOM   4478  O  OE1   . GLU E 3 460 ? 132.036 -24.930 17.172  1.00 43.89  ? 756 GLU A OE1   1 
ATOM   4479  O  OE2   . GLU E 3 460 ? 133.116 -23.048 17.608  1.00 43.61  ? 756 GLU A OE2   1 
ATOM   4480  N  N     . ALA E 3 461 ? 127.921 -21.808 16.263  1.00 34.66  ? 757 ALA A N     1 
ATOM   4481  C  CA    . ALA E 3 461 ? 126.719 -22.628 16.339  1.00 33.98  ? 757 ALA A CA    1 
ATOM   4482  C  C     . ALA E 3 461 ? 125.760 -22.280 15.212  1.00 33.52  ? 757 ALA A C     1 
ATOM   4483  O  O     . ALA E 3 461 ? 125.043 -23.140 14.709  1.00 33.20  ? 757 ALA A O     1 
ATOM   4484  C  CB    . ALA E 3 461 ? 126.042 -22.449 17.688  1.00 34.03  ? 757 ALA A CB    1 
ATOM   4485  N  N     . LYS E 3 462 ? 125.747 -21.006 14.834  1.00 33.21  ? 758 LYS A N     1 
ATOM   4486  C  CA    . LYS E 3 462 ? 124.911 -20.533 13.745  1.00 32.88  ? 758 LYS A CA    1 
ATOM   4487  C  C     . LYS E 3 462 ? 125.430 -21.111 12.446  1.00 32.43  ? 758 LYS A C     1 
ATOM   4488  O  O     . LYS E 3 462 ? 124.658 -21.572 11.617  1.00 32.41  ? 758 LYS A O     1 
ATOM   4489  C  CB    . LYS E 3 462 ? 124.926 -19.006 13.663  1.00 32.83  ? 758 LYS A CB    1 
ATOM   4490  C  CG    . LYS E 3 462 ? 124.194 -18.288 14.785  1.00 33.42  ? 758 LYS A CG    1 
ATOM   4491  C  CD    . LYS E 3 462 ? 124.161 -16.763 14.551  1.00 33.31  ? 758 LYS A CD    1 
ATOM   4492  C  CE    . LYS E 3 462 ? 123.726 -16.008 15.811  1.00 33.66  ? 758 LYS A CE    1 
ATOM   4493  N  NZ    . LYS E 3 462 ? 122.397 -16.460 16.349  1.00 33.56  ? 758 LYS A NZ    1 
ATOM   4494  N  N     . GLN E 3 463 ? 126.749 -21.101 12.285  1.00 32.05  ? 759 GLN A N     1 
ATOM   4495  C  CA    . GLN E 3 463 ? 127.383 -21.620 11.074  1.00 31.73  ? 759 GLN A CA    1 
ATOM   4496  C  C     . GLN E 3 463 ? 127.356 -23.152 11.000  1.00 31.15  ? 759 GLN A C     1 
ATOM   4497  O  O     . GLN E 3 463 ? 126.989 -23.706 9.967   1.00 31.09  ? 759 GLN A O     1 
ATOM   4498  C  CB    . GLN E 3 463 ? 128.813 -21.068 10.926  1.00 31.65  ? 759 GLN A CB    1 
ATOM   4499  C  CG    . GLN E 3 463 ? 128.873 -19.535 10.707  1.00 32.17  ? 759 GLN A CG    1 
ATOM   4500  C  CD    . GLN E 3 463 ? 130.235 -18.922 11.058  1.00 32.58  ? 759 GLN A CD    1 
ATOM   4501  O  OE1   . GLN E 3 463 ? 130.458 -17.722 10.872  1.00 33.76  ? 759 GLN A OE1   1 
ATOM   4502  N  NE2   . GLN E 3 463 ? 131.144 -19.744 11.575  1.00 32.65  ? 759 GLN A NE2   1 
ATOM   4503  N  N     . LYS E 3 464 ? 127.699 -23.839 12.088  1.00 30.44  ? 760 LYS A N     1 
ATOM   4504  C  CA    . LYS E 3 464 ? 127.760 -25.305 12.044  1.00 29.95  ? 760 LYS A CA    1 
ATOM   4505  C  C     . LYS E 3 464 ? 126.446 -26.038 12.282  1.00 29.23  ? 760 LYS A C     1 
ATOM   4506  O  O     . LYS E 3 464 ? 126.249 -27.126 11.752  1.00 29.40  ? 760 LYS A O     1 
ATOM   4507  C  CB    . LYS E 3 464 ? 128.820 -25.846 12.999  1.00 30.39  ? 760 LYS A CB    1 
ATOM   4508  C  CG    . LYS E 3 464 ? 130.243 -25.495 12.610  1.00 30.94  ? 760 LYS A CG    1 
ATOM   4509  C  CD    . LYS E 3 464 ? 131.230 -26.208 13.498  1.00 31.61  ? 760 LYS A CD    1 
ATOM   4510  C  CE    . LYS E 3 464 ? 132.606 -25.661 13.247  1.00 33.31  ? 760 LYS A CE    1 
ATOM   4511  N  NZ    . LYS E 3 464 ? 133.649 -26.561 13.782  1.00 34.97  ? 760 LYS A NZ    1 
ATOM   4512  N  N     . GLY E 3 465 ? 125.560 -25.455 13.080  1.00 28.16  ? 761 GLY A N     1 
ATOM   4513  C  CA    . GLY E 3 465 ? 124.290 -26.094 13.399  1.00 27.16  ? 761 GLY A CA    1 
ATOM   4514  C  C     . GLY E 3 465 ? 124.331 -26.851 14.719  1.00 26.40  ? 761 GLY A C     1 
ATOM   4515  O  O     . GLY E 3 465 ? 123.334 -27.433 15.157  1.00 26.22  ? 761 GLY A O     1 
ATOM   4516  N  N     . TYR E 3 466 ? 125.491 -26.829 15.363  1.00 25.70  ? 762 TYR A N     1 
ATOM   4517  C  CA    . TYR E 3 466 ? 125.680 -27.552 16.598  1.00 24.85  ? 762 TYR A CA    1 
ATOM   4518  C  C     . TYR E 3 466 ? 126.924 -27.098 17.342  1.00 24.67  ? 762 TYR A C     1 
ATOM   4519  O  O     . TYR E 3 466 ? 127.777 -26.410 16.786  1.00 24.77  ? 762 TYR A O     1 
ATOM   4520  C  CB    . TYR E 3 466 ? 125.789 -29.046 16.299  1.00 24.58  ? 762 TYR A CB    1 
ATOM   4521  C  CG    . TYR E 3 466 ? 127.029 -29.443 15.539  1.00 24.07  ? 762 TYR A CG    1 
ATOM   4522  C  CD1   . TYR E 3 466 ? 128.227 -29.672 16.202  1.00 24.34  ? 762 TYR A CD1   1 
ATOM   4523  C  CD2   . TYR E 3 466 ? 127.006 -29.604 14.158  1.00 23.82  ? 762 TYR A CD2   1 
ATOM   4524  C  CE1   . TYR E 3 466 ? 129.369 -30.055 15.510  1.00 24.80  ? 762 TYR A CE1   1 
ATOM   4525  C  CE2   . TYR E 3 466 ? 128.145 -29.980 13.456  1.00 23.56  ? 762 TYR A CE2   1 
ATOM   4526  C  CZ    . TYR E 3 466 ? 129.321 -30.203 14.141  1.00 24.20  ? 762 TYR A CZ    1 
ATOM   4527  O  OH    . TYR E 3 466 ? 130.461 -30.569 13.474  1.00 24.03  ? 762 TYR A OH    1 
ATOM   4528  N  N     . VAL E 3 467 ? 127.016 -27.492 18.608  1.00 24.52  ? 763 VAL A N     1 
ATOM   4529  C  CA    . VAL E 3 467 ? 128.215 -27.275 19.410  1.00 24.23  ? 763 VAL A CA    1 
ATOM   4530  C  C     . VAL E 3 467 ? 128.782 -28.625 19.881  1.00 24.37  ? 763 VAL A C     1 
ATOM   4531  O  O     . VAL E 3 467 ? 128.136 -29.672 19.732  1.00 24.03  ? 763 VAL A O     1 
ATOM   4532  C  CB    . VAL E 3 467 ? 127.953 -26.376 20.611  1.00 24.13  ? 763 VAL A CB    1 
ATOM   4533  C  CG1   . VAL E 3 467 ? 127.622 -24.969 20.153  1.00 24.00  ? 763 VAL A CG1   1 
ATOM   4534  C  CG2   . VAL E 3 467 ? 126.840 -26.954 21.465  1.00 23.75  ? 763 VAL A CG2   1 
ATOM   4535  N  N     . THR E 3 468 ? 129.996 -28.594 20.428  1.00 24.41  ? 764 THR A N     1 
ATOM   4536  C  CA    . THR E 3 468 ? 130.666 -29.809 20.877  1.00 24.60  ? 764 THR A CA    1 
ATOM   4537  C  C     . THR E 3 468 ? 131.394 -29.582 22.191  1.00 24.74  ? 764 THR A C     1 
ATOM   4538  O  O     . THR E 3 468 ? 131.769 -28.461 22.526  1.00 24.06  ? 764 THR A O     1 
ATOM   4539  C  CB    . THR E 3 468 ? 131.706 -30.320 19.848  1.00 24.82  ? 764 THR A CB    1 
ATOM   4540  O  OG1   . THR E 3 468 ? 132.679 -29.299 19.605  1.00 24.71  ? 764 THR A OG1   1 
ATOM   4541  C  CG2   . THR E 3 468 ? 131.047 -30.723 18.516  1.00 24.42  ? 764 THR A CG2   1 
ATOM   4542  N  N     . THR E 3 469 ? 131.594 -30.669 22.928  1.00 25.12  ? 765 THR A N     1 
ATOM   4543  C  CA    . THR E 3 469 ? 132.305 -30.627 24.201  1.00 25.14  ? 765 THR A CA    1 
ATOM   4544  C  C     . THR E 3 469 ? 133.718 -31.149 23.978  1.00 25.69  ? 765 THR A C     1 
ATOM   4545  O  O     . THR E 3 469 ? 134.058 -31.570 22.863  1.00 25.71  ? 765 THR A O     1 
ATOM   4546  C  CB    . THR E 3 469 ? 131.595 -31.488 25.263  1.00 25.01  ? 765 THR A CB    1 
ATOM   4547  O  OG1   . THR E 3 469 ? 131.747 -32.879 24.951  1.00 23.28  ? 765 THR A OG1   1 
ATOM   4548  C  CG2   . THR E 3 469 ? 130.123 -31.146 25.302  1.00 24.94  ? 765 THR A CG2   1 
ATOM   4549  N  N     . LEU E 3 470 ? 134.535 -31.127 25.029  1.00 26.03  ? 766 LEU A N     1 
ATOM   4550  C  CA    . LEU E 3 470 ? 135.903 -31.633 24.948  1.00 26.41  ? 766 LEU A CA    1 
ATOM   4551  C  C     . LEU E 3 470 ? 136.044 -33.022 24.320  1.00 26.65  ? 766 LEU A C     1 
ATOM   4552  O  O     . LEU E 3 470 ? 136.834 -33.204 23.396  1.00 26.65  ? 766 LEU A O     1 
ATOM   4553  C  CB    . LEU E 3 470 ? 136.580 -31.593 26.319  1.00 26.50  ? 766 LEU A CB    1 
ATOM   4554  C  CG    . LEU E 3 470 ? 137.487 -30.378 26.528  1.00 27.22  ? 766 LEU A CG    1 
ATOM   4555  C  CD1   . LEU E 3 470 ? 137.690 -30.043 28.006  1.00 28.04  ? 766 LEU A CD1   1 
ATOM   4556  C  CD2   . LEU E 3 470 ? 138.825 -30.614 25.829  1.00 27.84  ? 766 LEU A CD2   1 
ATOM   4557  N  N     . LEU E 3 471 ? 135.281 -34.000 24.798  1.00 27.17  ? 767 LEU A N     1 
ATOM   4558  C  CA    . LEU E 3 471 ? 135.421 -35.362 24.269  1.00 27.43  ? 767 LEU A CA    1 
ATOM   4559  C  C     . LEU E 3 471 ? 134.532 -35.598 23.045  1.00 27.77  ? 767 LEU A C     1 
ATOM   4560  O  O     . LEU E 3 471 ? 134.173 -36.737 22.738  1.00 27.66  ? 767 LEU A O     1 
ATOM   4561  C  CB    . LEU E 3 471 ? 135.216 -36.430 25.353  1.00 27.18  ? 767 LEU A CB    1 
ATOM   4562  C  CG    . LEU E 3 471 ? 135.989 -36.281 26.680  1.00 27.72  ? 767 LEU A CG    1 
ATOM   4563  C  CD1   . LEU E 3 471 ? 136.067 -37.620 27.430  1.00 27.03  ? 767 LEU A CD1   1 
ATOM   4564  C  CD2   . LEU E 3 471 ? 137.395 -35.695 26.516  1.00 27.59  ? 767 LEU A CD2   1 
ATOM   4565  N  N     . HIS E 3 472 ? 134.193 -34.505 22.356  1.00 28.03  ? 768 HIS A N     1 
ATOM   4566  C  CA    . HIS E 3 472 ? 133.442 -34.547 21.096  1.00 28.36  ? 768 HIS A CA    1 
ATOM   4567  C  C     . HIS E 3 472 ? 131.959 -34.891 21.271  1.00 28.13  ? 768 HIS A C     1 
ATOM   4568  O  O     . HIS E 3 472 ? 131.311 -35.369 20.336  1.00 27.97  ? 768 HIS A O     1 
ATOM   4569  C  CB    . HIS E 3 472 ? 134.094 -35.515 20.095  1.00 28.47  ? 768 HIS A CB    1 
ATOM   4570  C  CG    . HIS E 3 472 ? 135.470 -35.111 19.654  1.00 29.94  ? 768 HIS A CG    1 
ATOM   4571  N  ND1   . HIS E 3 472 ? 136.398 -34.546 20.507  1.00 30.82  ? 768 HIS A ND1   1 
ATOM   4572  C  CD2   . HIS E 3 472 ? 136.095 -35.247 18.459  1.00 30.05  ? 768 HIS A CD2   1 
ATOM   4573  C  CE1   . HIS E 3 472 ? 137.521 -34.323 19.848  1.00 30.23  ? 768 HIS A CE1   1 
ATOM   4574  N  NE2   . HIS E 3 472 ? 137.364 -34.742 18.605  1.00 29.68  ? 768 HIS A NE2   1 
ATOM   4575  N  N     . ARG E 3 473 ? 131.417 -34.671 22.464  1.00 27.86  ? 769 ARG A N     1 
ATOM   4576  C  CA    . ARG E 3 473 ? 129.988 -34.854 22.629  1.00 27.45  ? 769 ARG A CA    1 
ATOM   4577  C  C     . ARG E 3 473 ? 129.362 -33.678 21.903  1.00 27.53  ? 769 ARG A C     1 
ATOM   4578  O  O     . ARG E 3 473 ? 129.947 -32.590 21.824  1.00 27.54  ? 769 ARG A O     1 
ATOM   4579  C  CB    . ARG E 3 473 ? 129.568 -34.892 24.092  1.00 27.21  ? 769 ARG A CB    1 
ATOM   4580  C  CG    . ARG E 3 473 ? 128.125 -35.305 24.304  1.00 26.35  ? 769 ARG A CG    1 
ATOM   4581  C  CD    . ARG E 3 473 ? 127.737 -35.162 25.753  1.00 27.00  ? 769 ARG A CD    1 
ATOM   4582  N  NE    . ARG E 3 473 ? 128.722 -35.808 26.614  1.00 26.80  ? 769 ARG A NE    1 
ATOM   4583  C  CZ    . ARG E 3 473 ? 128.666 -37.081 26.977  1.00 25.98  ? 769 ARG A CZ    1 
ATOM   4584  N  NH1   . ARG E 3 473 ? 127.657 -37.839 26.574  1.00 26.38  ? 769 ARG A NH1   1 
ATOM   4585  N  NH2   . ARG E 3 473 ? 129.611 -37.590 27.747  1.00 26.38  ? 769 ARG A NH2   1 
ATOM   4586  N  N     . ARG E 3 474 ? 128.166 -33.892 21.383  1.00 27.45  ? 770 ARG A N     1 
ATOM   4587  C  CA    . ARG E 3 474 ? 127.577 -32.946 20.481  1.00 27.39  ? 770 ARG A CA    1 
ATOM   4588  C  C     . ARG E 3 474 ? 126.117 -32.668 20.818  1.00 27.36  ? 770 ARG A C     1 
ATOM   4589  O  O     . ARG E 3 474 ? 125.390 -33.555 21.277  1.00 27.66  ? 770 ARG A O     1 
ATOM   4590  C  CB    . ARG E 3 474 ? 127.698 -33.557 19.093  1.00 27.48  ? 770 ARG A CB    1 
ATOM   4591  C  CG    . ARG E 3 474 ? 127.397 -32.642 17.958  1.00 28.75  ? 770 ARG A CG    1 
ATOM   4592  C  CD    . ARG E 3 474 ? 127.487 -33.382 16.623  1.00 29.44  ? 770 ARG A CD    1 
ATOM   4593  N  NE    . ARG E 3 474 ? 128.848 -33.764 16.265  1.00 28.26  ? 770 ARG A NE    1 
ATOM   4594  C  CZ    . ARG E 3 474 ? 129.263 -33.903 15.009  1.00 28.60  ? 770 ARG A CZ    1 
ATOM   4595  N  NH1   . ARG E 3 474 ? 128.430 -33.668 14.004  1.00 27.18  ? 770 ARG A NH1   1 
ATOM   4596  N  NH2   . ARG E 3 474 ? 130.515 -34.256 14.754  1.00 28.67  ? 770 ARG A NH2   1 
ATOM   4597  N  N     . ARG E 3 475 ? 125.698 -31.425 20.610  1.00 27.29  ? 771 ARG A N     1 
ATOM   4598  C  CA    . ARG E 3 475 ? 124.300 -31.037 20.758  1.00 26.90  ? 771 ARG A CA    1 
ATOM   4599  C  C     . ARG E 3 475 ? 123.948 -30.181 19.549  1.00 26.92  ? 771 ARG A C     1 
ATOM   4600  O  O     . ARG E 3 475 ? 124.681 -29.263 19.216  1.00 26.53  ? 771 ARG A O     1 
ATOM   4601  C  CB    . ARG E 3 475 ? 124.075 -30.259 22.059  1.00 27.16  ? 771 ARG A CB    1 
ATOM   4602  C  CG    . ARG E 3 475 ? 122.609 -29.890 22.350  1.00 26.99  ? 771 ARG A CG    1 
ATOM   4603  C  CD    . ARG E 3 475 ? 122.439 -29.155 23.666  1.00 26.22  ? 771 ARG A CD    1 
ATOM   4604  N  NE    . ARG E 3 475 ? 121.040 -28.810 23.896  1.00 26.65  ? 771 ARG A NE    1 
ATOM   4605  C  CZ    . ARG E 3 475 ? 120.567 -28.242 25.011  1.00 27.18  ? 771 ARG A CZ    1 
ATOM   4606  N  NH1   . ARG E 3 475 ? 121.385 -27.950 26.021  1.00 28.25  ? 771 ARG A NH1   1 
ATOM   4607  N  NH2   . ARG E 3 475 ? 119.271 -27.967 25.122  1.00 24.70  ? 771 ARG A NH2   1 
ATOM   4608  N  N     . TYR E 3 476 ? 122.838 -30.503 18.890  1.00 27.13  ? 772 TYR A N     1 
ATOM   4609  C  CA    . TYR E 3 476 ? 122.374 -29.765 17.713  1.00 27.47  ? 772 TYR A CA    1 
ATOM   4610  C  C     . TYR E 3 476 ? 121.410 -28.655 18.111  1.00 27.81  ? 772 TYR A C     1 
ATOM   4611  O  O     . TYR E 3 476 ? 120.528 -28.856 18.926  1.00 27.97  ? 772 TYR A O     1 
ATOM   4612  C  CB    . TYR E 3 476 ? 121.704 -30.718 16.715  1.00 27.21  ? 772 TYR A CB    1 
ATOM   4613  C  CG    . TYR E 3 476 ? 122.673 -31.642 16.016  1.00 26.83  ? 772 TYR A CG    1 
ATOM   4614  C  CD1   . TYR E 3 476 ? 123.067 -32.835 16.599  1.00 26.59  ? 772 TYR A CD1   1 
ATOM   4615  C  CD2   . TYR E 3 476 ? 123.203 -31.313 14.773  1.00 26.79  ? 772 TYR A CD2   1 
ATOM   4616  C  CE1   . TYR E 3 476 ? 123.956 -33.677 15.964  1.00 26.76  ? 772 TYR A CE1   1 
ATOM   4617  C  CE2   . TYR E 3 476 ? 124.095 -32.147 14.131  1.00 26.17  ? 772 TYR A CE2   1 
ATOM   4618  C  CZ    . TYR E 3 476 ? 124.464 -33.325 14.731  1.00 26.86  ? 772 TYR A CZ    1 
ATOM   4619  O  OH    . TYR E 3 476 ? 125.345 -34.161 14.102  1.00 26.66  ? 772 TYR A OH    1 
ATOM   4620  N  N     . LEU E 3 477 ? 121.579 -27.474 17.540  1.00 28.53  ? 773 LEU A N     1 
ATOM   4621  C  CA    . LEU E 3 477 ? 120.719 -26.349 17.884  1.00 29.15  ? 773 LEU A CA    1 
ATOM   4622  C  C     . LEU E 3 477 ? 120.063 -25.819 16.630  1.00 29.76  ? 773 LEU A C     1 
ATOM   4623  O  O     . LEU E 3 477 ? 120.482 -24.808 16.095  1.00 29.68  ? 773 LEU A O     1 
ATOM   4624  C  CB    . LEU E 3 477 ? 121.523 -25.238 18.554  1.00 28.74  ? 773 LEU A CB    1 
ATOM   4625  C  CG    . LEU E 3 477 ? 122.277 -25.587 19.835  1.00 29.28  ? 773 LEU A CG    1 
ATOM   4626  C  CD1   . LEU E 3 477 ? 123.170 -24.426 20.241  1.00 29.56  ? 773 LEU A CD1   1 
ATOM   4627  C  CD2   . LEU E 3 477 ? 121.332 -25.974 20.975  1.00 28.04  ? 773 LEU A CD2   1 
ATOM   4628  N  N     . PRO E 3 478 ? 119.030 -26.513 16.146  1.00 30.77  ? 774 PRO A N     1 
ATOM   4629  C  CA    . PRO E 3 478 ? 118.374 -26.094 14.911  1.00 31.30  ? 774 PRO A CA    1 
ATOM   4630  C  C     . PRO E 3 478 ? 117.663 -24.740 14.994  1.00 32.02  ? 774 PRO A C     1 
ATOM   4631  O  O     . PRO E 3 478 ? 117.474 -24.092 13.969  1.00 32.75  ? 774 PRO A O     1 
ATOM   4632  C  CB    . PRO E 3 478 ? 117.375 -27.225 14.643  1.00 31.31  ? 774 PRO A CB    1 
ATOM   4633  C  CG    . PRO E 3 478 ? 117.135 -27.855 15.981  1.00 31.21  ? 774 PRO A CG    1 
ATOM   4634  C  CD    . PRO E 3 478 ? 118.435 -27.741 16.710  1.00 30.74  ? 774 PRO A CD    1 
ATOM   4635  N  N     . ASP E 3 479 ? 117.280 -24.307 16.190  1.00 32.56  ? 775 ASP A N     1 
ATOM   4636  C  CA    . ASP E 3 479 ? 116.596 -23.016 16.353  1.00 32.91  ? 775 ASP A CA    1 
ATOM   4637  C  C     . ASP E 3 479 ? 117.539 -21.830 16.451  1.00 32.85  ? 775 ASP A C     1 
ATOM   4638  O  O     . ASP E 3 479 ? 117.091 -20.722 16.736  1.00 33.11  ? 775 ASP A O     1 
ATOM   4639  C  CB    . ASP E 3 479 ? 115.772 -23.014 17.636  1.00 32.95  ? 775 ASP A CB    1 
ATOM   4640  C  CG    . ASP E 3 479 ? 114.708 -24.076 17.647  1.00 34.64  ? 775 ASP A CG    1 
ATOM   4641  O  OD1   . ASP E 3 479 ? 114.190 -24.368 18.753  1.00 35.50  ? 775 ASP A OD1   1 
ATOM   4642  O  OD2   . ASP E 3 479 ? 114.389 -24.617 16.559  1.00 35.85  ? 775 ASP A OD2   1 
ATOM   4643  N  N     . ILE E 3 480 ? 118.831 -22.048 16.234  1.00 32.69  ? 776 ILE A N     1 
ATOM   4644  C  CA    . ILE E 3 480 ? 119.828 -21.003 16.482  1.00 32.66  ? 776 ILE A CA    1 
ATOM   4645  C  C     . ILE E 3 480 ? 119.714 -19.756 15.604  1.00 32.85  ? 776 ILE A C     1 
ATOM   4646  O  O     . ILE E 3 480 ? 120.141 -18.679 16.015  1.00 32.87  ? 776 ILE A O     1 
ATOM   4647  C  CB    . ILE E 3 480 ? 121.257 -21.559 16.404  1.00 32.54  ? 776 ILE A CB    1 
ATOM   4648  C  CG1   . ILE E 3 480 ? 122.260 -20.543 16.967  1.00 32.73  ? 776 ILE A CG1   1 
ATOM   4649  C  CG2   . ILE E 3 480 ? 121.592 -21.974 14.966  1.00 32.44  ? 776 ILE A CG2   1 
ATOM   4650  C  CD1   . ILE E 3 480 ? 121.976 -20.115 18.385  1.00 32.58  ? 776 ILE A CD1   1 
ATOM   4651  N  N     . THR E 3 481 ? 119.161 -19.902 14.399  1.00 33.16  ? 777 THR A N     1 
ATOM   4652  C  CA    . THR E 3 481 ? 118.974 -18.763 13.500  1.00 33.21  ? 777 THR A CA    1 
ATOM   4653  C  C     . THR E 3 481 ? 117.505 -18.486 13.291  1.00 33.29  ? 777 THR A C     1 
ATOM   4654  O  O     . THR E 3 481 ? 117.076 -18.248 12.168  1.00 33.59  ? 777 THR A O     1 
ATOM   4655  C  CB    . THR E 3 481 ? 119.636 -18.961 12.113  1.00 33.33  ? 777 THR A CB    1 
ATOM   4656  O  OG1   . THR E 3 481 ? 119.364 -20.285 11.625  1.00 33.34  ? 777 THR A OG1   1 
ATOM   4657  C  CG2   . THR E 3 481 ? 121.151 -18.722 12.178  1.00 33.06  ? 777 THR A CG2   1 
ATOM   4658  N  N     . SER E 3 482 ? 116.735 -18.538 14.371  1.00 33.41  ? 778 SER A N     1 
ATOM   4659  C  CA    . SER E 3 482 ? 115.313 -18.223 14.322  1.00 33.58  ? 778 SER A CA    1 
ATOM   4660  C  C     . SER E 3 482 ? 115.176 -16.705 14.318  1.00 33.99  ? 778 SER A C     1 
ATOM   4661  O  O     . SER E 3 482 ? 115.989 -16.013 14.928  1.00 34.05  ? 778 SER A O     1 
ATOM   4662  C  CB    . SER E 3 482 ? 114.592 -18.827 15.529  1.00 33.33  ? 778 SER A CB    1 
ATOM   4663  O  OG    . SER E 3 482 ? 113.227 -18.461 15.553  1.00 32.47  ? 778 SER A OG    1 
ATOM   4664  N  N     . ARG E 3 483 ? 114.163 -16.183 13.631  1.00 34.46  ? 779 ARG A N     1 
ATOM   4665  C  CA    . ARG E 3 483 ? 113.972 -14.735 13.572  1.00 35.11  ? 779 ARG A CA    1 
ATOM   4666  C  C     . ARG E 3 483 ? 113.423 -14.194 14.892  1.00 35.45  ? 779 ARG A C     1 
ATOM   4667  O  O     . ARG E 3 483 ? 113.733 -13.069 15.296  1.00 35.52  ? 779 ARG A O     1 
ATOM   4668  C  CB    . ARG E 3 483 ? 113.075 -14.340 12.399  1.00 35.09  ? 779 ARG A CB    1 
ATOM   4669  C  CG    . ARG E 3 483 ? 111.610 -14.627 12.586  1.00 35.02  ? 779 ARG A CG    1 
ATOM   4670  C  CD    . ARG E 3 483 ? 110.834 -14.051 11.424  1.00 36.47  ? 779 ARG A CD    1 
ATOM   4671  N  NE    . ARG E 3 483 ? 109.409 -13.944 11.714  1.00 37.18  ? 779 ARG A NE    1 
ATOM   4672  C  CZ    . ARG E 3 483 ? 108.476 -13.646 10.813  1.00 37.60  ? 779 ARG A CZ    1 
ATOM   4673  N  NH1   . ARG E 3 483 ? 108.816 -13.432 9.546   1.00 37.14  ? 779 ARG A NH1   1 
ATOM   4674  N  NH2   . ARG E 3 483 ? 107.198 -13.571 11.183  1.00 37.05  ? 779 ARG A NH2   1 
ATOM   4675  N  N     . ASN E 3 484 ? 112.619 -15.023 15.554  1.00 35.78  ? 780 ASN A N     1 
ATOM   4676  C  CA    . ASN E 3 484 ? 112.039 -14.726 16.855  1.00 36.19  ? 780 ASN A CA    1 
ATOM   4677  C  C     . ASN E 3 484 ? 113.129 -14.555 17.909  1.00 36.26  ? 780 ASN A C     1 
ATOM   4678  O  O     . ASN E 3 484 ? 113.985 -15.424 18.072  1.00 36.33  ? 780 ASN A O     1 
ATOM   4679  C  CB    . ASN E 3 484 ? 111.090 -15.865 17.246  1.00 36.37  ? 780 ASN A CB    1 
ATOM   4680  C  CG    . ASN E 3 484 ? 110.465 -15.678 18.621  1.00 37.14  ? 780 ASN A CG    1 
ATOM   4681  O  OD1   . ASN E 3 484 ? 111.085 -15.149 19.549  1.00 38.63  ? 780 ASN A OD1   1 
ATOM   4682  N  ND2   . ASN E 3 484 ? 109.233 -16.146 18.764  1.00 37.56  ? 780 ASN A ND2   1 
ATOM   4683  N  N     . PHE E 3 485 ? 113.079 -13.437 18.626  1.00 36.45  ? 781 PHE A N     1 
ATOM   4684  C  CA    . PHE E 3 485 ? 114.086 -13.103 19.630  1.00 36.72  ? 781 PHE A CA    1 
ATOM   4685  C  C     . PHE E 3 485 ? 114.176 -14.139 20.755  1.00 36.78  ? 781 PHE A C     1 
ATOM   4686  O  O     . PHE E 3 485 ? 115.270 -14.552 21.150  1.00 36.64  ? 781 PHE A O     1 
ATOM   4687  C  CB    . PHE E 3 485 ? 113.825 -11.694 20.194  1.00 36.87  ? 781 PHE A CB    1 
ATOM   4688  C  CG    . PHE E 3 485 ? 114.691 -11.334 21.384  1.00 37.68  ? 781 PHE A CG    1 
ATOM   4689  C  CD1   . PHE E 3 485 ? 116.057 -11.104 21.229  1.00 37.59  ? 781 PHE A CD1   1 
ATOM   4690  C  CD2   . PHE E 3 485 ? 114.132 -11.211 22.661  1.00 38.10  ? 781 PHE A CD2   1 
ATOM   4691  C  CE1   . PHE E 3 485 ? 116.858 -10.772 22.325  1.00 37.97  ? 781 PHE A CE1   1 
ATOM   4692  C  CE2   . PHE E 3 485 ? 114.923 -10.883 23.758  1.00 38.41  ? 781 PHE A CE2   1 
ATOM   4693  C  CZ    . PHE E 3 485 ? 116.292 -10.662 23.588  1.00 38.05  ? 781 PHE A CZ    1 
ATOM   4694  N  N     . ASN E 3 486 ? 113.023 -14.559 21.255  1.00 36.63  ? 782 ASN A N     1 
ATOM   4695  C  CA    . ASN E 3 486 ? 112.967 -15.484 22.365  1.00 36.89  ? 782 ASN A CA    1 
ATOM   4696  C  C     . ASN E 3 486 ? 113.488 -16.864 21.984  1.00 36.76  ? 782 ASN A C     1 
ATOM   4697  O  O     . ASN E 3 486 ? 114.340 -17.429 22.681  1.00 37.04  ? 782 ASN A O     1 
ATOM   4698  C  CB    . ASN E 3 486 ? 111.542 -15.546 22.908  1.00 37.18  ? 782 ASN A CB    1 
ATOM   4699  C  CG    . ASN E 3 486 ? 111.056 -14.185 23.410  1.00 38.51  ? 782 ASN A CG    1 
ATOM   4700  O  OD1   . ASN E 3 486 ? 111.767 -13.496 24.154  1.00 39.51  ? 782 ASN A OD1   1 
ATOM   4701  N  ND2   . ASN E 3 486 ? 109.844 -13.790 23.002  1.00 38.72  ? 782 ASN A ND2   1 
ATOM   4702  N  N     . VAL E 3 487 ? 112.999 -17.388 20.863  1.00 36.05  ? 783 VAL A N     1 
ATOM   4703  C  CA    . VAL E 3 487 ? 113.455 -18.678 20.373  1.00 35.18  ? 783 VAL A CA    1 
ATOM   4704  C  C     . VAL E 3 487 ? 114.958 -18.625 20.068  1.00 35.06  ? 783 VAL A C     1 
ATOM   4705  O  O     . VAL E 3 487 ? 115.688 -19.529 20.466  1.00 35.11  ? 783 VAL A O     1 
ATOM   4706  C  CB    . VAL E 3 487 ? 112.605 -19.184 19.164  1.00 35.19  ? 783 VAL A CB    1 
ATOM   4707  C  CG1   . VAL E 3 487 ? 113.055 -20.574 18.702  1.00 34.27  ? 783 VAL A CG1   1 
ATOM   4708  C  CG2   . VAL E 3 487 ? 111.129 -19.222 19.539  1.00 34.76  ? 783 VAL A CG2   1 
ATOM   4709  N  N     . ARG E 3 488 ? 115.420 -17.562 19.405  1.00 34.82  ? 784 ARG A N     1 
ATOM   4710  C  CA    . ARG E 3 488 ? 116.849 -17.416 19.076  1.00 34.93  ? 784 ARG A CA    1 
ATOM   4711  C  C     . ARG E 3 488 ? 117.724 -17.333 20.335  1.00 34.84  ? 784 ARG A C     1 
ATOM   4712  O  O     . ARG E 3 488 ? 118.776 -17.978 20.405  1.00 34.66  ? 784 ARG A O     1 
ATOM   4713  C  CB    . ARG E 3 488 ? 117.104 -16.181 18.190  1.00 35.03  ? 784 ARG A CB    1 
ATOM   4714  C  CG    . ARG E 3 488 ? 118.563 -16.017 17.719  1.00 34.87  ? 784 ARG A CG    1 
ATOM   4715  C  CD    . ARG E 3 488 ? 118.954 -14.558 17.381  1.00 35.23  ? 784 ARG A CD    1 
ATOM   4716  N  NE    . ARG E 3 488 ? 118.125 -13.977 16.331  1.00 36.85  ? 784 ARG A NE    1 
ATOM   4717  C  CZ    . ARG E 3 488 ? 117.263 -12.975 16.502  1.00 37.60  ? 784 ARG A CZ    1 
ATOM   4718  N  NH1   . ARG E 3 488 ? 117.130 -12.383 17.683  1.00 37.41  ? 784 ARG A NH1   1 
ATOM   4719  N  NH2   . ARG E 3 488 ? 116.541 -12.544 15.474  1.00 38.06  ? 784 ARG A NH2   1 
ATOM   4720  N  N     . SER E 3 489 ? 117.280 -16.542 21.316  1.00 34.65  ? 785 SER A N     1 
ATOM   4721  C  CA    . SER E 3 489 ? 118.014 -16.343 22.569  1.00 34.53  ? 785 SER A CA    1 
ATOM   4722  C  C     . SER E 3 489 ? 118.159 -17.627 23.360  1.00 34.28  ? 785 SER A C     1 
ATOM   4723  O  O     . SER E 3 489 ? 119.215 -17.875 23.929  1.00 34.41  ? 785 SER A O     1 
ATOM   4724  C  CB    . SER E 3 489 ? 117.326 -15.310 23.468  1.00 34.81  ? 785 SER A CB    1 
ATOM   4725  O  OG    . SER E 3 489 ? 117.256 -14.029 22.869  1.00 35.63  ? 785 SER A OG    1 
ATOM   4726  N  N     . PHE E 3 490 ? 117.098 -18.428 23.425  1.00 34.02  ? 786 PHE A N     1 
ATOM   4727  C  CA    . PHE E 3 490 ? 117.175 -19.682 24.168  1.00 33.78  ? 786 PHE A CA    1 
ATOM   4728  C  C     . PHE E 3 490 ? 118.255 -20.599 23.619  1.00 33.11  ? 786 PHE A C     1 
ATOM   4729  O  O     . PHE E 3 490 ? 119.058 -21.117 24.388  1.00 33.30  ? 786 PHE A O     1 
ATOM   4730  C  CB    . PHE E 3 490 ? 115.821 -20.394 24.262  1.00 34.42  ? 786 PHE A CB    1 
ATOM   4731  C  CG    . PHE E 3 490 ? 114.963 -19.901 25.392  1.00 35.92  ? 786 PHE A CG    1 
ATOM   4732  C  CD1   . PHE E 3 490 ? 115.304 -20.190 26.716  1.00 37.39  ? 786 PHE A CD1   1 
ATOM   4733  C  CD2   . PHE E 3 490 ? 113.821 -19.139 25.146  1.00 37.44  ? 786 PHE A CD2   1 
ATOM   4734  C  CE1   . PHE E 3 490 ? 114.515 -19.720 27.791  1.00 37.77  ? 786 PHE A CE1   1 
ATOM   4735  C  CE2   . PHE E 3 490 ? 113.026 -18.665 26.208  1.00 38.37  ? 786 PHE A CE2   1 
ATOM   4736  C  CZ    . PHE E 3 490 ? 113.374 -18.961 27.536  1.00 37.06  ? 786 PHE A CZ    1 
ATOM   4737  N  N     . ALA E 3 491 ? 118.294 -20.776 22.300  1.00 32.17  ? 787 ALA A N     1 
ATOM   4738  C  CA    . ALA E 3 491 ? 119.311 -21.618 21.668  1.00 31.53  ? 787 ALA A CA    1 
ATOM   4739  C  C     . ALA E 3 491 ? 120.708 -21.015 21.819  1.00 31.11  ? 787 ALA A C     1 
ATOM   4740  O  O     . ALA E 3 491 ? 121.678 -21.743 21.968  1.00 30.81  ? 787 ALA A O     1 
ATOM   4741  C  CB    . ALA E 3 491 ? 118.984 -21.872 20.191  1.00 31.39  ? 787 ALA A CB    1 
ATOM   4742  N  N     . GLU E 3 492 ? 120.803 -19.687 21.786  1.00 30.83  ? 788 GLU A N     1 
ATOM   4743  C  CA    . GLU E 3 492 ? 122.089 -19.005 21.951  1.00 30.88  ? 788 GLU A CA    1 
ATOM   4744  C  C     . GLU E 3 492 ? 122.676 -19.304 23.313  1.00 30.22  ? 788 GLU A C     1 
ATOM   4745  O  O     . GLU E 3 492 ? 123.878 -19.554 23.437  1.00 30.28  ? 788 GLU A O     1 
ATOM   4746  C  CB    . GLU E 3 492 ? 121.963 -17.489 21.746  1.00 30.93  ? 788 GLU A CB    1 
ATOM   4747  C  CG    . GLU E 3 492 ? 121.847 -17.056 20.276  1.00 31.91  ? 788 GLU A CG    1 
ATOM   4748  C  CD    . GLU E 3 492 ? 121.828 -15.533 20.086  1.00 32.19  ? 788 GLU A CD    1 
ATOM   4749  O  OE1   . GLU E 3 492 ? 122.181 -14.791 21.030  1.00 34.59  ? 788 GLU A OE1   1 
ATOM   4750  O  OE2   . GLU E 3 492 ? 121.465 -15.072 18.981  1.00 34.25  ? 788 GLU A OE2   1 
ATOM   4751  N  N     . ARG E 3 493 ? 121.820 -19.295 24.335  1.00 29.53  ? 789 ARG A N     1 
ATOM   4752  C  CA    . ARG E 3 493 ? 122.247 -19.632 25.691  1.00 28.41  ? 789 ARG A CA    1 
ATOM   4753  C  C     . ARG E 3 493 ? 122.629 -21.101 25.853  1.00 28.03  ? 789 ARG A C     1 
ATOM   4754  O  O     . ARG E 3 493 ? 123.409 -21.455 26.734  1.00 28.30  ? 789 ARG A O     1 
ATOM   4755  C  CB    . ARG E 3 493 ? 121.209 -19.191 26.712  1.00 28.27  ? 789 ARG A CB    1 
ATOM   4756  C  CG    . ARG E 3 493 ? 121.104 -17.693 26.785  1.00 27.00  ? 789 ARG A CG    1 
ATOM   4757  C  CD    . ARG E 3 493 ? 120.386 -17.228 28.018  1.00 25.40  ? 789 ARG A CD    1 
ATOM   4758  N  NE    . ARG E 3 493 ? 118.986 -17.603 27.971  1.00 24.64  ? 789 ARG A NE    1 
ATOM   4759  C  CZ    . ARG E 3 493 ? 118.058 -16.912 27.331  1.00 25.70  ? 789 ARG A CZ    1 
ATOM   4760  N  NH1   . ARG E 3 493 ? 118.383 -15.800 26.680  1.00 27.47  ? 789 ARG A NH1   1 
ATOM   4761  N  NH2   . ARG E 3 493 ? 116.804 -17.333 27.337  1.00 26.97  ? 789 ARG A NH2   1 
ATOM   4762  N  N     . MET E 3 494 ? 122.101 -21.952 24.988  1.00 27.39  ? 790 MET A N     1 
ATOM   4763  C  CA    . MET E 3 494 ? 122.502 -23.345 24.971  1.00 27.25  ? 790 MET A CA    1 
ATOM   4764  C  C     . MET E 3 494 ? 123.867 -23.488 24.300  1.00 27.44  ? 790 MET A C     1 
ATOM   4765  O  O     . MET E 3 494 ? 124.601 -24.444 24.558  1.00 27.11  ? 790 MET A O     1 
ATOM   4766  C  CB    . MET E 3 494 ? 121.452 -24.201 24.255  1.00 27.03  ? 790 MET A CB    1 
ATOM   4767  C  CG    . MET E 3 494 ? 120.071 -24.100 24.876  1.00 26.62  ? 790 MET A CG    1 
ATOM   4768  S  SD    . MET E 3 494 ? 118.839 -25.102 24.052  1.00 27.07  ? 790 MET A SD    1 
ATOM   4769  C  CE    . MET E 3 494 ? 117.371 -24.727 25.016  1.00 25.44  ? 790 MET A CE    1 
ATOM   4770  N  N     . ALA E 3 495 ? 124.202 -22.529 23.438  1.00 27.86  ? 791 ALA A N     1 
ATOM   4771  C  CA    . ALA E 3 495 ? 125.483 -22.547 22.740  1.00 28.40  ? 791 ALA A CA    1 
ATOM   4772  C  C     . ALA E 3 495 ? 126.571 -22.087 23.697  1.00 28.67  ? 791 ALA A C     1 
ATOM   4773  O  O     . ALA E 3 495 ? 127.734 -22.452 23.548  1.00 28.72  ? 791 ALA A O     1 
ATOM   4774  C  CB    . ALA E 3 495 ? 125.446 -21.663 21.482  1.00 28.13  ? 791 ALA A CB    1 
ATOM   4775  N  N     . MET E 3 496 ? 126.181 -21.296 24.693  1.00 28.90  ? 792 MET A N     1 
ATOM   4776  C  CA    . MET E 3 496 ? 127.125 -20.810 25.695  1.00 29.11  ? 792 MET A CA    1 
ATOM   4777  C  C     . MET E 3 496 ? 127.394 -21.879 26.753  1.00 28.81  ? 792 MET A C     1 
ATOM   4778  O  O     . MET E 3 496 ? 128.540 -22.190 27.065  1.00 28.65  ? 792 MET A O     1 
ATOM   4779  C  CB    . MET E 3 496 ? 126.601 -19.519 26.340  1.00 28.93  ? 792 MET A CB    1 
ATOM   4780  C  CG    . MET E 3 496 ? 126.465 -18.357 25.360  1.00 29.11  ? 792 MET A CG    1 
ATOM   4781  S  SD    . MET E 3 496 ? 125.814 -16.835 26.091  1.00 30.19  ? 792 MET A SD    1 
ATOM   4782  C  CE    . MET E 3 496 ? 124.125 -16.808 25.532  1.00 30.29  ? 792 MET A CE    1 
ATOM   4783  N  N     . ASN E 3 497 ? 126.322 -22.462 27.270  1.00 28.83  ? 793 ASN A N     1 
ATOM   4784  C  CA    . ASN E 3 497 ? 126.399 -23.407 28.376  1.00 28.80  ? 793 ASN A CA    1 
ATOM   4785  C  C     . ASN E 3 497 ? 126.884 -24.814 28.036  1.00 28.43  ? 793 ASN A C     1 
ATOM   4786  O  O     . ASN E 3 497 ? 127.845 -25.305 28.626  1.00 28.07  ? 793 ASN A O     1 
ATOM   4787  C  CB    . ASN E 3 497 ? 125.035 -23.484 29.069  1.00 28.91  ? 793 ASN A CB    1 
ATOM   4788  C  CG    . ASN E 3 497 ? 125.020 -24.465 30.231  1.00 30.12  ? 793 ASN A CG    1 
ATOM   4789  O  OD1   . ASN E 3 497 ? 124.433 -25.549 30.139  1.00 32.12  ? 793 ASN A OD1   1 
ATOM   4790  N  ND2   . ASN E 3 497 ? 125.677 -24.098 31.327  1.00 30.91  ? 793 ASN A ND2   1 
ATOM   4791  N  N     . THR E 3 498 ? 126.199 -25.461 27.097  1.00 28.49  ? 794 THR A N     1 
ATOM   4792  C  CA    . THR E 3 498 ? 126.458 -26.866 26.756  1.00 28.29  ? 794 THR A CA    1 
ATOM   4793  C  C     . THR E 3 498 ? 127.934 -27.246 26.646  1.00 28.17  ? 794 THR A C     1 
ATOM   4794  O  O     . THR E 3 498 ? 128.373 -28.196 27.293  1.00 28.12  ? 794 THR A O     1 
ATOM   4795  C  CB    . THR E 3 498 ? 125.699 -27.308 25.490  1.00 28.21  ? 794 THR A CB    1 
ATOM   4796  O  OG1   . THR E 3 498 ? 124.305 -27.034 25.653  1.00 28.60  ? 794 THR A OG1   1 
ATOM   4797  C  CG2   . THR E 3 498 ? 125.892 -28.808 25.233  1.00 28.46  ? 794 THR A CG2   1 
ATOM   4798  N  N     . PRO E 3 499 ? 128.717 -26.502 25.849  1.00 28.09  ? 795 PRO A N     1 
ATOM   4799  C  CA    . PRO E 3 499 ? 130.115 -26.900 25.768  1.00 27.91  ? 795 PRO A CA    1 
ATOM   4800  C  C     . PRO E 3 499 ? 130.782 -26.969 27.143  1.00 27.79  ? 795 PRO A C     1 
ATOM   4801  O  O     . PRO E 3 499 ? 131.736 -27.716 27.331  1.00 27.69  ? 795 PRO A O     1 
ATOM   4802  C  CB    . PRO E 3 499 ? 130.749 -25.776 24.942  1.00 28.00  ? 795 PRO A CB    1 
ATOM   4803  C  CG    . PRO E 3 499 ? 129.646 -25.203 24.162  1.00 27.90  ? 795 PRO A CG    1 
ATOM   4804  C  CD    . PRO E 3 499 ? 128.434 -25.315 25.022  1.00 28.11  ? 795 PRO A CD    1 
ATOM   4805  N  N     . ILE E 3 500 ? 130.267 -26.213 28.104  1.00 27.86  ? 796 ILE A N     1 
ATOM   4806  C  CA    . ILE E 3 500 ? 130.887 -26.145 29.430  1.00 27.99  ? 796 ILE A CA    1 
ATOM   4807  C  C     . ILE E 3 500 ? 130.415 -27.260 30.368  1.00 27.74  ? 796 ILE A C     1 
ATOM   4808  O  O     . ILE E 3 500 ? 131.227 -28.005 30.918  1.00 27.60  ? 796 ILE A O     1 
ATOM   4809  C  CB    . ILE E 3 500 ? 130.692 -24.737 30.097  1.00 27.99  ? 796 ILE A CB    1 
ATOM   4810  C  CG1   . ILE E 3 500 ? 131.151 -23.608 29.165  1.00 27.94  ? 796 ILE A CG1   1 
ATOM   4811  C  CG2   . ILE E 3 500 ? 131.434 -24.659 31.410  1.00 27.92  ? 796 ILE A CG2   1 
ATOM   4812  C  CD1   . ILE E 3 500 ? 132.581 -23.765 28.620  1.00 28.18  ? 796 ILE A CD1   1 
ATOM   4813  N  N     . GLN E 3 501 ? 129.104 -27.364 30.547  1.00 27.62  ? 797 GLN A N     1 
ATOM   4814  C  CA    . GLN E 3 501 ? 128.525 -28.389 31.399  1.00 27.54  ? 797 GLN A CA    1 
ATOM   4815  C  C     . GLN E 3 501 ? 128.838 -29.755 30.817  1.00 27.61  ? 797 GLN A C     1 
ATOM   4816  O  O     . GLN E 3 501 ? 129.150 -30.703 31.551  1.00 27.78  ? 797 GLN A O     1 
ATOM   4817  C  CB    . GLN E 3 501 ? 127.015 -28.186 31.515  1.00 27.46  ? 797 GLN A CB    1 
ATOM   4818  C  CG    . GLN E 3 501 ? 126.293 -29.218 32.381  1.00 27.89  ? 797 GLN A CG    1 
ATOM   4819  C  CD    . GLN E 3 501 ? 124.820 -28.895 32.598  1.00 28.19  ? 797 GLN A CD    1 
ATOM   4820  O  OE1   . GLN E 3 501 ? 123.970 -29.790 32.544  1.00 29.15  ? 797 GLN A OE1   1 
ATOM   4821  N  NE2   . GLN E 3 501 ? 124.508 -27.613 32.844  1.00 27.78  ? 797 GLN A NE2   1 
ATOM   4822  N  N     . GLY E 3 502 ? 128.774 -29.839 29.487  1.00 27.71  ? 798 GLY A N     1 
ATOM   4823  C  CA    . GLY E 3 502 ? 129.029 -31.073 28.764  1.00 27.28  ? 798 GLY A CA    1 
ATOM   4824  C  C     . GLY E 3 502 ? 130.444 -31.551 28.975  1.00 27.17  ? 798 GLY A C     1 
ATOM   4825  O  O     . GLY E 3 502 ? 130.688 -32.748 29.112  1.00 27.15  ? 798 GLY A O     1 
ATOM   4826  N  N     . SER E 3 503 ? 131.382 -30.612 29.003  1.00 26.98  ? 799 SER A N     1 
ATOM   4827  C  CA    . SER E 3 503 ? 132.779 -30.958 29.221  1.00 27.05  ? 799 SER A CA    1 
ATOM   4828  C  C     . SER E 3 503 ? 133.034 -31.440 30.652  1.00 26.85  ? 799 SER A C     1 
ATOM   4829  O  O     . SER E 3 503 ? 133.752 -32.425 30.854  1.00 27.15  ? 799 SER A O     1 
ATOM   4830  C  CB    . SER E 3 503 ? 133.684 -29.782 28.875  1.00 27.11  ? 799 SER A CB    1 
ATOM   4831  O  OG    . SER E 3 503 ? 133.508 -29.418 27.520  1.00 27.97  ? 799 SER A OG    1 
ATOM   4832  N  N     . ALA E 3 504 ? 132.443 -30.758 31.635  1.00 26.27  ? 800 ALA A N     1 
ATOM   4833  C  CA    . ALA E 3 504 ? 132.570 -31.176 33.032  1.00 25.81  ? 800 ALA A CA    1 
ATOM   4834  C  C     . ALA E 3 504 ? 131.983 -32.568 33.176  1.00 25.65  ? 800 ALA A C     1 
ATOM   4835  O  O     . ALA E 3 504 ? 132.475 -33.386 33.946  1.00 25.75  ? 800 ALA A O     1 
ATOM   4836  C  CB    . ALA E 3 504 ? 131.855 -30.220 33.944  1.00 25.43  ? 800 ALA A CB    1 
ATOM   4837  N  N     . ALA E 3 505 ? 130.922 -32.824 32.421  1.00 25.44  ? 801 ALA A N     1 
ATOM   4838  C  CA    . ALA E 3 505 ? 130.277 -34.112 32.445  1.00 25.48  ? 801 ALA A CA    1 
ATOM   4839  C  C     . ALA E 3 505 ? 131.205 -35.186 31.893  1.00 25.62  ? 801 ALA A C     1 
ATOM   4840  O  O     . ALA E 3 505 ? 131.283 -36.271 32.459  1.00 25.83  ? 801 ALA A O     1 
ATOM   4841  C  CB    . ALA E 3 505 ? 128.978 -34.068 31.662  1.00 25.68  ? 801 ALA A CB    1 
ATOM   4842  N  N     . ASP E 3 506 ? 131.909 -34.882 30.802  1.00 25.69  ? 802 ASP A N     1 
ATOM   4843  C  CA    . ASP E 3 506 ? 132.852 -35.830 30.190  1.00 26.07  ? 802 ASP A CA    1 
ATOM   4844  C  C     . ASP E 3 506 ? 133.968 -36.202 31.165  1.00 26.20  ? 802 ASP A C     1 
ATOM   4845  O  O     . ASP E 3 506 ? 134.291 -37.375 31.356  1.00 26.24  ? 802 ASP A O     1 
ATOM   4846  C  CB    . ASP E 3 506 ? 133.499 -35.231 28.930  1.00 25.92  ? 802 ASP A CB    1 
ATOM   4847  C  CG    . ASP E 3 506 ? 132.508 -34.988 27.790  1.00 26.18  ? 802 ASP A CG    1 
ATOM   4848  O  OD1   . ASP E 3 506 ? 132.800 -34.107 26.950  1.00 26.28  ? 802 ASP A OD1   1 
ATOM   4849  O  OD2   . ASP E 3 506 ? 131.450 -35.656 27.717  1.00 25.44  ? 802 ASP A OD2   1 
ATOM   4850  N  N     . ILE E 3 507 ? 134.550 -35.178 31.774  1.00 26.49  ? 803 ILE A N     1 
ATOM   4851  C  CA    . ILE E 3 507 ? 135.676 -35.334 32.680  1.00 26.80  ? 803 ILE A CA    1 
ATOM   4852  C  C     . ILE E 3 507 ? 135.372 -36.262 33.844  1.00 26.86  ? 803 ILE A C     1 
ATOM   4853  O  O     . ILE E 3 507 ? 136.096 -37.243 34.063  1.00 26.93  ? 803 ILE A O     1 
ATOM   4854  C  CB    . ILE E 3 507 ? 136.145 -33.965 33.219  1.00 27.06  ? 803 ILE A CB    1 
ATOM   4855  C  CG1   . ILE E 3 507 ? 136.558 -33.051 32.065  1.00 27.29  ? 803 ILE A CG1   1 
ATOM   4856  C  CG2   . ILE E 3 507 ? 137.297 -34.129 34.208  1.00 26.98  ? 803 ILE A CG2   1 
ATOM   4857  C  CD1   . ILE E 3 507 ? 137.002 -31.680 32.516  1.00 28.54  ? 803 ILE A CD1   1 
ATOM   4858  N  N     . ILE E 3 508 ? 134.307 -35.958 34.583  1.00 27.02  ? 804 ILE A N     1 
ATOM   4859  C  CA    . ILE E 3 508 ? 133.933 -36.774 35.740  1.00 27.40  ? 804 ILE A CA    1 
ATOM   4860  C  C     . ILE E 3 508 ? 133.538 -38.203 35.330  1.00 27.72  ? 804 ILE A C     1 
ATOM   4861  O  O     . ILE E 3 508 ? 133.662 -39.142 36.117  1.00 27.60  ? 804 ILE A O     1 
ATOM   4862  C  CB    . ILE E 3 508 ? 132.842 -36.104 36.622  1.00 27.13  ? 804 ILE A CB    1 
ATOM   4863  C  CG1   . ILE E 3 508 ? 132.736 -36.837 37.964  1.00 27.23  ? 804 ILE A CG1   1 
ATOM   4864  C  CG2   . ILE E 3 508 ? 131.506 -36.025 35.888  1.00 27.04  ? 804 ILE A CG2   1 
ATOM   4865  C  CD1   . ILE E 3 508 ? 131.689 -36.295 38.912  1.00 27.44  ? 804 ILE A CD1   1 
ATOM   4866  N  N     . LYS E 3 509 ? 133.077 -38.365 34.094  1.00 28.20  ? 805 LYS A N     1 
ATOM   4867  C  CA    . LYS E 3 509 ? 132.803 -39.691 33.570  1.00 28.54  ? 805 LYS A CA    1 
ATOM   4868  C  C     . LYS E 3 509 ? 134.114 -40.462 33.437  1.00 29.18  ? 805 LYS A C     1 
ATOM   4869  O  O     . LYS E 3 509 ? 134.219 -41.610 33.884  1.00 29.19  ? 805 LYS A O     1 
ATOM   4870  C  CB    . LYS E 3 509 ? 132.063 -39.621 32.233  1.00 28.45  ? 805 LYS A CB    1 
ATOM   4871  C  CG    . LYS E 3 509 ? 130.583 -39.317 32.379  1.00 28.15  ? 805 LYS A CG    1 
ATOM   4872  C  CD    . LYS E 3 509 ? 129.825 -39.435 31.057  1.00 27.88  ? 805 LYS A CD    1 
ATOM   4873  C  CE    . LYS E 3 509 ? 128.322 -39.398 31.299  1.00 25.91  ? 805 LYS A CE    1 
ATOM   4874  N  NZ    . LYS E 3 509 ? 127.529 -39.411 30.054  1.00 24.57  ? 805 LYS A NZ    1 
ATOM   4875  N  N     . LYS E 3 510 ? 135.113 -39.816 32.841  1.00 29.91  ? 806 LYS A N     1 
ATOM   4876  C  CA    . LYS E 3 510 ? 136.426 -40.430 32.671  1.00 30.57  ? 806 LYS A CA    1 
ATOM   4877  C  C     . LYS E 3 510 ? 137.071 -40.750 34.022  1.00 30.79  ? 806 LYS A C     1 
ATOM   4878  O  O     . LYS E 3 510 ? 137.646 -41.829 34.210  1.00 30.83  ? 806 LYS A O     1 
ATOM   4879  C  CB    . LYS E 3 510 ? 137.342 -39.536 31.837  1.00 30.57  ? 806 LYS A CB    1 
ATOM   4880  C  CG    . LYS E 3 510 ? 138.633 -40.233 31.462  1.00 31.65  ? 806 LYS A CG    1 
ATOM   4881  C  CD    . LYS E 3 510 ? 139.418 -39.493 30.393  1.00 33.08  ? 806 LYS A CD    1 
ATOM   4882  C  CE    . LYS E 3 510 ? 140.501 -40.404 29.812  1.00 33.26  ? 806 LYS A CE    1 
ATOM   4883  N  NZ    . LYS E 3 510 ? 141.372 -40.976 30.887  1.00 33.90  ? 806 LYS A NZ    1 
ATOM   4884  N  N     . ALA E 3 511 ? 136.953 -39.813 34.959  1.00 30.86  ? 807 ALA A N     1 
ATOM   4885  C  CA    . ALA E 3 511 ? 137.483 -39.986 36.308  1.00 30.91  ? 807 ALA A CA    1 
ATOM   4886  C  C     . ALA E 3 511 ? 136.950 -41.239 36.988  1.00 30.97  ? 807 ALA A C     1 
ATOM   4887  O  O     . ALA E 3 511 ? 137.641 -41.854 37.791  1.00 31.44  ? 807 ALA A O     1 
ATOM   4888  C  CB    . ALA E 3 511 ? 137.174 -38.759 37.157  1.00 30.77  ? 807 ALA A CB    1 
ATOM   4889  N  N     . MET E 3 512 ? 135.716 -41.612 36.671  1.00 31.10  ? 808 MET A N     1 
ATOM   4890  C  CA    . MET E 3 512 ? 135.100 -42.796 37.261  1.00 30.82  ? 808 MET A CA    1 
ATOM   4891  C  C     . MET E 3 512 ? 135.693 -44.096 36.706  1.00 31.79  ? 808 MET A C     1 
ATOM   4892  O  O     . MET E 3 512 ? 135.860 -45.071 37.439  1.00 31.63  ? 808 MET A O     1 
ATOM   4893  C  CB    . MET E 3 512 ? 133.582 -42.770 37.053  1.00 30.92  ? 808 MET A CB    1 
ATOM   4894  C  CG    . MET E 3 512 ? 132.857 -41.653 37.796  1.00 30.15  ? 808 MET A CG    1 
ATOM   4895  S  SD    . MET E 3 512 ? 131.107 -41.440 37.371  1.00 28.31  ? 808 MET A SD    1 
ATOM   4896  C  CE    . MET E 3 512 ? 130.390 -42.977 37.943  1.00 26.52  ? 808 MET A CE    1 
ATOM   4897  N  N     . ILE E 3 513 ? 136.001 -44.109 35.412  1.00 32.84  ? 809 ILE A N     1 
ATOM   4898  C  CA    . ILE E 3 513 ? 136.560 -45.299 34.770  1.00 33.94  ? 809 ILE A CA    1 
ATOM   4899  C  C     . ILE E 3 513 ? 137.944 -45.576 35.327  1.00 34.72  ? 809 ILE A C     1 
ATOM   4900  O  O     . ILE E 3 513 ? 138.274 -46.713 35.677  1.00 34.91  ? 809 ILE A O     1 
ATOM   4901  C  CB    . ILE E 3 513 ? 136.641 -45.127 33.238  1.00 33.94  ? 809 ILE A CB    1 
ATOM   4902  C  CG1   . ILE E 3 513 ? 135.238 -44.915 32.654  1.00 33.72  ? 809 ILE A CG1   1 
ATOM   4903  C  CG2   . ILE E 3 513 ? 137.349 -46.319 32.592  1.00 33.81  ? 809 ILE A CG2   1 
ATOM   4904  C  CD1   . ILE E 3 513 ? 135.228 -44.651 31.171  1.00 33.26  ? 809 ILE A CD1   1 
ATOM   4905  N  N     . ASP E 3 514 ? 138.739 -44.516 35.421  1.00 35.60  ? 810 ASP A N     1 
ATOM   4906  C  CA    . ASP E 3 514 ? 140.087 -44.612 35.951  1.00 36.60  ? 810 ASP A CA    1 
ATOM   4907  C  C     . ASP E 3 514 ? 140.068 -45.017 37.419  1.00 37.29  ? 810 ASP A C     1 
ATOM   4908  O  O     . ASP E 3 514 ? 140.911 -45.804 37.853  1.00 37.64  ? 810 ASP A O     1 
ATOM   4909  C  CB    . ASP E 3 514 ? 140.846 -43.290 35.769  1.00 36.33  ? 810 ASP A CB    1 
ATOM   4910  C  CG    . ASP E 3 514 ? 140.972 -42.888 34.316  1.00 35.91  ? 810 ASP A CG    1 
ATOM   4911  O  OD1   . ASP E 3 514 ? 140.691 -43.726 33.438  1.00 35.80  ? 810 ASP A OD1   1 
ATOM   4912  O  OD2   . ASP E 3 514 ? 141.342 -41.730 34.045  1.00 35.81  ? 810 ASP A OD2   1 
ATOM   4913  N  N     . LEU E 3 515 ? 139.104 -44.491 38.173  1.00 38.14  ? 811 LEU A N     1 
ATOM   4914  C  CA    . LEU E 3 515 ? 139.003 -44.794 39.598  1.00 38.94  ? 811 LEU A CA    1 
ATOM   4915  C  C     . LEU E 3 515 ? 138.656 -46.251 39.800  1.00 39.68  ? 811 LEU A C     1 
ATOM   4916  O  O     . LEU E 3 515 ? 139.237 -46.921 40.651  1.00 39.71  ? 811 LEU A O     1 
ATOM   4917  C  CB    . LEU E 3 515 ? 137.957 -43.926 40.280  1.00 38.93  ? 811 LEU A CB    1 
ATOM   4918  C  CG    . LEU E 3 515 ? 137.851 -44.159 41.787  1.00 39.17  ? 811 LEU A CG    1 
ATOM   4919  C  CD1   . LEU E 3 515 ? 139.189 -43.900 42.458  1.00 38.90  ? 811 LEU A CD1   1 
ATOM   4920  C  CD2   . LEU E 3 515 ? 136.769 -43.277 42.383  1.00 39.16  ? 811 LEU A CD2   1 
ATOM   4921  N  N     . ASN E 3 516 ? 137.717 -46.737 38.997  1.00 40.60  ? 812 ASN A N     1 
ATOM   4922  C  CA    . ASN E 3 516 ? 137.301 -48.124 39.063  1.00 41.37  ? 812 ASN A CA    1 
ATOM   4923  C  C     . ASN E 3 516 ? 138.466 -49.033 38.721  1.00 42.30  ? 812 ASN A C     1 
ATOM   4924  O  O     . ASN E 3 516 ? 138.618 -50.106 39.312  1.00 42.45  ? 812 ASN A O     1 
ATOM   4925  C  CB    . ASN E 3 516 ? 136.159 -48.389 38.096  1.00 41.18  ? 812 ASN A CB    1 
ATOM   4926  C  CG    . ASN E 3 516 ? 135.166 -49.372 38.648  1.00 40.76  ? 812 ASN A CG    1 
ATOM   4927  O  OD1   . ASN E 3 516 ? 134.650 -49.174 39.749  1.00 40.25  ? 812 ASN A OD1   1 
ATOM   4928  N  ND2   . ASN E 3 516 ? 134.882 -50.434 37.896  1.00 39.15  ? 812 ASN A ND2   1 
ATOM   4929  N  N     . ALA E 3 517 ? 139.281 -48.595 37.760  1.00 43.25  ? 813 ALA A N     1 
ATOM   4930  C  CA    . ALA E 3 517 ? 140.480 -49.323 37.369  1.00 44.16  ? 813 ALA A CA    1 
ATOM   4931  C  C     . ALA E 3 517 ? 141.476 -49.340 38.528  1.00 45.00  ? 813 ALA A C     1 
ATOM   4932  O  O     . ALA E 3 517 ? 141.883 -50.401 38.993  1.00 45.11  ? 813 ALA A O     1 
ATOM   4933  C  CB    . ALA E 3 517 ? 141.096 -48.693 36.154  1.00 44.00  ? 813 ALA A CB    1 
ATOM   4934  N  N     . ARG E 3 518 ? 141.838 -48.155 39.010  1.00 46.07  ? 814 ARG A N     1 
ATOM   4935  C  CA    . ARG E 3 518 ? 142.770 -48.013 40.126  1.00 47.11  ? 814 ARG A CA    1 
ATOM   4936  C  C     . ARG E 3 518 ? 142.279 -48.669 41.418  1.00 47.54  ? 814 ARG A C     1 
ATOM   4937  O  O     . ARG E 3 518 ? 143.033 -48.797 42.380  1.00 47.68  ? 814 ARG A O     1 
ATOM   4938  C  CB    . ARG E 3 518 ? 143.090 -46.535 40.368  1.00 47.15  ? 814 ARG A CB    1 
ATOM   4939  C  CG    . ARG E 3 518 ? 143.998 -45.920 39.315  1.00 48.54  ? 814 ARG A CG    1 
ATOM   4940  C  CD    . ARG E 3 518 ? 145.429 -46.477 39.403  1.00 50.68  ? 814 ARG A CD    1 
ATOM   4941  N  NE    . ARG E 3 518 ? 146.103 -46.124 40.658  1.00 51.65  ? 814 ARG A NE    1 
ATOM   4942  C  CZ    . ARG E 3 518 ? 146.766 -44.984 40.863  1.00 52.04  ? 814 ARG A CZ    1 
ATOM   4943  N  NH1   . ARG E 3 518 ? 146.847 -44.068 39.901  1.00 51.88  ? 814 ARG A NH1   1 
ATOM   4944  N  NH2   . ARG E 3 518 ? 147.345 -44.754 42.033  1.00 52.31  ? 814 ARG A NH2   1 
ATOM   4945  N  N     . LEU E 3 519 ? 141.017 -49.077 41.440  1.00 48.14  ? 815 LEU A N     1 
ATOM   4946  C  CA    . LEU E 3 519 ? 140.474 -49.756 42.603  1.00 48.75  ? 815 LEU A CA    1 
ATOM   4947  C  C     . LEU E 3 519 ? 140.641 -51.265 42.486  1.00 49.14  ? 815 LEU A C     1 
ATOM   4948  O  O     . LEU E 3 519 ? 141.189 -51.902 43.385  1.00 49.23  ? 815 LEU A O     1 
ATOM   4949  C  CB    . LEU E 3 519 ? 139.002 -49.396 42.824  1.00 48.61  ? 815 LEU A CB    1 
ATOM   4950  C  CG    . LEU E 3 519 ? 138.720 -48.006 43.394  1.00 48.66  ? 815 LEU A CG    1 
ATOM   4951  C  CD1   . LEU E 3 519 ? 137.228 -47.697 43.320  1.00 48.73  ? 815 LEU A CD1   1 
ATOM   4952  C  CD2   . LEU E 3 519 ? 139.241 -47.872 44.818  1.00 48.21  ? 815 LEU A CD2   1 
ATOM   4953  N  N     . LYS E 3 520 ? 140.185 -51.832 41.373  1.00 49.63  ? 816 LYS A N     1 
ATOM   4954  C  CA    . LYS E 3 520 ? 140.236 -53.279 41.184  1.00 50.12  ? 816 LYS A CA    1 
ATOM   4955  C  C     . LYS E 3 520 ? 141.673 -53.794 41.046  1.00 50.21  ? 816 LYS A C     1 
ATOM   4956  O  O     . LYS E 3 520 ? 141.991 -54.904 41.485  1.00 50.44  ? 816 LYS A O     1 
ATOM   4957  C  CB    . LYS E 3 520 ? 139.320 -53.700 40.026  1.00 50.30  ? 816 LYS A CB    1 
ATOM   4958  C  CG    . LYS E 3 520 ? 139.184 -55.219 39.788  1.00 51.57  ? 816 LYS A CG    1 
ATOM   4959  C  CD    . LYS E 3 520 ? 137.707 -55.661 39.684  1.00 52.61  ? 816 LYS A CD    1 
ATOM   4960  C  CE    . LYS E 3 520 ? 136.775 -54.558 39.146  1.00 53.83  ? 816 LYS A CE    1 
ATOM   4961  N  NZ    . LYS E 3 520 ? 137.039 -54.158 37.726  1.00 54.36  ? 816 LYS A NZ    1 
ATOM   4962  N  N     . GLU E 3 521 ? 142.548 -52.971 40.479  1.00 50.19  ? 817 GLU A N     1 
ATOM   4963  C  CA    . GLU E 3 521 ? 143.955 -53.330 40.381  1.00 50.27  ? 817 GLU A CA    1 
ATOM   4964  C  C     . GLU E 3 521 ? 144.606 -53.343 41.766  1.00 50.00  ? 817 GLU A C     1 
ATOM   4965  O  O     . GLU E 3 521 ? 145.331 -54.272 42.098  1.00 50.07  ? 817 GLU A O     1 
ATOM   4966  C  CB    . GLU E 3 521 ? 144.685 -52.402 39.412  1.00 50.44  ? 817 GLU A CB    1 
ATOM   4967  C  CG    . GLU E 3 521 ? 144.237 -52.593 37.954  1.00 51.51  ? 817 GLU A CG    1 
ATOM   4968  C  CD    . GLU E 3 521 ? 144.483 -51.363 37.071  1.00 52.75  ? 817 GLU A CD    1 
ATOM   4969  O  OE1   . GLU E 3 521 ? 144.750 -50.263 37.616  1.00 52.67  ? 817 GLU A OE1   1 
ATOM   4970  O  OE2   . GLU E 3 521 ? 144.387 -51.497 35.829  1.00 52.38  ? 817 GLU A OE2   1 
ATOM   4971  N  N     . GLU E 3 522 ? 144.324 -52.338 42.586  1.00 49.70  ? 818 GLU A N     1 
ATOM   4972  C  CA    . GLU E 3 522 ? 144.850 -52.322 43.954  1.00 49.39  ? 818 GLU A CA    1 
ATOM   4973  C  C     . GLU E 3 522 ? 144.054 -53.205 44.923  1.00 49.14  ? 818 GLU A C     1 
ATOM   4974  O  O     . GLU E 3 522 ? 144.272 -53.149 46.134  1.00 49.03  ? 818 GLU A O     1 
ATOM   4975  C  CB    . GLU E 3 522 ? 144.935 -50.900 44.497  1.00 49.30  ? 818 GLU A CB    1 
ATOM   4976  C  CG    . GLU E 3 522 ? 145.917 -50.025 43.761  1.00 49.74  ? 818 GLU A CG    1 
ATOM   4977  C  CD    . GLU E 3 522 ? 146.045 -48.658 44.394  1.00 50.68  ? 818 GLU A CD    1 
ATOM   4978  O  OE1   . GLU E 3 522 ? 145.689 -48.513 45.585  1.00 51.85  ? 818 GLU A OE1   1 
ATOM   4979  O  OE2   . GLU E 3 522 ? 146.501 -47.724 43.703  1.00 51.06  ? 818 GLU A OE2   1 
ATOM   4980  N  N     . ARG E 3 523 ? 143.126 -53.998 44.381  1.00 48.87  ? 819 ARG A N     1 
ATOM   4981  C  CA    . ARG E 3 523 ? 142.339 -54.983 45.146  1.00 48.68  ? 819 ARG A CA    1 
ATOM   4982  C  C     . ARG E 3 523 ? 141.629 -54.504 46.419  1.00 48.06  ? 819 ARG A C     1 
ATOM   4983  O  O     . ARG E 3 523 ? 141.356 -55.311 47.307  1.00 48.15  ? 819 ARG A O     1 
ATOM   4984  C  CB    . ARG E 3 523 ? 143.197 -56.211 45.481  1.00 48.92  ? 819 ARG A CB    1 
ATOM   4985  C  CG    . ARG E 3 523 ? 143.426 -57.167 44.317  1.00 50.51  ? 819 ARG A CG    1 
ATOM   4986  C  CD    . ARG E 3 523 ? 142.159 -57.941 43.978  1.00 53.24  ? 819 ARG A CD    1 
ATOM   4987  N  NE    . ARG E 3 523 ? 142.391 -59.003 42.994  1.00 55.53  ? 819 ARG A NE    1 
ATOM   4988  C  CZ    . ARG E 3 523 ? 142.162 -58.894 41.685  1.00 56.56  ? 819 ARG A CZ    1 
ATOM   4989  N  NH1   . ARG E 3 523 ? 141.689 -57.760 41.174  1.00 57.65  ? 819 ARG A NH1   1 
ATOM   4990  N  NH2   . ARG E 3 523 ? 142.401 -59.925 40.883  1.00 56.20  ? 819 ARG A NH2   1 
ATOM   4991  N  N     . LEU E 3 524 ? 141.319 -53.210 46.497  1.00 47.32  ? 820 LEU A N     1 
ATOM   4992  C  CA    . LEU E 3 524 ? 140.647 -52.625 47.665  1.00 46.35  ? 820 LEU A CA    1 
ATOM   4993  C  C     . LEU E 3 524 ? 139.156 -52.950 47.699  1.00 45.73  ? 820 LEU A C     1 
ATOM   4994  O  O     . LEU E 3 524 ? 138.551 -53.210 46.662  1.00 45.55  ? 820 LEU A O     1 
ATOM   4995  C  CB    . LEU E 3 524 ? 140.838 -51.110 47.679  1.00 46.26  ? 820 LEU A CB    1 
ATOM   4996  C  CG    . LEU E 3 524 ? 142.281 -50.617 47.620  1.00 46.39  ? 820 LEU A CG    1 
ATOM   4997  C  CD1   . LEU E 3 524 ? 142.343 -49.102 47.740  1.00 46.37  ? 820 LEU A CD1   1 
ATOM   4998  C  CD2   . LEU E 3 524 ? 143.105 -51.270 48.717  1.00 47.11  ? 820 LEU A CD2   1 
ATOM   4999  N  N     . GLN E 3 525 ? 138.569 -52.925 48.894  1.00 44.96  ? 821 GLN A N     1 
ATOM   5000  C  CA    . GLN E 3 525 ? 137.138 -53.195 49.062  1.00 44.38  ? 821 GLN A CA    1 
ATOM   5001  C  C     . GLN E 3 525 ? 136.266 -51.966 48.804  1.00 43.73  ? 821 GLN A C     1 
ATOM   5002  O  O     . GLN E 3 525 ? 135.033 -52.083 48.713  1.00 43.49  ? 821 GLN A O     1 
ATOM   5003  C  CB    . GLN E 3 525 ? 136.854 -53.698 50.471  1.00 44.67  ? 821 GLN A CB    1 
ATOM   5004  C  CG    . GLN E 3 525 ? 137.159 -55.157 50.715  1.00 45.59  ? 821 GLN A CG    1 
ATOM   5005  C  CD    . GLN E 3 525 ? 136.994 -55.520 52.180  1.00 46.70  ? 821 GLN A CD    1 
ATOM   5006  O  OE1   . GLN E 3 525 ? 137.781 -55.086 53.031  1.00 46.74  ? 821 GLN A OE1   1 
ATOM   5007  N  NE2   . GLN E 3 525 ? 135.966 -56.314 52.485  1.00 45.97  ? 821 GLN A NE2   1 
ATOM   5008  N  N     . ALA E 3 526 ? 136.907 -50.794 48.721  1.00 42.80  ? 822 ALA A N     1 
ATOM   5009  C  CA    . ALA E 3 526 ? 136.224 -49.523 48.440  1.00 41.71  ? 822 ALA A CA    1 
ATOM   5010  C  C     . ALA E 3 526 ? 135.519 -49.577 47.090  1.00 40.98  ? 822 ALA A C     1 
ATOM   5011  O  O     . ALA E 3 526 ? 136.036 -50.173 46.137  1.00 40.73  ? 822 ALA A O     1 
ATOM   5012  C  CB    . ALA E 3 526 ? 137.213 -48.369 48.460  1.00 41.63  ? 822 ALA A CB    1 
ATOM   5013  N  N     . HIS E 3 527 ? 134.339 -48.963 47.013  1.00 39.95  ? 823 HIS A N     1 
ATOM   5014  C  CA    . HIS E 3 527 ? 133.574 -48.931 45.762  1.00 38.92  ? 823 HIS A CA    1 
ATOM   5015  C  C     . HIS E 3 527 ? 132.659 -47.724 45.696  1.00 37.79  ? 823 HIS A C     1 
ATOM   5016  O  O     . HIS E 3 527 ? 132.188 -47.227 46.716  1.00 37.96  ? 823 HIS A O     1 
ATOM   5017  C  CB    . HIS E 3 527 ? 132.779 -50.226 45.562  1.00 39.04  ? 823 HIS A CB    1 
ATOM   5018  C  CG    . HIS E 3 527 ? 131.772 -50.487 46.635  1.00 39.84  ? 823 HIS A CG    1 
ATOM   5019  N  ND1   . HIS E 3 527 ? 130.426 -50.607 46.377  1.00 40.79  ? 823 HIS A ND1   1 
ATOM   5020  C  CD2   . HIS E 3 527 ? 131.913 -50.625 47.974  1.00 40.69  ? 823 HIS A CD2   1 
ATOM   5021  C  CE1   . HIS E 3 527 ? 129.781 -50.824 47.509  1.00 41.05  ? 823 HIS A CE1   1 
ATOM   5022  N  NE2   . HIS E 3 527 ? 130.661 -50.839 48.492  1.00 40.98  ? 823 HIS A NE2   1 
ATOM   5023  N  N     . LEU E 3 528 ? 132.422 -47.260 44.477  1.00 36.33  ? 824 LEU A N     1 
ATOM   5024  C  CA    . LEU E 3 528 ? 131.566 -46.115 44.223  1.00 34.69  ? 824 LEU A CA    1 
ATOM   5025  C  C     . LEU E 3 528 ? 130.111 -46.360 44.598  1.00 33.36  ? 824 LEU A C     1 
ATOM   5026  O  O     . LEU E 3 528 ? 129.563 -47.418 44.314  1.00 33.15  ? 824 LEU A O     1 
ATOM   5027  C  CB    . LEU E 3 528 ? 131.642 -45.756 42.741  1.00 35.02  ? 824 LEU A CB    1 
ATOM   5028  C  CG    . LEU E 3 528 ? 132.877 -44.995 42.252  1.00 35.21  ? 824 LEU A CG    1 
ATOM   5029  C  CD1   . LEU E 3 528 ? 133.136 -45.324 40.788  1.00 35.51  ? 824 LEU A CD1   1 
ATOM   5030  C  CD2   . LEU E 3 528 ? 132.728 -43.491 42.475  1.00 34.11  ? 824 LEU A CD2   1 
ATOM   5031  N  N     . LEU E 3 529 ? 129.494 -45.367 45.233  1.00 31.98  ? 825 LEU A N     1 
ATOM   5032  C  CA    . LEU E 3 529 ? 128.064 -45.405 45.559  1.00 30.31  ? 825 LEU A CA    1 
ATOM   5033  C  C     . LEU E 3 529 ? 127.268 -44.434 44.686  1.00 29.46  ? 825 LEU A C     1 
ATOM   5034  O  O     . LEU E 3 529 ? 126.268 -44.805 44.082  1.00 29.18  ? 825 LEU A O     1 
ATOM   5035  C  CB    . LEU E 3 529 ? 127.825 -45.055 47.027  1.00 29.83  ? 825 LEU A CB    1 
ATOM   5036  C  CG    . LEU E 3 529 ? 128.178 -46.084 48.095  1.00 29.03  ? 825 LEU A CG    1 
ATOM   5037  C  CD1   . LEU E 3 529 ? 127.966 -45.488 49.475  1.00 27.19  ? 825 LEU A CD1   1 
ATOM   5038  C  CD2   . LEU E 3 529 ? 127.384 -47.389 47.925  1.00 27.60  ? 825 LEU A CD2   1 
ATOM   5039  N  N     . LEU E 3 530 ? 127.715 -43.186 44.630  1.00 28.60  ? 826 LEU A N     1 
ATOM   5040  C  CA    . LEU E 3 530 ? 126.988 -42.165 43.892  1.00 27.92  ? 826 LEU A CA    1 
ATOM   5041  C  C     . LEU E 3 530 ? 127.861 -41.184 43.136  1.00 27.42  ? 826 LEU A C     1 
ATOM   5042  O  O     . LEU E 3 530 ? 129.006 -40.931 43.491  1.00 27.41  ? 826 LEU A O     1 
ATOM   5043  C  CB    . LEU E 3 530 ? 126.099 -41.354 44.838  1.00 27.77  ? 826 LEU A CB    1 
ATOM   5044  C  CG    . LEU E 3 530 ? 124.918 -42.026 45.535  1.00 28.14  ? 826 LEU A CG    1 
ATOM   5045  C  CD1   . LEU E 3 530 ? 124.361 -41.093 46.598  1.00 27.03  ? 826 LEU A CD1   1 
ATOM   5046  C  CD2   . LEU E 3 530 ? 123.833 -42.466 44.535  1.00 27.28  ? 826 LEU A CD2   1 
ATOM   5047  N  N     . GLN E 3 531 ? 127.282 -40.626 42.083  1.00 27.04  ? 827 GLN A N     1 
ATOM   5048  C  CA    . GLN E 3 531 ? 127.876 -39.516 41.372  1.00 26.33  ? 827 GLN A CA    1 
ATOM   5049  C  C     . GLN E 3 531 ? 126.830 -38.415 41.420  1.00 25.74  ? 827 GLN A C     1 
ATOM   5050  O  O     . GLN E 3 531 ? 125.659 -38.659 41.185  1.00 25.47  ? 827 GLN A O     1 
ATOM   5051  C  CB    . GLN E 3 531 ? 128.223 -39.928 39.933  1.00 26.46  ? 827 GLN A CB    1 
ATOM   5052  C  CG    . GLN E 3 531 ? 128.836 -38.834 39.055  1.00 26.36  ? 827 GLN A CG    1 
ATOM   5053  C  CD    . GLN E 3 531 ? 127.808 -38.110 38.195  1.00 26.73  ? 827 GLN A CD    1 
ATOM   5054  O  OE1   . GLN E 3 531 ? 126.853 -37.516 38.696  1.00 25.36  ? 827 GLN A OE1   1 
ATOM   5055  N  NE2   . GLN E 3 531 ? 128.010 -38.157 36.884  1.00 27.24  ? 827 GLN A NE2   1 
ATOM   5056  N  N     . VAL E 3 532 ? 127.245 -37.210 41.772  1.00 25.78  ? 828 VAL A N     1 
ATOM   5057  C  CA    . VAL E 3 532 ? 126.340 -36.069 41.793  1.00 25.84  ? 828 VAL A CA    1 
ATOM   5058  C  C     . VAL E 3 532 ? 126.962 -34.987 40.913  1.00 26.09  ? 828 VAL A C     1 
ATOM   5059  O  O     . VAL E 3 532 ? 127.464 -33.983 41.407  1.00 26.24  ? 828 VAL A O     1 
ATOM   5060  C  CB    . VAL E 3 532 ? 126.058 -35.561 43.255  1.00 25.94  ? 828 VAL A CB    1 
ATOM   5061  C  CG1   . VAL E 3 532 ? 125.029 -34.412 43.287  1.00 25.59  ? 828 VAL A CG1   1 
ATOM   5062  C  CG2   . VAL E 3 532 ? 125.602 -36.707 44.157  1.00 25.76  ? 828 VAL A CG2   1 
ATOM   5063  N  N     . HIS E 3 533 ? 126.968 -35.232 39.602  1.00 26.52  ? 829 HIS A N     1 
ATOM   5064  C  CA    . HIS E 3 533 ? 127.455 -34.273 38.590  1.00 26.95  ? 829 HIS A CA    1 
ATOM   5065  C  C     . HIS E 3 533 ? 128.934 -33.886 38.658  1.00 27.66  ? 829 HIS A C     1 
ATOM   5066  O  O     . HIS E 3 533 ? 129.641 -34.039 37.665  1.00 27.92  ? 829 HIS A O     1 
ATOM   5067  C  CB    . HIS E 3 533 ? 126.558 -33.038 38.541  1.00 26.66  ? 829 HIS A CB    1 
ATOM   5068  C  CG    . HIS E 3 533 ? 125.101 -33.373 38.560  1.00 25.54  ? 829 HIS A CG    1 
ATOM   5069  N  ND1   . HIS E 3 533 ? 124.518 -34.191 37.620  1.00 23.60  ? 829 HIS A ND1   1 
ATOM   5070  C  CD2   . HIS E 3 533 ? 124.114 -33.016 39.414  1.00 24.58  ? 829 HIS A CD2   1 
ATOM   5071  C  CE1   . HIS E 3 533 ? 123.233 -34.322 37.892  1.00 23.60  ? 829 HIS A CE1   1 
ATOM   5072  N  NE2   . HIS E 3 533 ? 122.963 -33.616 38.975  1.00 23.48  ? 829 HIS A NE2   1 
ATOM   5073  N  N     . ASP E 3 534 ? 129.398 -33.366 39.796  1.00 28.33  ? 830 ASP A N     1 
ATOM   5074  C  CA    . ASP E 3 534 ? 130.818 -33.020 39.936  1.00 29.33  ? 830 ASP A CA    1 
ATOM   5075  C  C     . ASP E 3 534 ? 131.463 -33.530 41.221  1.00 29.68  ? 830 ASP A C     1 
ATOM   5076  O  O     . ASP E 3 534 ? 132.493 -33.013 41.663  1.00 29.64  ? 830 ASP A O     1 
ATOM   5077  C  CB    . ASP E 3 534 ? 131.038 -31.520 39.799  1.00 29.55  ? 830 ASP A CB    1 
ATOM   5078  C  CG    . ASP E 3 534 ? 130.281 -30.725 40.826  1.00 30.79  ? 830 ASP A CG    1 
ATOM   5079  O  OD1   . ASP E 3 534 ? 130.159 -31.165 41.985  1.00 32.30  ? 830 ASP A OD1   1 
ATOM   5080  O  OD2   . ASP E 3 534 ? 129.796 -29.638 40.470  1.00 32.37  ? 830 ASP A OD2   1 
ATOM   5081  N  N     . GLU E 3 535 ? 130.850 -34.546 41.813  1.00 30.17  ? 831 GLU A N     1 
ATOM   5082  C  CA    . GLU E 3 535 ? 131.366 -35.145 43.021  1.00 30.63  ? 831 GLU A CA    1 
ATOM   5083  C  C     . GLU E 3 535 ? 131.122 -36.646 43.042  1.00 31.06  ? 831 GLU A C     1 
ATOM   5084  O  O     . GLU E 3 535 ? 130.107 -37.134 42.558  1.00 30.75  ? 831 GLU A O     1 
ATOM   5085  C  CB    . GLU E 3 535 ? 130.749 -34.484 44.252  1.00 30.66  ? 831 GLU A CB    1 
ATOM   5086  C  CG    . GLU E 3 535 ? 129.257 -34.682 44.398  1.00 31.02  ? 831 GLU A CG    1 
ATOM   5087  C  CD    . GLU E 3 535 ? 128.684 -33.932 45.579  1.00 31.03  ? 831 GLU A CD    1 
ATOM   5088  O  OE1   . GLU E 3 535 ? 129.468 -33.326 46.334  1.00 32.90  ? 831 GLU A OE1   1 
ATOM   5089  O  OE2   . GLU E 3 535 ? 127.451 -33.936 45.756  1.00 32.12  ? 831 GLU A OE2   1 
ATOM   5090  N  N     . LEU E 3 536 ? 132.078 -37.375 43.600  1.00 31.85  ? 832 LEU A N     1 
ATOM   5091  C  CA    . LEU E 3 536 ? 131.960 -38.811 43.722  1.00 32.55  ? 832 LEU A CA    1 
ATOM   5092  C  C     . LEU E 3 536 ? 131.765 -39.205 45.180  1.00 33.22  ? 832 LEU A C     1 
ATOM   5093  O  O     . LEU E 3 536 ? 132.220 -38.502 46.094  1.00 32.91  ? 832 LEU A O     1 
ATOM   5094  C  CB    . LEU E 3 536 ? 133.187 -39.505 43.134  1.00 32.79  ? 832 LEU A CB    1 
ATOM   5095  C  CG    . LEU E 3 536 ? 133.385 -39.297 41.632  1.00 32.55  ? 832 LEU A CG    1 
ATOM   5096  C  CD1   . LEU E 3 536 ? 134.489 -40.204 41.143  1.00 31.03  ? 832 LEU A CD1   1 
ATOM   5097  C  CD2   . LEU E 3 536 ? 132.090 -39.577 40.880  1.00 32.46  ? 832 LEU A CD2   1 
ATOM   5098  N  N     . ILE E 3 537 ? 131.067 -40.322 45.389  1.00 33.88  ? 833 ILE A N     1 
ATOM   5099  C  CA    . ILE E 3 537 ? 130.763 -40.806 46.731  1.00 34.62  ? 833 ILE A CA    1 
ATOM   5100  C  C     . ILE E 3 537 ? 131.000 -42.307 46.840  1.00 34.98  ? 833 ILE A C     1 
ATOM   5101  O  O     . ILE E 3 537 ? 130.368 -43.095 46.135  1.00 34.44  ? 833 ILE A O     1 
ATOM   5102  C  CB    . ILE E 3 537 ? 129.315 -40.463 47.131  1.00 34.61  ? 833 ILE A CB    1 
ATOM   5103  C  CG1   . ILE E 3 537 ? 129.128 -38.950 47.134  1.00 35.01  ? 833 ILE A CG1   1 
ATOM   5104  C  CG2   . ILE E 3 537 ? 129.006 -41.000 48.513  1.00 34.61  ? 833 ILE A CG2   1 
ATOM   5105  C  CD1   . ILE E 3 537 ? 127.751 -38.508 46.735  1.00 36.77  ? 833 ILE A CD1   1 
ATOM   5106  N  N     . LEU E 3 538 ? 131.928 -42.685 47.720  1.00 35.77  ? 834 LEU A N     1 
ATOM   5107  C  CA    . LEU E 3 538 ? 132.248 -44.094 47.955  1.00 36.67  ? 834 LEU A CA    1 
ATOM   5108  C  C     . LEU E 3 538 ? 132.066 -44.503 49.419  1.00 37.35  ? 834 LEU A C     1 
ATOM   5109  O  O     . LEU E 3 538 ? 131.978 -43.658 50.317  1.00 37.29  ? 834 LEU A O     1 
ATOM   5110  C  CB    . LEU E 3 538 ? 133.693 -44.403 47.555  1.00 36.44  ? 834 LEU A CB    1 
ATOM   5111  C  CG    . LEU E 3 538 ? 134.235 -44.048 46.173  1.00 36.43  ? 834 LEU A CG    1 
ATOM   5112  C  CD1   . LEU E 3 538 ? 134.676 -42.580 46.120  1.00 36.51  ? 834 LEU A CD1   1 
ATOM   5113  C  CD2   . LEU E 3 538 ? 135.405 -44.956 45.851  1.00 35.46  ? 834 LEU A CD2   1 
ATOM   5114  N  N     . GLU E 3 539 ? 131.998 -45.810 49.644  1.00 38.10  ? 835 GLU A N     1 
ATOM   5115  C  CA    . GLU E 3 539 ? 132.049 -46.355 50.990  1.00 39.00  ? 835 GLU A CA    1 
ATOM   5116  C  C     . GLU E 3 539 ? 133.218 -47.330 51.039  1.00 40.01  ? 835 GLU A C     1 
ATOM   5117  O  O     . GLU E 3 539 ? 133.569 -47.952 50.027  1.00 40.08  ? 835 GLU A O     1 
ATOM   5118  C  CB    . GLU E 3 539 ? 130.748 -47.044 51.387  1.00 38.72  ? 835 GLU A CB    1 
ATOM   5119  C  CG    . GLU E 3 539 ? 130.417 -48.273 50.577  1.00 37.94  ? 835 GLU A CG    1 
ATOM   5120  C  CD    . GLU E 3 539 ? 129.191 -48.981 51.096  1.00 37.39  ? 835 GLU A CD    1 
ATOM   5121  O  OE1   . GLU E 3 539 ? 128.725 -48.634 52.202  1.00 36.37  ? 835 GLU A OE1   1 
ATOM   5122  O  OE2   . GLU E 3 539 ? 128.689 -49.887 50.399  1.00 37.83  ? 835 GLU A OE2   1 
ATOM   5123  N  N     . ALA E 3 540 ? 133.826 -47.458 52.211  1.00 41.14  ? 836 ALA A N     1 
ATOM   5124  C  CA    . ALA E 3 540 ? 134.995 -48.307 52.362  1.00 42.31  ? 836 ALA A CA    1 
ATOM   5125  C  C     . ALA E 3 540 ? 135.229 -48.684 53.816  1.00 43.21  ? 836 ALA A C     1 
ATOM   5126  O  O     . ALA E 3 540 ? 134.832 -47.948 54.719  1.00 43.18  ? 836 ALA A O     1 
ATOM   5127  C  CB    . ALA E 3 540 ? 136.227 -47.597 51.804  1.00 42.20  ? 836 ALA A CB    1 
ATOM   5128  N  N     . PRO E 3 541 ? 135.868 -49.843 54.050  1.00 44.20  ? 837 PRO A N     1 
ATOM   5129  C  CA    . PRO E 3 541 ? 136.238 -50.162 55.417  1.00 45.10  ? 837 PRO A CA    1 
ATOM   5130  C  C     . PRO E 3 541 ? 137.116 -49.052 55.997  1.00 46.04  ? 837 PRO A C     1 
ATOM   5131  O  O     . PRO E 3 541 ? 137.884 -48.426 55.272  1.00 46.14  ? 837 PRO A O     1 
ATOM   5132  C  CB    . PRO E 3 541 ? 137.020 -51.477 55.281  1.00 45.00  ? 837 PRO A CB    1 
ATOM   5133  C  CG    . PRO E 3 541 ? 137.338 -51.621 53.834  1.00 44.41  ? 837 PRO A CG    1 
ATOM   5134  C  CD    . PRO E 3 541 ? 136.254 -50.906 53.107  1.00 44.27  ? 837 PRO A CD    1 
ATOM   5135  N  N     . LYS E 3 542 ? 136.971 -48.817 57.296  1.00 47.21  ? 838 LYS A N     1 
ATOM   5136  C  CA    . LYS E 3 542 ? 137.681 -47.771 58.027  1.00 48.38  ? 838 LYS A CA    1 
ATOM   5137  C  C     . LYS E 3 542 ? 139.182 -47.693 57.713  1.00 49.15  ? 838 LYS A C     1 
ATOM   5138  O  O     . LYS E 3 542 ? 139.742 -46.593 57.599  1.00 49.19  ? 838 LYS A O     1 
ATOM   5139  C  CB    . LYS E 3 542 ? 137.440 -47.982 59.531  1.00 48.46  ? 838 LYS A CB    1 
ATOM   5140  C  CG    . LYS E 3 542 ? 137.894 -46.861 60.455  1.00 49.17  ? 838 LYS A CG    1 
ATOM   5141  C  CD    . LYS E 3 542 ? 137.094 -46.875 61.770  1.00 50.57  ? 838 LYS A CD    1 
ATOM   5142  C  CE    . LYS E 3 542 ? 137.105 -48.242 62.478  1.00 49.88  ? 838 LYS A CE    1 
ATOM   5143  N  NZ    . LYS E 3 542 ? 138.444 -48.575 63.026  1.00 48.70  ? 838 LYS A NZ    1 
ATOM   5144  N  N     . GLU E 3 543 ? 139.812 -48.862 57.568  1.00 50.10  ? 839 GLU A N     1 
ATOM   5145  C  CA    . GLU E 3 543 ? 141.255 -48.986 57.305  1.00 50.99  ? 839 GLU A CA    1 
ATOM   5146  C  C     . GLU E 3 543 ? 141.734 -48.294 56.028  1.00 51.53  ? 839 GLU A C     1 
ATOM   5147  O  O     . GLU E 3 543 ? 142.813 -47.691 56.004  1.00 51.55  ? 839 GLU A O     1 
ATOM   5148  C  CB    . GLU E 3 543 ? 141.665 -50.463 57.230  1.00 51.01  ? 839 GLU A CB    1 
ATOM   5149  C  CG    . GLU E 3 543 ? 141.532 -51.251 58.532  1.00 51.87  ? 839 GLU A CG    1 
ATOM   5150  C  CD    . GLU E 3 543 ? 140.132 -51.806 58.774  1.00 52.89  ? 839 GLU A CD    1 
ATOM   5151  O  OE1   . GLU E 3 543 ? 139.860 -52.224 59.925  1.00 53.53  ? 839 GLU A OE1   1 
ATOM   5152  O  OE2   . GLU E 3 543 ? 139.310 -51.831 57.826  1.00 52.32  ? 839 GLU A OE2   1 
ATOM   5153  N  N     . GLU E 3 544 ? 140.920 -48.385 54.977  1.00 52.23  ? 840 GLU A N     1 
ATOM   5154  C  CA    . GLU E 3 544 ? 141.276 -47.882 53.645  1.00 52.83  ? 840 GLU A CA    1 
ATOM   5155  C  C     . GLU E 3 544 ? 141.276 -46.359 53.469  1.00 53.25  ? 840 GLU A C     1 
ATOM   5156  O  O     . GLU E 3 544 ? 141.729 -45.853 52.433  1.00 53.37  ? 840 GLU A O     1 
ATOM   5157  C  CB    . GLU E 3 544 ? 140.390 -48.534 52.579  1.00 52.67  ? 840 GLU A CB    1 
ATOM   5158  C  CG    . GLU E 3 544 ? 140.495 -50.051 52.541  1.00 52.96  ? 840 GLU A CG    1 
ATOM   5159  C  CD    . GLU E 3 544 ? 139.762 -50.651 51.365  1.00 53.60  ? 840 GLU A CD    1 
ATOM   5160  O  OE1   . GLU E 3 544 ? 139.675 -51.893 51.277  1.00 54.14  ? 840 GLU A OE1   1 
ATOM   5161  O  OE2   . GLU E 3 544 ? 139.267 -49.880 50.521  1.00 54.29  ? 840 GLU A OE2   1 
ATOM   5162  N  N     . MET E 3 545 ? 140.793 -45.630 54.472  1.00 53.69  ? 841 MET A N     1 
ATOM   5163  C  CA    . MET E 3 545 ? 140.729 -44.172 54.369  1.00 54.30  ? 841 MET A CA    1 
ATOM   5164  C  C     . MET E 3 545 ? 142.054 -43.512 53.978  1.00 54.72  ? 841 MET A C     1 
ATOM   5165  O  O     . MET E 3 545 ? 142.044 -42.501 53.284  1.00 54.78  ? 841 MET A O     1 
ATOM   5166  C  CB    . MET E 3 545 ? 140.175 -43.537 55.647  1.00 54.20  ? 841 MET A CB    1 
ATOM   5167  C  CG    . MET E 3 545 ? 138.693 -43.792 55.923  1.00 54.44  ? 841 MET A CG    1 
ATOM   5168  S  SD    . MET E 3 545 ? 137.505 -43.207 54.678  1.00 54.83  ? 841 MET A SD    1 
ATOM   5169  C  CE    . MET E 3 545 ? 137.204 -44.690 53.717  1.00 53.27  ? 841 MET A CE    1 
ATOM   5170  N  N     . GLU E 3 546 ? 143.186 -44.071 54.412  1.00 55.34  ? 842 GLU A N     1 
ATOM   5171  C  CA    . GLU E 3 546 ? 144.481 -43.472 54.062  1.00 55.77  ? 842 GLU A CA    1 
ATOM   5172  C  C     . GLU E 3 546 ? 144.744 -43.455 52.563  1.00 55.74  ? 842 GLU A C     1 
ATOM   5173  O  O     . GLU E 3 546 ? 145.052 -42.399 52.002  1.00 55.69  ? 842 GLU A O     1 
ATOM   5174  C  CB    . GLU E 3 546 ? 145.674 -44.103 54.799  1.00 55.83  ? 842 GLU A CB    1 
ATOM   5175  C  CG    . GLU E 3 546 ? 146.108 -43.345 56.066  1.00 56.87  ? 842 GLU A CG    1 
ATOM   5176  C  CD    . GLU E 3 546 ? 147.634 -43.289 56.240  1.00 57.76  ? 842 GLU A CD    1 
ATOM   5177  O  OE1   . GLU E 3 546 ? 148.172 -43.978 57.132  1.00 58.34  ? 842 GLU A OE1   1 
ATOM   5178  O  OE2   . GLU E 3 546 ? 148.303 -42.561 55.475  1.00 57.92  ? 842 GLU A OE2   1 
ATOM   5179  N  N     . ARG E 3 547 ? 144.615 -44.614 51.919  1.00 55.74  ? 843 ARG A N     1 
ATOM   5180  C  CA    . ARG E 3 547 ? 144.887 -44.707 50.488  1.00 55.88  ? 843 ARG A CA    1 
ATOM   5181  C  C     . ARG E 3 547 ? 143.980 -43.755 49.710  1.00 55.75  ? 843 ARG A C     1 
ATOM   5182  O  O     . ARG E 3 547 ? 144.455 -42.980 48.875  1.00 55.66  ? 843 ARG A O     1 
ATOM   5183  C  CB    . ARG E 3 547 ? 144.741 -46.148 49.981  1.00 56.02  ? 843 ARG A CB    1 
ATOM   5184  C  CG    . ARG E 3 547 ? 145.154 -46.346 48.513  1.00 56.87  ? 843 ARG A CG    1 
ATOM   5185  C  CD    . ARG E 3 547 ? 146.679 -46.320 48.315  1.00 58.53  ? 843 ARG A CD    1 
ATOM   5186  N  NE    . ARG E 3 547 ? 147.066 -46.199 46.902  1.00 59.43  ? 843 ARG A NE    1 
ATOM   5187  C  CZ    . ARG E 3 547 ? 147.649 -45.128 46.360  1.00 59.55  ? 843 ARG A CZ    1 
ATOM   5188  N  NH1   . ARG E 3 547 ? 147.948 -44.065 47.103  1.00 59.66  ? 843 ARG A NH1   1 
ATOM   5189  N  NH2   . ARG E 3 547 ? 147.950 -45.124 45.068  1.00 59.18  ? 843 ARG A NH2   1 
ATOM   5190  N  N     . LEU E 3 548 ? 142.684 -43.799 50.023  1.00 55.58  ? 844 LEU A N     1 
ATOM   5191  C  CA    . LEU E 3 548 ? 141.673 -42.965 49.361  1.00 55.31  ? 844 LEU A CA    1 
ATOM   5192  C  C     . LEU E 3 548 ? 141.940 -41.462 49.403  1.00 55.16  ? 844 LEU A C     1 
ATOM   5193  O  O     . LEU E 3 548 ? 141.692 -40.761 48.421  1.00 55.07  ? 844 LEU A O     1 
ATOM   5194  C  CB    . LEU E 3 548 ? 140.279 -43.267 49.916  1.00 55.33  ? 844 LEU A CB    1 
ATOM   5195  C  CG    . LEU E 3 548 ? 139.432 -44.301 49.168  1.00 55.26  ? 844 LEU A CG    1 
ATOM   5196  C  CD1   . LEU E 3 548 ? 140.175 -45.604 48.908  1.00 55.16  ? 844 LEU A CD1   1 
ATOM   5197  C  CD2   . LEU E 3 548 ? 138.134 -44.544 49.922  1.00 55.35  ? 844 LEU A CD2   1 
ATOM   5198  N  N     . CYS E 3 549 ? 142.440 -40.971 50.535  1.00 55.00  ? 845 CYS A N     1 
ATOM   5199  C  CA    . CYS E 3 549 ? 142.756 -39.550 50.680  1.00 55.00  ? 845 CYS A CA    1 
ATOM   5200  C  C     . CYS E 3 549 ? 143.842 -39.125 49.695  1.00 54.77  ? 845 CYS A C     1 
ATOM   5201  O  O     . CYS E 3 549 ? 144.025 -37.934 49.431  1.00 54.79  ? 845 CYS A O     1 
ATOM   5202  C  CB    . CYS E 3 549 ? 143.205 -39.235 52.112  1.00 55.21  ? 845 CYS A CB    1 
ATOM   5203  S  SG    . CYS E 3 549 ? 141.961 -39.505 53.397  1.00 55.50  ? 845 CYS A SG    1 
ATOM   5204  N  N     . ARG E 3 550 ? 144.556 -40.113 49.162  1.00 54.51  ? 846 ARG A N     1 
ATOM   5205  C  CA    . ARG E 3 550 ? 145.641 -39.883 48.224  1.00 54.36  ? 846 ARG A CA    1 
ATOM   5206  C  C     . ARG E 3 550 ? 145.193 -40.306 46.834  1.00 53.77  ? 846 ARG A C     1 
ATOM   5207  O  O     . ARG E 3 550 ? 145.454 -39.614 45.847  1.00 53.86  ? 846 ARG A O     1 
ATOM   5208  C  CB    . ARG E 3 550 ? 146.871 -40.688 48.652  1.00 54.64  ? 846 ARG A CB    1 
ATOM   5209  C  CG    . ARG E 3 550 ? 148.186 -40.219 48.049  1.00 56.36  ? 846 ARG A CG    1 
ATOM   5210  C  CD    . ARG E 3 550 ? 149.373 -40.691 48.898  1.00 59.09  ? 846 ARG A CD    1 
ATOM   5211  N  NE    . ARG E 3 550 ? 150.622 -40.035 48.511  1.00 60.83  ? 846 ARG A NE    1 
ATOM   5212  C  CZ    . ARG E 3 550 ? 151.752 -40.074 49.217  1.00 62.26  ? 846 ARG A CZ    1 
ATOM   5213  N  NH1   . ARG E 3 550 ? 151.815 -40.735 50.370  1.00 62.57  ? 846 ARG A NH1   1 
ATOM   5214  N  NH2   . ARG E 3 550 ? 152.830 -39.441 48.771  1.00 62.68  ? 846 ARG A NH2   1 
ATOM   5215  N  N     . LEU E 3 551 ? 144.492 -41.433 46.772  1.00 52.84  ? 847 LEU A N     1 
ATOM   5216  C  CA    . LEU E 3 551 ? 144.043 -42.008 45.510  1.00 51.97  ? 847 LEU A CA    1 
ATOM   5217  C  C     . LEU E 3 551 ? 142.964 -41.182 44.809  1.00 51.59  ? 847 LEU A C     1 
ATOM   5218  O  O     . LEU E 3 551 ? 143.215 -40.597 43.759  1.00 51.53  ? 847 LEU A O     1 
ATOM   5219  C  CB    . LEU E 3 551 ? 143.558 -43.443 45.734  1.00 51.93  ? 847 LEU A CB    1 
ATOM   5220  C  CG    . LEU E 3 551 ? 143.169 -44.266 44.510  1.00 51.80  ? 847 LEU A CG    1 
ATOM   5221  C  CD1   . LEU E 3 551 ? 144.250 -44.190 43.445  1.00 52.23  ? 847 LEU A CD1   1 
ATOM   5222  C  CD2   . LEU E 3 551 ? 142.906 -45.704 44.911  1.00 51.68  ? 847 LEU A CD2   1 
ATOM   5223  N  N     . VAL E 3 552 ? 141.773 -41.139 45.395  1.00 50.94  ? 848 VAL A N     1 
ATOM   5224  C  CA    . VAL E 3 552 ? 140.625 -40.442 44.801  1.00 50.48  ? 848 VAL A CA    1 
ATOM   5225  C  C     . VAL E 3 552 ? 140.930 -39.081 44.132  1.00 50.31  ? 848 VAL A C     1 
ATOM   5226  O  O     . VAL E 3 552 ? 140.609 -38.890 42.956  1.00 50.07  ? 848 VAL A O     1 
ATOM   5227  C  CB    . VAL E 3 552 ? 139.441 -40.328 45.807  1.00 50.53  ? 848 VAL A CB    1 
ATOM   5228  C  CG1   . VAL E 3 552 ? 138.246 -39.677 45.155  1.00 49.83  ? 848 VAL A CG1   1 
ATOM   5229  C  CG2   . VAL E 3 552 ? 139.060 -41.711 46.348  1.00 50.41  ? 848 VAL A CG2   1 
ATOM   5230  N  N     . PRO E 3 553 ? 141.553 -38.136 44.862  1.00 50.15  ? 849 PRO A N     1 
ATOM   5231  C  CA    . PRO E 3 553 ? 141.832 -36.849 44.214  1.00 50.14  ? 849 PRO A CA    1 
ATOM   5232  C  C     . PRO E 3 553 ? 142.862 -36.942 43.083  1.00 50.00  ? 849 PRO A C     1 
ATOM   5233  O  O     . PRO E 3 553 ? 142.764 -36.208 42.106  1.00 49.92  ? 849 PRO A O     1 
ATOM   5234  C  CB    . PRO E 3 553 ? 142.371 -35.980 45.362  1.00 50.16  ? 849 PRO A CB    1 
ATOM   5235  C  CG    . PRO E 3 553 ? 141.994 -36.701 46.611  1.00 50.11  ? 849 PRO A CG    1 
ATOM   5236  C  CD    . PRO E 3 553 ? 142.015 -38.144 46.259  1.00 50.13  ? 849 PRO A CD    1 
ATOM   5237  N  N     . GLU E 3 554 ? 143.831 -37.842 43.221  1.00 49.91  ? 850 GLU A N     1 
ATOM   5238  C  CA    . GLU E 3 554 ? 144.865 -38.048 42.208  1.00 49.93  ? 850 GLU A CA    1 
ATOM   5239  C  C     . GLU E 3 554 ? 144.222 -38.476 40.895  1.00 49.26  ? 850 GLU A C     1 
ATOM   5240  O  O     . GLU E 3 554 ? 144.526 -37.919 39.852  1.00 49.37  ? 850 GLU A O     1 
ATOM   5241  C  CB    . GLU E 3 554 ? 145.852 -39.125 42.675  1.00 49.95  ? 850 GLU A CB    1 
ATOM   5242  C  CG    . GLU E 3 554 ? 147.204 -39.140 41.972  1.00 50.54  ? 850 GLU A CG    1 
ATOM   5243  C  CD    . GLU E 3 554 ? 148.071 -40.323 42.410  1.00 51.14  ? 850 GLU A CD    1 
ATOM   5244  O  OE1   . GLU E 3 554 ? 147.950 -41.418 41.805  1.00 53.17  ? 850 GLU A OE1   1 
ATOM   5245  O  OE2   . GLU E 3 554 ? 148.889 -40.155 43.348  1.00 52.21  ? 850 GLU A OE2   1 
ATOM   5246  N  N     . VAL E 3 555 ? 143.325 -39.458 40.959  1.00 48.67  ? 851 VAL A N     1 
ATOM   5247  C  CA    . VAL E 3 555 ? 142.618 -39.954 39.775  1.00 48.08  ? 851 VAL A CA    1 
ATOM   5248  C  C     . VAL E 3 555 ? 141.724 -38.889 39.135  1.00 47.77  ? 851 VAL A C     1 
ATOM   5249  O  O     . VAL E 3 555 ? 141.771 -38.685 37.918  1.00 47.87  ? 851 VAL A O     1 
ATOM   5250  C  CB    . VAL E 3 555 ? 141.774 -41.209 40.095  1.00 48.14  ? 851 VAL A CB    1 
ATOM   5251  C  CG1   . VAL E 3 555 ? 140.871 -41.562 38.929  1.00 48.03  ? 851 VAL A CG1   1 
ATOM   5252  C  CG2   . VAL E 3 555 ? 142.673 -42.384 40.448  1.00 47.82  ? 851 VAL A CG2   1 
ATOM   5253  N  N     . MET E 3 556 ? 140.931 -38.204 39.954  1.00 47.32  ? 852 MET A N     1 
ATOM   5254  C  CA    . MET E 3 556 ? 140.022 -37.167 39.461  1.00 47.26  ? 852 MET A CA    1 
ATOM   5255  C  C     . MET E 3 556 ? 140.725 -35.983 38.779  1.00 47.45  ? 852 MET A C     1 
ATOM   5256  O  O     . MET E 3 556 ? 140.202 -35.401 37.832  1.00 47.17  ? 852 MET A O     1 
ATOM   5257  C  CB    . MET E 3 556 ? 139.096 -36.685 40.582  1.00 47.08  ? 852 MET A CB    1 
ATOM   5258  C  CG    . MET E 3 556 ? 138.161 -37.772 41.098  1.00 47.04  ? 852 MET A CG    1 
ATOM   5259  S  SD    . MET E 3 556 ? 137.142 -37.303 42.514  1.00 46.71  ? 852 MET A SD    1 
ATOM   5260  C  CE    . MET E 3 556 ? 135.860 -36.333 41.740  1.00 46.71  ? 852 MET A CE    1 
ATOM   5261  N  N     . GLU E 3 557 ? 141.913 -35.636 39.259  1.00 47.93  ? 853 GLU A N     1 
ATOM   5262  C  CA    . GLU E 3 557 ? 142.683 -34.531 38.686  1.00 48.44  ? 853 GLU A CA    1 
ATOM   5263  C  C     . GLU E 3 557 ? 143.446 -34.970 37.437  1.00 48.36  ? 853 GLU A C     1 
ATOM   5264  O  O     . GLU E 3 557 ? 143.633 -34.188 36.505  1.00 48.03  ? 853 GLU A O     1 
ATOM   5265  C  CB    . GLU E 3 557 ? 143.635 -33.961 39.740  1.00 48.52  ? 853 GLU A CB    1 
ATOM   5266  C  CG    . GLU E 3 557 ? 142.893 -33.376 40.932  1.00 49.82  ? 853 GLU A CG    1 
ATOM   5267  C  CD    . GLU E 3 557 ? 143.729 -33.320 42.196  1.00 51.81  ? 853 GLU A CD    1 
ATOM   5268  O  OE1   . GLU E 3 557 ? 143.322 -32.616 43.145  1.00 51.69  ? 853 GLU A OE1   1 
ATOM   5269  O  OE2   . GLU E 3 557 ? 144.783 -33.994 42.252  1.00 53.68  ? 853 GLU A OE2   1 
ATOM   5270  N  N     . GLN E 3 558 ? 143.860 -36.236 37.422  1.00 48.50  ? 854 GLN A N     1 
ATOM   5271  C  CA    . GLN E 3 558 ? 144.611 -36.792 36.298  1.00 48.74  ? 854 GLN A CA    1 
ATOM   5272  C  C     . GLN E 3 558 ? 143.733 -37.333 35.162  1.00 48.49  ? 854 GLN A C     1 
ATOM   5273  O  O     . GLN E 3 558 ? 144.260 -37.798 34.151  1.00 48.51  ? 854 GLN A O     1 
ATOM   5274  C  CB    . GLN E 3 558 ? 145.585 -37.881 36.780  1.00 48.91  ? 854 GLN A CB    1 
ATOM   5275  C  CG    . GLN E 3 558 ? 146.647 -37.389 37.764  1.00 49.71  ? 854 GLN A CG    1 
ATOM   5276  C  CD    . GLN E 3 558 ? 147.427 -36.201 37.235  1.00 51.05  ? 854 GLN A CD    1 
ATOM   5277  O  OE1   . GLN E 3 558 ? 148.205 -36.320 36.284  1.00 51.51  ? 854 GLN A OE1   1 
ATOM   5278  N  NE2   . GLN E 3 558 ? 147.228 -35.042 37.858  1.00 51.24  ? 854 GLN A NE2   1 
ATOM   5279  N  N     . ALA E 3 559 ? 142.409 -37.281 35.334  1.00 48.19  ? 855 ALA A N     1 
ATOM   5280  C  CA    . ALA E 3 559 ? 141.455 -37.779 34.327  1.00 47.73  ? 855 ALA A CA    1 
ATOM   5281  C  C     . ALA E 3 559 ? 141.703 -37.155 32.952  1.00 47.45  ? 855 ALA A C     1 
ATOM   5282  O  O     . ALA E 3 559 ? 141.914 -37.859 31.962  1.00 47.08  ? 855 ALA A O     1 
ATOM   5283  C  CB    . ALA E 3 559 ? 140.025 -37.527 34.783  1.00 47.74  ? 855 ALA A CB    1 
ATOM   5284  N  N     . VAL E 3 560 ? 141.653 -35.828 32.901  1.00 47.30  ? 856 VAL A N     1 
ATOM   5285  C  CA    . VAL E 3 560 ? 142.035 -35.085 31.710  1.00 47.25  ? 856 VAL A CA    1 
ATOM   5286  C  C     . VAL E 3 560 ? 143.069 -34.063 32.156  1.00 47.30  ? 856 VAL A C     1 
ATOM   5287  O  O     . VAL E 3 560 ? 143.260 -33.849 33.354  1.00 47.35  ? 856 VAL A O     1 
ATOM   5288  C  CB    . VAL E 3 560 ? 140.847 -34.352 31.031  1.00 47.15  ? 856 VAL A CB    1 
ATOM   5289  C  CG1   . VAL E 3 560 ? 139.662 -35.279 30.876  1.00 47.47  ? 856 VAL A CG1   1 
ATOM   5290  C  CG2   . VAL E 3 560 ? 140.450 -33.098 31.805  1.00 47.11  ? 856 VAL A CG2   1 
ATOM   5291  N  N     . THR E 3 561 ? 143.759 -33.455 31.202  1.00 47.33  ? 857 THR A N     1 
ATOM   5292  C  CA    . THR E 3 561 ? 144.705 -32.415 31.537  1.00 47.36  ? 857 THR A CA    1 
ATOM   5293  C  C     . THR E 3 561 ? 144.184 -31.175 30.865  1.00 47.33  ? 857 THR A C     1 
ATOM   5294  O  O     . THR E 3 561 ? 143.742 -31.233 29.724  1.00 47.57  ? 857 THR A O     1 
ATOM   5295  C  CB    . THR E 3 561 ? 146.109 -32.728 31.038  1.00 47.44  ? 857 THR A CB    1 
ATOM   5296  O  OG1   . THR E 3 561 ? 146.384 -34.121 31.238  1.00 47.35  ? 857 THR A OG1   1 
ATOM   5297  C  CG2   . THR E 3 561 ? 147.133 -31.887 31.802  1.00 47.68  ? 857 THR A CG2   1 
ATOM   5298  N  N     . LEU E 3 562 ? 144.203 -30.058 31.578  1.00 47.16  ? 858 LEU A N     1 
ATOM   5299  C  CA    . LEU E 3 562 ? 143.659 -28.825 31.039  1.00 46.96  ? 858 LEU A CA    1 
ATOM   5300  C  C     . LEU E 3 562 ? 144.682 -27.698 31.113  1.00 47.09  ? 858 LEU A C     1 
ATOM   5301  O  O     . LEU E 3 562 ? 145.741 -27.849 31.723  1.00 47.00  ? 858 LEU A O     1 
ATOM   5302  C  CB    . LEU E 3 562 ? 142.372 -28.440 31.784  1.00 46.80  ? 858 LEU A CB    1 
ATOM   5303  C  CG    . LEU E 3 562 ? 141.178 -29.398 31.696  1.00 46.26  ? 858 LEU A CG    1 
ATOM   5304  C  CD1   . LEU E 3 562 ? 139.980 -28.817 32.408  1.00 45.20  ? 858 LEU A CD1   1 
ATOM   5305  C  CD2   . LEU E 3 562 ? 140.825 -29.702 30.248  1.00 45.97  ? 858 LEU A CD2   1 
ATOM   5306  N  N     . ARG E 3 563 ? 144.362 -26.570 30.483  1.00 47.17  ? 859 ARG A N     1 
ATOM   5307  C  CA    . ARG E 3 563 ? 145.230 -25.402 30.524  1.00 47.29  ? 859 ARG A CA    1 
ATOM   5308  C  C     . ARG E 3 563 ? 145.309 -24.810 31.933  1.00 47.37  ? 859 ARG A C     1 
ATOM   5309  O  O     . ARG E 3 563 ? 146.056 -23.872 32.182  1.00 47.66  ? 859 ARG A O     1 
ATOM   5310  C  CB    . ARG E 3 563 ? 144.812 -24.371 29.471  1.00 47.14  ? 859 ARG A CB    1 
ATOM   5311  C  CG    . ARG E 3 563 ? 145.408 -24.670 28.101  1.00 47.45  ? 859 ARG A CG    1 
ATOM   5312  C  CD    . ARG E 3 563 ? 144.988 -23.665 27.047  1.00 47.99  ? 859 ARG A CD    1 
ATOM   5313  N  NE    . ARG E 3 563 ? 143.670 -23.965 26.492  1.00 48.35  ? 859 ARG A NE    1 
ATOM   5314  C  CZ    . ARG E 3 563 ? 143.458 -24.572 25.327  1.00 48.26  ? 859 ARG A CZ    1 
ATOM   5315  N  NH1   . ARG E 3 563 ? 144.480 -24.947 24.566  1.00 48.71  ? 859 ARG A NH1   1 
ATOM   5316  N  NH2   . ARG E 3 563 ? 142.217 -24.798 24.916  1.00 48.08  ? 859 ARG A NH2   1 
ATOM   5317  N  N     . VAL E 3 564 ? 144.530 -25.380 32.846  1.00 47.44  ? 860 VAL A N     1 
ATOM   5318  C  CA    . VAL E 3 564 ? 144.565 -25.031 34.263  1.00 47.45  ? 860 VAL A CA    1 
ATOM   5319  C  C     . VAL E 3 564 ? 144.474 -26.321 35.078  1.00 47.38  ? 860 VAL A C     1 
ATOM   5320  O  O     . VAL E 3 564 ? 144.029 -27.354 34.572  1.00 47.48  ? 860 VAL A O     1 
ATOM   5321  C  CB    . VAL E 3 564 ? 143.424 -24.074 34.667  1.00 47.54  ? 860 VAL A CB    1 
ATOM   5322  C  CG1   . VAL E 3 564 ? 143.634 -22.702 34.045  1.00 47.80  ? 860 VAL A CG1   1 
ATOM   5323  C  CG2   . VAL E 3 564 ? 142.055 -24.654 34.302  1.00 47.55  ? 860 VAL A CG2   1 
ATOM   5324  N  N     . PRO E 3 565 ? 144.906 -26.276 36.342  1.00 47.26  ? 861 PRO A N     1 
ATOM   5325  C  CA    . PRO E 3 565 ? 144.845 -27.510 37.112  1.00 46.99  ? 861 PRO A CA    1 
ATOM   5326  C  C     . PRO E 3 565 ? 143.443 -27.807 37.640  1.00 46.72  ? 861 PRO A C     1 
ATOM   5327  O  O     . PRO E 3 565 ? 142.605 -26.912 37.750  1.00 46.34  ? 861 PRO A O     1 
ATOM   5328  C  CB    . PRO E 3 565 ? 145.801 -27.237 38.276  1.00 47.00  ? 861 PRO A CB    1 
ATOM   5329  C  CG    . PRO E 3 565 ? 145.732 -25.755 38.477  1.00 47.12  ? 861 PRO A CG    1 
ATOM   5330  C  CD    . PRO E 3 565 ? 145.460 -25.149 37.120  1.00 47.29  ? 861 PRO A CD    1 
ATOM   5331  N  N     . LEU E 3 566 ? 143.200 -29.070 37.956  1.00 46.63  ? 862 LEU A N     1 
ATOM   5332  C  CA    . LEU E 3 566 ? 141.929 -29.470 38.527  1.00 46.70  ? 862 LEU A CA    1 
ATOM   5333  C  C     . LEU E 3 566 ? 142.096 -29.783 40.024  1.00 46.68  ? 862 LEU A C     1 
ATOM   5334  O  O     . LEU E 3 566 ? 142.956 -30.575 40.406  1.00 46.71  ? 862 LEU A O     1 
ATOM   5335  C  CB    . LEU E 3 566 ? 141.352 -30.664 37.757  1.00 46.57  ? 862 LEU A CB    1 
ATOM   5336  C  CG    . LEU E 3 566 ? 140.977 -30.419 36.289  1.00 46.24  ? 862 LEU A CG    1 
ATOM   5337  C  CD1   . LEU E 3 566 ? 140.549 -31.717 35.606  1.00 45.62  ? 862 LEU A CD1   1 
ATOM   5338  C  CD2   . LEU E 3 566 ? 139.888 -29.368 36.173  1.00 45.14  ? 862 LEU A CD2   1 
ATOM   5339  N  N     . LYS E 3 567 ? 141.287 -29.142 40.866  1.00 46.59  ? 863 LYS A N     1 
ATOM   5340  C  CA    . LYS E 3 567 ? 141.365 -29.358 42.311  1.00 46.48  ? 863 LYS A CA    1 
ATOM   5341  C  C     . LYS E 3 567 ? 140.157 -30.144 42.823  1.00 46.07  ? 863 LYS A C     1 
ATOM   5342  O  O     . LYS E 3 567 ? 139.052 -30.019 42.292  1.00 46.01  ? 863 LYS A O     1 
ATOM   5343  C  CB    . LYS E 3 567 ? 141.501 -28.025 43.056  1.00 46.52  ? 863 LYS A CB    1 
ATOM   5344  C  CG    . LYS E 3 567 ? 141.925 -28.181 44.506  1.00 47.45  ? 863 LYS A CG    1 
ATOM   5345  C  CD    . LYS E 3 567 ? 141.876 -26.857 45.246  1.00 49.36  ? 863 LYS A CD    1 
ATOM   5346  C  CE    . LYS E 3 567 ? 142.196 -27.034 46.728  1.00 49.87  ? 863 LYS A CE    1 
ATOM   5347  N  NZ    . LYS E 3 567 ? 141.973 -25.771 47.487  1.00 50.14  ? 863 LYS A NZ    1 
ATOM   5348  N  N     . VAL E 3 568 ? 140.382 -30.965 43.844  1.00 45.67  ? 864 VAL A N     1 
ATOM   5349  C  CA    . VAL E 3 568 ? 139.334 -31.800 44.424  1.00 45.44  ? 864 VAL A CA    1 
ATOM   5350  C  C     . VAL E 3 568 ? 139.316 -31.712 45.943  1.00 45.28  ? 864 VAL A C     1 
ATOM   5351  O  O     . VAL E 3 568 ? 140.340 -31.870 46.598  1.00 45.33  ? 864 VAL A O     1 
ATOM   5352  C  CB    . VAL E 3 568 ? 139.487 -33.285 44.015  1.00 45.44  ? 864 VAL A CB    1 
ATOM   5353  C  CG1   . VAL E 3 568 ? 138.485 -34.164 44.762  1.00 45.14  ? 864 VAL A CG1   1 
ATOM   5354  C  CG2   . VAL E 3 568 ? 139.315 -33.450 42.514  1.00 45.31  ? 864 VAL A CG2   1 
ATOM   5355  N  N     . ASP E 3 569 ? 138.147 -31.446 46.501  1.00 45.17  ? 865 ASP A N     1 
ATOM   5356  C  CA    . ASP E 3 569 ? 138.002 -31.425 47.939  1.00 45.14  ? 865 ASP A CA    1 
ATOM   5357  C  C     . ASP E 3 569 ? 137.440 -32.742 48.420  1.00 45.22  ? 865 ASP A C     1 
ATOM   5358  O  O     . ASP E 3 569 ? 136.621 -33.360 47.745  1.00 44.94  ? 865 ASP A O     1 
ATOM   5359  C  CB    . ASP E 3 569 ? 137.141 -30.246 48.372  1.00 45.07  ? 865 ASP A CB    1 
ATOM   5360  C  CG    . ASP E 3 569 ? 137.872 -28.937 48.233  1.00 45.28  ? 865 ASP A CG    1 
ATOM   5361  O  OD1   . ASP E 3 569 ? 139.024 -28.969 47.762  1.00 45.92  ? 865 ASP A OD1   1 
ATOM   5362  O  OD2   . ASP E 3 569 ? 137.317 -27.884 48.598  1.00 45.99  ? 865 ASP A OD2   1 
ATOM   5363  N  N     . TYR E 3 570 ? 137.898 -33.180 49.585  1.00 45.63  ? 866 TYR A N     1 
ATOM   5364  C  CA    . TYR E 3 570 ? 137.472 -34.468 50.112  1.00 46.23  ? 866 TYR A CA    1 
ATOM   5365  C  C     . TYR E 3 570 ? 137.303 -34.471 51.618  1.00 46.08  ? 866 TYR A C     1 
ATOM   5366  O  O     . TYR E 3 570 ? 137.957 -33.710 52.329  1.00 46.08  ? 866 TYR A O     1 
ATOM   5367  C  CB    . TYR E 3 570 ? 138.444 -35.574 49.688  1.00 46.82  ? 866 TYR A CB    1 
ATOM   5368  C  CG    . TYR E 3 570 ? 139.905 -35.215 49.872  1.00 47.55  ? 866 TYR A CG    1 
ATOM   5369  C  CD1   . TYR E 3 570 ? 140.622 -35.656 50.985  1.00 48.38  ? 866 TYR A CD1   1 
ATOM   5370  C  CD2   . TYR E 3 570 ? 140.568 -34.434 48.931  1.00 48.00  ? 866 TYR A CD2   1 
ATOM   5371  C  CE1   . TYR E 3 570 ? 141.968 -35.328 51.152  1.00 48.57  ? 866 TYR A CE1   1 
ATOM   5372  C  CE2   . TYR E 3 570 ? 141.902 -34.098 49.085  1.00 48.99  ? 866 TYR A CE2   1 
ATOM   5373  C  CZ    . TYR E 3 570 ? 142.601 -34.547 50.196  1.00 48.82  ? 866 TYR A CZ    1 
ATOM   5374  O  OH    . TYR E 3 570 ? 143.929 -34.202 50.334  1.00 48.32  ? 866 TYR A OH    1 
ATOM   5375  N  N     . HIS E 3 571 ? 136.399 -35.330 52.081  1.00 45.89  ? 867 HIS A N     1 
ATOM   5376  C  CA    . HIS E 3 571 ? 136.111 -35.513 53.491  1.00 45.60  ? 867 HIS A CA    1 
ATOM   5377  C  C     . HIS E 3 571 ? 135.515 -36.907 53.646  1.00 45.27  ? 867 HIS A C     1 
ATOM   5378  O  O     . HIS E 3 571 ? 134.985 -37.466 52.690  1.00 45.26  ? 867 HIS A O     1 
ATOM   5379  C  CB    . HIS E 3 571 ? 135.087 -34.494 53.984  1.00 45.79  ? 867 HIS A CB    1 
ATOM   5380  C  CG    . HIS E 3 571 ? 135.352 -33.087 53.546  1.00 46.60  ? 867 HIS A CG    1 
ATOM   5381  N  ND1   . HIS E 3 571 ? 134.817 -32.555 52.390  1.00 47.33  ? 867 HIS A ND1   1 
ATOM   5382  C  CD2   . HIS E 3 571 ? 136.070 -32.094 54.120  1.00 47.43  ? 867 HIS A CD2   1 
ATOM   5383  C  CE1   . HIS E 3 571 ? 135.208 -31.299 52.264  1.00 47.92  ? 867 HIS A CE1   1 
ATOM   5384  N  NE2   . HIS E 3 571 ? 135.970 -30.994 53.301  1.00 48.31  ? 867 HIS A NE2   1 
ATOM   5385  N  N     . TYR E 3 572 ? 135.597 -37.458 54.852  1.00 45.04  ? 868 TYR A N     1 
ATOM   5386  C  CA    . TYR E 3 572 ? 135.016 -38.764 55.154  1.00 44.78  ? 868 TYR A CA    1 
ATOM   5387  C  C     . TYR E 3 572 ? 134.353 -38.710 56.531  1.00 44.28  ? 868 TYR A C     1 
ATOM   5388  O  O     . TYR E 3 572 ? 134.599 -37.785 57.304  1.00 44.28  ? 868 TYR A O     1 
ATOM   5389  C  CB    . TYR E 3 572 ? 136.072 -39.876 55.079  1.00 45.18  ? 868 TYR A CB    1 
ATOM   5390  C  CG    . TYR E 3 572 ? 137.158 -39.763 56.124  1.00 46.02  ? 868 TYR A CG    1 
ATOM   5391  C  CD1   . TYR E 3 572 ? 137.061 -40.457 57.327  1.00 47.25  ? 868 TYR A CD1   1 
ATOM   5392  C  CD2   . TYR E 3 572 ? 138.276 -38.952 55.918  1.00 46.11  ? 868 TYR A CD2   1 
ATOM   5393  C  CE1   . TYR E 3 572 ? 138.046 -40.351 58.297  1.00 47.79  ? 868 TYR A CE1   1 
ATOM   5394  C  CE2   . TYR E 3 572 ? 139.268 -38.840 56.881  1.00 46.31  ? 868 TYR A CE2   1 
ATOM   5395  C  CZ    . TYR E 3 572 ? 139.149 -39.544 58.070  1.00 46.93  ? 868 TYR A CZ    1 
ATOM   5396  O  OH    . TYR E 3 572 ? 140.123 -39.448 59.045  1.00 46.62  ? 868 TYR A OH    1 
ATOM   5397  N  N     . GLY E 3 573 ? 133.515 -39.698 56.832  1.00 43.56  ? 869 GLY A N     1 
ATOM   5398  C  CA    . GLY E 3 573 ? 132.761 -39.716 58.082  1.00 42.84  ? 869 GLY A CA    1 
ATOM   5399  C  C     . GLY E 3 573 ? 131.739 -40.833 58.078  1.00 42.47  ? 869 GLY A C     1 
ATOM   5400  O  O     . GLY E 3 573 ? 131.362 -41.338 57.014  1.00 42.22  ? 869 GLY A O     1 
ATOM   5401  N  N     . SER E 3 574 ? 131.274 -41.207 59.265  1.00 42.14  ? 870 SER A N     1 
ATOM   5402  C  CA    . SER E 3 574 ? 130.390 -42.366 59.408  1.00 42.07  ? 870 SER A CA    1 
ATOM   5403  C  C     . SER E 3 574 ? 128.996 -42.210 58.795  1.00 41.81  ? 870 SER A C     1 
ATOM   5404  O  O     . SER E 3 574 ? 128.273 -43.197 58.666  1.00 41.82  ? 870 SER A O     1 
ATOM   5405  C  CB    . SER E 3 574 ? 130.313 -42.825 60.869  1.00 42.24  ? 870 SER A CB    1 
ATOM   5406  O  OG    . SER E 3 574 ? 129.829 -41.784 61.697  1.00 43.07  ? 870 SER A OG    1 
ATOM   5407  N  N     . THR E 3 575 ? 128.619 -40.981 58.433  1.00 41.48  ? 871 THR A N     1 
ATOM   5408  C  CA    . THR E 3 575 ? 127.387 -40.735 57.669  1.00 41.16  ? 871 THR A CA    1 
ATOM   5409  C  C     . THR E 3 575 ? 127.691 -39.760 56.538  1.00 41.19  ? 871 THR A C     1 
ATOM   5410  O  O     . THR E 3 575 ? 128.615 -38.943 56.653  1.00 41.32  ? 871 THR A O     1 
ATOM   5411  C  CB    . THR E 3 575 ? 126.239 -40.145 58.521  1.00 41.05  ? 871 THR A CB    1 
ATOM   5412  O  OG1   . THR E 3 575 ? 126.643 -38.886 59.065  1.00 40.86  ? 871 THR A OG1   1 
ATOM   5413  C  CG2   . THR E 3 575 ? 125.837 -41.087 59.645  1.00 40.55  ? 871 THR A CG2   1 
ATOM   5414  N  N     . TRP E 3 576 ? 126.916 -39.837 55.457  1.00 40.93  ? 872 TRP A N     1 
ATOM   5415  C  CA    . TRP E 3 576 ? 127.083 -38.928 54.317  1.00 40.96  ? 872 TRP A CA    1 
ATOM   5416  C  C     . TRP E 3 576 ? 127.030 -37.474 54.777  1.00 40.96  ? 872 TRP A C     1 
ATOM   5417  O  O     . TRP E 3 576 ? 127.606 -36.594 54.150  1.00 40.99  ? 872 TRP A O     1 
ATOM   5418  C  CB    . TRP E 3 576 ? 126.041 -39.227 53.228  1.00 40.96  ? 872 TRP A CB    1 
ATOM   5419  C  CG    . TRP E 3 576 ? 126.183 -38.438 51.938  1.00 41.00  ? 872 TRP A CG    1 
ATOM   5420  C  CD1   . TRP E 3 576 ? 127.273 -37.726 51.514  1.00 41.18  ? 872 TRP A CD1   1 
ATOM   5421  C  CD2   . TRP E 3 576 ? 125.219 -38.356 50.873  1.00 41.44  ? 872 TRP A CD2   1 
ATOM   5422  N  NE1   . TRP E 3 576 ? 127.030 -37.173 50.277  1.00 41.17  ? 872 TRP A NE1   1 
ATOM   5423  C  CE2   . TRP E 3 576 ? 125.782 -37.550 49.858  1.00 41.27  ? 872 TRP A CE2   1 
ATOM   5424  C  CE3   . TRP E 3 576 ? 123.930 -38.873 50.685  1.00 41.07  ? 872 TRP A CE3   1 
ATOM   5425  C  CZ2   . TRP E 3 576 ? 125.100 -37.249 48.679  1.00 41.05  ? 872 TRP A CZ2   1 
ATOM   5426  C  CZ3   . TRP E 3 576 ? 123.257 -38.575 49.511  1.00 40.85  ? 872 TRP A CZ3   1 
ATOM   5427  C  CH2   . TRP E 3 576 ? 123.844 -37.771 48.523  1.00 40.91  ? 872 TRP A CH2   1 
ATOM   5428  N  N     . TYR E 3 577 ? 126.352 -37.235 55.890  1.00 41.28  ? 873 TYR A N     1 
ATOM   5429  C  CA    . TYR E 3 577 ? 126.323 -35.915 56.497  1.00 41.94  ? 873 TYR A CA    1 
ATOM   5430  C  C     . TYR E 3 577 ? 127.689 -35.548 57.095  1.00 42.59  ? 873 TYR A C     1 
ATOM   5431  O  O     . TYR E 3 577 ? 128.198 -34.451 56.857  1.00 42.53  ? 873 TYR A O     1 
ATOM   5432  C  CB    . TYR E 3 577 ? 125.248 -35.868 57.581  1.00 41.54  ? 873 TYR A CB    1 
ATOM   5433  C  CG    . TYR E 3 577 ? 125.214 -34.592 58.397  1.00 41.38  ? 873 TYR A CG    1 
ATOM   5434  C  CD1   . TYR E 3 577 ? 124.399 -33.525 58.027  1.00 41.01  ? 873 TYR A CD1   1 
ATOM   5435  C  CD2   . TYR E 3 577 ? 125.979 -34.459 59.550  1.00 40.92  ? 873 TYR A CD2   1 
ATOM   5436  C  CE1   . TYR E 3 577 ? 124.353 -32.363 58.778  1.00 40.70  ? 873 TYR A CE1   1 
ATOM   5437  C  CE2   . TYR E 3 577 ? 125.938 -33.297 60.306  1.00 40.96  ? 873 TYR A CE2   1 
ATOM   5438  C  CZ    . TYR E 3 577 ? 125.124 -32.256 59.916  1.00 40.90  ? 873 TYR A CZ    1 
ATOM   5439  O  OH    . TYR E 3 577 ? 125.087 -31.103 60.661  1.00 41.19  ? 873 TYR A OH    1 
ATOM   5440  N  N     . ASP E 3 578 ? 128.268 -36.473 57.866  1.00 43.39  ? 874 ASP A N     1 
ATOM   5441  C  CA    . ASP E 3 578 ? 129.555 -36.260 58.538  1.00 44.20  ? 874 ASP A CA    1 
ATOM   5442  C  C     . ASP E 3 578 ? 130.721 -36.170 57.563  1.00 44.77  ? 874 ASP A C     1 
ATOM   5443  O  O     . ASP E 3 578 ? 131.800 -35.690 57.920  1.00 44.94  ? 874 ASP A O     1 
ATOM   5444  C  CB    . ASP E 3 578 ? 129.819 -37.362 59.566  1.00 44.07  ? 874 ASP A CB    1 
ATOM   5445  C  CG    . ASP E 3 578 ? 128.781 -37.380 60.682  1.00 44.59  ? 874 ASP A CG    1 
ATOM   5446  O  OD1   . ASP E 3 578 ? 128.402 -38.484 61.132  1.00 44.83  ? 874 ASP A OD1   1 
ATOM   5447  O  OD2   . ASP E 3 578 ? 128.329 -36.294 61.102  1.00 44.56  ? 874 ASP A OD2   1 
ATOM   5448  N  N     . ALA E 3 579 ? 130.500 -36.624 56.330  1.00 45.37  ? 875 ALA A N     1 
ATOM   5449  C  CA    . ALA E 3 579 ? 131.517 -36.546 55.279  1.00 45.91  ? 875 ALA A CA    1 
ATOM   5450  C  C     . ALA E 3 579 ? 131.642 -35.124 54.711  1.00 46.31  ? 875 ALA A C     1 
ATOM   5451  O  O     . ALA E 3 579 ? 131.805 -34.941 53.503  1.00 46.38  ? 875 ALA A O     1 
ATOM   5452  C  CB    . ALA E 3 579 ? 131.206 -37.539 54.170  1.00 45.76  ? 875 ALA A CB    1 
ATOM   5453  N  N     . LYS E 3 580 ? 131.565 -34.131 55.594  1.00 46.74  ? 876 LYS A N     1 
ATOM   5454  C  CA    . LYS E 3 580 ? 131.673 -32.721 55.221  1.00 47.34  ? 876 LYS A CA    1 
ATOM   5455  C  C     . LYS E 3 580 ? 132.981 -32.123 55.740  1.00 47.46  ? 876 LYS A C     1 
ATOM   5456  O  O     . LYS E 3 580 ? 133.782 -32.823 56.364  1.00 47.59  ? 876 LYS A O     1 
ATOM   5457  C  CB    . LYS E 3 580 ? 130.477 -31.919 55.759  1.00 47.37  ? 876 LYS A CB    1 
ATOM   5458  C  CG    . LYS E 3 580 ? 130.317 -31.957 57.287  1.00 47.68  ? 876 LYS A CG    1 
ATOM   5459  C  CD    . LYS E 3 580 ? 129.121 -31.128 57.746  1.00 47.67  ? 876 LYS A CD    1 
ATOM   5460  C  CE    . LYS E 3 580 ? 128.804 -31.368 59.218  1.00 48.14  ? 876 LYS A CE    1 
ATOM   5461  N  NZ    . LYS E 3 580 ? 129.932 -31.020 60.119  1.00 48.33  ? 876 LYS A NZ    1 
ATOM   5462  O  OXT   . LYS E 3 580 ? 133.266 -30.935 55.552  1.00 47.55  ? 876 LYS A OXT   1 
ATOM   5463  N  N     . LYS F 3 1   ? 159.039 -51.005 -7.294  1.00 30.35  ? 297 LYS D N     1 
ATOM   5464  C  CA    . LYS F 3 1   ? 158.557 -50.576 -8.641  1.00 30.42  ? 297 LYS D CA    1 
ATOM   5465  C  C     . LYS F 3 1   ? 157.420 -51.480 -9.097  1.00 30.30  ? 297 LYS D C     1 
ATOM   5466  O  O     . LYS F 3 1   ? 156.815 -51.247 -10.140 1.00 30.17  ? 297 LYS D O     1 
ATOM   5467  C  CB    . LYS F 3 1   ? 159.696 -50.619 -9.640  1.00 30.61  ? 297 LYS D CB    1 
ATOM   5468  N  N     . LYS F 3 2   ? 157.151 -52.506 -8.292  1.00 30.07  ? 298 LYS D N     1 
ATOM   5469  C  CA    . LYS F 3 2   ? 156.153 -53.524 -8.579  1.00 29.84  ? 298 LYS D CA    1 
ATOM   5470  C  C     . LYS F 3 2   ? 155.009 -53.470 -7.572  1.00 29.26  ? 298 LYS D C     1 
ATOM   5471  O  O     . LYS F 3 2   ? 155.192 -53.044 -6.415  1.00 29.34  ? 298 LYS D O     1 
ATOM   5472  C  CB    . LYS F 3 2   ? 156.780 -54.923 -8.491  1.00 30.60  ? 298 LYS D CB    1 
ATOM   5473  C  CG    . LYS F 3 2   ? 157.438 -55.464 -9.763  1.00 32.32  ? 298 LYS D CG    1 
ATOM   5474  C  CD    . LYS F 3 2   ? 158.778 -54.794 -10.082 1.00 34.54  ? 298 LYS D CD    1 
ATOM   5475  C  CE    . LYS F 3 2   ? 159.350 -55.292 -11.409 1.00 34.19  ? 298 LYS D CE    1 
ATOM   5476  N  NZ    . LYS F 3 2   ? 160.430 -54.383 -11.879 1.00 35.64  ? 298 LYS D NZ    1 
ATOM   5477  N  N     . MET F 3 3   ? 153.833 -53.916 -8.013  1.00 27.83  ? 299 MET D N     1 
ATOM   5478  C  CA    . MET F 3 3   ? 152.684 -54.029 -7.138  1.00 26.21  ? 299 MET D CA    1 
ATOM   5479  C  C     . MET F 3 3   ? 152.077 -55.395 -7.359  1.00 25.87  ? 299 MET D C     1 
ATOM   5480  O  O     . MET F 3 3   ? 151.545 -55.684 -8.427  1.00 25.68  ? 299 MET D O     1 
ATOM   5481  C  CB    . MET F 3 3   ? 151.658 -52.919 -7.387  1.00 26.15  ? 299 MET D CB    1 
ATOM   5482  C  CG    . MET F 3 3   ? 150.550 -52.899 -6.337  1.00 25.43  ? 299 MET D CG    1 
ATOM   5483  S  SD    . MET F 3 3   ? 149.451 -51.458 -6.302  1.00 24.84  ? 299 MET D SD    1 
ATOM   5484  C  CE    . MET F 3 3   ? 150.413 -50.235 -5.426  1.00 24.45  ? 299 MET D CE    1 
ATOM   5485  N  N     . ALA F 3 4   ? 152.178 -56.242 -6.345  1.00 25.35  ? 300 ALA D N     1 
ATOM   5486  C  CA    . ALA F 3 4   ? 151.658 -57.599 -6.434  1.00 24.95  ? 300 ALA D CA    1 
ATOM   5487  C  C     . ALA F 3 4   ? 150.141 -57.614 -6.475  1.00 24.51  ? 300 ALA D C     1 
ATOM   5488  O  O     . ALA F 3 4   ? 149.488 -56.986 -5.651  1.00 24.77  ? 300 ALA D O     1 
ATOM   5489  C  CB    . ALA F 3 4   ? 152.154 -58.430 -5.267  1.00 24.92  ? 300 ALA D CB    1 
ATOM   5490  N  N     . PHE F 3 5   ? 149.588 -58.343 -7.434  1.00 23.94  ? 301 PHE D N     1 
ATOM   5491  C  CA    . PHE F 3 5   ? 148.152 -58.508 -7.533  1.00 23.32  ? 301 PHE D CA    1 
ATOM   5492  C  C     . PHE F 3 5   ? 147.843 -59.782 -8.292  1.00 23.36  ? 301 PHE D C     1 
ATOM   5493  O  O     . PHE F 3 5   ? 148.641 -60.236 -9.091  1.00 23.20  ? 301 PHE D O     1 
ATOM   5494  C  CB    . PHE F 3 5   ? 147.505 -57.304 -8.230  1.00 22.66  ? 301 PHE D CB    1 
ATOM   5495  C  CG    . PHE F 3 5   ? 147.797 -57.207 -9.709  1.00 21.80  ? 301 PHE D CG    1 
ATOM   5496  C  CD1   . PHE F 3 5   ? 146.968 -57.827 -10.640 1.00 21.04  ? 301 PHE D CD1   1 
ATOM   5497  C  CD2   . PHE F 3 5   ? 148.885 -56.475 -10.171 1.00 21.17  ? 301 PHE D CD2   1 
ATOM   5498  C  CE1   . PHE F 3 5   ? 147.226 -57.725 -12.007 1.00 21.54  ? 301 PHE D CE1   1 
ATOM   5499  C  CE2   . PHE F 3 5   ? 149.154 -56.363 -11.537 1.00 20.47  ? 301 PHE D CE2   1 
ATOM   5500  C  CZ    . PHE F 3 5   ? 148.325 -56.984 -12.457 1.00 21.01  ? 301 PHE D CZ    1 
ATOM   5501  N  N     . THR F 3 6   ? 146.675 -60.355 -8.047  1.00 23.94  ? 302 THR D N     1 
ATOM   5502  C  CA    . THR F 3 6   ? 146.251 -61.523 -8.795  1.00 24.69  ? 302 THR D CA    1 
ATOM   5503  C  C     . THR F 3 6   ? 145.441 -61.113 -10.028 1.00 25.76  ? 302 THR D C     1 
ATOM   5504  O  O     . THR F 3 6   ? 144.456 -60.380 -9.928  1.00 25.47  ? 302 THR D O     1 
ATOM   5505  C  CB    . THR F 3 6   ? 145.401 -62.455 -7.935  1.00 24.47  ? 302 THR D CB    1 
ATOM   5506  O  OG1   . THR F 3 6   ? 146.152 -62.857 -6.790  1.00 23.82  ? 302 THR D OG1   1 
ATOM   5507  C  CG2   . THR F 3 6   ? 144.991 -63.683 -8.724  1.00 24.35  ? 302 THR D CG2   1 
ATOM   5508  N  N     . LEU F 3 7   ? 145.883 -61.577 -11.192 1.00 27.18  ? 303 LEU D N     1 
ATOM   5509  C  CA    . LEU F 3 7   ? 145.146 -61.386 -12.426 1.00 28.37  ? 303 LEU D CA    1 
ATOM   5510  C  C     . LEU F 3 7   ? 144.228 -62.598 -12.484 1.00 29.19  ? 303 LEU D C     1 
ATOM   5511  O  O     . LEU F 3 7   ? 144.625 -63.666 -12.951 1.00 29.29  ? 303 LEU D O     1 
ATOM   5512  C  CB    . LEU F 3 7   ? 146.115 -61.351 -13.600 1.00 28.49  ? 303 LEU D CB    1 
ATOM   5513  C  CG    . LEU F 3 7   ? 145.635 -60.766 -14.925 1.00 28.99  ? 303 LEU D CG    1 
ATOM   5514  C  CD1   . LEU F 3 7   ? 146.830 -60.229 -15.688 1.00 28.75  ? 303 LEU D CD1   1 
ATOM   5515  C  CD2   . LEU F 3 7   ? 144.843 -61.795 -15.745 1.00 29.83  ? 303 LEU D CD2   1 
ATOM   5516  N  N     . ALA F 3 8   ? 143.006 -62.430 -11.983 1.00 30.09  ? 304 ALA D N     1 
ATOM   5517  C  CA    . ALA F 3 8   ? 142.102 -63.560 -11.773 1.00 31.10  ? 304 ALA D CA    1 
ATOM   5518  C  C     . ALA F 3 8   ? 141.347 -64.025 -13.002 1.00 31.92  ? 304 ALA D C     1 
ATOM   5519  O  O     . ALA F 3 8   ? 140.814 -63.217 -13.755 1.00 32.36  ? 304 ALA D O     1 
ATOM   5520  C  CB    . ALA F 3 8   ? 141.131 -63.247 -10.658 1.00 31.00  ? 304 ALA D CB    1 
ATOM   5521  N  N     . ASP F 3 9   ? 141.298 -65.339 -13.188 1.00 32.84  ? 305 ASP D N     1 
ATOM   5522  C  CA    . ASP F 3 9   ? 140.550 -65.927 -14.288 1.00 33.83  ? 305 ASP D CA    1 
ATOM   5523  C  C     . ASP F 3 9   ? 139.133 -66.272 -13.825 1.00 33.73  ? 305 ASP D C     1 
ATOM   5524  O  O     . ASP F 3 9   ? 138.254 -66.552 -14.640 1.00 34.13  ? 305 ASP D O     1 
ATOM   5525  C  CB    . ASP F 3 9   ? 141.260 -67.184 -14.819 1.00 34.39  ? 305 ASP D CB    1 
ATOM   5526  C  CG    . ASP F 3 9   ? 142.669 -66.892 -15.368 1.00 36.50  ? 305 ASP D CG    1 
ATOM   5527  O  OD1   . ASP F 3 9   ? 142.880 -65.833 -16.012 1.00 38.90  ? 305 ASP D OD1   1 
ATOM   5528  O  OD2   . ASP F 3 9   ? 143.573 -67.743 -15.174 1.00 38.33  ? 305 ASP D OD2   1 
ATOM   5529  N  N     . ARG F 3 10  ? 138.918 -66.229 -12.514 1.00 33.49  ? 306 ARG D N     1 
ATOM   5530  C  CA    . ARG F 3 10  ? 137.630 -66.573 -11.911 1.00 33.52  ? 306 ARG D CA    1 
ATOM   5531  C  C     . ARG F 3 10  ? 137.385 -65.751 -10.630 1.00 32.64  ? 306 ARG D C     1 
ATOM   5532  O  O     . ARG F 3 10  ? 138.334 -65.345 -9.965  1.00 32.53  ? 306 ARG D O     1 
ATOM   5533  C  CB    . ARG F 3 10  ? 137.590 -68.077 -11.615 1.00 33.24  ? 306 ARG D CB    1 
ATOM   5534  C  CG    . ARG F 3 10  ? 136.488 -68.520 -10.653 1.00 34.77  ? 306 ARG D CG    1 
ATOM   5535  C  CD    . ARG F 3 10  ? 136.614 -69.999 -10.286 1.00 35.22  ? 306 ARG D CD    1 
ATOM   5536  N  NE    . ARG F 3 10  ? 137.893 -70.315 -9.634  1.00 38.57  ? 306 ARG D NE    1 
ATOM   5537  C  CZ    . ARG F 3 10  ? 138.056 -70.479 -8.319  1.00 39.54  ? 306 ARG D CZ    1 
ATOM   5538  N  NH1   . ARG F 3 10  ? 137.018 -70.360 -7.492  1.00 39.67  ? 306 ARG D NH1   1 
ATOM   5539  N  NH2   . ARG F 3 10  ? 139.259 -70.770 -7.829  1.00 39.09  ? 306 ARG D NH2   1 
ATOM   5540  N  N     . VAL F 3 11  ? 136.118 -65.514 -10.293 1.00 31.79  ? 307 VAL D N     1 
ATOM   5541  C  CA    . VAL F 3 11  ? 135.752 -64.746 -9.103  1.00 31.15  ? 307 VAL D CA    1 
ATOM   5542  C  C     . VAL F 3 11  ? 135.765 -65.626 -7.857  1.00 31.26  ? 307 VAL D C     1 
ATOM   5543  O  O     . VAL F 3 11  ? 135.075 -66.634 -7.808  1.00 31.40  ? 307 VAL D O     1 
ATOM   5544  C  CB    . VAL F 3 11  ? 134.338 -64.118 -9.248  1.00 31.05  ? 307 VAL D CB    1 
ATOM   5545  C  CG1   . VAL F 3 11  ? 133.876 -63.487 -7.930  1.00 29.96  ? 307 VAL D CG1   1 
ATOM   5546  C  CG2   . VAL F 3 11  ? 134.301 -63.115 -10.391 1.00 29.49  ? 307 VAL D CG2   1 
ATOM   5547  N  N     . THR F 3 12  ? 136.543 -65.243 -6.849  1.00 31.35  ? 308 THR D N     1 
ATOM   5548  C  CA    . THR F 3 12  ? 136.625 -66.024 -5.616  1.00 31.38  ? 308 THR D CA    1 
ATOM   5549  C  C     . THR F 3 12  ? 135.986 -65.300 -4.439  1.00 31.48  ? 308 THR D C     1 
ATOM   5550  O  O     . THR F 3 12  ? 135.736 -64.095 -4.495  1.00 31.28  ? 308 THR D O     1 
ATOM   5551  C  CB    . THR F 3 12  ? 138.073 -66.378 -5.233  1.00 31.25  ? 308 THR D CB    1 
ATOM   5552  O  OG1   . THR F 3 12  ? 138.701 -65.238 -4.636  1.00 31.79  ? 308 THR D OG1   1 
ATOM   5553  C  CG2   . THR F 3 12  ? 138.864 -66.852 -6.449  1.00 30.91  ? 308 THR D CG2   1 
ATOM   5554  N  N     . GLU F 3 13  ? 135.746 -66.052 -3.367  1.00 31.73  ? 309 GLU D N     1 
ATOM   5555  C  CA    . GLU F 3 13  ? 135.070 -65.537 -2.179  1.00 31.97  ? 309 GLU D CA    1 
ATOM   5556  C  C     . GLU F 3 13  ? 135.764 -64.308 -1.590  1.00 31.37  ? 309 GLU D C     1 
ATOM   5557  O  O     . GLU F 3 13  ? 135.120 -63.290 -1.337  1.00 31.23  ? 309 GLU D O     1 
ATOM   5558  C  CB    . GLU F 3 13  ? 134.950 -66.633 -1.110  1.00 32.32  ? 309 GLU D CB    1 
ATOM   5559  C  CG    . GLU F 3 13  ? 133.865 -66.375 -0.068  1.00 34.02  ? 309 GLU D CG    1 
ATOM   5560  C  CD    . GLU F 3 13  ? 132.456 -66.492 -0.658  1.00 37.34  ? 309 GLU D CD    1 
ATOM   5561  O  OE1   . GLU F 3 13  ? 132.286 -67.167 -1.705  1.00 38.64  ? 309 GLU D OE1   1 
ATOM   5562  O  OE2   . GLU F 3 13  ? 131.510 -65.912 -0.074  1.00 38.13  ? 309 GLU D OE2   1 
ATOM   5563  N  N     . GLU F 3 14  ? 137.076 -64.405 -1.395  1.00 30.65  ? 310 GLU D N     1 
ATOM   5564  C  CA    . GLU F 3 14  ? 137.835 -63.327 -0.759  1.00 30.08  ? 310 GLU D CA    1 
ATOM   5565  C  C     . GLU F 3 14  ? 137.809 -61.996 -1.523  1.00 29.45  ? 310 GLU D C     1 
ATOM   5566  O  O     . GLU F 3 14  ? 138.176 -60.957 -0.965  1.00 29.58  ? 310 GLU D O     1 
ATOM   5567  C  CB    . GLU F 3 14  ? 139.272 -63.765 -0.442  1.00 30.09  ? 310 GLU D CB    1 
ATOM   5568  C  CG    . GLU F 3 14  ? 140.047 -64.287 -1.628  1.00 31.06  ? 310 GLU D CG    1 
ATOM   5569  C  CD    . GLU F 3 14  ? 141.533 -64.362 -1.352  1.00 32.52  ? 310 GLU D CD    1 
ATOM   5570  O  OE1   . GLU F 3 14  ? 141.956 -63.853 -0.290  1.00 32.80  ? 310 GLU D OE1   1 
ATOM   5571  O  OE2   . GLU F 3 14  ? 142.280 -64.906 -2.204  1.00 32.65  ? 310 GLU D OE2   1 
ATOM   5572  N  N     . MET F 3 15  ? 137.365 -62.025 -2.780  1.00 28.35  ? 311 MET D N     1 
ATOM   5573  C  CA    . MET F 3 15  ? 137.187 -60.803 -3.558  1.00 27.40  ? 311 MET D CA    1 
ATOM   5574  C  C     . MET F 3 15  ? 135.887 -60.092 -3.146  1.00 26.43  ? 311 MET D C     1 
ATOM   5575  O  O     . MET F 3 15  ? 135.677 -58.930 -3.483  1.00 26.50  ? 311 MET D O     1 
ATOM   5576  C  CB    . MET F 3 15  ? 137.128 -61.090 -5.068  1.00 27.34  ? 311 MET D CB    1 
ATOM   5577  C  CG    . MET F 3 15  ? 138.271 -61.886 -5.671  1.00 27.35  ? 311 MET D CG    1 
ATOM   5578  S  SD    . MET F 3 15  ? 138.110 -62.046 -7.479  1.00 28.30  ? 311 MET D SD    1 
ATOM   5579  C  CE    . MET F 3 15  ? 139.504 -63.099 -7.829  1.00 27.78  ? 311 MET D CE    1 
ATOM   5580  N  N     . LEU F 3 16  ? 135.014 -60.789 -2.423  1.00 25.20  ? 312 LEU D N     1 
ATOM   5581  C  CA    . LEU F 3 16  ? 133.708 -60.237 -2.076  1.00 24.12  ? 312 LEU D CA    1 
ATOM   5582  C  C     . LEU F 3 16  ? 133.610 -59.787 -0.635  1.00 23.59  ? 312 LEU D C     1 
ATOM   5583  O  O     . LEU F 3 16  ? 132.577 -59.967 0.008   1.00 23.15  ? 312 LEU D O     1 
ATOM   5584  C  CB    . LEU F 3 16  ? 132.615 -61.260 -2.368  1.00 24.21  ? 312 LEU D CB    1 
ATOM   5585  C  CG    . LEU F 3 16  ? 132.631 -61.813 -3.789  1.00 23.86  ? 312 LEU D CG    1 
ATOM   5586  C  CD1   . LEU F 3 16  ? 131.548 -62.862 -3.980  1.00 23.99  ? 312 LEU D CD1   1 
ATOM   5587  C  CD2   . LEU F 3 16  ? 132.479 -60.677 -4.784  1.00 22.78  ? 312 LEU D CD2   1 
ATOM   5588  N  N     . ALA F 3 17  ? 134.697 -59.207 -0.136  1.00 23.27  ? 313 ALA D N     1 
ATOM   5589  C  CA    . ALA F 3 17  ? 134.751 -58.660 1.211   1.00 22.73  ? 313 ALA D CA    1 
ATOM   5590  C  C     . ALA F 3 17  ? 133.747 -57.517 1.340   1.00 22.40  ? 313 ALA D C     1 
ATOM   5591  O  O     . ALA F 3 17  ? 133.265 -56.991 0.343   1.00 22.31  ? 313 ALA D O     1 
ATOM   5592  C  CB    . ALA F 3 17  ? 136.144 -58.184 1.524   1.00 22.91  ? 313 ALA D CB    1 
ATOM   5593  N  N     . ASP F 3 18  ? 133.421 -57.129 2.562   1.00 22.05  ? 314 ASP D N     1 
ATOM   5594  C  CA    . ASP F 3 18  ? 132.383 -56.136 2.727   1.00 22.01  ? 314 ASP D CA    1 
ATOM   5595  C  C     . ASP F 3 18  ? 132.937 -54.712 2.833   1.00 21.35  ? 314 ASP D C     1 
ATOM   5596  O  O     . ASP F 3 18  ? 132.287 -53.806 3.360   1.00 21.17  ? 314 ASP D O     1 
ATOM   5597  C  CB    . ASP F 3 18  ? 131.453 -56.516 3.880   1.00 22.50  ? 314 ASP D CB    1 
ATOM   5598  C  CG    . ASP F 3 18  ? 132.167 -56.588 5.203   1.00 24.42  ? 314 ASP D CG    1 
ATOM   5599  O  OD1   . ASP F 3 18  ? 131.543 -57.077 6.173   1.00 25.05  ? 314 ASP D OD1   1 
ATOM   5600  O  OD2   . ASP F 3 18  ? 133.346 -56.154 5.272   1.00 27.27  ? 314 ASP D OD2   1 
ATOM   5601  N  N     . LYS F 3 19  ? 134.152 -54.549 2.323   1.00 20.84  ? 315 LYS D N     1 
ATOM   5602  C  CA    . LYS F 3 19  ? 134.794 -53.248 2.157   1.00 20.54  ? 315 LYS D CA    1 
ATOM   5603  C  C     . LYS F 3 19  ? 135.906 -53.412 1.143   1.00 19.92  ? 315 LYS D C     1 
ATOM   5604  O  O     . LYS F 3 19  ? 136.799 -54.229 1.325   1.00 20.35  ? 315 LYS D O     1 
ATOM   5605  C  CB    . LYS F 3 19  ? 135.330 -52.672 3.471   1.00 20.80  ? 315 LYS D CB    1 
ATOM   5606  C  CG    . LYS F 3 19  ? 136.019 -51.317 3.313   1.00 21.07  ? 315 LYS D CG    1 
ATOM   5607  C  CD    . LYS F 3 19  ? 135.162 -50.313 2.539   1.00 22.29  ? 315 LYS D CD    1 
ATOM   5608  C  CE    . LYS F 3 19  ? 135.905 -48.987 2.278   1.00 22.56  ? 315 LYS D CE    1 
ATOM   5609  N  NZ    . LYS F 3 19  ? 136.347 -48.323 3.553   1.00 22.56  ? 315 LYS D NZ    1 
ATOM   5610  N  N     . ALA F 3 20  ? 135.835 -52.642 0.067   1.00 19.14  ? 316 ALA D N     1 
ATOM   5611  C  CA    . ALA F 3 20  ? 136.810 -52.735 -0.997  1.00 18.26  ? 316 ALA D CA    1 
ATOM   5612  C  C     . ALA F 3 20  ? 136.963 -51.425 -1.768  1.00 18.06  ? 316 ALA D C     1 
ATOM   5613  O  O     . ALA F 3 20  ? 136.083 -50.549 -1.736  1.00 17.79  ? 316 ALA D O     1 
ATOM   5614  C  CB    . ALA F 3 20  ? 136.414 -53.840 -1.946  1.00 18.32  ? 316 ALA D CB    1 
ATOM   5615  N  N     . ALA F 3 21  ? 138.097 -51.291 -2.449  1.00 17.31  ? 317 ALA D N     1 
ATOM   5616  C  CA    . ALA F 3 21  ? 138.306 -50.186 -3.361  1.00 16.71  ? 317 ALA D CA    1 
ATOM   5617  C  C     . ALA F 3 21  ? 137.942 -50.765 -4.719  1.00 16.72  ? 317 ALA D C     1 
ATOM   5618  O  O     . ALA F 3 21  ? 138.473 -51.810 -5.120  1.00 17.60  ? 317 ALA D O     1 
ATOM   5619  C  CB    . ALA F 3 21  ? 139.729 -49.742 -3.329  1.00 16.43  ? 317 ALA D CB    1 
ATOM   5620  N  N     . LEU F 3 22  ? 137.014 -50.127 -5.420  1.00 15.67  ? 318 LEU D N     1 
ATOM   5621  C  CA    . LEU F 3 22  ? 136.536 -50.690 -6.672  1.00 14.51  ? 318 LEU D CA    1 
ATOM   5622  C  C     . LEU F 3 22  ? 136.744 -49.765 -7.853  1.00 14.12  ? 318 LEU D C     1 
ATOM   5623  O  O     . LEU F 3 22  ? 136.467 -48.561 -7.776  1.00 13.45  ? 318 LEU D O     1 
ATOM   5624  C  CB    . LEU F 3 22  ? 135.049 -51.041 -6.563  1.00 14.50  ? 318 LEU D CB    1 
ATOM   5625  C  CG    . LEU F 3 22  ? 134.353 -51.586 -7.810  1.00 13.63  ? 318 LEU D CG    1 
ATOM   5626  C  CD1   . LEU F 3 22  ? 134.871 -52.973 -8.170  1.00 14.02  ? 318 LEU D CD1   1 
ATOM   5627  C  CD2   . LEU F 3 22  ? 132.871 -51.633 -7.585  1.00 14.41  ? 318 LEU D CD2   1 
ATOM   5628  N  N     . VAL F 3 23  ? 137.226 -50.356 -8.945  1.00 13.56  ? 319 VAL D N     1 
ATOM   5629  C  CA    . VAL F 3 23  ? 137.407 -49.667 -10.210 1.00 12.96  ? 319 VAL D CA    1 
ATOM   5630  C  C     . VAL F 3 23  ? 136.677 -50.445 -11.309 1.00 12.94  ? 319 VAL D C     1 
ATOM   5631  O  O     . VAL F 3 23  ? 136.942 -51.638 -11.522 1.00 13.13  ? 319 VAL D O     1 
ATOM   5632  C  CB    . VAL F 3 23  ? 138.913 -49.512 -10.558 1.00 12.89  ? 319 VAL D CB    1 
ATOM   5633  C  CG1   . VAL F 3 23  ? 139.104 -49.042 -11.990 1.00 12.08  ? 319 VAL D CG1   1 
ATOM   5634  C  CG2   . VAL F 3 23  ? 139.581 -48.550 -9.591  1.00 12.28  ? 319 VAL D CG2   1 
ATOM   5635  N  N     . VAL F 3 24  ? 135.731 -49.777 -11.968 1.00 12.52  ? 320 VAL D N     1 
ATOM   5636  C  CA    . VAL F 3 24  ? 135.025 -50.325 -13.138 1.00 12.34  ? 320 VAL D CA    1 
ATOM   5637  C  C     . VAL F 3 24  ? 135.394 -49.380 -14.260 1.00 12.64  ? 320 VAL D C     1 
ATOM   5638  O  O     . VAL F 3 24  ? 134.847 -48.282 -14.347 1.00 13.13  ? 320 VAL D O     1 
ATOM   5639  C  CB    . VAL F 3 24  ? 133.490 -50.355 -12.947 1.00 11.97  ? 320 VAL D CB    1 
ATOM   5640  C  CG1   . VAL F 3 24  ? 132.805 -50.883 -14.187 1.00 11.12  ? 320 VAL D CG1   1 
ATOM   5641  C  CG2   . VAL F 3 24  ? 133.107 -51.191 -11.707 1.00 11.38  ? 320 VAL D CG2   1 
ATOM   5642  N  N     . GLU F 3 25  ? 136.338 -49.789 -15.099 1.00 12.79  ? 321 GLU D N     1 
ATOM   5643  C  CA    . GLU F 3 25  ? 136.950 -48.851 -16.044 1.00 13.49  ? 321 GLU D CA    1 
ATOM   5644  C  C     . GLU F 3 25  ? 136.246 -48.641 -17.370 1.00 13.92  ? 321 GLU D C     1 
ATOM   5645  O  O     . GLU F 3 25  ? 136.129 -49.567 -18.189 1.00 13.27  ? 321 GLU D O     1 
ATOM   5646  C  CB    . GLU F 3 25  ? 138.408 -49.206 -16.323 1.00 13.37  ? 321 GLU D CB    1 
ATOM   5647  C  CG    . GLU F 3 25  ? 139.148 -48.107 -17.053 1.00 13.70  ? 321 GLU D CG    1 
ATOM   5648  C  CD    . GLU F 3 25  ? 139.651 -47.022 -16.112 1.00 15.07  ? 321 GLU D CD    1 
ATOM   5649  O  OE1   . GLU F 3 25  ? 139.132 -46.906 -14.987 1.00 16.88  ? 321 GLU D OE1   1 
ATOM   5650  O  OE2   . GLU F 3 25  ? 140.584 -46.287 -16.479 1.00 16.04  ? 321 GLU D OE2   1 
ATOM   5651  N  N     . VAL F 3 26  ? 135.821 -47.393 -17.570 1.00 14.53  ? 322 VAL D N     1 
ATOM   5652  C  CA    . VAL F 3 26  ? 135.153 -46.951 -18.773 1.00 15.21  ? 322 VAL D CA    1 
ATOM   5653  C  C     . VAL F 3 26  ? 135.979 -45.814 -19.366 1.00 16.16  ? 322 VAL D C     1 
ATOM   5654  O  O     . VAL F 3 26  ? 135.983 -44.693 -18.850 1.00 16.21  ? 322 VAL D O     1 
ATOM   5655  C  CB    . VAL F 3 26  ? 133.730 -46.488 -18.454 1.00 15.27  ? 322 VAL D CB    1 
ATOM   5656  C  CG1   . VAL F 3 26  ? 132.968 -46.078 -19.735 1.00 14.41  ? 322 VAL D CG1   1 
ATOM   5657  C  CG2   . VAL F 3 26  ? 133.000 -47.598 -17.735 1.00 15.09  ? 322 VAL D CG2   1 
ATOM   5658  N  N     . VAL F 3 27  ? 136.656 -46.118 -20.467 1.00 16.93  ? 323 VAL D N     1 
ATOM   5659  C  CA    . VAL F 3 27  ? 137.629 -45.219 -21.080 1.00 18.35  ? 323 VAL D CA    1 
ATOM   5660  C  C     . VAL F 3 27  ? 137.035 -44.078 -21.913 1.00 19.23  ? 323 VAL D C     1 
ATOM   5661  O  O     . VAL F 3 27  ? 137.594 -42.998 -21.947 1.00 19.12  ? 323 VAL D O     1 
ATOM   5662  C  CB    . VAL F 3 27  ? 138.642 -46.036 -21.941 1.00 18.41  ? 323 VAL D CB    1 
ATOM   5663  C  CG1   . VAL F 3 27  ? 139.641 -45.129 -22.657 1.00 18.29  ? 323 VAL D CG1   1 
ATOM   5664  C  CG2   . VAL F 3 27  ? 139.372 -47.059 -21.071 1.00 18.78  ? 323 VAL D CG2   1 
ATOM   5665  N  N     . GLU F 3 28  ? 135.912 -44.315 -22.589 1.00 20.49  ? 324 GLU D N     1 
ATOM   5666  C  CA    . GLU F 3 28  ? 135.311 -43.285 -23.439 1.00 21.62  ? 324 GLU D CA    1 
ATOM   5667  C  C     . GLU F 3 28  ? 134.681 -42.147 -22.642 1.00 21.68  ? 324 GLU D C     1 
ATOM   5668  O  O     . GLU F 3 28  ? 133.980 -42.379 -21.639 1.00 21.88  ? 324 GLU D O     1 
ATOM   5669  C  CB    . GLU F 3 28  ? 134.269 -43.892 -24.366 1.00 22.21  ? 324 GLU D CB    1 
ATOM   5670  C  CG    . GLU F 3 28  ? 134.801 -45.031 -25.197 1.00 25.55  ? 324 GLU D CG    1 
ATOM   5671  C  CD    . GLU F 3 28  ? 133.798 -45.535 -26.211 1.00 30.24  ? 324 GLU D CD    1 
ATOM   5672  O  OE1   . GLU F 3 28  ? 132.706 -44.921 -26.329 1.00 32.66  ? 324 GLU D OE1   1 
ATOM   5673  O  OE2   . GLU F 3 28  ? 134.105 -46.547 -26.890 1.00 32.46  ? 324 GLU D OE2   1 
ATOM   5674  N  N     . GLU F 3 29  ? 134.915 -40.922 -23.108 1.00 21.48  ? 325 GLU D N     1 
ATOM   5675  C  CA    . GLU F 3 29  ? 134.427 -39.720 -22.417 1.00 21.37  ? 325 GLU D CA    1 
ATOM   5676  C  C     . GLU F 3 29  ? 132.952 -39.777 -22.096 1.00 20.01  ? 325 GLU D C     1 
ATOM   5677  O  O     . GLU F 3 29  ? 132.572 -39.560 -20.956 1.00 19.96  ? 325 GLU D O     1 
ATOM   5678  C  CB    . GLU F 3 29  ? 134.755 -38.458 -23.202 1.00 21.77  ? 325 GLU D CB    1 
ATOM   5679  C  CG    . GLU F 3 29  ? 136.142 -38.522 -23.771 1.00 25.20  ? 325 GLU D CG    1 
ATOM   5680  C  CD    . GLU F 3 29  ? 136.900 -37.255 -23.519 1.00 29.88  ? 325 GLU D CD    1 
ATOM   5681  O  OE1   . GLU F 3 29  ? 136.232 -36.231 -23.222 1.00 32.24  ? 325 GLU D OE1   1 
ATOM   5682  O  OE2   . GLU F 3 29  ? 138.155 -37.291 -23.601 1.00 31.04  ? 325 GLU D OE2   1 
ATOM   5683  N  N     . ASN F 3 30  ? 132.126 -40.070 -23.093 1.00 18.73  ? 326 ASN D N     1 
ATOM   5684  C  CA    . ASN F 3 30  ? 130.710 -40.253 -22.841 1.00 17.81  ? 326 ASN D CA    1 
ATOM   5685  C  C     . ASN F 3 30  ? 130.467 -41.686 -22.393 1.00 17.49  ? 326 ASN D C     1 
ATOM   5686  O  O     . ASN F 3 30  ? 130.551 -42.613 -23.195 1.00 17.77  ? 326 ASN D O     1 
ATOM   5687  C  CB    . ASN F 3 30  ? 129.909 -39.960 -24.093 1.00 17.56  ? 326 ASN D CB    1 
ATOM   5688  C  CG    . ASN F 3 30  ? 128.433 -39.790 -23.816 1.00 17.06  ? 326 ASN D CG    1 
ATOM   5689  O  OD1   . ASN F 3 30  ? 127.783 -40.642 -23.189 1.00 15.42  ? 326 ASN D OD1   1 
ATOM   5690  N  ND2   . ASN F 3 30  ? 127.885 -38.688 -24.306 1.00 16.34  ? 326 ASN D ND2   1 
ATOM   5691  N  N     . TYR F 3 31  ? 130.166 -41.878 -21.116 1.00 16.74  ? 327 TYR D N     1 
ATOM   5692  C  CA    . TYR F 3 31  ? 130.029 -43.234 -20.595 1.00 16.01  ? 327 TYR D CA    1 
ATOM   5693  C  C     . TYR F 3 31  ? 128.715 -43.934 -20.910 1.00 15.74  ? 327 TYR D C     1 
ATOM   5694  O  O     . TYR F 3 31  ? 128.552 -45.095 -20.528 1.00 15.52  ? 327 TYR D O     1 
ATOM   5695  C  CB    . TYR F 3 31  ? 130.294 -43.277 -19.092 1.00 15.99  ? 327 TYR D CB    1 
ATOM   5696  C  CG    . TYR F 3 31  ? 129.567 -42.220 -18.294 1.00 15.26  ? 327 TYR D CG    1 
ATOM   5697  C  CD1   . TYR F 3 31  ? 128.186 -42.252 -18.153 1.00 15.44  ? 327 TYR D CD1   1 
ATOM   5698  C  CD2   . TYR F 3 31  ? 130.266 -41.208 -17.661 1.00 14.60  ? 327 TYR D CD2   1 
ATOM   5699  C  CE1   . TYR F 3 31  ? 127.517 -41.296 -17.414 1.00 16.16  ? 327 TYR D CE1   1 
ATOM   5700  C  CE2   . TYR F 3 31  ? 129.612 -40.238 -16.916 1.00 16.09  ? 327 TYR D CE2   1 
ATOM   5701  C  CZ    . TYR F 3 31  ? 128.235 -40.289 -16.793 1.00 17.23  ? 327 TYR D CZ    1 
ATOM   5702  O  OH    . TYR F 3 31  ? 127.571 -39.335 -16.048 1.00 16.82  ? 327 TYR D OH    1 
ATOM   5703  N  N     . HIS F 3 32  ? 127.785 -43.252 -21.588 1.00 15.48  ? 328 HIS D N     1 
ATOM   5704  C  CA    . HIS F 3 32  ? 126.492 -43.872 -21.915 1.00 15.28  ? 328 HIS D CA    1 
ATOM   5705  C  C     . HIS F 3 32  ? 126.677 -44.983 -22.912 1.00 15.45  ? 328 HIS D C     1 
ATOM   5706  O  O     . HIS F 3 32  ? 127.206 -44.765 -23.996 1.00 15.69  ? 328 HIS D O     1 
ATOM   5707  C  CB    . HIS F 3 32  ? 125.455 -42.873 -22.450 1.00 14.89  ? 328 HIS D CB    1 
ATOM   5708  C  CG    . HIS F 3 32  ? 124.897 -41.955 -21.406 1.00 14.41  ? 328 HIS D CG    1 
ATOM   5709  N  ND1   . HIS F 3 32  ? 124.091 -42.394 -20.377 1.00 13.51  ? 328 HIS D ND1   1 
ATOM   5710  C  CD2   . HIS F 3 32  ? 125.028 -40.618 -21.237 1.00 12.90  ? 328 HIS D CD2   1 
ATOM   5711  C  CE1   . HIS F 3 32  ? 123.749 -41.369 -19.620 1.00 13.16  ? 328 HIS D CE1   1 
ATOM   5712  N  NE2   . HIS F 3 32  ? 124.309 -40.279 -20.118 1.00 12.73  ? 328 HIS D NE2   1 
ATOM   5713  N  N     . ASP F 3 33  ? 126.251 -46.181 -22.523 1.00 16.14  ? 329 ASP D N     1 
ATOM   5714  C  CA    . ASP F 3 33  ? 126.313 -47.366 -23.381 1.00 16.54  ? 329 ASP D CA    1 
ATOM   5715  C  C     . ASP F 3 33  ? 127.731 -47.565 -23.906 1.00 16.53  ? 329 ASP D C     1 
ATOM   5716  O  O     . ASP F 3 33  ? 127.934 -47.988 -25.039 1.00 17.00  ? 329 ASP D O     1 
ATOM   5717  C  CB    . ASP F 3 33  ? 125.318 -47.222 -24.541 1.00 16.54  ? 329 ASP D CB    1 
ATOM   5718  C  CG    . ASP F 3 33  ? 125.039 -48.544 -25.264 1.00 17.13  ? 329 ASP D CG    1 
ATOM   5719  O  OD1   . ASP F 3 33  ? 125.007 -49.620 -24.629 1.00 14.14  ? 329 ASP D OD1   1 
ATOM   5720  O  OD2   . ASP F 3 33  ? 124.824 -48.481 -26.492 1.00 19.53  ? 329 ASP D OD2   1 
ATOM   5721  N  N     . ALA F 3 34  ? 128.713 -47.254 -23.076 1.00 16.31  ? 330 ALA D N     1 
ATOM   5722  C  CA    . ALA F 3 34  ? 130.098 -47.354 -23.485 1.00 16.30  ? 330 ALA D CA    1 
ATOM   5723  C  C     . ALA F 3 34  ? 130.673 -48.647 -22.912 1.00 16.25  ? 330 ALA D C     1 
ATOM   5724  O  O     . ALA F 3 34  ? 130.171 -49.143 -21.906 1.00 16.42  ? 330 ALA D O     1 
ATOM   5725  C  CB    . ALA F 3 34  ? 130.872 -46.113 -22.996 1.00 16.16  ? 330 ALA D CB    1 
ATOM   5726  N  N     . PRO F 3 35  ? 131.726 -49.204 -23.539 1.00 16.27  ? 331 PRO D N     1 
ATOM   5727  C  CA    . PRO F 3 35  ? 132.228 -50.492 -23.036 1.00 16.26  ? 331 PRO D CA    1 
ATOM   5728  C  C     . PRO F 3 35  ? 132.972 -50.368 -21.718 1.00 16.26  ? 331 PRO D C     1 
ATOM   5729  O  O     . PRO F 3 35  ? 133.558 -49.322 -21.421 1.00 16.51  ? 331 PRO D O     1 
ATOM   5730  C  CB    . PRO F 3 35  ? 133.213 -50.960 -24.125 1.00 15.86  ? 331 PRO D CB    1 
ATOM   5731  C  CG    . PRO F 3 35  ? 133.132 -49.966 -25.231 1.00 16.05  ? 331 PRO D CG    1 
ATOM   5732  C  CD    . PRO F 3 35  ? 132.503 -48.713 -24.690 1.00 16.52  ? 331 PRO D CD    1 
ATOM   5733  N  N     . ILE F 3 36  ? 132.941 -51.438 -20.941 1.00 16.14  ? 332 ILE D N     1 
ATOM   5734  C  CA    . ILE F 3 36  ? 133.681 -51.510 -19.698 1.00 16.21  ? 332 ILE D CA    1 
ATOM   5735  C  C     . ILE F 3 36  ? 134.907 -52.352 -20.010 1.00 16.35  ? 332 ILE D C     1 
ATOM   5736  O  O     . ILE F 3 36  ? 134.794 -53.521 -20.342 1.00 16.90  ? 332 ILE D O     1 
ATOM   5737  C  CB    . ILE F 3 36  ? 132.840 -52.162 -18.595 1.00 15.90  ? 332 ILE D CB    1 
ATOM   5738  C  CG1   . ILE F 3 36  ? 131.729 -51.208 -18.158 1.00 15.86  ? 332 ILE D CG1   1 
ATOM   5739  C  CG2   . ILE F 3 36  ? 133.715 -52.573 -17.421 1.00 16.21  ? 332 ILE D CG2   1 
ATOM   5740  C  CD1   . ILE F 3 36  ? 130.757 -51.787 -17.153 1.00 14.88  ? 332 ILE D CD1   1 
ATOM   5741  N  N     . VAL F 3 37  ? 136.085 -51.764 -19.903 1.00 16.60  ? 333 VAL D N     1 
ATOM   5742  C  CA    . VAL F 3 37  ? 137.304 -52.458 -20.317 1.00 16.57  ? 333 VAL D CA    1 
ATOM   5743  C  C     . VAL F 3 37  ? 137.963 -53.351 -19.258 1.00 16.36  ? 333 VAL D C     1 
ATOM   5744  O  O     . VAL F 3 37  ? 138.646 -54.309 -19.600 1.00 16.58  ? 333 VAL D O     1 
ATOM   5745  C  CB    . VAL F 3 37  ? 138.328 -51.462 -20.909 1.00 16.57  ? 333 VAL D CB    1 
ATOM   5746  C  CG1   . VAL F 3 37  ? 137.598 -50.427 -21.753 1.00 16.81  ? 333 VAL D CG1   1 
ATOM   5747  C  CG2   . VAL F 3 37  ? 139.103 -50.742 -19.818 1.00 16.67  ? 333 VAL D CG2   1 
ATOM   5748  N  N     . GLY F 3 38  ? 137.764 -53.056 -17.979 1.00 16.36  ? 334 GLY D N     1 
ATOM   5749  C  CA    . GLY F 3 38  ? 138.418 -53.853 -16.942 1.00 16.17  ? 334 GLY D CA    1 
ATOM   5750  C  C     . GLY F 3 38  ? 137.971 -53.549 -15.535 1.00 16.17  ? 334 GLY D C     1 
ATOM   5751  O  O     . GLY F 3 38  ? 137.351 -52.525 -15.275 1.00 16.03  ? 334 GLY D O     1 
ATOM   5752  N  N     . ILE F 3 39  ? 138.310 -54.445 -14.619 1.00 16.40  ? 335 ILE D N     1 
ATOM   5753  C  CA    . ILE F 3 39  ? 137.899 -54.332 -13.234 1.00 16.86  ? 335 ILE D CA    1 
ATOM   5754  C  C     . ILE F 3 39  ? 139.044 -54.582 -12.246 1.00 17.36  ? 335 ILE D C     1 
ATOM   5755  O  O     . ILE F 3 39  ? 139.840 -55.515 -12.409 1.00 17.78  ? 335 ILE D O     1 
ATOM   5756  C  CB    . ILE F 3 39  ? 136.773 -55.353 -12.929 1.00 16.73  ? 335 ILE D CB    1 
ATOM   5757  C  CG1   . ILE F 3 39  ? 135.539 -55.052 -13.771 1.00 16.79  ? 335 ILE D CG1   1 
ATOM   5758  C  CG2   . ILE F 3 39  ? 136.421 -55.365 -11.448 1.00 16.17  ? 335 ILE D CG2   1 
ATOM   5759  C  CD1   . ILE F 3 39  ? 134.437 -56.036 -13.569 1.00 17.97  ? 335 ILE D CD1   1 
ATOM   5760  N  N     . ALA F 3 40  ? 139.112 -53.758 -11.209 1.00 17.52  ? 336 ALA D N     1 
ATOM   5761  C  CA    . ALA F 3 40  ? 140.074 -53.982 -10.146 1.00 17.65  ? 336 ALA D CA    1 
ATOM   5762  C  C     . ALA F 3 40  ? 139.400 -53.857 -8.789  1.00 17.64  ? 336 ALA D C     1 
ATOM   5763  O  O     . ALA F 3 40  ? 138.512 -53.034 -8.587  1.00 17.47  ? 336 ALA D O     1 
ATOM   5764  C  CB    . ALA F 3 40  ? 141.262 -53.026 -10.261 1.00 17.80  ? 336 ALA D CB    1 
ATOM   5765  N  N     . VAL F 3 41  ? 139.823 -54.709 -7.870  1.00 17.98  ? 337 VAL D N     1 
ATOM   5766  C  CA    . VAL F 3 41  ? 139.301 -54.725 -6.517  1.00 18.25  ? 337 VAL D CA    1 
ATOM   5767  C  C     . VAL F 3 41  ? 140.476 -54.819 -5.557  1.00 18.59  ? 337 VAL D C     1 
ATOM   5768  O  O     . VAL F 3 41  ? 141.377 -55.643 -5.750  1.00 18.71  ? 337 VAL D O     1 
ATOM   5769  C  CB    . VAL F 3 41  ? 138.407 -55.953 -6.272  1.00 18.25  ? 337 VAL D CB    1 
ATOM   5770  C  CG1   . VAL F 3 41  ? 138.014 -56.056 -4.778  1.00 18.10  ? 337 VAL D CG1   1 
ATOM   5771  C  CG2   . VAL F 3 41  ? 137.177 -55.908 -7.162  1.00 18.14  ? 337 VAL D CG2   1 
ATOM   5772  N  N     . VAL F 3 42  ? 140.477 -53.969 -4.538  1.00 18.61  ? 338 VAL D N     1 
ATOM   5773  C  CA    . VAL F 3 42  ? 141.503 -54.026 -3.514  1.00 19.17  ? 338 VAL D CA    1 
ATOM   5774  C  C     . VAL F 3 42  ? 140.788 -54.069 -2.182  1.00 19.68  ? 338 VAL D C     1 
ATOM   5775  O  O     . VAL F 3 42  ? 139.922 -53.241 -1.915  1.00 20.05  ? 338 VAL D O     1 
ATOM   5776  C  CB    . VAL F 3 42  ? 142.438 -52.798 -3.552  1.00 19.16  ? 338 VAL D CB    1 
ATOM   5777  C  CG1   . VAL F 3 42  ? 143.245 -52.705 -2.279  1.00 18.95  ? 338 VAL D CG1   1 
ATOM   5778  C  CG2   . VAL F 3 42  ? 143.367 -52.860 -4.747  1.00 18.63  ? 338 VAL D CG2   1 
ATOM   5779  N  N     . ASN F 3 43  ? 141.127 -55.048 -1.355  1.00 19.96  ? 339 ASN D N     1 
ATOM   5780  C  CA    . ASN F 3 43  ? 140.526 -55.147 -0.037  1.00 20.48  ? 339 ASN D CA    1 
ATOM   5781  C  C     . ASN F 3 43  ? 141.521 -55.766 0.940   1.00 20.96  ? 339 ASN D C     1 
ATOM   5782  O  O     . ASN F 3 43  ? 142.675 -55.979 0.586   1.00 21.14  ? 339 ASN D O     1 
ATOM   5783  C  CB    . ASN F 3 43  ? 139.202 -55.925 -0.090  1.00 20.35  ? 339 ASN D CB    1 
ATOM   5784  C  CG    . ASN F 3 43  ? 139.391 -57.391 -0.449  1.00 19.77  ? 339 ASN D CG    1 
ATOM   5785  O  OD1   . ASN F 3 43  ? 140.418 -57.993 -0.132  1.00 19.35  ? 339 ASN D OD1   1 
ATOM   5786  N  ND2   . ASN F 3 43  ? 138.389 -57.977 -1.097  1.00 18.31  ? 339 ASN D ND2   1 
ATOM   5787  N  N     . GLU F 3 44  ? 141.076 -56.054 2.158   1.00 21.60  ? 340 GLU D N     1 
ATOM   5788  C  CA    . GLU F 3 44  ? 141.954 -56.589 3.201   1.00 22.49  ? 340 GLU D CA    1 
ATOM   5789  C  C     . GLU F 3 44  ? 142.694 -57.858 2.782   1.00 22.09  ? 340 GLU D C     1 
ATOM   5790  O  O     . GLU F 3 44  ? 143.769 -58.131 3.291   1.00 22.11  ? 340 GLU D O     1 
ATOM   5791  C  CB    . GLU F 3 44  ? 141.161 -56.863 4.486   1.00 22.52  ? 340 GLU D CB    1 
ATOM   5792  C  CG    . GLU F 3 44  ? 139.994 -57.858 4.287   1.00 23.98  ? 340 GLU D CG    1 
ATOM   5793  C  CD    . GLU F 3 44  ? 139.394 -58.381 5.594   1.00 24.47  ? 340 GLU D CD    1 
ATOM   5794  O  OE1   . GLU F 3 44  ? 140.162 -58.865 6.464   1.00 27.15  ? 340 GLU D OE1   1 
ATOM   5795  O  OE2   . GLU F 3 44  ? 138.145 -58.341 5.734   1.00 27.42  ? 340 GLU D OE2   1 
ATOM   5796  N  N     . HIS F 3 45  ? 142.126 -58.618 1.847   1.00 22.23  ? 341 HIS D N     1 
ATOM   5797  C  CA    . HIS F 3 45  ? 142.698 -59.902 1.444   1.00 22.04  ? 341 HIS D CA    1 
ATOM   5798  C  C     . HIS F 3 45  ? 143.599 -59.864 0.209   1.00 21.89  ? 341 HIS D C     1 
ATOM   5799  O  O     . HIS F 3 45  ? 144.079 -60.921 -0.224  1.00 22.36  ? 341 HIS D O     1 
ATOM   5800  C  CB    . HIS F 3 45  ? 141.599 -60.932 1.166   1.00 22.29  ? 341 HIS D CB    1 
ATOM   5801  C  CG    . HIS F 3 45  ? 140.541 -61.021 2.225   1.00 23.52  ? 341 HIS D CG    1 
ATOM   5802  N  ND1   . HIS F 3 45  ? 140.819 -61.340 3.539   1.00 24.52  ? 341 HIS D ND1   1 
ATOM   5803  C  CD2   . HIS F 3 45  ? 139.192 -60.896 2.145   1.00 24.39  ? 341 HIS D CD2   1 
ATOM   5804  C  CE1   . HIS F 3 45  ? 139.691 -61.378 4.228   1.00 25.07  ? 341 HIS D CE1   1 
ATOM   5805  N  NE2   . HIS F 3 45  ? 138.689 -61.113 3.407   1.00 25.15  ? 341 HIS D NE2   1 
ATOM   5806  N  N     . GLY F 3 46  ? 143.820 -58.689 -0.383  1.00 21.06  ? 342 GLY D N     1 
ATOM   5807  C  CA    . GLY F 3 46  ? 144.652 -58.620 -1.591  1.00 20.02  ? 342 GLY D CA    1 
ATOM   5808  C  C     . GLY F 3 46  ? 144.158 -57.721 -2.708  1.00 19.52  ? 342 GLY D C     1 
ATOM   5809  O  O     . GLY F 3 46  ? 143.193 -56.976 -2.543  1.00 19.88  ? 342 GLY D O     1 
ATOM   5810  N  N     . ARG F 3 47  ? 144.823 -57.790 -3.854  1.00 18.90  ? 343 ARG D N     1 
ATOM   5811  C  CA    . ARG F 3 47  ? 144.511 -56.916 -4.976  1.00 18.82  ? 343 ARG D CA    1 
ATOM   5812  C  C     . ARG F 3 47  ? 144.177 -57.746 -6.193  1.00 19.27  ? 343 ARG D C     1 
ATOM   5813  O  O     . ARG F 3 47  ? 144.940 -58.636 -6.566  1.00 19.80  ? 343 ARG D O     1 
ATOM   5814  C  CB    . ARG F 3 47  ? 145.703 -56.018 -5.298  1.00 18.59  ? 343 ARG D CB    1 
ATOM   5815  C  CG    . ARG F 3 47  ? 146.293 -55.310 -4.110  1.00 16.74  ? 343 ARG D CG    1 
ATOM   5816  C  CD    . ARG F 3 47  ? 147.296 -54.312 -4.581  1.00 15.09  ? 343 ARG D CD    1 
ATOM   5817  N  NE    . ARG F 3 47  ? 148.097 -53.797 -3.477  1.00 14.23  ? 343 ARG D NE    1 
ATOM   5818  C  CZ    . ARG F 3 47  ? 149.325 -54.222 -3.192  1.00 12.21  ? 343 ARG D CZ    1 
ATOM   5819  N  NH1   . ARG F 3 47  ? 149.892 -55.160 -3.942  1.00 8.79   ? 343 ARG D NH1   1 
ATOM   5820  N  NH2   . ARG F 3 47  ? 149.989 -53.693 -2.169  1.00 10.63  ? 343 ARG D NH2   1 
ATOM   5821  N  N     . PHE F 3 48  ? 143.055 -57.464 -6.840  1.00 19.50  ? 344 PHE D N     1 
ATOM   5822  C  CA    . PHE F 3 48  ? 142.643 -58.336 -7.934  1.00 20.24  ? 344 PHE D CA    1 
ATOM   5823  C  C     . PHE F 3 48  ? 142.241 -57.618 -9.205  1.00 20.33  ? 344 PHE D C     1 
ATOM   5824  O  O     . PHE F 3 48  ? 141.667 -56.537 -9.162  1.00 20.64  ? 344 PHE D O     1 
ATOM   5825  C  CB    . PHE F 3 48  ? 141.477 -59.223 -7.477  1.00 20.18  ? 344 PHE D CB    1 
ATOM   5826  C  CG    . PHE F 3 48  ? 141.674 -59.839 -6.116  1.00 20.64  ? 344 PHE D CG    1 
ATOM   5827  C  CD1   . PHE F 3 48  ? 141.282 -59.162 -4.970  1.00 20.91  ? 344 PHE D CD1   1 
ATOM   5828  C  CD2   . PHE F 3 48  ? 142.259 -61.093 -5.981  1.00 21.11  ? 344 PHE D CD2   1 
ATOM   5829  C  CE1   . PHE F 3 48  ? 141.469 -59.720 -3.710  1.00 20.95  ? 344 PHE D CE1   1 
ATOM   5830  C  CE2   . PHE F 3 48  ? 142.438 -61.662 -4.724  1.00 21.15  ? 344 PHE D CE2   1 
ATOM   5831  C  CZ    . PHE F 3 48  ? 142.042 -60.974 -3.585  1.00 20.82  ? 344 PHE D CZ    1 
ATOM   5832  N  N     . PHE F 3 49  ? 142.549 -58.235 -10.334 1.00 20.94  ? 345 PHE D N     1 
ATOM   5833  C  CA    . PHE F 3 49  ? 142.079 -57.765 -11.627 1.00 21.67  ? 345 PHE D CA    1 
ATOM   5834  C  C     . PHE F 3 49  ? 141.058 -58.777 -12.112 1.00 22.73  ? 345 PHE D C     1 
ATOM   5835  O  O     . PHE F 3 49  ? 141.153 -59.965 -11.809 1.00 22.92  ? 345 PHE D O     1 
ATOM   5836  C  CB    . PHE F 3 49  ? 143.216 -57.653 -12.631 1.00 21.27  ? 345 PHE D CB    1 
ATOM   5837  C  CG    . PHE F 3 49  ? 142.768 -57.295 -14.019 1.00 20.60  ? 345 PHE D CG    1 
ATOM   5838  C  CD1   . PHE F 3 49  ? 142.480 -55.982 -14.352 1.00 21.52  ? 345 PHE D CD1   1 
ATOM   5839  C  CD2   . PHE F 3 49  ? 142.651 -58.265 -14.997 1.00 20.13  ? 345 PHE D CD2   1 
ATOM   5840  C  CE1   . PHE F 3 49  ? 142.062 -55.641 -15.652 1.00 21.42  ? 345 PHE D CE1   1 
ATOM   5841  C  CE2   . PHE F 3 49  ? 142.234 -57.937 -16.290 1.00 20.20  ? 345 PHE D CE2   1 
ATOM   5842  C  CZ    . PHE F 3 49  ? 141.944 -56.624 -16.616 1.00 19.98  ? 345 PHE D CZ    1 
ATOM   5843  N  N     . LEU F 3 50  ? 140.062 -58.301 -12.841 1.00 23.68  ? 346 LEU D N     1 
ATOM   5844  C  CA    . LEU F 3 50  ? 139.041 -59.174 -13.368 1.00 24.31  ? 346 LEU D CA    1 
ATOM   5845  C  C     . LEU F 3 50  ? 138.654 -58.678 -14.741 1.00 24.88  ? 346 LEU D C     1 
ATOM   5846  O  O     . LEU F 3 50  ? 138.493 -57.478 -14.940 1.00 24.63  ? 346 LEU D O     1 
ATOM   5847  C  CB    . LEU F 3 50  ? 137.819 -59.171 -12.449 1.00 24.35  ? 346 LEU D CB    1 
ATOM   5848  C  CG    . LEU F 3 50  ? 137.851 -60.047 -11.196 1.00 24.46  ? 346 LEU D CG    1 
ATOM   5849  C  CD1   . LEU F 3 50  ? 136.784 -59.632 -10.211 1.00 24.21  ? 346 LEU D CD1   1 
ATOM   5850  C  CD2   . LEU F 3 50  ? 137.705 -61.520 -11.563 1.00 24.48  ? 346 LEU D CD2   1 
ATOM   5851  N  N     . ARG F 3 51  ? 138.550 -59.599 -15.695 1.00 25.65  ? 347 ARG D N     1 
ATOM   5852  C  CA    . ARG F 3 51  ? 138.045 -59.264 -17.015 1.00 26.64  ? 347 ARG D CA    1 
ATOM   5853  C  C     . ARG F 3 51  ? 136.535 -59.149 -16.867 1.00 26.41  ? 347 ARG D C     1 
ATOM   5854  O  O     . ARG F 3 51  ? 135.926 -59.936 -16.149 1.00 26.12  ? 347 ARG D O     1 
ATOM   5855  C  CB    . ARG F 3 51  ? 138.379 -60.367 -18.029 1.00 26.88  ? 347 ARG D CB    1 
ATOM   5856  C  CG    . ARG F 3 51  ? 139.854 -60.653 -18.187 1.00 27.91  ? 347 ARG D CG    1 
ATOM   5857  C  CD    . ARG F 3 51  ? 140.114 -61.813 -19.137 1.00 28.27  ? 347 ARG D CD    1 
ATOM   5858  N  NE    . ARG F 3 51  ? 141.534 -62.172 -19.121 1.00 32.67  ? 347 ARG D NE    1 
ATOM   5859  C  CZ    . ARG F 3 51  ? 142.053 -63.142 -18.369 1.00 34.08  ? 347 ARG D CZ    1 
ATOM   5860  N  NH1   . ARG F 3 51  ? 141.267 -63.870 -17.588 1.00 35.01  ? 347 ARG D NH1   1 
ATOM   5861  N  NH2   . ARG F 3 51  ? 143.355 -63.395 -18.402 1.00 34.82  ? 347 ARG D NH2   1 
ATOM   5862  N  N     . PRO F 3 52  ? 135.924 -58.161 -17.541 1.00 26.65  ? 348 PRO D N     1 
ATOM   5863  C  CA    . PRO F 3 52  ? 134.479 -57.921 -17.448 1.00 26.73  ? 348 PRO D CA    1 
ATOM   5864  C  C     . PRO F 3 52  ? 133.599 -59.112 -17.848 1.00 26.74  ? 348 PRO D C     1 
ATOM   5865  O  O     . PRO F 3 52  ? 132.625 -59.399 -17.147 1.00 26.70  ? 348 PRO D O     1 
ATOM   5866  C  CB    . PRO F 3 52  ? 134.254 -56.732 -18.386 1.00 26.69  ? 348 PRO D CB    1 
ATOM   5867  C  CG    . PRO F 3 52  ? 135.591 -56.095 -18.516 1.00 26.87  ? 348 PRO D CG    1 
ATOM   5868  C  CD    . PRO F 3 52  ? 136.583 -57.200 -18.437 1.00 26.48  ? 348 PRO D CD    1 
ATOM   5869  N  N     . GLU F 3 53  ? 133.950 -59.805 -18.932 1.00 26.89  ? 349 GLU D N     1 
ATOM   5870  C  CA    . GLU F 3 53  ? 133.185 -60.982 -19.392 1.00 27.75  ? 349 GLU D CA    1 
ATOM   5871  C  C     . GLU F 3 53  ? 133.025 -62.016 -18.279 1.00 27.32  ? 349 GLU D C     1 
ATOM   5872  O  O     . GLU F 3 53  ? 132.034 -62.727 -18.222 1.00 27.28  ? 349 GLU D O     1 
ATOM   5873  C  CB    . GLU F 3 53  ? 133.839 -61.673 -20.610 1.00 28.24  ? 349 GLU D CB    1 
ATOM   5874  C  CG    . GLU F 3 53  ? 134.476 -60.751 -21.663 1.00 30.41  ? 349 GLU D CG    1 
ATOM   5875  C  CD    . GLU F 3 53  ? 135.912 -60.341 -21.315 1.00 34.11  ? 349 GLU D CD    1 
ATOM   5876  O  OE1   . GLU F 3 53  ? 136.783 -61.239 -21.177 1.00 35.32  ? 349 GLU D OE1   1 
ATOM   5877  O  OE2   . GLU F 3 53  ? 136.173 -59.119 -21.193 1.00 35.05  ? 349 GLU D OE2   1 
ATOM   5878  N  N     . THR F 3 54  ? 134.021 -62.087 -17.407 1.00 27.04  ? 350 THR D N     1 
ATOM   5879  C  CA    . THR F 3 54  ? 134.024 -62.998 -16.288 1.00 26.91  ? 350 THR D CA    1 
ATOM   5880  C  C     . THR F 3 54  ? 133.184 -62.478 -15.119 1.00 26.82  ? 350 THR D C     1 
ATOM   5881  O  O     . THR F 3 54  ? 132.160 -63.074 -14.773 1.00 27.02  ? 350 THR D O     1 
ATOM   5882  C  CB    . THR F 3 54  ? 135.465 -63.222 -15.785 1.00 27.16  ? 350 THR D CB    1 
ATOM   5883  O  OG1   . THR F 3 54  ? 136.343 -63.380 -16.901 1.00 27.51  ? 350 THR D OG1   1 
ATOM   5884  C  CG2   . THR F 3 54  ? 135.568 -64.460 -14.877 1.00 27.47  ? 350 THR D CG2   1 
ATOM   5885  N  N     . ALA F 3 55  ? 133.616 -61.377 -14.507 1.00 26.44  ? 351 ALA D N     1 
ATOM   5886  C  CA    . ALA F 3 55  ? 132.955 -60.853 -13.298 1.00 25.92  ? 351 ALA D CA    1 
ATOM   5887  C  C     . ALA F 3 55  ? 131.506 -60.426 -13.511 1.00 25.62  ? 351 ALA D C     1 
ATOM   5888  O  O     . ALA F 3 55  ? 130.620 -60.771 -12.720 1.00 25.27  ? 351 ALA D O     1 
ATOM   5889  C  CB    . ALA F 3 55  ? 133.756 -59.714 -12.692 1.00 25.69  ? 351 ALA D CB    1 
ATOM   5890  N  N     . LEU F 3 56  ? 131.257 -59.693 -14.587 1.00 25.30  ? 352 LEU D N     1 
ATOM   5891  C  CA    . LEU F 3 56  ? 129.916 -59.194 -14.829 1.00 25.02  ? 352 LEU D CA    1 
ATOM   5892  C  C     . LEU F 3 56  ? 128.912 -60.312 -15.145 1.00 25.12  ? 352 LEU D C     1 
ATOM   5893  O  O     . LEU F 3 56  ? 127.705 -60.113 -15.040 1.00 25.06  ? 352 LEU D O     1 
ATOM   5894  C  CB    . LEU F 3 56  ? 129.934 -58.110 -15.896 1.00 24.76  ? 352 LEU D CB    1 
ATOM   5895  C  CG    . LEU F 3 56  ? 130.846 -56.925 -15.556 1.00 24.84  ? 352 LEU D CG    1 
ATOM   5896  C  CD1   . LEU F 3 56  ? 130.646 -55.772 -16.545 1.00 24.79  ? 352 LEU D CD1   1 
ATOM   5897  C  CD2   . LEU F 3 56  ? 130.601 -56.446 -14.136 1.00 23.81  ? 352 LEU D CD2   1 
ATOM   5898  N  N     . ALA F 3 57  ? 129.409 -61.497 -15.492 1.00 25.12  ? 353 ALA D N     1 
ATOM   5899  C  CA    . ALA F 3 57  ? 128.525 -62.643 -15.738 1.00 25.02  ? 353 ALA D CA    1 
ATOM   5900  C  C     . ALA F 3 57  ? 128.438 -63.586 -14.528 1.00 24.86  ? 353 ALA D C     1 
ATOM   5901  O  O     . ALA F 3 57  ? 127.619 -64.505 -14.496 1.00 25.03  ? 353 ALA D O     1 
ATOM   5902  C  CB    . ALA F 3 57  ? 128.958 -63.407 -16.998 1.00 24.80  ? 353 ALA D CB    1 
ATOM   5903  N  N     . ASP F 3 58  ? 129.285 -63.362 -13.532 1.00 24.60  ? 354 ASP D N     1 
ATOM   5904  C  CA    . ASP F 3 58  ? 129.296 -64.215 -12.358 1.00 24.24  ? 354 ASP D CA    1 
ATOM   5905  C  C     . ASP F 3 58  ? 128.256 -63.714 -11.384 1.00 24.01  ? 354 ASP D C     1 
ATOM   5906  O  O     . ASP F 3 58  ? 128.295 -62.551 -10.986 1.00 24.08  ? 354 ASP D O     1 
ATOM   5907  C  CB    . ASP F 3 58  ? 130.681 -64.223 -11.717 1.00 24.33  ? 354 ASP D CB    1 
ATOM   5908  C  CG    . ASP F 3 58  ? 130.737 -65.053 -10.451 1.00 24.49  ? 354 ASP D CG    1 
ATOM   5909  O  OD1   . ASP F 3 58  ? 130.269 -64.587 -9.387  1.00 26.76  ? 354 ASP D OD1   1 
ATOM   5910  O  OD2   . ASP F 3 58  ? 131.288 -66.166 -10.508 1.00 24.34  ? 354 ASP D OD2   1 
ATOM   5911  N  N     . PRO F 3 59  ? 127.336 -64.601 -10.976 1.00 23.82  ? 355 PRO D N     1 
ATOM   5912  C  CA    . PRO F 3 59  ? 126.197 -64.253 -10.112 1.00 23.66  ? 355 PRO D CA    1 
ATOM   5913  C  C     . PRO F 3 59  ? 126.580 -63.673 -8.739  1.00 23.56  ? 355 PRO D C     1 
ATOM   5914  O  O     . PRO F 3 59  ? 125.849 -62.814 -8.218  1.00 23.18  ? 355 PRO D O     1 
ATOM   5915  C  CB    . PRO F 3 59  ? 125.459 -65.587 -9.940  1.00 23.41  ? 355 PRO D CB    1 
ATOM   5916  C  CG    . PRO F 3 59  ? 125.924 -66.435 -11.061 1.00 23.38  ? 355 PRO D CG    1 
ATOM   5917  C  CD    . PRO F 3 59  ? 127.340 -66.031 -11.326 1.00 23.78  ? 355 PRO D CD    1 
ATOM   5918  N  N     . GLN F 3 60  ? 127.701 -64.132 -8.171  1.00 23.03  ? 356 GLN D N     1 
ATOM   5919  C  CA    . GLN F 3 60  ? 128.136 -63.668 -6.846  1.00 22.91  ? 356 GLN D CA    1 
ATOM   5920  C  C     . GLN F 3 60  ? 128.662 -62.240 -6.895  1.00 22.32  ? 356 GLN D C     1 
ATOM   5921  O  O     . GLN F 3 60  ? 128.462 -61.458 -5.963  1.00 21.79  ? 356 GLN D O     1 
ATOM   5922  C  CB    . GLN F 3 60  ? 129.208 -64.595 -6.242  1.00 23.17  ? 356 GLN D CB    1 
ATOM   5923  C  CG    . GLN F 3 60  ? 128.682 -65.781 -5.424  1.00 24.92  ? 356 GLN D CG    1 
ATOM   5924  C  CD    . GLN F 3 60  ? 127.803 -66.711 -6.256  1.00 29.14  ? 356 GLN D CD    1 
ATOM   5925  O  OE1   . GLN F 3 60  ? 128.212 -67.185 -7.334  1.00 30.66  ? 356 GLN D OE1   1 
ATOM   5926  N  NE2   . GLN F 3 60  ? 126.577 -66.964 -5.771  1.00 28.39  ? 356 GLN D NE2   1 
ATOM   5927  N  N     . PHE F 3 61  ? 129.357 -61.922 -7.980  1.00 21.86  ? 357 PHE D N     1 
ATOM   5928  C  CA    . PHE F 3 61  ? 129.928 -60.611 -8.141  1.00 21.67  ? 357 PHE D CA    1 
ATOM   5929  C  C     . PHE F 3 61  ? 128.789 -59.602 -8.341  1.00 21.84  ? 357 PHE D C     1 
ATOM   5930  O  O     . PHE F 3 61  ? 128.795 -58.530 -7.731  1.00 21.67  ? 357 PHE D O     1 
ATOM   5931  C  CB    . PHE F 3 61  ? 130.922 -60.593 -9.310  1.00 21.46  ? 357 PHE D CB    1 
ATOM   5932  C  CG    . PHE F 3 61  ? 131.784 -59.353 -9.360  1.00 21.15  ? 357 PHE D CG    1 
ATOM   5933  C  CD1   . PHE F 3 61  ? 132.982 -59.292 -8.652  1.00 20.61  ? 357 PHE D CD1   1 
ATOM   5934  C  CD2   . PHE F 3 61  ? 131.393 -58.241 -10.106 1.00 20.60  ? 357 PHE D CD2   1 
ATOM   5935  C  CE1   . PHE F 3 61  ? 133.778 -58.138 -8.680  1.00 20.20  ? 357 PHE D CE1   1 
ATOM   5936  C  CE2   . PHE F 3 61  ? 132.192 -57.086 -10.144 1.00 19.88  ? 357 PHE D CE2   1 
ATOM   5937  C  CZ    . PHE F 3 61  ? 133.380 -57.037 -9.429  1.00 19.54  ? 357 PHE D CZ    1 
ATOM   5938  N  N     . VAL F 3 62  ? 127.802 -59.970 -9.161  1.00 21.72  ? 358 VAL D N     1 
ATOM   5939  C  CA    . VAL F 3 62  ? 126.663 -59.094 -9.457  1.00 21.84  ? 358 VAL D CA    1 
ATOM   5940  C  C     . VAL F 3 62  ? 125.881 -58.778 -8.191  1.00 21.86  ? 358 VAL D C     1 
ATOM   5941  O  O     . VAL F 3 62  ? 125.462 -57.634 -7.967  1.00 21.67  ? 358 VAL D O     1 
ATOM   5942  C  CB    . VAL F 3 62  ? 125.722 -59.704 -10.528 1.00 21.98  ? 358 VAL D CB    1 
ATOM   5943  C  CG1   . VAL F 3 62  ? 124.481 -58.826 -10.751 1.00 21.64  ? 358 VAL D CG1   1 
ATOM   5944  C  CG2   . VAL F 3 62  ? 126.474 -59.902 -11.844 1.00 22.19  ? 358 VAL D CG2   1 
ATOM   5945  N  N     . ALA F 3 63  ? 125.699 -59.802 -7.362  1.00 21.88  ? 359 ALA D N     1 
ATOM   5946  C  CA    . ALA F 3 63  ? 125.026 -59.640 -6.083  1.00 21.60  ? 359 ALA D CA    1 
ATOM   5947  C  C     . ALA F 3 63  ? 125.868 -58.716 -5.218  1.00 21.66  ? 359 ALA D C     1 
ATOM   5948  O  O     . ALA F 3 63  ? 125.352 -57.760 -4.632  1.00 21.88  ? 359 ALA D O     1 
ATOM   5949  C  CB    . ALA F 3 63  ? 124.841 -60.982 -5.407  1.00 21.63  ? 359 ALA D CB    1 
ATOM   5950  N  N     . TRP F 3 64  ? 127.171 -58.987 -5.162  1.00 21.24  ? 360 TRP D N     1 
ATOM   5951  C  CA    . TRP F 3 64  ? 128.087 -58.155 -4.383  1.00 21.04  ? 360 TRP D CA    1 
ATOM   5952  C  C     . TRP F 3 64  ? 127.953 -56.667 -4.720  1.00 20.89  ? 360 TRP D C     1 
ATOM   5953  O  O     . TRP F 3 64  ? 127.933 -55.819 -3.825  1.00 21.07  ? 360 TRP D O     1 
ATOM   5954  C  CB    . TRP F 3 64  ? 129.537 -58.606 -4.578  1.00 20.78  ? 360 TRP D CB    1 
ATOM   5955  C  CG    . TRP F 3 64  ? 130.506 -57.762 -3.825  1.00 20.38  ? 360 TRP D CG    1 
ATOM   5956  C  CD1   . TRP F 3 64  ? 130.711 -57.768 -2.482  1.00 20.43  ? 360 TRP D CD1   1 
ATOM   5957  C  CD2   . TRP F 3 64  ? 131.396 -56.777 -4.368  1.00 20.03  ? 360 TRP D CD2   1 
ATOM   5958  N  NE1   . TRP F 3 64  ? 131.671 -56.850 -2.148  1.00 21.37  ? 360 TRP D NE1   1 
ATOM   5959  C  CE2   . TRP F 3 64  ? 132.111 -56.225 -3.286  1.00 20.71  ? 360 TRP D CE2   1 
ATOM   5960  C  CE3   . TRP F 3 64  ? 131.653 -56.303 -5.661  1.00 20.22  ? 360 TRP D CE3   1 
ATOM   5961  C  CZ2   . TRP F 3 64  ? 133.072 -55.218 -3.453  1.00 20.17  ? 360 TRP D CZ2   1 
ATOM   5962  C  CZ3   . TRP F 3 64  ? 132.607 -55.299 -5.827  1.00 20.63  ? 360 TRP D CZ3   1 
ATOM   5963  C  CH2   . TRP F 3 64  ? 133.307 -54.772 -4.727  1.00 20.04  ? 360 TRP D CH2   1 
ATOM   5964  N  N     . LEU F 3 65  ? 127.866 -56.369 -6.012  1.00 20.65  ? 361 LEU D N     1 
ATOM   5965  C  CA    . LEU F 3 65  ? 127.726 -55.011 -6.504  1.00 20.47  ? 361 LEU D CA    1 
ATOM   5966  C  C     . LEU F 3 65  ? 126.423 -54.375 -6.044  1.00 20.71  ? 361 LEU D C     1 
ATOM   5967  O  O     . LEU F 3 65  ? 126.395 -53.187 -5.725  1.00 20.66  ? 361 LEU D O     1 
ATOM   5968  C  CB    . LEU F 3 65  ? 127.769 -55.001 -8.034  1.00 20.26  ? 361 LEU D CB    1 
ATOM   5969  C  CG    . LEU F 3 65  ? 129.097 -55.321 -8.723  1.00 20.47  ? 361 LEU D CG    1 
ATOM   5970  C  CD1   . LEU F 3 65  ? 128.885 -55.512 -10.226 1.00 20.09  ? 361 LEU D CD1   1 
ATOM   5971  C  CD2   . LEU F 3 65  ? 130.143 -54.224 -8.439  1.00 20.20  ? 361 LEU D CD2   1 
ATOM   5972  N  N     . GLY F 3 66  ? 125.354 -55.177 -6.003  1.00 20.75  ? 362 GLY D N     1 
ATOM   5973  C  CA    . GLY F 3 66  ? 124.017 -54.690 -5.672  1.00 20.81  ? 362 GLY D CA    1 
ATOM   5974  C  C     . GLY F 3 66  ? 123.672 -54.685 -4.199  1.00 21.29  ? 362 GLY D C     1 
ATOM   5975  O  O     . GLY F 3 66  ? 122.628 -54.171 -3.799  1.00 21.83  ? 362 GLY D O     1 
ATOM   5976  N  N     . ASP F 3 67  ? 124.537 -55.263 -3.378  1.00 21.38  ? 363 ASP D N     1 
ATOM   5977  C  CA    . ASP F 3 67  ? 124.313 -55.275 -1.944  1.00 21.34  ? 363 ASP D CA    1 
ATOM   5978  C  C     . ASP F 3 67  ? 124.802 -53.961 -1.327  1.00 21.41  ? 363 ASP D C     1 
ATOM   5979  O  O     . ASP F 3 67  ? 125.992 -53.634 -1.387  1.00 21.52  ? 363 ASP D O     1 
ATOM   5980  C  CB    . ASP F 3 67  ? 125.031 -56.471 -1.330  1.00 21.37  ? 363 ASP D CB    1 
ATOM   5981  C  CG    . ASP F 3 67  ? 124.795 -56.599 0.159   1.00 21.64  ? 363 ASP D CG    1 
ATOM   5982  O  OD1   . ASP F 3 67  ? 124.201 -55.680 0.771   1.00 19.94  ? 363 ASP D OD1   1 
ATOM   5983  O  OD2   . ASP F 3 67  ? 125.219 -57.633 0.715   1.00 22.73  ? 363 ASP D OD2   1 
ATOM   5984  N  N     . GLU F 3 68  ? 123.886 -53.210 -0.731  1.00 21.37  ? 364 GLU D N     1 
ATOM   5985  C  CA    . GLU F 3 68  ? 124.242 -51.907 -0.166  1.00 21.83  ? 364 GLU D CA    1 
ATOM   5986  C  C     . GLU F 3 68  ? 125.123 -52.027 1.087   1.00 20.99  ? 364 GLU D C     1 
ATOM   5987  O  O     . GLU F 3 68  ? 125.854 -51.091 1.434   1.00 20.90  ? 364 GLU D O     1 
ATOM   5988  C  CB    . GLU F 3 68  ? 122.988 -51.072 0.124   1.00 21.56  ? 364 GLU D CB    1 
ATOM   5989  C  CG    . GLU F 3 68  ? 122.141 -51.585 1.293   1.00 23.19  ? 364 GLU D CG    1 
ATOM   5990  C  CD    . GLU F 3 68  ? 120.797 -50.861 1.419   1.00 24.10  ? 364 GLU D CD    1 
ATOM   5991  O  OE1   . GLU F 3 68  ? 120.440 -50.103 0.485   1.00 25.40  ? 364 GLU D OE1   1 
ATOM   5992  O  OE2   . GLU F 3 68  ? 120.097 -51.055 2.449   1.00 27.08  ? 364 GLU D OE2   1 
ATOM   5993  N  N     . THR F 3 69  ? 125.066 -53.190 1.736   1.00 20.33  ? 365 THR D N     1 
ATOM   5994  C  CA    . THR F 3 69  ? 125.783 -53.432 2.981   1.00 19.71  ? 365 THR D CA    1 
ATOM   5995  C  C     . THR F 3 69  ? 127.220 -53.819 2.704   1.00 19.46  ? 365 THR D C     1 
ATOM   5996  O  O     . THR F 3 69  ? 128.004 -53.998 3.633   1.00 19.76  ? 365 THR D O     1 
ATOM   5997  C  CB    . THR F 3 69  ? 125.129 -54.555 3.825   1.00 19.92  ? 365 THR D CB    1 
ATOM   5998  O  OG1   . THR F 3 69  ? 125.341 -55.820 3.192   1.00 20.17  ? 365 THR D OG1   1 
ATOM   5999  C  CG2   . THR F 3 69  ? 123.625 -54.327 3.994   1.00 19.41  ? 365 THR D CG2   1 
ATOM   6000  N  N     . LYS F 3 70  ? 127.556 -53.993 1.430   1.00 18.67  ? 366 LYS D N     1 
ATOM   6001  C  CA    . LYS F 3 70  ? 128.939 -54.206 1.043   1.00 18.40  ? 366 LYS D CA    1 
ATOM   6002  C  C     . LYS F 3 70  ? 129.491 -52.869 0.555   1.00 17.74  ? 366 LYS D C     1 
ATOM   6003  O  O     . LYS F 3 70  ? 129.144 -52.424 -0.538  1.00 17.44  ? 366 LYS D O     1 
ATOM   6004  C  CB    . LYS F 3 70  ? 129.030 -55.241 -0.072  1.00 18.63  ? 366 LYS D CB    1 
ATOM   6005  C  CG    . LYS F 3 70  ? 128.359 -56.563 0.252   1.00 20.02  ? 366 LYS D CG    1 
ATOM   6006  C  CD    . LYS F 3 70  ? 128.860 -57.174 1.542   1.00 20.62  ? 366 LYS D CD    1 
ATOM   6007  C  CE    . LYS F 3 70  ? 128.295 -58.568 1.726   1.00 21.39  ? 366 LYS D CE    1 
ATOM   6008  N  NZ    . LYS F 3 70  ? 128.345 -59.006 3.154   1.00 22.95  ? 366 LYS D NZ    1 
ATOM   6009  N  N     . LYS F 3 71  ? 130.347 -52.235 1.358   1.00 16.96  ? 367 LYS D N     1 
ATOM   6010  C  CA    . LYS F 3 71  ? 130.829 -50.878 1.053   1.00 16.30  ? 367 LYS D CA    1 
ATOM   6011  C  C     . LYS F 3 71  ? 131.971 -50.807 0.031   1.00 15.89  ? 367 LYS D C     1 
ATOM   6012  O  O     . LYS F 3 71  ? 132.957 -51.547 0.131   1.00 15.66  ? 367 LYS D O     1 
ATOM   6013  C  CB    . LYS F 3 71  ? 131.239 -50.142 2.334   1.00 16.30  ? 367 LYS D CB    1 
ATOM   6014  C  CG    . LYS F 3 71  ? 130.147 -50.029 3.403   1.00 16.59  ? 367 LYS D CG    1 
ATOM   6015  C  CD    . LYS F 3 71  ? 128.891 -49.347 2.886   1.00 17.17  ? 367 LYS D CD    1 
ATOM   6016  C  CE    . LYS F 3 71  ? 127.730 -49.576 3.840   1.00 18.09  ? 367 LYS D CE    1 
ATOM   6017  N  NZ    . LYS F 3 71  ? 126.411 -49.215 3.245   1.00 17.40  ? 367 LYS D NZ    1 
ATOM   6018  N  N     . LYS F 3 72  ? 131.835 -49.899 -0.935  1.00 14.94  ? 368 LYS D N     1 
ATOM   6019  C  CA    . LYS F 3 72  ? 132.862 -49.691 -1.959  1.00 14.38  ? 368 LYS D CA    1 
ATOM   6020  C  C     . LYS F 3 72  ? 133.439 -48.266 -1.988  1.00 14.15  ? 368 LYS D C     1 
ATOM   6021  O  O     . LYS F 3 72  ? 132.683 -47.287 -1.972  1.00 13.88  ? 368 LYS D O     1 
ATOM   6022  C  CB    . LYS F 3 72  ? 132.319 -49.996 -3.370  1.00 14.30  ? 368 LYS D CB    1 
ATOM   6023  C  CG    . LYS F 3 72  ? 131.821 -51.406 -3.620  1.00 14.03  ? 368 LYS D CG    1 
ATOM   6024  C  CD    . LYS F 3 72  ? 130.333 -51.545 -3.332  1.00 12.77  ? 368 LYS D CD    1 
ATOM   6025  C  CE    . LYS F 3 72  ? 129.820 -52.927 -3.660  1.00 9.90   ? 368 LYS D CE    1 
ATOM   6026  N  NZ    . LYS F 3 72  ? 128.452 -53.141 -3.112  1.00 8.14   ? 368 LYS D NZ    1 
ATOM   6027  N  N     . SER F 3 73  ? 134.770 -48.161 -2.045  1.00 13.95  ? 369 SER D N     1 
ATOM   6028  C  CA    . SER F 3 73  ? 135.449 -46.890 -2.303  1.00 14.02  ? 369 SER D CA    1 
ATOM   6029  C  C     . SER F 3 73  ? 135.792 -46.805 -3.793  1.00 13.53  ? 369 SER D C     1 
ATOM   6030  O  O     . SER F 3 73  ? 136.274 -47.767 -4.378  1.00 13.05  ? 369 SER D O     1 
ATOM   6031  C  CB    . SER F 3 73  ? 136.720 -46.772 -1.477  1.00 14.31  ? 369 SER D CB    1 
ATOM   6032  O  OG    . SER F 3 73  ? 136.443 -46.292 -0.175  1.00 16.91  ? 369 SER D OG    1 
ATOM   6033  N  N     . MET F 3 74  ? 135.544 -45.657 -4.409  1.00 13.37  ? 370 MET D N     1 
ATOM   6034  C  CA    . MET F 3 74  ? 135.737 -45.523 -5.854  1.00 13.65  ? 370 MET D CA    1 
ATOM   6035  C  C     . MET F 3 74  ? 136.153 -44.118 -6.224  1.00 13.50  ? 370 MET D C     1 
ATOM   6036  O  O     . MET F 3 74  ? 136.323 -43.248 -5.357  1.00 13.33  ? 370 MET D O     1 
ATOM   6037  C  CB    . MET F 3 74  ? 134.445 -45.842 -6.632  1.00 12.94  ? 370 MET D CB    1 
ATOM   6038  C  CG    . MET F 3 74  ? 133.746 -47.116 -6.216  1.00 13.58  ? 370 MET D CG    1 
ATOM   6039  S  SD    . MET F 3 74  ? 132.331 -47.537 -7.239  1.00 14.59  ? 370 MET D SD    1 
ATOM   6040  C  CE    . MET F 3 74  ? 133.142 -47.853 -8.816  1.00 15.09  ? 370 MET D CE    1 
ATOM   6041  N  N     . PHE F 3 75  ? 136.305 -43.917 -7.530  1.00 12.97  ? 371 PHE D N     1 
ATOM   6042  C  CA    . PHE F 3 75  ? 136.570 -42.618 -8.086  1.00 12.93  ? 371 PHE D CA    1 
ATOM   6043  C  C     . PHE F 3 75  ? 135.581 -42.449 -9.223  1.00 13.11  ? 371 PHE D C     1 
ATOM   6044  O  O     . PHE F 3 75  ? 135.614 -43.218 -10.182 1.00 13.84  ? 371 PHE D O     1 
ATOM   6045  C  CB    . PHE F 3 75  ? 138.001 -42.546 -8.611  1.00 12.84  ? 371 PHE D CB    1 
ATOM   6046  C  CG    . PHE F 3 75  ? 138.324 -41.254 -9.324  1.00 12.26  ? 371 PHE D CG    1 
ATOM   6047  C  CD1   . PHE F 3 75  ? 139.036 -40.257 -8.684  1.00 10.42  ? 371 PHE D CD1   1 
ATOM   6048  C  CD2   . PHE F 3 75  ? 137.898 -41.040 -10.631 1.00 11.08  ? 371 PHE D CD2   1 
ATOM   6049  C  CE1   . PHE F 3 75  ? 139.318 -39.081 -9.330  1.00 10.80  ? 371 PHE D CE1   1 
ATOM   6050  C  CE2   . PHE F 3 75  ? 138.178 -39.872 -11.278 1.00 10.87  ? 371 PHE D CE2   1 
ATOM   6051  C  CZ    . PHE F 3 75  ? 138.887 -38.885 -10.624 1.00 11.79  ? 371 PHE D CZ    1 
ATOM   6052  N  N     . ASP F 3 76  ? 134.719 -41.437 -9.135  1.00 13.12  ? 372 ASP D N     1 
ATOM   6053  C  CA    . ASP F 3 76  ? 133.674 -41.207 -10.150 1.00 12.73  ? 372 ASP D CA    1 
ATOM   6054  C  C     . ASP F 3 76  ? 132.748 -42.417 -10.241 1.00 12.28  ? 372 ASP D C     1 
ATOM   6055  O  O     . ASP F 3 76  ? 132.644 -43.069 -11.275 1.00 11.72  ? 372 ASP D O     1 
ATOM   6056  C  CB    . ASP F 3 76  ? 134.258 -40.883 -11.532 1.00 12.64  ? 372 ASP D CB    1 
ATOM   6057  C  CG    . ASP F 3 76  ? 133.200 -40.374 -12.510 1.00 13.42  ? 372 ASP D CG    1 
ATOM   6058  O  OD1   . ASP F 3 76  ? 132.014 -40.220 -12.110 1.00 12.39  ? 372 ASP D OD1   1 
ATOM   6059  O  OD2   . ASP F 3 76  ? 133.556 -40.129 -13.685 1.00 13.95  ? 372 ASP D OD2   1 
ATOM   6060  N  N     . SER F 3 77  ? 132.071 -42.686 -9.134  1.00 12.11  ? 373 SER D N     1 
ATOM   6061  C  CA    . SER F 3 77  ? 131.138 -43.784 -9.024  1.00 11.76  ? 373 SER D CA    1 
ATOM   6062  C  C     . SER F 3 77  ? 129.949 -43.651 -9.988  1.00 12.04  ? 373 SER D C     1 
ATOM   6063  O  O     . SER F 3 77  ? 129.391 -44.662 -10.443 1.00 11.92  ? 373 SER D O     1 
ATOM   6064  C  CB    . SER F 3 77  ? 130.659 -43.892 -7.579  1.00 11.62  ? 373 SER D CB    1 
ATOM   6065  O  OG    . SER F 3 77  ? 130.140 -42.651 -7.117  1.00 11.27  ? 373 SER D OG    1 
ATOM   6066  N  N     . LYS F 3 78  ? 129.552 -42.420 -10.297 1.00 12.11  ? 374 LYS D N     1 
ATOM   6067  C  CA    . LYS F 3 78  ? 128.448 -42.220 -11.237 1.00 12.52  ? 374 LYS D CA    1 
ATOM   6068  C  C     . LYS F 3 78  ? 128.783 -42.839 -12.593 1.00 12.97  ? 374 LYS D C     1 
ATOM   6069  O  O     . LYS F 3 78  ? 127.993 -43.612 -13.148 1.00 13.39  ? 374 LYS D O     1 
ATOM   6070  C  CB    . LYS F 3 78  ? 128.110 -40.739 -11.402 1.00 12.41  ? 374 LYS D CB    1 
ATOM   6071  C  CG    . LYS F 3 78  ? 126.943 -40.490 -12.352 1.00 11.64  ? 374 LYS D CG    1 
ATOM   6072  C  CD    . LYS F 3 78  ? 126.196 -39.216 -11.990 1.00 10.24  ? 374 LYS D CD    1 
ATOM   6073  C  CE    . LYS F 3 78  ? 127.033 -37.995 -12.245 1.00 9.97   ? 374 LYS D CE    1 
ATOM   6074  N  NZ    . LYS F 3 78  ? 127.193 -37.816 -13.689 1.00 11.04  ? 374 LYS D NZ    1 
ATOM   6075  N  N     . ARG F 3 79  ? 129.964 -42.508 -13.106 1.00 13.03  ? 375 ARG D N     1 
ATOM   6076  C  CA    . ARG F 3 79  ? 130.453 -43.071 -14.357 1.00 12.87  ? 375 ARG D CA    1 
ATOM   6077  C  C     . ARG F 3 79  ? 130.222 -44.579 -14.391 1.00 13.02  ? 375 ARG D C     1 
ATOM   6078  O  O     . ARG F 3 79  ? 129.664 -45.095 -15.357 1.00 12.89  ? 375 ARG D O     1 
ATOM   6079  C  CB    . ARG F 3 79  ? 131.938 -42.739 -14.542 1.00 12.45  ? 375 ARG D CB    1 
ATOM   6080  C  CG    . ARG F 3 79  ? 132.596 -43.334 -15.768 1.00 12.95  ? 375 ARG D CG    1 
ATOM   6081  C  CD    . ARG F 3 79  ? 133.987 -42.759 -15.997 1.00 12.90  ? 375 ARG D CD    1 
ATOM   6082  N  NE    . ARG F 3 79  ? 133.913 -41.446 -16.624 1.00 13.96  ? 375 ARG D NE    1 
ATOM   6083  C  CZ    . ARG F 3 79  ? 133.964 -41.239 -17.938 1.00 15.48  ? 375 ARG D CZ    1 
ATOM   6084  N  NH1   . ARG F 3 79  ? 134.111 -42.258 -18.783 1.00 14.95  ? 375 ARG D NH1   1 
ATOM   6085  N  NH2   . ARG F 3 79  ? 133.871 -40.006 -18.414 1.00 15.81  ? 375 ARG D NH2   1 
ATOM   6086  N  N     . ALA F 3 80  ? 130.627 -45.273 -13.329 1.00 13.27  ? 376 ALA D N     1 
ATOM   6087  C  CA    . ALA F 3 80  ? 130.497 -46.720 -13.266 1.00 13.70  ? 376 ALA D CA    1 
ATOM   6088  C  C     . ALA F 3 80  ? 129.042 -47.147 -13.102 1.00 14.18  ? 376 ALA D C     1 
ATOM   6089  O  O     . ALA F 3 80  ? 128.555 -48.027 -13.818 1.00 14.21  ? 376 ALA D O     1 
ATOM   6090  C  CB    . ALA F 3 80  ? 131.343 -47.271 -12.142 1.00 13.90  ? 376 ALA D CB    1 
ATOM   6091  N  N     . ALA F 3 81  ? 128.349 -46.509 -12.166 1.00 14.50  ? 377 ALA D N     1 
ATOM   6092  C  CA    . ALA F 3 81  ? 126.943 -46.799 -11.926 1.00 14.85  ? 377 ALA D CA    1 
ATOM   6093  C  C     . ALA F 3 81  ? 126.123 -46.700 -13.204 1.00 15.11  ? 377 ALA D C     1 
ATOM   6094  O  O     . ALA F 3 81  ? 125.268 -47.549 -13.456 1.00 15.81  ? 377 ALA D O     1 
ATOM   6095  C  CB    . ALA F 3 81  ? 126.377 -45.886 -10.859 1.00 14.88  ? 377 ALA D CB    1 
ATOM   6096  N  N     . VAL F 3 82  ? 126.370 -45.679 -14.018 1.00 15.14  ? 378 VAL D N     1 
ATOM   6097  C  CA    . VAL F 3 82  ? 125.624 -45.566 -15.275 1.00 15.22  ? 378 VAL D CA    1 
ATOM   6098  C  C     . VAL F 3 82  ? 126.068 -46.633 -16.281 1.00 15.57  ? 378 VAL D C     1 
ATOM   6099  O  O     . VAL F 3 82  ? 125.235 -47.364 -16.828 1.00 15.99  ? 378 VAL D O     1 
ATOM   6100  C  CB    . VAL F 3 82  ? 125.682 -44.147 -15.890 1.00 15.10  ? 378 VAL D CB    1 
ATOM   6101  C  CG1   . VAL F 3 82  ? 125.075 -44.142 -17.281 1.00 15.23  ? 378 VAL D CG1   1 
ATOM   6102  C  CG2   . VAL F 3 82  ? 124.945 -43.164 -15.009 1.00 13.62  ? 378 VAL D CG2   1 
ATOM   6103  N  N     . ALA F 3 83  ? 127.376 -46.745 -16.497 1.00 15.67  ? 379 ALA D N     1 
ATOM   6104  C  CA    . ALA F 3 83  ? 127.908 -47.715 -17.455 1.00 16.10  ? 379 ALA D CA    1 
ATOM   6105  C  C     . ALA F 3 83  ? 127.449 -49.126 -17.131 1.00 16.38  ? 379 ALA D C     1 
ATOM   6106  O  O     . ALA F 3 83  ? 127.356 -49.958 -18.020 1.00 16.39  ? 379 ALA D O     1 
ATOM   6107  C  CB    . ALA F 3 83  ? 129.426 -47.652 -17.519 1.00 16.00  ? 379 ALA D CB    1 
ATOM   6108  N  N     . LEU F 3 84  ? 127.157 -49.386 -15.860 1.00 16.78  ? 380 LEU D N     1 
ATOM   6109  C  CA    . LEU F 3 84  ? 126.654 -50.684 -15.454 1.00 17.09  ? 380 LEU D CA    1 
ATOM   6110  C  C     . LEU F 3 84  ? 125.157 -50.785 -15.722 1.00 17.40  ? 380 LEU D C     1 
ATOM   6111  O  O     . LEU F 3 84  ? 124.679 -51.853 -16.122 1.00 17.16  ? 380 LEU D O     1 
ATOM   6112  C  CB    . LEU F 3 84  ? 126.975 -50.982 -13.978 1.00 17.13  ? 380 LEU D CB    1 
ATOM   6113  C  CG    . LEU F 3 84  ? 128.402 -51.466 -13.670 1.00 17.66  ? 380 LEU D CG    1 
ATOM   6114  C  CD1   . LEU F 3 84  ? 128.732 -51.372 -12.175 1.00 17.40  ? 380 LEU D CD1   1 
ATOM   6115  C  CD2   . LEU F 3 84  ? 128.635 -52.900 -14.179 1.00 16.70  ? 380 LEU D CD2   1 
ATOM   6116  N  N     . LYS F 3 85  ? 124.413 -49.694 -15.496 1.00 17.53  ? 381 LYS D N     1 
ATOM   6117  C  CA    . LYS F 3 85  ? 122.972 -49.707 -15.769 1.00 17.67  ? 381 LYS D CA    1 
ATOM   6118  C  C     . LYS F 3 85  ? 122.731 -50.046 -17.240 1.00 18.28  ? 381 LYS D C     1 
ATOM   6119  O  O     . LYS F 3 85  ? 121.797 -50.781 -17.565 1.00 18.12  ? 381 LYS D O     1 
ATOM   6120  C  CB    . LYS F 3 85  ? 122.304 -48.379 -15.437 1.00 17.36  ? 381 LYS D CB    1 
ATOM   6121  C  CG    . LYS F 3 85  ? 122.059 -48.093 -13.965 1.00 16.86  ? 381 LYS D CG    1 
ATOM   6122  C  CD    . LYS F 3 85  ? 121.609 -46.638 -13.810 1.00 16.64  ? 381 LYS D CD    1 
ATOM   6123  C  CE    . LYS F 3 85  ? 121.644 -46.134 -12.363 1.00 16.72  ? 381 LYS D CE    1 
ATOM   6124  N  NZ    . LYS F 3 85  ? 120.628 -46.792 -11.490 1.00 16.68  ? 381 LYS D NZ    1 
ATOM   6125  N  N     . TRP F 3 86  ? 123.582 -49.530 -18.133 1.00 19.05  ? 382 TRP D N     1 
ATOM   6126  C  CA    . TRP F 3 86  ? 123.458 -49.881 -19.561 1.00 19.61  ? 382 TRP D CA    1 
ATOM   6127  C  C     . TRP F 3 86  ? 123.775 -51.364 -19.809 1.00 19.68  ? 382 TRP D C     1 
ATOM   6128  O  O     . TRP F 3 86  ? 123.717 -51.828 -20.936 1.00 20.25  ? 382 TRP D O     1 
ATOM   6129  C  CB    . TRP F 3 86  ? 124.320 -48.980 -20.467 1.00 19.77  ? 382 TRP D CB    1 
ATOM   6130  C  CG    . TRP F 3 86  ? 123.786 -47.571 -20.699 1.00 20.47  ? 382 TRP D CG    1 
ATOM   6131  C  CD1   . TRP F 3 86  ? 124.192 -46.421 -20.069 1.00 21.28  ? 382 TRP D CD1   1 
ATOM   6132  C  CD2   . TRP F 3 86  ? 122.781 -47.167 -21.640 1.00 20.23  ? 382 TRP D CD2   1 
ATOM   6133  N  NE1   . TRP F 3 86  ? 123.489 -45.339 -20.547 1.00 19.71  ? 382 TRP D NE1   1 
ATOM   6134  C  CE2   . TRP F 3 86  ? 122.620 -45.769 -21.511 1.00 20.04  ? 382 TRP D CE2   1 
ATOM   6135  C  CE3   . TRP F 3 86  ? 121.995 -47.851 -22.567 1.00 20.02  ? 382 TRP D CE3   1 
ATOM   6136  C  CZ2   . TRP F 3 86  ? 121.708 -45.047 -22.276 1.00 20.51  ? 382 TRP D CZ2   1 
ATOM   6137  C  CZ3   . TRP F 3 86  ? 121.086 -47.136 -23.317 1.00 20.68  ? 382 TRP D CZ3   1 
ATOM   6138  C  CH2   . TRP F 3 86  ? 120.952 -45.744 -23.174 1.00 20.64  ? 382 TRP D CH2   1 
ATOM   6139  N  N     . LYS F 3 87  ? 124.088 -52.104 -18.750 1.00 19.83  ? 383 LYS D N     1 
ATOM   6140  C  CA    . LYS F 3 87  ? 124.427 -53.518 -18.864 1.00 20.10  ? 383 LYS D CA    1 
ATOM   6141  C  C     . LYS F 3 87  ? 123.463 -54.383 -18.046 1.00 20.05  ? 383 LYS D C     1 
ATOM   6142  O  O     . LYS F 3 87  ? 123.638 -55.598 -17.942 1.00 20.07  ? 383 LYS D O     1 
ATOM   6143  C  CB    . LYS F 3 87  ? 125.864 -53.771 -18.396 1.00 20.26  ? 383 LYS D CB    1 
ATOM   6144  C  CG    . LYS F 3 87  ? 126.947 -52.996 -19.138 1.00 21.85  ? 383 LYS D CG    1 
ATOM   6145  C  CD    . LYS F 3 87  ? 127.389 -53.709 -20.410 1.00 24.34  ? 383 LYS D CD    1 
ATOM   6146  C  CE    . LYS F 3 87  ? 128.652 -53.067 -20.979 1.00 26.10  ? 383 LYS D CE    1 
ATOM   6147  N  NZ    . LYS F 3 87  ? 129.287 -53.902 -22.062 1.00 27.03  ? 383 LYS D NZ    1 
ATOM   6148  N  N     . GLY F 3 88  ? 122.458 -53.753 -17.448 1.00 19.73  ? 384 GLY D N     1 
ATOM   6149  C  CA    . GLY F 3 88  ? 121.462 -54.489 -16.676 1.00 19.13  ? 384 GLY D CA    1 
ATOM   6150  C  C     . GLY F 3 88  ? 121.891 -54.791 -15.256 1.00 18.70  ? 384 GLY D C     1 
ATOM   6151  O  O     . GLY F 3 88  ? 121.243 -55.575 -14.572 1.00 18.66  ? 384 GLY D O     1 
ATOM   6152  N  N     . ILE F 3 89  ? 122.959 -54.133 -14.807 1.00 18.21  ? 385 ILE D N     1 
ATOM   6153  C  CA    . ILE F 3 89  ? 123.565 -54.379 -13.497 1.00 17.92  ? 385 ILE D CA    1 
ATOM   6154  C  C     . ILE F 3 89  ? 123.473 -53.182 -12.544 1.00 17.89  ? 385 ILE D C     1 
ATOM   6155  O  O     . ILE F 3 89  ? 123.847 -52.061 -12.906 1.00 17.75  ? 385 ILE D O     1 
ATOM   6156  C  CB    . ILE F 3 89  ? 125.051 -54.794 -13.680 1.00 17.81  ? 385 ILE D CB    1 
ATOM   6157  C  CG1   . ILE F 3 89  ? 125.132 -56.183 -14.316 1.00 17.92  ? 385 ILE D CG1   1 
ATOM   6158  C  CG2   . ILE F 3 89  ? 125.782 -54.791 -12.357 1.00 18.41  ? 385 ILE D CG2   1 
ATOM   6159  C  CD1   . ILE F 3 89  ? 126.472 -56.519 -14.897 1.00 17.08  ? 385 ILE D CD1   1 
ATOM   6160  N  N     . GLU F 3 90  ? 122.992 -53.422 -11.320 1.00 18.03  ? 386 GLU D N     1 
ATOM   6161  C  CA    A GLU F 3 90  ? 122.845 -52.353 -10.330 0.50 17.77  ? 386 GLU D CA    1 
ATOM   6162  C  CA    B GLU F 3 90  ? 122.848 -52.345 -10.329 0.50 17.74  ? 386 GLU D CA    1 
ATOM   6163  C  C     . GLU F 3 90  ? 124.020 -52.302 -9.357  1.00 17.59  ? 386 GLU D C     1 
ATOM   6164  O  O     . GLU F 3 90  ? 124.456 -53.337 -8.847  1.00 17.39  ? 386 GLU D O     1 
ATOM   6165  C  CB    A GLU F 3 90  ? 121.536 -52.499 -9.545  0.50 17.77  ? 386 GLU D CB    1 
ATOM   6166  C  CB    B GLU F 3 90  ? 121.529 -52.449 -9.541  0.50 17.71  ? 386 GLU D CB    1 
ATOM   6167  C  CG    A GLU F 3 90  ? 121.065 -51.187 -8.937  0.50 18.42  ? 386 GLU D CG    1 
ATOM   6168  C  CG    B GLU F 3 90  ? 120.242 -52.221 -10.349 0.50 18.24  ? 386 GLU D CG    1 
ATOM   6169  C  CD    A GLU F 3 90  ? 120.023 -51.350 -7.853  0.50 19.21  ? 386 GLU D CD    1 
ATOM   6170  C  CD    B GLU F 3 90  ? 120.194 -50.882 -11.084 0.50 18.37  ? 386 GLU D CD    1 
ATOM   6171  O  OE1   A GLU F 3 90  ? 119.835 -52.479 -7.347  0.50 19.93  ? 386 GLU D OE1   1 
ATOM   6172  O  OE1   B GLU F 3 90  ? 120.627 -49.856 -10.521 0.50 19.22  ? 386 GLU D OE1   1 
ATOM   6173  O  OE2   A GLU F 3 90  ? 119.405 -50.329 -7.488  0.50 19.20  ? 386 GLU D OE2   1 
ATOM   6174  O  OE2   B GLU F 3 90  ? 119.701 -50.853 -12.230 0.50 18.04  ? 386 GLU D OE2   1 
ATOM   6175  N  N     . LEU F 3 91  ? 124.504 -51.085 -9.102  1.00 17.07  ? 387 LEU D N     1 
ATOM   6176  C  CA    . LEU F 3 91  ? 125.608 -50.829 -8.200  1.00 16.35  ? 387 LEU D CA    1 
ATOM   6177  C  C     . LEU F 3 91  ? 125.167 -50.049 -6.957  1.00 16.42  ? 387 LEU D C     1 
ATOM   6178  O  O     . LEU F 3 91  ? 124.627 -48.956 -7.059  1.00 16.60  ? 387 LEU D O     1 
ATOM   6179  C  CB    . LEU F 3 91  ? 126.665 -50.037 -8.950  1.00 16.18  ? 387 LEU D CB    1 
ATOM   6180  C  CG    . LEU F 3 91  ? 127.839 -49.507 -8.138  1.00 15.40  ? 387 LEU D CG    1 
ATOM   6181  C  CD1   . LEU F 3 91  ? 128.596 -50.660 -7.485  1.00 14.63  ? 387 LEU D CD1   1 
ATOM   6182  C  CD2   . LEU F 3 91  ? 128.721 -48.712 -9.056  1.00 13.53  ? 387 LEU D CD2   1 
ATOM   6183  N  N     . CYS F 3 92  ? 125.438 -50.603 -5.782  1.00 16.60  ? 388 CYS D N     1 
ATOM   6184  C  CA    . CYS F 3 92  ? 125.061 -49.999 -4.508  1.00 16.71  ? 388 CYS D CA    1 
ATOM   6185  C  C     . CYS F 3 92  ? 126.215 -50.045 -3.517  1.00 16.27  ? 388 CYS D C     1 
ATOM   6186  O  O     . CYS F 3 92  ? 127.204 -50.733 -3.743  1.00 16.21  ? 388 CYS D O     1 
ATOM   6187  C  CB    . CYS F 3 92  ? 123.889 -50.770 -3.893  1.00 17.38  ? 388 CYS D CB    1 
ATOM   6188  S  SG    . CYS F 3 92  ? 122.277 -50.499 -4.642  1.00 20.34  ? 388 CYS D SG    1 
ATOM   6189  N  N     . GLY F 3 93  ? 126.087 -49.321 -2.409  1.00 15.86  ? 389 GLY D N     1 
ATOM   6190  C  CA    . GLY F 3 93  ? 127.100 -49.376 -1.364  1.00 15.31  ? 389 GLY D CA    1 
ATOM   6191  C  C     . GLY F 3 93  ? 128.319 -48.496 -1.545  1.00 15.20  ? 389 GLY D C     1 
ATOM   6192  O  O     . GLY F 3 93  ? 129.306 -48.656 -0.830  1.00 15.66  ? 389 GLY D O     1 
ATOM   6193  N  N     . VAL F 3 94  ? 128.281 -47.578 -2.501  1.00 14.78  ? 390 VAL D N     1 
ATOM   6194  C  CA    . VAL F 3 94  ? 129.393 -46.662 -2.659  1.00 14.68  ? 390 VAL D CA    1 
ATOM   6195  C  C     . VAL F 3 94  ? 129.435 -45.757 -1.439  1.00 14.55  ? 390 VAL D C     1 
ATOM   6196  O  O     . VAL F 3 94  ? 128.619 -44.844 -1.301  1.00 14.56  ? 390 VAL D O     1 
ATOM   6197  C  CB    . VAL F 3 94  ? 129.256 -45.778 -3.904  1.00 14.47  ? 390 VAL D CB    1 
ATOM   6198  C  CG1   . VAL F 3 94  ? 130.486 -44.884 -4.044  1.00 15.47  ? 390 VAL D CG1   1 
ATOM   6199  C  CG2   . VAL F 3 94  ? 129.124 -46.625 -5.128  1.00 15.63  ? 390 VAL D CG2   1 
ATOM   6200  N  N     . SER F 3 95  ? 130.376 -46.005 -0.540  1.00 14.44  ? 391 SER D N     1 
ATOM   6201  C  CA    . SER F 3 95  ? 130.479 -45.147 0.642   1.00 14.17  ? 391 SER D CA    1 
ATOM   6202  C  C     . SER F 3 95  ? 131.539 -44.039 0.529   1.00 13.55  ? 391 SER D C     1 
ATOM   6203  O  O     . SER F 3 95  ? 131.600 -43.169 1.388   1.00 13.59  ? 391 SER D O     1 
ATOM   6204  C  CB    . SER F 3 95  ? 130.679 -45.985 1.909   1.00 14.20  ? 391 SER D CB    1 
ATOM   6205  O  OG    . SER F 3 95  ? 131.818 -46.814 1.793   1.00 15.31  ? 391 SER D OG    1 
ATOM   6206  N  N     . PHE F 3 96  ? 132.369 -44.066 -0.516  1.00 12.71  ? 392 PHE D N     1 
ATOM   6207  C  CA    . PHE F 3 96  ? 133.364 -43.006 -0.722  1.00 12.02  ? 392 PHE D CA    1 
ATOM   6208  C  C     . PHE F 3 96  ? 133.687 -42.795 -2.198  1.00 11.62  ? 392 PHE D C     1 
ATOM   6209  O  O     . PHE F 3 96  ? 134.062 -43.754 -2.886  1.00 11.50  ? 392 PHE D O     1 
ATOM   6210  C  CB    . PHE F 3 96  ? 134.659 -43.309 0.048   1.00 11.99  ? 392 PHE D CB    1 
ATOM   6211  C  CG    . PHE F 3 96  ? 135.755 -42.282 -0.155  1.00 11.83  ? 392 PHE D CG    1 
ATOM   6212  C  CD1   . PHE F 3 96  ? 135.739 -41.074 0.534   1.00 11.61  ? 392 PHE D CD1   1 
ATOM   6213  C  CD2   . PHE F 3 96  ? 136.820 -42.533 -1.024  1.00 11.64  ? 392 PHE D CD2   1 
ATOM   6214  C  CE1   . PHE F 3 96  ? 136.763 -40.130 0.352   1.00 10.72  ? 392 PHE D CE1   1 
ATOM   6215  C  CE2   . PHE F 3 96  ? 137.847 -41.600 -1.202  1.00 10.87  ? 392 PHE D CE2   1 
ATOM   6216  C  CZ    . PHE F 3 96  ? 137.816 -40.396 -0.520  1.00 10.17  ? 392 PHE D CZ    1 
ATOM   6217  N  N     . ASP F 3 97  ? 133.555 -41.548 -2.672  1.00 10.54  ? 393 ASP D N     1 
ATOM   6218  C  CA    . ASP F 3 97  ? 133.935 -41.194 -4.053  1.00 9.62   ? 393 ASP D CA    1 
ATOM   6219  C  C     . ASP F 3 97  ? 135.052 -40.156 -4.059  1.00 8.80   ? 393 ASP D C     1 
ATOM   6220  O  O     . ASP F 3 97  ? 134.817 -38.960 -3.834  1.00 8.45   ? 393 ASP D O     1 
ATOM   6221  C  CB    . ASP F 3 97  ? 132.745 -40.698 -4.876  1.00 9.55   ? 393 ASP D CB    1 
ATOM   6222  C  CG    . ASP F 3 97  ? 133.090 -40.485 -6.364  1.00 11.37  ? 393 ASP D CG    1 
ATOM   6223  O  OD1   . ASP F 3 97  ? 134.210 -40.007 -6.686  1.00 12.00  ? 393 ASP D OD1   1 
ATOM   6224  O  OD2   . ASP F 3 97  ? 132.224 -40.777 -7.230  1.00 12.17  ? 393 ASP D OD2   1 
ATOM   6225  N  N     . LEU F 3 98  ? 136.262 -40.626 -4.354  1.00 7.98   ? 394 LEU D N     1 
ATOM   6226  C  CA    . LEU F 3 98  ? 137.450 -39.791 -4.409  1.00 7.45   ? 394 LEU D CA    1 
ATOM   6227  C  C     . LEU F 3 98  ? 137.363 -38.562 -5.344  1.00 7.42   ? 394 LEU D C     1 
ATOM   6228  O  O     . LEU F 3 98  ? 137.936 -37.524 -5.052  1.00 7.77   ? 394 LEU D O     1 
ATOM   6229  C  CB    . LEU F 3 98  ? 138.651 -40.654 -4.765  1.00 7.34   ? 394 LEU D CB    1 
ATOM   6230  C  CG    . LEU F 3 98  ? 139.993 -39.940 -4.889  1.00 7.01   ? 394 LEU D CG    1 
ATOM   6231  C  CD1   . LEU F 3 98  ? 140.404 -39.318 -3.542  1.00 6.49   ? 394 LEU D CD1   1 
ATOM   6232  C  CD2   . LEU F 3 98  ? 141.023 -40.923 -5.401  1.00 6.12   ? 394 LEU D CD2   1 
ATOM   6233  N  N     . LEU F 3 99  ? 136.658 -38.673 -6.462  1.00 7.30   ? 395 LEU D N     1 
ATOM   6234  C  CA    . LEU F 3 99  ? 136.510 -37.526 -7.353  1.00 7.26   ? 395 LEU D CA    1 
ATOM   6235  C  C     . LEU F 3 99  ? 135.746 -36.398 -6.683  1.00 7.28   ? 395 LEU D C     1 
ATOM   6236  O  O     . LEU F 3 99  ? 136.150 -35.246 -6.757  1.00 7.49   ? 395 LEU D O     1 
ATOM   6237  C  CB    . LEU F 3 99  ? 135.827 -37.926 -8.667  1.00 7.28   ? 395 LEU D CB    1 
ATOM   6238  C  CG    . LEU F 3 99  ? 135.289 -36.767 -9.516  1.00 5.84   ? 395 LEU D CG    1 
ATOM   6239  C  CD1   . LEU F 3 99  ? 136.397 -35.930 -10.138 1.00 3.57   ? 395 LEU D CD1   1 
ATOM   6240  C  CD2   . LEU F 3 99  ? 134.352 -37.295 -10.578 1.00 4.84   ? 395 LEU D CD2   1 
ATOM   6241  N  N     . LEU F 3 100 ? 134.647 -36.742 -6.018  1.00 7.59   ? 396 LEU D N     1 
ATOM   6242  C  CA    . LEU F 3 100 ? 133.818 -35.754 -5.322  1.00 7.58   ? 396 LEU D CA    1 
ATOM   6243  C  C     . LEU F 3 100 ? 134.503 -35.193 -4.084  1.00 7.87   ? 396 LEU D C     1 
ATOM   6244  O  O     . LEU F 3 100 ? 134.219 -34.068 -3.669  1.00 7.70   ? 396 LEU D O     1 
ATOM   6245  C  CB    . LEU F 3 100 ? 132.427 -36.333 -4.997  1.00 7.37   ? 396 LEU D CB    1 
ATOM   6246  C  CG    . LEU F 3 100 ? 131.648 -36.744 -6.272  1.00 6.41   ? 396 LEU D CG    1 
ATOM   6247  C  CD1   . LEU F 3 100 ? 130.392 -37.522 -5.951  1.00 5.62   ? 396 LEU D CD1   1 
ATOM   6248  C  CD2   . LEU F 3 100 ? 131.331 -35.556 -7.174  1.00 2.34   ? 396 LEU D CD2   1 
ATOM   6249  N  N     . ALA F 3 101 ? 135.427 -35.969 -3.520  1.00 8.19   ? 397 ALA D N     1 
ATOM   6250  C  CA    . ALA F 3 101 ? 136.206 -35.532 -2.354  1.00 8.49   ? 397 ALA D CA    1 
ATOM   6251  C  C     . ALA F 3 101 ? 137.292 -34.532 -2.749  1.00 8.65   ? 397 ALA D C     1 
ATOM   6252  O  O     . ALA F 3 101 ? 137.509 -33.528 -2.071  1.00 8.76   ? 397 ALA D O     1 
ATOM   6253  C  CB    . ALA F 3 101 ? 136.818 -36.722 -1.643  1.00 8.23   ? 397 ALA D CB    1 
ATOM   6254  N  N     . ALA F 3 102 ? 137.969 -34.799 -3.856  1.00 8.73   ? 398 ALA D N     1 
ATOM   6255  C  CA    . ALA F 3 102 ? 138.971 -33.875 -4.336  1.00 9.10   ? 398 ALA D CA    1 
ATOM   6256  C  C     . ALA F 3 102 ? 138.277 -32.564 -4.715  1.00 9.72   ? 398 ALA D C     1 
ATOM   6257  O  O     . ALA F 3 102 ? 138.761 -31.461 -4.393  1.00 10.19  ? 398 ALA D O     1 
ATOM   6258  C  CB    . ALA F 3 102 ? 139.665 -34.460 -5.512  1.00 9.42   ? 398 ALA D CB    1 
ATOM   6259  N  N     . TYR F 3 103 ? 137.117 -32.691 -5.359  1.00 9.49   ? 399 TYR D N     1 
ATOM   6260  C  CA    . TYR F 3 103 ? 136.332 -31.536 -5.775  1.00 9.14   ? 399 TYR D CA    1 
ATOM   6261  C  C     . TYR F 3 103 ? 135.909 -30.642 -4.613  1.00 9.56   ? 399 TYR D C     1 
ATOM   6262  O  O     . TYR F 3 103 ? 135.984 -29.411 -4.710  1.00 9.37   ? 399 TYR D O     1 
ATOM   6263  C  CB    . TYR F 3 103 ? 135.107 -31.996 -6.540  1.00 8.61   ? 399 TYR D CB    1 
ATOM   6264  C  CG    . TYR F 3 103 ? 134.178 -30.891 -6.956  1.00 7.19   ? 399 TYR D CG    1 
ATOM   6265  C  CD1   . TYR F 3 103 ? 134.608 -29.872 -7.808  1.00 7.15   ? 399 TYR D CD1   1 
ATOM   6266  C  CD2   . TYR F 3 103 ? 132.852 -30.890 -6.535  1.00 6.14   ? 399 TYR D CD2   1 
ATOM   6267  C  CE1   . TYR F 3 103 ? 133.744 -28.864 -8.219  1.00 7.37   ? 399 TYR D CE1   1 
ATOM   6268  C  CE2   . TYR F 3 103 ? 131.975 -29.892 -6.930  1.00 7.79   ? 399 TYR D CE2   1 
ATOM   6269  C  CZ    . TYR F 3 103 ? 132.422 -28.878 -7.770  1.00 7.98   ? 399 TYR D CZ    1 
ATOM   6270  O  OH    . TYR F 3 103 ? 131.539 -27.902 -8.157  1.00 6.69   ? 399 TYR D OH    1 
ATOM   6271  N  N     . LEU F 3 104 ? 135.442 -31.244 -3.526  1.00 9.94   ? 400 LEU D N     1 
ATOM   6272  C  CA    . LEU F 3 104 ? 135.026 -30.431 -2.375  1.00 10.65  ? 400 LEU D CA    1 
ATOM   6273  C  C     . LEU F 3 104 ? 136.209 -29.725 -1.713  1.00 10.73  ? 400 LEU D C     1 
ATOM   6274  O  O     . LEU F 3 104 ? 136.112 -28.558 -1.409  1.00 10.87  ? 400 LEU D O     1 
ATOM   6275  C  CB    . LEU F 3 104 ? 134.221 -31.237 -1.349  1.00 10.80  ? 400 LEU D CB    1 
ATOM   6276  C  CG    . LEU F 3 104 ? 132.855 -31.778 -1.779  1.00 10.85  ? 400 LEU D CG    1 
ATOM   6277  C  CD1   . LEU F 3 104 ? 132.182 -32.441 -0.602  1.00 10.73  ? 400 LEU D CD1   1 
ATOM   6278  C  CD2   . LEU F 3 104 ? 131.970 -30.670 -2.335  1.00 11.31  ? 400 LEU D CD2   1 
ATOM   6279  N  N     . LEU F 3 105 ? 137.327 -30.424 -1.535  1.00 11.55  ? 401 LEU D N     1 
ATOM   6280  C  CA    . LEU F 3 105 ? 138.540 -29.829 -0.951  1.00 12.08  ? 401 LEU D CA    1 
ATOM   6281  C  C     . LEU F 3 105 ? 139.109 -28.599 -1.700  1.00 12.81  ? 401 LEU D C     1 
ATOM   6282  O  O     . LEU F 3 105 ? 139.547 -27.639 -1.072  1.00 12.74  ? 401 LEU D O     1 
ATOM   6283  C  CB    . LEU F 3 105 ? 139.639 -30.882 -0.797  1.00 11.66  ? 401 LEU D CB    1 
ATOM   6284  C  CG    . LEU F 3 105 ? 139.475 -32.023 0.209   1.00 10.88  ? 401 LEU D CG    1 
ATOM   6285  C  CD1   . LEU F 3 105 ? 140.785 -32.807 0.360   1.00 9.43   ? 401 LEU D CD1   1 
ATOM   6286  C  CD2   . LEU F 3 105 ? 139.040 -31.489 1.544   1.00 10.48  ? 401 LEU D CD2   1 
ATOM   6287  N  N     . ASP F 3 106 ? 139.130 -28.645 -3.031  1.00 13.76  ? 402 ASP D N     1 
ATOM   6288  C  CA    . ASP F 3 106 ? 139.625 -27.529 -3.849  1.00 14.09  ? 402 ASP D CA    1 
ATOM   6289  C  C     . ASP F 3 106 ? 139.205 -27.701 -5.294  1.00 14.18  ? 402 ASP D C     1 
ATOM   6290  O  O     . ASP F 3 106 ? 139.897 -28.357 -6.055  1.00 14.10  ? 402 ASP D O     1 
ATOM   6291  C  CB    . ASP F 3 106 ? 141.154 -27.427 -3.792  1.00 14.18  ? 402 ASP D CB    1 
ATOM   6292  C  CG    . ASP F 3 106 ? 141.713 -26.231 -4.597  1.00 15.28  ? 402 ASP D CG    1 
ATOM   6293  O  OD1   . ASP F 3 106 ? 140.935 -25.446 -5.203  1.00 15.05  ? 402 ASP D OD1   1 
ATOM   6294  O  OD2   . ASP F 3 106 ? 142.957 -26.089 -4.622  1.00 15.99  ? 402 ASP D OD2   1 
ATOM   6295  N  N     . PRO F 3 107 ? 138.081 -27.082 -5.676  1.00 14.58  ? 403 PRO D N     1 
ATOM   6296  C  CA    . PRO F 3 107 ? 137.521 -27.105 -7.031  1.00 15.00  ? 403 PRO D CA    1 
ATOM   6297  C  C     . PRO F 3 107 ? 138.433 -26.497 -8.089  1.00 15.88  ? 403 PRO D C     1 
ATOM   6298  O  O     . PRO F 3 107 ? 138.268 -26.776 -9.265  1.00 16.09  ? 403 PRO D O     1 
ATOM   6299  C  CB    . PRO F 3 107 ? 136.256 -26.250 -6.908  1.00 14.65  ? 403 PRO D CB    1 
ATOM   6300  C  CG    . PRO F 3 107 ? 135.936 -26.235 -5.459  1.00 14.56  ? 403 PRO D CG    1 
ATOM   6301  C  CD    . PRO F 3 107 ? 137.246 -26.304 -4.745  1.00 14.60  ? 403 PRO D CD    1 
ATOM   6302  N  N     . ALA F 3 108 ? 139.373 -25.649 -7.685  1.00 16.97  ? 404 ALA D N     1 
ATOM   6303  C  CA    . ALA F 3 108 ? 140.265 -25.024 -8.647  1.00 17.50  ? 404 ALA D CA    1 
ATOM   6304  C  C     . ALA F 3 108 ? 141.252 -26.035 -9.226  1.00 18.23  ? 404 ALA D C     1 
ATOM   6305  O  O     . ALA F 3 108 ? 141.767 -25.835 -10.312 1.00 17.86  ? 404 ALA D O     1 
ATOM   6306  C  CB    . ALA F 3 108 ? 140.991 -23.853 -8.026  1.00 17.32  ? 404 ALA D CB    1 
ATOM   6307  N  N     . GLN F 3 109 ? 141.487 -27.135 -8.510  1.00 19.50  ? 405 GLN D N     1 
ATOM   6308  C  CA    . GLN F 3 109 ? 142.414 -28.189 -8.962  1.00 20.08  ? 405 GLN D CA    1 
ATOM   6309  C  C     . GLN F 3 109 ? 142.027 -28.854 -10.285 1.00 20.24  ? 405 GLN D C     1 
ATOM   6310  O  O     . GLN F 3 109 ? 142.879 -29.390 -10.995 1.00 20.13  ? 405 GLN D O     1 
ATOM   6311  C  CB    . GLN F 3 109 ? 142.554 -29.267 -7.890  1.00 20.22  ? 405 GLN D CB    1 
ATOM   6312  C  CG    . GLN F 3 109 ? 143.332 -28.808 -6.700  1.00 21.81  ? 405 GLN D CG    1 
ATOM   6313  C  CD    . GLN F 3 109 ? 144.680 -28.267 -7.108  1.00 25.03  ? 405 GLN D CD    1 
ATOM   6314  O  OE1   . GLN F 3 109 ? 145.484 -28.975 -7.728  1.00 25.65  ? 405 GLN D OE1   1 
ATOM   6315  N  NE2   . GLN F 3 109 ? 144.935 -26.995 -6.780  1.00 25.20  ? 405 GLN D NE2   1 
ATOM   6316  N  N     . GLY F 3 110 ? 140.744 -28.828 -10.611 1.00 20.58  ? 406 GLY D N     1 
ATOM   6317  C  CA    . GLY F 3 110 ? 140.262 -29.481 -11.819 1.00 21.04  ? 406 GLY D CA    1 
ATOM   6318  C  C     . GLY F 3 110 ? 140.634 -30.954 -11.846 1.00 21.49  ? 406 GLY D C     1 
ATOM   6319  O  O     . GLY F 3 110 ? 140.879 -31.518 -12.916 1.00 21.81  ? 406 GLY D O     1 
ATOM   6320  N  N     . VAL F 3 111 ? 140.702 -31.576 -10.670 1.00 21.58  ? 407 VAL D N     1 
ATOM   6321  C  CA    . VAL F 3 111 ? 140.996 -33.005 -10.590 1.00 21.76  ? 407 VAL D CA    1 
ATOM   6322  C  C     . VAL F 3 111 ? 140.294 -33.789 -11.704 1.00 21.69  ? 407 VAL D C     1 
ATOM   6323  O  O     . VAL F 3 111 ? 139.081 -33.734 -11.884 1.00 21.57  ? 407 VAL D O     1 
ATOM   6324  C  CB    . VAL F 3 111 ? 140.712 -33.587 -9.217  1.00 21.46  ? 407 VAL D CB    1 
ATOM   6325  C  CG1   . VAL F 3 111 ? 140.666 -35.093 -9.291  1.00 21.69  ? 407 VAL D CG1   1 
ATOM   6326  C  CG2   . VAL F 3 111 ? 141.797 -33.137 -8.256  1.00 22.29  ? 407 VAL D CG2   1 
ATOM   6327  N  N     . ASP F 3 112 ? 141.118 -34.516 -12.435 1.00 21.82  ? 408 ASP D N     1 
ATOM   6328  C  CA    . ASP F 3 112 ? 140.766 -35.120 -13.694 1.00 22.02  ? 408 ASP D CA    1 
ATOM   6329  C  C     . ASP F 3 112 ? 140.666 -36.643 -13.602 1.00 21.29  ? 408 ASP D C     1 
ATOM   6330  O  O     . ASP F 3 112 ? 139.810 -37.261 -14.230 1.00 21.23  ? 408 ASP D O     1 
ATOM   6331  C  CB    . ASP F 3 112 ? 141.913 -34.784 -14.652 1.00 22.42  ? 408 ASP D CB    1 
ATOM   6332  C  CG    . ASP F 3 112 ? 141.435 -34.430 -16.021 1.00 23.40  ? 408 ASP D CG    1 
ATOM   6333  O  OD1   . ASP F 3 112 ? 140.297 -33.914 -16.136 1.00 24.67  ? 408 ASP D OD1   1 
ATOM   6334  O  OD2   . ASP F 3 112 ? 142.214 -34.641 -16.973 1.00 24.97  ? 408 ASP D OD2   1 
ATOM   6335  N  N     . ASP F 3 113 ? 141.580 -37.223 -12.831 1.00 20.28  ? 409 ASP D N     1 
ATOM   6336  C  CA    . ASP F 3 113 ? 141.714 -38.659 -12.680 1.00 19.44  ? 409 ASP D CA    1 
ATOM   6337  C  C     . ASP F 3 113 ? 142.336 -38.939 -11.334 1.00 18.40  ? 409 ASP D C     1 
ATOM   6338  O  O     . ASP F 3 113 ? 142.773 -38.015 -10.644 1.00 18.57  ? 409 ASP D O     1 
ATOM   6339  C  CB    . ASP F 3 113 ? 142.609 -39.228 -13.786 1.00 19.95  ? 409 ASP D CB    1 
ATOM   6340  C  CG    . ASP F 3 113 ? 144.018 -38.618 -13.800 1.00 21.07  ? 409 ASP D CG    1 
ATOM   6341  O  OD1   . ASP F 3 113 ? 144.892 -39.180 -14.483 1.00 21.87  ? 409 ASP D OD1   1 
ATOM   6342  O  OD2   . ASP F 3 113 ? 144.267 -37.583 -13.146 1.00 23.55  ? 409 ASP D OD2   1 
ATOM   6343  N  N     . VAL F 3 114 ? 142.396 -40.214 -10.974 1.00 17.04  ? 410 VAL D N     1 
ATOM   6344  C  CA    . VAL F 3 114 ? 142.963 -40.641 -9.700  1.00 15.74  ? 410 VAL D CA    1 
ATOM   6345  C  C     . VAL F 3 114 ? 144.376 -40.084 -9.437  1.00 15.68  ? 410 VAL D C     1 
ATOM   6346  O  O     . VAL F 3 114 ? 144.710 -39.735 -8.301  1.00 15.47  ? 410 VAL D O     1 
ATOM   6347  C  CB    . VAL F 3 114 ? 142.961 -42.178 -9.595  1.00 15.58  ? 410 VAL D CB    1 
ATOM   6348  C  CG1   . VAL F 3 114 ? 143.560 -42.633 -8.286  1.00 14.04  ? 410 VAL D CG1   1 
ATOM   6349  C  CG2   . VAL F 3 114 ? 141.551 -42.710 -9.756  1.00 14.58  ? 410 VAL D CG2   1 
ATOM   6350  N  N     . ALA F 3 115 ? 145.192 -39.955 -10.476 1.00 15.20  ? 411 ALA D N     1 
ATOM   6351  C  CA    . ALA F 3 115 ? 146.530 -39.425 -10.262 1.00 15.19  ? 411 ALA D CA    1 
ATOM   6352  C  C     . ALA F 3 115 ? 146.529 -37.970 -9.784  1.00 15.28  ? 411 ALA D C     1 
ATOM   6353  O  O     . ALA F 3 115 ? 147.253 -37.622 -8.860  1.00 15.27  ? 411 ALA D O     1 
ATOM   6354  C  CB    . ALA F 3 115 ? 147.391 -39.603 -11.491 1.00 15.02  ? 411 ALA D CB    1 
ATOM   6355  N  N     . ALA F 3 116 ? 145.690 -37.134 -10.387 1.00 15.60  ? 412 ALA D N     1 
ATOM   6356  C  CA    . ALA F 3 116 ? 145.614 -35.709 -10.036 1.00 15.62  ? 412 ALA D CA    1 
ATOM   6357  C  C     . ALA F 3 116 ? 145.227 -35.507 -8.569  1.00 15.83  ? 412 ALA D C     1 
ATOM   6358  O  O     . ALA F 3 116 ? 145.743 -34.614 -7.880  1.00 15.67  ? 412 ALA D O     1 
ATOM   6359  C  CB    . ALA F 3 116 ? 144.616 -35.005 -10.936 1.00 15.26  ? 412 ALA D CB    1 
ATOM   6360  N  N     . ALA F 3 117 ? 144.302 -36.345 -8.118  1.00 15.83  ? 413 ALA D N     1 
ATOM   6361  C  CA    . ALA F 3 117 ? 143.808 -36.302 -6.766  1.00 16.00  ? 413 ALA D CA    1 
ATOM   6362  C  C     . ALA F 3 117 ? 144.856 -36.859 -5.817  1.00 16.27  ? 413 ALA D C     1 
ATOM   6363  O  O     . ALA F 3 117 ? 145.033 -36.330 -4.731  1.00 16.54  ? 413 ALA D O     1 
ATOM   6364  C  CB    . ALA F 3 117 ? 142.519 -37.105 -6.656  1.00 16.04  ? 413 ALA D CB    1 
ATOM   6365  N  N     . ALA F 3 118 ? 145.551 -37.921 -6.224  1.00 16.45  ? 414 ALA D N     1 
ATOM   6366  C  CA    . ALA F 3 118 ? 146.581 -38.519 -5.376  1.00 16.78  ? 414 ALA D CA    1 
ATOM   6367  C  C     . ALA F 3 118 ? 147.726 -37.539 -5.093  1.00 17.14  ? 414 ALA D C     1 
ATOM   6368  O  O     . ALA F 3 118 ? 148.350 -37.586 -4.031  1.00 16.88  ? 414 ALA D O     1 
ATOM   6369  C  CB    . ALA F 3 118 ? 147.097 -39.826 -5.969  1.00 16.49  ? 414 ALA D CB    1 
ATOM   6370  N  N     . LYS F 3 119 ? 147.976 -36.631 -6.034  1.00 18.04  ? 415 LYS D N     1 
ATOM   6371  C  CA    . LYS F 3 119 ? 148.985 -35.590 -5.841  1.00 18.90  ? 415 LYS D CA    1 
ATOM   6372  C  C     . LYS F 3 119 ? 148.628 -34.698 -4.668  1.00 18.94  ? 415 LYS D C     1 
ATOM   6373  O  O     . LYS F 3 119 ? 149.505 -34.265 -3.925  1.00 18.83  ? 415 LYS D O     1 
ATOM   6374  C  CB    . LYS F 3 119 ? 149.172 -34.737 -7.093  1.00 19.06  ? 415 LYS D CB    1 
ATOM   6375  C  CG    . LYS F 3 119 ? 150.135 -35.337 -8.077  1.00 21.22  ? 415 LYS D CG    1 
ATOM   6376  C  CD    . LYS F 3 119 ? 150.619 -34.293 -9.059  1.00 25.99  ? 415 LYS D CD    1 
ATOM   6377  C  CE    . LYS F 3 119 ? 151.453 -34.927 -10.183 1.00 28.19  ? 415 LYS D CE    1 
ATOM   6378  N  NZ    . LYS F 3 119 ? 151.831 -33.901 -11.214 1.00 30.65  ? 415 LYS D NZ    1 
ATOM   6379  N  N     . MET F 3 120 ? 147.337 -34.441 -4.489  1.00 19.04  ? 416 MET D N     1 
ATOM   6380  C  CA    . MET F 3 120 ? 146.907 -33.601 -3.378  1.00 19.48  ? 416 MET D CA    1 
ATOM   6381  C  C     . MET F 3 120 ? 147.432 -34.121 -2.041  1.00 19.32  ? 416 MET D C     1 
ATOM   6382  O  O     . MET F 3 120 ? 147.540 -33.353 -1.092  1.00 19.76  ? 416 MET D O     1 
ATOM   6383  C  CB    . MET F 3 120 ? 145.379 -33.443 -3.352  1.00 19.18  ? 416 MET D CB    1 
ATOM   6384  C  CG    . MET F 3 120 ? 144.837 -32.601 -4.511  1.00 19.57  ? 416 MET D CG    1 
ATOM   6385  S  SD    . MET F 3 120 ? 143.038 -32.661 -4.708  1.00 20.62  ? 416 MET D SD    1 
ATOM   6386  C  CE    . MET F 3 120 ? 142.484 -31.756 -3.272  1.00 19.91  ? 416 MET D CE    1 
ATOM   6387  N  N     . LYS F 3 121 ? 147.777 -35.408 -1.976  1.00 18.82  ? 417 LYS D N     1 
ATOM   6388  C  CA    . LYS F 3 121 ? 148.243 -36.015 -0.726  1.00 18.77  ? 417 LYS D CA    1 
ATOM   6389  C  C     . LYS F 3 121 ? 149.621 -36.656 -0.815  1.00 18.60  ? 417 LYS D C     1 
ATOM   6390  O  O     . LYS F 3 121 ? 149.884 -37.669 -0.154  1.00 18.45  ? 417 LYS D O     1 
ATOM   6391  C  CB    . LYS F 3 121 ? 147.252 -37.075 -0.236  1.00 18.71  ? 417 LYS D CB    1 
ATOM   6392  C  CG    . LYS F 3 121 ? 145.905 -36.526 0.140   1.00 18.51  ? 417 LYS D CG    1 
ATOM   6393  C  CD    . LYS F 3 121 ? 146.056 -35.457 1.157   1.00 17.94  ? 417 LYS D CD    1 
ATOM   6394  C  CE    . LYS F 3 121 ? 144.730 -35.005 1.677   1.00 17.59  ? 417 LYS D CE    1 
ATOM   6395  N  NZ    . LYS F 3 121 ? 145.032 -33.963 2.687   1.00 20.74  ? 417 LYS D NZ    1 
ATOM   6396  N  N     . GLN F 3 122 ? 150.487 -36.073 -1.635  1.00 18.25  ? 418 GLN D N     1 
ATOM   6397  C  CA    . GLN F 3 122 ? 151.828 -36.612 -1.881  1.00 18.23  ? 418 GLN D CA    1 
ATOM   6398  C  C     . GLN F 3 122 ? 151.875 -38.098 -2.205  1.00 17.10  ? 418 GLN D C     1 
ATOM   6399  O  O     . GLN F 3 122 ? 152.862 -38.727 -1.910  1.00 17.44  ? 418 GLN D O     1 
ATOM   6400  C  CB    . GLN F 3 122 ? 152.772 -36.326 -0.711  1.00 18.68  ? 418 GLN D CB    1 
ATOM   6401  C  CG    . GLN F 3 122 ? 152.787 -34.875 -0.304  1.00 21.62  ? 418 GLN D CG    1 
ATOM   6402  C  CD    . GLN F 3 122 ? 153.015 -33.955 -1.487  1.00 24.93  ? 418 GLN D CD    1 
ATOM   6403  O  OE1   . GLN F 3 122 ? 152.139 -33.160 -1.843  1.00 26.97  ? 418 GLN D OE1   1 
ATOM   6404  N  NE2   . GLN F 3 122 ? 154.185 -34.073 -2.120  1.00 25.99  ? 418 GLN D NE2   1 
ATOM   6405  N  N     . TYR F 3 123 ? 150.827 -38.644 -2.817  1.00 16.29  ? 419 TYR D N     1 
ATOM   6406  C  CA    . TYR F 3 123 ? 150.789 -40.054 -3.229  1.00 15.63  ? 419 TYR D CA    1 
ATOM   6407  C  C     . TYR F 3 123 ? 151.022 -40.141 -4.737  1.00 15.65  ? 419 TYR D C     1 
ATOM   6408  O  O     . TYR F 3 123 ? 150.257 -39.570 -5.500  1.00 15.72  ? 419 TYR D O     1 
ATOM   6409  C  CB    . TYR F 3 123 ? 149.429 -40.661 -2.880  1.00 15.31  ? 419 TYR D CB    1 
ATOM   6410  C  CG    . TYR F 3 123 ? 149.319 -42.147 -3.103  1.00 14.93  ? 419 TYR D CG    1 
ATOM   6411  C  CD1   . TYR F 3 123 ? 149.344 -43.032 -2.030  1.00 15.01  ? 419 TYR D CD1   1 
ATOM   6412  C  CD2   . TYR F 3 123 ? 149.189 -42.674 -4.389  1.00 15.16  ? 419 TYR D CD2   1 
ATOM   6413  C  CE1   . TYR F 3 123 ? 149.258 -44.407 -2.226  1.00 14.77  ? 419 TYR D CE1   1 
ATOM   6414  C  CE2   . TYR F 3 123 ? 149.106 -44.039 -4.600  1.00 15.75  ? 419 TYR D CE2   1 
ATOM   6415  C  CZ    . TYR F 3 123 ? 149.136 -44.907 -3.512  1.00 15.92  ? 419 TYR D CZ    1 
ATOM   6416  O  OH    . TYR F 3 123 ? 149.038 -46.271 -3.717  1.00 15.13  ? 419 TYR D OH    1 
ATOM   6417  N  N     . GLU F 3 124 ? 152.062 -40.855 -5.173  1.00 15.50  ? 420 GLU D N     1 
ATOM   6418  C  CA    . GLU F 3 124 ? 152.387 -40.918 -6.604  1.00 15.81  ? 420 GLU D CA    1 
ATOM   6419  C  C     . GLU F 3 124 ? 152.678 -42.302 -7.208  1.00 15.80  ? 420 GLU D C     1 
ATOM   6420  O  O     . GLU F 3 124 ? 153.265 -42.386 -8.302  1.00 15.69  ? 420 GLU D O     1 
ATOM   6421  C  CB    . GLU F 3 124 ? 153.554 -39.981 -6.931  1.00 15.88  ? 420 GLU D CB    1 
ATOM   6422  C  CG    . GLU F 3 124 ? 153.259 -38.521 -6.697  1.00 17.64  ? 420 GLU D CG    1 
ATOM   6423  C  CD    . GLU F 3 124 ? 154.377 -37.613 -7.166  1.00 21.78  ? 420 GLU D CD    1 
ATOM   6424  O  OE1   . GLU F 3 124 ? 155.175 -38.021 -8.041  1.00 23.73  ? 420 GLU D OE1   1 
ATOM   6425  O  OE2   . GLU F 3 124 ? 154.452 -36.467 -6.668  1.00 24.88  ? 420 GLU D OE2   1 
ATOM   6426  N  N     . ALA F 3 125 ? 152.283 -43.374 -6.523  1.00 15.29  ? 421 ALA D N     1 
ATOM   6427  C  CA    . ALA F 3 125 ? 152.458 -44.723 -7.066  1.00 15.16  ? 421 ALA D CA    1 
ATOM   6428  C  C     . ALA F 3 125 ? 151.310 -45.066 -8.019  1.00 15.45  ? 421 ALA D C     1 
ATOM   6429  O  O     . ALA F 3 125 ? 150.649 -46.108 -7.895  1.00 15.15  ? 421 ALA D O     1 
ATOM   6430  C  CB    . ALA F 3 125 ? 152.548 -45.725 -5.953  1.00 15.07  ? 421 ALA D CB    1 
ATOM   6431  N  N     . VAL F 3 126 ? 151.066 -44.161 -8.963  1.00 15.73  ? 422 VAL D N     1 
ATOM   6432  C  CA    . VAL F 3 126 ? 149.981 -44.308 -9.913  1.00 16.08  ? 422 VAL D CA    1 
ATOM   6433  C  C     . VAL F 3 126 ? 150.235 -43.378 -11.094 1.00 16.79  ? 422 VAL D C     1 
ATOM   6434  O  O     . VAL F 3 126 ? 150.825 -42.302 -10.940 1.00 16.68  ? 422 VAL D O     1 
ATOM   6435  C  CB    . VAL F 3 126 ? 148.610 -44.022 -9.242  1.00 16.00  ? 422 VAL D CB    1 
ATOM   6436  C  CG1   . VAL F 3 126 ? 148.438 -42.544 -8.948  1.00 15.00  ? 422 VAL D CG1   1 
ATOM   6437  C  CG2   . VAL F 3 126 ? 147.457 -44.545 -10.092 1.00 16.23  ? 422 VAL D CG2   1 
ATOM   6438  N  N     . ARG F 3 127 ? 149.805 -43.804 -12.278 1.00 17.64  ? 423 ARG D N     1 
ATOM   6439  C  CA    . ARG F 3 127 ? 150.007 -43.024 -13.492 1.00 18.90  ? 423 ARG D CA    1 
ATOM   6440  C  C     . ARG F 3 127 ? 148.766 -42.256 -13.888 1.00 18.66  ? 423 ARG D C     1 
ATOM   6441  O  O     . ARG F 3 127 ? 147.647 -42.670 -13.560 1.00 18.63  ? 423 ARG D O     1 
ATOM   6442  C  CB    . ARG F 3 127 ? 150.445 -43.931 -14.654 1.00 18.96  ? 423 ARG D CB    1 
ATOM   6443  C  CG    . ARG F 3 127 ? 151.849 -44.504 -14.474 1.00 20.76  ? 423 ARG D CG    1 
ATOM   6444  C  CD    . ARG F 3 127 ? 152.392 -45.200 -15.729 1.00 21.34  ? 423 ARG D CD    1 
ATOM   6445  N  NE    . ARG F 3 127 ? 152.691 -44.326 -16.870 1.00 25.25  ? 423 ARG D NE    1 
ATOM   6446  C  CZ    . ARG F 3 127 ? 153.583 -43.335 -16.848 1.00 26.35  ? 423 ARG D CZ    1 
ATOM   6447  N  NH1   . ARG F 3 127 ? 154.225 -43.035 -15.720 1.00 27.41  ? 423 ARG D NH1   1 
ATOM   6448  N  NH2   . ARG F 3 127 ? 153.803 -42.611 -17.938 1.00 24.71  ? 423 ARG D NH2   1 
ATOM   6449  N  N     . PRO F 3 128 ? 148.964 -41.111 -14.566 1.00 18.91  ? 424 PRO D N     1 
ATOM   6450  C  CA    . PRO F 3 128 ? 147.888 -40.338 -15.165 1.00 19.08  ? 424 PRO D CA    1 
ATOM   6451  C  C     . PRO F 3 128 ? 147.203 -41.156 -16.247 1.00 19.53  ? 424 PRO D C     1 
ATOM   6452  O  O     . PRO F 3 128 ? 147.874 -41.856 -17.015 1.00 19.47  ? 424 PRO D O     1 
ATOM   6453  C  CB    . PRO F 3 128 ? 148.628 -39.161 -15.799 1.00 18.79  ? 424 PRO D CB    1 
ATOM   6454  C  CG    . PRO F 3 128 ? 149.848 -39.022 -14.973 1.00 18.89  ? 424 PRO D CG    1 
ATOM   6455  C  CD    . PRO F 3 128 ? 150.259 -40.440 -14.756 1.00 18.83  ? 424 PRO D CD    1 
ATOM   6456  N  N     . ASP F 3 129 ? 145.880 -41.077 -16.305 1.00 19.94  ? 425 ASP D N     1 
ATOM   6457  C  CA    . ASP F 3 129 ? 145.121 -41.831 -17.295 1.00 20.71  ? 425 ASP D CA    1 
ATOM   6458  C  C     . ASP F 3 129 ? 145.630 -41.625 -18.716 1.00 21.27  ? 425 ASP D C     1 
ATOM   6459  O  O     . ASP F 3 129 ? 145.647 -42.557 -19.513 1.00 21.20  ? 425 ASP D O     1 
ATOM   6460  C  CB    . ASP F 3 129 ? 143.630 -41.498 -17.201 1.00 20.46  ? 425 ASP D CB    1 
ATOM   6461  C  CG    . ASP F 3 129 ? 142.932 -42.260 -16.081 1.00 20.55  ? 425 ASP D CG    1 
ATOM   6462  O  OD1   . ASP F 3 129 ? 143.394 -43.358 -15.722 1.00 20.35  ? 425 ASP D OD1   1 
ATOM   6463  O  OD2   . ASP F 3 129 ? 141.904 -41.777 -15.567 1.00 21.75  ? 425 ASP D OD2   1 
ATOM   6464  N  N     . GLU F 3 130 ? 146.076 -40.407 -19.002 1.00 22.14  ? 426 GLU D N     1 
ATOM   6465  C  CA    . GLU F 3 130 ? 146.525 -40.010 -20.331 1.00 23.51  ? 426 GLU D CA    1 
ATOM   6466  C  C     . GLU F 3 130 ? 147.860 -40.645 -20.748 1.00 23.18  ? 426 GLU D C     1 
ATOM   6467  O  O     . GLU F 3 130 ? 148.090 -40.932 -21.917 1.00 22.87  ? 426 GLU D O     1 
ATOM   6468  C  CB    . GLU F 3 130 ? 146.634 -38.491 -20.361 1.00 24.42  ? 426 GLU D CB    1 
ATOM   6469  C  CG    . GLU F 3 130 ? 146.508 -37.868 -21.733 1.00 27.77  ? 426 GLU D CG    1 
ATOM   6470  C  CD    . GLU F 3 130 ? 146.291 -36.363 -21.637 1.00 32.30  ? 426 GLU D CD    1 
ATOM   6471  O  OE1   . GLU F 3 130 ? 145.358 -35.848 -22.299 1.00 33.96  ? 426 GLU D OE1   1 
ATOM   6472  O  OE2   . GLU F 3 130 ? 147.037 -35.701 -20.872 1.00 34.70  ? 426 GLU D OE2   1 
ATOM   6473  N  N     . ALA F 3 131 ? 148.744 -40.851 -19.787 1.00 23.07  ? 427 ALA D N     1 
ATOM   6474  C  CA    . ALA F 3 131 ? 149.991 -41.529 -20.069 1.00 23.21  ? 427 ALA D CA    1 
ATOM   6475  C  C     . ALA F 3 131 ? 149.764 -43.021 -20.300 1.00 23.20  ? 427 ALA D C     1 
ATOM   6476  O  O     . ALA F 3 131 ? 150.619 -43.707 -20.847 1.00 23.30  ? 427 ALA D O     1 
ATOM   6477  C  CB    . ALA F 3 131 ? 150.970 -41.321 -18.932 1.00 23.47  ? 427 ALA D CB    1 
ATOM   6478  N  N     . VAL F 3 132 ? 148.625 -43.536 -19.864 1.00 23.10  ? 428 VAL D N     1 
ATOM   6479  C  CA    . VAL F 3 132 ? 148.343 -44.945 -20.073 1.00 23.23  ? 428 VAL D CA    1 
ATOM   6480  C  C     . VAL F 3 132 ? 147.550 -45.136 -21.354 1.00 23.77  ? 428 VAL D C     1 
ATOM   6481  O  O     . VAL F 3 132 ? 147.850 -46.017 -22.144 1.00 23.43  ? 428 VAL D O     1 
ATOM   6482  C  CB    . VAL F 3 132 ? 147.550 -45.559 -18.901 1.00 22.94  ? 428 VAL D CB    1 
ATOM   6483  C  CG1   . VAL F 3 132 ? 146.995 -46.927 -19.279 1.00 22.22  ? 428 VAL D CG1   1 
ATOM   6484  C  CG2   . VAL F 3 132 ? 148.413 -45.648 -17.660 1.00 22.50  ? 428 VAL D CG2   1 
ATOM   6485  N  N     . TYR F 3 133 ? 146.544 -44.293 -21.556 1.00 24.55  ? 429 TYR D N     1 
ATOM   6486  C  CA    . TYR F 3 133 ? 145.644 -44.451 -22.689 1.00 25.51  ? 429 TYR D CA    1 
ATOM   6487  C  C     . TYR F 3 133 ? 146.018 -43.632 -23.913 1.00 26.76  ? 429 TYR D C     1 
ATOM   6488  O  O     . TYR F 3 133 ? 145.611 -43.968 -25.022 1.00 27.21  ? 429 TYR D O     1 
ATOM   6489  C  CB    . TYR F 3 133 ? 144.198 -44.153 -22.281 1.00 24.87  ? 429 TYR D CB    1 
ATOM   6490  C  CG    . TYR F 3 133 ? 143.686 -45.001 -21.136 1.00 23.88  ? 429 TYR D CG    1 
ATOM   6491  C  CD1   . TYR F 3 133 ? 143.290 -44.415 -19.935 1.00 23.67  ? 429 TYR D CD1   1 
ATOM   6492  C  CD2   . TYR F 3 133 ? 143.608 -46.385 -21.248 1.00 23.19  ? 429 TYR D CD2   1 
ATOM   6493  C  CE1   . TYR F 3 133 ? 142.816 -45.181 -18.873 1.00 22.99  ? 429 TYR D CE1   1 
ATOM   6494  C  CE2   . TYR F 3 133 ? 143.139 -47.164 -20.193 1.00 23.41  ? 429 TYR D CE2   1 
ATOM   6495  C  CZ    . TYR F 3 133 ? 142.743 -46.552 -19.007 1.00 23.47  ? 429 TYR D CZ    1 
ATOM   6496  O  OH    . TYR F 3 133 ? 142.287 -47.311 -17.957 1.00 22.85  ? 429 TYR D OH    1 
ATOM   6497  N  N     . GLY F 3 134 ? 146.790 -42.566 -23.721 1.00 28.14  ? 430 GLY D N     1 
ATOM   6498  C  CA    . GLY F 3 134 ? 147.167 -41.688 -24.827 1.00 29.57  ? 430 GLY D CA    1 
ATOM   6499  C  C     . GLY F 3 134 ? 146.049 -40.700 -25.082 1.00 31.03  ? 430 GLY D C     1 
ATOM   6500  O  O     . GLY F 3 134 ? 144.966 -40.825 -24.499 1.00 31.01  ? 430 GLY D O     1 
ATOM   6501  N  N     . LYS F 3 135 ? 146.302 -39.724 -25.957 1.00 32.33  ? 431 LYS D N     1 
ATOM   6502  C  CA    . LYS F 3 135 ? 145.324 -38.665 -26.240 1.00 33.90  ? 431 LYS D CA    1 
ATOM   6503  C  C     . LYS F 3 135 ? 144.903 -38.569 -27.708 1.00 34.07  ? 431 LYS D C     1 
ATOM   6504  O  O     . LYS F 3 135 ? 145.562 -39.108 -28.600 1.00 34.17  ? 431 LYS D O     1 
ATOM   6505  C  CB    . LYS F 3 135 ? 145.853 -37.303 -25.762 1.00 34.17  ? 431 LYS D CB    1 
ATOM   6506  C  CG    . LYS F 3 135 ? 147.311 -37.016 -26.178 1.00 36.34  ? 431 LYS D CG    1 
ATOM   6507  C  CD    . LYS F 3 135 ? 147.633 -35.521 -26.226 1.00 38.38  ? 431 LYS D CD    1 
ATOM   6508  C  CE    . LYS F 3 135 ? 147.467 -34.846 -24.861 1.00 41.91  ? 431 LYS D CE    1 
ATOM   6509  N  NZ    . LYS F 3 135 ? 147.641 -33.354 -24.941 1.00 43.02  ? 431 LYS D NZ    1 
ATOM   6510  N  N     . GLY F 3 136 ? 143.795 -37.869 -27.941 1.00 34.67  ? 432 GLY D N     1 
ATOM   6511  C  CA    . GLY F 3 136 ? 143.267 -37.643 -29.284 1.00 34.92  ? 432 GLY D CA    1 
ATOM   6512  C  C     . GLY F 3 136 ? 143.106 -38.904 -30.101 1.00 35.20  ? 432 GLY D C     1 
ATOM   6513  O  O     . GLY F 3 136 ? 142.554 -39.892 -29.632 1.00 35.40  ? 432 GLY D O     1 
ATOM   6514  N  N     . ALA F 3 137 ? 143.615 -38.870 -31.327 1.00 35.67  ? 433 ALA D N     1 
ATOM   6515  C  CA    . ALA F 3 137 ? 143.496 -39.989 -32.259 1.00 35.83  ? 433 ALA D CA    1 
ATOM   6516  C  C     . ALA F 3 137 ? 144.472 -41.114 -31.959 1.00 36.09  ? 433 ALA D C     1 
ATOM   6517  O  O     . ALA F 3 137 ? 144.550 -42.084 -32.704 1.00 36.35  ? 433 ALA D O     1 
ATOM   6518  C  CB    . ALA F 3 137 ? 143.682 -39.506 -33.684 1.00 35.69  ? 433 ALA D CB    1 
ATOM   6519  N  N     . LYS F 3 138 ? 145.229 -40.978 -30.880 1.00 36.26  ? 434 LYS D N     1 
ATOM   6520  C  CA    . LYS F 3 138 ? 146.168 -42.019 -30.491 1.00 36.34  ? 434 LYS D CA    1 
ATOM   6521  C  C     . LYS F 3 138 ? 145.690 -42.774 -29.252 1.00 36.03  ? 434 LYS D C     1 
ATOM   6522  O  O     . LYS F 3 138 ? 146.366 -43.695 -28.788 1.00 36.26  ? 434 LYS D O     1 
ATOM   6523  C  CB    . LYS F 3 138 ? 147.562 -41.429 -30.255 1.00 36.56  ? 434 LYS D CB    1 
ATOM   6524  C  CG    . LYS F 3 138 ? 148.298 -41.098 -31.537 1.00 38.01  ? 434 LYS D CG    1 
ATOM   6525  C  CD    . LYS F 3 138 ? 149.666 -40.485 -31.279 1.00 40.40  ? 434 LYS D CD    1 
ATOM   6526  C  CE    . LYS F 3 138 ? 150.405 -40.283 -32.600 1.00 41.35  ? 434 LYS D CE    1 
ATOM   6527  N  NZ    . LYS F 3 138 ? 151.586 -39.370 -32.504 1.00 42.19  ? 434 LYS D NZ    1 
ATOM   6528  N  N     . ARG F 3 139 ? 144.528 -42.380 -28.731 1.00 35.43  ? 435 ARG D N     1 
ATOM   6529  C  CA    . ARG F 3 139 ? 143.960 -42.974 -27.525 1.00 35.10  ? 435 ARG D CA    1 
ATOM   6530  C  C     . ARG F 3 139 ? 143.538 -44.422 -27.772 1.00 34.71  ? 435 ARG D C     1 
ATOM   6531  O  O     . ARG F 3 139 ? 142.864 -44.714 -28.757 1.00 34.91  ? 435 ARG D O     1 
ATOM   6532  C  CB    . ARG F 3 139 ? 142.773 -42.139 -27.054 1.00 35.17  ? 435 ARG D CB    1 
ATOM   6533  C  CG    . ARG F 3 139 ? 142.225 -42.486 -25.682 1.00 36.48  ? 435 ARG D CG    1 
ATOM   6534  C  CD    . ARG F 3 139 ? 141.161 -41.451 -25.298 1.00 39.31  ? 435 ARG D CD    1 
ATOM   6535  N  NE    . ARG F 3 139 ? 140.481 -41.734 -24.031 1.00 40.88  ? 435 ARG D NE    1 
ATOM   6536  C  CZ    . ARG F 3 139 ? 140.914 -41.333 -22.838 1.00 42.16  ? 435 ARG D CZ    1 
ATOM   6537  N  NH1   . ARG F 3 139 ? 142.049 -40.638 -22.730 1.00 42.16  ? 435 ARG D NH1   1 
ATOM   6538  N  NH2   . ARG F 3 139 ? 140.217 -41.634 -21.745 1.00 42.04  ? 435 ARG D NH2   1 
ATOM   6539  N  N     . ALA F 3 140 ? 143.942 -45.327 -26.884 1.00 34.15  ? 436 ALA D N     1 
ATOM   6540  C  CA    . ALA F 3 140 ? 143.630 -46.747 -27.037 1.00 33.47  ? 436 ALA D CA    1 
ATOM   6541  C  C     . ALA F 3 140 ? 143.789 -47.505 -25.734 1.00 33.20  ? 436 ALA D C     1 
ATOM   6542  O  O     . ALA F 3 140 ? 144.603 -47.137 -24.884 1.00 33.31  ? 436 ALA D O     1 
ATOM   6543  C  CB    . ALA F 3 140 ? 144.527 -47.372 -28.100 1.00 33.43  ? 436 ALA D CB    1 
ATOM   6544  N  N     . VAL F 3 141 ? 143.008 -48.567 -25.577 1.00 32.66  ? 437 VAL D N     1 
ATOM   6545  C  CA    . VAL F 3 141 ? 143.172 -49.451 -24.438 1.00 32.38  ? 437 VAL D CA    1 
ATOM   6546  C  C     . VAL F 3 141 ? 144.434 -50.276 -24.681 1.00 32.04  ? 437 VAL D C     1 
ATOM   6547  O  O     . VAL F 3 141 ? 144.570 -50.904 -25.724 1.00 32.20  ? 437 VAL D O     1 
ATOM   6548  C  CB    . VAL F 3 141 ? 141.974 -50.382 -24.273 1.00 32.24  ? 437 VAL D CB    1 
ATOM   6549  C  CG1   . VAL F 3 141 ? 142.229 -51.390 -23.172 1.00 31.89  ? 437 VAL D CG1   1 
ATOM   6550  C  CG2   . VAL F 3 141 ? 140.732 -49.569 -23.983 1.00 32.95  ? 437 VAL D CG2   1 
ATOM   6551  N  N     . PRO F 3 142 ? 145.378 -50.253 -23.732 1.00 31.65  ? 438 PRO D N     1 
ATOM   6552  C  CA    . PRO F 3 142 ? 146.618 -51.010 -23.929 1.00 31.34  ? 438 PRO D CA    1 
ATOM   6553  C  C     . PRO F 3 142 ? 146.494 -52.525 -23.681 1.00 30.76  ? 438 PRO D C     1 
ATOM   6554  O  O     . PRO F 3 142 ? 145.407 -53.029 -23.404 1.00 30.62  ? 438 PRO D O     1 
ATOM   6555  C  CB    . PRO F 3 142 ? 147.578 -50.362 -22.924 1.00 31.44  ? 438 PRO D CB    1 
ATOM   6556  C  CG    . PRO F 3 142 ? 146.688 -49.839 -21.839 1.00 31.48  ? 438 PRO D CG    1 
ATOM   6557  C  CD    . PRO F 3 142 ? 145.362 -49.508 -22.461 1.00 31.43  ? 438 PRO D CD    1 
ATOM   6558  N  N     . ASP F 3 143 ? 147.618 -53.226 -23.794 1.00 30.21  ? 439 ASP D N     1 
ATOM   6559  C  CA    . ASP F 3 143 ? 147.710 -54.666 -23.565 1.00 29.80  ? 439 ASP D CA    1 
ATOM   6560  C  C     . ASP F 3 143 ? 147.232 -55.023 -22.156 1.00 28.92  ? 439 ASP D C     1 
ATOM   6561  O  O     . ASP F 3 143 ? 147.457 -54.269 -21.195 1.00 29.28  ? 439 ASP D O     1 
ATOM   6562  C  CB    . ASP F 3 143 ? 149.174 -55.093 -23.748 1.00 30.47  ? 439 ASP D CB    1 
ATOM   6563  C  CG    . ASP F 3 143 ? 149.344 -56.596 -23.996 1.00 32.51  ? 439 ASP D CG    1 
ATOM   6564  O  OD1   . ASP F 3 143 ? 148.374 -57.289 -24.384 1.00 34.64  ? 439 ASP D OD1   1 
ATOM   6565  O  OD2   . ASP F 3 143 ? 150.477 -57.089 -23.808 1.00 34.32  ? 439 ASP D OD2   1 
ATOM   6566  N  N     . GLU F 3 144 ? 146.588 -56.178 -22.021 1.00 27.56  ? 440 GLU D N     1 
ATOM   6567  C  CA    . GLU F 3 144 ? 146.064 -56.610 -20.727 1.00 26.60  ? 440 GLU D CA    1 
ATOM   6568  C  C     . GLU F 3 144 ? 147.016 -56.393 -19.536 1.00 25.92  ? 440 GLU D C     1 
ATOM   6569  O  O     . GLU F 3 144 ? 146.594 -55.869 -18.520 1.00 25.88  ? 440 GLU D O     1 
ATOM   6570  C  CB    . GLU F 3 144 ? 145.591 -58.061 -20.783 1.00 26.66  ? 440 GLU D CB    1 
ATOM   6571  C  CG    . GLU F 3 144 ? 144.833 -58.503 -19.558 1.00 27.64  ? 440 GLU D CG    1 
ATOM   6572  C  CD    . GLU F 3 144 ? 144.162 -59.845 -19.742 1.00 30.39  ? 440 GLU D CD    1 
ATOM   6573  O  OE1   . GLU F 3 144 ? 144.872 -60.841 -19.993 1.00 30.99  ? 440 GLU D OE1   1 
ATOM   6574  O  OE2   . GLU F 3 144 ? 142.918 -59.912 -19.615 1.00 32.20  ? 440 GLU D OE2   1 
ATOM   6575  N  N     . PRO F 3 145 ? 148.298 -56.786 -19.652 1.00 25.39  ? 441 PRO D N     1 
ATOM   6576  C  CA    . PRO F 3 145 ? 149.163 -56.559 -18.489 1.00 24.97  ? 441 PRO D CA    1 
ATOM   6577  C  C     . PRO F 3 145 ? 149.220 -55.081 -18.071 1.00 24.67  ? 441 PRO D C     1 
ATOM   6578  O  O     . PRO F 3 145 ? 149.043 -54.768 -16.885 1.00 24.69  ? 441 PRO D O     1 
ATOM   6579  C  CB    . PRO F 3 145 ? 150.545 -57.007 -18.975 1.00 24.89  ? 441 PRO D CB    1 
ATOM   6580  C  CG    . PRO F 3 145 ? 150.296 -57.859 -20.158 1.00 25.18  ? 441 PRO D CG    1 
ATOM   6581  C  CD    . PRO F 3 145 ? 149.021 -57.420 -20.770 1.00 25.06  ? 441 PRO D CD    1 
ATOM   6582  N  N     . VAL F 3 146 ? 149.463 -54.188 -19.034 1.00 23.57  ? 442 VAL D N     1 
ATOM   6583  C  CA    . VAL F 3 146 ? 149.573 -52.768 -18.738 1.00 22.67  ? 442 VAL D CA    1 
ATOM   6584  C  C     . VAL F 3 146 ? 148.261 -52.275 -18.137 1.00 22.29  ? 442 VAL D C     1 
ATOM   6585  O  O     . VAL F 3 146 ? 148.250 -51.625 -17.088 1.00 22.26  ? 442 VAL D O     1 
ATOM   6586  C  CB    . VAL F 3 146 ? 149.940 -51.962 -19.989 1.00 22.83  ? 442 VAL D CB    1 
ATOM   6587  C  CG1   . VAL F 3 146 ? 149.910 -50.467 -19.707 1.00 22.00  ? 442 VAL D CG1   1 
ATOM   6588  C  CG2   . VAL F 3 146 ? 151.309 -52.379 -20.482 1.00 22.51  ? 442 VAL D CG2   1 
ATOM   6589  N  N     . LEU F 3 147 ? 147.156 -52.627 -18.788 1.00 21.51  ? 443 LEU D N     1 
ATOM   6590  C  CA    . LEU F 3 147 ? 145.836 -52.270 -18.296 1.00 20.34  ? 443 LEU D CA    1 
ATOM   6591  C  C     . LEU F 3 147 ? 145.623 -52.731 -16.858 1.00 19.76  ? 443 LEU D C     1 
ATOM   6592  O  O     . LEU F 3 147 ? 145.228 -51.949 -16.009 1.00 20.17  ? 443 LEU D O     1 
ATOM   6593  C  CB    . LEU F 3 147 ? 144.755 -52.870 -19.192 1.00 20.35  ? 443 LEU D CB    1 
ATOM   6594  C  CG    . LEU F 3 147 ? 143.298 -52.662 -18.746 1.00 20.26  ? 443 LEU D CG    1 
ATOM   6595  C  CD1   . LEU F 3 147 ? 142.909 -51.192 -18.772 1.00 19.67  ? 443 LEU D CD1   1 
ATOM   6596  C  CD2   . LEU F 3 147 ? 142.340 -53.489 -19.602 1.00 19.99  ? 443 LEU D CD2   1 
ATOM   6597  N  N     . ALA F 3 148 ? 145.899 -53.994 -16.581 1.00 18.72  ? 444 ALA D N     1 
ATOM   6598  C  CA    . ALA F 3 148 ? 145.643 -54.541 -15.262 1.00 17.95  ? 444 ALA D CA    1 
ATOM   6599  C  C     . ALA F 3 148 ? 146.404 -53.823 -14.169 1.00 17.83  ? 444 ALA D C     1 
ATOM   6600  O  O     . ALA F 3 148 ? 145.853 -53.551 -13.101 1.00 17.67  ? 444 ALA D O     1 
ATOM   6601  C  CB    . ALA F 3 148 ? 145.960 -56.010 -15.232 1.00 17.82  ? 444 ALA D CB    1 
ATOM   6602  N  N     . GLU F 3 149 ? 147.670 -53.510 -14.426 1.00 17.61  ? 445 GLU D N     1 
ATOM   6603  C  CA    . GLU F 3 149 ? 148.466 -52.836 -13.415 1.00 17.27  ? 445 GLU D CA    1 
ATOM   6604  C  C     . GLU F 3 149 ? 147.913 -51.451 -13.136 1.00 16.60  ? 445 GLU D C     1 
ATOM   6605  O  O     . GLU F 3 149 ? 147.778 -51.050 -11.983 1.00 16.71  ? 445 GLU D O     1 
ATOM   6606  C  CB    . GLU F 3 149 ? 149.940 -52.760 -13.805 1.00 17.50  ? 445 GLU D CB    1 
ATOM   6607  C  CG    . GLU F 3 149 ? 150.782 -52.052 -12.757 1.00 18.84  ? 445 GLU D CG    1 
ATOM   6608  C  CD    . GLU F 3 149 ? 152.268 -52.121 -13.040 1.00 21.77  ? 445 GLU D CD    1 
ATOM   6609  O  OE1   . GLU F 3 149 ? 153.039 -51.456 -12.315 1.00 22.64  ? 445 GLU D OE1   1 
ATOM   6610  O  OE2   . GLU F 3 149 ? 152.670 -52.845 -13.977 1.00 22.41  ? 445 GLU D OE2   1 
ATOM   6611  N  N     . HIS F 3 150 ? 147.562 -50.736 -14.192 1.00 15.92  ? 446 HIS D N     1 
ATOM   6612  C  CA    . HIS F 3 150 ? 147.033 -49.391 -14.046 1.00 15.44  ? 446 HIS D CA    1 
ATOM   6613  C  C     . HIS F 3 150 ? 145.762 -49.371 -13.219 1.00 15.22  ? 446 HIS D C     1 
ATOM   6614  O  O     . HIS F 3 150 ? 145.621 -48.553 -12.308 1.00 15.75  ? 446 HIS D O     1 
ATOM   6615  C  CB    . HIS F 3 150 ? 146.777 -48.772 -15.408 1.00 15.56  ? 446 HIS D CB    1 
ATOM   6616  C  CG    . HIS F 3 150 ? 146.219 -47.392 -15.338 1.00 16.28  ? 446 HIS D CG    1 
ATOM   6617  N  ND1   . HIS F 3 150 ? 146.808 -46.392 -14.592 1.00 17.43  ? 446 HIS D ND1   1 
ATOM   6618  C  CD2   . HIS F 3 150 ? 145.142 -46.833 -15.938 1.00 16.13  ? 446 HIS D CD2   1 
ATOM   6619  C  CE1   . HIS F 3 150 ? 146.106 -45.280 -14.720 1.00 18.04  ? 446 HIS D CE1   1 
ATOM   6620  N  NE2   . HIS F 3 150 ? 145.093 -45.520 -15.536 1.00 18.50  ? 446 HIS D NE2   1 
ATOM   6621  N  N     . LEU F 3 151 ? 144.839 -50.280 -13.511 1.00 14.54  ? 447 LEU D N     1 
ATOM   6622  C  CA    . LEU F 3 151 ? 143.598 -50.324 -12.750 1.00 13.96  ? 447 LEU D CA    1 
ATOM   6623  C  C     . LEU F 3 151 ? 143.853 -50.710 -11.291 1.00 14.17  ? 447 LEU D C     1 
ATOM   6624  O  O     . LEU F 3 151 ? 143.300 -50.087 -10.395 1.00 14.39  ? 447 LEU D O     1 
ATOM   6625  C  CB    . LEU F 3 151 ? 142.562 -51.226 -13.410 1.00 13.43  ? 447 LEU D CB    1 
ATOM   6626  C  CG    . LEU F 3 151 ? 142.281 -50.892 -14.879 1.00 12.82  ? 447 LEU D CG    1 
ATOM   6627  C  CD1   . LEU F 3 151 ? 141.058 -51.643 -15.340 1.00 12.90  ? 447 LEU D CD1   1 
ATOM   6628  C  CD2   . LEU F 3 151 ? 142.085 -49.401 -15.108 1.00 11.39  ? 447 LEU D CD2   1 
ATOM   6629  N  N     . VAL F 3 152 ? 144.707 -51.704 -11.045 1.00 13.78  ? 448 VAL D N     1 
ATOM   6630  C  CA    . VAL F 3 152 ? 145.037 -52.067 -9.671  1.00 13.49  ? 448 VAL D CA    1 
ATOM   6631  C  C     . VAL F 3 152 ? 145.654 -50.889 -8.892  1.00 13.37  ? 448 VAL D C     1 
ATOM   6632  O  O     . VAL F 3 152 ? 145.275 -50.637 -7.754  1.00 13.00  ? 448 VAL D O     1 
ATOM   6633  C  CB    . VAL F 3 152 ? 145.960 -53.303 -9.593  1.00 13.45  ? 448 VAL D CB    1 
ATOM   6634  C  CG1   . VAL F 3 152 ? 146.551 -53.436 -8.198  1.00 13.68  ? 448 VAL D CG1   1 
ATOM   6635  C  CG2   . VAL F 3 152 ? 145.198 -54.567 -9.967  1.00 13.20  ? 448 VAL D CG2   1 
ATOM   6636  N  N     . ARG F 3 153 ? 146.578 -50.161 -9.516  1.00 13.23  ? 449 ARG D N     1 
ATOM   6637  C  CA    . ARG F 3 153 ? 147.201 -48.991 -8.882  1.00 12.91  ? 449 ARG D CA    1 
ATOM   6638  C  C     . ARG F 3 153 ? 146.201 -47.897 -8.495  1.00 13.32  ? 449 ARG D C     1 
ATOM   6639  O  O     . ARG F 3 153 ? 146.373 -47.256 -7.456  1.00 13.61  ? 449 ARG D O     1 
ATOM   6640  C  CB    . ARG F 3 153 ? 148.328 -48.407 -9.744  1.00 12.90  ? 449 ARG D CB    1 
ATOM   6641  C  CG    . ARG F 3 153 ? 149.567 -49.272 -9.788  1.00 12.25  ? 449 ARG D CG    1 
ATOM   6642  C  CD    . ARG F 3 153 ? 150.769 -48.624 -10.478 1.00 12.44  ? 449 ARG D CD    1 
ATOM   6643  N  NE    . ARG F 3 153 ? 151.959 -49.443 -10.247 1.00 10.83  ? 449 ARG D NE    1 
ATOM   6644  C  CZ    . ARG F 3 153 ? 152.745 -49.340 -9.177  1.00 12.13  ? 449 ARG D CZ    1 
ATOM   6645  N  NH1   . ARG F 3 153 ? 152.497 -48.432 -8.243  1.00 13.35  ? 449 ARG D NH1   1 
ATOM   6646  N  NH2   . ARG F 3 153 ? 153.787 -50.148 -9.029  1.00 12.88  ? 449 ARG D NH2   1 
ATOM   6647  N  N     . LYS F 3 154 ? 145.158 -47.693 -9.306  1.00 13.41  ? 450 LYS D N     1 
ATOM   6648  C  CA    . LYS F 3 154 ? 144.118 -46.698 -8.995  1.00 13.03  ? 450 LYS D CA    1 
ATOM   6649  C  C     . LYS F 3 154 ? 143.271 -47.190 -7.845  1.00 13.56  ? 450 LYS D C     1 
ATOM   6650  O  O     . LYS F 3 154 ? 142.880 -46.412 -6.959  1.00 13.90  ? 450 LYS D O     1 
ATOM   6651  C  CB    . LYS F 3 154 ? 143.235 -46.382 -10.215 1.00 12.81  ? 450 LYS D CB    1 
ATOM   6652  C  CG    . LYS F 3 154 ? 144.045 -46.019 -11.457 1.00 12.63  ? 450 LYS D CG    1 
ATOM   6653  C  CD    . LYS F 3 154 ? 143.313 -45.181 -12.474 1.00 11.80  ? 450 LYS D CD    1 
ATOM   6654  C  CE    . LYS F 3 154 ? 142.210 -45.922 -13.160 1.00 12.14  ? 450 LYS D CE    1 
ATOM   6655  N  NZ    . LYS F 3 154 ? 141.768 -45.160 -14.380 1.00 12.07  ? 450 LYS D NZ    1 
ATOM   6656  N  N     . ALA F 3 155 ? 142.981 -48.487 -7.852  1.00 13.82  ? 451 ALA D N     1 
ATOM   6657  C  CA    . ALA F 3 155 ? 142.233 -49.083 -6.759  1.00 14.29  ? 451 ALA D CA    1 
ATOM   6658  C  C     . ALA F 3 155 ? 143.074 -49.019 -5.499  1.00 14.49  ? 451 ALA D C     1 
ATOM   6659  O  O     . ALA F 3 155 ? 142.558 -48.791 -4.400  1.00 15.00  ? 451 ALA D O     1 
ATOM   6660  C  CB    . ALA F 3 155 ? 141.866 -50.514 -7.066  1.00 14.31  ? 451 ALA D CB    1 
ATOM   6661  N  N     . ALA F 3 156 ? 144.375 -49.211 -5.660  1.00 14.04  ? 452 ALA D N     1 
ATOM   6662  C  CA    . ALA F 3 156 ? 145.262 -49.165 -4.517  1.00 14.03  ? 452 ALA D CA    1 
ATOM   6663  C  C     . ALA F 3 156 ? 145.296 -47.752 -3.978  1.00 13.54  ? 452 ALA D C     1 
ATOM   6664  O  O     . ALA F 3 156 ? 145.209 -47.545 -2.785  1.00 13.58  ? 452 ALA D O     1 
ATOM   6665  C  CB    . ALA F 3 156 ? 146.656 -49.633 -4.886  1.00 13.70  ? 452 ALA D CB    1 
ATOM   6666  N  N     . ALA F 3 157 ? 145.404 -46.787 -4.876  1.00 13.56  ? 453 ALA D N     1 
ATOM   6667  C  CA    . ALA F 3 157 ? 145.454 -45.381 -4.489  1.00 13.56  ? 453 ALA D CA    1 
ATOM   6668  C  C     . ALA F 3 157 ? 144.219 -45.008 -3.683  1.00 13.56  ? 453 ALA D C     1 
ATOM   6669  O  O     . ALA F 3 157 ? 144.323 -44.435 -2.586  1.00 13.11  ? 453 ALA D O     1 
ATOM   6670  C  CB    . ALA F 3 157 ? 145.578 -44.488 -5.720  1.00 13.01  ? 453 ALA D CB    1 
ATOM   6671  N  N     . ILE F 3 158 ? 143.056 -45.358 -4.238  1.00 13.68  ? 454 ILE D N     1 
ATOM   6672  C  CA    . ILE F 3 158 ? 141.770 -45.056 -3.626  1.00 13.53  ? 454 ILE D CA    1 
ATOM   6673  C  C     . ILE F 3 158 ? 141.735 -45.641 -2.226  1.00 13.53  ? 454 ILE D C     1 
ATOM   6674  O  O     . ILE F 3 158 ? 141.378 -44.968 -1.258  1.00 13.48  ? 454 ILE D O     1 
ATOM   6675  C  CB    . ILE F 3 158 ? 140.604 -45.593 -4.487  1.00 13.60  ? 454 ILE D CB    1 
ATOM   6676  C  CG1   . ILE F 3 158 ? 140.452 -44.760 -5.765  1.00 13.26  ? 454 ILE D CG1   1 
ATOM   6677  C  CG2   . ILE F 3 158 ? 139.303 -45.548 -3.706  1.00 13.95  ? 454 ILE D CG2   1 
ATOM   6678  C  CD1   . ILE F 3 158 ? 139.609 -45.399 -6.827  1.00 13.37  ? 454 ILE D CD1   1 
ATOM   6679  N  N     . TRP F 3 159 ? 142.166 -46.887 -2.124  1.00 13.43  ? 455 TRP D N     1 
ATOM   6680  C  CA    . TRP F 3 159 ? 142.159 -47.600 -0.867  1.00 13.69  ? 455 TRP D CA    1 
ATOM   6681  C  C     . TRP F 3 159 ? 142.982 -46.857 0.172   1.00 14.23  ? 455 TRP D C     1 
ATOM   6682  O  O     . TRP F 3 159 ? 142.595 -46.770 1.342   1.00 14.15  ? 455 TRP D O     1 
ATOM   6683  C  CB    . TRP F 3 159 ? 142.708 -49.000 -1.102  1.00 13.45  ? 455 TRP D CB    1 
ATOM   6684  C  CG    . TRP F 3 159 ? 142.673 -49.934 0.042   1.00 12.75  ? 455 TRP D CG    1 
ATOM   6685  C  CD1   . TRP F 3 159 ? 143.747 -50.448 0.697   1.00 12.45  ? 455 TRP D CD1   1 
ATOM   6686  C  CD2   . TRP F 3 159 ? 141.516 -50.521 0.645   1.00 12.98  ? 455 TRP D CD2   1 
ATOM   6687  N  NE1   . TRP F 3 159 ? 143.337 -51.304 1.672   1.00 13.05  ? 455 TRP D NE1   1 
ATOM   6688  C  CE2   . TRP F 3 159 ? 141.969 -51.368 1.668   1.00 12.94  ? 455 TRP D CE2   1 
ATOM   6689  C  CE3   . TRP F 3 159 ? 140.137 -50.401 0.429   1.00 14.04  ? 455 TRP D CE3   1 
ATOM   6690  C  CZ2   . TRP F 3 159 ? 141.098 -52.091 2.481   1.00 12.92  ? 455 TRP D CZ2   1 
ATOM   6691  C  CZ3   . TRP F 3 159 ? 139.272 -51.124 1.237   1.00 13.18  ? 455 TRP D CZ3   1 
ATOM   6692  C  CH2   . TRP F 3 159 ? 139.757 -51.957 2.249   1.00 12.83  ? 455 TRP D CH2   1 
ATOM   6693  N  N     . GLU F 3 160 ? 144.096 -46.283 -0.252  1.00 14.77  ? 456 GLU D N     1 
ATOM   6694  C  CA    . GLU F 3 160 ? 144.964 -45.610 0.702   1.00 15.84  ? 456 GLU D CA    1 
ATOM   6695  C  C     . GLU F 3 160 ? 144.554 -44.190 1.022   1.00 15.47  ? 456 GLU D C     1 
ATOM   6696  O  O     . GLU F 3 160 ? 144.864 -43.704 2.097   1.00 15.37  ? 456 GLU D O     1 
ATOM   6697  C  CB    . GLU F 3 160 ? 146.424 -45.645 0.238   1.00 16.19  ? 456 GLU D CB    1 
ATOM   6698  C  CG    . GLU F 3 160 ? 147.009 -47.060 0.121   1.00 19.30  ? 456 GLU D CG    1 
ATOM   6699  C  CD    . GLU F 3 160 ? 147.277 -47.756 1.473   1.00 23.67  ? 456 GLU D CD    1 
ATOM   6700  O  OE1   . GLU F 3 160 ? 147.402 -49.001 1.460   1.00 25.51  ? 456 GLU D OE1   1 
ATOM   6701  O  OE2   . GLU F 3 160 ? 147.376 -47.083 2.532   1.00 24.21  ? 456 GLU D OE2   1 
ATOM   6702  N  N     . LEU F 3 161 ? 143.828 -43.543 0.116   1.00 15.96  ? 457 LEU D N     1 
ATOM   6703  C  CA    . LEU F 3 161 ? 143.529 -42.110 0.249   1.00 16.36  ? 457 LEU D CA    1 
ATOM   6704  C  C     . LEU F 3 161 ? 142.261 -41.734 0.994   1.00 16.88  ? 457 LEU D C     1 
ATOM   6705  O  O     . LEU F 3 161 ? 142.102 -40.583 1.406   1.00 17.10  ? 457 LEU D O     1 
ATOM   6706  C  CB    . LEU F 3 161 ? 143.522 -41.442 -1.120  1.00 16.39  ? 457 LEU D CB    1 
ATOM   6707  C  CG    . LEU F 3 161 ? 144.869 -41.382 -1.840  1.00 16.49  ? 457 LEU D CG    1 
ATOM   6708  C  CD1   . LEU F 3 161 ? 144.738 -40.633 -3.140  1.00 16.11  ? 457 LEU D CD1   1 
ATOM   6709  C  CD2   . LEU F 3 161 ? 145.888 -40.705 -0.947  1.00 17.52  ? 457 LEU D CD2   1 
ATOM   6710  N  N     . GLU F 3 162 ? 141.362 -42.695 1.174   1.00 17.58  ? 458 GLU D N     1 
ATOM   6711  C  CA    . GLU F 3 162 ? 140.083 -42.430 1.833   1.00 18.15  ? 458 GLU D CA    1 
ATOM   6712  C  C     . GLU F 3 162 ? 140.274 -41.733 3.178   1.00 18.20  ? 458 GLU D C     1 
ATOM   6713  O  O     . GLU F 3 162 ? 139.615 -40.733 3.460   1.00 18.23  ? 458 GLU D O     1 
ATOM   6714  C  CB    . GLU F 3 162 ? 139.289 -43.723 2.011   1.00 17.85  ? 458 GLU D CB    1 
ATOM   6715  C  CG    . GLU F 3 162 ? 137.908 -43.543 2.655   1.00 18.57  ? 458 GLU D CG    1 
ATOM   6716  C  CD    . GLU F 3 162 ? 137.093 -44.838 2.662   1.00 19.37  ? 458 GLU D CD    1 
ATOM   6717  O  OE1   . GLU F 3 162 ? 135.968 -44.839 3.205   1.00 21.14  ? 458 GLU D OE1   1 
ATOM   6718  O  OE2   . GLU F 3 162 ? 137.578 -45.861 2.119   1.00 20.49  ? 458 GLU D OE2   1 
ATOM   6719  N  N     . ARG F 3 163 ? 141.192 -42.252 3.990   1.00 18.46  ? 459 ARG D N     1 
ATOM   6720  C  CA    . ARG F 3 163 ? 141.434 -41.706 5.326   1.00 18.59  ? 459 ARG D CA    1 
ATOM   6721  C  C     . ARG F 3 163 ? 141.957 -40.269 5.306   1.00 18.40  ? 459 ARG D C     1 
ATOM   6722  O  O     . ARG F 3 163 ? 141.306 -39.377 5.843   1.00 18.40  ? 459 ARG D O     1 
ATOM   6723  C  CB    . ARG F 3 163 ? 142.350 -42.633 6.132   1.00 18.76  ? 459 ARG D CB    1 
ATOM   6724  C  CG    . ARG F 3 163 ? 142.585 -42.243 7.597   1.00 20.88  ? 459 ARG D CG    1 
ATOM   6725  C  CD    . ARG F 3 163 ? 141.296 -41.790 8.288   1.00 24.34  ? 459 ARG D CD    1 
ATOM   6726  N  NE    . ARG F 3 163 ? 140.160 -42.692 8.062   1.00 25.89  ? 459 ARG D NE    1 
ATOM   6727  C  CZ    . ARG F 3 163 ? 138.892 -42.375 8.313   1.00 26.48  ? 459 ARG D CZ    1 
ATOM   6728  N  NH1   . ARG F 3 163 ? 138.577 -41.169 8.786   1.00 26.42  ? 459 ARG D NH1   1 
ATOM   6729  N  NH2   . ARG F 3 163 ? 137.935 -43.263 8.084   1.00 26.86  ? 459 ARG D NH2   1 
ATOM   6730  N  N     . PRO F 3 164 ? 143.125 -40.032 4.687   1.00 18.22  ? 460 PRO D N     1 
ATOM   6731  C  CA    . PRO F 3 164 ? 143.623 -38.648 4.666   1.00 18.35  ? 460 PRO D CA    1 
ATOM   6732  C  C     . PRO F 3 164 ? 142.608 -37.622 4.114   1.00 18.34  ? 460 PRO D C     1 
ATOM   6733  O  O     . PRO F 3 164 ? 142.467 -36.548 4.680   1.00 18.72  ? 460 PRO D O     1 
ATOM   6734  C  CB    . PRO F 3 164 ? 144.873 -38.728 3.768   1.00 18.07  ? 460 PRO D CB    1 
ATOM   6735  C  CG    . PRO F 3 164 ? 144.830 -40.073 3.125   1.00 17.81  ? 460 PRO D CG    1 
ATOM   6736  C  CD    . PRO F 3 164 ? 144.042 -40.963 4.007   1.00 17.89  ? 460 PRO D CD    1 
ATOM   6737  N  N     . PHE F 3 165 ? 141.915 -37.950 3.027   1.00 18.14  ? 461 PHE D N     1 
ATOM   6738  C  CA    . PHE F 3 165 ? 140.898 -37.061 2.466   1.00 17.74  ? 461 PHE D CA    1 
ATOM   6739  C  C     . PHE F 3 165 ? 139.772 -36.795 3.453   1.00 17.95  ? 461 PHE D C     1 
ATOM   6740  O  O     . PHE F 3 165 ? 139.380 -35.638 3.663   1.00 17.46  ? 461 PHE D O     1 
ATOM   6741  C  CB    . PHE F 3 165 ? 140.328 -37.636 1.153   1.00 17.63  ? 461 PHE D CB    1 
ATOM   6742  C  CG    . PHE F 3 165 ? 141.086 -37.202 -0.067  1.00 17.23  ? 461 PHE D CG    1 
ATOM   6743  C  CD1   . PHE F 3 165 ? 142.272 -37.826 -0.428  1.00 16.78  ? 461 PHE D CD1   1 
ATOM   6744  C  CD2   . PHE F 3 165 ? 140.631 -36.144 -0.837  1.00 16.25  ? 461 PHE D CD2   1 
ATOM   6745  C  CE1   . PHE F 3 165 ? 142.983 -37.410 -1.552  1.00 17.09  ? 461 PHE D CE1   1 
ATOM   6746  C  CE2   . PHE F 3 165 ? 141.339 -35.726 -1.960  1.00 16.72  ? 461 PHE D CE2   1 
ATOM   6747  C  CZ    . PHE F 3 165 ? 142.513 -36.359 -2.319  1.00 16.59  ? 461 PHE D CZ    1 
ATOM   6748  N  N     . LEU F 3 166 ? 139.251 -37.874 4.044   1.00 18.35  ? 462 LEU D N     1 
ATOM   6749  C  CA    . LEU F 3 166 ? 138.174 -37.783 5.029   1.00 18.73  ? 462 LEU D CA    1 
ATOM   6750  C  C     . LEU F 3 166 ? 138.568 -36.979 6.257   1.00 19.32  ? 462 LEU D C     1 
ATOM   6751  O  O     . LEU F 3 166 ? 137.724 -36.299 6.849   1.00 19.93  ? 462 LEU D O     1 
ATOM   6752  C  CB    . LEU F 3 166 ? 137.685 -39.163 5.455   1.00 18.48  ? 462 LEU D CB    1 
ATOM   6753  C  CG    . LEU F 3 166 ? 136.733 -39.918 4.536   1.00 17.66  ? 462 LEU D CG    1 
ATOM   6754  C  CD1   . LEU F 3 166 ? 136.455 -41.279 5.146   1.00 18.36  ? 462 LEU D CD1   1 
ATOM   6755  C  CD2   . LEU F 3 166 ? 135.454 -39.156 4.334   1.00 16.46  ? 462 LEU D CD2   1 
ATOM   6756  N  N     . ASP F 3 167 ? 139.836 -37.044 6.644   1.00 19.64  ? 463 ASP D N     1 
ATOM   6757  C  CA    . ASP F 3 167 ? 140.288 -36.248 7.772   1.00 20.18  ? 463 ASP D CA    1 
ATOM   6758  C  C     . ASP F 3 167 ? 140.306 -34.773 7.409   1.00 20.07  ? 463 ASP D C     1 
ATOM   6759  O  O     . ASP F 3 167 ? 139.931 -33.942 8.229   1.00 20.49  ? 463 ASP D O     1 
ATOM   6760  C  CB    . ASP F 3 167 ? 141.656 -36.704 8.283   1.00 20.42  ? 463 ASP D CB    1 
ATOM   6761  C  CG    . ASP F 3 167 ? 141.616 -38.096 8.947   1.00 22.93  ? 463 ASP D CG    1 
ATOM   6762  O  OD1   . ASP F 3 167 ? 142.657 -38.798 8.918   1.00 24.84  ? 463 ASP D OD1   1 
ATOM   6763  O  OD2   . ASP F 3 167 ? 140.555 -38.504 9.488   1.00 25.84  ? 463 ASP D OD2   1 
ATOM   6764  N  N     . GLU F 3 168 ? 140.722 -34.431 6.191   1.00 20.05  ? 464 GLU D N     1 
ATOM   6765  C  CA    . GLU F 3 168 ? 140.738 -33.015 5.799   1.00 19.80  ? 464 GLU D CA    1 
ATOM   6766  C  C     . GLU F 3 168 ? 139.338 -32.441 5.592   1.00 20.03  ? 464 GLU D C     1 
ATOM   6767  O  O     . GLU F 3 168 ? 139.076 -31.290 5.954   1.00 19.98  ? 464 GLU D O     1 
ATOM   6768  C  CB    . GLU F 3 168 ? 141.612 -32.735 4.575   1.00 19.78  ? 464 GLU D CB    1 
ATOM   6769  C  CG    . GLU F 3 168 ? 141.806 -31.228 4.380   1.00 19.30  ? 464 GLU D CG    1 
ATOM   6770  C  CD    . GLU F 3 168 ? 142.664 -30.865 3.202   1.00 19.52  ? 464 GLU D CD    1 
ATOM   6771  O  OE1   . GLU F 3 168 ? 142.536 -29.717 2.717   1.00 19.50  ? 464 GLU D OE1   1 
ATOM   6772  O  OE2   . GLU F 3 168 ? 143.461 -31.716 2.756   1.00 19.57  ? 464 GLU D OE2   1 
ATOM   6773  N  N     . LEU F 3 169 ? 138.441 -33.233 5.009   1.00 20.43  ? 465 LEU D N     1 
ATOM   6774  C  CA    . LEU F 3 169 ? 137.041 -32.814 4.874   1.00 20.74  ? 465 LEU D CA    1 
ATOM   6775  C  C     . LEU F 3 169 ? 136.488 -32.508 6.261   1.00 21.13  ? 465 LEU D C     1 
ATOM   6776  O  O     . LEU F 3 169 ? 135.881 -31.461 6.484   1.00 20.91  ? 465 LEU D O     1 
ATOM   6777  C  CB    . LEU F 3 169 ? 136.192 -33.895 4.191   1.00 20.46  ? 465 LEU D CB    1 
ATOM   6778  C  CG    . LEU F 3 169 ? 136.432 -34.158 2.696   1.00 20.29  ? 465 LEU D CG    1 
ATOM   6779  C  CD1   . LEU F 3 169 ? 135.819 -35.475 2.264   1.00 18.67  ? 465 LEU D CD1   1 
ATOM   6780  C  CD2   . LEU F 3 169 ? 135.911 -33.008 1.836   1.00 19.68  ? 465 LEU D CD2   1 
ATOM   6781  N  N     . ARG F 3 170 ? 136.730 -33.424 7.195   1.00 21.75  ? 466 ARG D N     1 
ATOM   6782  C  CA    . ARG F 3 170 ? 136.263 -33.276 8.563   1.00 22.53  ? 466 ARG D CA    1 
ATOM   6783  C  C     . ARG F 3 170 ? 136.733 -31.956 9.190   1.00 22.48  ? 466 ARG D C     1 
ATOM   6784  O  O     . ARG F 3 170 ? 135.935 -31.234 9.801   1.00 22.62  ? 466 ARG D O     1 
ATOM   6785  C  CB    . ARG F 3 170 ? 136.714 -34.473 9.379   1.00 22.78  ? 466 ARG D CB    1 
ATOM   6786  C  CG    . ARG F 3 170 ? 136.294 -34.458 10.822  1.00 26.02  ? 466 ARG D CG    1 
ATOM   6787  C  CD    . ARG F 3 170 ? 136.953 -35.630 11.558  1.00 32.61  ? 466 ARG D CD    1 
ATOM   6788  N  NE    . ARG F 3 170 ? 138.368 -35.826 11.192  1.00 37.89  ? 466 ARG D NE    1 
ATOM   6789  C  CZ    . ARG F 3 170 ? 139.395 -35.071 11.616  1.00 40.33  ? 466 ARG D CZ    1 
ATOM   6790  N  NH1   . ARG F 3 170 ? 139.196 -34.030 12.427  1.00 41.44  ? 466 ARG D NH1   1 
ATOM   6791  N  NH2   . ARG F 3 170 ? 140.634 -35.350 11.216  1.00 40.73  ? 466 ARG D NH2   1 
ATOM   6792  N  N     . ARG F 3 171 ? 138.014 -31.631 9.014   1.00 22.27  ? 467 ARG D N     1 
ATOM   6793  C  CA    . ARG F 3 171 ? 138.563 -30.372 9.507   1.00 22.26  ? 467 ARG D CA    1 
ATOM   6794  C  C     . ARG F 3 171 ? 137.901 -29.157 8.868   1.00 21.55  ? 467 ARG D C     1 
ATOM   6795  O  O     . ARG F 3 171 ? 137.838 -28.094 9.485   1.00 21.50  ? 467 ARG D O     1 
ATOM   6796  C  CB    . ARG F 3 171 ? 140.069 -30.287 9.243   1.00 22.81  ? 467 ARG D CB    1 
ATOM   6797  C  CG    . ARG F 3 171 ? 140.933 -31.113 10.169  1.00 25.02  ? 467 ARG D CG    1 
ATOM   6798  C  CD    . ARG F 3 171 ? 142.389 -30.661 10.102  1.00 28.01  ? 467 ARG D CD    1 
ATOM   6799  N  NE    . ARG F 3 171 ? 142.967 -30.754 8.759   1.00 30.64  ? 467 ARG D NE    1 
ATOM   6800  C  CZ    . ARG F 3 171 ? 143.506 -31.866 8.253   1.00 31.47  ? 467 ARG D CZ    1 
ATOM   6801  N  NH1   . ARG F 3 171 ? 143.515 -32.983 8.974   1.00 32.37  ? 467 ARG D NH1   1 
ATOM   6802  N  NH2   . ARG F 3 171 ? 144.032 -31.868 7.031   1.00 30.11  ? 467 ARG D NH2   1 
ATOM   6803  N  N     . ASN F 3 172 ? 137.434 -29.319 7.629   1.00 20.76  ? 468 ASN D N     1 
ATOM   6804  C  CA    . ASN F 3 172 ? 136.823 -28.236 6.868   1.00 20.12  ? 468 ASN D CA    1 
ATOM   6805  C  C     . ASN F 3 172 ? 135.312 -28.118 7.045   1.00 19.65  ? 468 ASN D C     1 
ATOM   6806  O  O     . ASN F 3 172 ? 134.669 -27.268 6.414   1.00 19.26  ? 468 ASN D O     1 
ATOM   6807  C  CB    . ASN F 3 172 ? 137.136 -28.401 5.381   1.00 20.62  ? 468 ASN D CB    1 
ATOM   6808  C  CG    . ASN F 3 172 ? 138.498 -27.843 4.997   1.00 21.28  ? 468 ASN D CG    1 
ATOM   6809  O  OD1   . ASN F 3 172 ? 139.258 -27.379 5.851   1.00 22.45  ? 468 ASN D OD1   1 
ATOM   6810  N  ND2   . ASN F 3 172 ? 138.807 -27.880 3.702   1.00 20.95  ? 468 ASN D ND2   1 
ATOM   6811  N  N     . GLU F 3 173 ? 134.757 -28.971 7.904   1.00 18.85  ? 469 GLU D N     1 
ATOM   6812  C  CA    . GLU F 3 173 ? 133.324 -29.056 8.111   1.00 18.18  ? 469 GLU D CA    1 
ATOM   6813  C  C     . GLU F 3 173 ? 132.655 -29.436 6.792   1.00 17.59  ? 469 GLU D C     1 
ATOM   6814  O  O     . GLU F 3 173 ? 131.558 -28.988 6.470   1.00 17.16  ? 469 GLU D O     1 
ATOM   6815  C  CB    . GLU F 3 173 ? 132.769 -27.752 8.685   1.00 18.43  ? 469 GLU D CB    1 
ATOM   6816  C  CG    . GLU F 3 173 ? 131.520 -27.961 9.531   1.00 20.39  ? 469 GLU D CG    1 
ATOM   6817  C  CD    . GLU F 3 173 ? 131.738 -28.930 10.703  1.00 22.55  ? 469 GLU D CD    1 
ATOM   6818  O  OE1   . GLU F 3 173 ? 130.774 -29.630 11.084  1.00 24.85  ? 469 GLU D OE1   1 
ATOM   6819  O  OE2   . GLU F 3 173 ? 132.865 -29.006 11.242  1.00 23.20  ? 469 GLU D OE2   1 
ATOM   6820  N  N     . GLN F 3 174 ? 133.339 -30.292 6.039   1.00 17.48  ? 470 GLN D N     1 
ATOM   6821  C  CA    . GLN F 3 174 ? 132.862 -30.761 4.744   1.00 17.30  ? 470 GLN D CA    1 
ATOM   6822  C  C     . GLN F 3 174 ? 132.531 -32.248 4.701   1.00 17.56  ? 470 GLN D C     1 
ATOM   6823  O  O     . GLN F 3 174 ? 132.200 -32.770 3.639   1.00 17.33  ? 470 GLN D O     1 
ATOM   6824  C  CB    . GLN F 3 174 ? 133.885 -30.433 3.657   1.00 17.30  ? 470 GLN D CB    1 
ATOM   6825  C  CG    . GLN F 3 174 ? 133.817 -29.006 3.157   1.00 17.11  ? 470 GLN D CG    1 
ATOM   6826  C  CD    . GLN F 3 174 ? 134.923 -28.666 2.172   1.00 16.64  ? 470 GLN D CD    1 
ATOM   6827  O  OE1   . GLN F 3 174 ? 135.962 -29.317 2.142   1.00 15.12  ? 470 GLN D OE1   1 
ATOM   6828  N  NE2   . GLN F 3 174 ? 134.711 -27.619 1.381   1.00 15.13  ? 470 GLN D NE2   1 
ATOM   6829  N  N     . ASP F 3 175 ? 132.600 -32.924 5.847   1.00 18.08  ? 471 ASP D N     1 
ATOM   6830  C  CA    . ASP F 3 175 ? 132.342 -34.377 5.906   1.00 18.70  ? 471 ASP D CA    1 
ATOM   6831  C  C     . ASP F 3 175 ? 130.876 -34.772 5.672   1.00 18.60  ? 471 ASP D C     1 
ATOM   6832  O  O     . ASP F 3 175 ? 130.608 -35.817 5.073   1.00 18.95  ? 471 ASP D O     1 
ATOM   6833  C  CB    . ASP F 3 175 ? 132.890 -35.002 7.197   1.00 19.00  ? 471 ASP D CB    1 
ATOM   6834  C  CG    . ASP F 3 175 ? 132.316 -34.364 8.463   1.00 21.32  ? 471 ASP D CG    1 
ATOM   6835  O  OD1   . ASP F 3 175 ? 132.094 -33.125 8.511   1.00 22.95  ? 471 ASP D OD1   1 
ATOM   6836  O  OD2   . ASP F 3 175 ? 132.100 -35.114 9.435   1.00 24.24  ? 471 ASP D OD2   1 
ATOM   6837  N  N     . ARG F 3 176 ? 129.932 -33.952 6.134   1.00 18.19  ? 472 ARG D N     1 
ATOM   6838  C  CA    . ARG F 3 176 ? 128.522 -34.201 5.828   1.00 18.23  ? 472 ARG D CA    1 
ATOM   6839  C  C     . ARG F 3 176 ? 128.215 -33.788 4.382   1.00 17.24  ? 472 ARG D C     1 
ATOM   6840  O  O     . ARG F 3 176 ? 127.358 -34.357 3.724   1.00 17.01  ? 472 ARG D O     1 
ATOM   6841  C  CB    . ARG F 3 176 ? 127.596 -33.475 6.809   1.00 18.87  ? 472 ARG D CB    1 
ATOM   6842  C  CG    . ARG F 3 176 ? 127.627 -34.037 8.227   1.00 21.86  ? 472 ARG D CG    1 
ATOM   6843  C  CD    . ARG F 3 176 ? 127.075 -33.032 9.236   1.00 27.53  ? 472 ARG D CD    1 
ATOM   6844  N  NE    . ARG F 3 176 ? 125.614 -33.040 9.259   1.00 33.08  ? 472 ARG D NE    1 
ATOM   6845  C  CZ    . ARG F 3 176 ? 124.882 -33.768 10.106  1.00 34.89  ? 472 ARG D CZ    1 
ATOM   6846  N  NH1   . ARG F 3 176 ? 125.481 -34.538 11.012  1.00 35.90  ? 472 ARG D NH1   1 
ATOM   6847  N  NH2   . ARG F 3 176 ? 123.552 -33.722 10.058  1.00 34.90  ? 472 ARG D NH2   1 
ATOM   6848  N  N     . LEU F 3 177 ? 128.947 -32.807 3.879   1.00 16.44  ? 473 LEU D N     1 
ATOM   6849  C  CA    . LEU F 3 177 ? 128.735 -32.324 2.524   1.00 15.41  ? 473 LEU D CA    1 
ATOM   6850  C  C     . LEU F 3 177 ? 128.976 -33.457 1.508   1.00 14.97  ? 473 LEU D C     1 
ATOM   6851  O  O     . LEU F 3 177 ? 128.192 -33.659 0.592   1.00 14.10  ? 473 LEU D O     1 
ATOM   6852  C  CB    . LEU F 3 177 ? 129.661 -31.131 2.265   1.00 15.38  ? 473 LEU D CB    1 
ATOM   6853  C  CG    . LEU F 3 177 ? 129.453 -30.337 0.983   1.00 14.82  ? 473 LEU D CG    1 
ATOM   6854  C  CD1   . LEU F 3 177 ? 128.024 -29.905 0.927   1.00 13.35  ? 473 LEU D CD1   1 
ATOM   6855  C  CD2   . LEU F 3 177 ? 130.393 -29.130 0.924   1.00 14.61  ? 473 LEU D CD2   1 
ATOM   6856  N  N     . LEU F 3 178 ? 130.066 -34.193 1.704   1.00 14.75  ? 474 LEU D N     1 
ATOM   6857  C  CA    . LEU F 3 178 ? 130.418 -35.312 0.847   1.00 14.72  ? 474 LEU D CA    1 
ATOM   6858  C  C     . LEU F 3 178 ? 129.468 -36.482 1.037   1.00 14.91  ? 474 LEU D C     1 
ATOM   6859  O  O     . LEU F 3 178 ? 128.865 -36.942 0.082   1.00 15.00  ? 474 LEU D O     1 
ATOM   6860  C  CB    . LEU F 3 178 ? 131.851 -35.788 1.120   1.00 14.18  ? 474 LEU D CB    1 
ATOM   6861  C  CG    . LEU F 3 178 ? 132.157 -37.121 0.431   1.00 14.29  ? 474 LEU D CG    1 
ATOM   6862  C  CD1   . LEU F 3 178 ? 132.295 -36.931 -1.080  1.00 14.01  ? 474 LEU D CD1   1 
ATOM   6863  C  CD2   . LEU F 3 178 ? 133.387 -37.802 1.018   1.00 13.05  ? 474 LEU D CD2   1 
ATOM   6864  N  N     . VAL F 3 179 ? 129.335 -36.946 2.276   1.00 15.38  ? 475 VAL D N     1 
ATOM   6865  C  CA    . VAL F 3 179 ? 128.593 -38.166 2.572   1.00 15.84  ? 475 VAL D CA    1 
ATOM   6866  C  C     . VAL F 3 179 ? 127.070 -38.040 2.527   1.00 16.40  ? 475 VAL D C     1 
ATOM   6867  O  O     . VAL F 3 179 ? 126.372 -39.012 2.211   1.00 16.20  ? 475 VAL D O     1 
ATOM   6868  C  CB    . VAL F 3 179 ? 129.066 -38.777 3.922   1.00 15.89  ? 475 VAL D CB    1 
ATOM   6869  C  CG1   . VAL F 3 179 ? 127.945 -39.489 4.634   1.00 15.87  ? 475 VAL D CG1   1 
ATOM   6870  C  CG2   . VAL F 3 179 ? 130.271 -39.719 3.697   1.00 16.02  ? 475 VAL D CG2   1 
ATOM   6871  N  N     . GLU F 3 180 ? 126.551 -36.845 2.817   1.00 16.77  ? 476 GLU D N     1 
ATOM   6872  C  CA    . GLU F 3 180 ? 125.097 -36.656 2.875   1.00 17.08  ? 476 GLU D CA    1 
ATOM   6873  C  C     . GLU F 3 180 ? 124.496 -35.855 1.730   1.00 16.77  ? 476 GLU D C     1 
ATOM   6874  O  O     . GLU F 3 180 ? 123.298 -35.952 1.479   1.00 17.18  ? 476 GLU D O     1 
ATOM   6875  C  CB    . GLU F 3 180 ? 124.673 -36.107 4.235   1.00 17.03  ? 476 GLU D CB    1 
ATOM   6876  C  CG    . GLU F 3 180 ? 125.079 -37.067 5.336   1.00 20.23  ? 476 GLU D CG    1 
ATOM   6877  C  CD    . GLU F 3 180 ? 124.858 -36.543 6.744   1.00 24.13  ? 476 GLU D CD    1 
ATOM   6878  O  OE1   . GLU F 3 180 ? 125.063 -37.343 7.690   1.00 24.92  ? 476 GLU D OE1   1 
ATOM   6879  O  OE2   . GLU F 3 180 ? 124.495 -35.352 6.911   1.00 25.72  ? 476 GLU D OE2   1 
ATOM   6880  N  N     . LEU F 3 181 ? 125.313 -35.079 1.029   1.00 16.40  ? 477 LEU D N     1 
ATOM   6881  C  CA    . LEU F 3 181 ? 124.803 -34.326 -0.118  1.00 16.04  ? 477 LEU D CA    1 
ATOM   6882  C  C     . LEU F 3 181 ? 125.378 -34.888 -1.428  1.00 15.88  ? 477 LEU D C     1 
ATOM   6883  O  O     . LEU F 3 181 ? 124.706 -35.618 -2.163  1.00 15.43  ? 477 LEU D O     1 
ATOM   6884  C  CB    . LEU F 3 181 ? 125.101 -32.829 0.017   1.00 15.34  ? 477 LEU D CB    1 
ATOM   6885  C  CG    . LEU F 3 181 ? 124.428 -31.855 -0.962  1.00 15.74  ? 477 LEU D CG    1 
ATOM   6886  C  CD1   . LEU F 3 181 ? 122.964 -31.640 -0.658  1.00 14.88  ? 477 LEU D CD1   1 
ATOM   6887  C  CD2   . LEU F 3 181 ? 125.113 -30.505 -0.964  1.00 16.05  ? 477 LEU D CD2   1 
ATOM   6888  N  N     . GLU F 3 182 ? 126.634 -34.559 -1.698  1.00 15.48  ? 478 GLU D N     1 
ATOM   6889  C  CA    . GLU F 3 182 ? 127.250 -34.916 -2.967  1.00 15.55  ? 478 GLU D CA    1 
ATOM   6890  C  C     . GLU F 3 182 ? 127.158 -36.402 -3.334  1.00 15.07  ? 478 GLU D C     1 
ATOM   6891  O  O     . GLU F 3 182 ? 126.801 -36.724 -4.446  1.00 14.69  ? 478 GLU D O     1 
ATOM   6892  C  CB    . GLU F 3 182 ? 128.701 -34.411 -3.047  1.00 15.45  ? 478 GLU D CB    1 
ATOM   6893  C  CG    . GLU F 3 182 ? 128.866 -32.907 -2.894  1.00 15.60  ? 478 GLU D CG    1 
ATOM   6894  C  CD    . GLU F 3 182 ? 128.149 -32.083 -3.966  1.00 15.87  ? 478 GLU D CD    1 
ATOM   6895  O  OE1   . GLU F 3 182 ? 127.507 -32.669 -4.856  1.00 15.10  ? 478 GLU D OE1   1 
ATOM   6896  O  OE2   . GLU F 3 182 ? 128.234 -30.831 -3.913  1.00 16.63  ? 478 GLU D OE2   1 
ATOM   6897  N  N     . GLN F 3 183 ? 127.464 -37.298 -2.405  1.00 15.08  ? 479 GLN D N     1 
ATOM   6898  C  CA    . GLN F 3 183 ? 127.406 -38.732 -2.722  1.00 15.11  ? 479 GLN D CA    1 
ATOM   6899  C  C     . GLN F 3 183 ? 125.986 -39.231 -3.007  1.00 14.98  ? 479 GLN D C     1 
ATOM   6900  O  O     . GLN F 3 183 ? 125.747 -39.773 -4.088  1.00 15.36  ? 479 GLN D O     1 
ATOM   6901  C  CB    . GLN F 3 183 ? 128.149 -39.588 -1.693  1.00 14.74  ? 479 GLN D CB    1 
ATOM   6902  C  CG    . GLN F 3 183 ? 129.626 -39.381 -1.792  1.00 14.67  ? 479 GLN D CG    1 
ATOM   6903  C  CD    . GLN F 3 183 ? 130.428 -40.225 -0.843  1.00 16.33  ? 479 GLN D CD    1 
ATOM   6904  O  OE1   . GLN F 3 183 ? 131.662 -40.277 -0.946  1.00 17.18  ? 479 GLN D OE1   1 
ATOM   6905  N  NE2   . GLN F 3 183 ? 129.750 -40.893 0.094   1.00 15.72  ? 479 GLN D NE2   1 
ATOM   6906  N  N     . PRO F 3 184 ? 125.046 -39.060 -2.051  1.00 14.59  ? 480 PRO D N     1 
ATOM   6907  C  CA    . PRO F 3 184 ? 123.655 -39.389 -2.369  1.00 14.33  ? 480 PRO D CA    1 
ATOM   6908  C  C     . PRO F 3 184 ? 123.205 -38.781 -3.707  1.00 14.35  ? 480 PRO D C     1 
ATOM   6909  O  O     . PRO F 3 184 ? 122.567 -39.463 -4.519  1.00 14.49  ? 480 PRO D O     1 
ATOM   6910  C  CB    . PRO F 3 184 ? 122.884 -38.768 -1.209  1.00 14.01  ? 480 PRO D CB    1 
ATOM   6911  C  CG    . PRO F 3 184 ? 123.822 -38.851 -0.080  1.00 13.82  ? 480 PRO D CG    1 
ATOM   6912  C  CD    . PRO F 3 184 ? 125.188 -38.626 -0.649  1.00 14.47  ? 480 PRO D CD    1 
ATOM   6913  N  N     . LEU F 3 185 ? 123.552 -37.523 -3.952  1.00 14.00  ? 481 LEU D N     1 
ATOM   6914  C  CA    . LEU F 3 185 ? 123.165 -36.889 -5.206  1.00 13.76  ? 481 LEU D CA    1 
ATOM   6915  C  C     . LEU F 3 185 ? 123.672 -37.686 -6.395  1.00 13.72  ? 481 LEU D C     1 
ATOM   6916  O  O     . LEU F 3 185 ? 122.968 -37.854 -7.390  1.00 13.77  ? 481 LEU D O     1 
ATOM   6917  C  CB    . LEU F 3 185 ? 123.679 -35.453 -5.288  1.00 13.39  ? 481 LEU D CB    1 
ATOM   6918  C  CG    . LEU F 3 185 ? 123.251 -34.694 -6.542  1.00 13.61  ? 481 LEU D CG    1 
ATOM   6919  C  CD1   . LEU F 3 185 ? 121.752 -34.601 -6.649  1.00 12.27  ? 481 LEU D CD1   1 
ATOM   6920  C  CD2   . LEU F 3 185 ? 123.852 -33.315 -6.539  1.00 14.72  ? 481 LEU D CD2   1 
ATOM   6921  N  N     . SER F 3 186 ? 124.896 -38.185 -6.279  1.00 13.74  ? 482 SER D N     1 
ATOM   6922  C  CA    . SER F 3 186 ? 125.537 -38.907 -7.371  1.00 13.88  ? 482 SER D CA    1 
ATOM   6923  C  C     . SER F 3 186 ? 124.625 -40.001 -7.935  1.00 13.57  ? 482 SER D C     1 
ATOM   6924  O  O     . SER F 3 186 ? 124.501 -40.149 -9.148  1.00 13.53  ? 482 SER D O     1 
ATOM   6925  C  CB    . SER F 3 186 ? 126.872 -39.477 -6.901  1.00 13.85  ? 482 SER D CB    1 
ATOM   6926  O  OG    . SER F 3 186 ? 127.606 -39.978 -7.993  1.00 15.22  ? 482 SER D OG    1 
ATOM   6927  N  N     . SER F 3 187 ? 123.980 -40.750 -7.042  1.00 13.49  ? 483 SER D N     1 
ATOM   6928  C  CA    . SER F 3 187 ? 123.015 -41.785 -7.427  1.00 13.27  ? 483 SER D CA    1 
ATOM   6929  C  C     . SER F 3 187 ? 121.757 -41.270 -8.125  1.00 13.08  ? 483 SER D C     1 
ATOM   6930  O  O     . SER F 3 187 ? 121.302 -41.871 -9.111  1.00 13.36  ? 483 SER D O     1 
ATOM   6931  C  CB    . SER F 3 187 ? 122.626 -42.609 -6.215  1.00 13.06  ? 483 SER D CB    1 
ATOM   6932  O  OG    . SER F 3 187 ? 123.706 -43.453 -5.879  1.00 13.77  ? 483 SER D OG    1 
ATOM   6933  N  N     . ILE F 3 188 ? 121.202 -40.170 -7.615  1.00 12.48  ? 484 ILE D N     1 
ATOM   6934  C  CA    . ILE F 3 188 ? 120.015 -39.561 -8.205  1.00 11.91  ? 484 ILE D CA    1 
ATOM   6935  C  C     . ILE F 3 188 ? 120.299 -39.103 -9.636  1.00 11.98  ? 484 ILE D C     1 
ATOM   6936  O  O     . ILE F 3 188 ? 119.529 -39.396 -10.551 1.00 12.37  ? 484 ILE D O     1 
ATOM   6937  C  CB    . ILE F 3 188 ? 119.494 -38.419 -7.332  1.00 11.68  ? 484 ILE D CB    1 
ATOM   6938  C  CG1   . ILE F 3 188 ? 119.076 -38.989 -5.967  1.00 12.22  ? 484 ILE D CG1   1 
ATOM   6939  C  CG2   . ILE F 3 188 ? 118.333 -37.744 -7.998  1.00 10.98  ? 484 ILE D CG2   1 
ATOM   6940  C  CD1   . ILE F 3 188 ? 118.886 -37.961 -4.868  1.00 11.23  ? 484 ILE D CD1   1 
ATOM   6941  N  N     . LEU F 3 189 ? 121.424 -38.421 -9.828  1.00 11.68  ? 485 LEU D N     1 
ATOM   6942  C  CA    . LEU F 3 189 ? 121.845 -37.987 -11.151 1.00 11.53  ? 485 LEU D CA    1 
ATOM   6943  C  C     . LEU F 3 189 ? 121.983 -39.183 -12.088 1.00 11.78  ? 485 LEU D C     1 
ATOM   6944  O  O     . LEU F 3 189 ? 121.466 -39.161 -13.208 1.00 11.61  ? 485 LEU D O     1 
ATOM   6945  C  CB    . LEU F 3 189 ? 123.161 -37.213 -11.075 1.00 11.30  ? 485 LEU D CB    1 
ATOM   6946  C  CG    . LEU F 3 189 ? 123.091 -35.851 -10.378 1.00 11.44  ? 485 LEU D CG    1 
ATOM   6947  C  CD1   . LEU F 3 189 ? 124.492 -35.300 -10.075 1.00 10.41  ? 485 LEU D CD1   1 
ATOM   6948  C  CD2   . LEU F 3 189 ? 122.259 -34.857 -11.203 1.00 8.74   ? 485 LEU D CD2   1 
ATOM   6949  N  N     . ALA F 3 190 ? 122.660 -40.231 -11.620 1.00 11.90  ? 486 ALA D N     1 
ATOM   6950  C  CA    . ALA F 3 190 ? 122.845 -41.429 -12.420 1.00 12.29  ? 486 ALA D CA    1 
ATOM   6951  C  C     . ALA F 3 190 ? 121.506 -41.985 -12.916 1.00 13.06  ? 486 ALA D C     1 
ATOM   6952  O  O     . ALA F 3 190 ? 121.397 -42.415 -14.063 1.00 12.46  ? 486 ALA D O     1 
ATOM   6953  C  CB    . ALA F 3 190 ? 123.618 -42.482 -11.634 1.00 12.45  ? 486 ALA D CB    1 
ATOM   6954  N  N     . GLU F 3 191 ? 120.482 -41.961 -12.067 1.00 14.23  ? 487 GLU D N     1 
ATOM   6955  C  CA    . GLU F 3 191 ? 119.164 -42.418 -12.500 1.00 16.26  ? 487 GLU D CA    1 
ATOM   6956  C  C     . GLU F 3 191 ? 118.604 -41.507 -13.587 1.00 15.84  ? 487 GLU D C     1 
ATOM   6957  O  O     . GLU F 3 191 ? 118.084 -41.980 -14.604 1.00 16.26  ? 487 GLU D O     1 
ATOM   6958  C  CB    . GLU F 3 191 ? 118.185 -42.542 -11.332 1.00 16.01  ? 487 GLU D CB    1 
ATOM   6959  C  CG    . GLU F 3 191 ? 118.402 -43.791 -10.473 1.00 18.14  ? 487 GLU D CG    1 
ATOM   6960  C  CD    . GLU F 3 191 ? 117.611 -43.754 -9.153  1.00 19.57  ? 487 GLU D CD    1 
ATOM   6961  O  OE1   . GLU F 3 191 ? 117.009 -42.691 -8.835  1.00 22.70  ? 487 GLU D OE1   1 
ATOM   6962  O  OE2   . GLU F 3 191 ? 117.595 -44.791 -8.427  1.00 23.90  ? 487 GLU D OE2   1 
ATOM   6963  N  N     . MET F 3 192 ? 118.747 -40.203 -13.394 1.00 15.56  ? 488 MET D N     1 
ATOM   6964  C  CA    . MET F 3 192 ? 118.247 -39.249 -14.378 1.00 15.26  ? 488 MET D CA    1 
ATOM   6965  C  C     . MET F 3 192 ? 118.939 -39.446 -15.714 1.00 15.03  ? 488 MET D C     1 
ATOM   6966  O  O     . MET F 3 192 ? 118.290 -39.612 -16.731 1.00 15.11  ? 488 MET D O     1 
ATOM   6967  C  CB    . MET F 3 192 ? 118.413 -37.835 -13.851 1.00 14.85  ? 488 MET D CB    1 
ATOM   6968  C  CG    . MET F 3 192 ? 117.847 -37.727 -12.440 1.00 15.18  ? 488 MET D CG    1 
ATOM   6969  S  SD    . MET F 3 192 ? 118.276 -36.210 -11.577 1.00 15.90  ? 488 MET D SD    1 
ATOM   6970  C  CE    . MET F 3 192 ? 117.755 -34.982 -12.761 1.00 14.75  ? 488 MET D CE    1 
ATOM   6971  N  N     . GLU F 3 193 ? 120.262 -39.475 -15.703 1.00 15.17  ? 489 GLU D N     1 
ATOM   6972  C  CA    . GLU F 3 193 ? 121.015 -39.654 -16.934 1.00 15.18  ? 489 GLU D CA    1 
ATOM   6973  C  C     . GLU F 3 193 ? 120.578 -40.922 -17.661 1.00 15.42  ? 489 GLU D C     1 
ATOM   6974  O  O     . GLU F 3 193 ? 120.375 -40.909 -18.877 1.00 15.74  ? 489 GLU D O     1 
ATOM   6975  C  CB    . GLU F 3 193 ? 122.519 -39.662 -16.647 1.00 15.05  ? 489 GLU D CB    1 
ATOM   6976  C  CG    . GLU F 3 193 ? 123.009 -38.367 -15.996 1.00 15.09  ? 489 GLU D CG    1 
ATOM   6977  C  CD    . GLU F 3 193 ? 124.489 -38.388 -15.644 1.00 15.31  ? 489 GLU D CD    1 
ATOM   6978  O  OE1   . GLU F 3 193 ? 125.031 -37.311 -15.309 1.00 14.30  ? 489 GLU D OE1   1 
ATOM   6979  O  OE2   . GLU F 3 193 ? 125.113 -39.473 -15.706 1.00 14.90  ? 489 GLU D OE2   1 
ATOM   6980  N  N     . PHE F 3 194 ? 120.402 -42.009 -16.911 1.00 15.37  ? 490 PHE D N     1 
ATOM   6981  C  CA    . PHE F 3 194 ? 119.996 -43.277 -17.496 1.00 15.05  ? 490 PHE D CA    1 
ATOM   6982  C  C     . PHE F 3 194 ? 118.569 -43.232 -18.027 1.00 15.21  ? 490 PHE D C     1 
ATOM   6983  O  O     . PHE F 3 194 ? 118.263 -43.841 -19.046 1.00 15.88  ? 490 PHE D O     1 
ATOM   6984  C  CB    . PHE F 3 194 ? 120.130 -44.418 -16.482 1.00 14.65  ? 490 PHE D CB    1 
ATOM   6985  C  CG    . PHE F 3 194 ? 119.837 -45.779 -17.062 1.00 14.04  ? 490 PHE D CG    1 
ATOM   6986  C  CD1   . PHE F 3 194 ? 120.720 -46.369 -17.974 1.00 13.34  ? 490 PHE D CD1   1 
ATOM   6987  C  CD2   . PHE F 3 194 ? 118.691 -46.471 -16.705 1.00 11.62  ? 490 PHE D CD2   1 
ATOM   6988  C  CE1   . PHE F 3 194 ? 120.456 -47.629 -18.516 1.00 13.08  ? 490 PHE D CE1   1 
ATOM   6989  C  CE2   . PHE F 3 194 ? 118.427 -47.728 -17.238 1.00 10.90  ? 490 PHE D CE2   1 
ATOM   6990  C  CZ    . PHE F 3 194 ? 119.310 -48.310 -18.137 1.00 12.22  ? 490 PHE D CZ    1 
ATOM   6991  N  N     . ALA F 3 195 ? 117.690 -42.530 -17.332 1.00 15.08  ? 491 ALA D N     1 
ATOM   6992  C  CA    . ALA F 3 195 ? 116.301 -42.450 -17.769 1.00 14.97  ? 491 ALA D CA    1 
ATOM   6993  C  C     . ALA F 3 195 ? 116.172 -41.632 -19.051 1.00 15.19  ? 491 ALA D C     1 
ATOM   6994  O  O     . ALA F 3 195 ? 115.388 -41.968 -19.927 1.00 15.54  ? 491 ALA D O     1 
ATOM   6995  C  CB    . ALA F 3 195 ? 115.430 -41.857 -16.668 1.00 14.50  ? 491 ALA D CB    1 
ATOM   6996  N  N     . GLY F 3 196 ? 116.941 -40.551 -19.153 1.00 15.45  ? 492 GLY D N     1 
ATOM   6997  C  CA    . GLY F 3 196 ? 116.870 -39.663 -20.310 1.00 15.55  ? 492 GLY D CA    1 
ATOM   6998  C  C     . GLY F 3 196 ? 115.544 -38.923 -20.454 1.00 15.57  ? 492 GLY D C     1 
ATOM   6999  O  O     . GLY F 3 196 ? 114.605 -39.128 -19.679 1.00 15.46  ? 492 GLY D O     1 
ATOM   7000  N  N     . VAL F 3 197 ? 115.480 -38.051 -21.451 1.00 15.48  ? 493 VAL D N     1 
ATOM   7001  C  CA    . VAL F 3 197 ? 114.259 -37.351 -21.792 1.00 15.69  ? 493 VAL D CA    1 
ATOM   7002  C  C     . VAL F 3 197 ? 113.871 -37.790 -23.193 1.00 16.15  ? 493 VAL D C     1 
ATOM   7003  O  O     . VAL F 3 197 ? 114.724 -37.928 -24.060 1.00 15.72  ? 493 VAL D O     1 
ATOM   7004  C  CB    . VAL F 3 197 ? 114.456 -35.814 -21.767 1.00 15.82  ? 493 VAL D CB    1 
ATOM   7005  C  CG1   . VAL F 3 197 ? 113.136 -35.100 -22.050 1.00 15.06  ? 493 VAL D CG1   1 
ATOM   7006  C  CG2   . VAL F 3 197 ? 115.019 -35.373 -20.417 1.00 15.02  ? 493 VAL D CG2   1 
ATOM   7007  N  N     . LYS F 3 198 ? 112.583 -38.018 -23.413 1.00 17.30  ? 494 LYS D N     1 
ATOM   7008  C  CA    . LYS F 3 198 ? 112.102 -38.465 -24.720 1.00 18.05  ? 494 LYS D CA    1 
ATOM   7009  C  C     . LYS F 3 198 ? 111.899 -37.276 -25.642 1.00 18.44  ? 494 LYS D C     1 
ATOM   7010  O  O     . LYS F 3 198 ? 111.385 -36.243 -25.230 1.00 18.44  ? 494 LYS D O     1 
ATOM   7011  C  CB    . LYS F 3 198 ? 110.817 -39.285 -24.574 1.00 17.94  ? 494 LYS D CB    1 
ATOM   7012  C  CG    . LYS F 3 198 ? 110.410 -40.057 -25.818 1.00 18.87  ? 494 LYS D CG    1 
ATOM   7013  C  CD    . LYS F 3 198 ? 109.125 -40.774 -25.546 1.00 21.46  ? 494 LYS D CD    1 
ATOM   7014  C  CE    . LYS F 3 198 ? 108.308 -41.051 -26.807 1.00 23.61  ? 494 LYS D CE    1 
ATOM   7015  N  NZ    . LYS F 3 198 ? 108.648 -42.342 -27.465 1.00 25.24  ? 494 LYS D NZ    1 
ATOM   7016  N  N     . VAL F 3 199 ? 112.325 -37.422 -26.891 1.00 19.59  ? 495 VAL D N     1 
ATOM   7017  C  CA    . VAL F 3 199 ? 112.252 -36.331 -27.857 1.00 20.36  ? 495 VAL D CA    1 
ATOM   7018  C  C     . VAL F 3 199 ? 111.374 -36.692 -29.043 1.00 21.30  ? 495 VAL D C     1 
ATOM   7019  O  O     . VAL F 3 199 ? 111.456 -37.788 -29.591 1.00 21.17  ? 495 VAL D O     1 
ATOM   7020  C  CB    . VAL F 3 199 ? 113.657 -35.879 -28.350 1.00 20.26  ? 495 VAL D CB    1 
ATOM   7021  C  CG1   . VAL F 3 199 ? 113.530 -34.720 -29.333 1.00 19.48  ? 495 VAL D CG1   1 
ATOM   7022  C  CG2   . VAL F 3 199 ? 114.518 -35.450 -27.183 1.00 19.31  ? 495 VAL D CG2   1 
ATOM   7023  N  N     . ASP F 3 200 ? 110.518 -35.754 -29.426 1.00 22.66  ? 496 ASP D N     1 
ATOM   7024  C  CA    . ASP F 3 200 ? 109.625 -35.953 -30.549 1.00 23.95  ? 496 ASP D CA    1 
ATOM   7025  C  C     . ASP F 3 200 ? 110.336 -35.421 -31.785 1.00 24.85  ? 496 ASP D C     1 
ATOM   7026  O  O     . ASP F 3 200 ? 110.268 -34.233 -32.102 1.00 24.76  ? 496 ASP D O     1 
ATOM   7027  C  CB    . ASP F 3 200 ? 108.306 -35.239 -30.281 1.00 23.96  ? 496 ASP D CB    1 
ATOM   7028  C  CG    . ASP F 3 200 ? 107.344 -35.332 -31.435 1.00 24.49  ? 496 ASP D CG    1 
ATOM   7029  O  OD1   . ASP F 3 200 ? 107.690 -35.958 -32.466 1.00 25.29  ? 496 ASP D OD1   1 
ATOM   7030  O  OD2   . ASP F 3 200 ? 106.243 -34.761 -31.305 1.00 23.68  ? 496 ASP D OD2   1 
ATOM   7031  N  N     . THR F 3 201 ? 111.023 -36.330 -32.471 1.00 26.17  ? 497 THR D N     1 
ATOM   7032  C  CA    . THR F 3 201 ? 111.875 -35.987 -33.610 1.00 27.11  ? 497 THR D CA    1 
ATOM   7033  C  C     . THR F 3 201 ? 111.133 -35.432 -34.814 1.00 27.91  ? 497 THR D C     1 
ATOM   7034  O  O     . THR F 3 201 ? 111.633 -34.548 -35.502 1.00 27.95  ? 497 THR D O     1 
ATOM   7035  C  CB    . THR F 3 201 ? 112.731 -37.180 -34.043 1.00 26.92  ? 497 THR D CB    1 
ATOM   7036  O  OG1   . THR F 3 201 ? 111.881 -38.307 -34.280 1.00 27.24  ? 497 THR D OG1   1 
ATOM   7037  C  CG2   . THR F 3 201 ? 113.719 -37.523 -32.947 1.00 26.89  ? 497 THR D CG2   1 
ATOM   7038  N  N     . LYS F 3 202 ? 109.940 -35.943 -35.074 1.00 29.02  ? 498 LYS D N     1 
ATOM   7039  C  CA    . LYS F 3 202 ? 109.183 -35.440 -36.206 1.00 30.31  ? 498 LYS D CA    1 
ATOM   7040  C  C     . LYS F 3 202 ? 108.788 -33.979 -36.046 1.00 30.92  ? 498 LYS D C     1 
ATOM   7041  O  O     . LYS F 3 202 ? 108.797 -33.224 -37.019 1.00 30.88  ? 498 LYS D O     1 
ATOM   7042  C  CB    . LYS F 3 202 ? 108.001 -36.348 -36.525 1.00 30.41  ? 498 LYS D CB    1 
ATOM   7043  C  CG    . LYS F 3 202 ? 108.513 -37.692 -37.019 1.00 32.04  ? 498 LYS D CG    1 
ATOM   7044  C  CD    . LYS F 3 202 ? 107.494 -38.478 -37.792 1.00 34.64  ? 498 LYS D CD    1 
ATOM   7045  C  CE    . LYS F 3 202 ? 108.162 -39.698 -38.418 1.00 35.53  ? 498 LYS D CE    1 
ATOM   7046  N  NZ    . LYS F 3 202 ? 107.199 -40.505 -39.219 1.00 37.28  ? 498 LYS D NZ    1 
ATOM   7047  N  N     . ARG F 3 203 ? 108.477 -33.571 -34.819 1.00 31.87  ? 499 ARG D N     1 
ATOM   7048  C  CA    . ARG F 3 203 ? 108.172 -32.176 -34.571 1.00 32.91  ? 499 ARG D CA    1 
ATOM   7049  C  C     . ARG F 3 203 ? 109.436 -31.336 -34.729 1.00 33.27  ? 499 ARG D C     1 
ATOM   7050  O  O     . ARG F 3 203 ? 109.402 -30.226 -35.280 1.00 33.05  ? 499 ARG D O     1 
ATOM   7051  C  CB    . ARG F 3 203 ? 107.586 -31.974 -33.183 1.00 33.15  ? 499 ARG D CB    1 
ATOM   7052  C  CG    . ARG F 3 203 ? 107.079 -30.556 -32.991 1.00 34.84  ? 499 ARG D CG    1 
ATOM   7053  C  CD    . ARG F 3 203 ? 105.996 -30.520 -31.938 1.00 38.67  ? 499 ARG D CD    1 
ATOM   7054  N  NE    . ARG F 3 203 ? 104.985 -29.500 -32.211 1.00 40.25  ? 499 ARG D NE    1 
ATOM   7055  C  CZ    . ARG F 3 203 ? 103.789 -29.487 -31.633 1.00 41.73  ? 499 ARG D CZ    1 
ATOM   7056  N  NH1   . ARG F 3 203 ? 103.479 -30.435 -30.756 1.00 41.74  ? 499 ARG D NH1   1 
ATOM   7057  N  NH2   . ARG F 3 203 ? 102.905 -28.535 -31.928 1.00 42.54  ? 499 ARG D NH2   1 
ATOM   7058  N  N     . LEU F 3 204 ? 110.548 -31.890 -34.255 1.00 33.59  ? 500 LEU D N     1 
ATOM   7059  C  CA    . LEU F 3 204 ? 111.835 -31.227 -34.330 1.00 34.12  ? 500 LEU D CA    1 
ATOM   7060  C  C     . LEU F 3 204 ? 112.223 -31.014 -35.787 1.00 34.83  ? 500 LEU D C     1 
ATOM   7061  O  O     . LEU F 3 204 ? 112.567 -29.894 -36.179 1.00 35.01  ? 500 LEU D O     1 
ATOM   7062  C  CB    . LEU F 3 204 ? 112.879 -32.056 -33.596 1.00 34.02  ? 500 LEU D CB    1 
ATOM   7063  C  CG    . LEU F 3 204 ? 114.038 -31.327 -32.923 1.00 33.64  ? 500 LEU D CG    1 
ATOM   7064  C  CD1   . LEU F 3 204 ? 113.564 -30.099 -32.150 1.00 32.31  ? 500 LEU D CD1   1 
ATOM   7065  C  CD2   . LEU F 3 204 ? 114.730 -32.308 -32.010 1.00 32.08  ? 500 LEU D CD2   1 
ATOM   7066  N  N     . GLU F 3 205 ? 112.128 -32.083 -36.581 1.00 35.50  ? 501 GLU D N     1 
ATOM   7067  C  CA    . GLU F 3 205 ? 112.428 -32.056 -38.013 1.00 36.42  ? 501 GLU D CA    1 
ATOM   7068  C  C     . GLU F 3 205 ? 111.584 -31.042 -38.765 1.00 36.76  ? 501 GLU D C     1 
ATOM   7069  O  O     . GLU F 3 205 ? 112.076 -30.370 -39.670 1.00 36.97  ? 501 GLU D O     1 
ATOM   7070  C  CB    . GLU F 3 205 ? 112.213 -33.437 -38.631 1.00 36.30  ? 501 GLU D CB    1 
ATOM   7071  C  CG    . GLU F 3 205 ? 113.345 -34.436 -38.383 1.00 37.24  ? 501 GLU D CG    1 
ATOM   7072  C  CD    . GLU F 3 205 ? 112.924 -35.896 -38.610 1.00 37.84  ? 501 GLU D CD    1 
ATOM   7073  O  OE1   . GLU F 3 205 ? 111.771 -36.146 -39.052 1.00 39.90  ? 501 GLU D OE1   1 
ATOM   7074  O  OE2   . GLU F 3 205 ? 113.749 -36.798 -38.330 1.00 39.11  ? 501 GLU D OE2   1 
ATOM   7075  N  N     . GLN F 3 206 ? 110.314 -30.933 -38.389 1.00 37.25  ? 502 GLN D N     1 
ATOM   7076  C  CA    . GLN F 3 206 ? 109.409 -29.998 -39.045 1.00 37.82  ? 502 GLN D CA    1 
ATOM   7077  C  C     . GLN F 3 206 ? 109.717 -28.556 -38.656 1.00 38.15  ? 502 GLN D C     1 
ATOM   7078  O  O     . GLN F 3 206 ? 109.476 -27.637 -39.437 1.00 38.31  ? 502 GLN D O     1 
ATOM   7079  C  CB    . GLN F 3 206 ? 107.937 -30.361 -38.781 1.00 37.97  ? 502 GLN D CB    1 
ATOM   7080  C  CG    . GLN F 3 206 ? 106.905 -29.611 -39.648 1.00 38.78  ? 502 GLN D CG    1 
ATOM   7081  C  CD    . GLN F 3 206 ? 107.154 -29.732 -41.174 1.00 40.58  ? 502 GLN D CD    1 
ATOM   7082  O  OE1   . GLN F 3 206 ? 107.011 -28.748 -41.912 1.00 40.21  ? 502 GLN D OE1   1 
ATOM   7083  N  NE2   . GLN F 3 206 ? 107.536 -30.932 -41.640 1.00 39.72  ? 502 GLN D NE2   1 
ATOM   7084  N  N     . MET F 3 207 ? 110.250 -28.347 -37.456 1.00 38.66  ? 503 MET D N     1 
ATOM   7085  C  CA    . MET F 3 207 ? 110.687 -27.011 -37.074 1.00 39.12  ? 503 MET D CA    1 
ATOM   7086  C  C     . MET F 3 207 ? 111.985 -26.723 -37.814 1.00 39.54  ? 503 MET D C     1 
ATOM   7087  O  O     . MET F 3 207 ? 112.297 -25.576 -38.113 1.00 39.21  ? 503 MET D O     1 
ATOM   7088  C  CB    . MET F 3 207 ? 110.877 -26.891 -35.570 1.00 39.00  ? 503 MET D CB    1 
ATOM   7089  C  CG    . MET F 3 207 ? 109.570 -26.845 -34.803 1.00 39.31  ? 503 MET D CG    1 
ATOM   7090  S  SD    . MET F 3 207 ? 109.776 -26.596 -33.022 1.00 39.71  ? 503 MET D SD    1 
ATOM   7091  C  CE    . MET F 3 207 ? 110.553 -28.123 -32.508 1.00 39.04  ? 503 MET D CE    1 
ATOM   7092  N  N     . GLY F 3 208 ? 112.719 -27.790 -38.129 1.00 40.29  ? 504 GLY D N     1 
ATOM   7093  C  CA    . GLY F 3 208 ? 113.950 -27.695 -38.912 1.00 41.07  ? 504 GLY D CA    1 
ATOM   7094  C  C     . GLY F 3 208 ? 113.662 -27.174 -40.305 1.00 41.65  ? 504 GLY D C     1 
ATOM   7095  O  O     . GLY F 3 208 ? 114.409 -26.355 -40.834 1.00 41.63  ? 504 GLY D O     1 
ATOM   7096  N  N     . LYS F 3 209 ? 112.558 -27.647 -40.881 1.00 42.24  ? 505 LYS D N     1 
ATOM   7097  C  CA    . LYS F 3 209 ? 112.103 -27.240 -42.208 1.00 42.91  ? 505 LYS D CA    1 
ATOM   7098  C  C     . LYS F 3 209 ? 111.652 -25.780 -42.235 1.00 43.06  ? 505 LYS D C     1 
ATOM   7099  O  O     . LYS F 3 209 ? 112.096 -25.004 -43.074 1.00 42.99  ? 505 LYS D O     1 
ATOM   7100  C  CB    . LYS F 3 209 ? 110.981 -28.178 -42.685 1.00 42.87  ? 505 LYS D CB    1 
ATOM   7101  C  CG    . LYS F 3 209 ? 110.099 -27.633 -43.810 1.00 43.47  ? 505 LYS D CG    1 
ATOM   7102  C  CD    . LYS F 3 209 ? 109.089 -28.673 -44.312 1.00 43.69  ? 505 LYS D CD    1 
ATOM   7103  C  CE    . LYS F 3 209 ? 107.868 -28.015 -44.968 1.00 44.11  ? 505 LYS D CE    1 
ATOM   7104  N  NZ    . LYS F 3 209 ? 108.264 -26.972 -45.962 1.00 45.39  ? 505 LYS D NZ    1 
ATOM   7105  N  N     . GLU F 3 210 ? 110.775 -25.411 -41.313 1.00 43.56  ? 506 GLU D N     1 
ATOM   7106  C  CA    . GLU F 3 210 ? 110.282 -24.047 -41.238 1.00 44.52  ? 506 GLU D CA    1 
ATOM   7107  C  C     . GLU F 3 210 ? 111.433 -23.057 -41.101 1.00 44.41  ? 506 GLU D C     1 
ATOM   7108  O  O     . GLU F 3 210 ? 111.476 -22.032 -41.792 1.00 44.72  ? 506 GLU D O     1 
ATOM   7109  C  CB    . GLU F 3 210 ? 109.313 -23.886 -40.059 1.00 44.38  ? 506 GLU D CB    1 
ATOM   7110  C  CG    . GLU F 3 210 ? 107.987 -24.650 -40.224 1.00 45.98  ? 506 GLU D CG    1 
ATOM   7111  C  CD    . GLU F 3 210 ? 107.120 -24.663 -38.955 1.00 46.11  ? 506 GLU D CD    1 
ATOM   7112  O  OE1   . GLU F 3 210 ? 107.047 -23.625 -38.246 1.00 47.48  ? 506 GLU D OE1   1 
ATOM   7113  O  OE2   . GLU F 3 210 ? 106.500 -25.720 -38.677 1.00 47.76  ? 506 GLU D OE2   1 
ATOM   7114  N  N     . LEU F 3 211 ? 112.373 -23.391 -40.223 1.00 44.25  ? 507 LEU D N     1 
ATOM   7115  C  CA    . LEU F 3 211 ? 113.499 -22.526 -39.887 1.00 44.00  ? 507 LEU D CA    1 
ATOM   7116  C  C     . LEU F 3 211 ? 114.446 -22.284 -41.073 1.00 43.73  ? 507 LEU D C     1 
ATOM   7117  O  O     . LEU F 3 211 ? 114.934 -21.173 -41.265 1.00 43.64  ? 507 LEU D O     1 
ATOM   7118  C  CB    . LEU F 3 211 ? 114.255 -23.146 -38.712 1.00 44.05  ? 507 LEU D CB    1 
ATOM   7119  C  CG    . LEU F 3 211 ? 114.860 -22.283 -37.609 1.00 44.35  ? 507 LEU D CG    1 
ATOM   7120  C  CD1   . LEU F 3 211 ? 113.811 -21.411 -36.935 1.00 44.31  ? 507 LEU D CD1   1 
ATOM   7121  C  CD2   . LEU F 3 211 ? 115.508 -23.205 -36.590 1.00 44.25  ? 507 LEU D CD2   1 
ATOM   7122  N  N     . ALA F 3 212 ? 114.703 -23.324 -41.860 1.00 43.43  ? 508 ALA D N     1 
ATOM   7123  C  CA    . ALA F 3 212 ? 115.549 -23.196 -43.042 1.00 43.37  ? 508 ALA D CA    1 
ATOM   7124  C  C     . ALA F 3 212 ? 114.981 -22.159 -44.007 1.00 43.55  ? 508 ALA D C     1 
ATOM   7125  O  O     . ALA F 3 212 ? 115.696 -21.285 -44.489 1.00 43.74  ? 508 ALA D O     1 
ATOM   7126  C  CB    . ALA F 3 212 ? 115.691 -24.531 -43.735 1.00 43.01  ? 508 ALA D CB    1 
ATOM   7127  N  N     . GLU F 3 213 ? 113.688 -22.254 -44.278 1.00 43.57  ? 509 GLU D N     1 
ATOM   7128  C  CA    . GLU F 3 213 ? 113.031 -21.332 -45.187 1.00 43.94  ? 509 GLU D CA    1 
ATOM   7129  C  C     . GLU F 3 213 ? 113.097 -19.896 -44.683 1.00 43.27  ? 509 GLU D C     1 
ATOM   7130  O  O     . GLU F 3 213 ? 113.326 -18.982 -45.476 1.00 43.61  ? 509 GLU D O     1 
ATOM   7131  C  CB    . GLU F 3 213 ? 111.580 -21.757 -45.432 1.00 44.06  ? 509 GLU D CB    1 
ATOM   7132  C  CG    . GLU F 3 213 ? 111.442 -23.130 -46.093 1.00 45.20  ? 509 GLU D CG    1 
ATOM   7133  C  CD    . GLU F 3 213 ? 110.009 -23.645 -46.071 1.00 45.56  ? 509 GLU D CD    1 
ATOM   7134  O  OE1   . GLU F 3 213 ? 109.254 -23.256 -45.147 1.00 48.59  ? 509 GLU D OE1   1 
ATOM   7135  O  OE2   . GLU F 3 213 ? 109.641 -24.443 -46.964 1.00 47.55  ? 509 GLU D OE2   1 
ATOM   7136  N  N     . GLN F 3 214 ? 112.886 -19.691 -43.382 1.00 42.49  ? 510 GLN D N     1 
ATOM   7137  C  CA    . GLN F 3 214 ? 113.032 -18.359 -42.792 1.00 41.85  ? 510 GLN D CA    1 
ATOM   7138  C  C     . GLN F 3 214 ? 114.461 -17.874 -42.981 1.00 41.24  ? 510 GLN D C     1 
ATOM   7139  O  O     . GLN F 3 214 ? 114.697 -16.735 -43.380 1.00 41.09  ? 510 GLN D O     1 
ATOM   7140  C  CB    . GLN F 3 214 ? 112.722 -18.358 -41.294 1.00 42.01  ? 510 GLN D CB    1 
ATOM   7141  C  CG    . GLN F 3 214 ? 111.260 -18.469 -40.913 1.00 42.30  ? 510 GLN D CG    1 
ATOM   7142  C  CD    . GLN F 3 214 ? 111.018 -17.971 -39.497 1.00 42.63  ? 510 GLN D CD    1 
ATOM   7143  O  OE1   . GLN F 3 214 ? 111.414 -16.861 -39.141 1.00 41.96  ? 510 GLN D OE1   1 
ATOM   7144  N  NE2   . GLN F 3 214 ? 110.367 -18.791 -38.683 1.00 43.84  ? 510 GLN D NE2   1 
ATOM   7145  N  N     . LEU F 3 215 ? 115.411 -18.756 -42.691 1.00 40.53  ? 511 LEU D N     1 
ATOM   7146  C  CA    . LEU F 3 215 ? 116.822 -18.445 -42.858 1.00 40.11  ? 511 LEU D CA    1 
ATOM   7147  C  C     . LEU F 3 215 ? 117.167 -17.913 -44.245 1.00 39.78  ? 511 LEU D C     1 
ATOM   7148  O  O     . LEU F 3 215 ? 118.049 -17.070 -44.384 1.00 39.57  ? 511 LEU D O     1 
ATOM   7149  C  CB    . LEU F 3 215 ? 117.692 -19.656 -42.517 1.00 40.02  ? 511 LEU D CB    1 
ATOM   7150  C  CG    . LEU F 3 215 ? 117.996 -19.759 -41.028 1.00 39.94  ? 511 LEU D CG    1 
ATOM   7151  C  CD1   . LEU F 3 215 ? 119.010 -20.840 -40.773 1.00 39.32  ? 511 LEU D CD1   1 
ATOM   7152  C  CD2   . LEU F 3 215 ? 118.519 -18.407 -40.545 1.00 39.90  ? 511 LEU D CD2   1 
ATOM   7153  N  N     . GLY F 3 216 ? 116.469 -18.409 -45.261 1.00 39.56  ? 512 GLY D N     1 
ATOM   7154  C  CA    . GLY F 3 216 ? 116.674 -17.951 -46.629 1.00 39.08  ? 512 GLY D CA    1 
ATOM   7155  C  C     . GLY F 3 216 ? 116.209 -16.518 -46.810 1.00 38.83  ? 512 GLY D C     1 
ATOM   7156  O  O     . GLY F 3 216 ? 116.961 -15.664 -47.286 1.00 38.85  ? 512 GLY D O     1 
ATOM   7157  N  N     . THR F 3 217 ? 114.970 -16.251 -46.415 1.00 38.48  ? 513 THR D N     1 
ATOM   7158  C  CA    . THR F 3 217 ? 114.370 -14.929 -46.585 1.00 38.24  ? 513 THR D CA    1 
ATOM   7159  C  C     . THR F 3 217 ? 115.186 -13.833 -45.913 1.00 38.06  ? 513 THR D C     1 
ATOM   7160  O  O     . THR F 3 217 ? 115.408 -12.768 -46.492 1.00 37.87  ? 513 THR D O     1 
ATOM   7161  C  CB    . THR F 3 217 ? 112.945 -14.883 -46.017 1.00 38.26  ? 513 THR D CB    1 
ATOM   7162  O  OG1   . THR F 3 217 ? 112.196 -16.005 -46.504 1.00 37.83  ? 513 THR D OG1   1 
ATOM   7163  C  CG2   . THR F 3 217 ? 112.256 -13.582 -46.416 1.00 38.34  ? 513 THR D CG2   1 
ATOM   7164  N  N     . VAL F 3 218 ? 115.625 -14.114 -44.688 1.00 37.87  ? 514 VAL D N     1 
ATOM   7165  C  CA    . VAL F 3 218 ? 116.411 -13.177 -43.901 1.00 37.40  ? 514 VAL D CA    1 
ATOM   7166  C  C     . VAL F 3 218 ? 117.778 -12.984 -44.544 1.00 37.23  ? 514 VAL D C     1 
ATOM   7167  O  O     . VAL F 3 218 ? 118.268 -11.856 -44.678 1.00 37.15  ? 514 VAL D O     1 
ATOM   7168  C  CB    . VAL F 3 218 ? 116.551 -13.665 -42.446 1.00 37.36  ? 514 VAL D CB    1 
ATOM   7169  C  CG1   . VAL F 3 218 ? 117.374 -12.684 -41.614 1.00 36.98  ? 514 VAL D CG1   1 
ATOM   7170  C  CG2   . VAL F 3 218 ? 115.167 -13.860 -41.836 1.00 37.42  ? 514 VAL D CG2   1 
ATOM   7171  N  N     . GLU F 3 219 ? 118.372 -14.096 -44.963 1.00 37.00  ? 515 GLU D N     1 
ATOM   7172  C  CA    . GLU F 3 219 ? 119.667 -14.080 -45.618 1.00 36.94  ? 515 GLU D CA    1 
ATOM   7173  C  C     . GLU F 3 219 ? 119.620 -13.180 -46.850 1.00 36.93  ? 515 GLU D C     1 
ATOM   7174  O  O     . GLU F 3 219 ? 120.473 -12.305 -47.024 1.00 37.00  ? 515 GLU D O     1 
ATOM   7175  C  CB    . GLU F 3 219 ? 120.071 -15.500 -46.017 1.00 36.88  ? 515 GLU D CB    1 
ATOM   7176  C  CG    . GLU F 3 219 ? 121.526 -15.655 -46.395 1.00 37.09  ? 515 GLU D CG    1 
ATOM   7177  C  CD    . GLU F 3 219 ? 121.823 -16.983 -47.062 1.00 37.99  ? 515 GLU D CD    1 
ATOM   7178  O  OE1   . GLU F 3 219 ? 122.977 -17.198 -47.489 1.00 38.51  ? 515 GLU D OE1   1 
ATOM   7179  O  OE2   . GLU F 3 219 ? 120.900 -17.816 -47.176 1.00 39.08  ? 515 GLU D OE2   1 
ATOM   7180  N  N     . GLN F 3 220 ? 118.611 -13.383 -47.691 1.00 36.75  ? 516 GLN D N     1 
ATOM   7181  C  CA    . GLN F 3 220 ? 118.474 -12.595 -48.907 1.00 36.89  ? 516 GLN D CA    1 
ATOM   7182  C  C     . GLN F 3 220 ? 118.257 -11.127 -48.597 1.00 36.74  ? 516 GLN D C     1 
ATOM   7183  O  O     . GLN F 3 220 ? 118.854 -10.262 -49.240 1.00 36.62  ? 516 GLN D O     1 
ATOM   7184  C  CB    . GLN F 3 220 ? 117.354 -13.141 -49.793 1.00 36.92  ? 516 GLN D CB    1 
ATOM   7185  C  CG    . GLN F 3 220 ? 117.692 -14.499 -50.383 1.00 37.83  ? 516 GLN D CG    1 
ATOM   7186  C  CD    . GLN F 3 220 ? 118.987 -14.482 -51.186 1.00 38.95  ? 516 GLN D CD    1 
ATOM   7187  O  OE1   . GLN F 3 220 ? 119.168 -13.651 -52.086 1.00 40.14  ? 516 GLN D OE1   1 
ATOM   7188  N  NE2   . GLN F 3 220 ? 119.888 -15.409 -50.874 1.00 38.08  ? 516 GLN D NE2   1 
ATOM   7189  N  N     . ARG F 3 221 ? 117.415 -10.855 -47.604 1.00 36.55  ? 517 ARG D N     1 
ATOM   7190  C  CA    . ARG F 3 221 ? 117.150 -9.489  -47.172 1.00 36.69  ? 517 ARG D CA    1 
ATOM   7191  C  C     . ARG F 3 221 ? 118.459 -8.814  -46.749 1.00 36.47  ? 517 ARG D C     1 
ATOM   7192  O  O     . ARG F 3 221 ? 118.669 -7.630  -47.022 1.00 36.22  ? 517 ARG D O     1 
ATOM   7193  C  CB    . ARG F 3 221 ? 116.157 -9.487  -46.009 1.00 36.88  ? 517 ARG D CB    1 
ATOM   7194  C  CG    . ARG F 3 221 ? 115.841 -8.112  -45.433 1.00 38.28  ? 517 ARG D CG    1 
ATOM   7195  C  CD    . ARG F 3 221 ? 114.638 -7.475  -46.108 1.00 40.03  ? 517 ARG D CD    1 
ATOM   7196  N  NE    . ARG F 3 221 ? 114.496 -6.065  -45.759 1.00 40.01  ? 517 ARG D NE    1 
ATOM   7197  C  CZ    . ARG F 3 221 ? 114.851 -5.062  -46.560 1.00 41.03  ? 517 ARG D CZ    1 
ATOM   7198  N  NH1   . ARG F 3 221 ? 115.364 -5.316  -47.768 1.00 39.67  ? 517 ARG D NH1   1 
ATOM   7199  N  NH2   . ARG F 3 221 ? 114.684 -3.802  -46.158 1.00 40.53  ? 517 ARG D NH2   1 
ATOM   7200  N  N     . ILE F 3 222 ? 119.332 -9.585  -46.099 1.00 36.17  ? 518 ILE D N     1 
ATOM   7201  C  CA    . ILE F 3 222 ? 120.620 -9.082  -45.627 1.00 36.23  ? 518 ILE D CA    1 
ATOM   7202  C  C     . ILE F 3 222 ? 121.553 -8.746  -46.781 1.00 36.42  ? 518 ILE D C     1 
ATOM   7203  O  O     . ILE F 3 222 ? 122.156 -7.672  -46.796 1.00 36.27  ? 518 ILE D O     1 
ATOM   7204  C  CB    . ILE F 3 222 ? 121.304 -10.061 -44.626 1.00 36.31  ? 518 ILE D CB    1 
ATOM   7205  C  CG1   . ILE F 3 222 ? 120.583 -10.024 -43.280 1.00 36.28  ? 518 ILE D CG1   1 
ATOM   7206  C  CG2   . ILE F 3 222 ? 122.764 -9.696  -44.402 1.00 35.46  ? 518 ILE D CG2   1 
ATOM   7207  C  CD1   . ILE F 3 222 ? 121.040 -11.073 -42.319 1.00 36.97  ? 518 ILE D CD1   1 
ATOM   7208  N  N     . TYR F 3 223 ? 121.657 -9.655  -47.749 1.00 36.76  ? 519 TYR D N     1 
ATOM   7209  C  CA    . TYR F 3 223 ? 122.511 -9.438  -48.918 1.00 37.09  ? 519 TYR D CA    1 
ATOM   7210  C  C     . TYR F 3 223 ? 122.063 -8.234  -49.744 1.00 37.65  ? 519 TYR D C     1 
ATOM   7211  O  O     . TYR F 3 223 ? 122.890 -7.535  -50.326 1.00 37.69  ? 519 TYR D O     1 
ATOM   7212  C  CB    . TYR F 3 223 ? 122.569 -10.675 -49.814 1.00 36.83  ? 519 TYR D CB    1 
ATOM   7213  C  CG    . TYR F 3 223 ? 123.164 -11.901 -49.166 1.00 36.95  ? 519 TYR D CG    1 
ATOM   7214  C  CD1   . TYR F 3 223 ? 124.137 -11.789 -48.174 1.00 37.25  ? 519 TYR D CD1   1 
ATOM   7215  C  CD2   . TYR F 3 223 ? 122.790 -13.174 -49.576 1.00 36.82  ? 519 TYR D CD2   1 
ATOM   7216  C  CE1   . TYR F 3 223 ? 124.691 -12.906 -47.584 1.00 36.51  ? 519 TYR D CE1   1 
ATOM   7217  C  CE2   . TYR F 3 223 ? 123.347 -14.301 -49.000 1.00 36.69  ? 519 TYR D CE2   1 
ATOM   7218  C  CZ    . TYR F 3 223 ? 124.298 -14.163 -48.002 1.00 37.09  ? 519 TYR D CZ    1 
ATOM   7219  O  OH    . TYR F 3 223 ? 124.861 -15.283 -47.421 1.00 36.59  ? 519 TYR D OH    1 
ATOM   7220  N  N     . GLU F 3 224 ? 120.756 -7.997  -49.804 1.00 38.21  ? 520 GLU D N     1 
ATOM   7221  C  CA    . GLU F 3 224 ? 120.238 -6.847  -50.534 1.00 38.75  ? 520 GLU D CA    1 
ATOM   7222  C  C     . GLU F 3 224 ? 120.607 -5.553  -49.838 1.00 38.36  ? 520 GLU D C     1 
ATOM   7223  O  O     . GLU F 3 224 ? 121.104 -4.631  -50.467 1.00 38.83  ? 520 GLU D O     1 
ATOM   7224  C  CB    . GLU F 3 224 ? 118.731 -6.945  -50.708 1.00 39.05  ? 520 GLU D CB    1 
ATOM   7225  C  CG    . GLU F 3 224 ? 118.328 -7.910  -51.798 1.00 41.15  ? 520 GLU D CG    1 
ATOM   7226  C  CD    . GLU F 3 224 ? 116.923 -8.442  -51.595 1.00 44.59  ? 520 GLU D CD    1 
ATOM   7227  O  OE1   . GLU F 3 224 ? 116.195 -7.894  -50.730 1.00 45.72  ? 520 GLU D OE1   1 
ATOM   7228  O  OE2   . GLU F 3 224 ? 116.554 -9.420  -52.287 1.00 45.94  ? 520 GLU D OE2   1 
ATOM   7229  N  N     . LEU F 3 225 ? 120.374 -5.495  -48.535 1.00 37.99  ? 521 LEU D N     1 
ATOM   7230  C  CA    . LEU F 3 225 ? 120.713 -4.315  -47.752 1.00 37.34  ? 521 LEU D CA    1 
ATOM   7231  C  C     . LEU F 3 225 ? 122.211 -4.065  -47.744 1.00 36.96  ? 521 LEU D C     1 
ATOM   7232  O  O     . LEU F 3 225 ? 122.649 -2.919  -47.755 1.00 36.87  ? 521 LEU D O     1 
ATOM   7233  C  CB    . LEU F 3 225 ? 120.204 -4.462  -46.323 1.00 37.36  ? 521 LEU D CB    1 
ATOM   7234  C  CG    . LEU F 3 225 ? 118.692 -4.536  -46.160 1.00 37.29  ? 521 LEU D CG    1 
ATOM   7235  C  CD1   . LEU F 3 225 ? 118.344 -4.672  -44.691 1.00 36.91  ? 521 LEU D CD1   1 
ATOM   7236  C  CD2   . LEU F 3 225 ? 118.040 -3.305  -46.768 1.00 37.04  ? 521 LEU D CD2   1 
ATOM   7237  N  N     . ALA F 3 226 ? 122.996 -5.139  -47.720 1.00 36.57  ? 522 ALA D N     1 
ATOM   7238  C  CA    . ALA F 3 226 ? 124.455 -5.017  -47.773 1.00 36.33  ? 522 ALA D CA    1 
ATOM   7239  C  C     . ALA F 3 226 ? 124.936 -4.653  -49.176 1.00 36.01  ? 522 ALA D C     1 
ATOM   7240  O  O     . ALA F 3 226 ? 126.019 -4.106  -49.343 1.00 35.92  ? 522 ALA D O     1 
ATOM   7241  C  CB    . ALA F 3 226 ? 125.121 -6.312  -47.309 1.00 36.29  ? 522 ALA D CB    1 
ATOM   7242  N  N     . GLY F 3 227 ? 124.117 -4.971  -50.177 1.00 35.87  ? 523 GLY D N     1 
ATOM   7243  C  CA    . GLY F 3 227 ? 124.452 -4.742  -51.574 1.00 35.47  ? 523 GLY D CA    1 
ATOM   7244  C  C     . GLY F 3 227 ? 125.454 -5.774  -52.038 1.00 35.29  ? 523 GLY D C     1 
ATOM   7245  O  O     . GLY F 3 227 ? 126.046 -5.645  -53.105 1.00 35.32  ? 523 GLY D O     1 
ATOM   7246  N  N     . GLN F 3 228 ? 125.631 -6.817  -51.235 1.00 35.13  ? 524 GLN D N     1 
ATOM   7247  C  CA    . GLN F 3 228 ? 126.638 -7.830  -51.512 1.00 35.01  ? 524 GLN D CA    1 
ATOM   7248  C  C     . GLN F 3 228 ? 126.393 -9.124  -50.725 1.00 34.57  ? 524 GLN D C     1 
ATOM   7249  O  O     . GLN F 3 228 ? 125.831 -9.101  -49.628 1.00 34.57  ? 524 GLN D O     1 
ATOM   7250  C  CB    . GLN F 3 228 ? 128.016 -7.259  -51.157 1.00 35.11  ? 524 GLN D CB    1 
ATOM   7251  C  CG    . GLN F 3 228 ? 129.157 -8.244  -51.218 1.00 35.53  ? 524 GLN D CG    1 
ATOM   7252  C  CD    . GLN F 3 228 ? 130.417 -7.683  -50.603 1.00 36.82  ? 524 GLN D CD    1 
ATOM   7253  O  OE1   . GLN F 3 228 ? 130.636 -6.470  -50.604 1.00 36.83  ? 524 GLN D OE1   1 
ATOM   7254  N  NE2   . GLN F 3 228 ? 131.261 -8.566  -50.073 1.00 38.06  ? 524 GLN D NE2   1 
ATOM   7255  N  N     . GLU F 3 229 ? 126.814 -10.249 -51.294 1.00 33.87  ? 525 GLU D N     1 
ATOM   7256  C  CA    . GLU F 3 229 ? 126.777 -11.511 -50.584 1.00 33.14  ? 525 GLU D CA    1 
ATOM   7257  C  C     . GLU F 3 229 ? 128.111 -11.718 -49.876 1.00 32.64  ? 525 GLU D C     1 
ATOM   7258  O  O     . GLU F 3 229 ? 129.173 -11.386 -50.419 1.00 32.66  ? 525 GLU D O     1 
ATOM   7259  C  CB    . GLU F 3 229 ? 126.500 -12.666 -51.530 1.00 33.15  ? 525 GLU D CB    1 
ATOM   7260  C  CG    . GLU F 3 229 ? 125.196 -12.528 -52.269 1.00 34.25  ? 525 GLU D CG    1 
ATOM   7261  C  CD    . GLU F 3 229 ? 124.696 -13.853 -52.794 1.00 35.57  ? 525 GLU D CD    1 
ATOM   7262  O  OE1   . GLU F 3 229 ? 125.539 -14.768 -52.961 1.00 36.42  ? 525 GLU D OE1   1 
ATOM   7263  O  OE2   . GLU F 3 229 ? 123.466 -13.978 -53.030 1.00 35.00  ? 525 GLU D OE2   1 
ATOM   7264  N  N     . PHE F 3 230 ? 128.037 -12.254 -48.658 1.00 31.56  ? 526 PHE D N     1 
ATOM   7265  C  CA    . PHE F 3 230 ? 129.197 -12.533 -47.822 1.00 30.36  ? 526 PHE D CA    1 
ATOM   7266  C  C     . PHE F 3 230 ? 128.771 -13.625 -46.849 1.00 29.77  ? 526 PHE D C     1 
ATOM   7267  O  O     . PHE F 3 230 ? 127.627 -14.083 -46.897 1.00 29.81  ? 526 PHE D O     1 
ATOM   7268  C  CB    . PHE F 3 230 ? 129.612 -11.278 -47.054 1.00 30.18  ? 526 PHE D CB    1 
ATOM   7269  C  CG    . PHE F 3 230 ? 128.612 -10.842 -46.004 1.00 30.40  ? 526 PHE D CG    1 
ATOM   7270  C  CD1   . PHE F 3 230 ? 127.424 -10.213 -46.365 1.00 29.88  ? 526 PHE D CD1   1 
ATOM   7271  C  CD2   . PHE F 3 230 ? 128.869 -11.049 -44.651 1.00 29.48  ? 526 PHE D CD2   1 
ATOM   7272  C  CE1   . PHE F 3 230 ? 126.516 -9.810  -45.402 1.00 29.47  ? 526 PHE D CE1   1 
ATOM   7273  C  CE2   . PHE F 3 230 ? 127.962 -10.648 -43.682 1.00 28.81  ? 526 PHE D CE2   1 
ATOM   7274  C  CZ    . PHE F 3 230 ? 126.788 -10.029 -44.055 1.00 29.46  ? 526 PHE D CZ    1 
ATOM   7275  N  N     . ASN F 3 231 ? 129.677 -14.044 -45.971 1.00 28.78  ? 527 ASN D N     1 
ATOM   7276  C  CA    . ASN F 3 231 ? 129.340 -15.026 -44.939 1.00 27.88  ? 527 ASN D CA    1 
ATOM   7277  C  C     . ASN F 3 231 ? 128.916 -14.327 -43.629 1.00 27.54  ? 527 ASN D C     1 
ATOM   7278  O  O     . ASN F 3 231 ? 129.745 -13.753 -42.912 1.00 27.67  ? 527 ASN D O     1 
ATOM   7279  C  CB    . ASN F 3 231 ? 130.507 -15.993 -44.709 1.00 27.46  ? 527 ASN D CB    1 
ATOM   7280  C  CG    . ASN F 3 231 ? 130.146 -17.136 -43.776 1.00 26.96  ? 527 ASN D CG    1 
ATOM   7281  O  OD1   . ASN F 3 231 ? 129.187 -17.052 -43.012 1.00 27.47  ? 527 ASN D OD1   1 
ATOM   7282  N  ND2   . ASN F 3 231 ? 130.914 -18.212 -43.836 1.00 25.41  ? 527 ASN D ND2   1 
ATOM   7283  N  N     . ILE F 3 232 ? 127.627 -14.373 -43.320 1.00 26.84  ? 528 ILE D N     1 
ATOM   7284  C  CA    . ILE F 3 232 ? 127.114 -13.707 -42.130 1.00 26.49  ? 528 ILE D CA    1 
ATOM   7285  C  C     . ILE F 3 232 ? 127.636 -14.365 -40.849 1.00 26.83  ? 528 ILE D C     1 
ATOM   7286  O  O     . ILE F 3 232 ? 127.795 -13.712 -39.820 1.00 26.84  ? 528 ILE D O     1 
ATOM   7287  C  CB    . ILE F 3 232 ? 125.576 -13.646 -42.152 1.00 26.32  ? 528 ILE D CB    1 
ATOM   7288  C  CG1   . ILE F 3 232 ? 125.097 -13.105 -43.503 1.00 25.72  ? 528 ILE D CG1   1 
ATOM   7289  C  CG2   . ILE F 3 232 ? 125.050 -12.761 -41.042 1.00 25.82  ? 528 ILE D CG2   1 
ATOM   7290  C  CD1   . ILE F 3 232 ? 123.693 -13.488 -43.864 1.00 24.61  ? 528 ILE D CD1   1 
ATOM   7291  N  N     . ASN F 3 233 ? 127.943 -15.655 -40.919 1.00 27.06  ? 529 ASN D N     1 
ATOM   7292  C  CA    . ASN F 3 233 ? 128.456 -16.364 -39.756 1.00 27.28  ? 529 ASN D CA    1 
ATOM   7293  C  C     . ASN F 3 233 ? 129.931 -16.109 -39.472 1.00 27.68  ? 529 ASN D C     1 
ATOM   7294  O  O     . ASN F 3 233 ? 130.521 -16.690 -38.558 1.00 27.68  ? 529 ASN D O     1 
ATOM   7295  C  CB    . ASN F 3 233 ? 128.153 -17.844 -39.881 1.00 27.03  ? 529 ASN D CB    1 
ATOM   7296  C  CG    . ASN F 3 233 ? 126.683 -18.138 -39.671 1.00 27.24  ? 529 ASN D CG    1 
ATOM   7297  O  OD1   . ASN F 3 233 ? 125.993 -17.423 -38.940 1.00 27.57  ? 529 ASN D OD1   1 
ATOM   7298  N  ND2   . ASN F 3 233 ? 126.196 -19.192 -40.299 1.00 27.88  ? 529 ASN D ND2   1 
ATOM   7299  N  N     . SER F 3 234 ? 130.504 -15.202 -40.252 1.00 28.11  ? 530 SER D N     1 
ATOM   7300  C  CA    . SER F 3 234 ? 131.894 -14.811 -40.123 1.00 28.39  ? 530 SER D CA    1 
ATOM   7301  C  C     . SER F 3 234 ? 131.998 -13.415 -39.557 1.00 28.35  ? 530 SER D C     1 
ATOM   7302  O  O     . SER F 3 234 ? 131.809 -12.448 -40.280 1.00 28.22  ? 530 SER D O     1 
ATOM   7303  C  CB    . SER F 3 234 ? 132.562 -14.830 -41.488 1.00 28.21  ? 530 SER D CB    1 
ATOM   7304  O  OG    . SER F 3 234 ? 133.764 -14.084 -41.445 1.00 29.75  ? 530 SER D OG    1 
ATOM   7305  N  N     . PRO F 3 235 ? 132.323 -13.297 -38.264 1.00 28.78  ? 531 PRO D N     1 
ATOM   7306  C  CA    . PRO F 3 235 ? 132.419 -11.964 -37.679 1.00 28.93  ? 531 PRO D CA    1 
ATOM   7307  C  C     . PRO F 3 235 ? 133.492 -11.128 -38.364 1.00 29.14  ? 531 PRO D C     1 
ATOM   7308  O  O     . PRO F 3 235 ? 133.448 -9.897  -38.308 1.00 29.22  ? 531 PRO D O     1 
ATOM   7309  C  CB    . PRO F 3 235 ? 132.783 -12.243 -36.220 1.00 28.55  ? 531 PRO D CB    1 
ATOM   7310  C  CG    . PRO F 3 235 ? 132.340 -13.639 -35.983 1.00 28.93  ? 531 PRO D CG    1 
ATOM   7311  C  CD    . PRO F 3 235 ? 132.608 -14.345 -37.274 1.00 28.70  ? 531 PRO D CD    1 
ATOM   7312  N  N     . LYS F 3 236 ? 134.445 -11.797 -39.007 1.00 29.27  ? 532 LYS D N     1 
ATOM   7313  C  CA    . LYS F 3 236 ? 135.486 -11.097 -39.746 1.00 29.32  ? 532 LYS D CA    1 
ATOM   7314  C  C     . LYS F 3 236 ? 134.890 -10.406 -40.980 1.00 28.80  ? 532 LYS D C     1 
ATOM   7315  O  O     . LYS F 3 236 ? 134.980 -9.187  -41.106 1.00 28.71  ? 532 LYS D O     1 
ATOM   7316  C  CB    . LYS F 3 236 ? 136.607 -12.060 -40.138 1.00 29.92  ? 532 LYS D CB    1 
ATOM   7317  C  CG    . LYS F 3 236 ? 137.787 -11.417 -40.877 1.00 30.86  ? 532 LYS D CG    1 
ATOM   7318  C  CD    . LYS F 3 236 ? 138.736 -10.690 -39.917 1.00 33.59  ? 532 LYS D CD    1 
ATOM   7319  C  CE    . LYS F 3 236 ? 140.050 -10.256 -40.617 1.00 33.47  ? 532 LYS D CE    1 
ATOM   7320  N  NZ    . LYS F 3 236 ? 140.862 -11.410 -41.132 1.00 32.94  ? 532 LYS D NZ    1 
ATOM   7321  N  N     . GLN F 3 237 ? 134.275 -11.182 -41.875 1.00 28.10  ? 533 GLN D N     1 
ATOM   7322  C  CA    . GLN F 3 237 ? 133.649 -10.624 -43.078 1.00 27.47  ? 533 GLN D CA    1 
ATOM   7323  C  C     . GLN F 3 237 ? 132.575 -9.588  -42.748 1.00 27.15  ? 533 GLN D C     1 
ATOM   7324  O  O     . GLN F 3 237 ? 132.528 -8.506  -43.348 1.00 27.31  ? 533 GLN D O     1 
ATOM   7325  C  CB    . GLN F 3 237 ? 133.044 -11.729 -43.930 1.00 27.12  ? 533 GLN D CB    1 
ATOM   7326  C  CG    . GLN F 3 237 ? 134.059 -12.697 -44.477 1.00 27.23  ? 533 GLN D CG    1 
ATOM   7327  C  CD    . GLN F 3 237 ? 133.424 -13.726 -45.381 1.00 26.93  ? 533 GLN D CD    1 
ATOM   7328  O  OE1   . GLN F 3 237 ? 132.453 -13.438 -46.075 1.00 27.42  ? 533 GLN D OE1   1 
ATOM   7329  N  NE2   . GLN F 3 237 ? 133.969 -14.934 -45.380 1.00 26.95  ? 533 GLN D NE2   1 
ATOM   7330  N  N     . LEU F 3 238 ? 131.714 -9.938  -41.800 1.00 26.44  ? 534 LEU D N     1 
ATOM   7331  C  CA    . LEU F 3 238 ? 130.663 -9.051  -41.324 1.00 25.93  ? 534 LEU D CA    1 
ATOM   7332  C  C     . LEU F 3 238 ? 131.236 -7.721  -40.852 1.00 25.51  ? 534 LEU D C     1 
ATOM   7333  O  O     . LEU F 3 238 ? 130.652 -6.671  -41.101 1.00 25.26  ? 534 LEU D O     1 
ATOM   7334  C  CB    . LEU F 3 238 ? 129.908 -9.714  -40.175 1.00 25.95  ? 534 LEU D CB    1 
ATOM   7335  C  CG    . LEU F 3 238 ? 128.863 -8.866  -39.461 1.00 25.65  ? 534 LEU D CG    1 
ATOM   7336  C  CD1   . LEU F 3 238 ? 127.807 -8.429  -40.445 1.00 25.05  ? 534 LEU D CD1   1 
ATOM   7337  C  CD2   . LEU F 3 238 ? 128.248 -9.638  -38.305 1.00 26.14  ? 534 LEU D CD2   1 
ATOM   7338  N  N     . GLY F 3 239 ? 132.375 -7.783  -40.166 1.00 25.04  ? 535 GLY D N     1 
ATOM   7339  C  CA    . GLY F 3 239 ? 133.075 -6.589  -39.703 1.00 24.77  ? 535 GLY D CA    1 
ATOM   7340  C  C     . GLY F 3 239 ? 133.420 -5.676  -40.864 1.00 24.76  ? 535 GLY D C     1 
ATOM   7341  O  O     . GLY F 3 239 ? 133.226 -4.455  -40.790 1.00 25.06  ? 535 GLY D O     1 
ATOM   7342  N  N     . VAL F 3 240 ? 133.915 -6.267  -41.947 1.00 24.60  ? 536 VAL D N     1 
ATOM   7343  C  CA    . VAL F 3 240 ? 134.248 -5.511  -43.148 1.00 24.61  ? 536 VAL D CA    1 
ATOM   7344  C  C     . VAL F 3 240 ? 132.999 -4.834  -43.718 1.00 24.71  ? 536 VAL D C     1 
ATOM   7345  O  O     . VAL F 3 240 ? 132.991 -3.632  -43.968 1.00 24.78  ? 536 VAL D O     1 
ATOM   7346  C  CB    . VAL F 3 240 ? 134.910 -6.400  -44.219 1.00 24.61  ? 536 VAL D CB    1 
ATOM   7347  C  CG1   . VAL F 3 240 ? 135.009 -5.660  -45.547 1.00 23.89  ? 536 VAL D CG1   1 
ATOM   7348  C  CG2   . VAL F 3 240 ? 136.282 -6.876  -43.739 1.00 24.39  ? 536 VAL D CG2   1 
ATOM   7349  N  N     . ILE F 3 241 ? 131.935 -5.607  -43.881 1.00 24.72  ? 537 ILE D N     1 
ATOM   7350  C  CA    . ILE F 3 241 ? 130.689 -5.077  -44.420 1.00 24.83  ? 537 ILE D CA    1 
ATOM   7351  C  C     . ILE F 3 241 ? 130.158 -3.873  -43.637 1.00 24.77  ? 537 ILE D C     1 
ATOM   7352  O  O     . ILE F 3 241 ? 129.682 -2.913  -44.219 1.00 24.70  ? 537 ILE D O     1 
ATOM   7353  C  CB    . ILE F 3 241 ? 129.592 -6.174  -44.457 1.00 24.76  ? 537 ILE D CB    1 
ATOM   7354  C  CG1   . ILE F 3 241 ? 130.049 -7.378  -45.296 1.00 25.07  ? 537 ILE D CG1   1 
ATOM   7355  C  CG2   . ILE F 3 241 ? 128.269 -5.608  -44.955 1.00 23.61  ? 537 ILE D CG2   1 
ATOM   7356  C  CD1   . ILE F 3 241 ? 130.259 -7.081  -46.777 1.00 24.27  ? 537 ILE D CD1   1 
ATOM   7357  N  N     . LEU F 3 242 ? 130.264 -3.933  -42.319 1.00 25.00  ? 538 LEU D N     1 
ATOM   7358  C  CA    . LEU F 3 242 ? 129.644 -2.944  -41.451 1.00 25.30  ? 538 LEU D CA    1 
ATOM   7359  C  C     . LEU F 3 242 ? 130.477 -1.708  -41.163 1.00 25.57  ? 538 LEU D C     1 
ATOM   7360  O  O     . LEU F 3 242 ? 129.942 -0.604  -41.114 1.00 25.78  ? 538 LEU D O     1 
ATOM   7361  C  CB    . LEU F 3 242 ? 129.264 -3.588  -40.116 1.00 25.13  ? 538 LEU D CB    1 
ATOM   7362  C  CG    . LEU F 3 242 ? 128.195 -4.675  -40.135 1.00 25.27  ? 538 LEU D CG    1 
ATOM   7363  C  CD1   . LEU F 3 242 ? 128.009 -5.216  -38.729 1.00 25.89  ? 538 LEU D CD1   1 
ATOM   7364  C  CD2   . LEU F 3 242 ? 126.885 -4.132  -40.669 1.00 25.17  ? 538 LEU D CD2   1 
ATOM   7365  N  N     . PHE F 3 243 ? 131.774 -1.884  -40.952 1.00 25.90  ? 539 PHE D N     1 
ATOM   7366  C  CA    . PHE F 3 243 ? 132.598 -0.758  -40.528 1.00 26.46  ? 539 PHE D CA    1 
ATOM   7367  C  C     . PHE F 3 243 ? 133.517 -0.220  -41.603 1.00 27.02  ? 539 PHE D C     1 
ATOM   7368  O  O     . PHE F 3 243 ? 134.091 0.851   -41.456 1.00 27.20  ? 539 PHE D O     1 
ATOM   7369  C  CB    . PHE F 3 243 ? 133.360 -1.120  -39.256 1.00 26.26  ? 539 PHE D CB    1 
ATOM   7370  C  CG    . PHE F 3 243 ? 132.482 -1.732  -38.215 1.00 26.05  ? 539 PHE D CG    1 
ATOM   7371  C  CD1   . PHE F 3 243 ? 131.469 -0.984  -37.630 1.00 23.61  ? 539 PHE D CD1   1 
ATOM   7372  C  CD2   . PHE F 3 243 ? 132.632 -3.066  -37.856 1.00 25.72  ? 539 PHE D CD2   1 
ATOM   7373  C  CE1   . PHE F 3 243 ? 130.635 -1.542  -36.694 1.00 24.99  ? 539 PHE D CE1   1 
ATOM   7374  C  CE2   . PHE F 3 243 ? 131.795 -3.638  -36.903 1.00 26.21  ? 539 PHE D CE2   1 
ATOM   7375  C  CZ    . PHE F 3 243 ? 130.794 -2.880  -36.327 1.00 25.91  ? 539 PHE D CZ    1 
ATOM   7376  N  N     . GLU F 3 244 ? 133.646 -0.963  -42.688 1.00 27.69  ? 540 GLU D N     1 
ATOM   7377  C  CA    . GLU F 3 244 ? 134.447 -0.501  -43.794 1.00 28.54  ? 540 GLU D CA    1 
ATOM   7378  C  C     . GLU F 3 244 ? 133.554 -0.187  -44.982 1.00 28.48  ? 540 GLU D C     1 
ATOM   7379  O  O     . GLU F 3 244 ? 133.627 0.901   -45.532 1.00 28.70  ? 540 GLU D O     1 
ATOM   7380  C  CB    . GLU F 3 244 ? 135.537 -1.519  -44.143 1.00 28.90  ? 540 GLU D CB    1 
ATOM   7381  C  CG    . GLU F 3 244 ? 136.624 -1.602  -43.077 1.00 30.66  ? 540 GLU D CG    1 
ATOM   7382  C  CD    . GLU F 3 244 ? 137.711 -2.600  -43.411 1.00 33.09  ? 540 GLU D CD    1 
ATOM   7383  O  OE1   . GLU F 3 244 ? 138.577 -2.816  -42.540 1.00 34.40  ? 540 GLU D OE1   1 
ATOM   7384  O  OE2   . GLU F 3 244 ? 137.702 -3.170  -44.530 1.00 33.88  ? 540 GLU D OE2   1 
ATOM   7385  N  N     . LYS F 3 245 ? 132.688 -1.129  -45.346 1.00 28.43  ? 541 LYS D N     1 
ATOM   7386  C  CA    . LYS F 3 245 ? 131.805 -0.955  -46.492 1.00 28.65  ? 541 LYS D CA    1 
ATOM   7387  C  C     . LYS F 3 245 ? 130.628 -0.017  -46.217 1.00 28.29  ? 541 LYS D C     1 
ATOM   7388  O  O     . LYS F 3 245 ? 130.410 0.935   -46.962 1.00 28.29  ? 541 LYS D O     1 
ATOM   7389  C  CB    . LYS F 3 245 ? 131.311 -2.305  -47.029 1.00 28.62  ? 541 LYS D CB    1 
ATOM   7390  C  CG    . LYS F 3 245 ? 130.561 -2.175  -48.355 1.00 29.58  ? 541 LYS D CG    1 
ATOM   7391  C  CD    . LYS F 3 245 ? 130.148 -3.533  -48.935 1.00 29.35  ? 541 LYS D CD    1 
ATOM   7392  C  CE    . LYS F 3 245 ? 129.271 -3.369  -50.180 1.00 29.56  ? 541 LYS D CE    1 
ATOM   7393  N  NZ    . LYS F 3 245 ? 128.215 -2.326  -49.992 1.00 28.47  ? 541 LYS D NZ    1 
ATOM   7394  N  N     . LEU F 3 246 ? 129.871 -0.293  -45.158 1.00 28.21  ? 542 LEU D N     1 
ATOM   7395  C  CA    . LEU F 3 246 ? 128.725 0.539   -44.794 1.00 27.94  ? 542 LEU D CA    1 
ATOM   7396  C  C     . LEU F 3 246 ? 129.146 1.717   -43.918 1.00 28.03  ? 542 LEU D C     1 
ATOM   7397  O  O     . LEU F 3 246 ? 128.385 2.661   -43.718 1.00 28.22  ? 542 LEU D O     1 
ATOM   7398  C  CB    . LEU F 3 246 ? 127.642 -0.288  -44.096 1.00 27.67  ? 542 LEU D CB    1 
ATOM   7399  C  CG    . LEU F 3 246 ? 126.891 -1.347  -44.912 1.00 27.71  ? 542 LEU D CG    1 
ATOM   7400  C  CD1   . LEU F 3 246 ? 125.716 -1.880  -44.100 1.00 26.48  ? 542 LEU D CD1   1 
ATOM   7401  C  CD2   . LEU F 3 246 ? 126.401 -0.796  -46.254 1.00 26.13  ? 542 LEU D CD2   1 
ATOM   7402  N  N     . GLN F 3 247 ? 130.364 1.647   -43.400 1.00 28.06  ? 543 GLN D N     1 
ATOM   7403  C  CA    . GLN F 3 247 ? 130.928 2.689   -42.542 1.00 28.32  ? 543 GLN D CA    1 
ATOM   7404  C  C     . GLN F 3 247 ? 130.126 3.057   -41.297 1.00 27.97  ? 543 GLN D C     1 
ATOM   7405  O  O     . GLN F 3 247 ? 130.072 4.227   -40.911 1.00 27.62  ? 543 GLN D O     1 
ATOM   7406  C  CB    . GLN F 3 247 ? 131.273 3.945   -43.341 1.00 28.44  ? 543 GLN D CB    1 
ATOM   7407  C  CG    . GLN F 3 247 ? 132.601 3.842   -44.078 1.00 30.21  ? 543 GLN D CG    1 
ATOM   7408  C  CD    . GLN F 3 247 ? 132.823 5.019   -44.990 1.00 31.57  ? 543 GLN D CD    1 
ATOM   7409  O  OE1   . GLN F 3 247 ? 131.870 5.564   -45.553 1.00 32.10  ? 543 GLN D OE1   1 
ATOM   7410  N  NE2   . GLN F 3 247 ? 134.077 5.427   -45.142 1.00 31.61  ? 543 GLN D NE2   1 
ATOM   7411  N  N     . LEU F 3 248 ? 129.513 2.052   -40.673 1.00 27.58  ? 544 LEU D N     1 
ATOM   7412  C  CA    . LEU F 3 248 ? 128.859 2.257   -39.393 1.00 27.16  ? 544 LEU D CA    1 
ATOM   7413  C  C     . LEU F 3 248 ? 129.965 2.508   -38.383 1.00 26.77  ? 544 LEU D C     1 
ATOM   7414  O  O     . LEU F 3 248 ? 131.063 1.977   -38.526 1.00 26.77  ? 544 LEU D O     1 
ATOM   7415  C  CB    . LEU F 3 248 ? 128.033 1.034   -39.000 1.00 27.03  ? 544 LEU D CB    1 
ATOM   7416  C  CG    . LEU F 3 248 ? 126.945 0.652   -40.005 1.00 27.48  ? 544 LEU D CG    1 
ATOM   7417  C  CD1   . LEU F 3 248 ? 126.139 -0.567  -39.542 1.00 26.29  ? 544 LEU D CD1   1 
ATOM   7418  C  CD2   . LEU F 3 248 ? 126.029 1.840   -40.269 1.00 27.12  ? 544 LEU D CD2   1 
ATOM   7419  N  N     . PRO F 3 249 ? 129.702 3.359   -37.391 1.00 26.58  ? 545 PRO D N     1 
ATOM   7420  C  CA    . PRO F 3 249 ? 130.672 3.695   -36.348 1.00 26.93  ? 545 PRO D CA    1 
ATOM   7421  C  C     . PRO F 3 249 ? 131.172 2.500   -35.538 1.00 27.18  ? 545 PRO D C     1 
ATOM   7422  O  O     . PRO F 3 249 ? 130.383 1.623   -35.183 1.00 27.57  ? 545 PRO D O     1 
ATOM   7423  C  CB    . PRO F 3 249 ? 129.901 4.667   -35.445 1.00 27.12  ? 545 PRO D CB    1 
ATOM   7424  C  CG    . PRO F 3 249 ? 128.458 4.481   -35.805 1.00 27.21  ? 545 PRO D CG    1 
ATOM   7425  C  CD    . PRO F 3 249 ? 128.444 4.102   -37.242 1.00 26.57  ? 545 PRO D CD    1 
ATOM   7426  N  N     . VAL F 3 250 ? 132.476 2.474   -35.256 1.00 27.45  ? 546 VAL D N     1 
ATOM   7427  C  CA    . VAL F 3 250 ? 133.092 1.396   -34.468 1.00 27.74  ? 546 VAL D CA    1 
ATOM   7428  C  C     . VAL F 3 250 ? 133.022 1.650   -32.956 1.00 28.24  ? 546 VAL D C     1 
ATOM   7429  O  O     . VAL F 3 250 ? 133.807 2.417   -32.396 1.00 28.33  ? 546 VAL D O     1 
ATOM   7430  C  CB    . VAL F 3 250 ? 134.568 1.133   -34.871 1.00 27.52  ? 546 VAL D CB    1 
ATOM   7431  C  CG1   . VAL F 3 250 ? 135.180 0.049   -33.981 1.00 27.27  ? 546 VAL D CG1   1 
ATOM   7432  C  CG2   . VAL F 3 250 ? 134.662 0.732   -36.319 1.00 26.30  ? 546 VAL D CG2   1 
ATOM   7433  N  N     . LEU F 3 251 ? 132.090 0.975   -32.301 1.00 28.98  ? 547 LEU D N     1 
ATOM   7434  C  CA    . LEU F 3 251 ? 131.885 1.145   -30.875 1.00 29.58  ? 547 LEU D CA    1 
ATOM   7435  C  C     . LEU F 3 251 ? 132.868 0.350   -30.021 1.00 30.29  ? 547 LEU D C     1 
ATOM   7436  O  O     . LEU F 3 251 ? 133.162 0.740   -28.888 1.00 30.59  ? 547 LEU D O     1 
ATOM   7437  C  CB    . LEU F 3 251 ? 130.461 0.748   -30.502 1.00 29.28  ? 547 LEU D CB    1 
ATOM   7438  C  CG    . LEU F 3 251 ? 129.333 1.388   -31.313 1.00 29.45  ? 547 LEU D CG    1 
ATOM   7439  C  CD1   . LEU F 3 251 ? 127.995 1.003   -30.706 1.00 28.03  ? 547 LEU D CD1   1 
ATOM   7440  C  CD2   . LEU F 3 251 ? 129.468 2.916   -31.404 1.00 29.12  ? 547 LEU D CD2   1 
ATOM   7441  N  N     . LYS F 3 252 ? 133.375 -0.760  -30.548 1.00 30.96  ? 548 LYS D N     1 
ATOM   7442  C  CA    . LYS F 3 252 ? 134.246 -1.608  -29.753 1.00 31.66  ? 548 LYS D CA    1 
ATOM   7443  C  C     . LYS F 3 252 ? 135.148 -2.497  -30.598 1.00 32.07  ? 548 LYS D C     1 
ATOM   7444  O  O     . LYS F 3 252 ? 134.787 -2.899  -31.697 1.00 31.94  ? 548 LYS D O     1 
ATOM   7445  C  CB    . LYS F 3 252 ? 133.395 -2.460  -28.805 1.00 31.65  ? 548 LYS D CB    1 
ATOM   7446  C  CG    . LYS F 3 252 ? 134.116 -2.873  -27.516 1.00 32.46  ? 548 LYS D CG    1 
ATOM   7447  C  CD    . LYS F 3 252 ? 133.121 -3.205  -26.404 1.00 33.07  ? 548 LYS D CD    1 
ATOM   7448  C  CE    . LYS F 3 252 ? 132.460 -4.559  -26.597 1.00 33.01  ? 548 LYS D CE    1 
ATOM   7449  N  NZ    . LYS F 3 252 ? 133.417 -5.676  -26.354 1.00 33.45  ? 548 LYS D NZ    1 
ATOM   7450  N  N     . LYS F 3 253 ? 136.329 -2.797  -30.075 1.00 32.89  ? 549 LYS D N     1 
ATOM   7451  C  CA    . LYS F 3 253 ? 137.262 -3.681  -30.761 1.00 33.82  ? 549 LYS D CA    1 
ATOM   7452  C  C     . LYS F 3 253 ? 137.675 -4.833  -29.851 1.00 34.01  ? 549 LYS D C     1 
ATOM   7453  O  O     . LYS F 3 253 ? 137.702 -4.683  -28.636 1.00 34.32  ? 549 LYS D O     1 
ATOM   7454  C  CB    . LYS F 3 253 ? 138.505 -2.908  -31.221 1.00 33.66  ? 549 LYS D CB    1 
ATOM   7455  C  CG    . LYS F 3 253 ? 138.239 -1.929  -32.355 1.00 34.22  ? 549 LYS D CG    1 
ATOM   7456  C  CD    . LYS F 3 253 ? 139.520 -1.375  -32.964 1.00 34.39  ? 549 LYS D CD    1 
ATOM   7457  C  CE    . LYS F 3 253 ? 139.207 -0.646  -34.272 1.00 36.08  ? 549 LYS D CE    1 
ATOM   7458  N  NZ    . LYS F 3 253 ? 140.421 -0.228  -35.048 1.00 35.86  ? 549 LYS D NZ    1 
ATOM   7459  N  N     . THR F 3 254 ? 137.960 -5.990  -30.437 1.00 34.15  ? 550 THR D N     1 
ATOM   7460  C  CA    . THR F 3 254 ? 138.519 -7.105  -29.680 1.00 34.52  ? 550 THR D CA    1 
ATOM   7461  C  C     . THR F 3 254 ? 139.930 -7.299  -30.219 1.00 34.56  ? 550 THR D C     1 
ATOM   7462  O  O     . THR F 3 254 ? 140.283 -6.727  -31.253 1.00 34.89  ? 550 THR D O     1 
ATOM   7463  C  CB    . THR F 3 254 ? 137.686 -8.416  -29.802 1.00 34.70  ? 550 THR D CB    1 
ATOM   7464  O  OG1   . THR F 3 254 ? 137.422 -8.710  -31.181 1.00 35.52  ? 550 THR D OG1   1 
ATOM   7465  C  CG2   . THR F 3 254 ? 136.354 -8.310  -29.050 1.00 34.71  ? 550 THR D CG2   1 
ATOM   7466  N  N     . LYS F 3 255 ? 140.746 -8.094  -29.540 1.00 34.36  ? 551 LYS D N     1 
ATOM   7467  C  CA    . LYS F 3 255 ? 142.135 -8.262  -29.975 1.00 34.02  ? 551 LYS D CA    1 
ATOM   7468  C  C     . LYS F 3 255 ? 142.269 -8.769  -31.416 1.00 33.14  ? 551 LYS D C     1 
ATOM   7469  O  O     . LYS F 3 255 ? 143.295 -8.542  -32.051 1.00 33.18  ? 551 LYS D O     1 
ATOM   7470  C  CB    . LYS F 3 255 ? 142.937 -9.130  -28.992 1.00 34.36  ? 551 LYS D CB    1 
ATOM   7471  C  CG    . LYS F 3 255 ? 142.378 -10.528 -28.798 1.00 36.08  ? 551 LYS D CG    1 
ATOM   7472  C  CD    . LYS F 3 255 ? 143.320 -11.375 -27.957 1.00 38.70  ? 551 LYS D CD    1 
ATOM   7473  C  CE    . LYS F 3 255 ? 142.780 -12.787 -27.760 1.00 39.87  ? 551 LYS D CE    1 
ATOM   7474  N  NZ    . LYS F 3 255 ? 143.681 -13.594 -26.880 1.00 41.97  ? 551 LYS D NZ    1 
ATOM   7475  N  N     . THR F 3 256 ? 141.241 -9.430  -31.942 1.00 32.07  ? 552 THR D N     1 
ATOM   7476  C  CA    . THR F 3 256 ? 141.312 -9.913  -33.325 1.00 31.16  ? 552 THR D CA    1 
ATOM   7477  C  C     . THR F 3 256 ? 140.738 -8.948  -34.354 1.00 30.57  ? 552 THR D C     1 
ATOM   7478  O  O     . THR F 3 256 ? 140.978 -9.128  -35.547 1.00 30.36  ? 552 THR D O     1 
ATOM   7479  C  CB    . THR F 3 256 ? 140.632 -11.272 -33.528 1.00 31.03  ? 552 THR D CB    1 
ATOM   7480  O  OG1   . THR F 3 256 ? 139.227 -11.156 -33.267 1.00 30.51  ? 552 THR D OG1   1 
ATOM   7481  C  CG2   . THR F 3 256 ? 141.262 -12.323 -32.624 1.00 31.75  ? 552 THR D CG2   1 
ATOM   7482  N  N     . GLY F 3 257 ? 139.979 -7.946  -33.902 1.00 29.76  ? 553 GLY D N     1 
ATOM   7483  C  CA    . GLY F 3 257 ? 139.376 -6.966  -34.809 1.00 29.07  ? 553 GLY D CA    1 
ATOM   7484  C  C     . GLY F 3 257 ? 138.141 -6.267  -34.270 1.00 28.60  ? 553 GLY D C     1 
ATOM   7485  O  O     . GLY F 3 257 ? 138.010 -6.064  -33.065 1.00 28.61  ? 553 GLY D O     1 
ATOM   7486  N  N     . TYR F 3 258 ? 137.241 -5.884  -35.170 1.00 28.29  ? 554 TYR D N     1 
ATOM   7487  C  CA    . TYR F 3 258 ? 135.992 -5.223  -34.793 1.00 28.05  ? 554 TYR D CA    1 
ATOM   7488  C  C     . TYR F 3 258 ? 135.082 -6.167  -34.024 1.00 28.03  ? 554 TYR D C     1 
ATOM   7489  O  O     . TYR F 3 258 ? 135.074 -7.373  -34.286 1.00 28.26  ? 554 TYR D O     1 
ATOM   7490  C  CB    . TYR F 3 258 ? 135.218 -4.788  -36.028 1.00 27.92  ? 554 TYR D CB    1 
ATOM   7491  C  CG    . TYR F 3 258 ? 135.977 -3.939  -37.009 1.00 28.55  ? 554 TYR D CG    1 
ATOM   7492  C  CD1   . TYR F 3 258 ? 136.158 -4.361  -38.332 1.00 28.70  ? 554 TYR D CD1   1 
ATOM   7493  C  CD2   . TYR F 3 258 ? 136.509 -2.706  -36.626 1.00 28.42  ? 554 TYR D CD2   1 
ATOM   7494  C  CE1   . TYR F 3 258 ? 136.845 -3.574  -39.249 1.00 28.00  ? 554 TYR D CE1   1 
ATOM   7495  C  CE2   . TYR F 3 258 ? 137.204 -1.921  -37.525 1.00 28.19  ? 554 TYR D CE2   1 
ATOM   7496  C  CZ    . TYR F 3 258 ? 137.370 -2.356  -38.834 1.00 28.61  ? 554 TYR D CZ    1 
ATOM   7497  O  OH    . TYR F 3 258 ? 138.064 -1.561  -39.720 1.00 28.69  ? 554 TYR D OH    1 
ATOM   7498  N  N     . SER F 3 259 ? 134.303 -5.624  -33.089 1.00 27.68  ? 555 SER D N     1 
ATOM   7499  C  CA    . SER F 3 259 ? 133.305 -6.427  -32.393 1.00 27.34  ? 555 SER D CA    1 
ATOM   7500  C  C     . SER F 3 259 ? 131.969 -6.355  -33.113 1.00 27.02  ? 555 SER D C     1 
ATOM   7501  O  O     . SER F 3 259 ? 131.532 -5.279  -33.520 1.00 27.10  ? 555 SER D O     1 
ATOM   7502  C  CB    . SER F 3 259 ? 133.113 -5.977  -30.947 1.00 27.43  ? 555 SER D CB    1 
ATOM   7503  O  OG    . SER F 3 259 ? 132.030 -6.688  -30.358 1.00 27.62  ? 555 SER D OG    1 
ATOM   7504  N  N     . THR F 3 260 ? 131.330 -7.509  -33.273 1.00 26.62  ? 556 THR D N     1 
ATOM   7505  C  CA    . THR F 3 260 ? 130.005 -7.576  -33.868 1.00 25.98  ? 556 THR D CA    1 
ATOM   7506  C  C     . THR F 3 260 ? 129.071 -8.198  -32.851 1.00 25.84  ? 556 THR D C     1 
ATOM   7507  O  O     . THR F 3 260 ? 128.078 -8.813  -33.230 1.00 25.89  ? 556 THR D O     1 
ATOM   7508  C  CB    . THR F 3 260 ? 129.955 -8.428  -35.170 1.00 26.05  ? 556 THR D CB    1 
ATOM   7509  O  OG1   . THR F 3 260 ? 130.205 -9.817  -34.875 1.00 26.47  ? 556 THR D OG1   1 
ATOM   7510  C  CG2   . THR F 3 260 ? 130.951 -7.925  -36.199 1.00 25.34  ? 556 THR D CG2   1 
ATOM   7511  N  N     . SER F 3 261 ? 129.380 -8.036  -31.564 1.00 25.38  ? 557 SER D N     1 
ATOM   7512  C  CA    . SER F 3 261 ? 128.546 -8.629  -30.527 1.00 25.60  ? 557 SER D CA    1 
ATOM   7513  C  C     . SER F 3 261 ? 127.141 -8.046  -30.534 1.00 25.78  ? 557 SER D C     1 
ATOM   7514  O  O     . SER F 3 261 ? 126.912 -6.955  -31.064 1.00 25.80  ? 557 SER D O     1 
ATOM   7515  C  CB    . SER F 3 261 ? 129.183 -8.533  -29.135 1.00 25.65  ? 557 SER D CB    1 
ATOM   7516  O  OG    . SER F 3 261 ? 129.331 -7.192  -28.706 1.00 25.86  ? 557 SER D OG    1 
ATOM   7517  N  N     . ALA F 3 262 ? 126.203 -8.801  -29.964 1.00 25.94  ? 558 ALA D N     1 
ATOM   7518  C  CA    . ALA F 3 262 ? 124.802 -8.415  -29.915 1.00 25.98  ? 558 ALA D CA    1 
ATOM   7519  C  C     . ALA F 3 262 ? 124.624 -7.051  -29.270 1.00 26.36  ? 558 ALA D C     1 
ATOM   7520  O  O     . ALA F 3 262 ? 123.742 -6.298  -29.650 1.00 26.18  ? 558 ALA D O     1 
ATOM   7521  C  CB    . ALA F 3 262 ? 123.994 -9.464  -29.178 1.00 25.57  ? 558 ALA D CB    1 
ATOM   7522  N  N     . ASP F 3 263 ? 125.471 -6.744  -28.295 1.00 27.49  ? 559 ASP D N     1 
ATOM   7523  C  CA    . ASP F 3 263 ? 125.424 -5.465  -27.601 1.00 28.81  ? 559 ASP D CA    1 
ATOM   7524  C  C     . ASP F 3 263 ? 125.843 -4.308  -28.474 1.00 29.40  ? 559 ASP D C     1 
ATOM   7525  O  O     . ASP F 3 263 ? 125.262 -3.220  -28.390 1.00 29.63  ? 559 ASP D O     1 
ATOM   7526  C  CB    . ASP F 3 263 ? 126.285 -5.493  -26.355 1.00 28.84  ? 559 ASP D CB    1 
ATOM   7527  C  CG    . ASP F 3 263 ? 125.542 -6.043  -25.175 1.00 31.53  ? 559 ASP D CG    1 
ATOM   7528  O  OD1   . ASP F 3 263 ? 124.434 -6.610  -25.384 1.00 32.34  ? 559 ASP D OD1   1 
ATOM   7529  O  OD2   . ASP F 3 263 ? 126.052 -5.893  -24.040 1.00 34.55  ? 559 ASP D OD2   1 
ATOM   7530  N  N     . VAL F 3 264 ? 126.860 -4.540  -29.300 1.00 29.52  ? 560 VAL D N     1 
ATOM   7531  C  CA    . VAL F 3 264 ? 127.317 -3.522  -30.221 1.00 29.81  ? 560 VAL D CA    1 
ATOM   7532  C  C     . VAL F 3 264 ? 126.259 -3.318  -31.307 1.00 29.91  ? 560 VAL D C     1 
ATOM   7533  O  O     . VAL F 3 264 ? 125.836 -2.195  -31.576 1.00 29.98  ? 560 VAL D O     1 
ATOM   7534  C  CB    . VAL F 3 264 ? 128.676 -3.904  -30.832 1.00 29.86  ? 560 VAL D CB    1 
ATOM   7535  C  CG1   . VAL F 3 264 ? 129.056 -2.957  -31.962 1.00 30.03  ? 560 VAL D CG1   1 
ATOM   7536  C  CG2   . VAL F 3 264 ? 129.745 -3.918  -29.754 1.00 29.39  ? 560 VAL D CG2   1 
ATOM   7537  N  N     . LEU F 3 265 ? 125.803 -4.410  -31.902 1.00 30.11  ? 561 LEU D N     1 
ATOM   7538  C  CA    . LEU F 3 265 ? 124.844 -4.308  -32.995 1.00 30.34  ? 561 LEU D CA    1 
ATOM   7539  C  C     . LEU F 3 265 ? 123.538 -3.667  -32.571 1.00 30.62  ? 561 LEU D C     1 
ATOM   7540  O  O     . LEU F 3 265 ? 122.864 -3.056  -33.393 1.00 31.12  ? 561 LEU D O     1 
ATOM   7541  C  CB    . LEU F 3 265 ? 124.562 -5.667  -33.652 1.00 30.24  ? 561 LEU D CB    1 
ATOM   7542  C  CG    . LEU F 3 265 ? 125.710 -6.491  -34.242 1.00 29.37  ? 561 LEU D CG    1 
ATOM   7543  C  CD1   . LEU F 3 265 ? 125.152 -7.394  -35.313 1.00 27.65  ? 561 LEU D CD1   1 
ATOM   7544  C  CD2   . LEU F 3 265 ? 126.790 -5.605  -34.825 1.00 29.19  ? 561 LEU D CD2   1 
ATOM   7545  N  N     . GLU F 3 266 ? 123.161 -3.803  -31.306 1.00 30.74  ? 562 GLU D N     1 
ATOM   7546  C  CA    . GLU F 3 266 ? 121.904 -3.198  -30.867 1.00 31.06  ? 562 GLU D CA    1 
ATOM   7547  C  C     . GLU F 3 266 ? 122.002 -1.685  -30.782 1.00 30.70  ? 562 GLU D C     1 
ATOM   7548  O  O     . GLU F 3 266 ? 121.041 -0.973  -31.062 1.00 30.60  ? 562 GLU D O     1 
ATOM   7549  C  CB    . GLU F 3 266 ? 121.426 -3.792  -29.552 1.00 31.51  ? 562 GLU D CB    1 
ATOM   7550  C  CG    . GLU F 3 266 ? 120.668 -5.102  -29.742 1.00 33.60  ? 562 GLU D CG    1 
ATOM   7551  C  CD    . GLU F 3 266 ? 120.483 -5.859  -28.444 1.00 36.55  ? 562 GLU D CD    1 
ATOM   7552  O  OE1   . GLU F 3 266 ? 120.834 -5.305  -27.372 1.00 38.03  ? 562 GLU D OE1   1 
ATOM   7553  O  OE2   . GLU F 3 266 ? 119.993 -7.007  -28.497 1.00 37.34  ? 562 GLU D OE2   1 
ATOM   7554  N  N     . LYS F 3 267 ? 123.186 -1.205  -30.428 1.00 30.50  ? 563 LYS D N     1 
ATOM   7555  C  CA    . LYS F 3 267 ? 123.439 0.219   -30.332 1.00 30.47  ? 563 LYS D CA    1 
ATOM   7556  C  C     . LYS F 3 267 ? 123.606 0.864   -31.722 1.00 30.37  ? 563 LYS D C     1 
ATOM   7557  O  O     . LYS F 3 267 ? 123.573 2.088   -31.858 1.00 30.60  ? 563 LYS D O     1 
ATOM   7558  C  CB    . LYS F 3 267 ? 124.666 0.474   -29.452 1.00 30.15  ? 563 LYS D CB    1 
ATOM   7559  C  CG    . LYS F 3 267 ? 124.584 -0.149  -28.070 1.00 30.25  ? 563 LYS D CG    1 
ATOM   7560  C  CD    . LYS F 3 267 ? 125.806 0.209   -27.217 1.00 31.00  ? 563 LYS D CD    1 
ATOM   7561  C  CE    . LYS F 3 267 ? 125.880 -0.631  -25.937 1.00 31.39  ? 563 LYS D CE    1 
ATOM   7562  N  NZ    . LYS F 3 267 ? 124.639 -0.507  -25.136 1.00 31.44  ? 563 LYS D NZ    1 
ATOM   7563  N  N     . LEU F 3 268 ? 123.783 0.038   -32.746 1.00 30.05  ? 564 LEU D N     1 
ATOM   7564  C  CA    . LEU F 3 268 ? 123.950 0.529   -34.101 1.00 29.82  ? 564 LEU D CA    1 
ATOM   7565  C  C     . LEU F 3 268 ? 122.626 0.649   -34.837 1.00 29.84  ? 564 LEU D C     1 
ATOM   7566  O  O     . LEU F 3 268 ? 122.572 1.208   -35.923 1.00 29.91  ? 564 LEU D O     1 
ATOM   7567  C  CB    . LEU F 3 268 ? 124.879 -0.392  -34.881 1.00 29.73  ? 564 LEU D CB    1 
ATOM   7568  C  CG    . LEU F 3 268 ? 126.331 -0.393  -34.426 1.00 29.72  ? 564 LEU D CG    1 
ATOM   7569  C  CD1   . LEU F 3 268 ? 127.115 -1.421  -35.219 1.00 29.87  ? 564 LEU D CD1   1 
ATOM   7570  C  CD2   . LEU F 3 268 ? 126.928 0.993   -34.599 1.00 29.52  ? 564 LEU D CD2   1 
ATOM   7571  N  N     . ALA F 3 269 ? 121.563 0.120   -34.237 1.00 30.02  ? 565 ALA D N     1 
ATOM   7572  C  CA    . ALA F 3 269 ? 120.229 0.108   -34.847 1.00 30.00  ? 565 ALA D CA    1 
ATOM   7573  C  C     . ALA F 3 269 ? 119.772 1.447   -35.431 1.00 30.08  ? 565 ALA D C     1 
ATOM   7574  O  O     . ALA F 3 269 ? 119.192 1.478   -36.511 1.00 30.29  ? 565 ALA D O     1 
ATOM   7575  C  CB    . ALA F 3 269 ? 119.184 -0.464  -33.872 1.00 30.01  ? 565 ALA D CB    1 
ATOM   7576  N  N     . PRO F 3 270 ? 120.002 2.561   -34.720 1.00 30.33  ? 566 PRO D N     1 
ATOM   7577  C  CA    . PRO F 3 270 ? 119.636 3.842   -35.369 1.00 30.24  ? 566 PRO D CA    1 
ATOM   7578  C  C     . PRO F 3 270 ? 120.373 4.174   -36.683 1.00 29.82  ? 566 PRO D C     1 
ATOM   7579  O  O     . PRO F 3 270 ? 119.925 5.049   -37.419 1.00 29.61  ? 566 PRO D O     1 
ATOM   7580  C  CB    . PRO F 3 270 ? 119.975 4.893   -34.297 1.00 30.13  ? 566 PRO D CB    1 
ATOM   7581  C  CG    . PRO F 3 270 ? 119.965 4.131   -33.002 1.00 30.58  ? 566 PRO D CG    1 
ATOM   7582  C  CD    . PRO F 3 270 ? 120.494 2.765   -33.344 1.00 30.23  ? 566 PRO D CD    1 
ATOM   7583  N  N     . TYR F 3 271 ? 121.466 3.477   -36.984 1.00 29.44  ? 567 TYR D N     1 
ATOM   7584  C  CA    . TYR F 3 271 ? 122.265 3.809   -38.163 1.00 29.47  ? 567 TYR D CA    1 
ATOM   7585  C  C     . TYR F 3 271 ? 121.933 3.023   -39.420 1.00 29.67  ? 567 TYR D C     1 
ATOM   7586  O  O     . TYR F 3 271 ? 122.108 3.527   -40.527 1.00 29.73  ? 567 TYR D O     1 
ATOM   7587  C  CB    . TYR F 3 271 ? 123.761 3.679   -37.874 1.00 29.27  ? 567 TYR D CB    1 
ATOM   7588  C  CG    . TYR F 3 271 ? 124.246 4.570   -36.764 1.00 29.40  ? 567 TYR D CG    1 
ATOM   7589  C  CD1   . TYR F 3 271 ? 124.061 4.214   -35.432 1.00 29.60  ? 567 TYR D CD1   1 
ATOM   7590  C  CD2   . TYR F 3 271 ? 124.894 5.767   -37.041 1.00 29.26  ? 567 TYR D CD2   1 
ATOM   7591  C  CE1   . TYR F 3 271 ? 124.500 5.025   -34.411 1.00 29.70  ? 567 TYR D CE1   1 
ATOM   7592  C  CE2   . TYR F 3 271 ? 125.338 6.589   -36.021 1.00 29.36  ? 567 TYR D CE2   1 
ATOM   7593  C  CZ    . TYR F 3 271 ? 125.138 6.208   -34.713 1.00 29.60  ? 567 TYR D CZ    1 
ATOM   7594  O  OH    . TYR F 3 271 ? 125.575 7.006   -33.694 1.00 30.20  ? 567 TYR D OH    1 
ATOM   7595  N  N     . HIS F 3 272 ? 121.480 1.785   -39.264 1.00 30.01  ? 568 HIS D N     1 
ATOM   7596  C  CA    . HIS F 3 272 ? 121.213 0.954   -40.433 1.00 30.57  ? 568 HIS D CA    1 
ATOM   7597  C  C     . HIS F 3 272 ? 120.294 -0.221  -40.113 1.00 30.70  ? 568 HIS D C     1 
ATOM   7598  O  O     . HIS F 3 272 ? 120.523 -0.975  -39.178 1.00 30.87  ? 568 HIS D O     1 
ATOM   7599  C  CB    . HIS F 3 272 ? 122.528 0.441   -41.043 1.00 30.56  ? 568 HIS D CB    1 
ATOM   7600  C  CG    . HIS F 3 272 ? 122.440 0.145   -42.505 1.00 30.66  ? 568 HIS D CG    1 
ATOM   7601  N  ND1   . HIS F 3 272 ? 121.569 -0.788  -43.022 1.00 31.20  ? 568 HIS D ND1   1 
ATOM   7602  C  CD2   . HIS F 3 272 ? 123.118 0.655   -43.560 1.00 30.84  ? 568 HIS D CD2   1 
ATOM   7603  C  CE1   . HIS F 3 272 ? 121.705 -0.831  -44.337 1.00 31.48  ? 568 HIS D CE1   1 
ATOM   7604  N  NE2   . HIS F 3 272 ? 122.641 0.033   -44.687 1.00 31.03  ? 568 HIS D NE2   1 
ATOM   7605  N  N     . GLU F 3 273 ? 119.255 -0.366  -40.917 1.00 31.22  ? 569 GLU D N     1 
ATOM   7606  C  CA    . GLU F 3 273 ? 118.284 -1.436  -40.768 1.00 31.54  ? 569 GLU D CA    1 
ATOM   7607  C  C     . GLU F 3 273 ? 118.882 -2.856  -40.777 1.00 31.12  ? 569 GLU D C     1 
ATOM   7608  O  O     . GLU F 3 273 ? 118.325 -3.785  -40.179 1.00 31.75  ? 569 GLU D O     1 
ATOM   7609  C  CB    . GLU F 3 273 ? 117.247 -1.305  -41.876 1.00 31.90  ? 569 GLU D CB    1 
ATOM   7610  C  CG    . GLU F 3 273 ? 116.510 -2.587  -42.150 1.00 34.16  ? 569 GLU D CG    1 
ATOM   7611  C  CD    . GLU F 3 273 ? 115.447 -2.447  -43.207 1.00 36.65  ? 569 GLU D CD    1 
ATOM   7612  O  OE1   . GLU F 3 273 ? 115.616 -1.593  -44.110 1.00 37.13  ? 569 GLU D OE1   1 
ATOM   7613  O  OE2   . GLU F 3 273 ? 114.454 -3.209  -43.129 1.00 37.08  ? 569 GLU D OE2   1 
ATOM   7614  N  N     . ILE F 3 274 ? 120.022 -3.024  -41.432 1.00 30.29  ? 570 ILE D N     1 
ATOM   7615  C  CA    . ILE F 3 274 ? 120.637 -4.341  -41.566 1.00 29.25  ? 570 ILE D CA    1 
ATOM   7616  C  C     . ILE F 3 274 ? 121.031 -5.031  -40.247 1.00 28.95  ? 570 ILE D C     1 
ATOM   7617  O  O     . ILE F 3 274 ? 121.100 -6.256  -40.199 1.00 28.63  ? 570 ILE D O     1 
ATOM   7618  C  CB    . ILE F 3 274 ? 121.860 -4.285  -42.515 1.00 29.29  ? 570 ILE D CB    1 
ATOM   7619  C  CG1   . ILE F 3 274 ? 122.045 -5.616  -43.246 1.00 28.50  ? 570 ILE D CG1   1 
ATOM   7620  C  CG2   . ILE F 3 274 ? 123.132 -3.822  -41.771 1.00 28.40  ? 570 ILE D CG2   1 
ATOM   7621  C  CD1   . ILE F 3 274 ? 123.149 -5.575  -44.257 1.00 27.88  ? 570 ILE D CD1   1 
ATOM   7622  N  N     . VAL F 3 275 ? 121.272 -4.267  -39.183 1.00 28.53  ? 571 VAL D N     1 
ATOM   7623  C  CA    . VAL F 3 275 ? 121.753 -4.880  -37.944 1.00 28.51  ? 571 VAL D CA    1 
ATOM   7624  C  C     . VAL F 3 275 ? 120.701 -5.743  -37.253 1.00 28.62  ? 571 VAL D C     1 
ATOM   7625  O  O     . VAL F 3 275 ? 120.997 -6.857  -36.818 1.00 28.66  ? 571 VAL D O     1 
ATOM   7626  C  CB    . VAL F 3 275 ? 122.380 -3.861  -36.955 1.00 28.53  ? 571 VAL D CB    1 
ATOM   7627  C  CG1   . VAL F 3 275 ? 123.645 -3.255  -37.539 1.00 27.44  ? 571 VAL D CG1   1 
ATOM   7628  C  CG2   . VAL F 3 275 ? 121.391 -2.788  -36.595 1.00 29.15  ? 571 VAL D CG2   1 
ATOM   7629  N  N     . GLU F 3 276 ? 119.474 -5.250  -37.164 1.00 28.65  ? 572 GLU D N     1 
ATOM   7630  C  CA    . GLU F 3 276 ? 118.413 -6.044  -36.562 1.00 29.02  ? 572 GLU D CA    1 
ATOM   7631  C  C     . GLU F 3 276 ? 118.169 -7.327  -37.354 1.00 28.67  ? 572 GLU D C     1 
ATOM   7632  O  O     . GLU F 3 276 ? 117.793 -8.353  -36.781 1.00 28.92  ? 572 GLU D O     1 
ATOM   7633  C  CB    . GLU F 3 276 ? 117.128 -5.228  -36.400 1.00 28.89  ? 572 GLU D CB    1 
ATOM   7634  C  CG    . GLU F 3 276 ? 117.186 -4.238  -35.240 1.00 29.83  ? 572 GLU D CG    1 
ATOM   7635  C  CD    . GLU F 3 276 ? 115.906 -3.436  -35.054 1.00 30.16  ? 572 GLU D CD    1 
ATOM   7636  O  OE1   . GLU F 3 276 ? 115.389 -2.885  -36.053 1.00 31.00  ? 572 GLU D OE1   1 
ATOM   7637  O  OE2   . GLU F 3 276 ? 115.429 -3.338  -33.895 1.00 31.84  ? 572 GLU D OE2   1 
ATOM   7638  N  N     . ASN F 3 277 ? 118.401 -7.261  -38.664 1.00 28.41  ? 573 ASN D N     1 
ATOM   7639  C  CA    . ASN F 3 277 ? 118.269 -8.415  -39.549 1.00 27.79  ? 573 ASN D CA    1 
ATOM   7640  C  C     . ASN F 3 277 ? 119.351 -9.425  -39.242 1.00 27.55  ? 573 ASN D C     1 
ATOM   7641  O  O     . ASN F 3 277 ? 119.091 -10.629 -39.252 1.00 27.65  ? 573 ASN D O     1 
ATOM   7642  C  CB    . ASN F 3 277 ? 118.368 -7.995  -41.018 1.00 27.77  ? 573 ASN D CB    1 
ATOM   7643  C  CG    . ASN F 3 277 ? 117.067 -7.413  -41.555 1.00 28.09  ? 573 ASN D CG    1 
ATOM   7644  O  OD1   . ASN F 3 277 ? 116.198 -8.143  -42.023 1.00 28.22  ? 573 ASN D OD1   1 
ATOM   7645  N  ND2   . ASN F 3 277 ? 116.944 -6.089  -41.517 1.00 28.13  ? 573 ASN D ND2   1 
ATOM   7646  N  N     . ILE F 3 278 ? 120.561 -8.926  -38.968 1.00 26.90  ? 574 ILE D N     1 
ATOM   7647  C  CA    . ILE F 3 278 ? 121.708 -9.784  -38.651 1.00 26.18  ? 574 ILE D CA    1 
ATOM   7648  C  C     . ILE F 3 278 ? 121.456 -10.538 -37.349 1.00 26.13  ? 574 ILE D C     1 
ATOM   7649  O  O     . ILE F 3 278 ? 121.564 -11.770 -37.311 1.00 26.15  ? 574 ILE D O     1 
ATOM   7650  C  CB    . ILE F 3 278 ? 123.051 -8.994  -38.618 1.00 26.06  ? 574 ILE D CB    1 
ATOM   7651  C  CG1   . ILE F 3 278 ? 123.468 -8.611  -40.034 1.00 24.94  ? 574 ILE D CG1   1 
ATOM   7652  C  CG2   . ILE F 3 278 ? 124.160 -9.824  -38.009 1.00 25.26  ? 574 ILE D CG2   1 
ATOM   7653  C  CD1   . ILE F 3 278 ? 124.316 -7.377  -40.096 1.00 24.04  ? 574 ILE D CD1   1 
ATOM   7654  N  N     . LEU F 3 279 ? 121.089 -9.809  -36.299 1.00 25.91  ? 575 LEU D N     1 
ATOM   7655  C  CA    . LEU F 3 279 ? 120.742 -10.440 -35.030 1.00 25.86  ? 575 LEU D CA    1 
ATOM   7656  C  C     . LEU F 3 279 ? 119.714 -11.555 -35.221 1.00 25.89  ? 575 LEU D C     1 
ATOM   7657  O  O     . LEU F 3 279 ? 119.943 -12.691 -34.813 1.00 25.75  ? 575 LEU D O     1 
ATOM   7658  C  CB    . LEU F 3 279 ? 120.199 -9.415  -34.051 1.00 25.67  ? 575 LEU D CB    1 
ATOM   7659  C  CG    . LEU F 3 279 ? 121.200 -8.371  -33.596 1.00 25.43  ? 575 LEU D CG    1 
ATOM   7660  C  CD1   . LEU F 3 279 ? 120.483 -7.389  -32.686 1.00 25.64  ? 575 LEU D CD1   1 
ATOM   7661  C  CD2   . LEU F 3 279 ? 122.386 -9.020  -32.895 1.00 24.09  ? 575 LEU D CD2   1 
ATOM   7662  N  N     . HIS F 3 280 ? 118.588 -11.220 -35.845 1.00 25.85  ? 576 HIS D N     1 
ATOM   7663  C  CA    . HIS F 3 280 ? 117.560 -12.207 -36.146 1.00 25.97  ? 576 HIS D CA    1 
ATOM   7664  C  C     . HIS F 3 280 ? 118.185 -13.432 -36.825 1.00 25.79  ? 576 HIS D C     1 
ATOM   7665  O  O     . HIS F 3 280 ? 117.976 -14.563 -36.395 1.00 25.60  ? 576 HIS D O     1 
ATOM   7666  C  CB    . HIS F 3 280 ? 116.447 -11.572 -36.989 1.00 25.98  ? 576 HIS D CB    1 
ATOM   7667  C  CG    . HIS F 3 280 ? 115.197 -12.399 -37.087 1.00 27.27  ? 576 HIS D CG    1 
ATOM   7668  N  ND1   . HIS F 3 280 ? 114.408 -12.427 -38.220 1.00 27.72  ? 576 HIS D ND1   1 
ATOM   7669  C  CD2   . HIS F 3 280 ? 114.609 -13.242 -36.201 1.00 27.94  ? 576 HIS D CD2   1 
ATOM   7670  C  CE1   . HIS F 3 280 ? 113.376 -13.228 -38.019 1.00 27.85  ? 576 HIS D CE1   1 
ATOM   7671  N  NE2   . HIS F 3 280 ? 113.478 -13.742 -36.805 1.00 27.99  ? 576 HIS D NE2   1 
ATOM   7672  N  N     . TYR F 3 281 ? 118.992 -13.201 -37.855 1.00 25.98  ? 577 TYR D N     1 
ATOM   7673  C  CA    . TYR F 3 281 ? 119.665 -14.288 -38.552 1.00 25.89  ? 577 TYR D CA    1 
ATOM   7674  C  C     . TYR F 3 281 ? 120.567 -15.144 -37.655 1.00 25.97  ? 577 TYR D C     1 
ATOM   7675  O  O     . TYR F 3 281 ? 120.463 -16.361 -37.695 1.00 25.93  ? 577 TYR D O     1 
ATOM   7676  C  CB    . TYR F 3 281 ? 120.459 -13.766 -39.751 1.00 25.97  ? 577 TYR D CB    1 
ATOM   7677  C  CG    . TYR F 3 281 ? 121.208 -14.858 -40.498 1.00 25.99  ? 577 TYR D CG    1 
ATOM   7678  C  CD1   . TYR F 3 281 ? 120.660 -15.469 -41.623 1.00 25.57  ? 577 TYR D CD1   1 
ATOM   7679  C  CD2   . TYR F 3 281 ? 122.462 -15.284 -40.067 1.00 25.86  ? 577 TYR D CD2   1 
ATOM   7680  C  CE1   . TYR F 3 281 ? 121.345 -16.470 -42.292 1.00 25.34  ? 577 TYR D CE1   1 
ATOM   7681  C  CE2   . TYR F 3 281 ? 123.142 -16.279 -40.720 1.00 25.40  ? 577 TYR D CE2   1 
ATOM   7682  C  CZ    . TYR F 3 281 ? 122.587 -16.863 -41.830 1.00 25.62  ? 577 TYR D CZ    1 
ATOM   7683  O  OH    . TYR F 3 281 ? 123.296 -17.844 -42.471 1.00 26.84  ? 577 TYR D OH    1 
ATOM   7684  N  N     . ARG F 3 282 ? 121.454 -14.532 -36.868 1.00 26.05  ? 578 ARG D N     1 
ATOM   7685  C  CA    . ARG F 3 282 ? 122.392 -15.319 -36.037 1.00 26.25  ? 578 ARG D CA    1 
ATOM   7686  C  C     . ARG F 3 282 ? 121.709 -16.129 -34.933 1.00 26.75  ? 578 ARG D C     1 
ATOM   7687  O  O     . ARG F 3 282 ? 122.247 -17.136 -34.481 1.00 27.08  ? 578 ARG D O     1 
ATOM   7688  C  CB    . ARG F 3 282 ? 123.556 -14.477 -35.472 1.00 26.02  ? 578 ARG D CB    1 
ATOM   7689  C  CG    . ARG F 3 282 ? 124.550 -13.989 -36.534 1.00 26.43  ? 578 ARG D CG    1 
ATOM   7690  C  CD    . ARG F 3 282 ? 125.891 -13.427 -36.000 1.00 25.99  ? 578 ARG D CD    1 
ATOM   7691  N  NE    . ARG F 3 282 ? 125.730 -12.373 -34.998 1.00 25.12  ? 578 ARG D NE    1 
ATOM   7692  C  CZ    . ARG F 3 282 ? 126.662 -11.467 -34.695 1.00 25.30  ? 578 ARG D CZ    1 
ATOM   7693  N  NH1   . ARG F 3 282 ? 127.830 -11.454 -35.335 1.00 24.84  ? 578 ARG D NH1   1 
ATOM   7694  N  NH2   . ARG F 3 282 ? 126.417 -10.554 -33.761 1.00 23.95  ? 578 ARG D NH2   1 
ATOM   7695  N  N     . GLN F 3 283 ? 120.529 -15.709 -34.497 1.00 27.25  ? 579 GLN D N     1 
ATOM   7696  C  CA    . GLN F 3 283 ? 119.792 -16.522 -33.526 1.00 28.10  ? 579 GLN D CA    1 
ATOM   7697  C  C     . GLN F 3 283 ? 118.998 -17.667 -34.178 1.00 28.00  ? 579 GLN D C     1 
ATOM   7698  O  O     . GLN F 3 283 ? 118.945 -18.771 -33.632 1.00 28.40  ? 579 GLN D O     1 
ATOM   7699  C  CB    . GLN F 3 283 ? 118.949 -15.675 -32.556 1.00 28.47  ? 579 GLN D CB    1 
ATOM   7700  C  CG    . GLN F 3 283 ? 117.927 -14.750 -33.155 1.00 29.81  ? 579 GLN D CG    1 
ATOM   7701  C  CD    . GLN F 3 283 ? 117.778 -13.490 -32.321 1.00 32.95  ? 579 GLN D CD    1 
ATOM   7702  O  OE1   . GLN F 3 283 ? 118.674 -13.146 -31.550 1.00 34.47  ? 579 GLN D OE1   1 
ATOM   7703  N  NE2   . GLN F 3 283 ? 116.658 -12.786 -32.477 1.00 34.21  ? 579 GLN D NE2   1 
ATOM   7704  N  N     . LEU F 3 284 ? 118.413 -17.423 -35.346 1.00 27.50  ? 580 LEU D N     1 
ATOM   7705  C  CA    . LEU F 3 284 ? 117.762 -18.489 -36.082 1.00 27.06  ? 580 LEU D CA    1 
ATOM   7706  C  C     . LEU F 3 284 ? 118.808 -19.504 -36.522 1.00 27.05  ? 580 LEU D C     1 
ATOM   7707  O  O     . LEU F 3 284 ? 118.499 -20.674 -36.746 1.00 27.28  ? 580 LEU D O     1 
ATOM   7708  C  CB    . LEU F 3 284 ? 117.038 -17.950 -37.318 1.00 27.26  ? 580 LEU D CB    1 
ATOM   7709  C  CG    . LEU F 3 284 ? 115.837 -17.015 -37.186 1.00 27.01  ? 580 LEU D CG    1 
ATOM   7710  C  CD1   . LEU F 3 284 ? 115.248 -16.785 -38.557 1.00 27.03  ? 580 LEU D CD1   1 
ATOM   7711  C  CD2   . LEU F 3 284 ? 114.788 -17.593 -36.261 1.00 27.52  ? 580 LEU D CD2   1 
ATOM   7712  N  N     . GLY F 3 285 ? 120.049 -19.053 -36.661 1.00 26.69  ? 581 GLY D N     1 
ATOM   7713  C  CA    . GLY F 3 285 ? 121.132 -19.935 -37.067 1.00 26.48  ? 581 GLY D CA    1 
ATOM   7714  C  C     . GLY F 3 285 ? 121.578 -20.819 -35.922 1.00 26.49  ? 581 GLY D C     1 
ATOM   7715  O  O     . GLY F 3 285 ? 121.983 -21.959 -36.125 1.00 26.49  ? 581 GLY D O     1 
ATOM   7716  N  N     . LYS F 3 286 ? 121.511 -20.278 -34.711 1.00 26.49  ? 582 LYS D N     1 
ATOM   7717  C  CA    . LYS F 3 286 ? 121.855 -21.030 -33.521 1.00 26.24  ? 582 LYS D CA    1 
ATOM   7718  C  C     . LYS F 3 286 ? 120.840 -22.152 -33.309 1.00 26.10  ? 582 LYS D C     1 
ATOM   7719  O  O     . LYS F 3 286 ? 121.223 -23.305 -33.073 1.00 26.37  ? 582 LYS D O     1 
ATOM   7720  C  CB    . LYS F 3 286 ? 121.891 -20.104 -32.303 1.00 26.45  ? 582 LYS D CB    1 
ATOM   7721  C  CG    . LYS F 3 286 ? 122.383 -20.751 -31.016 1.00 26.39  ? 582 LYS D CG    1 
ATOM   7722  C  CD    . LYS F 3 286 ? 123.825 -21.220 -31.143 1.00 27.84  ? 582 LYS D CD    1 
ATOM   7723  C  CE    . LYS F 3 286 ? 124.275 -22.021 -29.911 1.00 28.17  ? 582 LYS D CE    1 
ATOM   7724  N  NZ    . LYS F 3 286 ? 125.585 -22.688 -30.131 1.00 26.41  ? 582 LYS D NZ    1 
ATOM   7725  N  N     . LEU F 3 287 ? 119.552 -21.817 -33.404 1.00 25.33  ? 583 LEU D N     1 
ATOM   7726  C  CA    . LEU F 3 287 ? 118.496 -22.803 -33.218 1.00 24.90  ? 583 LEU D CA    1 
ATOM   7727  C  C     . LEU F 3 287 ? 118.696 -23.973 -34.153 1.00 24.81  ? 583 LEU D C     1 
ATOM   7728  O  O     . LEU F 3 287 ? 118.689 -25.127 -33.730 1.00 24.88  ? 583 LEU D O     1 
ATOM   7729  C  CB    . LEU F 3 287 ? 117.113 -22.197 -33.455 1.00 24.67  ? 583 LEU D CB    1 
ATOM   7730  C  CG    . LEU F 3 287 ? 116.607 -21.122 -32.482 1.00 25.07  ? 583 LEU D CG    1 
ATOM   7731  C  CD1   . LEU F 3 287 ? 115.268 -20.538 -32.949 1.00 24.48  ? 583 LEU D CD1   1 
ATOM   7732  C  CD2   . LEU F 3 287 ? 116.493 -21.647 -31.052 1.00 23.03  ? 583 LEU D CD2   1 
ATOM   7733  N  N     . GLN F 3 288 ? 118.891 -23.665 -35.428 1.00 24.56  ? 584 GLN D N     1 
ATOM   7734  C  CA    . GLN F 3 288 ? 119.050 -24.684 -36.434 1.00 24.79  ? 584 GLN D CA    1 
ATOM   7735  C  C     . GLN F 3 288 ? 120.298 -25.526 -36.180 1.00 23.92  ? 584 GLN D C     1 
ATOM   7736  O  O     . GLN F 3 288 ? 120.214 -26.758 -36.136 1.00 23.72  ? 584 GLN D O     1 
ATOM   7737  C  CB    . GLN F 3 288 ? 119.037 -24.054 -37.828 1.00 24.59  ? 584 GLN D CB    1 
ATOM   7738  C  CG    . GLN F 3 288 ? 119.457 -24.965 -38.961 1.00 26.25  ? 584 GLN D CG    1 
ATOM   7739  C  CD    . GLN F 3 288 ? 119.258 -24.326 -40.346 1.00 27.77  ? 584 GLN D CD    1 
ATOM   7740  O  OE1   . GLN F 3 288 ? 118.121 -24.133 -40.801 1.00 31.21  ? 584 GLN D OE1   1 
ATOM   7741  N  NE2   . GLN F 3 288 ? 120.371 -24.023 -41.035 1.00 31.22  ? 584 GLN D NE2   1 
ATOM   7742  N  N     . SER F 3 289 ? 121.438 -24.873 -35.965 1.00 23.27  ? 585 SER D N     1 
ATOM   7743  C  CA    . SER F 3 289 ? 122.702 -25.599 -35.779 1.00 22.94  ? 585 SER D CA    1 
ATOM   7744  C  C     . SER F 3 289 ? 122.849 -26.363 -34.462 1.00 22.27  ? 585 SER D C     1 
ATOM   7745  O  O     . SER F 3 289 ? 123.519 -27.385 -34.418 1.00 22.37  ? 585 SER D O     1 
ATOM   7746  C  CB    . SER F 3 289 ? 123.909 -24.675 -35.959 1.00 23.09  ? 585 SER D CB    1 
ATOM   7747  O  OG    . SER F 3 289 ? 123.955 -23.690 -34.941 1.00 23.82  ? 585 SER D OG    1 
ATOM   7748  N  N     . THR F 3 290 ? 122.222 -25.886 -33.396 1.00 21.67  ? 586 THR D N     1 
ATOM   7749  C  CA    . THR F 3 290 ? 122.411 -26.513 -32.092 1.00 20.94  ? 586 THR D CA    1 
ATOM   7750  C  C     . THR F 3 290 ? 121.187 -27.255 -31.567 1.00 20.67  ? 586 THR D C     1 
ATOM   7751  O  O     . THR F 3 290 ? 121.301 -28.381 -31.090 1.00 20.78  ? 586 THR D O     1 
ATOM   7752  C  CB    . THR F 3 290 ? 122.878 -25.480 -31.054 1.00 20.94  ? 586 THR D CB    1 
ATOM   7753  O  OG1   . THR F 3 290 ? 124.029 -24.781 -31.560 1.00 21.30  ? 586 THR D OG1   1 
ATOM   7754  C  CG2   . THR F 3 290 ? 123.226 -26.152 -29.738 1.00 19.96  ? 586 THR D CG2   1 
ATOM   7755  N  N     . TYR F 3 291 ? 120.015 -26.645 -31.673 1.00 20.26  ? 587 TYR D N     1 
ATOM   7756  C  CA    . TYR F 3 291 ? 118.825 -27.227 -31.074 1.00 20.16  ? 587 TYR D CA    1 
ATOM   7757  C  C     . TYR F 3 291 ? 117.960 -28.005 -32.038 1.00 20.85  ? 587 TYR D C     1 
ATOM   7758  O  O     . TYR F 3 291 ? 116.879 -28.461 -31.670 1.00 21.00  ? 587 TYR D O     1 
ATOM   7759  C  CB    . TYR F 3 291 ? 118.010 -26.159 -30.354 1.00 19.44  ? 587 TYR D CB    1 
ATOM   7760  C  CG    . TYR F 3 291 ? 118.831 -25.409 -29.345 1.00 18.78  ? 587 TYR D CG    1 
ATOM   7761  C  CD1   . TYR F 3 291 ? 119.309 -24.137 -29.618 1.00 17.69  ? 587 TYR D CD1   1 
ATOM   7762  C  CD2   . TYR F 3 291 ? 119.177 -25.994 -28.136 1.00 18.81  ? 587 TYR D CD2   1 
ATOM   7763  C  CE1   . TYR F 3 291 ? 120.085 -23.450 -28.696 1.00 17.15  ? 587 TYR D CE1   1 
ATOM   7764  C  CE2   . TYR F 3 291 ? 119.952 -25.316 -27.211 1.00 18.15  ? 587 TYR D CE2   1 
ATOM   7765  C  CZ    . TYR F 3 291 ? 120.396 -24.046 -27.499 1.00 17.26  ? 587 TYR D CZ    1 
ATOM   7766  O  OH    . TYR F 3 291 ? 121.162 -23.381 -26.587 1.00 17.81  ? 587 TYR D OH    1 
ATOM   7767  N  N     . ILE F 3 292 ? 118.436 -28.149 -33.272 1.00 21.47  ? 588 ILE D N     1 
ATOM   7768  C  CA    . ILE F 3 292 ? 117.772 -28.991 -34.259 1.00 21.74  ? 588 ILE D CA    1 
ATOM   7769  C  C     . ILE F 3 292 ? 118.772 -30.059 -34.710 1.00 22.43  ? 588 ILE D C     1 
ATOM   7770  O  O     . ILE F 3 292 ? 118.665 -31.219 -34.296 1.00 22.08  ? 588 ILE D O     1 
ATOM   7771  C  CB    . ILE F 3 292 ? 117.230 -28.182 -35.463 1.00 21.88  ? 588 ILE D CB    1 
ATOM   7772  C  CG1   . ILE F 3 292 ? 116.259 -27.103 -34.994 1.00 21.10  ? 588 ILE D CG1   1 
ATOM   7773  C  CG2   . ILE F 3 292 ? 116.523 -29.093 -36.459 1.00 20.98  ? 588 ILE D CG2   1 
ATOM   7774  C  CD1   . ILE F 3 292 ? 114.928 -27.632 -34.621 1.00 20.63  ? 588 ILE D CD1   1 
ATOM   7775  N  N     . GLU F 3 293 ? 119.744 -29.662 -35.535 1.00 23.21  ? 589 GLU D N     1 
ATOM   7776  C  CA    . GLU F 3 293 ? 120.780 -30.575 -36.031 1.00 24.20  ? 589 GLU D CA    1 
ATOM   7777  C  C     . GLU F 3 293 ? 121.509 -31.235 -34.875 1.00 24.51  ? 589 GLU D C     1 
ATOM   7778  O  O     . GLU F 3 293 ? 121.609 -32.470 -34.813 1.00 24.52  ? 589 GLU D O     1 
ATOM   7779  C  CB    . GLU F 3 293 ? 121.778 -29.833 -36.927 1.00 24.33  ? 589 GLU D CB    1 
ATOM   7780  C  CG    . GLU F 3 293 ? 121.224 -29.490 -38.322 1.00 27.15  ? 589 GLU D CG    1 
ATOM   7781  C  CD    . GLU F 3 293 ? 121.864 -28.248 -38.955 1.00 30.12  ? 589 GLU D CD    1 
ATOM   7782  O  OE1   . GLU F 3 293 ? 122.969 -27.842 -38.520 1.00 32.27  ? 589 GLU D OE1   1 
ATOM   7783  O  OE2   . GLU F 3 293 ? 121.254 -27.672 -39.890 1.00 30.76  ? 589 GLU D OE2   1 
ATOM   7784  N  N     . GLY F 3 294 ? 121.992 -30.404 -33.948 1.00 24.61  ? 590 GLY D N     1 
ATOM   7785  C  CA    . GLY F 3 294 ? 122.745 -30.874 -32.785 1.00 24.75  ? 590 GLY D CA    1 
ATOM   7786  C  C     . GLY F 3 294 ? 121.993 -31.883 -31.936 1.00 24.86  ? 590 GLY D C     1 
ATOM   7787  O  O     . GLY F 3 294 ? 122.544 -32.904 -31.533 1.00 25.19  ? 590 GLY D O     1 
ATOM   7788  N  N     . LEU F 3 295 ? 120.723 -31.602 -31.681 1.00 24.87  ? 591 LEU D N     1 
ATOM   7789  C  CA    . LEU F 3 295 ? 119.894 -32.476 -30.879 1.00 24.74  ? 591 LEU D CA    1 
ATOM   7790  C  C     . LEU F 3 295 ? 119.628 -33.779 -31.626 1.00 25.22  ? 591 LEU D C     1 
ATOM   7791  O  O     . LEU F 3 295 ? 119.813 -34.865 -31.071 1.00 25.53  ? 591 LEU D O     1 
ATOM   7792  C  CB    . LEU F 3 295 ? 118.591 -31.773 -30.538 1.00 24.46  ? 591 LEU D CB    1 
ATOM   7793  C  CG    . LEU F 3 295 ? 117.944 -32.121 -29.207 1.00 23.88  ? 591 LEU D CG    1 
ATOM   7794  C  CD1   . LEU F 3 295 ? 118.960 -31.953 -28.106 1.00 22.19  ? 591 LEU D CD1   1 
ATOM   7795  C  CD2   . LEU F 3 295 ? 116.753 -31.208 -28.981 1.00 23.59  ? 591 LEU D CD2   1 
ATOM   7796  N  N     . LEU F 3 296 ? 119.230 -33.676 -32.893 1.00 25.47  ? 592 LEU D N     1 
ATOM   7797  C  CA    . LEU F 3 296 ? 118.936 -34.859 -33.702 1.00 25.61  ? 592 LEU D CA    1 
ATOM   7798  C  C     . LEU F 3 296 ? 120.100 -35.832 -33.762 1.00 25.95  ? 592 LEU D C     1 
ATOM   7799  O  O     . LEU F 3 296 ? 119.893 -37.046 -33.826 1.00 26.02  ? 592 LEU D O     1 
ATOM   7800  C  CB    . LEU F 3 296 ? 118.483 -34.473 -35.113 1.00 25.64  ? 592 LEU D CB    1 
ATOM   7801  C  CG    . LEU F 3 296 ? 117.022 -33.998 -35.186 1.00 26.41  ? 592 LEU D CG    1 
ATOM   7802  C  CD1   . LEU F 3 296 ? 116.697 -33.176 -36.430 1.00 27.44  ? 592 LEU D CD1   1 
ATOM   7803  C  CD2   . LEU F 3 296 ? 116.071 -35.165 -35.053 1.00 27.49  ? 592 LEU D CD2   1 
ATOM   7804  N  N     . LYS F 3 297 ? 121.319 -35.297 -33.720 1.00 26.15  ? 593 LYS D N     1 
ATOM   7805  C  CA    . LYS F 3 297 ? 122.532 -36.108 -33.757 1.00 25.96  ? 593 LYS D CA    1 
ATOM   7806  C  C     . LYS F 3 297 ? 122.767 -36.916 -32.486 1.00 25.61  ? 593 LYS D C     1 
ATOM   7807  O  O     . LYS F 3 297 ? 123.509 -37.894 -32.508 1.00 25.55  ? 593 LYS D O     1 
ATOM   7808  C  CB    . LYS F 3 297 ? 123.754 -35.232 -34.030 1.00 26.16  ? 593 LYS D CB    1 
ATOM   7809  C  CG    . LYS F 3 297 ? 123.856 -34.757 -35.458 1.00 27.82  ? 593 LYS D CG    1 
ATOM   7810  C  CD    . LYS F 3 297 ? 125.044 -33.821 -35.642 1.00 30.54  ? 593 LYS D CD    1 
ATOM   7811  C  CE    . LYS F 3 297 ? 125.106 -33.272 -37.073 1.00 31.03  ? 593 LYS D CE    1 
ATOM   7812  N  NZ    . LYS F 3 297 ? 126.223 -32.289 -37.218 1.00 31.72  ? 593 LYS D NZ    1 
ATOM   7813  N  N     . VAL F 3 298 ? 122.157 -36.514 -31.376 1.00 25.25  ? 594 VAL D N     1 
ATOM   7814  C  CA    . VAL F 3 298 ? 122.382 -37.241 -30.121 1.00 24.79  ? 594 VAL D CA    1 
ATOM   7815  C  C     . VAL F 3 298 ? 121.202 -38.063 -29.609 1.00 24.81  ? 594 VAL D C     1 
ATOM   7816  O  O     . VAL F 3 298 ? 121.345 -38.777 -28.632 1.00 24.91  ? 594 VAL D O     1 
ATOM   7817  C  CB    . VAL F 3 298 ? 122.965 -36.345 -29.013 1.00 24.48  ? 594 VAL D CB    1 
ATOM   7818  C  CG1   . VAL F 3 298 ? 124.412 -36.043 -29.318 1.00 24.17  ? 594 VAL D CG1   1 
ATOM   7819  C  CG2   . VAL F 3 298 ? 122.167 -35.070 -28.871 1.00 23.93  ? 594 VAL D CG2   1 
ATOM   7820  N  N     . VAL F 3 299 ? 120.053 -37.973 -30.276 1.00 25.00  ? 595 VAL D N     1 
ATOM   7821  C  CA    . VAL F 3 299 ? 118.897 -38.811 -29.960 1.00 25.32  ? 595 VAL D CA    1 
ATOM   7822  C  C     . VAL F 3 299 ? 119.210 -40.270 -30.283 1.00 25.59  ? 595 VAL D C     1 
ATOM   7823  O  O     . VAL F 3 299 ? 119.763 -40.557 -31.347 1.00 25.81  ? 595 VAL D O     1 
ATOM   7824  C  CB    . VAL F 3 299 ? 117.656 -38.406 -30.807 1.00 25.52  ? 595 VAL D CB    1 
ATOM   7825  C  CG1   . VAL F 3 299 ? 116.693 -39.584 -30.970 1.00 25.61  ? 595 VAL D CG1   1 
ATOM   7826  C  CG2   . VAL F 3 299 ? 116.941 -37.192 -30.214 1.00 25.11  ? 595 VAL D CG2   1 
ATOM   7827  N  N     . ARG F 3 300 ? 118.878 -41.184 -29.371 1.00 25.78  ? 596 ARG D N     1 
ATOM   7828  C  CA    . ARG F 3 300 ? 119.058 -42.617 -29.626 1.00 26.09  ? 596 ARG D CA    1 
ATOM   7829  C  C     . ARG F 3 300 ? 117.821 -43.093 -30.368 1.00 26.05  ? 596 ARG D C     1 
ATOM   7830  O  O     . ARG F 3 300 ? 116.734 -43.145 -29.805 1.00 26.50  ? 596 ARG D O     1 
ATOM   7831  C  CB    . ARG F 3 300 ? 119.303 -43.391 -28.335 1.00 26.02  ? 596 ARG D CB    1 
ATOM   7832  C  CG    . ARG F 3 300 ? 120.400 -42.744 -27.509 1.00 27.86  ? 596 ARG D CG    1 
ATOM   7833  C  CD    . ARG F 3 300 ? 120.979 -43.616 -26.430 1.00 30.33  ? 596 ARG D CD    1 
ATOM   7834  N  NE    . ARG F 3 300 ? 121.954 -44.571 -26.950 1.00 32.29  ? 596 ARG D NE    1 
ATOM   7835  C  CZ    . ARG F 3 300 ? 121.698 -45.860 -27.157 1.00 32.43  ? 596 ARG D CZ    1 
ATOM   7836  N  NH1   . ARG F 3 300 ? 120.489 -46.356 -26.880 1.00 30.50  ? 596 ARG D NH1   1 
ATOM   7837  N  NH2   . ARG F 3 300 ? 122.659 -46.652 -27.632 1.00 32.02  ? 596 ARG D NH2   1 
ATOM   7838  N  N     . PRO F 3 301 ? 117.994 -43.451 -31.645 1.00 25.92  ? 597 PRO D N     1 
ATOM   7839  C  CA    . PRO F 3 301 ? 116.896 -43.667 -32.588 1.00 25.63  ? 597 PRO D CA    1 
ATOM   7840  C  C     . PRO F 3 301 ? 115.936 -44.798 -32.193 1.00 25.56  ? 597 PRO D C     1 
ATOM   7841  O  O     . PRO F 3 301 ? 114.728 -44.695 -32.434 1.00 25.52  ? 597 PRO D O     1 
ATOM   7842  C  CB    . PRO F 3 301 ? 117.627 -43.979 -33.891 1.00 25.53  ? 597 PRO D CB    1 
ATOM   7843  C  CG    . PRO F 3 301 ? 118.955 -44.522 -33.461 1.00 25.74  ? 597 PRO D CG    1 
ATOM   7844  C  CD    . PRO F 3 301 ? 119.309 -43.740 -32.247 1.00 25.70  ? 597 PRO D CD    1 
ATOM   7845  N  N     . ALA F 3 302 ? 116.462 -45.859 -31.586 1.00 25.09  ? 598 ALA D N     1 
ATOM   7846  C  CA    . ALA F 3 302 ? 115.612 -46.942 -31.118 1.00 24.48  ? 598 ALA D CA    1 
ATOM   7847  C  C     . ALA F 3 302 ? 114.590 -46.448 -30.093 1.00 24.20  ? 598 ALA D C     1 
ATOM   7848  O  O     . ALA F 3 302 ? 113.431 -46.855 -30.142 1.00 24.66  ? 598 ALA D O     1 
ATOM   7849  C  CB    . ALA F 3 302 ? 116.445 -48.062 -30.530 1.00 24.41  ? 598 ALA D CB    1 
ATOM   7850  N  N     . THR F 3 303 ? 115.012 -45.573 -29.174 1.00 23.48  ? 599 THR D N     1 
ATOM   7851  C  CA    . THR F 3 303 ? 114.130 -45.093 -28.097 1.00 22.33  ? 599 THR D CA    1 
ATOM   7852  C  C     . THR F 3 303 ? 113.699 -43.637 -28.190 1.00 22.41  ? 599 THR D C     1 
ATOM   7853  O  O     . THR F 3 303 ? 112.736 -43.249 -27.536 1.00 22.56  ? 599 THR D O     1 
ATOM   7854  C  CB    . THR F 3 303 ? 114.768 -45.246 -26.695 1.00 22.12  ? 599 THR D CB    1 
ATOM   7855  O  OG1   . THR F 3 303 ? 115.986 -44.497 -26.645 1.00 21.67  ? 599 THR D OG1   1 
ATOM   7856  C  CG2   . THR F 3 303 ? 115.014 -46.703 -26.339 1.00 20.08  ? 599 THR D CG2   1 
ATOM   7857  N  N     . LYS F 3 304 ? 114.412 -42.828 -28.967 1.00 22.25  ? 600 LYS D N     1 
ATOM   7858  C  CA    . LYS F 3 304 ? 114.119 -41.393 -29.079 1.00 22.55  ? 600 LYS D CA    1 
ATOM   7859  C  C     . LYS F 3 304 ? 114.317 -40.658 -27.759 1.00 21.77  ? 600 LYS D C     1 
ATOM   7860  O  O     . LYS F 3 304 ? 113.583 -39.737 -27.433 1.00 21.94  ? 600 LYS D O     1 
ATOM   7861  C  CB    . LYS F 3 304 ? 112.714 -41.138 -29.643 1.00 22.57  ? 600 LYS D CB    1 
ATOM   7862  C  CG    . LYS F 3 304 ? 112.562 -41.498 -31.125 1.00 24.08  ? 600 LYS D CG    1 
ATOM   7863  C  CD    . LYS F 3 304 ? 111.116 -41.342 -31.579 1.00 24.80  ? 600 LYS D CD    1 
ATOM   7864  C  CE    . LYS F 3 304 ? 110.928 -41.729 -33.056 1.00 28.06  ? 600 LYS D CE    1 
ATOM   7865  N  NZ    . LYS F 3 304 ? 110.969 -43.211 -33.262 1.00 28.81  ? 600 LYS D NZ    1 
ATOM   7866  N  N     . LYS F 3 305 ? 115.311 -41.086 -26.992 1.00 21.19  ? 601 LYS D N     1 
ATOM   7867  C  CA    . LYS F 3 305 ? 115.656 -40.417 -25.751 1.00 19.87  ? 601 LYS D CA    1 
ATOM   7868  C  C     . LYS F 3 305 ? 117.000 -39.751 -25.899 1.00 19.25  ? 601 LYS D C     1 
ATOM   7869  O  O     . LYS F 3 305 ? 117.852 -40.228 -26.658 1.00 19.63  ? 601 LYS D O     1 
ATOM   7870  C  CB    . LYS F 3 305 ? 115.727 -41.411 -24.605 1.00 19.55  ? 601 LYS D CB    1 
ATOM   7871  C  CG    . LYS F 3 305 ? 114.376 -41.820 -24.058 1.00 20.08  ? 601 LYS D CG    1 
ATOM   7872  C  CD    . LYS F 3 305 ? 114.547 -42.870 -22.967 1.00 20.28  ? 601 LYS D CD    1 
ATOM   7873  C  CE    . LYS F 3 305 ? 113.230 -43.220 -22.311 1.00 19.41  ? 601 LYS D CE    1 
ATOM   7874  N  NZ    . LYS F 3 305 ? 113.469 -43.941 -21.042 1.00 17.34  ? 601 LYS D NZ    1 
ATOM   7875  N  N     . VAL F 3 306 ? 117.182 -38.633 -25.202 1.00 18.11  ? 602 VAL D N     1 
ATOM   7876  C  CA    . VAL F 3 306 ? 118.500 -38.015 -25.093 1.00 16.88  ? 602 VAL D CA    1 
ATOM   7877  C  C     . VAL F 3 306 ? 119.010 -38.290 -23.687 1.00 16.21  ? 602 VAL D C     1 
ATOM   7878  O  O     . VAL F 3 306 ? 118.257 -38.185 -22.715 1.00 15.91  ? 602 VAL D O     1 
ATOM   7879  C  CB    . VAL F 3 306 ? 118.513 -36.496 -25.387 1.00 16.72  ? 602 VAL D CB    1 
ATOM   7880  C  CG1   . VAL F 3 306 ? 118.459 -36.255 -26.869 1.00 16.41  ? 602 VAL D CG1   1 
ATOM   7881  C  CG2   . VAL F 3 306 ? 117.384 -35.781 -24.670 1.00 16.52  ? 602 VAL D CG2   1 
ATOM   7882  N  N     . HIS F 3 307 ? 120.281 -38.674 -23.595 1.00 15.22  ? 603 HIS D N     1 
ATOM   7883  C  CA    . HIS F 3 307 ? 120.899 -38.991 -22.324 1.00 14.09  ? 603 HIS D CA    1 
ATOM   7884  C  C     . HIS F 3 307 ? 122.056 -38.050 -22.055 1.00 13.61  ? 603 HIS D C     1 
ATOM   7885  O  O     . HIS F 3 307 ? 123.176 -38.283 -22.494 1.00 13.68  ? 603 HIS D O     1 
ATOM   7886  C  CB    . HIS F 3 307 ? 121.381 -40.438 -22.322 1.00 14.11  ? 603 HIS D CB    1 
ATOM   7887  C  CG    . HIS F 3 307 ? 120.284 -41.447 -22.478 1.00 13.49  ? 603 HIS D CG    1 
ATOM   7888  N  ND1   . HIS F 3 307 ? 119.709 -42.096 -21.405 1.00 13.33  ? 603 HIS D ND1   1 
ATOM   7889  C  CD2   . HIS F 3 307 ? 119.663 -41.926 -23.582 1.00 12.55  ? 603 HIS D CD2   1 
ATOM   7890  C  CE1   . HIS F 3 307 ? 118.788 -42.937 -21.842 1.00 12.36  ? 603 HIS D CE1   1 
ATOM   7891  N  NE2   . HIS F 3 307 ? 118.741 -42.853 -23.159 1.00 13.28  ? 603 HIS D NE2   1 
ATOM   7892  N  N     . THR F 3 308 ? 121.774 -36.975 -21.336 1.00 13.11  ? 604 THR D N     1 
ATOM   7893  C  CA    . THR F 3 308 ? 122.789 -35.997 -20.974 1.00 12.59  ? 604 THR D CA    1 
ATOM   7894  C  C     . THR F 3 308 ? 123.740 -36.559 -19.931 1.00 12.65  ? 604 THR D C     1 
ATOM   7895  O  O     . THR F 3 308 ? 123.482 -37.607 -19.325 1.00 12.71  ? 604 THR D O     1 
ATOM   7896  C  CB    . THR F 3 308 ? 122.140 -34.728 -20.377 1.00 12.50  ? 604 THR D CB    1 
ATOM   7897  O  OG1   . THR F 3 308 ? 123.117 -33.692 -20.236 1.00 11.21  ? 604 THR D OG1   1 
ATOM   7898  C  CG2   . THR F 3 308 ? 121.539 -35.031 -19.019 1.00 11.73  ? 604 THR D CG2   1 
ATOM   7899  N  N     . ILE F 3 309 ? 124.855 -35.868 -19.733 1.00 12.50  ? 605 ILE D N     1 
ATOM   7900  C  CA    . ILE F 3 309 ? 125.735 -36.184 -18.611 1.00 12.26  ? 605 ILE D CA    1 
ATOM   7901  C  C     . ILE F 3 309 ? 125.811 -34.954 -17.703 1.00 12.33  ? 605 ILE D C     1 
ATOM   7902  O  O     . ILE F 3 309 ? 126.116 -33.851 -18.157 1.00 12.31  ? 605 ILE D O     1 
ATOM   7903  C  CB    . ILE F 3 309 ? 127.136 -36.634 -19.061 1.00 12.35  ? 605 ILE D CB    1 
ATOM   7904  C  CG1   . ILE F 3 309 ? 127.060 -38.038 -19.676 1.00 12.58  ? 605 ILE D CG1   1 
ATOM   7905  C  CG2   . ILE F 3 309 ? 128.112 -36.616 -17.882 1.00 11.48  ? 605 ILE D CG2   1 
ATOM   7906  C  CD1   . ILE F 3 309 ? 128.401 -38.623 -20.129 1.00 11.90  ? 605 ILE D CD1   1 
ATOM   7907  N  N     . PHE F 3 310 ? 125.490 -35.145 -16.431 1.00 12.25  ? 606 PHE D N     1 
ATOM   7908  C  CA    . PHE F 3 310 ? 125.547 -34.069 -15.457 1.00 12.20  ? 606 PHE D CA    1 
ATOM   7909  C  C     . PHE F 3 310 ? 126.895 -34.073 -14.763 1.00 12.68  ? 606 PHE D C     1 
ATOM   7910  O  O     . PHE F 3 310 ? 127.162 -34.922 -13.899 1.00 13.35  ? 606 PHE D O     1 
ATOM   7911  C  CB    . PHE F 3 310 ? 124.436 -34.222 -14.400 1.00 11.57  ? 606 PHE D CB    1 
ATOM   7912  C  CG    . PHE F 3 310 ? 123.084 -33.784 -14.870 1.00 10.64  ? 606 PHE D CG    1 
ATOM   7913  C  CD1   . PHE F 3 310 ? 122.767 -32.432 -14.943 1.00 11.27  ? 606 PHE D CD1   1 
ATOM   7914  C  CD2   . PHE F 3 310 ? 122.115 -34.713 -15.210 1.00 8.85   ? 606 PHE D CD2   1 
ATOM   7915  C  CE1   . PHE F 3 310 ? 121.513 -32.016 -15.374 1.00 10.01  ? 606 PHE D CE1   1 
ATOM   7916  C  CE2   . PHE F 3 310 ? 120.864 -34.315 -15.644 1.00 6.92   ? 606 PHE D CE2   1 
ATOM   7917  C  CZ    . PHE F 3 310 ? 120.560 -32.969 -15.729 1.00 10.12  ? 606 PHE D CZ    1 
ATOM   7918  N  N     . ASN F 3 311 ? 127.741 -33.116 -15.114 1.00 12.90  ? 607 ASN D N     1 
ATOM   7919  C  CA    . ASN F 3 311 ? 129.041 -33.003 -14.471 1.00 12.99  ? 607 ASN D CA    1 
ATOM   7920  C  C     . ASN F 3 311 ? 128.912 -32.391 -13.061 1.00 12.65  ? 607 ASN D C     1 
ATOM   7921  O  O     . ASN F 3 311 ? 128.605 -31.200 -12.918 1.00 13.10  ? 607 ASN D O     1 
ATOM   7922  C  CB    . ASN F 3 311 ? 129.993 -32.204 -15.352 1.00 13.00  ? 607 ASN D CB    1 
ATOM   7923  C  CG    . ASN F 3 311 ? 131.452 -32.455 -15.010 1.00 15.51  ? 607 ASN D CG    1 
ATOM   7924  O  OD1   . ASN F 3 311 ? 131.817 -32.660 -13.844 1.00 18.20  ? 607 ASN D OD1   1 
ATOM   7925  N  ND2   . ASN F 3 311 ? 132.300 -32.440 -16.028 1.00 17.72  ? 607 ASN D ND2   1 
ATOM   7926  N  N     . GLN F 3 312 ? 129.151 -33.219 -12.038 1.00 11.85  ? 608 GLN D N     1 
ATOM   7927  C  CA    . GLN F 3 312 ? 129.000 -32.846 -10.620 1.00 11.05  ? 608 GLN D CA    1 
ATOM   7928  C  C     . GLN F 3 312 ? 130.295 -32.316 -10.012 1.00 10.66  ? 608 GLN D C     1 
ATOM   7929  O  O     . GLN F 3 312 ? 130.290 -31.773 -8.923  1.00 10.54  ? 608 GLN D O     1 
ATOM   7930  C  CB    . GLN F 3 312 ? 128.505 -34.063 -9.810  1.00 10.58  ? 608 GLN D CB    1 
ATOM   7931  C  CG    . GLN F 3 312 ? 128.089 -33.792 -8.352  1.00 10.91  ? 608 GLN D CG    1 
ATOM   7932  C  CD    . GLN F 3 312 ? 127.469 -35.023 -7.633  1.00 11.75  ? 608 GLN D CD    1 
ATOM   7933  O  OE1   . GLN F 3 312 ? 127.383 -36.129 -8.188  1.00 13.01  ? 608 GLN D OE1   1 
ATOM   7934  N  NE2   . GLN F 3 312 ? 127.037 -34.819 -6.393  1.00 11.82  ? 608 GLN D NE2   1 
ATOM   7935  N  N     . ALA F 3 313 ? 131.410 -32.455 -10.713 1.00 10.54  ? 609 ALA D N     1 
ATOM   7936  C  CA    . ALA F 3 313 ? 132.693 -32.053 -10.132 1.00 10.73  ? 609 ALA D CA    1 
ATOM   7937  C  C     . ALA F 3 313 ? 133.465 -31.051 -11.001 1.00 10.92  ? 609 ALA D C     1 
ATOM   7938  O  O     . ALA F 3 313 ? 134.682 -31.147 -11.157 1.00 10.72  ? 609 ALA D O     1 
ATOM   7939  C  CB    . ALA F 3 313 ? 133.550 -33.302 -9.829  1.00 10.42  ? 609 ALA D CB    1 
ATOM   7940  N  N     . LEU F 3 314 ? 132.759 -30.065 -11.543 1.00 11.13  ? 610 LEU D N     1 
ATOM   7941  C  CA    . LEU F 3 314 ? 133.393 -29.138 -12.444 1.00 10.77  ? 610 LEU D CA    1 
ATOM   7942  C  C     . LEU F 3 314 ? 133.282 -27.661 -12.091 1.00 10.62  ? 610 LEU D C     1 
ATOM   7943  O  O     . LEU F 3 314 ? 134.278 -26.941 -12.204 1.00 10.95  ? 610 LEU D O     1 
ATOM   7944  C  CB    . LEU F 3 314 ? 132.898 -29.393 -13.870 1.00 11.14  ? 610 LEU D CB    1 
ATOM   7945  C  CG    . LEU F 3 314 ? 133.595 -28.653 -15.026 1.00 12.23  ? 610 LEU D CG    1 
ATOM   7946  C  CD1   . LEU F 3 314 ? 133.751 -29.577 -16.270 1.00 11.71  ? 610 LEU D CD1   1 
ATOM   7947  C  CD2   . LEU F 3 314 ? 132.870 -27.343 -15.363 1.00 11.46  ? 610 LEU D CD2   1 
ATOM   7948  N  N     . THR F 3 315 ? 132.103 -27.190 -11.681 1.00 10.11  ? 611 THR D N     1 
ATOM   7949  C  CA    . THR F 3 315 ? 131.925 -25.740 -11.530 1.00 9.52   ? 611 THR D CA    1 
ATOM   7950  C  C     . THR F 3 315 ? 132.557 -25.231 -10.264 1.00 10.01  ? 611 THR D C     1 
ATOM   7951  O  O     . THR F 3 315 ? 132.565 -25.926 -9.248  1.00 10.05  ? 611 THR D O     1 
ATOM   7952  C  CB    . THR F 3 315 ? 130.454 -25.271 -11.564 1.00 9.26   ? 611 THR D CB    1 
ATOM   7953  O  OG1   . THR F 3 315 ? 129.792 -25.660 -10.356 1.00 9.36   ? 611 THR D OG1   1 
ATOM   7954  C  CG2   . THR F 3 315 ? 129.723 -25.810 -12.776 1.00 7.75   ? 611 THR D CG2   1 
ATOM   7955  N  N     . GLN F 3 316 ? 133.056 -23.998 -10.324 1.00 10.13  ? 612 GLN D N     1 
ATOM   7956  C  CA    . GLN F 3 316 ? 133.744 -23.383 -9.187  1.00 9.72   ? 612 GLN D CA    1 
ATOM   7957  C  C     . GLN F 3 316 ? 132.821 -22.949 -8.042  1.00 9.44   ? 612 GLN D C     1 
ATOM   7958  O  O     . GLN F 3 316 ? 133.290 -22.639 -6.947  1.00 9.47   ? 612 GLN D O     1 
ATOM   7959  C  CB    . GLN F 3 316 ? 134.586 -22.204 -9.667  1.00 9.83   ? 612 GLN D CB    1 
ATOM   7960  C  CG    . GLN F 3 316 ? 135.659 -22.605 -10.648 1.00 9.83   ? 612 GLN D CG    1 
ATOM   7961  C  CD    . GLN F 3 316 ? 136.543 -23.689 -10.096 1.00 11.05  ? 612 GLN D CD    1 
ATOM   7962  O  OE1   . GLN F 3 316 ? 137.250 -23.495 -9.104  1.00 10.46  ? 612 GLN D OE1   1 
ATOM   7963  N  NE2   . GLN F 3 316 ? 136.509 -24.853 -10.732 1.00 12.01  ? 612 GLN D NE2   1 
ATOM   7964  N  N     . THR F 3 317 ? 131.515 -22.950 -8.281  1.00 9.06   ? 613 THR D N     1 
ATOM   7965  C  CA    . THR F 3 317 ? 130.565 -22.484 -7.275  1.00 8.92   ? 613 THR D CA    1 
ATOM   7966  C  C     . THR F 3 317 ? 129.725 -23.572 -6.614  1.00 9.23   ? 613 THR D C     1 
ATOM   7967  O  O     . THR F 3 317 ? 128.913 -23.262 -5.729  1.00 9.04   ? 613 THR D O     1 
ATOM   7968  C  CB    . THR F 3 317 ? 129.555 -21.508 -7.888  1.00 8.88   ? 613 THR D CB    1 
ATOM   7969  O  OG1   . THR F 3 317 ? 129.048 -22.070 -9.105  1.00 7.80   ? 613 THR D OG1   1 
ATOM   7970  C  CG2   . THR F 3 317 ? 130.190 -20.159 -8.157  1.00 7.82   ? 613 THR D CG2   1 
ATOM   7971  N  N     . GLY F 3 318 ? 129.896 -24.824 -7.052  1.00 9.09   ? 614 GLY D N     1 
ATOM   7972  C  CA    . GLY F 3 318 ? 129.093 -25.931 -6.554  1.00 8.57   ? 614 GLY D CA    1 
ATOM   7973  C  C     . GLY F 3 318 ? 127.904 -26.242 -7.450  1.00 8.65   ? 614 GLY D C     1 
ATOM   7974  O  O     . GLY F 3 318 ? 127.129 -27.147 -7.166  1.00 8.20   ? 614 GLY D O     1 
ATOM   7975  N  N     . ARG F 3 319 ? 127.745 -25.490 -8.536  1.00 9.11   ? 615 ARG D N     1 
ATOM   7976  C  CA    . ARG F 3 319 ? 126.677 -25.787 -9.506  1.00 9.58   ? 615 ARG D CA    1 
ATOM   7977  C  C     . ARG F 3 319 ? 126.983 -27.052 -10.317 1.00 9.69   ? 615 ARG D C     1 
ATOM   7978  O  O     . ARG F 3 319 ? 128.116 -27.537 -10.323 1.00 9.63   ? 615 ARG D O     1 
ATOM   7979  C  CB    . ARG F 3 319 ? 126.495 -24.626 -10.489 1.00 9.67   ? 615 ARG D CB    1 
ATOM   7980  C  CG    . ARG F 3 319 ? 125.642 -23.475 -10.009 1.00 9.21   ? 615 ARG D CG    1 
ATOM   7981  C  CD    . ARG F 3 319 ? 125.313 -22.578 -11.187 1.00 8.14   ? 615 ARG D CD    1 
ATOM   7982  N  NE    . ARG F 3 319 ? 124.358 -21.518 -10.866 1.00 7.14   ? 615 ARG D NE    1 
ATOM   7983  C  CZ    . ARG F 3 319 ? 123.725 -20.799 -11.792 1.00 7.85   ? 615 ARG D CZ    1 
ATOM   7984  N  NH1   . ARG F 3 319 ? 123.931 -21.046 -13.085 1.00 7.92   ? 615 ARG D NH1   1 
ATOM   7985  N  NH2   . ARG F 3 319 ? 122.875 -19.846 -11.441 1.00 7.45   ? 615 ARG D NH2   1 
ATOM   7986  N  N     . LEU F 3 320 ? 125.975 -27.594 -10.995 1.00 9.90   ? 616 LEU D N     1 
ATOM   7987  C  CA    . LEU F 3 320 ? 126.206 -28.695 -11.930 1.00 9.88   ? 616 LEU D CA    1 
ATOM   7988  C  C     . LEU F 3 320 ? 126.407 -28.079 -13.300 1.00 10.03  ? 616 LEU D C     1 
ATOM   7989  O  O     . LEU F 3 320 ? 126.193 -26.885 -13.473 1.00 9.94   ? 616 LEU D O     1 
ATOM   7990  C  CB    . LEU F 3 320 ? 124.990 -29.603 -12.009 1.00 9.82   ? 616 LEU D CB    1 
ATOM   7991  C  CG    . LEU F 3 320 ? 124.523 -30.404 -10.802 1.00 10.06  ? 616 LEU D CG    1 
ATOM   7992  C  CD1   . LEU F 3 320 ? 123.110 -30.923 -11.060 1.00 9.68   ? 616 LEU D CD1   1 
ATOM   7993  C  CD2   . LEU F 3 320 ? 125.486 -31.537 -10.514 1.00 8.87   ? 616 LEU D CD2   1 
ATOM   7994  N  N     . SER F 3 321 ? 126.826 -28.888 -14.268 1.00 10.64  ? 617 SER D N     1 
ATOM   7995  C  CA    . SER F 3 321 ? 126.835 -28.466 -15.666 1.00 11.08  ? 617 SER D CA    1 
ATOM   7996  C  C     . SER F 3 321 ? 126.318 -29.648 -16.469 1.00 11.58  ? 617 SER D C     1 
ATOM   7997  O  O     . SER F 3 321 ? 126.326 -30.786 -15.976 1.00 11.52  ? 617 SER D O     1 
ATOM   7998  C  CB    . SER F 3 321 ? 128.218 -28.045 -16.140 1.00 11.23  ? 617 SER D CB    1 
ATOM   7999  O  OG    . SER F 3 321 ? 129.060 -29.159 -16.392 1.00 13.04  ? 617 SER D OG    1 
ATOM   8000  N  N     . SER F 3 322 ? 125.851 -29.386 -17.687 1.00 11.53  ? 618 SER D N     1 
ATOM   8001  C  CA    . SER F 3 322 ? 125.254 -30.437 -18.495 1.00 11.61  ? 618 SER D CA    1 
ATOM   8002  C  C     . SER F 3 322 ? 125.925 -30.487 -19.846 1.00 11.94  ? 618 SER D C     1 
ATOM   8003  O  O     . SER F 3 322 ? 126.072 -29.468 -20.518 1.00 11.44  ? 618 SER D O     1 
ATOM   8004  C  CB    . SER F 3 322 ? 123.753 -30.189 -18.661 1.00 11.82  ? 618 SER D CB    1 
ATOM   8005  O  OG    . SER F 3 322 ? 123.192 -31.081 -19.611 1.00 11.86  ? 618 SER D OG    1 
ATOM   8006  N  N     . THR F 3 323 ? 126.354 -31.676 -20.246 1.00 12.22  ? 619 THR D N     1 
ATOM   8007  C  CA    . THR F 3 323 ? 127.044 -31.797 -21.510 1.00 12.77  ? 619 THR D CA    1 
ATOM   8008  C  C     . THR F 3 323 ? 126.480 -32.869 -22.396 1.00 12.92  ? 619 THR D C     1 
ATOM   8009  O  O     . THR F 3 323 ? 125.917 -33.850 -21.907 1.00 13.11  ? 619 THR D O     1 
ATOM   8010  C  CB    . THR F 3 323 ? 128.547 -32.107 -21.323 1.00 13.06  ? 619 THR D CB    1 
ATOM   8011  O  OG1   . THR F 3 323 ? 128.707 -33.179 -20.386 1.00 13.78  ? 619 THR D OG1   1 
ATOM   8012  C  CG2   . THR F 3 323 ? 129.278 -30.890 -20.823 1.00 13.43  ? 619 THR D CG2   1 
ATOM   8013  N  N     . GLU F 3 324 ? 126.618 -32.639 -23.702 1.00 13.08  ? 620 GLU D N     1 
ATOM   8014  C  CA    . GLU F 3 324 ? 126.409 -33.642 -24.747 1.00 13.57  ? 620 GLU D CA    1 
ATOM   8015  C  C     . GLU F 3 324 ? 125.105 -34.436 -24.698 1.00 12.63  ? 620 GLU D C     1 
ATOM   8016  O  O     . GLU F 3 324 ? 125.125 -35.646 -24.520 1.00 12.76  ? 620 GLU D O     1 
ATOM   8017  C  CB    . GLU F 3 324 ? 127.611 -34.594 -24.735 1.00 14.18  ? 620 GLU D CB    1 
ATOM   8018  C  CG    . GLU F 3 324 ? 127.832 -35.378 -26.019 1.00 18.61  ? 620 GLU D CG    1 
ATOM   8019  C  CD    . GLU F 3 324 ? 129.318 -35.646 -26.271 1.00 23.61  ? 620 GLU D CD    1 
ATOM   8020  O  OE1   . GLU F 3 324 ? 130.076 -34.651 -26.409 1.00 24.48  ? 620 GLU D OE1   1 
ATOM   8021  O  OE2   . GLU F 3 324 ? 129.717 -36.839 -26.344 1.00 25.19  ? 620 GLU D OE2   1 
ATOM   8022  N  N     . PRO F 3 325 ? 123.967 -33.764 -24.869 1.00 12.05  ? 621 PRO D N     1 
ATOM   8023  C  CA    . PRO F 3 325 ? 123.816 -32.332 -25.084 1.00 11.80  ? 621 PRO D CA    1 
ATOM   8024  C  C     . PRO F 3 325 ? 123.580 -31.589 -23.776 1.00 11.39  ? 621 PRO D C     1 
ATOM   8025  O  O     . PRO F 3 325 ? 123.285 -32.213 -22.751 1.00 11.99  ? 621 PRO D O     1 
ATOM   8026  C  CB    . PRO F 3 325 ? 122.557 -32.260 -25.931 1.00 11.52  ? 621 PRO D CB    1 
ATOM   8027  C  CG    . PRO F 3 325 ? 121.716 -33.410 -25.425 1.00 11.85  ? 621 PRO D CG    1 
ATOM   8028  C  CD    . PRO F 3 325 ? 122.669 -34.456 -24.873 1.00 11.97  ? 621 PRO D CD    1 
ATOM   8029  N  N     . ASN F 3 326 ? 123.728 -30.273 -23.815 1.00 10.70  ? 622 ASN D N     1 
ATOM   8030  C  CA    . ASN F 3 326 ? 123.416 -29.429 -22.679 1.00 10.29  ? 622 ASN D CA    1 
ATOM   8031  C  C     . ASN F 3 326 ? 121.907 -29.321 -22.639 1.00 10.25  ? 622 ASN D C     1 
ATOM   8032  O  O     . ASN F 3 326 ? 121.320 -28.805 -23.580 1.00 10.75  ? 622 ASN D O     1 
ATOM   8033  C  CB    . ASN F 3 326 ? 124.016 -28.031 -22.868 1.00 9.79   ? 622 ASN D CB    1 
ATOM   8034  C  CG    . ASN F 3 326 ? 124.000 -27.203 -21.588 1.00 10.15  ? 622 ASN D CG    1 
ATOM   8035  O  OD1   . ASN F 3 326 ? 123.233 -27.474 -20.657 1.00 10.55  ? 622 ASN D OD1   1 
ATOM   8036  N  ND2   . ASN F 3 326 ? 124.861 -26.192 -21.530 1.00 8.69   ? 622 ASN D ND2   1 
ATOM   8037  N  N     . LEU F 3 327 ? 121.274 -29.799 -21.571 1.00 9.85   ? 623 LEU D N     1 
ATOM   8038  C  CA    . LEU F 3 327 ? 119.830 -29.685 -21.468 1.00 9.73   ? 623 LEU D CA    1 
ATOM   8039  C  C     . LEU F 3 327 ? 119.442 -28.607 -20.447 1.00 9.51   ? 623 LEU D C     1 
ATOM   8040  O  O     . LEU F 3 327 ? 118.298 -28.541 -19.971 1.00 8.34   ? 623 LEU D O     1 
ATOM   8041  C  CB    . LEU F 3 327 ? 119.185 -31.043 -21.165 1.00 9.66   ? 623 LEU D CB    1 
ATOM   8042  C  CG    . LEU F 3 327 ? 119.285 -32.106 -22.268 1.00 9.86   ? 623 LEU D CG    1 
ATOM   8043  C  CD1   . LEU F 3 327 ? 118.477 -33.340 -21.914 1.00 9.71   ? 623 LEU D CD1   1 
ATOM   8044  C  CD2   . LEU F 3 327 ? 118.818 -31.582 -23.606 1.00 9.98   ? 623 LEU D CD2   1 
ATOM   8045  N  N     . GLN F 3 328 ? 120.417 -27.751 -20.150 1.00 9.41   ? 624 GLN D N     1 
ATOM   8046  C  CA    . GLN F 3 328 ? 120.247 -26.663 -19.196 1.00 9.44   ? 624 GLN D CA    1 
ATOM   8047  C  C     . GLN F 3 328 ? 120.295 -25.304 -19.890 1.00 9.92   ? 624 GLN D C     1 
ATOM   8048  O  O     . GLN F 3 328 ? 120.218 -24.256 -19.222 1.00 9.70   ? 624 GLN D O     1 
ATOM   8049  C  CB    . GLN F 3 328 ? 121.329 -26.711 -18.133 1.00 9.34   ? 624 GLN D CB    1 
ATOM   8050  C  CG    . GLN F 3 328 ? 121.216 -27.828 -17.151 1.00 9.10   ? 624 GLN D CG    1 
ATOM   8051  C  CD    . GLN F 3 328 ? 122.315 -27.746 -16.109 1.00 10.20  ? 624 GLN D CD    1 
ATOM   8052  O  OE1   . GLN F 3 328 ? 123.454 -27.411 -16.429 1.00 10.18  ? 624 GLN D OE1   1 
ATOM   8053  N  NE2   . GLN F 3 328 ? 121.978 -28.044 -14.858 1.00 9.41   ? 624 GLN D NE2   1 
ATOM   8054  N  N     . ASN F 3 329 ? 120.441 -25.323 -21.220 1.00 10.10  ? 625 ASN D N     1 
ATOM   8055  C  CA    . ASN F 3 329 ? 120.381 -24.096 -22.021 1.00 10.06  ? 625 ASN D CA    1 
ATOM   8056  C  C     . ASN F 3 329 ? 119.460 -24.218 -23.238 1.00 10.22  ? 625 ASN D C     1 
ATOM   8057  O  O     . ASN F 3 329 ? 119.764 -23.733 -24.324 1.00 10.18  ? 625 ASN D O     1 
ATOM   8058  C  CB    . ASN F 3 329 ? 121.782 -23.549 -22.378 1.00 10.34  ? 625 ASN D CB    1 
ATOM   8059  C  CG    . ASN F 3 329 ? 122.507 -24.358 -23.467 1.00 11.54  ? 625 ASN D CG    1 
ATOM   8060  O  OD1   . ASN F 3 329 ? 122.113 -25.474 -23.820 1.00 13.37  ? 625 ASN D OD1   1 
ATOM   8061  N  ND2   . ASN F 3 329 ? 123.579 -23.782 -23.997 1.00 10.36  ? 625 ASN D ND2   1 
ATOM   8062  N  N     . ILE F 3 330 ? 118.319 -24.870 -23.038 1.00 10.41  ? 626 ILE D N     1 
ATOM   8063  C  CA    . ILE F 3 330 ? 117.333 -25.029 -24.089 1.00 10.54  ? 626 ILE D CA    1 
ATOM   8064  C  C     . ILE F 3 330 ? 116.573 -23.710 -24.178 1.00 10.87  ? 626 ILE D C     1 
ATOM   8065  O  O     . ILE F 3 330 ? 116.116 -23.199 -23.173 1.00 10.64  ? 626 ILE D O     1 
ATOM   8066  C  CB    . ILE F 3 330 ? 116.395 -26.217 -23.756 1.00 10.63  ? 626 ILE D CB    1 
ATOM   8067  C  CG1   . ILE F 3 330 ? 117.189 -27.527 -23.726 1.00 10.66  ? 626 ILE D CG1   1 
ATOM   8068  C  CG2   . ILE F 3 330 ? 115.260 -26.337 -24.773 1.00 9.82   ? 626 ILE D CG2   1 
ATOM   8069  C  CD1   . ILE F 3 330 ? 117.734 -27.936 -25.085 1.00 10.09  ? 626 ILE D CD1   1 
ATOM   8070  N  N     . PRO F 3 331 ? 116.446 -23.134 -25.376 1.00 11.77  ? 627 PRO D N     1 
ATOM   8071  C  CA    . PRO F 3 331 ? 115.872 -21.777 -25.432 1.00 12.61  ? 627 PRO D CA    1 
ATOM   8072  C  C     . PRO F 3 331 ? 114.501 -21.616 -24.764 1.00 13.46  ? 627 PRO D C     1 
ATOM   8073  O  O     . PRO F 3 331 ? 113.740 -22.581 -24.640 1.00 13.17  ? 627 PRO D O     1 
ATOM   8074  C  CB    . PRO F 3 331 ? 115.799 -21.494 -26.929 1.00 12.19  ? 627 PRO D CB    1 
ATOM   8075  C  CG    . PRO F 3 331 ? 116.893 -22.339 -27.495 1.00 11.92  ? 627 PRO D CG    1 
ATOM   8076  C  CD    . PRO F 3 331 ? 116.809 -23.617 -26.715 1.00 11.87  ? 627 PRO D CD    1 
ATOM   8077  N  N     . ILE F 3 332 ? 114.218 -20.394 -24.326 1.00 14.57  ? 628 ILE D N     1 
ATOM   8078  C  CA    . ILE F 3 332 ? 112.957 -20.078 -23.662 1.00 16.02  ? 628 ILE D CA    1 
ATOM   8079  C  C     . ILE F 3 332 ? 112.682 -18.559 -23.642 1.00 17.03  ? 628 ILE D C     1 
ATOM   8080  O  O     . ILE F 3 332 ? 111.581 -18.119 -23.318 1.00 16.99  ? 628 ILE D O     1 
ATOM   8081  C  CB    . ILE F 3 332 ? 112.945 -20.636 -22.220 1.00 15.82  ? 628 ILE D CB    1 
ATOM   8082  C  CG1   . ILE F 3 332 ? 111.543 -20.557 -21.608 1.00 15.65  ? 628 ILE D CG1   1 
ATOM   8083  C  CG2   . ILE F 3 332 ? 114.003 -19.937 -21.368 1.00 15.75  ? 628 ILE D CG2   1 
ATOM   8084  C  CD1   . ILE F 3 332 ? 111.401 -21.263 -20.276 1.00 16.12  ? 628 ILE D CD1   1 
ATOM   8085  N  N     . ARG F 3 333 ? 113.680 -17.767 -24.015 1.00 18.42  ? 629 ARG D N     1 
ATOM   8086  C  CA    . ARG F 3 333 ? 113.558 -16.328 -23.928 1.00 19.86  ? 629 ARG D CA    1 
ATOM   8087  C  C     . ARG F 3 333 ? 112.773 -15.671 -25.054 1.00 21.03  ? 629 ARG D C     1 
ATOM   8088  O  O     . ARG F 3 333 ? 112.069 -14.702 -24.810 1.00 21.81  ? 629 ARG D O     1 
ATOM   8089  C  CB    . ARG F 3 333 ? 114.928 -15.684 -23.734 1.00 20.02  ? 629 ARG D CB    1 
ATOM   8090  C  CG    . ARG F 3 333 ? 115.552 -16.058 -22.387 1.00 19.83  ? 629 ARG D CG    1 
ATOM   8091  C  CD    . ARG F 3 333 ? 116.794 -15.253 -22.093 1.00 19.89  ? 629 ARG D CD    1 
ATOM   8092  N  NE    . ARG F 3 333 ? 117.473 -15.748 -20.900 1.00 21.25  ? 629 ARG D NE    1 
ATOM   8093  C  CZ    . ARG F 3 333 ? 118.634 -15.285 -20.432 1.00 21.13  ? 629 ARG D CZ    1 
ATOM   8094  N  NH1   . ARG F 3 333 ? 119.264 -14.278 -21.039 1.00 20.91  ? 629 ARG D NH1   1 
ATOM   8095  N  NH2   . ARG F 3 333 ? 119.163 -15.828 -19.342 1.00 19.33  ? 629 ARG D NH2   1 
ATOM   8096  N  N     . LEU F 3 334 ? 112.884 -16.187 -26.274 1.00 22.04  ? 630 LEU D N     1 
ATOM   8097  C  CA    . LEU F 3 334 ? 112.119 -15.658 -27.411 1.00 23.00  ? 630 LEU D CA    1 
ATOM   8098  C  C     . LEU F 3 334 ? 111.187 -16.753 -27.933 1.00 23.90  ? 630 LEU D C     1 
ATOM   8099  O  O     . LEU F 3 334 ? 111.562 -17.928 -27.952 1.00 24.06  ? 630 LEU D O     1 
ATOM   8100  C  CB    . LEU F 3 334 ? 113.045 -15.178 -28.528 1.00 22.89  ? 630 LEU D CB    1 
ATOM   8101  C  CG    . LEU F 3 334 ? 114.155 -14.175 -28.177 1.00 23.33  ? 630 LEU D CG    1 
ATOM   8102  C  CD1   . LEU F 3 334 ? 115.049 -13.897 -29.379 1.00 22.02  ? 630 LEU D CD1   1 
ATOM   8103  C  CD2   . LEU F 3 334 ? 113.586 -12.872 -27.598 1.00 23.16  ? 630 LEU D CD2   1 
ATOM   8104  N  N     . GLU F 3 335 ? 109.989 -16.370 -28.369 1.00 24.72  ? 631 GLU D N     1 
ATOM   8105  C  CA    . GLU F 3 335 ? 108.969 -17.346 -28.751 1.00 25.72  ? 631 GLU D CA    1 
ATOM   8106  C  C     . GLU F 3 335 ? 109.426 -18.388 -29.787 1.00 26.12  ? 631 GLU D C     1 
ATOM   8107  O  O     . GLU F 3 335 ? 109.138 -19.585 -29.633 1.00 26.20  ? 631 GLU D O     1 
ATOM   8108  C  CB    . GLU F 3 335 ? 107.667 -16.657 -29.172 1.00 25.93  ? 631 GLU D CB    1 
ATOM   8109  C  CG    . GLU F 3 335 ? 106.495 -17.624 -29.446 1.00 28.22  ? 631 GLU D CG    1 
ATOM   8110  C  CD    . GLU F 3 335 ? 106.106 -18.505 -28.236 1.00 30.01  ? 631 GLU D CD    1 
ATOM   8111  O  OE1   . GLU F 3 335 ? 106.423 -18.148 -27.080 1.00 31.49  ? 631 GLU D OE1   1 
ATOM   8112  O  OE2   . GLU F 3 335 ? 105.467 -19.558 -28.447 1.00 30.47  ? 631 GLU D OE2   1 
ATOM   8113  N  N     . GLU F 3 336 ? 110.157 -17.945 -30.809 1.00 26.33  ? 632 GLU D N     1 
ATOM   8114  C  CA    . GLU F 3 336 ? 110.692 -18.867 -31.816 1.00 27.16  ? 632 GLU D CA    1 
ATOM   8115  C  C     . GLU F 3 336 ? 111.561 -19.979 -31.216 1.00 26.39  ? 632 GLU D C     1 
ATOM   8116  O  O     . GLU F 3 336 ? 111.421 -21.138 -31.580 1.00 26.62  ? 632 GLU D O     1 
ATOM   8117  C  CB    . GLU F 3 336 ? 111.448 -18.116 -32.919 1.00 26.77  ? 632 GLU D CB    1 
ATOM   8118  C  CG    . GLU F 3 336 ? 110.550 -17.551 -33.999 1.00 28.22  ? 632 GLU D CG    1 
ATOM   8119  C  CD    . GLU F 3 336 ? 111.262 -16.543 -34.899 1.00 29.57  ? 632 GLU D CD    1 
ATOM   8120  O  OE1   . GLU F 3 336 ? 111.655 -15.453 -34.392 1.00 32.61  ? 632 GLU D OE1   1 
ATOM   8121  O  OE2   . GLU F 3 336 ? 111.398 -16.828 -36.119 1.00 32.07  ? 632 GLU D OE2   1 
ATOM   8122  N  N     . GLY F 3 337 ? 112.452 -19.627 -30.299 1.00 26.04  ? 633 GLY D N     1 
ATOM   8123  C  CA    . GLY F 3 337 ? 113.293 -20.623 -29.656 1.00 25.37  ? 633 GLY D CA    1 
ATOM   8124  C  C     . GLY F 3 337 ? 112.472 -21.470 -28.708 1.00 25.09  ? 633 GLY D C     1 
ATOM   8125  O  O     . GLY F 3 337 ? 112.540 -22.695 -28.732 1.00 25.11  ? 633 GLY D O     1 
ATOM   8126  N  N     . ARG F 3 338 ? 111.678 -20.795 -27.886 1.00 24.78  ? 634 ARG D N     1 
ATOM   8127  C  CA    . ARG F 3 338 ? 110.793 -21.428 -26.923 1.00 24.60  ? 634 ARG D CA    1 
ATOM   8128  C  C     . ARG F 3 338 ? 110.081 -22.671 -27.490 1.00 24.35  ? 634 ARG D C     1 
ATOM   8129  O  O     . ARG F 3 338 ? 109.826 -23.616 -26.754 1.00 23.87  ? 634 ARG D O     1 
ATOM   8130  C  CB    . ARG F 3 338 ? 109.803 -20.384 -26.370 1.00 24.58  ? 634 ARG D CB    1 
ATOM   8131  C  CG    . ARG F 3 338 ? 109.010 -20.848 -25.161 1.00 26.18  ? 634 ARG D CG    1 
ATOM   8132  C  CD    . ARG F 3 338 ? 108.547 -19.729 -24.228 1.00 28.38  ? 634 ARG D CD    1 
ATOM   8133  N  NE    . ARG F 3 338 ? 107.981 -20.315 -23.005 1.00 31.60  ? 634 ARG D NE    1 
ATOM   8134  C  CZ    . ARG F 3 338 ? 107.863 -19.695 -21.826 1.00 33.58  ? 634 ARG D CZ    1 
ATOM   8135  N  NH1   . ARG F 3 338 ? 108.288 -18.443 -21.674 1.00 35.37  ? 634 ARG D NH1   1 
ATOM   8136  N  NH2   . ARG F 3 338 ? 107.331 -20.333 -20.783 1.00 33.64  ? 634 ARG D NH2   1 
ATOM   8137  N  N     . LYS F 3 339 ? 109.808 -22.680 -28.800 1.00 24.27  ? 635 LYS D N     1 
ATOM   8138  C  CA    . LYS F 3 339 ? 109.122 -23.803 -29.459 1.00 24.03  ? 635 LYS D CA    1 
ATOM   8139  C  C     . LYS F 3 339 ? 109.884 -25.136 -29.425 1.00 23.44  ? 635 LYS D C     1 
ATOM   8140  O  O     . LYS F 3 339 ? 109.275 -26.200 -29.397 1.00 23.40  ? 635 LYS D O     1 
ATOM   8141  C  CB    . LYS F 3 339 ? 108.718 -23.456 -30.904 1.00 24.41  ? 635 LYS D CB    1 
ATOM   8142  C  CG    . LYS F 3 339 ? 107.506 -22.526 -31.014 1.00 26.26  ? 635 LYS D CG    1 
ATOM   8143  C  CD    . LYS F 3 339 ? 106.742 -22.700 -32.340 1.00 30.50  ? 635 LYS D CD    1 
ATOM   8144  C  CE    . LYS F 3 339 ? 107.409 -22.030 -33.549 1.00 32.75  ? 635 LYS D CE    1 
ATOM   8145  N  NZ    . LYS F 3 339 ? 107.259 -20.530 -33.561 1.00 34.44  ? 635 LYS D NZ    1 
ATOM   8146  N  N     . ILE F 3 340 ? 111.212 -25.073 -29.440 1.00 22.95  ? 636 ILE D N     1 
ATOM   8147  C  CA    . ILE F 3 340 ? 112.057 -26.261 -29.321 1.00 22.07  ? 636 ILE D CA    1 
ATOM   8148  C  C     . ILE F 3 340 ? 111.558 -27.169 -28.187 1.00 21.81  ? 636 ILE D C     1 
ATOM   8149  O  O     . ILE F 3 340 ? 111.588 -28.400 -28.288 1.00 21.78  ? 636 ILE D O     1 
ATOM   8150  C  CB    . ILE F 3 340 ? 113.542 -25.853 -29.066 1.00 22.08  ? 636 ILE D CB    1 
ATOM   8151  C  CG1   . ILE F 3 340 ? 114.132 -25.175 -30.305 1.00 22.24  ? 636 ILE D CG1   1 
ATOM   8152  C  CG2   . ILE F 3 340 ? 114.406 -27.056 -28.682 1.00 21.02  ? 636 ILE D CG2   1 
ATOM   8153  C  CD1   . ILE F 3 340 ? 114.469 -26.150 -31.440 1.00 21.77  ? 636 ILE D CD1   1 
ATOM   8154  N  N     . ARG F 3 341 ? 111.063 -26.549 -27.122 1.00 21.07  ? 637 ARG D N     1 
ATOM   8155  C  CA    . ARG F 3 341 ? 110.610 -27.277 -25.945 1.00 20.43  ? 637 ARG D CA    1 
ATOM   8156  C  C     . ARG F 3 341 ? 109.419 -28.190 -26.193 1.00 20.21  ? 637 ARG D C     1 
ATOM   8157  O  O     . ARG F 3 341 ? 109.136 -29.083 -25.390 1.00 19.97  ? 637 ARG D O     1 
ATOM   8158  C  CB    . ARG F 3 341 ? 110.318 -26.307 -24.806 1.00 20.08  ? 637 ARG D CB    1 
ATOM   8159  C  CG    . ARG F 3 341 ? 111.541 -25.557 -24.380 1.00 19.43  ? 637 ARG D CG    1 
ATOM   8160  C  CD    . ARG F 3 341 ? 111.472 -25.118 -22.947 1.00 19.34  ? 637 ARG D CD    1 
ATOM   8161  N  NE    . ARG F 3 341 ? 112.688 -24.393 -22.592 1.00 18.35  ? 637 ARG D NE    1 
ATOM   8162  C  CZ    . ARG F 3 341 ? 113.096 -24.174 -21.352 1.00 16.31  ? 637 ARG D CZ    1 
ATOM   8163  N  NH1   . ARG F 3 341 ? 112.387 -24.632 -20.330 1.00 16.19  ? 637 ARG D NH1   1 
ATOM   8164  N  NH2   . ARG F 3 341 ? 114.210 -23.497 -21.139 1.00 14.24  ? 637 ARG D NH2   1 
ATOM   8165  N  N     . GLN F 3 342 ? 108.739 -27.976 -27.314 1.00 20.12  ? 638 GLN D N     1 
ATOM   8166  C  CA    . GLN F 3 342 ? 107.581 -28.786 -27.685 1.00 20.08  ? 638 GLN D CA    1 
ATOM   8167  C  C     . GLN F 3 342 ? 108.006 -30.195 -28.056 1.00 19.22  ? 638 GLN D C     1 
ATOM   8168  O  O     . GLN F 3 342 ? 107.182 -31.105 -28.078 1.00 18.83  ? 638 GLN D O     1 
ATOM   8169  C  CB    . GLN F 3 342 ? 106.816 -28.147 -28.853 1.00 20.05  ? 638 GLN D CB    1 
ATOM   8170  C  CG    . GLN F 3 342 ? 105.915 -26.972 -28.459 1.00 20.67  ? 638 GLN D CG    1 
ATOM   8171  C  CD    . GLN F 3 342 ? 105.448 -26.146 -29.656 1.00 21.43  ? 638 GLN D CD    1 
ATOM   8172  O  OE1   . GLN F 3 342 ? 105.483 -26.600 -30.811 1.00 21.91  ? 638 GLN D OE1   1 
ATOM   8173  N  NE2   . GLN F 3 342 ? 105.018 -24.917 -29.381 1.00 22.69  ? 638 GLN D NE2   1 
ATOM   8174  N  N     . ALA F 3 343 ? 109.295 -30.360 -28.346 1.00 18.67  ? 639 ALA D N     1 
ATOM   8175  C  CA    . ALA F 3 343 ? 109.835 -31.645 -28.752 1.00 18.25  ? 639 ALA D CA    1 
ATOM   8176  C  C     . ALA F 3 343 ? 110.220 -32.500 -27.553 1.00 18.19  ? 639 ALA D C     1 
ATOM   8177  O  O     . ALA F 3 343 ? 110.474 -33.698 -27.708 1.00 18.39  ? 639 ALA D O     1 
ATOM   8178  C  CB    . ALA F 3 343 ? 111.005 -31.458 -29.686 1.00 17.93  ? 639 ALA D CB    1 
ATOM   8179  N  N     . PHE F 3 344 ? 110.265 -31.890 -26.365 1.00 17.74  ? 640 PHE D N     1 
ATOM   8180  C  CA    . PHE F 3 344 ? 110.532 -32.627 -25.124 1.00 17.47  ? 640 PHE D CA    1 
ATOM   8181  C  C     . PHE F 3 344 ? 109.218 -33.069 -24.508 1.00 17.24  ? 640 PHE D C     1 
ATOM   8182  O  O     . PHE F 3 344 ? 108.484 -32.251 -23.930 1.00 17.29  ? 640 PHE D O     1 
ATOM   8183  C  CB    . PHE F 3 344 ? 111.352 -31.779 -24.149 1.00 17.43  ? 640 PHE D CB    1 
ATOM   8184  C  CG    . PHE F 3 344 ? 112.732 -31.519 -24.627 1.00 17.32  ? 640 PHE D CG    1 
ATOM   8185  C  CD1   . PHE F 3 344 ? 113.768 -32.361 -24.270 1.00 16.96  ? 640 PHE D CD1   1 
ATOM   8186  C  CD2   . PHE F 3 344 ? 112.990 -30.473 -25.489 1.00 17.53  ? 640 PHE D CD2   1 
ATOM   8187  C  CE1   . PHE F 3 344 ? 115.044 -32.141 -24.738 1.00 17.08  ? 640 PHE D CE1   1 
ATOM   8188  C  CE2   . PHE F 3 344 ? 114.269 -30.256 -25.968 1.00 17.83  ? 640 PHE D CE2   1 
ATOM   8189  C  CZ    . PHE F 3 344 ? 115.294 -31.090 -25.591 1.00 17.13  ? 640 PHE D CZ    1 
ATOM   8190  N  N     . VAL F 3 345 ? 108.933 -34.362 -24.648 1.00 16.87  ? 641 VAL D N     1 
ATOM   8191  C  CA    . VAL F 3 345 ? 107.651 -34.950 -24.258 1.00 17.05  ? 641 VAL D CA    1 
ATOM   8192  C  C     . VAL F 3 345 ? 107.822 -36.024 -23.178 1.00 17.84  ? 641 VAL D C     1 
ATOM   8193  O  O     . VAL F 3 345 ? 108.931 -36.508 -22.948 1.00 18.06  ? 641 VAL D O     1 
ATOM   8194  C  CB    . VAL F 3 345 ? 106.965 -35.613 -25.482 1.00 16.67  ? 641 VAL D CB    1 
ATOM   8195  C  CG1   . VAL F 3 345 ? 106.805 -34.634 -26.616 1.00 15.16  ? 641 VAL D CG1   1 
ATOM   8196  C  CG2   . VAL F 3 345 ? 107.769 -36.812 -25.949 1.00 16.61  ? 641 VAL D CG2   1 
ATOM   8197  N  N     . PRO F 3 346 ? 106.725 -36.393 -22.491 1.00 18.40  ? 642 PRO D N     1 
ATOM   8198  C  CA    . PRO F 3 346 ? 106.782 -37.495 -21.519 1.00 18.81  ? 642 PRO D CA    1 
ATOM   8199  C  C     . PRO F 3 346 ? 107.206 -38.793 -22.197 1.00 19.56  ? 642 PRO D C     1 
ATOM   8200  O  O     . PRO F 3 346 ? 107.000 -38.941 -23.400 1.00 19.71  ? 642 PRO D O     1 
ATOM   8201  C  CB    . PRO F 3 346 ? 105.341 -37.610 -21.041 1.00 18.32  ? 642 PRO D CB    1 
ATOM   8202  C  CG    . PRO F 3 346 ? 104.759 -36.242 -21.300 1.00 18.44  ? 642 PRO D CG    1 
ATOM   8203  C  CD    . PRO F 3 346 ? 105.388 -35.781 -22.554 1.00 18.08  ? 642 PRO D CD    1 
ATOM   8204  N  N     . SER F 3 347 ? 107.782 -39.723 -21.437 1.00 20.52  ? 643 SER D N     1 
ATOM   8205  C  CA    . SER F 3 347 ? 108.292 -40.980 -22.005 1.00 21.17  ? 643 SER D CA    1 
ATOM   8206  C  C     . SER F 3 347 ? 107.239 -42.065 -22.160 1.00 22.08  ? 643 SER D C     1 
ATOM   8207  O  O     . SER F 3 347 ? 107.558 -43.169 -22.575 1.00 22.40  ? 643 SER D O     1 
ATOM   8208  C  CB    . SER F 3 347 ? 109.443 -41.529 -21.168 1.00 20.83  ? 643 SER D CB    1 
ATOM   8209  O  OG    . SER F 3 347 ? 108.960 -42.051 -19.947 1.00 20.57  ? 643 SER D OG    1 
ATOM   8210  N  N     . GLU F 3 348 ? 105.996 -41.764 -21.808 1.00 23.29  ? 644 GLU D N     1 
ATOM   8211  C  CA    . GLU F 3 348 ? 104.903 -42.715 -21.980 1.00 24.60  ? 644 GLU D CA    1 
ATOM   8212  C  C     . GLU F 3 348 ? 103.535 -42.098 -22.120 1.00 25.09  ? 644 GLU D C     1 
ATOM   8213  O  O     . GLU F 3 348 ? 103.347 -40.901 -21.898 1.00 25.40  ? 644 GLU D O     1 
ATOM   8214  C  CB    . GLU F 3 348 ? 104.884 -43.770 -20.884 1.00 24.90  ? 644 GLU D CB    1 
ATOM   8215  C  CG    . GLU F 3 348 ? 105.314 -45.114 -21.412 1.00 27.26  ? 644 GLU D CG    1 
ATOM   8216  C  CD    . GLU F 3 348 ? 105.898 -45.986 -20.342 1.00 29.18  ? 644 GLU D CD    1 
ATOM   8217  O  OE1   . GLU F 3 348 ? 106.170 -45.457 -19.245 1.00 29.56  ? 644 GLU D OE1   1 
ATOM   8218  O  OE2   . GLU F 3 348 ? 106.100 -47.193 -20.607 1.00 30.95  ? 644 GLU D OE2   1 
ATOM   8219  N  N     . SER F 3 349 ? 102.591 -42.950 -22.504 1.00 25.59  ? 645 SER D N     1 
ATOM   8220  C  CA    . SER F 3 349 ? 101.204 -42.573 -22.727 1.00 26.01  ? 645 SER D CA    1 
ATOM   8221  C  C     . SER F 3 349 ? 100.543 -42.090 -21.446 1.00 25.87  ? 645 SER D C     1 
ATOM   8222  O  O     . SER F 3 349 ? 100.643 -42.749 -20.394 1.00 25.94  ? 645 SER D O     1 
ATOM   8223  C  CB    . SER F 3 349 ? 100.430 -43.796 -23.219 1.00 26.39  ? 645 SER D CB    1 
ATOM   8224  O  OG    . SER F 3 349 ? 101.190 -44.514 -24.169 1.00 27.53  ? 645 SER D OG    1 
ATOM   8225  N  N     . ASP F 3 350 ? 99.864  -40.948 -21.526 1.00 25.28  ? 646 ASP D N     1 
ATOM   8226  C  CA    . ASP F 3 350 ? 99.126  -40.458 -20.370 1.00 24.84  ? 646 ASP D CA    1 
ATOM   8227  C  C     . ASP F 3 350 ? 100.055 -40.096 -19.203 1.00 23.55  ? 646 ASP D C     1 
ATOM   8228  O  O     . ASP F 3 350 ? 99.678  -40.183 -18.034 1.00 23.23  ? 646 ASP D O     1 
ATOM   8229  C  CB    . ASP F 3 350 ? 98.085  -41.505 -19.940 1.00 25.40  ? 646 ASP D CB    1 
ATOM   8230  C  CG    . ASP F 3 350 ? 97.163  -41.924 -21.092 1.00 27.99  ? 646 ASP D CG    1 
ATOM   8231  O  OD1   . ASP F 3 350 ? 96.544  -41.018 -21.726 1.00 28.85  ? 646 ASP D OD1   1 
ATOM   8232  O  OD2   . ASP F 3 350 ? 97.054  -43.157 -21.351 1.00 29.35  ? 646 ASP D OD2   1 
ATOM   8233  N  N     . TRP F 3 351 ? 101.287 -39.728 -19.528 1.00 22.27  ? 647 TRP D N     1 
ATOM   8234  C  CA    . TRP F 3 351 ? 102.188 -39.172 -18.539 1.00 20.96  ? 647 TRP D CA    1 
ATOM   8235  C  C     . TRP F 3 351 ? 102.301 -37.729 -18.900 1.00 20.15  ? 647 TRP D C     1 
ATOM   8236  O  O     . TRP F 3 351 ? 102.050 -37.350 -20.047 1.00 19.75  ? 647 TRP D O     1 
ATOM   8237  C  CB    . TRP F 3 351 ? 103.561 -39.807 -18.591 1.00 20.87  ? 647 TRP D CB    1 
ATOM   8238  C  CG    . TRP F 3 351 ? 103.626 -41.091 -17.888 1.00 20.67  ? 647 TRP D CG    1 
ATOM   8239  C  CD1   . TRP F 3 351 ? 102.760 -42.129 -18.008 1.00 20.57  ? 647 TRP D CD1   1 
ATOM   8240  C  CD2   . TRP F 3 351 ? 104.635 -41.508 -16.963 1.00 20.37  ? 647 TRP D CD2   1 
ATOM   8241  N  NE1   . TRP F 3 351 ? 103.154 -43.166 -17.204 1.00 20.62  ? 647 TRP D NE1   1 
ATOM   8242  C  CE2   . TRP F 3 351 ? 104.306 -42.814 -16.552 1.00 20.07  ? 647 TRP D CE2   1 
ATOM   8243  C  CE3   . TRP F 3 351 ? 105.786 -40.904 -16.442 1.00 20.67  ? 647 TRP D CE3   1 
ATOM   8244  C  CZ2   . TRP F 3 351 ? 105.084 -43.533 -15.649 1.00 19.62  ? 647 TRP D CZ2   1 
ATOM   8245  C  CZ3   . TRP F 3 351 ? 106.553 -41.613 -15.534 1.00 20.64  ? 647 TRP D CZ3   1 
ATOM   8246  C  CH2   . TRP F 3 351 ? 106.200 -42.917 -15.151 1.00 20.34  ? 647 TRP D CH2   1 
ATOM   8247  N  N     . LEU F 3 352 ? 102.656 -36.917 -17.916 1.00 19.37  ? 648 LEU D N     1 
ATOM   8248  C  CA    . LEU F 3 352 ? 102.844 -35.499 -18.156 1.00 18.46  ? 648 LEU D CA    1 
ATOM   8249  C  C     . LEU F 3 352 ? 104.182 -35.040 -17.609 1.00 17.85  ? 648 LEU D C     1 
ATOM   8250  O  O     . LEU F 3 352 ? 104.780 -35.700 -16.770 1.00 17.19  ? 648 LEU D O     1 
ATOM   8251  C  CB    . LEU F 3 352 ? 101.704 -34.705 -17.523 1.00 18.59  ? 648 LEU D CB    1 
ATOM   8252  C  CG    . LEU F 3 352 ? 100.283 -34.924 -18.060 1.00 18.53  ? 648 LEU D CG    1 
ATOM   8253  C  CD1   . LEU F 3 352 ? 99.265  -34.259 -17.154 1.00 18.67  ? 648 LEU D CD1   1 
ATOM   8254  C  CD2   . LEU F 3 352 ? 100.136 -34.415 -19.496 1.00 16.96  ? 648 LEU D CD2   1 
ATOM   8255  N  N     . ILE F 3 353 ? 104.645 -33.912 -18.125 1.00 17.68  ? 649 ILE D N     1 
ATOM   8256  C  CA    . ILE F 3 353 ? 105.829 -33.239 -17.637 1.00 17.41  ? 649 ILE D CA    1 
ATOM   8257  C  C     . ILE F 3 353 ? 105.418 -32.289 -16.497 1.00 17.41  ? 649 ILE D C     1 
ATOM   8258  O  O     . ILE F 3 353 ? 104.383 -31.631 -16.584 1.00 17.55  ? 649 ILE D O     1 
ATOM   8259  C  CB    . ILE F 3 353 ? 106.496 -32.450 -18.796 1.00 17.55  ? 649 ILE D CB    1 
ATOM   8260  C  CG1   . ILE F 3 353 ? 107.164 -33.421 -19.763 1.00 17.56  ? 649 ILE D CG1   1 
ATOM   8261  C  CG2   . ILE F 3 353 ? 107.547 -31.462 -18.291 1.00 17.08  ? 649 ILE D CG2   1 
ATOM   8262  C  CD1   . ILE F 3 353 ? 108.179 -34.327 -19.104 1.00 16.05  ? 649 ILE D CD1   1 
ATOM   8263  N  N     . PHE F 3 354 ? 106.217 -32.236 -15.431 1.00 17.14  ? 650 PHE D N     1 
ATOM   8264  C  CA    . PHE F 3 354 ? 105.993 -31.325 -14.303 1.00 16.83  ? 650 PHE D CA    1 
ATOM   8265  C  C     . PHE F 3 354 ? 107.238 -30.439 -14.096 1.00 16.48  ? 650 PHE D C     1 
ATOM   8266  O  O     . PHE F 3 354 ? 108.352 -30.933 -14.104 1.00 16.75  ? 650 PHE D O     1 
ATOM   8267  C  CB    . PHE F 3 354 ? 105.709 -32.134 -13.031 1.00 16.47  ? 650 PHE D CB    1 
ATOM   8268  C  CG    . PHE F 3 354 ? 105.369 -31.291 -11.829 1.00 16.95  ? 650 PHE D CG    1 
ATOM   8269  C  CD1   . PHE F 3 354 ? 104.051 -31.185 -11.384 1.00 16.97  ? 650 PHE D CD1   1 
ATOM   8270  C  CD2   . PHE F 3 354 ? 106.357 -30.593 -11.138 1.00 16.92  ? 650 PHE D CD2   1 
ATOM   8271  C  CE1   . PHE F 3 354 ? 103.731 -30.409 -10.269 1.00 15.78  ? 650 PHE D CE1   1 
ATOM   8272  C  CE2   . PHE F 3 354 ? 106.040 -29.801 -10.018 1.00 15.31  ? 650 PHE D CE2   1 
ATOM   8273  C  CZ    . PHE F 3 354 ? 104.733 -29.713 -9.589  1.00 15.53  ? 650 PHE D CZ    1 
ATOM   8274  N  N     . ALA F 3 355 ? 107.067 -29.138 -13.900 1.00 16.24  ? 651 ALA D N     1 
ATOM   8275  C  CA    . ALA F 3 355 ? 108.236 -28.271 -13.675 1.00 15.72  ? 651 ALA D CA    1 
ATOM   8276  C  C     . ALA F 3 355 ? 108.033 -27.382 -12.463 1.00 15.63  ? 651 ALA D C     1 
ATOM   8277  O  O     . ALA F 3 355 ? 106.952 -26.836 -12.277 1.00 15.87  ? 651 ALA D O     1 
ATOM   8278  C  CB    . ALA F 3 355 ? 108.524 -27.434 -14.889 1.00 15.29  ? 651 ALA D CB    1 
ATOM   8279  N  N     . ALA F 3 356 ? 109.067 -27.255 -11.635 1.00 15.43  ? 652 ALA D N     1 
ATOM   8280  C  CA    . ALA F 3 356 ? 109.009 -26.415 -10.435 1.00 15.18  ? 652 ALA D CA    1 
ATOM   8281  C  C     . ALA F 3 356 ? 110.281 -25.570 -10.294 1.00 15.26  ? 652 ALA D C     1 
ATOM   8282  O  O     . ALA F 3 356 ? 111.393 -26.112 -10.290 1.00 14.99  ? 652 ALA D O     1 
ATOM   8283  C  CB    . ALA F 3 356 ? 108.791 -27.269 -9.202  1.00 15.04  ? 652 ALA D CB    1 
ATOM   8284  N  N     . ASP F 3 357 ? 110.097 -24.253 -10.144 1.00 15.18  ? 653 ASP D N     1 
ATOM   8285  C  CA    . ASP F 3 357 ? 111.184 -23.268 -10.148 1.00 15.19  ? 653 ASP D CA    1 
ATOM   8286  C  C     . ASP F 3 357 ? 111.193 -22.365 -8.900  1.00 14.83  ? 653 ASP D C     1 
ATOM   8287  O  O     . ASP F 3 357 ? 110.185 -21.740 -8.577  1.00 14.82  ? 653 ASP D O     1 
ATOM   8288  C  CB    . ASP F 3 357 ? 111.048 -22.406 -11.414 1.00 15.79  ? 653 ASP D CB    1 
ATOM   8289  C  CG    . ASP F 3 357 ? 112.187 -21.392 -11.589 1.00 18.18  ? 653 ASP D CG    1 
ATOM   8290  O  OD1   . ASP F 3 357 ? 112.819 -20.982 -10.599 1.00 21.25  ? 653 ASP D OD1   1 
ATOM   8291  O  OD2   . ASP F 3 357 ? 112.444 -20.974 -12.736 1.00 21.02  ? 653 ASP D OD2   1 
ATOM   8292  N  N     . TYR F 3 358 ? 112.333 -22.287 -8.213  1.00 13.92  ? 654 TYR D N     1 
ATOM   8293  C  CA    . TYR F 3 358 ? 112.473 -21.407 -7.058  1.00 13.53  ? 654 TYR D CA    1 
ATOM   8294  C  C     . TYR F 3 358 ? 112.386 -19.935 -7.440  1.00 13.62  ? 654 TYR D C     1 
ATOM   8295  O  O     . TYR F 3 358 ? 113.119 -19.481 -8.300  1.00 13.77  ? 654 TYR D O     1 
ATOM   8296  C  CB    . TYR F 3 358 ? 113.820 -21.624 -6.369  1.00 13.40  ? 654 TYR D CB    1 
ATOM   8297  C  CG    . TYR F 3 358 ? 113.906 -22.800 -5.426  1.00 12.50  ? 654 TYR D CG    1 
ATOM   8298  C  CD1   . TYR F 3 358 ? 114.790 -23.848 -5.679  1.00 11.94  ? 654 TYR D CD1   1 
ATOM   8299  C  CD2   . TYR F 3 358 ? 113.116 -22.861 -4.279  1.00 11.55  ? 654 TYR D CD2   1 
ATOM   8300  C  CE1   . TYR F 3 358 ? 114.892 -24.908 -4.824  1.00 10.94  ? 654 TYR D CE1   1 
ATOM   8301  C  CE2   . TYR F 3 358 ? 113.206 -23.927 -3.417  1.00 10.64  ? 654 TYR D CE2   1 
ATOM   8302  C  CZ    . TYR F 3 358 ? 114.101 -24.942 -3.694  1.00 11.81  ? 654 TYR D CZ    1 
ATOM   8303  O  OH    . TYR F 3 358 ? 114.205 -26.013 -2.850  1.00 12.39  ? 654 TYR D OH    1 
ATOM   8304  N  N     . SER F 3 359 ? 111.528 -19.190 -6.751  1.00 13.98  ? 655 SER D N     1 
ATOM   8305  C  CA    . SER F 3 359 ? 111.285 -17.767 -7.020  1.00 14.20  ? 655 SER D CA    1 
ATOM   8306  C  C     . SER F 3 359 ? 112.391 -16.822 -6.544  1.00 13.61  ? 655 SER D C     1 
ATOM   8307  O  O     . SER F 3 359 ? 112.617 -16.684 -5.335  1.00 13.13  ? 655 SER D O     1 
ATOM   8308  C  CB    . SER F 3 359 ? 109.964 -17.346 -6.368  1.00 14.62  ? 655 SER D CB    1 
ATOM   8309  O  OG    . SER F 3 359 ? 109.864 -15.926 -6.304  1.00 17.21  ? 655 SER D OG    1 
ATOM   8310  N  N     . GLN F 3 360 ? 113.048 -16.149 -7.492  1.00 13.19  ? 656 GLN D N     1 
ATOM   8311  C  CA    . GLN F 3 360 ? 114.163 -15.233 -7.182  1.00 13.26  ? 656 GLN D CA    1 
ATOM   8312  C  C     . GLN F 3 360 ? 115.060 -15.814 -6.090  1.00 12.57  ? 656 GLN D C     1 
ATOM   8313  O  O     . GLN F 3 360 ? 115.293 -15.171 -5.058  1.00 11.64  ? 656 GLN D O     1 
ATOM   8314  C  CB    . GLN F 3 360 ? 113.630 -13.887 -6.712  1.00 13.68  ? 656 GLN D CB    1 
ATOM   8315  C  CG    . GLN F 3 360 ? 112.403 -13.451 -7.458  1.00 15.87  ? 656 GLN D CG    1 
ATOM   8316  C  CD    . GLN F 3 360 ? 111.416 -12.751 -6.548  1.00 18.16  ? 656 GLN D CD    1 
ATOM   8317  O  OE1   . GLN F 3 360 ? 111.599 -11.587 -6.197  1.00 18.63  ? 656 GLN D OE1   1 
ATOM   8318  N  NE2   . GLN F 3 360 ? 110.355 -13.465 -6.163  1.00 17.87  ? 656 GLN D NE2   1 
ATOM   8319  N  N     . ILE F 3 361 ? 115.543 -17.030 -6.333  1.00 11.85  ? 657 ILE D N     1 
ATOM   8320  C  CA    . ILE F 3 361 ? 116.324 -17.783 -5.360  1.00 11.49  ? 657 ILE D CA    1 
ATOM   8321  C  C     . ILE F 3 361 ? 117.547 -17.042 -4.853  1.00 11.88  ? 657 ILE D C     1 
ATOM   8322  O  O     . ILE F 3 361 ? 117.799 -17.006 -3.640  1.00 12.25  ? 657 ILE D O     1 
ATOM   8323  C  CB    . ILE F 3 361 ? 116.766 -19.191 -5.926  1.00 11.58  ? 657 ILE D CB    1 
ATOM   8324  C  CG1   . ILE F 3 361 ? 117.528 -20.008 -4.887  1.00 10.42  ? 657 ILE D CG1   1 
ATOM   8325  C  CG2   . ILE F 3 361 ? 117.596 -19.065 -7.190  1.00 10.42  ? 657 ILE D CG2   1 
ATOM   8326  C  CD1   . ILE F 3 361 ? 116.655 -20.645 -3.870  1.00 9.36   ? 657 ILE D CD1   1 
ATOM   8327  N  N     . GLU F 3 362 ? 118.315 -16.442 -5.752  1.00 11.69  ? 658 GLU D N     1 
ATOM   8328  C  CA    . GLU F 3 362 ? 119.566 -15.871 -5.286  1.00 12.66  ? 658 GLU D CA    1 
ATOM   8329  C  C     . GLU F 3 362 ? 119.435 -14.596 -4.468  1.00 12.29  ? 658 GLU D C     1 
ATOM   8330  O  O     . GLU F 3 362 ? 120.259 -14.355 -3.582  1.00 12.05  ? 658 GLU D O     1 
ATOM   8331  C  CB    . GLU F 3 362 ? 120.666 -15.871 -6.359  1.00 12.35  ? 658 GLU D CB    1 
ATOM   8332  C  CG    . GLU F 3 362 ? 121.209 -17.299 -6.554  1.00 13.11  ? 658 GLU D CG    1 
ATOM   8333  C  CD    . GLU F 3 362 ? 122.293 -17.430 -7.605  1.00 14.57  ? 658 GLU D CD    1 
ATOM   8334  O  OE1   . GLU F 3 362 ? 123.046 -16.444 -7.838  1.00 19.74  ? 658 GLU D OE1   1 
ATOM   8335  O  OE2   . GLU F 3 362 ? 122.389 -18.523 -8.209  1.00 15.15  ? 658 GLU D OE2   1 
ATOM   8336  N  N     . LEU F 3 363 ? 118.372 -13.826 -4.723  1.00 12.41  ? 659 LEU D N     1 
ATOM   8337  C  CA    . LEU F 3 363 ? 118.071 -12.629 -3.926  1.00 12.46  ? 659 LEU D CA    1 
ATOM   8338  C  C     . LEU F 3 363 ? 117.574 -13.009 -2.528  1.00 12.38  ? 659 LEU D C     1 
ATOM   8339  O  O     . LEU F 3 363 ? 117.919 -12.341 -1.548  1.00 12.86  ? 659 LEU D O     1 
ATOM   8340  C  CB    . LEU F 3 363 ? 117.062 -11.708 -4.625  1.00 12.19  ? 659 LEU D CB    1 
ATOM   8341  C  CG    . LEU F 3 363 ? 117.506 -11.036 -5.931  1.00 13.26  ? 659 LEU D CG    1 
ATOM   8342  C  CD1   . LEU F 3 363 ? 116.348 -10.316 -6.616  1.00 12.04  ? 659 LEU D CD1   1 
ATOM   8343  C  CD2   . LEU F 3 363 ? 118.684 -10.070 -5.728  1.00 12.75  ? 659 LEU D CD2   1 
ATOM   8344  N  N     . ARG F 3 364 ? 116.782 -14.081 -2.437  1.00 12.17  ? 660 ARG D N     1 
ATOM   8345  C  CA    . ARG F 3 364 ? 116.288 -14.569 -1.143  1.00 12.10  ? 660 ARG D CA    1 
ATOM   8346  C  C     . ARG F 3 364 ? 117.441 -15.042 -0.284  1.00 11.95  ? 660 ARG D C     1 
ATOM   8347  O  O     . ARG F 3 364 ? 117.517 -14.712 0.906   1.00 11.97  ? 660 ARG D O     1 
ATOM   8348  C  CB    . ARG F 3 364 ? 115.262 -15.694 -1.310  1.00 11.90  ? 660 ARG D CB    1 
ATOM   8349  C  CG    . ARG F 3 364 ? 113.944 -15.231 -1.885  1.00 12.45  ? 660 ARG D CG    1 
ATOM   8350  C  CD    . ARG F 3 364 ? 112.928 -16.344 -1.922  1.00 12.13  ? 660 ARG D CD    1 
ATOM   8351  N  NE    . ARG F 3 364 ? 111.731 -15.937 -2.652  1.00 13.29  ? 660 ARG D NE    1 
ATOM   8352  C  CZ    . ARG F 3 364 ? 110.616 -15.502 -2.080  1.00 13.54  ? 660 ARG D CZ    1 
ATOM   8353  N  NH1   . ARG F 3 364 ? 110.551 -15.431 -0.758  1.00 13.46  ? 660 ARG D NH1   1 
ATOM   8354  N  NH2   . ARG F 3 364 ? 109.573 -15.143 -2.827  1.00 12.76  ? 660 ARG D NH2   1 
ATOM   8355  N  N     . VAL F 3 365 ? 118.325 -15.832 -0.898  1.00 11.88  ? 661 VAL D N     1 
ATOM   8356  C  CA    . VAL F 3 365 ? 119.551 -16.308 -0.244  1.00 11.31  ? 661 VAL D CA    1 
ATOM   8357  C  C     . VAL F 3 365 ? 120.384 -15.111 0.239   1.00 11.05  ? 661 VAL D C     1 
ATOM   8358  O  O     . VAL F 3 365 ? 120.786 -15.050 1.407   1.00 10.87  ? 661 VAL D O     1 
ATOM   8359  C  CB    . VAL F 3 365 ? 120.378 -17.181 -1.201  1.00 10.92  ? 661 VAL D CB    1 
ATOM   8360  C  CG1   . VAL F 3 365 ? 121.757 -17.388 -0.668  1.00 10.68  ? 661 VAL D CG1   1 
ATOM   8361  C  CG2   . VAL F 3 365 ? 119.695 -18.531 -1.402  1.00 11.16  ? 661 VAL D CG2   1 
ATOM   8362  N  N     . LEU F 3 366 ? 120.614 -14.155 -0.655  1.00 10.50  ? 662 LEU D N     1 
ATOM   8363  C  CA    . LEU F 3 366 ? 121.344 -12.955 -0.294  1.00 10.57  ? 662 LEU D CA    1 
ATOM   8364  C  C     . LEU F 3 366 ? 120.721 -12.318 0.945   1.00 10.76  ? 662 LEU D C     1 
ATOM   8365  O  O     . LEU F 3 366 ? 121.424 -11.998 1.899   1.00 10.77  ? 662 LEU D O     1 
ATOM   8366  C  CB    . LEU F 3 366 ? 121.356 -11.955 -1.450  1.00 10.83  ? 662 LEU D CB    1 
ATOM   8367  C  CG    . LEU F 3 366 ? 121.977 -10.589 -1.122  1.00 11.25  ? 662 LEU D CG    1 
ATOM   8368  C  CD1   . LEU F 3 366 ? 123.409 -10.733 -0.565  1.00 10.84  ? 662 LEU D CD1   1 
ATOM   8369  C  CD2   . LEU F 3 366 ? 121.945 -9.669  -2.343  1.00 10.08  ? 662 LEU D CD2   1 
ATOM   8370  N  N     . ALA F 3 367 ? 119.401 -12.151 0.929   1.00 10.81  ? 663 ALA D N     1 
ATOM   8371  C  CA    . ALA F 3 367 ? 118.695 -11.560 2.050   1.00 10.83  ? 663 ALA D CA    1 
ATOM   8372  C  C     . ALA F 3 367 ? 119.026 -12.288 3.335   1.00 11.13  ? 663 ALA D C     1 
ATOM   8373  O  O     . ALA F 3 367 ? 119.271 -11.661 4.356   1.00 11.28  ? 663 ALA D O     1 
ATOM   8374  C  CB    . ALA F 3 367 ? 117.204 -11.587 1.808   1.00 10.73  ? 663 ALA D CB    1 
ATOM   8375  N  N     . HIS F 3 368 ? 119.031 -13.615 3.278   1.00 11.60  ? 664 HIS D N     1 
ATOM   8376  C  CA    . HIS F 3 368 ? 119.328 -14.430 4.440   1.00 12.04  ? 664 HIS D CA    1 
ATOM   8377  C  C     . HIS F 3 368 ? 120.764 -14.296 4.911   1.00 13.01  ? 664 HIS D C     1 
ATOM   8378  O  O     . HIS F 3 368 ? 121.039 -14.285 6.117   1.00 12.59  ? 664 HIS D O     1 
ATOM   8379  C  CB    . HIS F 3 368 ? 119.053 -15.896 4.140   1.00 12.00  ? 664 HIS D CB    1 
ATOM   8380  C  CG    . HIS F 3 368 ? 119.647 -16.822 5.144   1.00 11.76  ? 664 HIS D CG    1 
ATOM   8381  N  ND1   . HIS F 3 368 ? 119.022 -17.123 6.334   1.00 12.08  ? 664 HIS D ND1   1 
ATOM   8382  C  CD2   . HIS F 3 368 ? 120.824 -17.490 5.155   1.00 12.21  ? 664 HIS D CD2   1 
ATOM   8383  C  CE1   . HIS F 3 368 ? 119.783 -17.949 7.029   1.00 12.61  ? 664 HIS D CE1   1 
ATOM   8384  N  NE2   . HIS F 3 368 ? 120.885 -18.181 6.340   1.00 13.01  ? 664 HIS D NE2   1 
ATOM   8385  N  N     . ILE F 3 369 ? 121.684 -14.219 3.954   1.00 13.89  ? 665 ILE D N     1 
ATOM   8386  C  CA    . ILE F 3 369 ? 123.106 -14.134 4.287   1.00 14.79  ? 665 ILE D CA    1 
ATOM   8387  C  C     . ILE F 3 369 ? 123.542 -12.737 4.758   1.00 15.21  ? 665 ILE D C     1 
ATOM   8388  O  O     . ILE F 3 369 ? 124.246 -12.599 5.777   1.00 15.69  ? 665 ILE D O     1 
ATOM   8389  C  CB    . ILE F 3 369 ? 123.997 -14.661 3.132   1.00 14.67  ? 665 ILE D CB    1 
ATOM   8390  C  CG1   . ILE F 3 369 ? 123.932 -16.191 3.098   1.00 14.66  ? 665 ILE D CG1   1 
ATOM   8391  C  CG2   . ILE F 3 369 ? 125.424 -14.253 3.337   1.00 14.10  ? 665 ILE D CG2   1 
ATOM   8392  C  CD1   . ILE F 3 369 ? 124.592 -16.815 1.896   1.00 13.32  ? 665 ILE D CD1   1 
ATOM   8393  N  N     . ALA F 3 370 ? 123.113 -11.715 4.026   1.00 14.97  ? 666 ALA D N     1 
ATOM   8394  C  CA    . ALA F 3 370 ? 123.454 -10.335 4.349   1.00 14.79  ? 666 ALA D CA    1 
ATOM   8395  C  C     . ALA F 3 370 ? 122.658 -9.822  5.531   1.00 15.15  ? 666 ALA D C     1 
ATOM   8396  O  O     . ALA F 3 370 ? 123.012 -8.808  6.109   1.00 15.28  ? 666 ALA D O     1 
ATOM   8397  C  CB    . ALA F 3 370 ? 123.204 -9.441  3.146   1.00 14.66  ? 666 ALA D CB    1 
ATOM   8398  N  N     . GLU F 3 371 ? 121.580 -10.524 5.881   1.00 15.72  ? 667 GLU D N     1 
ATOM   8399  C  CA    . GLU F 3 371 ? 120.655 -10.084 6.926   1.00 16.16  ? 667 GLU D CA    1 
ATOM   8400  C  C     . GLU F 3 371 ? 120.220 -8.613  6.733   1.00 16.26  ? 667 GLU D C     1 
ATOM   8401  O  O     . GLU F 3 371 ? 120.210 -7.821  7.674   1.00 15.51  ? 667 GLU D O     1 
ATOM   8402  C  CB    . GLU F 3 371 ? 121.251 -10.300 8.321   1.00 16.17  ? 667 GLU D CB    1 
ATOM   8403  C  CG    . GLU F 3 371 ? 121.648 -11.723 8.606   1.00 17.90  ? 667 GLU D CG    1 
ATOM   8404  C  CD    . GLU F 3 371 ? 121.993 -11.961 10.066  1.00 20.53  ? 667 GLU D CD    1 
ATOM   8405  O  OE1   . GLU F 3 371 ? 121.227 -11.480 10.930  1.00 21.18  ? 667 GLU D OE1   1 
ATOM   8406  O  OE2   . GLU F 3 371 ? 123.009 -12.650 10.350  1.00 21.13  ? 667 GLU D OE2   1 
ATOM   8407  N  N     . ASP F 3 372 ? 119.873 -8.246  5.508   1.00 16.71  ? 668 ASP D N     1 
ATOM   8408  C  CA    . ASP F 3 372 ? 119.414 -6.887  5.255   1.00 17.76  ? 668 ASP D CA    1 
ATOM   8409  C  C     . ASP F 3 372 ? 117.942 -6.744  5.635   1.00 18.03  ? 668 ASP D C     1 
ATOM   8410  O  O     . ASP F 3 372 ? 117.110 -7.539  5.203   1.00 18.36  ? 668 ASP D O     1 
ATOM   8411  C  CB    . ASP F 3 372 ? 119.647 -6.495  3.799   1.00 17.67  ? 668 ASP D CB    1 
ATOM   8412  C  CG    . ASP F 3 372 ? 119.185 -5.095  3.505   1.00 18.59  ? 668 ASP D CG    1 
ATOM   8413  O  OD1   . ASP F 3 372 ? 117.983 -4.903  3.235   1.00 20.10  ? 668 ASP D OD1   1 
ATOM   8414  O  OD2   . ASP F 3 372 ? 120.023 -4.176  3.534   1.00 19.46  ? 668 ASP D OD2   1 
ATOM   8415  N  N     . ASP F 3 373 ? 117.616 -5.729  6.430   1.00 18.55  ? 669 ASP D N     1 
ATOM   8416  C  CA    . ASP F 3 373 ? 116.243 -5.579  6.931   1.00 18.98  ? 669 ASP D CA    1 
ATOM   8417  C  C     . ASP F 3 373 ? 115.195 -5.391  5.864   1.00 18.70  ? 669 ASP D C     1 
ATOM   8418  O  O     . ASP F 3 373 ? 114.155 -6.040  5.901   1.00 19.03  ? 669 ASP D O     1 
ATOM   8419  C  CB    . ASP F 3 373 ? 116.121 -4.437  7.930   1.00 19.58  ? 669 ASP D CB    1 
ATOM   8420  C  CG    . ASP F 3 373 ? 116.811 -4.732  9.246   1.00 21.18  ? 669 ASP D CG    1 
ATOM   8421  O  OD1   . ASP F 3 373 ? 117.025 -5.923  9.573   1.00 22.33  ? 669 ASP D OD1   1 
ATOM   8422  O  OD2   . ASP F 3 373 ? 117.139 -3.752  9.951   1.00 23.29  ? 669 ASP D OD2   1 
ATOM   8423  N  N     . ASN F 3 374 ? 115.460 -4.508  4.917   1.00 18.61  ? 670 ASN D N     1 
ATOM   8424  C  CA    . ASN F 3 374 ? 114.462 -4.197  3.904   1.00 18.70  ? 670 ASN D CA    1 
ATOM   8425  C  C     . ASN F 3 374 ? 114.263 -5.324  2.909   1.00 18.57  ? 670 ASN D C     1 
ATOM   8426  O  O     . ASN F 3 374 ? 113.148 -5.547  2.440   1.00 19.02  ? 670 ASN D O     1 
ATOM   8427  C  CB    . ASN F 3 374 ? 114.802 -2.890  3.183   1.00 18.78  ? 670 ASN D CB    1 
ATOM   8428  C  CG    . ASN F 3 374 ? 114.806 -1.709  4.112   1.00 18.83  ? 670 ASN D CG    1 
ATOM   8429  O  OD1   . ASN F 3 374 ? 113.963 -1.612  5.000   1.00 19.94  ? 670 ASN D OD1   1 
ATOM   8430  N  ND2   . ASN F 3 374 ? 115.757 -0.804  3.924   1.00 18.88  ? 670 ASN D ND2   1 
ATOM   8431  N  N     . LEU F 3 375 ? 115.347 -6.024  2.594   1.00 18.26  ? 671 LEU D N     1 
ATOM   8432  C  CA    . LEU F 3 375 ? 115.291 -7.135  1.658   1.00 17.92  ? 671 LEU D CA    1 
ATOM   8433  C  C     . LEU F 3 375 ? 114.578 -8.346  2.280   1.00 17.71  ? 671 LEU D C     1 
ATOM   8434  O  O     . LEU F 3 375 ? 113.754 -8.983  1.620   1.00 17.90  ? 671 LEU D O     1 
ATOM   8435  C  CB    . LEU F 3 375 ? 116.682 -7.498  1.142   1.00 17.73  ? 671 LEU D CB    1 
ATOM   8436  C  CG    . LEU F 3 375 ? 116.637 -8.442  -0.058  1.00 17.15  ? 671 LEU D CG    1 
ATOM   8437  C  CD1   . LEU F 3 375 ? 115.854 -7.775  -1.174  1.00 17.88  ? 671 LEU D CD1   1 
ATOM   8438  C  CD2   . LEU F 3 375 ? 118.033 -8.815  -0.514  1.00 16.07  ? 671 LEU D CD2   1 
ATOM   8439  N  N     . MET F 3 376 ? 114.879 -8.655  3.540   1.00 17.07  ? 672 MET D N     1 
ATOM   8440  C  CA    . MET F 3 376 ? 114.133 -9.697  4.239   1.00 16.85  ? 672 MET D CA    1 
ATOM   8441  C  C     . MET F 3 376 ? 112.644 -9.301  4.303   1.00 17.07  ? 672 MET D C     1 
ATOM   8442  O  O     . MET F 3 376 ? 111.751 -10.134 4.066   1.00 17.05  ? 672 MET D O     1 
ATOM   8443  C  CB    . MET F 3 376 ? 114.690 -9.954  5.639   1.00 16.36  ? 672 MET D CB    1 
ATOM   8444  C  CG    . MET F 3 376 ? 116.083 -10.552 5.666   1.00 16.05  ? 672 MET D CG    1 
ATOM   8445  S  SD    . MET F 3 376 ? 116.668 -10.947 7.340   1.00 17.13  ? 672 MET D SD    1 
ATOM   8446  C  CE    . MET F 3 376 ? 116.662 -9.335  8.142   1.00 17.77  ? 672 MET D CE    1 
ATOM   8447  N  N     . GLU F 3 377 ? 112.374 -8.027  4.590   1.00 16.61  ? 673 GLU D N     1 
ATOM   8448  C  CA    . GLU F 3 377 ? 111.001 -7.567  4.632   1.00 16.77  ? 673 GLU D CA    1 
ATOM   8449  C  C     . GLU F 3 377 ? 110.299 -7.853  3.305   1.00 16.84  ? 673 GLU D C     1 
ATOM   8450  O  O     . GLU F 3 377 ? 109.164 -8.368  3.276   1.00 17.18  ? 673 GLU D O     1 
ATOM   8451  C  CB    . GLU F 3 377 ? 110.924 -6.073  4.954   1.00 16.92  ? 673 GLU D CB    1 
ATOM   8452  C  CG    . GLU F 3 377 ? 109.496 -5.510  5.020   1.00 17.15  ? 673 GLU D CG    1 
ATOM   8453  C  CD    . GLU F 3 377 ? 108.736 -5.982  6.242   1.00 17.50  ? 673 GLU D CD    1 
ATOM   8454  O  OE1   . GLU F 3 377 ? 109.385 -6.556  7.140   1.00 18.68  ? 673 GLU D OE1   1 
ATOM   8455  O  OE2   . GLU F 3 377 ? 107.500 -5.782  6.306   1.00 16.94  ? 673 GLU D OE2   1 
ATOM   8456  N  N     . ALA F 3 378 ? 110.988 -7.539  2.214   1.00 16.20  ? 674 ALA D N     1 
ATOM   8457  C  CA    . ALA F 3 378 ? 110.425 -7.694  0.887   1.00 15.92  ? 674 ALA D CA    1 
ATOM   8458  C  C     . ALA F 3 378 ? 109.982 -9.129  0.616   1.00 15.61  ? 674 ALA D C     1 
ATOM   8459  O  O     . ALA F 3 378 ? 108.919 -9.356  0.048   1.00 15.57  ? 674 ALA D O     1 
ATOM   8460  C  CB    . ALA F 3 378 ? 111.430 -7.254  -0.160  1.00 16.12  ? 674 ALA D CB    1 
ATOM   8461  N  N     . PHE F 3 379 ? 110.799 -10.097 1.014   1.00 14.86  ? 675 PHE D N     1 
ATOM   8462  C  CA    . PHE F 3 379 ? 110.477 -11.493 0.724   1.00 14.20  ? 675 PHE D CA    1 
ATOM   8463  C  C     . PHE F 3 379 ? 109.532 -12.111 1.743   1.00 14.28  ? 675 PHE D C     1 
ATOM   8464  O  O     . PHE F 3 379 ? 108.934 -13.157 1.502   1.00 14.26  ? 675 PHE D O     1 
ATOM   8465  C  CB    . PHE F 3 379 ? 111.745 -12.312 0.526   1.00 13.09  ? 675 PHE D CB    1 
ATOM   8466  C  CG    . PHE F 3 379 ? 112.520 -11.907 -0.690  1.00 11.27  ? 675 PHE D CG    1 
ATOM   8467  C  CD1   . PHE F 3 379 ? 113.807 -11.387 -0.576  1.00 9.26   ? 675 PHE D CD1   1 
ATOM   8468  C  CD2   . PHE F 3 379 ? 111.952 -12.024 -1.950  1.00 9.07   ? 675 PHE D CD2   1 
ATOM   8469  C  CE1   . PHE F 3 379 ? 114.514 -11.000 -1.704  1.00 8.82   ? 675 PHE D CE1   1 
ATOM   8470  C  CE2   . PHE F 3 379 ? 112.655 -11.647 -3.086  1.00 9.06   ? 675 PHE D CE2   1 
ATOM   8471  C  CZ    . PHE F 3 379 ? 113.932 -11.120 -2.966  1.00 9.35   ? 675 PHE D CZ    1 
ATOM   8472  N  N     . ARG F 3 380 ? 109.396 -11.444 2.881   1.00 14.64  ? 676 ARG D N     1 
ATOM   8473  C  CA    . ARG F 3 380 ? 108.420 -11.842 3.867   1.00 14.48  ? 676 ARG D CA    1 
ATOM   8474  C  C     . ARG F 3 380 ? 107.082 -11.323 3.354   1.00 14.76  ? 676 ARG D C     1 
ATOM   8475  O  O     . ARG F 3 380 ? 106.039 -11.871 3.653   1.00 14.78  ? 676 ARG D O     1 
ATOM   8476  C  CB    . ARG F 3 380 ? 108.779 -11.277 5.249   1.00 14.45  ? 676 ARG D CB    1 
ATOM   8477  C  CG    . ARG F 3 380 ? 110.016 -11.926 5.853   1.00 14.27  ? 676 ARG D CG    1 
ATOM   8478  C  CD    . ARG F 3 380 ? 110.503 -11.312 7.178   1.00 13.68  ? 676 ARG D CD    1 
ATOM   8479  N  NE    . ARG F 3 380 ? 111.653 -12.072 7.679   1.00 12.76  ? 676 ARG D NE    1 
ATOM   8480  C  CZ    . ARG F 3 380 ? 112.396 -11.770 8.746   1.00 13.04  ? 676 ARG D CZ    1 
ATOM   8481  N  NH1   . ARG F 3 380 ? 112.157 -10.691 9.468   1.00 14.79  ? 676 ARG D NH1   1 
ATOM   8482  N  NH2   . ARG F 3 380 ? 113.403 -12.556 9.090   1.00 13.01  ? 676 ARG D NH2   1 
ATOM   8483  N  N     . ARG F 3 381 ? 107.123 -10.273 2.551   1.00 15.59  ? 677 ARG D N     1 
ATOM   8484  C  CA    . ARG F 3 381 ? 105.910 -9.728  1.952   1.00 16.72  ? 677 ARG D CA    1 
ATOM   8485  C  C     . ARG F 3 381 ? 105.621 -10.411 0.627   1.00 17.71  ? 677 ARG D C     1 
ATOM   8486  O  O     . ARG F 3 381 ? 104.643 -10.081 -0.048  1.00 18.29  ? 677 ARG D O     1 
ATOM   8487  C  CB    . ARG F 3 381 ? 106.040 -8.221  1.700   1.00 16.34  ? 677 ARG D CB    1 
ATOM   8488  C  CG    . ARG F 3 381 ? 106.012 -7.333  2.916   1.00 15.73  ? 677 ARG D CG    1 
ATOM   8489  C  CD    . ARG F 3 381 ? 105.874 -5.887  2.475   1.00 15.87  ? 677 ARG D CD    1 
ATOM   8490  N  NE    . ARG F 3 381 ? 106.204 -4.955  3.547   1.00 15.99  ? 677 ARG D NE    1 
ATOM   8491  C  CZ    . ARG F 3 381 ? 106.337 -3.641  3.394   1.00 15.49  ? 677 ARG D CZ    1 
ATOM   8492  N  NH1   . ARG F 3 381 ? 106.162 -3.076  2.204   1.00 14.18  ? 677 ARG D NH1   1 
ATOM   8493  N  NH2   . ARG F 3 381 ? 106.647 -2.888  4.442   1.00 16.15  ? 677 ARG D NH2   1 
ATOM   8494  N  N     . ASP F 3 382 ? 106.495 -11.338 0.250   1.00 18.86  ? 678 ASP D N     1 
ATOM   8495  C  CA    . ASP F 3 382 ? 106.407 -12.041 -1.019  1.00 20.09  ? 678 ASP D CA    1 
ATOM   8496  C  C     . ASP F 3 382 ? 106.376 -11.068 -2.197  1.00 20.48  ? 678 ASP D C     1 
ATOM   8497  O  O     . ASP F 3 382 ? 105.637 -11.280 -3.141  1.00 20.90  ? 678 ASP D O     1 
ATOM   8498  C  CB    . ASP F 3 382 ? 105.183 -12.977 -1.032  1.00 20.56  ? 678 ASP D CB    1 
ATOM   8499  C  CG    . ASP F 3 382 ? 105.178 -13.962 -2.218  1.00 22.22  ? 678 ASP D CG    1 
ATOM   8500  O  OD1   . ASP F 3 382 ? 106.250 -14.264 -2.798  1.00 23.85  ? 678 ASP D OD1   1 
ATOM   8501  O  OD2   . ASP F 3 382 ? 104.081 -14.452 -2.564  1.00 24.49  ? 678 ASP D OD2   1 
ATOM   8502  N  N     . LEU F 3 383 ? 107.165 -9.996  -2.144  1.00 21.24  ? 679 LEU D N     1 
ATOM   8503  C  CA    . LEU F 3 383 ? 107.201 -9.047  -3.259  1.00 21.99  ? 679 LEU D CA    1 
ATOM   8504  C  C     . LEU F 3 383 ? 108.108 -9.546  -4.389  1.00 22.53  ? 679 LEU D C     1 
ATOM   8505  O  O     . LEU F 3 383 ? 109.171 -10.115 -4.129  1.00 22.34  ? 679 LEU D O     1 
ATOM   8506  C  CB    . LEU F 3 383 ? 107.709 -7.672  -2.816  1.00 21.78  ? 679 LEU D CB    1 
ATOM   8507  C  CG    . LEU F 3 383 ? 107.042 -6.851  -1.715  1.00 22.34  ? 679 LEU D CG    1 
ATOM   8508  C  CD1   . LEU F 3 383 ? 107.874 -5.591  -1.465  1.00 21.33  ? 679 LEU D CD1   1 
ATOM   8509  C  CD2   . LEU F 3 383 ? 105.596 -6.495  -2.035  1.00 22.06  ? 679 LEU D CD2   1 
ATOM   8510  N  N     . ASP F 3 384 ? 107.704 -9.317  -5.639  1.00 22.96  ? 680 ASP D N     1 
ATOM   8511  C  CA    . ASP F 3 384 ? 108.587 -9.631  -6.763  1.00 23.70  ? 680 ASP D CA    1 
ATOM   8512  C  C     . ASP F 3 384 ? 109.545 -8.453  -6.966  1.00 23.62  ? 680 ASP D C     1 
ATOM   8513  O  O     . ASP F 3 384 ? 109.154 -7.414  -7.498  1.00 23.50  ? 680 ASP D O     1 
ATOM   8514  C  CB    . ASP F 3 384 ? 107.800 -9.938  -8.048  1.00 23.72  ? 680 ASP D CB    1 
ATOM   8515  C  CG    . ASP F 3 384 ? 108.670 -10.581 -9.143  1.00 25.58  ? 680 ASP D CG    1 
ATOM   8516  O  OD1   . ASP F 3 384 ? 109.873 -10.862 -8.912  1.00 26.30  ? 680 ASP D OD1   1 
ATOM   8517  O  OD2   . ASP F 3 384 ? 108.145 -10.814 -10.253 1.00 26.96  ? 680 ASP D OD2   1 
ATOM   8518  N  N     . ILE F 3 385 ? 110.787 -8.622  -6.515  1.00 23.98  ? 681 ILE D N     1 
ATOM   8519  C  CA    . ILE F 3 385 ? 111.820 -7.594  -6.632  1.00 24.48  ? 681 ILE D CA    1 
ATOM   8520  C  C     . ILE F 3 385 ? 112.185 -7.299  -8.082  1.00 25.07  ? 681 ILE D C     1 
ATOM   8521  O  O     . ILE F 3 385 ? 112.414 -6.144  -8.438  1.00 24.74  ? 681 ILE D O     1 
ATOM   8522  C  CB    . ILE F 3 385 ? 113.080 -7.985  -5.861  1.00 24.27  ? 681 ILE D CB    1 
ATOM   8523  C  CG1   . ILE F 3 385 ? 112.798 -7.945  -4.367  1.00 24.71  ? 681 ILE D CG1   1 
ATOM   8524  C  CG2   . ILE F 3 385 ? 114.214 -7.015  -6.145  1.00 24.72  ? 681 ILE D CG2   1 
ATOM   8525  C  CD1   . ILE F 3 385 ? 112.534 -6.550  -3.834  1.00 23.89  ? 681 ILE D CD1   1 
ATOM   8526  N  N     . HIS F 3 386 ? 112.223 -8.338  -8.919  1.00 25.93  ? 682 HIS D N     1 
ATOM   8527  C  CA    . HIS F 3 386 ? 112.554 -8.150  -10.331 1.00 27.02  ? 682 HIS D CA    1 
ATOM   8528  C  C     . HIS F 3 386 ? 111.518 -7.248  -10.992 1.00 28.14  ? 682 HIS D C     1 
ATOM   8529  O  O     . HIS F 3 386 ? 111.858 -6.448  -11.853 1.00 28.19  ? 682 HIS D O     1 
ATOM   8530  C  CB    . HIS F 3 386 ? 112.675 -9.475  -11.102 1.00 26.64  ? 682 HIS D CB    1 
ATOM   8531  C  CG    . HIS F 3 386 ? 113.711 -10.413 -10.559 1.00 25.93  ? 682 HIS D CG    1 
ATOM   8532  N  ND1   . HIS F 3 386 ? 115.017 -10.037 -10.343 1.00 24.97  ? 682 HIS D ND1   1 
ATOM   8533  C  CD2   . HIS F 3 386 ? 113.639 -11.723 -10.221 1.00 25.98  ? 682 HIS D CD2   1 
ATOM   8534  C  CE1   . HIS F 3 386 ? 115.701 -11.068 -9.876  1.00 24.57  ? 682 HIS D CE1   1 
ATOM   8535  N  NE2   . HIS F 3 386 ? 114.889 -12.104 -9.793  1.00 25.12  ? 682 HIS D NE2   1 
ATOM   8536  N  N     . THR F 3 387 ? 110.257 -7.385  -10.585 1.00 29.59  ? 683 THR D N     1 
ATOM   8537  C  CA    . THR F 3 387 ? 109.187 -6.536  -11.098 1.00 30.99  ? 683 THR D CA    1 
ATOM   8538  C  C     . THR F 3 387 ? 109.286 -5.125  -10.509 1.00 31.94  ? 683 THR D C     1 
ATOM   8539  O  O     . THR F 3 387 ? 109.030 -4.140  -11.194 1.00 31.89  ? 683 THR D O     1 
ATOM   8540  C  CB    . THR F 3 387 ? 107.816 -7.118  -10.788 1.00 30.86  ? 683 THR D CB    1 
ATOM   8541  O  OG1   . THR F 3 387 ? 107.779 -8.479  -11.212 1.00 31.04  ? 683 THR D OG1   1 
ATOM   8542  C  CG2   . THR F 3 387 ? 106.742 -6.350  -11.527 1.00 31.19  ? 683 THR D CG2   1 
ATOM   8543  N  N     . LYS F 3 388 ? 109.661 -5.040  -9.238  1.00 33.13  ? 684 LYS D N     1 
ATOM   8544  C  CA    . LYS F 3 388 ? 109.873 -3.763  -8.581  1.00 34.64  ? 684 LYS D CA    1 
ATOM   8545  C  C     . LYS F 3 388 ? 110.987 -2.999  -9.328  1.00 35.51  ? 684 LYS D C     1 
ATOM   8546  O  O     . LYS F 3 388 ? 110.905 -1.787  -9.505  1.00 35.66  ? 684 LYS D O     1 
ATOM   8547  C  CB    . LYS F 3 388 ? 110.230 -3.992  -7.103  1.00 34.84  ? 684 LYS D CB    1 
ATOM   8548  C  CG    . LYS F 3 388 ? 110.541 -2.742  -6.271  1.00 35.68  ? 684 LYS D CG    1 
ATOM   8549  C  CD    . LYS F 3 388 ? 111.600 -3.078  -5.197  1.00 37.23  ? 684 LYS D CD    1 
ATOM   8550  C  CE    . LYS F 3 388 ? 111.866 -1.945  -4.187  1.00 36.34  ? 684 LYS D CE    1 
ATOM   8551  N  NZ    . LYS F 3 388 ? 110.862 -1.927  -3.073  1.00 36.02  ? 684 LYS D NZ    1 
ATOM   8552  N  N     . THR F 3 389 ? 112.012 -3.716  -9.787  1.00 36.62  ? 685 THR D N     1 
ATOM   8553  C  CA    . THR F 3 389 ? 113.120 -3.096  -10.521 1.00 37.55  ? 685 THR D CA    1 
ATOM   8554  C  C     . THR F 3 389 ? 112.714 -2.674  -11.945 1.00 38.34  ? 685 THR D C     1 
ATOM   8555  O  O     . THR F 3 389 ? 113.120 -1.619  -12.419 1.00 38.65  ? 685 THR D O     1 
ATOM   8556  C  CB    . THR F 3 389 ? 114.385 -4.013  -10.548 1.00 37.66  ? 685 THR D CB    1 
ATOM   8557  O  OG1   . THR F 3 389 ? 114.894 -4.175  -9.218  1.00 37.47  ? 685 THR D OG1   1 
ATOM   8558  C  CG2   . THR F 3 389 ? 115.493 -3.431  -11.434 1.00 37.20  ? 685 THR D CG2   1 
ATOM   8559  N  N     . ALA F 3 390 ? 111.901 -3.489  -12.612 1.00 39.09  ? 686 ALA D N     1 
ATOM   8560  C  CA    . ALA F 3 390 ? 111.464 -3.200  -13.977 1.00 39.98  ? 686 ALA D CA    1 
ATOM   8561  C  C     . ALA F 3 390 ? 110.627 -1.920  -14.056 1.00 40.77  ? 686 ALA D C     1 
ATOM   8562  O  O     . ALA F 3 390 ? 110.761 -1.134  -14.999 1.00 40.65  ? 686 ALA D O     1 
ATOM   8563  C  CB    . ALA F 3 390 ? 110.693 -4.386  -14.550 1.00 39.77  ? 686 ALA D CB    1 
ATOM   8564  N  N     . MET F 3 391 ? 109.765 -1.723  -13.059 1.00 41.74  ? 687 MET D N     1 
ATOM   8565  C  CA    . MET F 3 391 ? 108.938 -0.518  -12.959 1.00 42.76  ? 687 MET D CA    1 
ATOM   8566  C  C     . MET F 3 391 ? 109.819 0.710   -12.818 1.00 43.29  ? 687 MET D C     1 
ATOM   8567  O  O     . MET F 3 391 ? 109.531 1.765   -13.382 1.00 43.42  ? 687 MET D O     1 
ATOM   8568  C  CB    . MET F 3 391 ? 108.017 -0.592  -11.738 1.00 42.54  ? 687 MET D CB    1 
ATOM   8569  C  CG    . MET F 3 391 ? 106.935 -1.644  -11.829 1.00 42.88  ? 687 MET D CG    1 
ATOM   8570  S  SD    . MET F 3 391 ? 106.265 -2.075  -10.214 1.00 43.22  ? 687 MET D SD    1 
ATOM   8571  C  CE    . MET F 3 391 ? 105.583 -0.498  -9.681  1.00 43.08  ? 687 MET D CE    1 
ATOM   8572  N  N     . ASP F 3 392 ? 110.901 0.549   -12.063 1.00 43.94  ? 688 ASP D N     1 
ATOM   8573  C  CA    . ASP F 3 392 ? 111.805 1.636   -11.748 1.00 44.50  ? 688 ASP D CA    1 
ATOM   8574  C  C     . ASP F 3 392 ? 112.661 2.039   -12.952 1.00 44.71  ? 688 ASP D C     1 
ATOM   8575  O  O     . ASP F 3 392 ? 112.900 3.229   -13.170 1.00 44.73  ? 688 ASP D O     1 
ATOM   8576  C  CB    . ASP F 3 392 ? 112.673 1.241   -10.553 1.00 44.74  ? 688 ASP D CB    1 
ATOM   8577  C  CG    . ASP F 3 392 ? 112.947 2.401   -9.623  1.00 45.69  ? 688 ASP D CG    1 
ATOM   8578  O  OD1   . ASP F 3 392 ? 113.629 3.372   -10.038 1.00 46.30  ? 688 ASP D OD1   1 
ATOM   8579  O  OD2   . ASP F 3 392 ? 112.482 2.327   -8.461  1.00 47.01  ? 688 ASP D OD2   1 
ATOM   8580  N  N     . ILE F 3 393 ? 113.115 1.061   -13.735 1.00 45.04  ? 689 ILE D N     1 
ATOM   8581  C  CA    . ILE F 3 393 ? 113.904 1.371   -14.926 1.00 45.69  ? 689 ILE D CA    1 
ATOM   8582  C  C     . ILE F 3 393 ? 112.994 1.893   -16.032 1.00 46.03  ? 689 ILE D C     1 
ATOM   8583  O  O     . ILE F 3 393 ? 113.206 2.990   -16.555 1.00 46.30  ? 689 ILE D O     1 
ATOM   8584  C  CB    . ILE F 3 393 ? 114.637 0.142   -15.528 1.00 45.87  ? 689 ILE D CB    1 
ATOM   8585  C  CG1   . ILE F 3 393 ? 115.358 -0.692  -14.472 1.00 45.74  ? 689 ILE D CG1   1 
ATOM   8586  C  CG2   . ILE F 3 393 ? 115.607 0.588   -16.636 1.00 45.94  ? 689 ILE D CG2   1 
ATOM   8587  C  CD1   . ILE F 3 393 ? 115.776 -2.049  -15.007 1.00 45.64  ? 689 ILE D CD1   1 
ATOM   8588  N  N     . PHE F 3 394 ? 111.982 1.103   -16.378 1.00 46.13  ? 690 PHE D N     1 
ATOM   8589  C  CA    . PHE F 3 394 ? 111.099 1.426   -17.488 1.00 46.60  ? 690 PHE D CA    1 
ATOM   8590  C  C     . PHE F 3 394 ? 110.004 2.431   -17.122 1.00 46.94  ? 690 PHE D C     1 
ATOM   8591  O  O     . PHE F 3 394 ? 109.208 2.824   -17.976 1.00 46.71  ? 690 PHE D O     1 
ATOM   8592  C  CB    . PHE F 3 394 ? 110.478 0.147   -18.054 1.00 46.71  ? 690 PHE D CB    1 
ATOM   8593  C  CG    . PHE F 3 394 ? 111.486 -0.880  -18.482 1.00 46.84  ? 690 PHE D CG    1 
ATOM   8594  C  CD1   . PHE F 3 394 ? 111.961 -0.900  -19.787 1.00 47.44  ? 690 PHE D CD1   1 
ATOM   8595  C  CD2   . PHE F 3 394 ? 111.957 -1.829  -17.585 1.00 46.69  ? 690 PHE D CD2   1 
ATOM   8596  C  CE1   . PHE F 3 394 ? 112.895 -1.847  -20.191 1.00 47.43  ? 690 PHE D CE1   1 
ATOM   8597  C  CE2   . PHE F 3 394 ? 112.889 -2.778  -17.977 1.00 47.14  ? 690 PHE D CE2   1 
ATOM   8598  C  CZ    . PHE F 3 394 ? 113.359 -2.789  -19.283 1.00 47.20  ? 690 PHE D CZ    1 
ATOM   8599  N  N     . GLN F 3 395 ? 109.975 2.839   -15.856 1.00 47.46  ? 691 GLN D N     1 
ATOM   8600  C  CA    . GLN F 3 395 ? 108.986 3.785   -15.358 1.00 48.02  ? 691 GLN D CA    1 
ATOM   8601  C  C     . GLN F 3 395 ? 107.557 3.374   -15.729 1.00 48.40  ? 691 GLN D C     1 
ATOM   8602  O  O     . GLN F 3 395 ? 106.821 4.146   -16.349 1.00 48.62  ? 691 GLN D O     1 
ATOM   8603  C  CB    . GLN F 3 395 ? 109.289 5.209   -15.854 1.00 48.11  ? 691 GLN D CB    1 
ATOM   8604  C  CG    . GLN F 3 395 ? 110.627 5.787   -15.399 1.00 48.71  ? 691 GLN D CG    1 
ATOM   8605  C  CD    . GLN F 3 395 ? 110.680 6.101   -13.902 1.00 50.06  ? 691 GLN D CD    1 
ATOM   8606  O  OE1   . GLN F 3 395 ? 109.754 5.789   -13.144 1.00 49.86  ? 691 GLN D OE1   1 
ATOM   8607  N  NE2   . GLN F 3 395 ? 111.773 6.727   -13.474 1.00 50.45  ? 691 GLN D NE2   1 
ATOM   8608  N  N     . VAL F 3 396 ? 107.166 2.158   -15.361 1.00 48.62  ? 692 VAL D N     1 
ATOM   8609  C  CA    . VAL F 3 396 ? 105.813 1.693   -15.641 1.00 48.87  ? 692 VAL D CA    1 
ATOM   8610  C  C     . VAL F 3 396 ? 105.086 1.324   -14.360 1.00 49.22  ? 692 VAL D C     1 
ATOM   8611  O  O     . VAL F 3 396 ? 105.675 1.323   -13.278 1.00 49.33  ? 692 VAL D O     1 
ATOM   8612  C  CB    . VAL F 3 396 ? 105.810 0.459   -16.545 1.00 48.83  ? 692 VAL D CB    1 
ATOM   8613  C  CG1   . VAL F 3 396 ? 106.462 0.767   -17.882 1.00 48.66  ? 692 VAL D CG1   1 
ATOM   8614  C  CG2   . VAL F 3 396 ? 106.513 -0.681  -15.852 1.00 49.13  ? 692 VAL D CG2   1 
ATOM   8615  N  N     . SER F 3 397 ? 103.796 1.030   -14.496 1.00 49.69  ? 693 SER D N     1 
ATOM   8616  C  CA    . SER F 3 397 ? 102.979 0.551   -13.387 1.00 50.04  ? 693 SER D CA    1 
ATOM   8617  C  C     . SER F 3 397 ? 103.036 -0.973  -13.431 1.00 50.33  ? 693 SER D C     1 
ATOM   8618  O  O     . SER F 3 397 ? 103.265 -1.554  -14.498 1.00 50.48  ? 693 SER D O     1 
ATOM   8619  C  CB    . SER F 3 397 ? 101.536 1.038   -13.523 1.00 49.96  ? 693 SER D CB    1 
ATOM   8620  O  OG    . SER F 3 397 ? 100.951 0.561   -14.723 1.00 50.17  ? 693 SER D OG    1 
ATOM   8621  N  N     . GLU F 3 398 ? 102.824 -1.613  -12.285 1.00 50.48  ? 694 GLU D N     1 
ATOM   8622  C  CA    . GLU F 3 398 ? 102.945 -3.068  -12.179 1.00 50.77  ? 694 GLU D CA    1 
ATOM   8623  C  C     . GLU F 3 398 ? 102.265 -3.880  -13.282 1.00 50.65  ? 694 GLU D C     1 
ATOM   8624  O  O     . GLU F 3 398 ? 102.822 -4.873  -13.744 1.00 50.83  ? 694 GLU D O     1 
ATOM   8625  C  CB    . GLU F 3 398 ? 102.475 -3.562  -10.809 1.00 51.02  ? 694 GLU D CB    1 
ATOM   8626  C  CG    . GLU F 3 398 ? 102.384 -5.085  -10.718 1.00 52.14  ? 694 GLU D CG    1 
ATOM   8627  C  CD    . GLU F 3 398 ? 102.099 -5.579  -9.317  1.00 53.66  ? 694 GLU D CD    1 
ATOM   8628  O  OE1   . GLU F 3 398 ? 102.477 -4.879  -8.350  1.00 54.17  ? 694 GLU D OE1   1 
ATOM   8629  O  OE2   . GLU F 3 398 ? 101.512 -6.677  -9.185  1.00 54.09  ? 694 GLU D OE2   1 
ATOM   8630  N  N     . ASP F 3 399 ? 101.078 -3.464  -13.708 1.00 50.56  ? 695 ASP D N     1 
ATOM   8631  C  CA    . ASP F 3 399 ? 100.329 -4.227  -14.707 1.00 50.48  ? 695 ASP D CA    1 
ATOM   8632  C  C     . ASP F 3 399 ? 100.954 -4.180  -16.091 1.00 50.18  ? 695 ASP D C     1 
ATOM   8633  O  O     . ASP F 3 399 ? 100.784 -5.103  -16.891 1.00 50.13  ? 695 ASP D O     1 
ATOM   8634  C  CB    . ASP F 3 399 ? 98.874  -3.763  -14.767 1.00 50.85  ? 695 ASP D CB    1 
ATOM   8635  C  CG    . ASP F 3 399 ? 98.126  -4.031  -13.473 1.00 51.33  ? 695 ASP D CG    1 
ATOM   8636  O  OD1   . ASP F 3 399 ? 98.747  -4.560  -12.519 1.00 51.60  ? 695 ASP D OD1   1 
ATOM   8637  O  OD2   . ASP F 3 399 ? 96.918  -3.707  -13.412 1.00 52.32  ? 695 ASP D OD2   1 
ATOM   8638  N  N     . GLU F 3 400 ? 101.683 -3.103  -16.363 1.00 49.74  ? 696 GLU D N     1 
ATOM   8639  C  CA    . GLU F 3 400 ? 102.369 -2.936  -17.641 1.00 49.42  ? 696 GLU D CA    1 
ATOM   8640  C  C     . GLU F 3 400 ? 103.676 -3.745  -17.780 1.00 48.79  ? 696 GLU D C     1 
ATOM   8641  O  O     . GLU F 3 400 ? 104.230 -3.835  -18.879 1.00 48.86  ? 696 GLU D O     1 
ATOM   8642  C  CB    . GLU F 3 400 ? 102.663 -1.455  -17.884 1.00 49.42  ? 696 GLU D CB    1 
ATOM   8643  C  CG    . GLU F 3 400 ? 101.459 -0.602  -18.219 1.00 49.66  ? 696 GLU D CG    1 
ATOM   8644  C  CD    . GLU F 3 400 ? 101.797 0.883   -18.214 1.00 50.20  ? 696 GLU D CD    1 
ATOM   8645  O  OE1   . GLU F 3 400 ? 102.056 1.441   -17.120 1.00 50.88  ? 696 GLU D OE1   1 
ATOM   8646  O  OE2   . GLU F 3 400 ? 101.797 1.496   -19.305 1.00 51.54  ? 696 GLU D OE2   1 
ATOM   8647  N  N     . VAL F 3 401 ? 104.169 -4.328  -16.685 1.00 47.82  ? 697 VAL D N     1 
ATOM   8648  C  CA    . VAL F 3 401 ? 105.448 -5.046  -16.713 1.00 46.87  ? 697 VAL D CA    1 
ATOM   8649  C  C     . VAL F 3 401 ? 105.394 -6.349  -17.514 1.00 46.51  ? 697 VAL D C     1 
ATOM   8650  O  O     . VAL F 3 401 ? 104.748 -7.315  -17.103 1.00 46.43  ? 697 VAL D O     1 
ATOM   8651  C  CB    . VAL F 3 401 ? 105.983 -5.325  -15.296 1.00 46.73  ? 697 VAL D CB    1 
ATOM   8652  C  CG1   . VAL F 3 401 ? 107.351 -5.977  -15.363 1.00 46.50  ? 697 VAL D CG1   1 
ATOM   8653  C  CG2   . VAL F 3 401 ? 106.072 -4.046  -14.520 1.00 46.40  ? 697 VAL D CG2   1 
ATOM   8654  N  N     . THR F 3 402 ? 106.078 -6.357  -18.658 1.00 45.96  ? 698 THR D N     1 
ATOM   8655  C  CA    . THR F 3 402 ? 106.147 -7.532  -19.537 1.00 45.42  ? 698 THR D CA    1 
ATOM   8656  C  C     . THR F 3 402 ? 107.260 -8.478  -19.100 1.00 44.85  ? 698 THR D C     1 
ATOM   8657  O  O     . THR F 3 402 ? 108.184 -8.060  -18.403 1.00 44.62  ? 698 THR D O     1 
ATOM   8658  C  CB    . THR F 3 402 ? 106.371 -7.143  -21.044 1.00 45.54  ? 698 THR D CB    1 
ATOM   8659  O  OG1   . THR F 3 402 ? 107.609 -6.427  -21.206 1.00 45.06  ? 698 THR D OG1   1 
ATOM   8660  C  CG2   . THR F 3 402 ? 105.207 -6.306  -21.569 1.00 45.44  ? 698 THR D CG2   1 
ATOM   8661  N  N     . PRO F 3 403 ? 107.155 -9.765  -19.485 1.00 44.45  ? 699 PRO D N     1 
ATOM   8662  C  CA    . PRO F 3 403 ? 108.200 -10.765 -19.243 1.00 44.22  ? 699 PRO D CA    1 
ATOM   8663  C  C     . PRO F 3 403 ? 109.596 -10.306 -19.699 1.00 43.90  ? 699 PRO D C     1 
ATOM   8664  O  O     . PRO F 3 403 ? 110.597 -10.603 -19.037 1.00 43.92  ? 699 PRO D O     1 
ATOM   8665  C  CB    . PRO F 3 403 ? 107.735 -11.950 -20.095 1.00 44.16  ? 699 PRO D CB    1 
ATOM   8666  C  CG    . PRO F 3 403 ? 106.263 -11.839 -20.081 1.00 44.29  ? 699 PRO D CG    1 
ATOM   8667  C  CD    . PRO F 3 403 ? 105.980 -10.363 -20.145 1.00 44.32  ? 699 PRO D CD    1 
ATOM   8668  N  N     . ASN F 3 404 ? 109.639 -9.586  -20.818 1.00 43.37  ? 700 ASN D N     1 
ATOM   8669  C  CA    . ASN F 3 404 ? 110.877 -9.076  -21.399 1.00 42.79  ? 700 ASN D CA    1 
ATOM   8670  C  C     . ASN F 3 404 ? 111.606 -8.102  -20.465 1.00 42.11  ? 700 ASN D C     1 
ATOM   8671  O  O     . ASN F 3 404 ? 112.820 -8.207  -20.243 1.00 41.85  ? 700 ASN D O     1 
ATOM   8672  C  CB    . ASN F 3 404 ? 110.557 -8.377  -22.726 1.00 43.05  ? 700 ASN D CB    1 
ATOM   8673  C  CG    . ASN F 3 404 ? 111.736 -8.351  -23.664 1.00 43.44  ? 700 ASN D CG    1 
ATOM   8674  O  OD1   . ASN F 3 404 ? 112.286 -9.402  -24.007 1.00 44.24  ? 700 ASN D OD1   1 
ATOM   8675  N  ND2   . ASN F 3 404 ? 112.133 -7.153  -24.096 1.00 42.84  ? 700 ASN D ND2   1 
ATOM   8676  N  N     . MET F 3 405 ? 110.840 -7.154  -19.931 1.00 41.28  ? 701 MET D N     1 
ATOM   8677  C  CA    . MET F 3 405 ? 111.325 -6.155  -18.987 1.00 40.54  ? 701 MET D CA    1 
ATOM   8678  C  C     . MET F 3 405 ? 111.791 -6.805  -17.680 1.00 39.83  ? 701 MET D C     1 
ATOM   8679  O  O     . MET F 3 405 ? 112.771 -6.372  -17.073 1.00 39.47  ? 701 MET D O     1 
ATOM   8680  C  CB    . MET F 3 405 ? 110.213 -5.135  -18.706 1.00 40.69  ? 701 MET D CB    1 
ATOM   8681  C  CG    . MET F 3 405 ? 109.847 -4.227  -19.887 1.00 40.52  ? 701 MET D CG    1 
ATOM   8682  S  SD    . MET F 3 405 ? 108.233 -3.425  -19.696 1.00 41.28  ? 701 MET D SD    1 
ATOM   8683  C  CE    . MET F 3 405 ? 108.403 -2.564  -18.143 1.00 39.78  ? 701 MET D CE    1 
ATOM   8684  N  N     . ARG F 3 406 ? 111.083 -7.850  -17.258 1.00 39.20  ? 702 ARG D N     1 
ATOM   8685  C  CA    . ARG F 3 406 ? 111.426 -8.576  -16.040 1.00 38.52  ? 702 ARG D CA    1 
ATOM   8686  C  C     . ARG F 3 406 ? 112.767 -9.293  -16.190 1.00 38.47  ? 702 ARG D C     1 
ATOM   8687  O  O     . ARG F 3 406 ? 113.545 -9.338  -15.239 1.00 38.25  ? 702 ARG D O     1 
ATOM   8688  C  CB    . ARG F 3 406 ? 110.311 -9.561  -15.644 1.00 38.40  ? 702 ARG D CB    1 
ATOM   8689  C  CG    . ARG F 3 406 ? 110.305 -9.917  -14.160 1.00 36.50  ? 702 ARG D CG    1 
ATOM   8690  C  CD    . ARG F 3 406 ? 109.250 -10.944 -13.846 1.00 34.40  ? 702 ARG D CD    1 
ATOM   8691  N  NE    . ARG F 3 406 ? 109.401 -11.529 -12.513 1.00 33.30  ? 702 ARG D NE    1 
ATOM   8692  C  CZ    . ARG F 3 406 ? 110.249 -12.513 -12.212 1.00 33.00  ? 702 ARG D CZ    1 
ATOM   8693  N  NH1   . ARG F 3 406 ? 111.055 -13.017 -13.139 1.00 32.58  ? 702 ARG D NH1   1 
ATOM   8694  N  NH2   . ARG F 3 406 ? 110.307 -12.988 -10.976 1.00 32.63  ? 702 ARG D NH2   1 
ATOM   8695  N  N     . ARG F 3 407 ? 113.031 -9.844  -17.379 1.00 38.48  ? 703 ARG D N     1 
ATOM   8696  C  CA    . ARG F 3 407 ? 114.325 -10.483 -17.676 1.00 38.77  ? 703 ARG D CA    1 
ATOM   8697  C  C     . ARG F 3 407 ? 115.476 -9.477  -17.623 1.00 38.12  ? 703 ARG D C     1 
ATOM   8698  O  O     . ARG F 3 407 ? 116.551 -9.784  -17.109 1.00 38.11  ? 703 ARG D O     1 
ATOM   8699  C  CB    . ARG F 3 407 ? 114.317 -11.199 -19.035 1.00 38.90  ? 703 ARG D CB    1 
ATOM   8700  C  CG    . ARG F 3 407 ? 113.512 -12.512 -19.061 1.00 40.28  ? 703 ARG D CG    1 
ATOM   8701  C  CD    . ARG F 3 407 ? 113.651 -13.279 -20.397 1.00 40.14  ? 703 ARG D CD    1 
ATOM   8702  N  NE    . ARG F 3 407 ? 113.029 -12.596 -21.539 1.00 42.98  ? 703 ARG D NE    1 
ATOM   8703  C  CZ    . ARG F 3 407 ? 111.810 -12.856 -22.021 1.00 43.54  ? 703 ARG D CZ    1 
ATOM   8704  N  NH1   . ARG F 3 407 ? 111.055 -13.803 -21.470 1.00 43.74  ? 703 ARG D NH1   1 
ATOM   8705  N  NH2   . ARG F 3 407 ? 111.344 -12.166 -23.066 1.00 43.21  ? 703 ARG D NH2   1 
ATOM   8706  N  N     . GLN F 3 408 ? 115.246 -8.275  -18.145 1.00 37.75  ? 704 GLN D N     1 
ATOM   8707  C  CA    . GLN F 3 408 ? 116.264 -7.220  -18.107 1.00 37.21  ? 704 GLN D CA    1 
ATOM   8708  C  C     . GLN F 3 408 ? 116.542 -6.733  -16.692 1.00 36.15  ? 704 GLN D C     1 
ATOM   8709  O  O     . GLN F 3 408 ? 117.694 -6.509  -16.330 1.00 36.24  ? 704 GLN D O     1 
ATOM   8710  C  CB    . GLN F 3 408 ? 115.862 -6.028  -18.972 1.00 37.62  ? 704 GLN D CB    1 
ATOM   8711  C  CG    . GLN F 3 408 ? 115.869 -6.291  -20.461 1.00 39.24  ? 704 GLN D CG    1 
ATOM   8712  C  CD    . GLN F 3 408 ? 116.155 -5.021  -21.255 1.00 42.24  ? 704 GLN D CD    1 
ATOM   8713  O  OE1   . GLN F 3 408 ? 116.973 -4.180  -20.842 1.00 42.43  ? 704 GLN D OE1   1 
ATOM   8714  N  NE2   . GLN F 3 408 ? 115.497 -4.881  -22.408 1.00 42.72  ? 704 GLN D NE2   1 
ATOM   8715  N  N     . ALA F 3 409 ? 115.486 -6.569  -15.900 1.00 35.08  ? 705 ALA D N     1 
ATOM   8716  C  CA    . ALA F 3 409 ? 115.617 -6.095  -14.517 1.00 34.05  ? 705 ALA D CA    1 
ATOM   8717  C  C     . ALA F 3 409 ? 116.199 -7.171  -13.608 1.00 33.15  ? 705 ALA D C     1 
ATOM   8718  O  O     . ALA F 3 409 ? 116.858 -6.865  -12.609 1.00 32.94  ? 705 ALA D O     1 
ATOM   8719  C  CB    . ALA F 3 409 ? 114.284 -5.611  -13.987 1.00 33.99  ? 705 ALA D CB    1 
ATOM   8720  N  N     . LYS F 3 410 ? 115.951 -8.429  -13.966 1.00 31.97  ? 706 LYS D N     1 
ATOM   8721  C  CA    . LYS F 3 410 ? 116.530 -9.560  -13.252 1.00 30.85  ? 706 LYS D CA    1 
ATOM   8722  C  C     . LYS F 3 410 ? 118.051 -9.430  -13.351 1.00 30.25  ? 706 LYS D C     1 
ATOM   8723  O  O     . LYS F 3 410 ? 118.773 -9.572  -12.352 1.00 30.36  ? 706 LYS D O     1 
ATOM   8724  C  CB    . LYS F 3 410 ? 116.031 -10.891 -13.842 1.00 30.83  ? 706 LYS D CB    1 
ATOM   8725  C  CG    . LYS F 3 410 ? 116.583 -12.147 -13.174 1.00 30.26  ? 706 LYS D CG    1 
ATOM   8726  C  CD    . LYS F 3 410 ? 116.054 -13.441 -13.820 1.00 30.30  ? 706 LYS D CD    1 
ATOM   8727  C  CE    . LYS F 3 410 ? 114.545 -13.613 -13.662 1.00 28.94  ? 706 LYS D CE    1 
ATOM   8728  N  NZ    . LYS F 3 410 ? 114.065 -14.897 -14.260 1.00 28.04  ? 706 LYS D NZ    1 
ATOM   8729  N  N     . ALA F 3 411 ? 118.515 -9.123  -14.562 1.00 29.09  ? 707 ALA D N     1 
ATOM   8730  C  CA    . ALA F 3 411 ? 119.931 -8.909  -14.840 1.00 27.88  ? 707 ALA D CA    1 
ATOM   8731  C  C     . ALA F 3 411 ? 120.486 -7.674  -14.109 1.00 27.08  ? 707 ALA D C     1 
ATOM   8732  O  O     . ALA F 3 411 ? 121.643 -7.687  -13.690 1.00 27.23  ? 707 ALA D O     1 
ATOM   8733  C  CB    . ALA F 3 411 ? 120.163 -8.803  -16.349 1.00 27.57  ? 707 ALA D CB    1 
ATOM   8734  N  N     . VAL F 3 412 ? 119.668 -6.619  -13.977 1.00 25.84  ? 708 VAL D N     1 
ATOM   8735  C  CA    . VAL F 3 412 ? 120.042 -5.393  -13.257 1.00 24.33  ? 708 VAL D CA    1 
ATOM   8736  C  C     . VAL F 3 412 ? 120.201 -5.684  -11.762 1.00 24.07  ? 708 VAL D C     1 
ATOM   8737  O  O     . VAL F 3 412 ? 121.231 -5.353  -11.168 1.00 24.18  ? 708 VAL D O     1 
ATOM   8738  C  CB    . VAL F 3 412 ? 118.987 -4.266  -13.454 1.00 24.49  ? 708 VAL D CB    1 
ATOM   8739  C  CG1   . VAL F 3 412 ? 119.282 -3.066  -12.553 1.00 22.97  ? 708 VAL D CG1   1 
ATOM   8740  C  CG2   . VAL F 3 412 ? 118.921 -3.844  -14.907 1.00 23.50  ? 708 VAL D CG2   1 
ATOM   8741  N  N     . ASN F 3 413 ? 119.177 -6.298  -11.159 1.00 23.15  ? 709 ASN D N     1 
ATOM   8742  C  CA    . ASN F 3 413 ? 119.231 -6.734  -9.758  1.00 22.25  ? 709 ASN D CA    1 
ATOM   8743  C  C     . ASN F 3 413 ? 120.430 -7.632  -9.467  1.00 21.79  ? 709 ASN D C     1 
ATOM   8744  O  O     . ASN F 3 413 ? 121.122 -7.435  -8.476  1.00 21.84  ? 709 ASN D O     1 
ATOM   8745  C  CB    . ASN F 3 413 ? 117.961 -7.495  -9.373  1.00 22.51  ? 709 ASN D CB    1 
ATOM   8746  C  CG    . ASN F 3 413 ? 116.825 -6.589  -8.910  1.00 22.91  ? 709 ASN D CG    1 
ATOM   8747  O  OD1   . ASN F 3 413 ? 117.044 -5.549  -8.286  1.00 23.52  ? 709 ASN D OD1   1 
ATOM   8748  N  ND2   . ASN F 3 413 ? 115.597 -7.013  -9.179  1.00 22.40  ? 709 ASN D ND2   1 
ATOM   8749  N  N     . TYR F 3 414 ? 120.669 -8.625  -10.321 1.00 20.95  ? 710 TYR D N     1 
ATOM   8750  C  CA    . TYR F 3 414 ? 121.778 -9.542  -10.090 1.00 20.62  ? 710 TYR D CA    1 
ATOM   8751  C  C     . TYR F 3 414 ? 123.153 -8.947  -10.414 1.00 20.82  ? 710 TYR D C     1 
ATOM   8752  O  O     . TYR F 3 414 ? 124.150 -9.278  -9.769  1.00 20.37  ? 710 TYR D O     1 
ATOM   8753  C  CB    . TYR F 3 414 ? 121.563 -10.885 -10.801 1.00 20.02  ? 710 TYR D CB    1 
ATOM   8754  C  CG    . TYR F 3 414 ? 120.596 -11.764 -10.068 1.00 19.63  ? 710 TYR D CG    1 
ATOM   8755  C  CD1   . TYR F 3 414 ? 120.821 -12.093 -8.734  1.00 20.25  ? 710 TYR D CD1   1 
ATOM   8756  C  CD2   . TYR F 3 414 ? 119.456 -12.266 -10.686 1.00 19.01  ? 710 TYR D CD2   1 
ATOM   8757  C  CE1   . TYR F 3 414 ? 119.921 -12.889 -8.026  1.00 19.66  ? 710 TYR D CE1   1 
ATOM   8758  C  CE2   . TYR F 3 414 ? 118.551 -13.063 -9.988  1.00 18.47  ? 710 TYR D CE2   1 
ATOM   8759  C  CZ    . TYR F 3 414 ? 118.795 -13.367 -8.654  1.00 19.13  ? 710 TYR D CZ    1 
ATOM   8760  O  OH    . TYR F 3 414 ? 117.932 -14.161 -7.937  1.00 19.00  ? 710 TYR D OH    1 
ATOM   8761  N  N     . GLY F 3 415 ? 123.203 -8.065  -11.405 1.00 20.87  ? 711 GLY D N     1 
ATOM   8762  C  CA    . GLY F 3 415 ? 124.457 -7.419  -11.764 1.00 21.53  ? 711 GLY D CA    1 
ATOM   8763  C  C     . GLY F 3 415 ? 124.953 -6.504  -10.660 1.00 22.03  ? 711 GLY D C     1 
ATOM   8764  O  O     . GLY F 3 415 ? 126.133 -6.519  -10.301 1.00 21.86  ? 711 GLY D O     1 
ATOM   8765  N  N     . ILE F 3 416 ? 124.040 -5.723  -10.095 1.00 22.65  ? 712 ILE D N     1 
ATOM   8766  C  CA    . ILE F 3 416 ? 124.426 -4.733  -9.114  1.00 23.43  ? 712 ILE D CA    1 
ATOM   8767  C  C     . ILE F 3 416 ? 124.992 -5.378  -7.859  1.00 24.33  ? 712 ILE D C     1 
ATOM   8768  O  O     . ILE F 3 416 ? 126.092 -5.024  -7.415  1.00 24.98  ? 712 ILE D O     1 
ATOM   8769  C  CB    . ILE F 3 416 ? 123.275 -3.767  -8.794  1.00 23.39  ? 712 ILE D CB    1 
ATOM   8770  C  CG1   . ILE F 3 416 ? 122.962 -2.913  -10.033 1.00 23.73  ? 712 ILE D CG1   1 
ATOM   8771  C  CG2   . ILE F 3 416 ? 123.635 -2.880  -7.609  1.00 22.44  ? 712 ILE D CG2   1 
ATOM   8772  C  CD1   . ILE F 3 416 ? 121.779 -1.947  -9.879  1.00 23.64  ? 712 ILE D CD1   1 
ATOM   8773  N  N     . VAL F 3 417 ? 124.267 -6.348  -7.313  1.00 24.65  ? 713 VAL D N     1 
ATOM   8774  C  CA    . VAL F 3 417 ? 124.728 -7.045  -6.124  1.00 25.05  ? 713 VAL D CA    1 
ATOM   8775  C  C     . VAL F 3 417 ? 126.030 -7.808  -6.392  1.00 25.41  ? 713 VAL D C     1 
ATOM   8776  O  O     . VAL F 3 417 ? 126.791 -8.067  -5.462  1.00 25.55  ? 713 VAL D O     1 
ATOM   8777  C  CB    . VAL F 3 417 ? 123.646 -7.997  -5.539  1.00 24.98  ? 713 VAL D CB    1 
ATOM   8778  C  CG1   . VAL F 3 417 ? 122.320 -7.262  -5.401  1.00 24.67  ? 713 VAL D CG1   1 
ATOM   8779  C  CG2   . VAL F 3 417 ? 123.477 -9.246  -6.396  1.00 25.02  ? 713 VAL D CG2   1 
ATOM   8780  N  N     . TYR F 3 418 ? 126.294 -8.142  -7.656  1.00 25.82  ? 714 TYR D N     1 
ATOM   8781  C  CA    . TYR F 3 418 ? 127.501 -8.896  -8.005  1.00 26.28  ? 714 TYR D CA    1 
ATOM   8782  C  C     . TYR F 3 418 ? 128.676 -8.074  -8.529  1.00 26.43  ? 714 TYR D C     1 
ATOM   8783  O  O     . TYR F 3 418 ? 129.619 -8.635  -9.084  1.00 26.65  ? 714 TYR D O     1 
ATOM   8784  C  CB    . TYR F 3 418 ? 127.187 -10.046 -8.962  1.00 26.52  ? 714 TYR D CB    1 
ATOM   8785  C  CG    . TYR F 3 418 ? 126.344 -11.097 -8.305  1.00 26.98  ? 714 TYR D CG    1 
ATOM   8786  C  CD1   . TYR F 3 418 ? 126.495 -11.370 -6.951  1.00 27.46  ? 714 TYR D CD1   1 
ATOM   8787  C  CD2   . TYR F 3 418 ? 125.420 -11.839 -9.029  1.00 27.08  ? 714 TYR D CD2   1 
ATOM   8788  C  CE1   . TYR F 3 418 ? 125.725 -12.337 -6.322  1.00 28.30  ? 714 TYR D CE1   1 
ATOM   8789  C  CE2   . TYR F 3 418 ? 124.636 -12.806 -8.407  1.00 27.46  ? 714 TYR D CE2   1 
ATOM   8790  C  CZ    . TYR F 3 418 ? 124.800 -13.050 -7.055  1.00 27.59  ? 714 TYR D CZ    1 
ATOM   8791  O  OH    . TYR F 3 418 ? 124.053 -14.016 -6.425  1.00 27.45  ? 714 TYR D OH    1 
ATOM   8792  N  N     . GLY F 3 419 ? 128.616 -6.754  -8.377  1.00 26.48  ? 715 GLY D N     1 
ATOM   8793  C  CA    . GLY F 3 419 ? 129.777 -5.918  -8.680  1.00 26.21  ? 715 GLY D CA    1 
ATOM   8794  C  C     . GLY F 3 419 ? 129.762 -4.972  -9.861  1.00 25.97  ? 715 GLY D C     1 
ATOM   8795  O  O     . GLY F 3 419 ? 130.680 -4.167  -9.994  1.00 26.17  ? 715 GLY D O     1 
ATOM   8796  N  N     . ILE F 3 420 ? 128.742 -5.054  -10.713 1.00 25.71  ? 716 ILE D N     1 
ATOM   8797  C  CA    . ILE F 3 420 ? 128.658 -4.191  -11.895 1.00 25.56  ? 716 ILE D CA    1 
ATOM   8798  C  C     . ILE F 3 420 ? 128.919 -2.714  -11.556 1.00 26.10  ? 716 ILE D C     1 
ATOM   8799  O  O     . ILE F 3 420 ? 128.468 -2.201  -10.534 1.00 26.15  ? 716 ILE D O     1 
ATOM   8800  C  CB    . ILE F 3 420 ? 127.294 -4.334  -12.623 1.00 25.33  ? 716 ILE D CB    1 
ATOM   8801  C  CG1   . ILE F 3 420 ? 127.439 -4.098  -14.131 1.00 25.26  ? 716 ILE D CG1   1 
ATOM   8802  C  CG2   . ILE F 3 420 ? 126.259 -3.400  -12.029 1.00 25.20  ? 716 ILE D CG2   1 
ATOM   8803  C  CD1   . ILE F 3 420 ? 126.149 -4.294  -14.913 1.00 24.98  ? 716 ILE D CD1   1 
ATOM   8804  N  N     . SER F 3 421 ? 129.675 -2.048  -12.415 1.00 26.67  ? 717 SER D N     1 
ATOM   8805  C  CA    . SER F 3 421 ? 129.981 -0.638  -12.252 1.00 27.17  ? 717 SER D CA    1 
ATOM   8806  C  C     . SER F 3 421 ? 128.988 0.167   -13.074 1.00 27.66  ? 717 SER D C     1 
ATOM   8807  O  O     . SER F 3 421 ? 128.283 -0.393  -13.916 1.00 27.74  ? 717 SER D O     1 
ATOM   8808  C  CB    . SER F 3 421 ? 131.382 -0.371  -12.774 1.00 27.08  ? 717 SER D CB    1 
ATOM   8809  O  OG    . SER F 3 421 ? 131.485 -0.841  -14.104 1.00 26.30  ? 717 SER D OG    1 
ATOM   8810  N  N     . ASP F 3 422 ? 128.944 1.477   -12.847 1.00 28.06  ? 718 ASP D N     1 
ATOM   8811  C  CA    . ASP F 3 422 ? 128.059 2.345   -13.614 1.00 28.88  ? 718 ASP D CA    1 
ATOM   8812  C  C     . ASP F 3 422 ? 128.231 2.112   -15.108 1.00 28.95  ? 718 ASP D C     1 
ATOM   8813  O  O     . ASP F 3 422 ? 127.264 2.116   -15.858 1.00 29.09  ? 718 ASP D O     1 
ATOM   8814  C  CB    . ASP F 3 422 ? 128.280 3.829   -13.265 1.00 29.23  ? 718 ASP D CB    1 
ATOM   8815  C  CG    . ASP F 3 422 ? 129.753 4.270   -13.370 1.00 30.94  ? 718 ASP D CG    1 
ATOM   8816  O  OD1   . ASP F 3 422 ? 130.108 5.309   -12.772 1.00 31.47  ? 718 ASP D OD1   1 
ATOM   8817  O  OD2   . ASP F 3 422 ? 130.568 3.590   -14.035 1.00 33.89  ? 718 ASP D OD2   1 
ATOM   8818  N  N     . TYR F 3 423 ? 129.472 1.889   -15.526 1.00 29.07  ? 719 TYR D N     1 
ATOM   8819  C  CA    . TYR F 3 423 ? 129.788 1.708   -16.928 1.00 29.31  ? 719 TYR D CA    1 
ATOM   8820  C  C     . TYR F 3 423 ? 129.107 0.466   -17.502 1.00 29.79  ? 719 TYR D C     1 
ATOM   8821  O  O     . TYR F 3 423 ? 128.452 0.534   -18.540 1.00 29.82  ? 719 TYR D O     1 
ATOM   8822  C  CB    . TYR F 3 423 ? 131.304 1.647   -17.137 1.00 29.04  ? 719 TYR D CB    1 
ATOM   8823  C  CG    . TYR F 3 423 ? 131.688 1.423   -18.577 1.00 28.84  ? 719 TYR D CG    1 
ATOM   8824  C  CD1   . TYR F 3 423 ? 131.698 2.476   -19.485 1.00 28.94  ? 719 TYR D CD1   1 
ATOM   8825  C  CD2   . TYR F 3 423 ? 132.025 0.158   -19.037 1.00 28.86  ? 719 TYR D CD2   1 
ATOM   8826  C  CE1   . TYR F 3 423 ? 132.040 2.276   -20.808 1.00 29.00  ? 719 TYR D CE1   1 
ATOM   8827  C  CE2   . TYR F 3 423 ? 132.373 -0.056  -20.360 1.00 28.78  ? 719 TYR D CE2   1 
ATOM   8828  C  CZ    . TYR F 3 423 ? 132.379 1.008   -21.240 1.00 29.25  ? 719 TYR D CZ    1 
ATOM   8829  O  OH    . TYR F 3 423 ? 132.715 0.805   -22.555 1.00 29.04  ? 719 TYR D OH    1 
ATOM   8830  N  N     . GLY F 3 424 ? 129.271 -0.665  -16.824 1.00 30.16  ? 720 GLY D N     1 
ATOM   8831  C  CA    . GLY F 3 424 ? 128.647 -1.902  -17.258 1.00 30.61  ? 720 GLY D CA    1 
ATOM   8832  C  C     . GLY F 3 424 ? 127.139 -1.784  -17.252 1.00 31.07  ? 720 GLY D C     1 
ATOM   8833  O  O     . GLY F 3 424 ? 126.467 -2.309  -18.141 1.00 30.82  ? 720 GLY D O     1 
ATOM   8834  N  N     . LEU F 3 425 ? 126.607 -1.090  -16.244 1.00 31.82  ? 721 LEU D N     1 
ATOM   8835  C  CA    . LEU F 3 425 ? 125.163 -0.882  -16.122 1.00 32.13  ? 721 LEU D CA    1 
ATOM   8836  C  C     . LEU F 3 425 ? 124.641 -0.004  -17.251 1.00 32.73  ? 721 LEU D C     1 
ATOM   8837  O  O     . LEU F 3 425 ? 123.582 -0.278  -17.813 1.00 33.24  ? 721 LEU D O     1 
ATOM   8838  C  CB    . LEU F 3 425 ? 124.803 -0.296  -14.756 1.00 31.90  ? 721 LEU D CB    1 
ATOM   8839  C  CG    . LEU F 3 425 ? 123.314 -0.110  -14.415 1.00 31.91  ? 721 LEU D CG    1 
ATOM   8840  C  CD1   . LEU F 3 425 ? 122.481 -1.386  -14.587 1.00 30.37  ? 721 LEU D CD1   1 
ATOM   8841  C  CD2   . LEU F 3 425 ? 123.160 0.444   -13.007 1.00 31.59  ? 721 LEU D CD2   1 
ATOM   8842  N  N     . ALA F 3 426 ? 125.402 1.028   -17.599 1.00 33.47  ? 722 ALA D N     1 
ATOM   8843  C  CA    . ALA F 3 426 ? 125.032 1.949   -18.679 1.00 33.98  ? 722 ALA D CA    1 
ATOM   8844  C  C     . ALA F 3 426 ? 125.073 1.274   -20.054 1.00 34.41  ? 722 ALA D C     1 
ATOM   8845  O  O     . ALA F 3 426 ? 124.217 1.526   -20.897 1.00 34.34  ? 722 ALA D O     1 
ATOM   8846  C  CB    . ALA F 3 426 ? 125.926 3.175   -18.657 1.00 33.82  ? 722 ALA D CB    1 
ATOM   8847  N  N     . GLN F 3 427 ? 126.068 0.420   -20.275 1.00 34.91  ? 723 GLN D N     1 
ATOM   8848  C  CA    . GLN F 3 427 ? 126.182 -0.308  -21.532 1.00 35.76  ? 723 GLN D CA    1 
ATOM   8849  C  C     . GLN F 3 427 ? 125.058 -1.329  -21.682 1.00 36.60  ? 723 GLN D C     1 
ATOM   8850  O  O     . GLN F 3 427 ? 124.487 -1.490  -22.763 1.00 36.69  ? 723 GLN D O     1 
ATOM   8851  C  CB    . GLN F 3 427 ? 127.539 -1.002  -21.628 1.00 35.63  ? 723 GLN D CB    1 
ATOM   8852  C  CG    . GLN F 3 427 ? 128.705 -0.040  -21.722 1.00 35.99  ? 723 GLN D CG    1 
ATOM   8853  C  CD    . GLN F 3 427 ? 128.645 0.815   -22.972 1.00 36.54  ? 723 GLN D CD    1 
ATOM   8854  O  OE1   . GLN F 3 427 ? 128.647 0.293   -24.089 1.00 38.31  ? 723 GLN D OE1   1 
ATOM   8855  N  NE2   . GLN F 3 427 ? 128.593 2.133   -22.794 1.00 35.42  ? 723 GLN D NE2   1 
ATOM   8856  N  N     . ASN F 3 428 ? 124.737 -2.015  -20.591 1.00 37.54  ? 724 ASN D N     1 
ATOM   8857  C  CA    . ASN F 3 428 ? 123.660 -2.996  -20.617 1.00 38.45  ? 724 ASN D CA    1 
ATOM   8858  C  C     . ASN F 3 428 ? 122.300 -2.343  -20.824 1.00 38.48  ? 724 ASN D C     1 
ATOM   8859  O  O     . ASN F 3 428 ? 121.577 -2.715  -21.741 1.00 38.57  ? 724 ASN D O     1 
ATOM   8860  C  CB    . ASN F 3 428 ? 123.680 -3.883  -19.367 1.00 38.77  ? 724 ASN D CB    1 
ATOM   8861  C  CG    . ASN F 3 428 ? 124.951 -4.726  -19.269 1.00 40.08  ? 724 ASN D CG    1 
ATOM   8862  O  OD1   . ASN F 3 428 ? 125.955 -4.446  -19.943 1.00 40.94  ? 724 ASN D OD1   1 
ATOM   8863  N  ND2   . ASN F 3 428 ? 124.916 -5.762  -18.426 1.00 40.40  ? 724 ASN D ND2   1 
ATOM   8864  N  N     . LEU F 3 429 ? 121.964 -1.353  -20.002 1.00 38.74  ? 725 LEU D N     1 
ATOM   8865  C  CA    . LEU F 3 429 ? 120.682 -0.657  -20.152 1.00 39.03  ? 725 LEU D CA    1 
ATOM   8866  C  C     . LEU F 3 429 ? 120.676 0.389   -21.259 1.00 39.30  ? 725 LEU D C     1 
ATOM   8867  O  O     . LEU F 3 429 ? 119.617 0.888   -21.625 1.00 39.44  ? 725 LEU D O     1 
ATOM   8868  C  CB    . LEU F 3 429 ? 120.237 -0.001  -18.842 1.00 39.01  ? 725 LEU D CB    1 
ATOM   8869  C  CG    . LEU F 3 429 ? 119.840 -0.913  -17.683 1.00 38.90  ? 725 LEU D CG    1 
ATOM   8870  C  CD1   . LEU F 3 429 ? 119.270 -0.077  -16.558 1.00 38.11  ? 725 LEU D CD1   1 
ATOM   8871  C  CD2   . LEU F 3 429 ? 118.833 -1.966  -18.136 1.00 38.87  ? 725 LEU D CD2   1 
ATOM   8872  N  N     . ASN F 3 430 ? 121.852 0.734   -21.779 1.00 39.69  ? 726 ASN D N     1 
ATOM   8873  C  CA    . ASN F 3 430 ? 121.949 1.743   -22.826 1.00 39.85  ? 726 ASN D CA    1 
ATOM   8874  C  C     . ASN F 3 430 ? 121.399 3.080   -22.303 1.00 39.64  ? 726 ASN D C     1 
ATOM   8875  O  O     . ASN F 3 430 ? 120.510 3.676   -22.898 1.00 39.62  ? 726 ASN D O     1 
ATOM   8876  C  CB    . ASN F 3 430 ? 121.201 1.257   -24.072 1.00 40.13  ? 726 ASN D CB    1 
ATOM   8877  C  CG    . ASN F 3 430 ? 121.525 2.061   -25.316 1.00 41.25  ? 726 ASN D CG    1 
ATOM   8878  O  OD1   . ASN F 3 430 ? 121.962 3.211   -25.242 1.00 43.04  ? 726 ASN D OD1   1 
ATOM   8879  N  ND2   . ASN F 3 430 ? 121.290 1.458   -26.478 1.00 41.97  ? 726 ASN D ND2   1 
ATOM   8880  N  N     . ILE F 3 431 ? 121.923 3.526   -21.165 1.00 39.54  ? 727 ILE D N     1 
ATOM   8881  C  CA    . ILE F 3 431 ? 121.490 4.774   -20.536 1.00 39.52  ? 727 ILE D CA    1 
ATOM   8882  C  C     . ILE F 3 431 ? 122.674 5.603   -20.031 1.00 39.64  ? 727 ILE D C     1 
ATOM   8883  O  O     . ILE F 3 431 ? 123.794 5.106   -19.927 1.00 39.57  ? 727 ILE D O     1 
ATOM   8884  C  CB    . ILE F 3 431 ? 120.525 4.530   -19.334 1.00 39.66  ? 727 ILE D CB    1 
ATOM   8885  C  CG1   . ILE F 3 431 ? 121.260 3.885   -18.151 1.00 39.37  ? 727 ILE D CG1   1 
ATOM   8886  C  CG2   . ILE F 3 431 ? 119.312 3.709   -19.759 1.00 39.72  ? 727 ILE D CG2   1 
ATOM   8887  C  CD1   . ILE F 3 431 ? 120.440 3.814   -16.879 1.00 39.20  ? 727 ILE D CD1   1 
ATOM   8888  N  N     . SER F 3 432 ? 122.403 6.866   -19.711 1.00 39.78  ? 728 SER D N     1 
ATOM   8889  C  CA    . SER F 3 432 ? 123.406 7.783   -19.188 1.00 40.04  ? 728 SER D CA    1 
ATOM   8890  C  C     . SER F 3 432 ? 124.209 7.167   -18.060 1.00 40.27  ? 728 SER D C     1 
ATOM   8891  O  O     . SER F 3 432 ? 123.642 6.558   -17.151 1.00 40.55  ? 728 SER D O     1 
ATOM   8892  C  CB    . SER F 3 432 ? 122.736 9.052   -18.676 1.00 40.03  ? 728 SER D CB    1 
ATOM   8893  O  OG    . SER F 3 432 ? 123.541 9.699   -17.701 1.00 40.29  ? 728 SER D OG    1 
ATOM   8894  N  N     . ARG F 3 433 ? 125.525 7.358   -18.112 1.00 40.37  ? 729 ARG D N     1 
ATOM   8895  C  CA    . ARG F 3 433 ? 126.432 6.794   -17.117 1.00 40.43  ? 729 ARG D CA    1 
ATOM   8896  C  C     . ARG F 3 433 ? 126.308 7.490   -15.762 1.00 40.46  ? 729 ARG D C     1 
ATOM   8897  O  O     . ARG F 3 433 ? 126.610 6.901   -14.716 1.00 40.25  ? 729 ARG D O     1 
ATOM   8898  C  CB    . ARG F 3 433 ? 127.875 6.848   -17.615 1.00 40.52  ? 729 ARG D CB    1 
ATOM   8899  C  CG    . ARG F 3 433 ? 128.785 5.897   -16.887 1.00 40.26  ? 729 ARG D CG    1 
ATOM   8900  C  CD    . ARG F 3 433 ? 130.213 6.034   -17.327 1.00 39.45  ? 729 ARG D CD    1 
ATOM   8901  N  NE    . ARG F 3 433 ? 131.080 5.323   -16.401 1.00 38.94  ? 729 ARG D NE    1 
ATOM   8902  C  CZ    . ARG F 3 433 ? 132.403 5.307   -16.474 1.00 38.48  ? 729 ARG D CZ    1 
ATOM   8903  N  NH1   . ARG F 3 433 ? 133.024 5.970   -17.438 1.00 38.31  ? 729 ARG D NH1   1 
ATOM   8904  N  NH2   . ARG F 3 433 ? 133.100 4.622   -15.581 1.00 38.21  ? 729 ARG D NH2   1 
ATOM   8905  N  N     . LYS F 3 434 ? 125.869 8.748   -15.789 1.00 40.52  ? 730 LYS D N     1 
ATOM   8906  C  CA    . LYS F 3 434 ? 125.609 9.504   -14.564 1.00 40.51  ? 730 LYS D CA    1 
ATOM   8907  C  C     . LYS F 3 434 ? 124.356 8.930   -13.900 1.00 40.00  ? 730 LYS D C     1 
ATOM   8908  O  O     . LYS F 3 434 ? 124.285 8.795   -12.679 1.00 39.91  ? 730 LYS D O     1 
ATOM   8909  C  CB    . LYS F 3 434 ? 125.442 10.998  -14.883 1.00 40.75  ? 730 LYS D CB    1 
ATOM   8910  C  CG    . LYS F 3 434 ? 125.099 11.890  -13.688 1.00 41.24  ? 730 LYS D CG    1 
ATOM   8911  C  CD    . LYS F 3 434 ? 125.174 13.374  -14.063 1.00 41.27  ? 730 LYS D CD    1 
ATOM   8912  C  CE    . LYS F 3 434 ? 124.781 14.303  -12.887 1.00 42.00  ? 730 LYS D CE    1 
ATOM   8913  N  NZ    . LYS F 3 434 ? 123.317 14.285  -12.548 1.00 41.47  ? 730 LYS D NZ    1 
ATOM   8914  N  N     . GLU F 3 435 ? 123.382 8.569   -14.724 1.00 39.49  ? 731 GLU D N     1 
ATOM   8915  C  CA    . GLU F 3 435 ? 122.141 8.001   -14.238 1.00 39.49  ? 731 GLU D CA    1 
ATOM   8916  C  C     . GLU F 3 435 ? 122.347 6.568   -13.764 1.00 38.66  ? 731 GLU D C     1 
ATOM   8917  O  O     . GLU F 3 435 ? 121.668 6.108   -12.846 1.00 38.42  ? 731 GLU D O     1 
ATOM   8918  C  CB    . GLU F 3 435 ? 121.066 8.078   -15.320 1.00 39.38  ? 731 GLU D CB    1 
ATOM   8919  C  CG    . GLU F 3 435 ? 120.758 9.513   -15.734 1.00 40.57  ? 731 GLU D CG    1 
ATOM   8920  C  CD    . GLU F 3 435 ? 119.781 9.613   -16.904 1.00 41.15  ? 731 GLU D CD    1 
ATOM   8921  O  OE1   . GLU F 3 435 ? 118.790 8.837   -16.929 1.00 43.16  ? 731 GLU D OE1   1 
ATOM   8922  O  OE2   . GLU F 3 435 ? 120.001 10.479  -17.793 1.00 42.90  ? 731 GLU D OE2   1 
ATOM   8923  N  N     . ALA F 3 436 ? 123.297 5.871   -14.380 1.00 38.11  ? 732 ALA D N     1 
ATOM   8924  C  CA    . ALA F 3 436 ? 123.617 4.505   -13.981 1.00 37.48  ? 732 ALA D CA    1 
ATOM   8925  C  C     . ALA F 3 436 ? 124.230 4.499   -12.591 1.00 36.97  ? 732 ALA D C     1 
ATOM   8926  O  O     . ALA F 3 436 ? 123.924 3.641   -11.773 1.00 36.77  ? 732 ALA D O     1 
ATOM   8927  C  CB    . ALA F 3 436 ? 124.549 3.862   -14.982 1.00 37.72  ? 732 ALA D CB    1 
ATOM   8928  N  N     . ALA F 3 437 ? 125.078 5.485   -12.332 1.00 36.62  ? 733 ALA D N     1 
ATOM   8929  C  CA    . ALA F 3 437 ? 125.704 5.655   -11.032 1.00 36.45  ? 733 ALA D CA    1 
ATOM   8930  C  C     . ALA F 3 437 ? 124.660 5.856   -9.937  1.00 36.34  ? 733 ALA D C     1 
ATOM   8931  O  O     . ALA F 3 437 ? 124.600 5.091   -8.983  1.00 36.16  ? 733 ALA D O     1 
ATOM   8932  C  CB    . ALA F 3 437 ? 126.677 6.834   -11.069 1.00 36.28  ? 733 ALA D CB    1 
ATOM   8933  N  N     . GLU F 3 438 ? 123.843 6.892   -10.090 1.00 36.47  ? 734 GLU D N     1 
ATOM   8934  C  CA    . GLU F 3 438 ? 122.791 7.222   -9.130  1.00 36.72  ? 734 GLU D CA    1 
ATOM   8935  C  C     . GLU F 3 438 ? 121.838 6.045   -8.873  1.00 36.31  ? 734 GLU D C     1 
ATOM   8936  O  O     . GLU F 3 438 ? 121.347 5.874   -7.755  1.00 36.17  ? 734 GLU D O     1 
ATOM   8937  C  CB    . GLU F 3 438 ? 122.035 8.482   -9.585  1.00 36.70  ? 734 GLU D CB    1 
ATOM   8938  C  CG    . GLU F 3 438 ? 122.941 9.732   -9.662  1.00 37.66  ? 734 GLU D CG    1 
ATOM   8939  C  CD    . GLU F 3 438 ? 122.330 10.922  -10.424 1.00 37.81  ? 734 GLU D CD    1 
ATOM   8940  O  OE1   . GLU F 3 438 ? 121.304 10.740  -11.129 1.00 39.98  ? 734 GLU D OE1   1 
ATOM   8941  O  OE2   . GLU F 3 438 ? 122.889 12.042  -10.326 1.00 37.11  ? 734 GLU D OE2   1 
ATOM   8942  N  N     . PHE F 3 439 ? 121.601 5.221   -9.892  1.00 35.98  ? 735 PHE D N     1 
ATOM   8943  C  CA    . PHE F 3 439 ? 120.777 4.024   -9.717  1.00 35.91  ? 735 PHE D CA    1 
ATOM   8944  C  C     . PHE F 3 439 ? 121.443 3.053   -8.734  1.00 35.59  ? 735 PHE D C     1 
ATOM   8945  O  O     . PHE F 3 439 ? 120.797 2.483   -7.847  1.00 35.08  ? 735 PHE D O     1 
ATOM   8946  C  CB    . PHE F 3 439 ? 120.532 3.332   -11.054 1.00 36.11  ? 735 PHE D CB    1 
ATOM   8947  C  CG    . PHE F 3 439 ? 119.358 2.392   -11.042 1.00 36.88  ? 735 PHE D CG    1 
ATOM   8948  C  CD1   . PHE F 3 439 ? 118.074 2.860   -11.323 1.00 37.93  ? 735 PHE D CD1   1 
ATOM   8949  C  CD2   . PHE F 3 439 ? 119.527 1.040   -10.751 1.00 37.54  ? 735 PHE D CD2   1 
ATOM   8950  C  CE1   . PHE F 3 439 ? 116.973 1.999   -11.318 1.00 37.83  ? 735 PHE D CE1   1 
ATOM   8951  C  CE2   . PHE F 3 439 ? 118.439 0.173   -10.741 1.00 37.77  ? 735 PHE D CE2   1 
ATOM   8952  C  CZ    . PHE F 3 439 ? 117.154 0.657   -11.025 1.00 37.66  ? 735 PHE D CZ    1 
ATOM   8953  N  N     . ILE F 3 440 ? 122.746 2.875   -8.905  1.00 35.55  ? 736 ILE D N     1 
ATOM   8954  C  CA    . ILE F 3 440 ? 123.529 2.033   -8.015  1.00 35.53  ? 736 ILE D CA    1 
ATOM   8955  C  C     . ILE F 3 440 ? 123.545 2.632   -6.616  1.00 35.80  ? 736 ILE D C     1 
ATOM   8956  O  O     . ILE F 3 440 ? 123.409 1.921   -5.629  1.00 35.66  ? 736 ILE D O     1 
ATOM   8957  C  CB    . ILE F 3 440 ? 124.968 1.868   -8.534  1.00 35.31  ? 736 ILE D CB    1 
ATOM   8958  C  CG1   . ILE F 3 440 ? 124.979 0.962   -9.760  1.00 34.90  ? 736 ILE D CG1   1 
ATOM   8959  C  CG2   . ILE F 3 440 ? 125.878 1.308   -7.450  1.00 35.26  ? 736 ILE D CG2   1 
ATOM   8960  C  CD1   . ILE F 3 440 ? 126.323 0.866   -10.433 1.00 35.38  ? 736 ILE D CD1   1 
ATOM   8961  N  N     . GLU F 3 441 ? 123.685 3.950   -6.540  1.00 36.26  ? 737 GLU D N     1 
ATOM   8962  C  CA    . GLU F 3 441 ? 123.739 4.624   -5.256  1.00 36.61  ? 737 GLU D CA    1 
ATOM   8963  C  C     . GLU F 3 441 ? 122.412 4.489   -4.516  1.00 36.34  ? 737 GLU D C     1 
ATOM   8964  O  O     . GLU F 3 441 ? 122.393 4.214   -3.313  1.00 36.45  ? 737 GLU D O     1 
ATOM   8965  C  CB    . GLU F 3 441 ? 124.098 6.093   -5.431  1.00 37.07  ? 737 GLU D CB    1 
ATOM   8966  C  CG    . GLU F 3 441 ? 124.458 6.783   -4.126  1.00 39.26  ? 737 GLU D CG    1 
ATOM   8967  C  CD    . GLU F 3 441 ? 124.044 8.247   -4.098  1.00 41.95  ? 737 GLU D CD    1 
ATOM   8968  O  OE1   . GLU F 3 441 ? 124.234 8.887   -3.037  1.00 43.59  ? 737 GLU D OE1   1 
ATOM   8969  O  OE2   . GLU F 3 441 ? 123.513 8.750   -5.120  1.00 42.85  ? 737 GLU D OE2   1 
ATOM   8970  N  N     . ARG F 3 442 ? 121.304 4.675   -5.229  1.00 35.88  ? 738 ARG D N     1 
ATOM   8971  C  CA    . ARG F 3 442 ? 119.984 4.512   -4.610  1.00 35.83  ? 738 ARG D CA    1 
ATOM   8972  C  C     . ARG F 3 442 ? 119.677 3.061   -4.231  1.00 34.91  ? 738 ARG D C     1 
ATOM   8973  O  O     . ARG F 3 442 ? 118.898 2.811   -3.313  1.00 34.89  ? 738 ARG D O     1 
ATOM   8974  C  CB    . ARG F 3 442 ? 118.863 5.090   -5.483  1.00 35.80  ? 738 ARG D CB    1 
ATOM   8975  C  CG    . ARG F 3 442 ? 118.684 6.605   -5.347  1.00 36.87  ? 738 ARG D CG    1 
ATOM   8976  C  CD    . ARG F 3 442 ? 117.528 7.127   -6.209  1.00 37.20  ? 738 ARG D CD    1 
ATOM   8977  N  NE    . ARG F 3 442 ? 117.703 6.770   -7.619  1.00 39.44  ? 738 ARG D NE    1 
ATOM   8978  C  CZ    . ARG F 3 442 ? 118.213 7.575   -8.545  1.00 39.65  ? 738 ARG D CZ    1 
ATOM   8979  N  NH1   . ARG F 3 442 ? 118.591 8.812   -8.227  1.00 39.47  ? 738 ARG D NH1   1 
ATOM   8980  N  NH2   . ARG F 3 442 ? 118.333 7.139   -9.795  1.00 39.76  ? 738 ARG D NH2   1 
ATOM   8981  N  N     . TYR F 3 443 ? 120.291 2.111   -4.929  1.00 33.93  ? 739 TYR D N     1 
ATOM   8982  C  CA    . TYR F 3 443 ? 120.084 0.703   -4.619  1.00 33.13  ? 739 TYR D CA    1 
ATOM   8983  C  C     . TYR F 3 443 ? 120.617 0.426   -3.233  1.00 32.29  ? 739 TYR D C     1 
ATOM   8984  O  O     . TYR F 3 443 ? 119.963 -0.207  -2.414  1.00 32.14  ? 739 TYR D O     1 
ATOM   8985  C  CB    . TYR F 3 443 ? 120.840 -0.179  -5.614  1.00 33.64  ? 739 TYR D CB    1 
ATOM   8986  C  CG    . TYR F 3 443 ? 120.333 -1.597  -5.715  1.00 33.59  ? 739 TYR D CG    1 
ATOM   8987  C  CD1   . TYR F 3 443 ? 119.315 -1.914  -6.609  1.00 34.42  ? 739 TYR D CD1   1 
ATOM   8988  C  CD2   . TYR F 3 443 ? 120.876 -2.624  -4.936  1.00 33.81  ? 739 TYR D CD2   1 
ATOM   8989  C  CE1   . TYR F 3 443 ? 118.833 -3.209  -6.734  1.00 34.30  ? 739 TYR D CE1   1 
ATOM   8990  C  CE2   . TYR F 3 443 ? 120.402 -3.938  -5.051  1.00 34.00  ? 739 TYR D CE2   1 
ATOM   8991  C  CZ    . TYR F 3 443 ? 119.376 -4.218  -5.961  1.00 34.41  ? 739 TYR D CZ    1 
ATOM   8992  O  OH    . TYR F 3 443 ? 118.873 -5.495  -6.126  1.00 34.51  ? 739 TYR D OH    1 
ATOM   8993  N  N     . PHE F 3 444 ? 121.816 0.921   -2.971  1.00 31.27  ? 740 PHE D N     1 
ATOM   8994  C  CA    . PHE F 3 444 ? 122.464 0.637   -1.717  1.00 30.48  ? 740 PHE D CA    1 
ATOM   8995  C  C     . PHE F 3 444 ? 121.880 1.403   -0.546  1.00 30.35  ? 740 PHE D C     1 
ATOM   8996  O  O     . PHE F 3 444 ? 122.076 1.025   0.606   1.00 30.28  ? 740 PHE D O     1 
ATOM   8997  C  CB    . PHE F 3 444 ? 123.977 0.795   -1.839  1.00 30.19  ? 740 PHE D CB    1 
ATOM   8998  C  CG    . PHE F 3 444 ? 124.618 -0.267  -2.694  1.00 29.72  ? 740 PHE D CG    1 
ATOM   8999  C  CD1   . PHE F 3 444 ? 124.293 -1.604  -2.518  1.00 29.29  ? 740 PHE D CD1   1 
ATOM   9000  C  CD2   . PHE F 3 444 ? 125.555 0.062   -3.653  1.00 29.24  ? 740 PHE D CD2   1 
ATOM   9001  C  CE1   . PHE F 3 444 ? 124.870 -2.585  -3.294  1.00 28.82  ? 740 PHE D CE1   1 
ATOM   9002  C  CE2   . PHE F 3 444 ? 126.142 -0.925  -4.428  1.00 29.40  ? 740 PHE D CE2   1 
ATOM   9003  C  CZ    . PHE F 3 444 ? 125.792 -2.247  -4.250  1.00 28.93  ? 740 PHE D CZ    1 
ATOM   9004  N  N     . GLU F 3 445 ? 121.142 2.468   -0.837  1.00 30.23  ? 741 GLU D N     1 
ATOM   9005  C  CA    . GLU F 3 445 ? 120.473 3.212   0.222   1.00 30.29  ? 741 GLU D CA    1 
ATOM   9006  C  C     . GLU F 3 445 ? 119.218 2.459   0.638   1.00 29.47  ? 741 GLU D C     1 
ATOM   9007  O  O     . GLU F 3 445 ? 118.776 2.558   1.779   1.00 29.59  ? 741 GLU D O     1 
ATOM   9008  C  CB    . GLU F 3 445 ? 120.144 4.637   -0.218  1.00 30.20  ? 741 GLU D CB    1 
ATOM   9009  C  CG    . GLU F 3 445 ? 121.368 5.533   -0.341  1.00 31.40  ? 741 GLU D CG    1 
ATOM   9010  C  CD    . GLU F 3 445 ? 121.063 6.883   -0.996  1.00 31.95  ? 741 GLU D CD    1 
ATOM   9011  O  OE1   . GLU F 3 445 ? 121.918 7.800   -0.883  1.00 34.12  ? 741 GLU D OE1   1 
ATOM   9012  O  OE2   . GLU F 3 445 ? 119.980 7.026   -1.625  1.00 33.65  ? 741 GLU D OE2   1 
ATOM   9013  N  N     . SER F 3 446 ? 118.660 1.690   -0.291  1.00 28.76  ? 742 SER D N     1 
ATOM   9014  C  CA    . SER F 3 446 ? 117.492 0.864   -0.006  1.00 28.06  ? 742 SER D CA    1 
ATOM   9015  C  C     . SER F 3 446 ? 117.899 -0.411  0.706   1.00 27.34  ? 742 SER D C     1 
ATOM   9016  O  O     . SER F 3 446 ? 117.211 -0.858  1.621   1.00 27.27  ? 742 SER D O     1 
ATOM   9017  C  CB    . SER F 3 446 ? 116.747 0.507   -1.288  1.00 28.05  ? 742 SER D CB    1 
ATOM   9018  O  OG    . SER F 3 446 ? 116.349 1.689   -1.948  1.00 29.03  ? 742 SER D OG    1 
ATOM   9019  N  N     . PHE F 3 447 ? 119.020 -0.994  0.292   1.00 26.44  ? 743 PHE D N     1 
ATOM   9020  C  CA    . PHE F 3 447 ? 119.486 -2.229  0.904   1.00 25.83  ? 743 PHE D CA    1 
ATOM   9021  C  C     . PHE F 3 447 ? 120.910 -2.108  1.429   1.00 25.58  ? 743 PHE D C     1 
ATOM   9022  O  O     . PHE F 3 447 ? 121.796 -2.784  0.938   1.00 25.48  ? 743 PHE D O     1 
ATOM   9023  C  CB    . PHE F 3 447 ? 119.388 -3.382  -0.091  1.00 25.52  ? 743 PHE D CB    1 
ATOM   9024  C  CG    . PHE F 3 447 ? 118.067 -3.465  -0.790  1.00 25.19  ? 743 PHE D CG    1 
ATOM   9025  C  CD1   . PHE F 3 447 ? 116.919 -3.834  -0.097  1.00 25.33  ? 743 PHE D CD1   1 
ATOM   9026  C  CD2   . PHE F 3 447 ? 117.964 -3.176  -2.145  1.00 25.00  ? 743 PHE D CD2   1 
ATOM   9027  C  CE1   . PHE F 3 447 ? 115.683 -3.911  -0.744  1.00 24.69  ? 743 PHE D CE1   1 
ATOM   9028  C  CE2   . PHE F 3 447 ? 116.728 -3.252  -2.807  1.00 24.57  ? 743 PHE D CE2   1 
ATOM   9029  C  CZ    . PHE F 3 447 ? 115.593 -3.617  -2.105  1.00 24.61  ? 743 PHE D CZ    1 
ATOM   9030  N  N     . PRO F 3 448 ? 121.119 -1.273  2.461   1.00 25.45  ? 744 PRO D N     1 
ATOM   9031  C  CA    . PRO F 3 448 ? 122.447 -1.006  2.993   1.00 25.29  ? 744 PRO D CA    1 
ATOM   9032  C  C     . PRO F 3 448 ? 123.116 -2.223  3.595   1.00 25.25  ? 744 PRO D C     1 
ATOM   9033  O  O     . PRO F 3 448 ? 124.342 -2.269  3.677   1.00 25.43  ? 744 PRO D O     1 
ATOM   9034  C  CB    . PRO F 3 448 ? 122.181 0.026   4.091   1.00 25.28  ? 744 PRO D CB    1 
ATOM   9035  C  CG    . PRO F 3 448 ? 120.770 -0.173  4.471   1.00 25.14  ? 744 PRO D CG    1 
ATOM   9036  C  CD    . PRO F 3 448 ? 120.085 -0.533  3.205   1.00 25.55  ? 744 PRO D CD    1 
ATOM   9037  N  N     . GLY F 3 449 ? 122.315 -3.196  4.014   1.00 25.28  ? 745 GLY D N     1 
ATOM   9038  C  CA    . GLY F 3 449 ? 122.835 -4.423  4.609   1.00 25.16  ? 745 GLY D CA    1 
ATOM   9039  C  C     . GLY F 3 449 ? 123.598 -5.201  3.567   1.00 25.16  ? 745 GLY D C     1 
ATOM   9040  O  O     . GLY F 3 449 ? 124.575 -5.876  3.874   1.00 25.17  ? 745 GLY D O     1 
ATOM   9041  N  N     . VAL F 3 450 ? 123.145 -5.091  2.326   1.00 25.19  ? 746 VAL D N     1 
ATOM   9042  C  CA    . VAL F 3 450 ? 123.799 -5.739  1.219   1.00 25.35  ? 746 VAL D CA    1 
ATOM   9043  C  C     . VAL F 3 450 ? 125.148 -5.059  0.976   1.00 25.96  ? 746 VAL D C     1 
ATOM   9044  O  O     . VAL F 3 450 ? 126.159 -5.739  0.803   1.00 25.68  ? 746 VAL D O     1 
ATOM   9045  C  CB    . VAL F 3 450 ? 122.906 -5.726  -0.040  1.00 25.15  ? 746 VAL D CB    1 
ATOM   9046  C  CG1   . VAL F 3 450 ? 123.608 -6.360  -1.232  1.00 24.88  ? 746 VAL D CG1   1 
ATOM   9047  C  CG2   . VAL F 3 450 ? 121.618 -6.467  0.243   1.00 25.45  ? 746 VAL D CG2   1 
ATOM   9048  N  N     . LYS F 3 451 ? 125.182 -3.727  1.003   1.00 26.49  ? 747 LYS D N     1 
ATOM   9049  C  CA    . LYS F 3 451 ? 126.439 -3.029  0.763   1.00 27.43  ? 747 LYS D CA    1 
ATOM   9050  C  C     . LYS F 3 451 ? 127.461 -3.426  1.807   1.00 27.62  ? 747 LYS D C     1 
ATOM   9051  O  O     . LYS F 3 451 ? 128.620 -3.690  1.497   1.00 27.80  ? 747 LYS D O     1 
ATOM   9052  C  CB    . LYS F 3 451 ? 126.260 -1.515  0.784   1.00 27.88  ? 747 LYS D CB    1 
ATOM   9053  C  CG    . LYS F 3 451 ? 127.518 -0.773  0.344   1.00 29.21  ? 747 LYS D CG    1 
ATOM   9054  C  CD    . LYS F 3 451 ? 127.368 0.741   0.469   1.00 32.53  ? 747 LYS D CD    1 
ATOM   9055  C  CE    . LYS F 3 451 ? 128.627 1.467   -0.016  1.00 33.94  ? 747 LYS D CE    1 
ATOM   9056  N  NZ    . LYS F 3 451 ? 128.683 2.869   0.494   1.00 35.83  ? 747 LYS D NZ    1 
ATOM   9057  N  N     . ARG F 3 452 ? 127.014 -3.467  3.053   1.00 27.85  ? 748 ARG D N     1 
ATOM   9058  C  CA    . ARG F 3 452 ? 127.866 -3.824  4.169   1.00 28.35  ? 748 ARG D CA    1 
ATOM   9059  C  C     . ARG F 3 452 ? 128.375 -5.262  4.004   1.00 28.20  ? 748 ARG D C     1 
ATOM   9060  O  O     . ARG F 3 452 ? 129.509 -5.592  4.357   1.00 28.64  ? 748 ARG D O     1 
ATOM   9061  C  CB    . ARG F 3 452 ? 127.084 -3.656  5.476   1.00 28.39  ? 748 ARG D CB    1 
ATOM   9062  C  CG    . ARG F 3 452 ? 127.916 -3.839  6.707   1.00 31.02  ? 748 ARG D CG    1 
ATOM   9063  C  CD    . ARG F 3 452 ? 127.096 -3.782  7.989   1.00 35.91  ? 748 ARG D CD    1 
ATOM   9064  N  NE    . ARG F 3 452 ? 127.967 -3.852  9.170   1.00 39.72  ? 748 ARG D NE    1 
ATOM   9065  C  CZ    . ARG F 3 452 ? 128.261 -4.969  9.843   1.00 41.65  ? 748 ARG D CZ    1 
ATOM   9066  N  NH1   . ARG F 3 452 ? 127.740 -6.138  9.468   1.00 42.52  ? 748 ARG D NH1   1 
ATOM   9067  N  NH2   . ARG F 3 452 ? 129.067 -4.915  10.902  1.00 41.19  ? 748 ARG D NH2   1 
ATOM   9068  N  N     . TYR F 3 453 ? 127.539 -6.115  3.442   1.00 27.84  ? 749 TYR D N     1 
ATOM   9069  C  CA    . TYR F 3 453 ? 127.926 -7.490  3.226   1.00 27.58  ? 749 TYR D CA    1 
ATOM   9070  C  C     . TYR F 3 453 ? 129.022 -7.662  2.154   1.00 27.65  ? 749 TYR D C     1 
ATOM   9071  O  O     . TYR F 3 453 ? 129.899 -8.505  2.300   1.00 27.86  ? 749 TYR D O     1 
ATOM   9072  C  CB    . TYR F 3 453 ? 126.698 -8.337  2.903   1.00 27.35  ? 749 TYR D CB    1 
ATOM   9073  C  CG    . TYR F 3 453 ? 127.073 -9.667  2.356   1.00 27.59  ? 749 TYR D CG    1 
ATOM   9074  C  CD1   . TYR F 3 453 ? 127.542 -10.671 3.192   1.00 28.53  ? 749 TYR D CD1   1 
ATOM   9075  C  CD2   . TYR F 3 453 ? 127.009 -9.917  0.998   1.00 27.98  ? 749 TYR D CD2   1 
ATOM   9076  C  CE1   . TYR F 3 453 ? 127.918 -11.889 2.688   1.00 28.38  ? 749 TYR D CE1   1 
ATOM   9077  C  CE2   . TYR F 3 453 ? 127.376 -11.133 0.484   1.00 27.91  ? 749 TYR D CE2   1 
ATOM   9078  C  CZ    . TYR F 3 453 ? 127.823 -12.117 1.332   1.00 27.92  ? 749 TYR D CZ    1 
ATOM   9079  O  OH    . TYR F 3 453 ? 128.197 -13.334 0.815   1.00 28.23  ? 749 TYR D OH    1 
ATOM   9080  N  N     . MET F 3 454 ? 128.961 -6.887  1.074   1.00 27.53  ? 750 MET D N     1 
ATOM   9081  C  CA    . MET F 3 454 ? 129.976 -6.947  0.033   1.00 27.66  ? 750 MET D CA    1 
ATOM   9082  C  C     . MET F 3 454 ? 131.351 -6.710  0.636   1.00 27.16  ? 750 MET D C     1 
ATOM   9083  O  O     . MET F 3 454 ? 132.325 -7.380  0.294   1.00 27.13  ? 750 MET D O     1 
ATOM   9084  C  CB    . MET F 3 454 ? 129.814 -5.791  -0.942  1.00 28.41  ? 750 MET D CB    1 
ATOM   9085  C  CG    . MET F 3 454 ? 128.432 -5.425  -1.372  1.00 30.98  ? 750 MET D CG    1 
ATOM   9086  S  SD    . MET F 3 454 ? 127.870 -6.465  -2.700  1.00 36.88  ? 750 MET D SD    1 
ATOM   9087  C  CE    . MET F 3 454 ? 127.384 -5.210  -3.892  1.00 32.70  ? 750 MET D CE    1 
ATOM   9088  N  N     . GLU F 3 455 ? 131.431 -5.694  1.490   1.00 26.23  ? 751 GLU D N     1 
ATOM   9089  C  CA    . GLU F 3 455 ? 132.690 -5.298  2.090   1.00 25.44  ? 751 GLU D CA    1 
ATOM   9090  C  C     . GLU F 3 455 ? 133.197 -6.362  3.043   1.00 24.61  ? 751 GLU D C     1 
ATOM   9091  O  O     . GLU F 3 455 ? 134.361 -6.748  2.989   1.00 24.33  ? 751 GLU D O     1 
ATOM   9092  C  CB    . GLU F 3 455 ? 132.531 -3.952  2.800   1.00 25.42  ? 751 GLU D CB    1 
ATOM   9093  C  CG    . GLU F 3 455 ? 132.340 -2.800  1.831   1.00 26.23  ? 751 GLU D CG    1 
ATOM   9094  C  CD    . GLU F 3 455 ? 131.641 -1.599  2.446   1.00 27.56  ? 751 GLU D CD    1 
ATOM   9095  O  OE1   . GLU F 3 455 ? 131.308 -0.669  1.681   1.00 27.67  ? 751 GLU D OE1   1 
ATOM   9096  O  OE2   . GLU F 3 455 ? 131.405 -1.587  3.678   1.00 27.98  ? 751 GLU D OE2   1 
ATOM   9097  N  N     . ASN F 3 456 ? 132.309 -6.841  3.906   1.00 23.69  ? 752 ASN D N     1 
ATOM   9098  C  CA    . ASN F 3 456 ? 132.682 -7.838  4.887   1.00 22.74  ? 752 ASN D CA    1 
ATOM   9099  C  C     . ASN F 3 456 ? 133.150 -9.137  4.276   1.00 22.16  ? 752 ASN D C     1 
ATOM   9100  O  O     . ASN F 3 456 ? 134.095 -9.758  4.774   1.00 22.32  ? 752 ASN D O     1 
ATOM   9101  C  CB    . ASN F 3 456 ? 131.546 -8.061  5.875   1.00 22.69  ? 752 ASN D CB    1 
ATOM   9102  C  CG    . ASN F 3 456 ? 131.341 -6.863  6.762   1.00 22.54  ? 752 ASN D CG    1 
ATOM   9103  O  OD1   . ASN F 3 456 ? 132.102 -5.905  6.679   1.00 23.64  ? 752 ASN D OD1   1 
ATOM   9104  N  ND2   . ASN F 3 456 ? 130.327 -6.898  7.609   1.00 21.85  ? 752 ASN D ND2   1 
ATOM   9105  N  N     . ILE F 3 457 ? 132.519 -9.535  3.180   1.00 21.01  ? 753 ILE D N     1 
ATOM   9106  C  CA    . ILE F 3 457 ? 132.883 -10.788 2.540   1.00 19.99  ? 753 ILE D CA    1 
ATOM   9107  C  C     . ILE F 3 457 ? 134.272 -10.705 1.883   1.00 19.44  ? 753 ILE D C     1 
ATOM   9108  O  O     . ILE F 3 457 ? 135.022 -11.682 1.870   1.00 19.01  ? 753 ILE D O     1 
ATOM   9109  C  CB    . ILE F 3 457 ? 131.773 -11.297 1.568   1.00 20.07  ? 753 ILE D CB    1 
ATOM   9110  C  CG1   . ILE F 3 457 ? 131.909 -12.802 1.347   1.00 19.16  ? 753 ILE D CG1   1 
ATOM   9111  C  CG2   . ILE F 3 457 ? 131.745 -10.520 0.256   1.00 19.68  ? 753 ILE D CG2   1 
ATOM   9112  C  CD1   . ILE F 3 457 ? 131.639 -13.581 2.588   1.00 18.24  ? 753 ILE D CD1   1 
ATOM   9113  N  N     . VAL F 3 458 ? 134.616 -9.527  1.372   1.00 18.79  ? 754 VAL D N     1 
ATOM   9114  C  CA    . VAL F 3 458 ? 135.921 -9.314  0.757   1.00 18.53  ? 754 VAL D CA    1 
ATOM   9115  C  C     . VAL F 3 458 ? 137.023 -9.329  1.826   1.00 18.44  ? 754 VAL D C     1 
ATOM   9116  O  O     . VAL F 3 458 ? 138.053 -9.982  1.640   1.00 18.27  ? 754 VAL D O     1 
ATOM   9117  C  CB    . VAL F 3 458 ? 135.952 -8.039  -0.123  1.00 18.47  ? 754 VAL D CB    1 
ATOM   9118  C  CG1   . VAL F 3 458 ? 137.354 -7.746  -0.620  1.00 18.40  ? 754 VAL D CG1   1 
ATOM   9119  C  CG2   . VAL F 3 458 ? 135.031 -8.211  -1.299  1.00 18.74  ? 754 VAL D CG2   1 
ATOM   9120  N  N     . GLN F 3 459 ? 136.795 -8.659  2.955   1.00 18.06  ? 755 GLN D N     1 
ATOM   9121  C  CA    . GLN F 3 459 ? 137.769 -8.718  4.049   1.00 18.26  ? 755 GLN D CA    1 
ATOM   9122  C  C     . GLN F 3 459 ? 137.999 -10.137 4.554   1.00 17.94  ? 755 GLN D C     1 
ATOM   9123  O  O     . GLN F 3 459 ? 139.143 -10.554 4.731   1.00 18.10  ? 755 GLN D O     1 
ATOM   9124  C  CB    . GLN F 3 459 ? 137.402 -7.790  5.214   1.00 18.16  ? 755 GLN D CB    1 
ATOM   9125  C  CG    . GLN F 3 459 ? 137.311 -6.306  4.830   1.00 20.25  ? 755 GLN D CG    1 
ATOM   9126  C  CD    . GLN F 3 459 ? 138.472 -5.840  3.933   1.00 23.02  ? 755 GLN D CD    1 
ATOM   9127  O  OE1   . GLN F 3 459 ? 139.647 -5.933  4.308   1.00 24.07  ? 755 GLN D OE1   1 
ATOM   9128  N  NE2   . GLN F 3 459 ? 138.137 -5.328  2.745   1.00 23.70  ? 755 GLN D NE2   1 
ATOM   9129  N  N     . GLU F 3 460 ? 136.915 -10.875 4.780   1.00 18.00  ? 756 GLU D N     1 
ATOM   9130  C  CA    . GLU F 3 460 ? 136.998 -12.250 5.275   1.00 17.74  ? 756 GLU D CA    1 
ATOM   9131  C  C     . GLU F 3 460 ? 137.741 -13.140 4.276   1.00 17.50  ? 756 GLU D C     1 
ATOM   9132  O  O     . GLU F 3 460 ? 138.541 -13.995 4.664   1.00 17.44  ? 756 GLU D O     1 
ATOM   9133  C  CB    . GLU F 3 460 ? 135.606 -12.814 5.552   1.00 17.81  ? 756 GLU D CB    1 
ATOM   9134  C  CG    . GLU F 3 460 ? 135.621 -13.986 6.511   1.00 19.67  ? 756 GLU D CG    1 
ATOM   9135  C  CD    . GLU F 3 460 ? 134.331 -14.783 6.516   1.00 22.19  ? 756 GLU D CD    1 
ATOM   9136  O  OE1   . GLU F 3 460 ? 133.720 -14.966 5.447   1.00 22.71  ? 756 GLU D OE1   1 
ATOM   9137  O  OE2   . GLU F 3 460 ? 133.935 -15.262 7.594   1.00 24.79  ? 756 GLU D OE2   1 
ATOM   9138  N  N     . ALA F 3 461 ? 137.472 -12.936 2.991   1.00 17.20  ? 757 ALA D N     1 
ATOM   9139  C  CA    . ALA F 3 461 ? 138.194 -13.645 1.955   1.00 17.38  ? 757 ALA D CA    1 
ATOM   9140  C  C     . ALA F 3 461 ? 139.696 -13.324 2.084   1.00 17.68  ? 757 ALA D C     1 
ATOM   9141  O  O     . ALA F 3 461 ? 140.535 -14.223 2.036   1.00 17.92  ? 757 ALA D O     1 
ATOM   9142  C  CB    . ALA F 3 461 ? 137.668 -13.254 0.573   1.00 17.15  ? 757 ALA D CB    1 
ATOM   9143  N  N     . LYS F 3 462 ? 140.024 -12.044 2.264   1.00 17.89  ? 758 LYS D N     1 
ATOM   9144  C  CA    . LYS F 3 462 ? 141.411 -11.617 2.449   1.00 18.29  ? 758 LYS D CA    1 
ATOM   9145  C  C     . LYS F 3 462 ? 142.058 -12.238 3.693   1.00 18.30  ? 758 LYS D C     1 
ATOM   9146  O  O     . LYS F 3 462 ? 143.239 -12.574 3.669   1.00 18.78  ? 758 LYS D O     1 
ATOM   9147  C  CB    . LYS F 3 462 ? 141.539 -10.082 2.502   1.00 17.92  ? 758 LYS D CB    1 
ATOM   9148  C  CG    . LYS F 3 462 ? 141.266 -9.335  1.183   1.00 18.02  ? 758 LYS D CG    1 
ATOM   9149  C  CD    . LYS F 3 462 ? 141.717 -7.860  1.294   1.00 19.31  ? 758 LYS D CD    1 
ATOM   9150  C  CE    . LYS F 3 462 ? 140.968 -6.889  0.337   1.00 20.87  ? 758 LYS D CE    1 
ATOM   9151  N  NZ    . LYS F 3 462 ? 141.144 -7.101  -1.154  1.00 21.39  ? 758 LYS D NZ    1 
ATOM   9152  N  N     . GLN F 3 463 ? 141.295 -12.408 4.768   1.00 18.22  ? 759 GLN D N     1 
ATOM   9153  C  CA    . GLN F 3 463 ? 141.858 -12.932 6.016   1.00 18.27  ? 759 GLN D CA    1 
ATOM   9154  C  C     . GLN F 3 463 ? 141.995 -14.462 6.058   1.00 18.26  ? 759 GLN D C     1 
ATOM   9155  O  O     . GLN F 3 463 ? 143.029 -14.979 6.488   1.00 18.23  ? 759 GLN D O     1 
ATOM   9156  C  CB    . GLN F 3 463 ? 141.080 -12.400 7.219   1.00 18.07  ? 759 GLN D CB    1 
ATOM   9157  C  CG    . GLN F 3 463 ? 141.559 -12.907 8.572   1.00 19.94  ? 759 GLN D CG    1 
ATOM   9158  C  CD    . GLN F 3 463 ? 140.796 -14.130 9.078   1.00 22.06  ? 759 GLN D CD    1 
ATOM   9159  O  OE1   . GLN F 3 463 ? 139.569 -14.190 9.011   1.00 23.47  ? 759 GLN D OE1   1 
ATOM   9160  N  NE2   . GLN F 3 463 ? 141.525 -15.103 9.604   1.00 23.39  ? 759 GLN D NE2   1 
ATOM   9161  N  N     . LYS F 3 464 ? 140.958 -15.181 5.619   1.00 18.13  ? 760 LYS D N     1 
ATOM   9162  C  CA    . LYS F 3 464 ? 140.980 -16.648 5.592   1.00 17.24  ? 760 LYS D CA    1 
ATOM   9163  C  C     . LYS F 3 464 ? 141.658 -17.167 4.342   1.00 16.71  ? 760 LYS D C     1 
ATOM   9164  O  O     . LYS F 3 464 ? 142.442 -18.104 4.411   1.00 16.80  ? 760 LYS D O     1 
ATOM   9165  C  CB    . LYS F 3 464 ? 139.570 -17.221 5.595   1.00 17.47  ? 760 LYS D CB    1 
ATOM   9166  C  CG    . LYS F 3 464 ? 138.780 -17.061 6.859   1.00 18.21  ? 760 LYS D CG    1 
ATOM   9167  C  CD    . LYS F 3 464 ? 137.448 -17.804 6.702   1.00 18.80  ? 760 LYS D CD    1 
ATOM   9168  C  CE    . LYS F 3 464 ? 136.503 -17.496 7.840   1.00 17.92  ? 760 LYS D CE    1 
ATOM   9169  N  NZ    . LYS F 3 464 ? 137.233 -17.762 9.094   1.00 18.19  ? 760 LYS D NZ    1 
ATOM   9170  N  N     . GLY F 3 465 ? 141.334 -16.573 3.195   1.00 16.07  ? 761 GLY D N     1 
ATOM   9171  C  CA    . GLY F 3 465 ? 141.869 -17.025 1.910   1.00 15.25  ? 761 GLY D CA    1 
ATOM   9172  C  C     . GLY F 3 465 ? 140.832 -17.712 1.037   1.00 14.73  ? 761 GLY D C     1 
ATOM   9173  O  O     . GLY F 3 465 ? 141.107 -18.060 -0.122  1.00 14.91  ? 761 GLY D O     1 
ATOM   9174  N  N     . TYR F 3 466 ? 139.634 -17.903 1.585   1.00 13.87  ? 762 TYR D N     1 
ATOM   9175  C  CA    . TYR F 3 466 ? 138.557 -18.577 0.872   1.00 13.33  ? 762 TYR D CA    1 
ATOM   9176  C  C     . TYR F 3 466 ? 137.209 -18.077 1.385   1.00 12.97  ? 762 TYR D C     1 
ATOM   9177  O  O     . TYR F 3 466 ? 137.136 -17.528 2.466   1.00 12.71  ? 762 TYR D O     1 
ATOM   9178  C  CB    . TYR F 3 466 ? 138.656 -20.102 1.061   1.00 13.23  ? 762 TYR D CB    1 
ATOM   9179  C  CG    . TYR F 3 466 ? 138.485 -20.535 2.507   1.00 13.22  ? 762 TYR D CG    1 
ATOM   9180  C  CD1   . TYR F 3 466 ? 137.217 -20.757 3.050   1.00 13.07  ? 762 TYR D CD1   1 
ATOM   9181  C  CD2   . TYR F 3 466 ? 139.589 -20.701 3.341   1.00 11.80  ? 762 TYR D CD2   1 
ATOM   9182  C  CE1   . TYR F 3 466 ? 137.067 -21.139 4.392   1.00 12.85  ? 762 TYR D CE1   1 
ATOM   9183  C  CE2   . TYR F 3 466 ? 139.443 -21.082 4.671   1.00 11.65  ? 762 TYR D CE2   1 
ATOM   9184  C  CZ    . TYR F 3 466 ? 138.186 -21.298 5.184   1.00 12.37  ? 762 TYR D CZ    1 
ATOM   9185  O  OH    . TYR F 3 466 ? 138.047 -21.661 6.497   1.00 13.90  ? 762 TYR D OH    1 
ATOM   9186  N  N     . VAL F 3 467 ? 136.153 -18.275 0.599   1.00 12.84  ? 763 VAL D N     1 
ATOM   9187  C  CA    . VAL F 3 467 ? 134.787 -17.943 0.993   1.00 12.32  ? 763 VAL D CA    1 
ATOM   9188  C  C     . VAL F 3 467 ? 134.021 -19.245 1.053   1.00 12.96  ? 763 VAL D C     1 
ATOM   9189  O  O     . VAL F 3 467 ? 134.364 -20.204 0.358   1.00 13.22  ? 763 VAL D O     1 
ATOM   9190  C  CB    . VAL F 3 467 ? 134.101 -17.005 -0.018  1.00 12.29  ? 763 VAL D CB    1 
ATOM   9191  C  CG1   . VAL F 3 467 ? 134.637 -15.595 0.111   1.00 10.79  ? 763 VAL D CG1   1 
ATOM   9192  C  CG2   . VAL F 3 467 ? 134.285 -17.513 -1.440  1.00 11.30  ? 763 VAL D CG2   1 
ATOM   9193  N  N     . THR F 3 468 ? 132.992 -19.307 1.894   1.00 13.63  ? 764 THR D N     1 
ATOM   9194  C  CA    . THR F 3 468 ? 132.238 -20.544 2.034   1.00 13.57  ? 764 THR D CA    1 
ATOM   9195  C  C     . THR F 3 468 ? 130.768 -20.336 1.740   1.00 13.71  ? 764 THR D C     1 
ATOM   9196  O  O     . THR F 3 468 ? 130.296 -19.212 1.676   1.00 13.67  ? 764 THR D O     1 
ATOM   9197  C  CB    . THR F 3 468 ? 132.324 -21.099 3.439   1.00 13.62  ? 764 THR D CB    1 
ATOM   9198  O  OG1   . THR F 3 468 ? 131.415 -20.378 4.261   1.00 14.43  ? 764 THR D OG1   1 
ATOM   9199  C  CG2   . THR F 3 468 ? 133.727 -20.978 4.006   1.00 13.07  ? 764 THR D CG2   1 
ATOM   9200  N  N     . THR F 3 469 ? 130.054 -21.447 1.572   1.00 14.11  ? 765 THR D N     1 
ATOM   9201  C  CA    . THR F 3 469 ? 128.637 -21.450 1.282   1.00 13.79  ? 765 THR D CA    1 
ATOM   9202  C  C     . THR F 3 469 ? 127.908 -21.979 2.503   1.00 14.64  ? 765 THR D C     1 
ATOM   9203  O  O     . THR F 3 469 ? 128.534 -22.440 3.471   1.00 14.52  ? 765 THR D O     1 
ATOM   9204  C  CB    . THR F 3 469 ? 128.317 -22.418 0.153   1.00 13.81  ? 765 THR D CB    1 
ATOM   9205  O  OG1   . THR F 3 469 ? 128.651 -23.743 0.578   1.00 12.84  ? 765 THR D OG1   1 
ATOM   9206  C  CG2   . THR F 3 469 ? 129.088 -22.078 -1.100  1.00 13.26  ? 765 THR D CG2   1 
ATOM   9207  N  N     . LEU F 3 470 ? 126.579 -21.934 2.431   1.00 15.21  ? 766 LEU D N     1 
ATOM   9208  C  CA    . LEU F 3 470 ? 125.704 -22.371 3.503   1.00 15.77  ? 766 LEU D CA    1 
ATOM   9209  C  C     . LEU F 3 470 ? 125.969 -23.807 3.987   1.00 15.95  ? 766 LEU D C     1 
ATOM   9210  O  O     . LEU F 3 470 ? 126.018 -24.045 5.196   1.00 16.67  ? 766 LEU D O     1 
ATOM   9211  C  CB    . LEU F 3 470 ? 124.248 -22.174 3.083   1.00 15.88  ? 766 LEU D CB    1 
ATOM   9212  C  CG    . LEU F 3 470 ? 123.136 -22.606 4.039   1.00 16.45  ? 766 LEU D CG    1 
ATOM   9213  C  CD1   . LEU F 3 470 ? 123.062 -21.705 5.258   1.00 16.92  ? 766 LEU D CD1   1 
ATOM   9214  C  CD2   . LEU F 3 470 ? 121.805 -22.631 3.304   1.00 16.14  ? 766 LEU D CD2   1 
ATOM   9215  N  N     . LEU F 3 471 ? 126.147 -24.764 3.075   1.00 15.70  ? 767 LEU D N     1 
ATOM   9216  C  CA    . LEU F 3 471 ? 126.488 -26.135 3.505   1.00 15.33  ? 767 LEU D CA    1 
ATOM   9217  C  C     . LEU F 3 471 ? 128.004 -26.409 3.525   1.00 14.86  ? 767 LEU D C     1 
ATOM   9218  O  O     . LEU F 3 471 ? 128.441 -27.565 3.497   1.00 14.74  ? 767 LEU D O     1 
ATOM   9219  C  CB    . LEU F 3 471 ? 125.746 -27.200 2.691   1.00 15.43  ? 767 LEU D CB    1 
ATOM   9220  C  CG    . LEU F 3 471 ? 124.228 -27.278 2.907   1.00 16.74  ? 767 LEU D CG    1 
ATOM   9221  C  CD1   . LEU F 3 471 ? 123.594 -28.288 1.965   1.00 17.39  ? 767 LEU D CD1   1 
ATOM   9222  C  CD2   . LEU F 3 471 ? 123.898 -27.632 4.351   1.00 18.06  ? 767 LEU D CD2   1 
ATOM   9223  N  N     . HIS F 3 472 ? 128.788 -25.332 3.548   1.00 13.87  ? 768 HIS D N     1 
ATOM   9224  C  CA    . HIS F 3 472 ? 130.246 -25.392 3.732   1.00 13.12  ? 768 HIS D CA    1 
ATOM   9225  C  C     . HIS F 3 472 ? 131.137 -25.687 2.524   1.00 12.01  ? 768 HIS D C     1 
ATOM   9226  O  O     . HIS F 3 472 ? 132.316 -25.997 2.681   1.00 11.87  ? 768 HIS D O     1 
ATOM   9227  C  CB    . HIS F 3 472 ? 130.598 -26.303 4.902   1.00 13.14  ? 768 HIS D CB    1 
ATOM   9228  C  CG    . HIS F 3 472 ? 129.938 -25.903 6.181   1.00 15.04  ? 768 HIS D CG    1 
ATOM   9229  N  ND1   . HIS F 3 472 ? 128.736 -26.439 6.600   1.00 17.69  ? 768 HIS D ND1   1 
ATOM   9230  C  CD2   . HIS F 3 472 ? 130.299 -25.005 7.129   1.00 16.72  ? 768 HIS D CD2   1 
ATOM   9231  C  CE1   . HIS F 3 472 ? 128.394 -25.905 7.760   1.00 17.02  ? 768 HIS D CE1   1 
ATOM   9232  N  NE2   . HIS F 3 472 ? 129.323 -25.028 8.102   1.00 17.60  ? 768 HIS D NE2   1 
ATOM   9233  N  N     . ARG F 3 473 ? 130.584 -25.581 1.325   1.00 10.83  ? 769 ARG D N     1 
ATOM   9234  C  CA    . ARG F 3 473 ? 131.384 -25.698 0.122   1.00 10.00  ? 769 ARG D CA    1 
ATOM   9235  C  C     . ARG F 3 473 ? 132.387 -24.553 0.219   1.00 10.16  ? 769 ARG D C     1 
ATOM   9236  O  O     . ARG F 3 473 ? 132.104 -23.551 0.862   1.00 10.78  ? 769 ARG D O     1 
ATOM   9237  C  CB    . ARG F 3 473 ? 130.466 -25.526 -1.085  1.00 9.53   ? 769 ARG D CB    1 
ATOM   9238  C  CG    . ARG F 3 473 ? 131.050 -25.861 -2.407  1.00 7.72   ? 769 ARG D CG    1 
ATOM   9239  C  CD    . ARG F 3 473 ? 130.032 -25.675 -3.514  1.00 6.59   ? 769 ARG D CD    1 
ATOM   9240  N  NE    . ARG F 3 473 ? 128.782 -26.381 -3.257  1.00 7.73   ? 769 ARG D NE    1 
ATOM   9241  C  CZ    . ARG F 3 473 ? 128.564 -27.678 -3.482  1.00 8.62   ? 769 ARG D CZ    1 
ATOM   9242  N  NH1   . ARG F 3 473 ? 129.512 -28.472 -3.981  1.00 7.37   ? 769 ARG D NH1   1 
ATOM   9243  N  NH2   . ARG F 3 473 ? 127.378 -28.189 -3.202  1.00 9.29   ? 769 ARG D NH2   1 
ATOM   9244  N  N     . ARG F 3 474 ? 133.571 -24.682 -0.358  1.00 10.28  ? 770 ARG D N     1 
ATOM   9245  C  CA    . ARG F 3 474 ? 134.503 -23.552 -0.289  1.00 10.62  ? 770 ARG D CA    1 
ATOM   9246  C  C     . ARG F 3 474 ? 135.245 -23.250 -1.584  1.00 10.64  ? 770 ARG D C     1 
ATOM   9247  O  O     . ARG F 3 474 ? 135.334 -24.087 -2.470  1.00 10.09  ? 770 ARG D O     1 
ATOM   9248  C  CB    . ARG F 3 474 ? 135.488 -23.691 0.876   1.00 10.64  ? 770 ARG D CB    1 
ATOM   9249  C  CG    . ARG F 3 474 ? 136.554 -24.705 0.682   1.00 10.95  ? 770 ARG D CG    1 
ATOM   9250  C  CD    . ARG F 3 474 ? 137.682 -24.508 1.691   1.00 12.86  ? 770 ARG D CD    1 
ATOM   9251  N  NE    . ARG F 3 474 ? 137.294 -24.629 3.101   1.00 12.15  ? 770 ARG D NE    1 
ATOM   9252  C  CZ    . ARG F 3 474 ? 138.167 -24.565 4.109   1.00 11.87  ? 770 ARG D CZ    1 
ATOM   9253  N  NH1   . ARG F 3 474 ? 139.459 -24.403 3.855   1.00 11.13  ? 770 ARG D NH1   1 
ATOM   9254  N  NH2   . ARG F 3 474 ? 137.763 -24.662 5.363   1.00 10.48  ? 770 ARG D NH2   1 
ATOM   9255  N  N     . ARG F 3 475 ? 135.763 -22.032 -1.688  1.00 11.13  ? 771 ARG D N     1 
ATOM   9256  C  CA    . ARG F 3 475 ? 136.498 -21.637 -2.878  1.00 12.12  ? 771 ARG D CA    1 
ATOM   9257  C  C     . ARG F 3 475 ? 137.682 -20.793 -2.460  1.00 12.80  ? 771 ARG D C     1 
ATOM   9258  O  O     . ARG F 3 475 ? 137.509 -19.764 -1.816  1.00 13.21  ? 771 ARG D O     1 
ATOM   9259  C  CB    . ARG F 3 475 ? 135.599 -20.834 -3.828  1.00 11.91  ? 771 ARG D CB    1 
ATOM   9260  C  CG    . ARG F 3 475 ? 136.237 -20.542 -5.172  1.00 12.14  ? 771 ARG D CG    1 
ATOM   9261  C  CD    . ARG F 3 475 ? 135.298 -19.735 -6.052  1.00 13.73  ? 771 ARG D CD    1 
ATOM   9262  N  NE    . ARG F 3 475 ? 135.809 -19.571 -7.408  1.00 13.43  ? 771 ARG D NE    1 
ATOM   9263  C  CZ    . ARG F 3 475 ? 135.218 -18.847 -8.353  1.00 15.77  ? 771 ARG D CZ    1 
ATOM   9264  N  NH1   . ARG F 3 475 ? 134.075 -18.209 -8.117  1.00 15.49  ? 771 ARG D NH1   1 
ATOM   9265  N  NH2   . ARG F 3 475 ? 135.773 -18.761 -9.552  1.00 18.15  ? 771 ARG D NH2   1 
ATOM   9266  N  N     . TYR F 3 476 ? 138.883 -21.231 -2.818  1.00 13.39  ? 772 TYR D N     1 
ATOM   9267  C  CA    . TYR F 3 476 ? 140.074 -20.474 -2.480  1.00 14.26  ? 772 TYR D CA    1 
ATOM   9268  C  C     . TYR F 3 476 ? 140.211 -19.287 -3.416  1.00 15.18  ? 772 TYR D C     1 
ATOM   9269  O  O     . TYR F 3 476 ? 139.874 -19.376 -4.593  1.00 15.42  ? 772 TYR D O     1 
ATOM   9270  C  CB    . TYR F 3 476 ? 141.321 -21.365 -2.478  1.00 13.54  ? 772 TYR D CB    1 
ATOM   9271  C  CG    . TYR F 3 476 ? 141.271 -22.370 -1.359  1.00 13.17  ? 772 TYR D CG    1 
ATOM   9272  C  CD1   . TYR F 3 476 ? 140.684 -23.617 -1.542  1.00 13.40  ? 772 TYR D CD1   1 
ATOM   9273  C  CD2   . TYR F 3 476 ? 141.762 -22.057 -0.103  1.00 12.35  ? 772 TYR D CD2   1 
ATOM   9274  C  CE1   . TYR F 3 476 ? 140.606 -24.529 -0.504  1.00 13.52  ? 772 TYR D CE1   1 
ATOM   9275  C  CE2   . TYR F 3 476 ? 141.697 -22.960 0.943   1.00 12.30  ? 772 TYR D CE2   1 
ATOM   9276  C  CZ    . TYR F 3 476 ? 141.119 -24.197 0.742   1.00 13.41  ? 772 TYR D CZ    1 
ATOM   9277  O  OH    . TYR F 3 476 ? 141.049 -25.104 1.784   1.00 12.83  ? 772 TYR D OH    1 
ATOM   9278  N  N     . LEU F 3 477 ? 140.674 -18.159 -2.886  1.00 16.23  ? 773 LEU D N     1 
ATOM   9279  C  CA    . LEU F 3 477 ? 140.851 -16.978 -3.719  1.00 17.08  ? 773 LEU D CA    1 
ATOM   9280  C  C     . LEU F 3 477 ? 142.230 -16.358 -3.496  1.00 18.26  ? 773 LEU D C     1 
ATOM   9281  O  O     . LEU F 3 477 ? 142.329 -15.268 -2.920  1.00 18.58  ? 773 LEU D O     1 
ATOM   9282  C  CB    . LEU F 3 477 ? 139.737 -15.952 -3.448  1.00 16.72  ? 773 LEU D CB    1 
ATOM   9283  C  CG    . LEU F 3 477 ? 138.279 -16.335 -3.760  1.00 15.96  ? 773 LEU D CG    1 
ATOM   9284  C  CD1   . LEU F 3 477 ? 137.293 -15.332 -3.192  1.00 14.26  ? 773 LEU D CD1   1 
ATOM   9285  C  CD2   . LEU F 3 477 ? 138.060 -16.517 -5.251  1.00 15.30  ? 773 LEU D CD2   1 
ATOM   9286  N  N     . PRO F 3 478 ? 143.301 -17.041 -3.953  1.00 19.14  ? 774 PRO D N     1 
ATOM   9287  C  CA    . PRO F 3 478 ? 144.646 -16.503 -3.758  1.00 20.19  ? 774 PRO D CA    1 
ATOM   9288  C  C     . PRO F 3 478 ? 144.809 -15.104 -4.361  1.00 21.50  ? 774 PRO D C     1 
ATOM   9289  O  O     . PRO F 3 478 ? 145.514 -14.271 -3.794  1.00 21.62  ? 774 PRO D O     1 
ATOM   9290  C  CB    . PRO F 3 478 ? 145.551 -17.502 -4.507  1.00 19.84  ? 774 PRO D CB    1 
ATOM   9291  C  CG    . PRO F 3 478 ? 144.657 -18.279 -5.394  1.00 19.48  ? 774 PRO D CG    1 
ATOM   9292  C  CD    . PRO F 3 478 ? 143.329 -18.322 -4.683  1.00 19.23  ? 774 PRO D CD    1 
ATOM   9293  N  N     . ASP F 3 479 ? 144.140 -14.850 -5.485  1.00 22.90  ? 775 ASP D N     1 
ATOM   9294  C  CA    . ASP F 3 479 ? 144.277 -13.577 -6.191  1.00 24.53  ? 775 ASP D CA    1 
ATOM   9295  C  C     . ASP F 3 479 ? 143.680 -12.384 -5.464  1.00 25.32  ? 775 ASP D C     1 
ATOM   9296  O  O     . ASP F 3 479 ? 143.868 -11.247 -5.894  1.00 25.32  ? 775 ASP D O     1 
ATOM   9297  C  CB    . ASP F 3 479 ? 143.677 -13.667 -7.600  1.00 24.52  ? 775 ASP D CB    1 
ATOM   9298  C  CG    . ASP F 3 479 ? 144.435 -14.636 -8.497  1.00 26.46  ? 775 ASP D CG    1 
ATOM   9299  O  OD1   . ASP F 3 479 ? 144.021 -14.798 -9.663  1.00 27.23  ? 775 ASP D OD1   1 
ATOM   9300  O  OD2   . ASP F 3 479 ? 145.439 -15.245 -8.043  1.00 27.79  ? 775 ASP D OD2   1 
ATOM   9301  N  N     . ILE F 3 480 ? 142.960 -12.616 -4.371  1.00 26.53  ? 776 ILE D N     1 
ATOM   9302  C  CA    . ILE F 3 480 ? 142.345 -11.489 -3.689  1.00 27.98  ? 776 ILE D CA    1 
ATOM   9303  C  C     . ILE F 3 480 ? 143.377 -10.590 -2.995  1.00 29.39  ? 776 ILE D C     1 
ATOM   9304  O  O     . ILE F 3 480 ? 143.050 -9.487  -2.560  1.00 29.59  ? 776 ILE D O     1 
ATOM   9305  C  CB    . ILE F 3 480 ? 141.208 -11.900 -2.725  1.00 27.93  ? 776 ILE D CB    1 
ATOM   9306  C  CG1   . ILE F 3 480 ? 140.343 -10.665 -2.423  1.00 27.24  ? 776 ILE D CG1   1 
ATOM   9307  C  CG2   . ILE F 3 480 ? 141.778 -12.580 -1.454  1.00 27.22  ? 776 ILE D CG2   1 
ATOM   9308  C  CD1   . ILE F 3 480 ? 138.991 -10.942 -1.863  1.00 26.51  ? 776 ILE D CD1   1 
ATOM   9309  N  N     . THR F 3 481 ? 144.621 -11.057 -2.903  1.00 31.00  ? 777 THR D N     1 
ATOM   9310  C  CA    . THR F 3 481 ? 145.684 -10.250 -2.305  1.00 32.51  ? 777 THR D CA    1 
ATOM   9311  C  C     . THR F 3 481 ? 146.621 -9.656  -3.342  1.00 33.74  ? 777 THR D C     1 
ATOM   9312  O  O     . THR F 3 481 ? 147.462 -8.818  -3.002  1.00 34.41  ? 777 THR D O     1 
ATOM   9313  C  CB    . THR F 3 481 ? 146.510 -11.025 -1.276  1.00 32.29  ? 777 THR D CB    1 
ATOM   9314  O  OG1   . THR F 3 481 ? 146.878 -12.302 -1.818  1.00 32.54  ? 777 THR D OG1   1 
ATOM   9315  C  CG2   . THR F 3 481 ? 145.709 -11.208 0.001   1.00 32.00  ? 777 THR D CG2   1 
ATOM   9316  N  N     . SER F 3 482 ? 146.472 -10.077 -4.597  1.00 35.00  ? 778 SER D N     1 
ATOM   9317  C  CA    . SER F 3 482 ? 147.306 -9.567  -5.683  1.00 36.14  ? 778 SER D CA    1 
ATOM   9318  C  C     . SER F 3 482 ? 147.477 -8.051  -5.632  1.00 37.19  ? 778 SER D C     1 
ATOM   9319  O  O     . SER F 3 482 ? 146.519 -7.300  -5.368  1.00 37.46  ? 778 SER D O     1 
ATOM   9320  C  CB    . SER F 3 482 ? 146.737 -9.961  -7.043  1.00 36.06  ? 778 SER D CB    1 
ATOM   9321  O  OG    . SER F 3 482 ? 147.522 -9.427  -8.097  1.00 36.32  ? 778 SER D OG    1 
ATOM   9322  N  N     . ARG F 3 483 ? 148.715 -7.622  -5.877  1.00 37.99  ? 779 ARG D N     1 
ATOM   9323  C  CA    . ARG F 3 483 ? 149.079 -6.217  -5.920  1.00 38.68  ? 779 ARG D CA    1 
ATOM   9324  C  C     . ARG F 3 483 ? 148.423 -5.543  -7.118  1.00 38.62  ? 779 ARG D C     1 
ATOM   9325  O  O     . ARG F 3 483 ? 148.274 -4.320  -7.164  1.00 38.69  ? 779 ARG D O     1 
ATOM   9326  C  CB    . ARG F 3 483 ? 150.591 -6.091  -6.075  1.00 39.10  ? 779 ARG D CB    1 
ATOM   9327  C  CG    . ARG F 3 483 ? 151.431 -6.484  -4.865  1.00 41.15  ? 779 ARG D CG    1 
ATOM   9328  C  CD    . ARG F 3 483 ? 152.899 -6.300  -5.241  1.00 43.73  ? 779 ARG D CD    1 
ATOM   9329  N  NE    . ARG F 3 483 ? 153.733 -5.824  -4.139  1.00 45.19  ? 779 ARG D NE    1 
ATOM   9330  C  CZ    . ARG F 3 483 ? 154.894 -5.186  -4.305  1.00 46.03  ? 779 ARG D CZ    1 
ATOM   9331  N  NH1   . ARG F 3 483 ? 155.351 -4.936  -5.528  1.00 45.77  ? 779 ARG D NH1   1 
ATOM   9332  N  NH2   . ARG F 3 483 ? 155.597 -4.783  -3.249  1.00 46.43  ? 779 ARG D NH2   1 
ATOM   9333  N  N     . ASN F 3 484 ? 148.058 -6.356  -8.101  1.00 38.70  ? 780 ASN D N     1 
ATOM   9334  C  CA    . ASN F 3 484 ? 147.461 -5.869  -9.335  1.00 38.78  ? 780 ASN D CA    1 
ATOM   9335  C  C     . ASN F 3 484 ? 145.986 -5.537  -9.155  1.00 38.54  ? 780 ASN D C     1 
ATOM   9336  O  O     . ASN F 3 484 ? 145.246 -6.311  -8.557  1.00 38.80  ? 780 ASN D O     1 
ATOM   9337  C  CB    . ASN F 3 484 ? 147.673 -6.903  -10.442 1.00 38.88  ? 780 ASN D CB    1 
ATOM   9338  C  CG    . ASN F 3 484 ? 146.944 -6.555  -11.713 1.00 40.08  ? 780 ASN D CG    1 
ATOM   9339  O  OD1   . ASN F 3 484 ? 145.726 -6.412  -11.714 1.00 42.30  ? 780 ASN D OD1   1 
ATOM   9340  N  ND2   . ASN F 3 484 ? 147.679 -6.446  -12.814 1.00 40.44  ? 780 ASN D ND2   1 
ATOM   9341  N  N     . PHE F 3 485 ? 145.564 -4.387  -9.673  1.00 38.27  ? 781 PHE D N     1 
ATOM   9342  C  CA    . PHE F 3 485 ? 144.178 -3.940  -9.527  1.00 37.91  ? 781 PHE D CA    1 
ATOM   9343  C  C     . PHE F 3 485 ? 143.182 -4.743  -10.371 1.00 37.44  ? 781 PHE D C     1 
ATOM   9344  O  O     . PHE F 3 485 ? 142.057 -5.000  -9.945  1.00 37.52  ? 781 PHE D O     1 
ATOM   9345  C  CB    . PHE F 3 485 ? 144.043 -2.437  -9.827  1.00 38.00  ? 781 PHE D CB    1 
ATOM   9346  C  CG    . PHE F 3 485 ? 142.661 -1.889  -9.561  1.00 38.08  ? 781 PHE D CG    1 
ATOM   9347  C  CD1   . PHE F 3 485 ? 142.261 -1.579  -8.263  1.00 38.05  ? 781 PHE D CD1   1 
ATOM   9348  C  CD2   . PHE F 3 485 ? 141.757 -1.699  -10.604 1.00 37.88  ? 781 PHE D CD2   1 
ATOM   9349  C  CE1   . PHE F 3 485 ? 140.985 -1.088  -8.003  1.00 38.30  ? 781 PHE D CE1   1 
ATOM   9350  C  CE2   . PHE F 3 485 ? 140.484 -1.208  -10.355 1.00 38.31  ? 781 PHE D CE2   1 
ATOM   9351  C  CZ    . PHE F 3 485 ? 140.098 -0.898  -9.047  1.00 38.23  ? 781 PHE D CZ    1 
ATOM   9352  N  N     . ASN F 3 486 ? 143.587 -5.123  -11.572 1.00 36.93  ? 782 ASN D N     1 
ATOM   9353  C  CA    . ASN F 3 486 ? 142.711 -5.893  -12.449 1.00 36.45  ? 782 ASN D CA    1 
ATOM   9354  C  C     . ASN F 3 486 ? 142.467 -7.299  -11.898 1.00 35.55  ? 782 ASN D C     1 
ATOM   9355  O  O     . ASN F 3 486 ? 141.359 -7.813  -11.961 1.00 35.40  ? 782 ASN D O     1 
ATOM   9356  C  CB    . ASN F 3 486 ? 143.312 -5.986  -13.855 1.00 36.76  ? 782 ASN D CB    1 
ATOM   9357  C  CG    . ASN F 3 486 ? 142.295 -6.421  -14.896 1.00 37.89  ? 782 ASN D CG    1 
ATOM   9358  O  OD1   . ASN F 3 486 ? 141.348 -5.691  -15.195 1.00 38.19  ? 782 ASN D OD1   1 
ATOM   9359  N  ND2   . ASN F 3 486 ? 142.497 -7.608  -15.468 1.00 38.77  ? 782 ASN D ND2   1 
ATOM   9360  N  N     . VAL F 3 487 ? 143.512 -7.906  -11.345 1.00 34.52  ? 783 VAL D N     1 
ATOM   9361  C  CA    . VAL F 3 487 ? 143.433 -9.271  -10.837 1.00 33.24  ? 783 VAL D CA    1 
ATOM   9362  C  C     . VAL F 3 487 ? 142.702 -9.294  -9.503  1.00 32.56  ? 783 VAL D C     1 
ATOM   9363  O  O     . VAL F 3 487 ? 141.943 -10.220 -9.211  1.00 32.00  ? 783 VAL D O     1 
ATOM   9364  C  CB    . VAL F 3 487 ? 144.847 -9.923  -10.732 1.00 33.26  ? 783 VAL D CB    1 
ATOM   9365  C  CG1   . VAL F 3 487 ? 144.807 -11.243 -9.988  1.00 32.59  ? 783 VAL D CG1   1 
ATOM   9366  C  CG2   . VAL F 3 487 ? 145.438 -10.128 -12.122 1.00 32.76  ? 783 VAL D CG2   1 
ATOM   9367  N  N     . ARG F 3 488 ? 142.901 -8.250  -8.710  1.00 31.76  ? 784 ARG D N     1 
ATOM   9368  C  CA    . ARG F 3 488 ? 142.282 -8.204  -7.405  1.00 31.31  ? 784 ARG D CA    1 
ATOM   9369  C  C     . ARG F 3 488 ? 140.786 -7.970  -7.530  1.00 30.18  ? 784 ARG D C     1 
ATOM   9370  O  O     . ARG F 3 488 ? 140.010 -8.486  -6.738  1.00 29.95  ? 784 ARG D O     1 
ATOM   9371  C  CB    . ARG F 3 488 ? 142.919 -7.129  -6.535  1.00 31.43  ? 784 ARG D CB    1 
ATOM   9372  C  CG    . ARG F 3 488 ? 142.710 -7.364  -5.035  1.00 32.82  ? 784 ARG D CG    1 
ATOM   9373  C  CD    . ARG F 3 488 ? 143.350 -6.288  -4.178  1.00 32.73  ? 784 ARG D CD    1 
ATOM   9374  N  NE    . ARG F 3 488 ? 142.656 -5.017  -4.338  1.00 36.31  ? 784 ARG D NE    1 
ATOM   9375  C  CZ    . ARG F 3 488 ? 143.088 -4.013  -5.094  1.00 37.82  ? 784 ARG D CZ    1 
ATOM   9376  N  NH1   . ARG F 3 488 ? 144.240 -4.119  -5.760  1.00 37.90  ? 784 ARG D NH1   1 
ATOM   9377  N  NH2   . ARG F 3 488 ? 142.364 -2.899  -5.176  1.00 38.90  ? 784 ARG D NH2   1 
ATOM   9378  N  N     . SER F 3 489 ? 140.386 -7.204  -8.540  1.00 29.18  ? 785 SER D N     1 
ATOM   9379  C  CA    . SER F 3 489 ? 138.968 -6.923  -8.773  1.00 28.12  ? 785 SER D CA    1 
ATOM   9380  C  C     . SER F 3 489 ? 138.162 -8.156  -9.166  1.00 27.08  ? 785 SER D C     1 
ATOM   9381  O  O     . SER F 3 489 ? 136.983 -8.265  -8.840  1.00 26.96  ? 785 SER D O     1 
ATOM   9382  C  CB    . SER F 3 489 ? 138.796 -5.837  -9.828  1.00 28.02  ? 785 SER D CB    1 
ATOM   9383  O  OG    . SER F 3 489 ? 139.075 -4.568  -9.264  1.00 29.73  ? 785 SER D OG    1 
ATOM   9384  N  N     . PHE F 3 490 ? 138.786 -9.080  -9.878  1.00 25.95  ? 786 PHE D N     1 
ATOM   9385  C  CA    . PHE F 3 490 ? 138.074 -10.273 -10.261 1.00 25.05  ? 786 PHE D CA    1 
ATOM   9386  C  C     . PHE F 3 490 ? 137.869 -11.140 -9.056  1.00 24.14  ? 786 PHE D C     1 
ATOM   9387  O  O     . PHE F 3 490 ? 136.789 -11.668 -8.849  1.00 24.28  ? 786 PHE D O     1 
ATOM   9388  C  CB    . PHE F 3 490 ? 138.790 -11.027 -11.375 1.00 25.14  ? 786 PHE D CB    1 
ATOM   9389  C  CG    . PHE F 3 490 ? 138.442 -10.526 -12.728 1.00 25.80  ? 786 PHE D CG    1 
ATOM   9390  C  CD1   . PHE F 3 490 ? 137.325 -11.019 -13.391 1.00 26.76  ? 786 PHE D CD1   1 
ATOM   9391  C  CD2   . PHE F 3 490 ? 139.194 -9.526  -13.329 1.00 25.57  ? 786 PHE D CD2   1 
ATOM   9392  C  CE1   . PHE F 3 490 ? 136.983 -10.538 -14.650 1.00 26.21  ? 786 PHE D CE1   1 
ATOM   9393  C  CE2   . PHE F 3 490 ? 138.862 -9.047  -14.578 1.00 25.60  ? 786 PHE D CE2   1 
ATOM   9394  C  CZ    . PHE F 3 490 ? 137.755 -9.552  -15.240 1.00 25.65  ? 786 PHE D CZ    1 
ATOM   9395  N  N     . ALA F 3 491 ? 138.912 -11.262 -8.250  1.00 23.22  ? 787 ALA D N     1 
ATOM   9396  C  CA    . ALA F 3 491 ? 138.865 -12.089 -7.066  1.00 21.93  ? 787 ALA D CA    1 
ATOM   9397  C  C     . ALA F 3 491 ? 137.763 -11.605 -6.140  1.00 21.39  ? 787 ALA D C     1 
ATOM   9398  O  O     . ALA F 3 491 ? 136.991 -12.406 -5.612  1.00 21.25  ? 787 ALA D O     1 
ATOM   9399  C  CB    . ALA F 3 491 ? 140.196 -12.062 -6.368  1.00 21.78  ? 787 ALA D CB    1 
ATOM   9400  N  N     . GLU F 3 492 ? 137.680 -10.289 -5.968  1.00 20.41  ? 788 GLU D N     1 
ATOM   9401  C  CA    . GLU F 3 492 ? 136.712 -9.693  -5.064  1.00 19.92  ? 788 GLU D CA    1 
ATOM   9402  C  C     . GLU F 3 492 ? 135.287 -9.971  -5.508  1.00 18.86  ? 788 GLU D C     1 
ATOM   9403  O  O     . GLU F 3 492 ? 134.413 -10.256 -4.690  1.00 18.52  ? 788 GLU D O     1 
ATOM   9404  C  CB    . GLU F 3 492 ? 136.955 -8.187  -4.927  1.00 19.86  ? 788 GLU D CB    1 
ATOM   9405  C  CG    . GLU F 3 492 ? 138.257 -7.855  -4.209  1.00 20.57  ? 788 GLU D CG    1 
ATOM   9406  C  CD    . GLU F 3 492 ? 138.446 -6.363  -3.944  1.00 21.42  ? 788 GLU D CD    1 
ATOM   9407  O  OE1   . GLU F 3 492 ? 137.667 -5.551  -4.500  1.00 22.79  ? 788 GLU D OE1   1 
ATOM   9408  O  OE2   . GLU F 3 492 ? 139.378 -6.008  -3.169  1.00 23.84  ? 788 GLU D OE2   1 
ATOM   9409  N  N     . ARG F 3 493 ? 135.063 -9.899  -6.811  1.00 18.12  ? 789 ARG D N     1 
ATOM   9410  C  CA    . ARG F 3 493 ? 133.739 -10.124 -7.355  1.00 17.55  ? 789 ARG D CA    1 
ATOM   9411  C  C     . ARG F 3 493 ? 133.360 -11.597 -7.230  1.00 17.15  ? 789 ARG D C     1 
ATOM   9412  O  O     . ARG F 3 493 ? 132.187 -11.933 -7.097  1.00 17.22  ? 789 ARG D O     1 
ATOM   9413  C  CB    . ARG F 3 493 ? 133.622 -9.579  -8.786  1.00 17.41  ? 789 ARG D CB    1 
ATOM   9414  C  CG    . ARG F 3 493 ? 133.632 -8.054  -8.846  1.00 17.02  ? 789 ARG D CG    1 
ATOM   9415  C  CD    . ARG F 3 493 ? 133.205 -7.502  -10.205 1.00 17.70  ? 789 ARG D CD    1 
ATOM   9416  N  NE    . ARG F 3 493 ? 134.093 -7.982  -11.265 1.00 18.38  ? 789 ARG D NE    1 
ATOM   9417  C  CZ    . ARG F 3 493 ? 135.199 -7.362  -11.647 1.00 17.06  ? 789 ARG D CZ    1 
ATOM   9418  N  NH1   . ARG F 3 493 ? 135.541 -6.213  -11.078 1.00 17.57  ? 789 ARG D NH1   1 
ATOM   9419  N  NH2   . ARG F 3 493 ? 135.952 -7.886  -12.600 1.00 15.74  ? 789 ARG D NH2   1 
ATOM   9420  N  N     . MET F 3 494 ? 134.360 -12.468 -7.238  1.00 16.81  ? 790 MET D N     1 
ATOM   9421  C  CA    . MET F 3 494 ? 134.136 -13.881 -6.952  1.00 16.89  ? 790 MET D CA    1 
ATOM   9422  C  C     . MET F 3 494 ? 133.789 -14.080 -5.458  1.00 16.18  ? 790 MET D C     1 
ATOM   9423  O  O     . MET F 3 494 ? 133.056 -15.001 -5.106  1.00 16.23  ? 790 MET D O     1 
ATOM   9424  C  CB    . MET F 3 494 ? 135.361 -14.715 -7.331  1.00 16.90  ? 790 MET D CB    1 
ATOM   9425  C  CG    . MET F 3 494 ? 135.764 -14.647 -8.791  1.00 16.72  ? 790 MET D CG    1 
ATOM   9426  S  SD    . MET F 3 494 ? 137.130 -15.788 -9.081  1.00 18.48  ? 790 MET D SD    1 
ATOM   9427  C  CE    . MET F 3 494 ? 137.317 -15.686 -10.875 1.00 16.45  ? 790 MET D CE    1 
ATOM   9428  N  N     . ALA F 3 495 ? 134.303 -13.220 -4.584  1.00 15.52  ? 791 ALA D N     1 
ATOM   9429  C  CA    . ALA F 3 495 ? 133.954 -13.305 -3.161  1.00 15.41  ? 791 ALA D CA    1 
ATOM   9430  C  C     . ALA F 3 495 ? 132.499 -12.889 -2.909  1.00 15.35  ? 791 ALA D C     1 
ATOM   9431  O  O     . ALA F 3 495 ? 131.841 -13.406 -2.006  1.00 15.48  ? 791 ALA D O     1 
ATOM   9432  C  CB    . ALA F 3 495 ? 134.899 -12.474 -2.314  1.00 15.03  ? 791 ALA D CB    1 
ATOM   9433  N  N     . MET F 3 496 ? 131.993 -11.959 -3.710  1.00 15.13  ? 792 MET D N     1 
ATOM   9434  C  CA    . MET F 3 496 ? 130.603 -11.532 -3.572  1.00 15.20  ? 792 MET D CA    1 
ATOM   9435  C  C     . MET F 3 496 ? 129.618 -12.587 -4.116  1.00 14.50  ? 792 MET D C     1 
ATOM   9436  O  O     . MET F 3 496 ? 128.646 -12.955 -3.459  1.00 14.18  ? 792 MET D O     1 
ATOM   9437  C  CB    . MET F 3 496 ? 130.388 -10.188 -4.269  1.00 14.52  ? 792 MET D CB    1 
ATOM   9438  C  CG    . MET F 3 496 ? 131.337 -9.114  -3.784  1.00 15.33  ? 792 MET D CG    1 
ATOM   9439  S  SD    . MET F 3 496 ? 131.284 -7.580  -4.753  1.00 17.54  ? 792 MET D SD    1 
ATOM   9440  C  CE    . MET F 3 496 ? 132.819 -6.801  -4.221  1.00 17.07  ? 792 MET D CE    1 
ATOM   9441  N  N     . ASN F 3 497 ? 129.888 -13.081 -5.318  1.00 14.07  ? 793 ASN D N     1 
ATOM   9442  C  CA    . ASN F 3 497 ? 128.990 -14.014 -5.973  1.00 13.48  ? 793 ASN D CA    1 
ATOM   9443  C  C     . ASN F 3 497 ? 128.999 -15.463 -5.444  1.00 12.70  ? 793 ASN D C     1 
ATOM   9444  O  O     . ASN F 3 497 ? 127.948 -16.059 -5.273  1.00 12.80  ? 793 ASN D O     1 
ATOM   9445  C  CB    . ASN F 3 497 ? 129.255 -13.987 -7.475  1.00 13.67  ? 793 ASN D CB    1 
ATOM   9446  C  CG    . ASN F 3 497 ? 128.492 -15.043 -8.210  1.00 13.65  ? 793 ASN D CG    1 
ATOM   9447  O  OD1   . ASN F 3 497 ? 129.012 -16.132 -8.472  1.00 14.23  ? 793 ASN D OD1   1 
ATOM   9448  N  ND2   . ASN F 3 497 ? 127.240 -14.752 -8.519  1.00 12.51  ? 793 ASN D ND2   1 
ATOM   9449  N  N     . THR F 3 498 ? 130.171 -16.018 -5.173  1.00 12.25  ? 794 THR D N     1 
ATOM   9450  C  CA    . THR F 3 498 ? 130.280 -17.443 -4.752  1.00 11.85  ? 794 THR D CA    1 
ATOM   9451  C  C     . THR F 3 498 ? 129.423 -17.930 -3.569  1.00 11.73  ? 794 THR D C     1 
ATOM   9452  O  O     . THR F 3 498 ? 128.725 -18.923 -3.693  1.00 11.53  ? 794 THR D O     1 
ATOM   9453  C  CB    . THR F 3 498 ? 131.747 -17.890 -4.538  1.00 11.66  ? 794 THR D CB    1 
ATOM   9454  O  OG1   . THR F 3 498 ? 132.433 -17.909 -5.800  1.00 10.03  ? 794 THR D OG1   1 
ATOM   9455  C  CG2   . THR F 3 498 ? 131.796 -19.265 -3.893  1.00 10.60  ? 794 THR D CG2   1 
ATOM   9456  N  N     . PRO F 3 499 ? 129.478 -17.246 -2.419  1.00 11.90  ? 795 PRO D N     1 
ATOM   9457  C  CA    . PRO F 3 499 ? 128.628 -17.715 -1.330  1.00 11.99  ? 795 PRO D CA    1 
ATOM   9458  C  C     . PRO F 3 499 ? 127.137 -17.649 -1.655  1.00 11.96  ? 795 PRO D C     1 
ATOM   9459  O  O     . PRO F 3 499 ? 126.362 -18.457 -1.149  1.00 12.42  ? 795 PRO D O     1 
ATOM   9460  C  CB    . PRO F 3 499 ? 128.969 -16.761 -0.179  1.00 12.01  ? 795 PRO D CB    1 
ATOM   9461  C  CG    . PRO F 3 499 ? 130.310 -16.208 -0.527  1.00 12.07  ? 795 PRO D CG    1 
ATOM   9462  C  CD    . PRO F 3 499 ? 130.286 -16.085 -2.012  1.00 12.22  ? 795 PRO D CD    1 
ATOM   9463  N  N     . ILE F 3 500 ? 126.720 -16.711 -2.494  1.00 11.83  ? 796 ILE D N     1 
ATOM   9464  C  CA    . ILE F 3 500 ? 125.304 -16.632 -2.804  1.00 11.28  ? 796 ILE D CA    1 
ATOM   9465  C  C     . ILE F 3 500 ? 124.959 -17.721 -3.811  1.00 11.35  ? 796 ILE D C     1 
ATOM   9466  O  O     . ILE F 3 500 ? 124.085 -18.569 -3.544  1.00 11.56  ? 796 ILE D O     1 
ATOM   9467  C  CB    . ILE F 3 500 ? 124.883 -15.260 -3.359  1.00 11.29  ? 796 ILE D CB    1 
ATOM   9468  C  CG1   . ILE F 3 500 ? 125.535 -14.116 -2.571  1.00 12.00  ? 796 ILE D CG1   1 
ATOM   9469  C  CG2   . ILE F 3 500 ? 123.394 -15.137 -3.339  1.00 9.74   ? 796 ILE D CG2   1 
ATOM   9470  C  CD1   . ILE F 3 500 ? 125.173 -14.084 -1.094  1.00 13.77  ? 796 ILE D CD1   1 
ATOM   9471  N  N     . GLN F 3 501 ? 125.657 -17.716 -4.948  1.00 10.51  ? 797 GLN D N     1 
ATOM   9472  C  CA    . GLN F 3 501 ? 125.402 -18.705 -5.993  1.00 10.35  ? 797 GLN D CA    1 
ATOM   9473  C  C     . GLN F 3 501 ? 125.604 -20.140 -5.476  1.00 9.86   ? 797 GLN D C     1 
ATOM   9474  O  O     . GLN F 3 501 ? 124.824 -21.030 -5.781  1.00 9.68   ? 797 GLN D O     1 
ATOM   9475  C  CB    . GLN F 3 501 ? 126.250 -18.431 -7.254  1.00 10.01  ? 797 GLN D CB    1 
ATOM   9476  C  CG    . GLN F 3 501 ? 125.807 -19.286 -8.464  1.00 10.66  ? 797 GLN D CG    1 
ATOM   9477  C  CD    . GLN F 3 501 ? 126.706 -19.189 -9.703  1.00 10.70  ? 797 GLN D CD    1 
ATOM   9478  O  OE1   . GLN F 3 501 ? 127.369 -20.159 -10.067 1.00 11.05  ? 797 GLN D OE1   1 
ATOM   9479  N  NE2   . GLN F 3 501 ? 126.722 -18.025 -10.353 1.00 9.39   ? 797 GLN D NE2   1 
ATOM   9480  N  N     . GLY F 3 502 ? 126.640 -20.347 -4.674  1.00 9.63   ? 798 GLY D N     1 
ATOM   9481  C  CA    . GLY F 3 502 ? 126.944 -21.665 -4.128  1.00 9.46   ? 798 GLY D CA    1 
ATOM   9482  C  C     . GLY F 3 502 ? 125.937 -22.132 -3.095  1.00 9.91   ? 798 GLY D C     1 
ATOM   9483  O  O     . GLY F 3 502 ? 125.597 -23.338 -3.019  1.00 9.68   ? 798 GLY D O     1 
ATOM   9484  N  N     . SER F 3 503 ? 125.459 -21.201 -2.274  1.00 9.27   ? 799 SER D N     1 
ATOM   9485  C  CA    . SER F 3 503 ? 124.450 -21.583 -1.312  1.00 9.26   ? 799 SER D CA    1 
ATOM   9486  C  C     . SER F 3 503 ? 123.185 -22.027 -2.051  1.00 9.10   ? 799 SER D C     1 
ATOM   9487  O  O     . SER F 3 503 ? 122.553 -23.018 -1.661  1.00 9.47   ? 799 SER D O     1 
ATOM   9488  C  CB    . SER F 3 503 ? 124.177 -20.470 -0.311  1.00 9.05   ? 799 SER D CB    1 
ATOM   9489  O  OG    . SER F 3 503 ? 125.342 -20.225 0.459   1.00 8.53   ? 799 SER D OG    1 
ATOM   9490  N  N     . ALA F 3 504 ? 122.853 -21.335 -3.145  1.00 8.81   ? 800 ALA D N     1 
ATOM   9491  C  CA    . ALA F 3 504 ? 121.653 -21.671 -3.928  1.00 8.08   ? 800 ALA D CA    1 
ATOM   9492  C  C     . ALA F 3 504 ? 121.820 -23.054 -4.505  1.00 7.88   ? 800 ALA D C     1 
ATOM   9493  O  O     . ALA F 3 504 ? 120.864 -23.796 -4.639  1.00 7.86   ? 800 ALA D O     1 
ATOM   9494  C  CB    . ALA F 3 504 ? 121.412 -20.664 -5.014  1.00 7.51   ? 800 ALA D CB    1 
ATOM   9495  N  N     . ALA F 3 505 ? 123.062 -23.403 -4.809  1.00 8.31   ? 801 ALA D N     1 
ATOM   9496  C  CA    . ALA F 3 505 ? 123.403 -24.714 -5.326  1.00 8.51   ? 801 ALA D CA    1 
ATOM   9497  C  C     . ALA F 3 505 ? 123.227 -25.785 -4.254  1.00 9.14   ? 801 ALA D C     1 
ATOM   9498  O  O     . ALA F 3 505 ? 122.719 -26.874 -4.529  1.00 9.69   ? 801 ALA D O     1 
ATOM   9499  C  CB    . ALA F 3 505 ? 124.816 -24.710 -5.835  1.00 8.25   ? 801 ALA D CB    1 
ATOM   9500  N  N     . ASP F 3 506 ? 123.632 -25.476 -3.025  1.00 9.39   ? 802 ASP D N     1 
ATOM   9501  C  CA    . ASP F 3 506 ? 123.518 -26.434 -1.933  1.00 9.25   ? 802 ASP D CA    1 
ATOM   9502  C  C     . ASP F 3 506 ? 122.044 -26.721 -1.652  1.00 9.02   ? 802 ASP D C     1 
ATOM   9503  O  O     . ASP F 3 506 ? 121.667 -27.849 -1.316  1.00 8.96   ? 802 ASP D O     1 
ATOM   9504  C  CB    . ASP F 3 506 ? 124.175 -25.877 -0.659  1.00 9.61   ? 802 ASP D CB    1 
ATOM   9505  C  CG    . ASP F 3 506 ? 125.696 -25.642 -0.804  1.00 11.12  ? 802 ASP D CG    1 
ATOM   9506  O  OD1   . ASP F 3 506 ? 126.187 -24.692 -0.139  1.00 13.23  ? 802 ASP D OD1   1 
ATOM   9507  O  OD2   . ASP F 3 506 ? 126.388 -26.378 -1.561  1.00 7.85   ? 802 ASP D OD2   1 
ATOM   9508  N  N     . ILE F 3 507 ? 121.214 -25.688 -1.789  1.00 8.64   ? 803 ILE D N     1 
ATOM   9509  C  CA    . ILE F 3 507 ? 119.792 -25.784 -1.472  1.00 8.08   ? 803 ILE D CA    1 
ATOM   9510  C  C     . ILE F 3 507 ? 119.024 -26.700 -2.427  1.00 8.03   ? 803 ILE D C     1 
ATOM   9511  O  O     . ILE F 3 507 ? 118.337 -27.632 -1.979  1.00 7.26   ? 803 ILE D O     1 
ATOM   9512  C  CB    . ILE F 3 507 ? 119.133 -24.395 -1.416  1.00 8.35   ? 803 ILE D CB    1 
ATOM   9513  C  CG1   . ILE F 3 507 ? 119.706 -23.607 -0.232  1.00 8.68   ? 803 ILE D CG1   1 
ATOM   9514  C  CG2   . ILE F 3 507 ? 117.619 -24.518 -1.350  1.00 6.40   ? 803 ILE D CG2   1 
ATOM   9515  C  CD1   . ILE F 3 507 ? 119.328 -22.132 -0.200  1.00 9.30   ? 803 ILE D CD1   1 
ATOM   9516  N  N     . ILE F 3 508 ? 119.153 -26.457 -3.731  1.00 7.51   ? 804 ILE D N     1 
ATOM   9517  C  CA    . ILE F 3 508 ? 118.432 -27.286 -4.692  1.00 7.19   ? 804 ILE D CA    1 
ATOM   9518  C  C     . ILE F 3 508 ? 118.901 -28.732 -4.673  1.00 7.30   ? 804 ILE D C     1 
ATOM   9519  O  O     . ILE F 3 508 ? 118.118 -29.654 -4.920  1.00 7.16   ? 804 ILE D O     1 
ATOM   9520  C  CB    . ILE F 3 508 ? 118.444 -26.692 -6.137  1.00 7.32   ? 804 ILE D CB    1 
ATOM   9521  C  CG1   . ILE F 3 508 ? 117.535 -27.527 -7.048  1.00 6.60   ? 804 ILE D CG1   1 
ATOM   9522  C  CG2   . ILE F 3 508 ? 119.859 -26.589 -6.689  1.00 6.51   ? 804 ILE D CG2   1 
ATOM   9523  C  CD1   . ILE F 3 508 ? 116.927 -26.758 -8.149  1.00 6.99   ? 804 ILE D CD1   1 
ATOM   9524  N  N     . LYS F 3 509 ? 120.175 -28.933 -4.367  1.00 7.86   ? 805 LYS D N     1 
ATOM   9525  C  CA    . LYS F 3 509 ? 120.718 -30.281 -4.275  1.00 8.70   ? 805 LYS D CA    1 
ATOM   9526  C  C     . LYS F 3 509 ? 120.070 -31.048 -3.117  1.00 9.44   ? 805 LYS D C     1 
ATOM   9527  O  O     . LYS F 3 509 ? 119.787 -32.253 -3.232  1.00 9.69   ? 805 LYS D O     1 
ATOM   9528  C  CB    . LYS F 3 509 ? 122.232 -30.245 -4.117  1.00 8.83   ? 805 LYS D CB    1 
ATOM   9529  C  CG    . LYS F 3 509 ? 122.994 -29.973 -5.397  1.00 8.97   ? 805 LYS D CG    1 
ATOM   9530  C  CD    . LYS F 3 509 ? 124.486 -30.035 -5.117  1.00 10.76  ? 805 LYS D CD    1 
ATOM   9531  C  CE    . LYS F 3 509 ? 125.305 -29.752 -6.352  1.00 11.56  ? 805 LYS D CE    1 
ATOM   9532  N  NZ    . LYS F 3 509 ? 126.756 -29.885 -6.042  1.00 12.72  ? 805 LYS D NZ    1 
ATOM   9533  N  N     . LYS F 3 510 ? 119.807 -30.344 -2.012  1.00 9.78   ? 806 LYS D N     1 
ATOM   9534  C  CA    . LYS F 3 510 ? 119.192 -30.985 -0.868  1.00 10.03  ? 806 LYS D CA    1 
ATOM   9535  C  C     . LYS F 3 510 ? 117.741 -31.249 -1.211  1.00 10.53  ? 806 LYS D C     1 
ATOM   9536  O  O     . LYS F 3 510 ? 117.161 -32.279 -0.826  1.00 11.13  ? 806 LYS D O     1 
ATOM   9537  C  CB    . LYS F 3 510 ? 119.338 -30.143 0.395   1.00 9.78   ? 806 LYS D CB    1 
ATOM   9538  C  CG    . LYS F 3 510 ? 119.116 -30.934 1.644   1.00 9.20   ? 806 LYS D CG    1 
ATOM   9539  C  CD    . LYS F 3 510 ? 119.318 -30.068 2.888   1.00 10.81  ? 806 LYS D CD    1 
ATOM   9540  C  CE    . LYS F 3 510 ? 118.951 -30.815 4.177   1.00 9.08   ? 806 LYS D CE    1 
ATOM   9541  N  NZ    . LYS F 3 510 ? 117.498 -31.216 4.236   1.00 9.29   ? 806 LYS D NZ    1 
ATOM   9542  N  N     . ALA F 3 511 ? 117.165 -30.332 -1.970  1.00 10.63  ? 807 ALA D N     1 
ATOM   9543  C  CA    . ALA F 3 511 ? 115.811 -30.501 -2.449  1.00 11.21  ? 807 ALA D CA    1 
ATOM   9544  C  C     . ALA F 3 511 ? 115.682 -31.772 -3.294  1.00 11.48  ? 807 ALA D C     1 
ATOM   9545  O  O     . ALA F 3 511 ? 114.715 -32.490 -3.164  1.00 11.36  ? 807 ALA D O     1 
ATOM   9546  C  CB    . ALA F 3 511 ? 115.370 -29.282 -3.238  1.00 11.24  ? 807 ALA D CB    1 
ATOM   9547  N  N     . MET F 3 512 ? 116.654 -32.051 -4.157  1.00 12.45  ? 808 MET D N     1 
ATOM   9548  C  CA    . MET F 3 512 ? 116.584 -33.256 -4.998  1.00 13.28  ? 808 MET D CA    1 
ATOM   9549  C  C     . MET F 3 512 ? 116.642 -34.519 -4.161  1.00 13.51  ? 808 MET D C     1 
ATOM   9550  O  O     . MET F 3 512 ? 115.930 -35.481 -4.445  1.00 13.83  ? 808 MET D O     1 
ATOM   9551  C  CB    . MET F 3 512 ? 117.707 -33.285 -6.033  1.00 13.07  ? 808 MET D CB    1 
ATOM   9552  C  CG    . MET F 3 512 ? 117.566 -32.227 -7.086  1.00 13.40  ? 808 MET D CG    1 
ATOM   9553  S  SD    . MET F 3 512 ? 119.018 -32.050 -8.144  1.00 13.60  ? 808 MET D SD    1 
ATOM   9554  C  CE    . MET F 3 512 ? 118.860 -33.437 -9.270  1.00 11.95  ? 808 MET D CE    1 
ATOM   9555  N  N     . ILE F 3 513 ? 117.487 -34.506 -3.131  1.00 13.63  ? 809 ILE D N     1 
ATOM   9556  C  CA    . ILE F 3 513 ? 117.643 -35.662 -2.250  1.00 13.63  ? 809 ILE D CA    1 
ATOM   9557  C  C     . ILE F 3 513 ? 116.385 -35.885 -1.418  1.00 13.79  ? 809 ILE D C     1 
ATOM   9558  O  O     . ILE F 3 513 ? 115.916 -37.015 -1.260  1.00 13.95  ? 809 ILE D O     1 
ATOM   9559  C  CB    . ILE F 3 513 ? 118.864 -35.506 -1.321  1.00 13.86  ? 809 ILE D CB    1 
ATOM   9560  C  CG1   . ILE F 3 513 ? 120.157 -35.383 -2.137  1.00 13.50  ? 809 ILE D CG1   1 
ATOM   9561  C  CG2   . ILE F 3 513 ? 118.971 -36.685 -0.347  1.00 13.12  ? 809 ILE D CG2   1 
ATOM   9562  C  CD1   . ILE F 3 513 ? 121.318 -34.822 -1.334  1.00 11.57  ? 809 ILE D CD1   1 
ATOM   9563  N  N     . ASP F 3 514 ? 115.842 -34.801 -0.885  1.00 13.82  ? 810 ASP D N     1 
ATOM   9564  C  CA    . ASP F 3 514 ? 114.628 -34.884 -0.093  1.00 13.83  ? 810 ASP D CA    1 
ATOM   9565  C  C     . ASP F 3 514 ? 113.460 -35.332 -0.950  1.00 13.74  ? 810 ASP D C     1 
ATOM   9566  O  O     . ASP F 3 514 ? 112.637 -36.141 -0.498  1.00 13.85  ? 810 ASP D O     1 
ATOM   9567  C  CB    . ASP F 3 514 ? 114.318 -33.544 0.575   1.00 13.88  ? 810 ASP D CB    1 
ATOM   9568  C  CG    . ASP F 3 514 ? 115.312 -33.201 1.666   1.00 15.10  ? 810 ASP D CG    1 
ATOM   9569  O  OD1   . ASP F 3 514 ? 116.171 -34.070 1.963   1.00 16.74  ? 810 ASP D OD1   1 
ATOM   9570  O  OD2   . ASP F 3 514 ? 115.236 -32.081 2.228   1.00 13.95  ? 810 ASP D OD2   1 
ATOM   9571  N  N     . LEU F 3 515 ? 113.398 -34.817 -2.179  1.00 13.26  ? 811 LEU D N     1 
ATOM   9572  C  CA    . LEU F 3 515 ? 112.326 -35.158 -3.105  1.00 13.52  ? 811 LEU D CA    1 
ATOM   9573  C  C     . LEU F 3 515 ? 112.348 -36.647 -3.442  1.00 14.33  ? 811 LEU D C     1 
ATOM   9574  O  O     . LEU F 3 515 ? 111.314 -37.324 -3.470  1.00 14.21  ? 811 LEU D O     1 
ATOM   9575  C  CB    . LEU F 3 515 ? 112.425 -34.330 -4.387  1.00 13.26  ? 811 LEU D CB    1 
ATOM   9576  C  CG    . LEU F 3 515 ? 111.360 -34.555 -5.462  1.00 12.29  ? 811 LEU D CG    1 
ATOM   9577  C  CD1   . LEU F 3 515 ? 109.964 -34.426 -4.874  1.00 11.64  ? 811 LEU D CD1   1 
ATOM   9578  C  CD2   . LEU F 3 515 ? 111.535 -33.572 -6.592  1.00 12.68  ? 811 LEU D CD2   1 
ATOM   9579  N  N     . ASN F 3 516 ? 113.543 -37.152 -3.689  1.00 15.16  ? 812 ASN D N     1 
ATOM   9580  C  CA    . ASN F 3 516 ? 113.710 -38.542 -4.029  1.00 16.24  ? 812 ASN D CA    1 
ATOM   9581  C  C     . ASN F 3 516 ? 113.193 -39.422 -2.897  1.00 16.75  ? 812 ASN D C     1 
ATOM   9582  O  O     . ASN F 3 516 ? 112.503 -40.410 -3.129  1.00 17.18  ? 812 ASN D O     1 
ATOM   9583  C  CB    . ASN F 3 516 ? 115.182 -38.810 -4.274  1.00 16.61  ? 812 ASN D CB    1 
ATOM   9584  C  CG    . ASN F 3 516 ? 115.405 -39.959 -5.199  1.00 17.02  ? 812 ASN D CG    1 
ATOM   9585  O  OD1   . ASN F 3 516 ? 115.052 -39.895 -6.373  1.00 17.74  ? 812 ASN D OD1   1 
ATOM   9586  N  ND2   . ASN F 3 516 ? 116.014 -41.016 -4.687  1.00 17.95  ? 812 ASN D ND2   1 
ATOM   9587  N  N     . ALA F 3 517 ? 113.520 -39.037 -1.666  1.00 17.46  ? 813 ALA D N     1 
ATOM   9588  C  CA    . ALA F 3 517 ? 113.074 -39.749 -0.473  1.00 17.77  ? 813 ALA D CA    1 
ATOM   9589  C  C     . ALA F 3 517 ? 111.560 -39.816 -0.396  1.00 18.14  ? 813 ALA D C     1 
ATOM   9590  O  O     . ALA F 3 517 ? 111.010 -40.887 -0.190  1.00 18.17  ? 813 ALA D O     1 
ATOM   9591  C  CB    . ALA F 3 517 ? 113.635 -39.095 0.769   1.00 17.54  ? 813 ALA D CB    1 
ATOM   9592  N  N     . ARG F 3 518 ? 110.895 -38.675 -0.578  1.00 18.98  ? 814 ARG D N     1 
ATOM   9593  C  CA    . ARG F 3 518 ? 109.435 -38.618 -0.528  1.00 19.73  ? 814 ARG D CA    1 
ATOM   9594  C  C     . ARG F 3 518 ? 108.761 -39.477 -1.595  1.00 19.68  ? 814 ARG D C     1 
ATOM   9595  O  O     . ARG F 3 518 ? 107.841 -40.214 -1.283  1.00 19.67  ? 814 ARG D O     1 
ATOM   9596  C  CB    . ARG F 3 518 ? 108.911 -37.184 -0.631  1.00 19.80  ? 814 ARG D CB    1 
ATOM   9597  C  CG    . ARG F 3 518 ? 109.249 -36.246 0.528   1.00 22.98  ? 814 ARG D CG    1 
ATOM   9598  C  CD    . ARG F 3 518 ? 108.581 -36.627 1.849   1.00 27.39  ? 814 ARG D CD    1 
ATOM   9599  N  NE    . ARG F 3 518 ? 107.179 -37.008 1.674   1.00 31.65  ? 814 ARG D NE    1 
ATOM   9600  C  CZ    . ARG F 3 518 ? 106.150 -36.171 1.780   1.00 33.49  ? 814 ARG D CZ    1 
ATOM   9601  N  NH1   . ARG F 3 518 ? 106.363 -34.892 2.061   1.00 33.75  ? 814 ARG D NH1   1 
ATOM   9602  N  NH2   . ARG F 3 518 ? 104.910 -36.616 1.601   1.00 33.82  ? 814 ARG D NH2   1 
ATOM   9603  N  N     . LEU F 3 519 ? 109.200 -39.375 -2.847  1.00 20.17  ? 815 LEU D N     1 
ATOM   9604  C  CA    . LEU F 3 519 ? 108.576 -40.145 -3.934  1.00 20.84  ? 815 LEU D CA    1 
ATOM   9605  C  C     . LEU F 3 519 ? 108.578 -41.630 -3.613  1.00 21.49  ? 815 LEU D C     1 
ATOM   9606  O  O     . LEU F 3 519 ? 107.565 -42.294 -3.732  1.00 21.38  ? 815 LEU D O     1 
ATOM   9607  C  CB    . LEU F 3 519 ? 109.269 -39.883 -5.272  1.00 20.21  ? 815 LEU D CB    1 
ATOM   9608  C  CG    . LEU F 3 519 ? 109.181 -38.432 -5.753  1.00 21.13  ? 815 LEU D CG    1 
ATOM   9609  C  CD1   . LEU F 3 519 ? 110.088 -38.159 -6.961  1.00 20.63  ? 815 LEU D CD1   1 
ATOM   9610  C  CD2   . LEU F 3 519 ? 107.736 -38.025 -6.057  1.00 20.84  ? 815 LEU D CD2   1 
ATOM   9611  N  N     . LYS F 3 520 ? 109.729 -42.132 -3.190  1.00 22.94  ? 816 LYS D N     1 
ATOM   9612  C  CA    . LYS F 3 520 ? 109.871 -43.515 -2.788  1.00 24.57  ? 816 LYS D CA    1 
ATOM   9613  C  C     . LYS F 3 520 ? 108.925 -43.832 -1.636  1.00 24.92  ? 816 LYS D C     1 
ATOM   9614  O  O     . LYS F 3 520 ? 108.128 -44.768 -1.711  1.00 25.66  ? 816 LYS D O     1 
ATOM   9615  C  CB    . LYS F 3 520 ? 111.320 -43.808 -2.382  1.00 24.67  ? 816 LYS D CB    1 
ATOM   9616  C  CG    . LYS F 3 520 ? 111.514 -45.182 -1.741  1.00 25.48  ? 816 LYS D CG    1 
ATOM   9617  C  CD    . LYS F 3 520 ? 113.001 -45.569 -1.598  1.00 25.80  ? 816 LYS D CD    1 
ATOM   9618  C  CE    . LYS F 3 520 ? 113.148 -47.014 -1.106  1.00 26.70  ? 816 LYS D CE    1 
ATOM   9619  N  NZ    . LYS F 3 520 ? 114.553 -47.520 -1.256  1.00 28.43  ? 816 LYS D NZ    1 
ATOM   9620  N  N     . GLU F 3 521 ? 109.020 -43.050 -0.571  1.00 25.25  ? 817 GLU D N     1 
ATOM   9621  C  CA    . GLU F 3 521 ? 108.164 -43.206 0.596   1.00 25.71  ? 817 GLU D CA    1 
ATOM   9622  C  C     . GLU F 3 521 ? 106.677 -43.244 0.197   1.00 25.78  ? 817 GLU D C     1 
ATOM   9623  O  O     . GLU F 3 521 ? 105.911 -44.025 0.733   1.00 26.16  ? 817 GLU D O     1 
ATOM   9624  C  CB    . GLU F 3 521 ? 108.485 -42.080 1.585   1.00 25.80  ? 817 GLU D CB    1 
ATOM   9625  C  CG    . GLU F 3 521 ? 107.496 -41.797 2.698   1.00 27.32  ? 817 GLU D CG    1 
ATOM   9626  C  CD    . GLU F 3 521 ? 107.502 -40.302 3.096   1.00 30.19  ? 817 GLU D CD    1 
ATOM   9627  O  OE1   . GLU F 3 521 ? 108.597 -39.684 3.183   1.00 30.49  ? 817 GLU D OE1   1 
ATOM   9628  O  OE2   . GLU F 3 521 ? 106.403 -39.735 3.304   1.00 31.34  ? 817 GLU D OE2   1 
ATOM   9629  N  N     . GLU F 3 522 ? 106.278 -42.431 -0.771  1.00 26.07  ? 818 GLU D N     1 
ATOM   9630  C  CA    . GLU F 3 522 ? 104.889 -42.411 -1.234  1.00 26.23  ? 818 GLU D CA    1 
ATOM   9631  C  C     . GLU F 3 522 ? 104.596 -43.477 -2.295  1.00 25.96  ? 818 GLU D C     1 
ATOM   9632  O  O     . GLU F 3 522 ? 103.460 -43.618 -2.732  1.00 25.83  ? 818 GLU D O     1 
ATOM   9633  C  CB    . GLU F 3 522 ? 104.555 -41.041 -1.829  1.00 26.34  ? 818 GLU D CB    1 
ATOM   9634  C  CG    . GLU F 3 522 ? 104.856 -39.877 -0.917  1.00 27.93  ? 818 GLU D CG    1 
ATOM   9635  C  CD    . GLU F 3 522 ? 103.765 -39.630 0.091   1.00 28.61  ? 818 GLU D CD    1 
ATOM   9636  O  OE1   . GLU F 3 522 ? 104.090 -39.466 1.284   1.00 29.70  ? 818 GLU D OE1   1 
ATOM   9637  O  OE2   . GLU F 3 522 ? 102.590 -39.602 -0.316  1.00 28.60  ? 818 GLU D OE2   1 
ATOM   9638  N  N     . ARG F 3 523 ? 105.620 -44.203 -2.726  1.00 25.85  ? 819 ARG D N     1 
ATOM   9639  C  CA    . ARG F 3 523 ? 105.468 -45.220 -3.771  1.00 26.30  ? 819 ARG D CA    1 
ATOM   9640  C  C     . ARG F 3 523 ? 104.821 -44.622 -5.029  1.00 25.47  ? 819 ARG D C     1 
ATOM   9641  O  O     . ARG F 3 523 ? 103.864 -45.171 -5.573  1.00 25.70  ? 819 ARG D O     1 
ATOM   9642  C  CB    . ARG F 3 523 ? 104.681 -46.436 -3.251  1.00 26.12  ? 819 ARG D CB    1 
ATOM   9643  C  CG    . ARG F 3 523 ? 105.273 -47.052 -1.983  1.00 27.09  ? 819 ARG D CG    1 
ATOM   9644  C  CD    . ARG F 3 523 ? 104.473 -48.262 -1.498  1.00 28.31  ? 819 ARG D CD    1 
ATOM   9645  N  NE    . ARG F 3 523 ? 103.115 -47.931 -1.051  1.00 33.68  ? 819 ARG D NE    1 
ATOM   9646  C  CZ    . ARG F 3 523 ? 102.736 -47.791 0.225   1.00 36.56  ? 819 ARG D CZ    1 
ATOM   9647  N  NH1   . ARG F 3 523 ? 103.608 -47.960 1.219   1.00 38.84  ? 819 ARG D NH1   1 
ATOM   9648  N  NH2   . ARG F 3 523 ? 101.474 -47.491 0.517   1.00 37.38  ? 819 ARG D NH2   1 
ATOM   9649  N  N     . LEU F 3 524 ? 105.339 -43.473 -5.460  1.00 24.40  ? 820 LEU D N     1 
ATOM   9650  C  CA    . LEU F 3 524 ? 104.864 -42.804 -6.665  1.00 23.05  ? 820 LEU D CA    1 
ATOM   9651  C  C     . LEU F 3 524 ? 105.781 -43.173 -7.805  1.00 22.59  ? 820 LEU D C     1 
ATOM   9652  O  O     . LEU F 3 524 ? 106.967 -43.390 -7.591  1.00 22.44  ? 820 LEU D O     1 
ATOM   9653  C  CB    . LEU F 3 524 ? 104.889 -41.288 -6.479  1.00 22.64  ? 820 LEU D CB    1 
ATOM   9654  C  CG    . LEU F 3 524 ? 103.852 -40.669 -5.546  1.00 21.15  ? 820 LEU D CG    1 
ATOM   9655  C  CD1   . LEU F 3 524 ? 104.149 -39.219 -5.320  1.00 19.77  ? 820 LEU D CD1   1 
ATOM   9656  C  CD2   . LEU F 3 524 ? 102.463 -40.824 -6.115  1.00 20.50  ? 820 LEU D CD2   1 
ATOM   9657  N  N     . GLN F 3 525 ? 105.249 -43.228 -9.018  1.00 21.99  ? 821 GLN D N     1 
ATOM   9658  C  CA    . GLN F 3 525 ? 106.065 -43.615 -10.166 1.00 21.58  ? 821 GLN D CA    1 
ATOM   9659  C  C     . GLN F 3 525 ? 106.850 -42.454 -10.724 1.00 20.66  ? 821 GLN D C     1 
ATOM   9660  O  O     . GLN F 3 525 ? 107.726 -42.646 -11.572 1.00 20.82  ? 821 GLN D O     1 
ATOM   9661  C  CB    . GLN F 3 525 ? 105.206 -44.169 -11.286 1.00 22.03  ? 821 GLN D CB    1 
ATOM   9662  C  CG    . GLN F 3 525 ? 104.357 -45.341 -10.901 1.00 24.08  ? 821 GLN D CG    1 
ATOM   9663  C  CD    . GLN F 3 525 ? 103.494 -45.768 -12.055 1.00 27.42  ? 821 GLN D CD    1 
ATOM   9664  O  OE1   . GLN F 3 525 ? 102.268 -45.782 -11.956 1.00 30.22  ? 821 GLN D OE1   1 
ATOM   9665  N  NE2   . GLN F 3 525 ? 104.124 -46.071 -13.181 1.00 27.64  ? 821 GLN D NE2   1 
ATOM   9666  N  N     . ALA F 3 526 ? 106.520 -41.255 -10.252 1.00 19.49  ? 822 ALA D N     1 
ATOM   9667  C  CA    . ALA F 3 526 ? 107.160 -40.018 -10.695 1.00 18.31  ? 822 ALA D CA    1 
ATOM   9668  C  C     . ALA F 3 526 ? 108.664 -40.054 -10.500 1.00 17.24  ? 822 ALA D C     1 
ATOM   9669  O  O     . ALA F 3 526 ? 109.142 -40.636 -9.538  1.00 17.36  ? 822 ALA D O     1 
ATOM   9670  C  CB    . ALA F 3 526 ? 106.565 -38.826 -9.939  1.00 18.56  ? 822 ALA D CB    1 
ATOM   9671  N  N     . HIS F 3 527 ? 109.405 -39.444 -11.423 1.00 15.92  ? 823 HIS D N     1 
ATOM   9672  C  CA    . HIS F 3 527 ? 110.861 -39.319 -11.275 1.00 14.45  ? 823 HIS D CA    1 
ATOM   9673  C  C     . HIS F 3 527 ? 111.447 -38.058 -11.910 1.00 13.76  ? 823 HIS D C     1 
ATOM   9674  O  O     . HIS F 3 527 ? 110.895 -37.483 -12.844 1.00 13.77  ? 823 HIS D O     1 
ATOM   9675  C  CB    . HIS F 3 527 ? 111.584 -40.554 -11.812 1.00 14.08  ? 823 HIS D CB    1 
ATOM   9676  C  CG    . HIS F 3 527 ? 111.333 -40.820 -13.264 1.00 13.22  ? 823 HIS D CG    1 
ATOM   9677  N  ND1   . HIS F 3 527 ? 110.402 -41.734 -13.702 1.00 13.03  ? 823 HIS D ND1   1 
ATOM   9678  C  CD2   . HIS F 3 527 ? 111.903 -40.305 -14.377 1.00 12.17  ? 823 HIS D CD2   1 
ATOM   9679  C  CE1   . HIS F 3 527 ? 110.399 -41.762 -15.022 1.00 12.71  ? 823 HIS D CE1   1 
ATOM   9680  N  NE2   . HIS F 3 527 ? 111.296 -40.899 -15.457 1.00 11.75  ? 823 HIS D NE2   1 
ATOM   9681  N  N     . LEU F 3 528 ? 112.593 -37.646 -11.392 1.00 13.13  ? 824 LEU D N     1 
ATOM   9682  C  CA    . LEU F 3 528 ? 113.313 -36.495 -11.913 1.00 11.74  ? 824 LEU D CA    1 
ATOM   9683  C  C     . LEU F 3 528 ? 113.864 -36.794 -13.304 1.00 11.47  ? 824 LEU D C     1 
ATOM   9684  O  O     . LEU F 3 528 ? 114.296 -37.921 -13.588 1.00 11.24  ? 824 LEU D O     1 
ATOM   9685  C  CB    . LEU F 3 528 ? 114.465 -36.141 -10.968 1.00 11.47  ? 824 LEU D CB    1 
ATOM   9686  C  CG    . LEU F 3 528 ? 114.137 -35.428 -9.660  1.00 10.05  ? 824 LEU D CG    1 
ATOM   9687  C  CD1   . LEU F 3 528 ? 115.267 -35.564 -8.691  1.00 8.51   ? 824 LEU D CD1   1 
ATOM   9688  C  CD2   . LEU F 3 528 ? 113.840 -33.972 -9.928  1.00 9.94   ? 824 LEU D CD2   1 
ATOM   9689  N  N     . LEU F 3 529 ? 113.840 -35.777 -14.161 1.00 10.69  ? 825 LEU D N     1 
ATOM   9690  C  CA    . LEU F 3 529 ? 114.416 -35.865 -15.487 1.00 10.13  ? 825 LEU D CA    1 
ATOM   9691  C  C     . LEU F 3 529 ? 115.602 -34.912 -15.603 1.00 10.22  ? 825 LEU D C     1 
ATOM   9692  O  O     . LEU F 3 529 ? 116.644 -35.261 -16.174 1.00 10.24  ? 825 LEU D O     1 
ATOM   9693  C  CB    . LEU F 3 529 ? 113.389 -35.503 -16.559 1.00 9.60   ? 825 LEU D CB    1 
ATOM   9694  C  CG    . LEU F 3 529 ? 112.177 -36.401 -16.847 1.00 10.11  ? 825 LEU D CG    1 
ATOM   9695  C  CD1   . LEU F 3 529 ? 111.424 -35.856 -18.062 1.00 10.00  ? 825 LEU D CD1   1 
ATOM   9696  C  CD2   . LEU F 3 529 ? 112.581 -37.832 -17.103 1.00 8.95   ? 825 LEU D CD2   1 
ATOM   9697  N  N     . LEU F 3 530 ? 115.444 -33.708 -15.056 1.00 9.88   ? 826 LEU D N     1 
ATOM   9698  C  CA    . LEU F 3 530 ? 116.424 -32.653 -15.244 1.00 9.73   ? 826 LEU D CA    1 
ATOM   9699  C  C     . LEU F 3 530 ? 116.525 -31.735 -14.058 1.00 10.04  ? 826 LEU D C     1 
ATOM   9700  O  O     . LEU F 3 530 ? 115.613 -31.650 -13.227 1.00 10.60  ? 826 LEU D O     1 
ATOM   9701  C  CB    . LEU F 3 530 ? 116.050 -31.779 -16.450 1.00 9.20   ? 826 LEU D CB    1 
ATOM   9702  C  CG    . LEU F 3 530 ? 116.119 -32.381 -17.857 1.00 9.57   ? 826 LEU D CG    1 
ATOM   9703  C  CD1   . LEU F 3 530 ? 115.538 -31.448 -18.929 1.00 6.80   ? 826 LEU D CD1   1 
ATOM   9704  C  CD2   . LEU F 3 530 ? 117.558 -32.812 -18.193 1.00 9.02   ? 826 LEU D CD2   1 
ATOM   9705  N  N     . GLN F 3 531 ? 117.644 -31.022 -14.005 1.00 9.74   ? 827 GLN D N     1 
ATOM   9706  C  CA    . GLN F 3 531 ? 117.821 -29.950 -13.055 1.00 9.20   ? 827 GLN D CA    1 
ATOM   9707  C  C     . GLN F 3 531 ? 118.364 -28.783 -13.860 1.00 9.22   ? 827 GLN D C     1 
ATOM   9708  O  O     . GLN F 3 531 ? 119.263 -28.951 -14.680 1.00 8.32   ? 827 GLN D O     1 
ATOM   9709  C  CB    . GLN F 3 531 ? 118.782 -30.383 -11.958 1.00 9.21   ? 827 GLN D CB    1 
ATOM   9710  C  CG    . GLN F 3 531 ? 119.067 -29.355 -10.881 1.00 8.48   ? 827 GLN D CG    1 
ATOM   9711  C  CD    . GLN F 3 531 ? 120.348 -28.572 -11.140 1.00 7.59   ? 827 GLN D CD    1 
ATOM   9712  O  OE1   . GLN F 3 531 ? 120.667 -28.222 -12.274 1.00 4.34   ? 827 GLN D OE1   1 
ATOM   9713  N  NE2   . GLN F 3 531 ? 121.088 -28.303 -10.077 1.00 7.16   ? 827 GLN D NE2   1 
ATOM   9714  N  N     . VAL F 3 532 ? 117.777 -27.607 -13.674 1.00 9.55   ? 828 VAL D N     1 
ATOM   9715  C  CA    . VAL F 3 532 ? 118.281 -26.425 -14.358 1.00 9.70   ? 828 VAL D CA    1 
ATOM   9716  C  C     . VAL F 3 532 ? 118.623 -25.340 -13.329 1.00 10.31  ? 828 VAL D C     1 
ATOM   9717  O  O     . VAL F 3 532 ? 117.962 -24.293 -13.233 1.00 10.44  ? 828 VAL D O     1 
ATOM   9718  C  CB    . VAL F 3 532 ? 117.327 -25.944 -15.463 1.00 9.97   ? 828 VAL D CB    1 
ATOM   9719  C  CG1   . VAL F 3 532 ? 118.029 -24.916 -16.401 1.00 9.49   ? 828 VAL D CG1   1 
ATOM   9720  C  CG2   . VAL F 3 532 ? 116.818 -27.127 -16.252 1.00 8.28   ? 828 VAL D CG2   1 
ATOM   9721  N  N     . HIS F 3 533 ? 119.645 -25.655 -12.529 1.00 10.76  ? 829 HIS D N     1 
ATOM   9722  C  CA    . HIS F 3 533 ? 120.256 -24.754 -11.549 1.00 10.84  ? 829 HIS D CA    1 
ATOM   9723  C  C     . HIS F 3 533 ? 119.353 -24.385 -10.368 1.00 11.49  ? 829 HIS D C     1 
ATOM   9724  O  O     . HIS F 3 533 ? 119.756 -24.512 -9.206  1.00 11.33  ? 829 HIS D O     1 
ATOM   9725  C  CB    . HIS F 3 533 ? 120.817 -23.507 -12.244 1.00 10.53  ? 829 HIS D CB    1 
ATOM   9726  C  CG    . HIS F 3 533 ? 121.714 -23.819 -13.401 1.00 8.78   ? 829 HIS D CG    1 
ATOM   9727  N  ND1   . HIS F 3 533 ? 122.854 -24.582 -13.272 1.00 7.67   ? 829 HIS D ND1   1 
ATOM   9728  C  CD2   . HIS F 3 533 ? 121.642 -23.468 -14.708 1.00 6.83   ? 829 HIS D CD2   1 
ATOM   9729  C  CE1   . HIS F 3 533 ? 123.448 -24.685 -14.449 1.00 7.33   ? 829 HIS D CE1   1 
ATOM   9730  N  NE2   . HIS F 3 533 ? 122.728 -24.026 -15.339 1.00 4.79   ? 829 HIS D NE2   1 
ATOM   9731  N  N     . ASP F 3 534 ? 118.146 -23.913 -10.661 1.00 11.89  ? 830 ASP D N     1 
ATOM   9732  C  CA    . ASP F 3 534 ? 117.199 -23.662 -9.602  1.00 12.56  ? 830 ASP D CA    1 
ATOM   9733  C  C     . ASP F 3 534 ? 115.816 -24.208 -9.931  1.00 12.83  ? 830 ASP D C     1 
ATOM   9734  O  O     . ASP F 3 534 ? 114.839 -23.873 -9.271  1.00 13.17  ? 830 ASP D O     1 
ATOM   9735  C  CB    . ASP F 3 534 ? 117.138 -22.177 -9.258  1.00 12.73  ? 830 ASP D CB    1 
ATOM   9736  C  CG    . ASP F 3 534 ? 116.367 -21.387 -10.263 1.00 13.38  ? 830 ASP D CG    1 
ATOM   9737  O  OD1   . ASP F 3 534 ? 116.440 -21.712 -11.474 1.00 14.19  ? 830 ASP D OD1   1 
ATOM   9738  O  OD2   . ASP F 3 534 ? 115.680 -20.441 -9.827  1.00 14.50  ? 830 ASP D OD2   1 
ATOM   9739  N  N     . GLU F 3 535 ? 115.723 -25.056 -10.948 1.00 13.21  ? 831 GLU D N     1 
ATOM   9740  C  CA    . GLU F 3 535 ? 114.436 -25.690 -11.235 1.00 13.69  ? 831 GLU D CA    1 
ATOM   9741  C  C     . GLU F 3 535 ? 114.527 -27.222 -11.376 1.00 13.67  ? 831 GLU D C     1 
ATOM   9742  O  O     . GLU F 3 535 ? 115.605 -27.774 -11.593 1.00 13.95  ? 831 GLU D O     1 
ATOM   9743  C  CB    . GLU F 3 535 ? 113.723 -25.032 -12.419 1.00 13.59  ? 831 GLU D CB    1 
ATOM   9744  C  CG    . GLU F 3 535 ? 114.377 -25.237 -13.736 1.00 15.70  ? 831 GLU D CG    1 
ATOM   9745  C  CD    . GLU F 3 535 ? 113.690 -24.470 -14.854 1.00 19.06  ? 831 GLU D CD    1 
ATOM   9746  O  OE1   . GLU F 3 535 ? 112.436 -24.486 -14.910 1.00 20.22  ? 831 GLU D OE1   1 
ATOM   9747  O  OE2   . GLU F 3 535 ? 114.413 -23.855 -15.675 1.00 19.42  ? 831 GLU D OE2   1 
ATOM   9748  N  N     . LEU F 3 536 ? 113.401 -27.906 -11.204 1.00 13.53  ? 832 LEU D N     1 
ATOM   9749  C  CA    . LEU F 3 536 ? 113.396 -29.351 -11.299 1.00 13.57  ? 832 LEU D CA    1 
ATOM   9750  C  C     . LEU F 3 536 ? 112.321 -29.813 -12.259 1.00 13.94  ? 832 LEU D C     1 
ATOM   9751  O  O     . LEU F 3 536 ? 111.166 -29.379 -12.185 1.00 13.82  ? 832 LEU D O     1 
ATOM   9752  C  CB    . LEU F 3 536 ? 113.213 -29.985 -9.929  1.00 13.39  ? 832 LEU D CB    1 
ATOM   9753  C  CG    . LEU F 3 536 ? 114.271 -29.617 -8.887  1.00 13.47  ? 832 LEU D CG    1 
ATOM   9754  C  CD1   . LEU F 3 536 ? 113.987 -30.349 -7.572  1.00 13.28  ? 832 LEU D CD1   1 
ATOM   9755  C  CD2   . LEU F 3 536 ? 115.674 -29.937 -9.386  1.00 12.29  ? 832 LEU D CD2   1 
ATOM   9756  N  N     . ILE F 3 537 ? 112.715 -30.691 -13.175 1.00 14.14  ? 833 ILE D N     1 
ATOM   9757  C  CA    . ILE F 3 537 ? 111.805 -31.184 -14.197 1.00 14.39  ? 833 ILE D CA    1 
ATOM   9758  C  C     . ILE F 3 537 ? 111.568 -32.666 -13.972 1.00 14.13  ? 833 ILE D C     1 
ATOM   9759  O  O     . ILE F 3 537 ? 112.513 -33.428 -13.897 1.00 13.67  ? 833 ILE D O     1 
ATOM   9760  C  CB    . ILE F 3 537 ? 112.401 -30.995 -15.599 1.00 14.61  ? 833 ILE D CB    1 
ATOM   9761  C  CG1   . ILE F 3 537 ? 113.081 -29.624 -15.724 1.00 15.18  ? 833 ILE D CG1   1 
ATOM   9762  C  CG2   . ILE F 3 537 ? 111.346 -31.240 -16.679 1.00 14.70  ? 833 ILE D CG2   1 
ATOM   9763  C  CD1   . ILE F 3 537 ? 112.162 -28.420 -15.546 1.00 17.32  ? 833 ILE D CD1   1 
ATOM   9764  N  N     . LEU F 3 538 ? 110.301 -33.054 -13.856 1.00 14.57  ? 834 LEU D N     1 
ATOM   9765  C  CA    . LEU F 3 538 ? 109.898 -34.443 -13.601 1.00 14.90  ? 834 LEU D CA    1 
ATOM   9766  C  C     . LEU F 3 538 ? 108.891 -34.954 -14.620 1.00 15.04  ? 834 LEU D C     1 
ATOM   9767  O  O     . LEU F 3 538 ? 108.295 -34.185 -15.368 1.00 15.09  ? 834 LEU D O     1 
ATOM   9768  C  CB    . LEU F 3 538 ? 109.227 -34.563 -12.229 1.00 14.70  ? 834 LEU D CB    1 
ATOM   9769  C  CG    . LEU F 3 538 ? 109.973 -34.215 -10.942 1.00 15.71  ? 834 LEU D CG    1 
ATOM   9770  C  CD1   . LEU F 3 538 ? 110.117 -32.707 -10.787 1.00 15.88  ? 834 LEU D CD1   1 
ATOM   9771  C  CD2   . LEU F 3 538 ? 109.241 -34.802 -9.742  1.00 15.06  ? 834 LEU D CD2   1 
ATOM   9772  N  N     . GLU F 3 539 ? 108.680 -36.259 -14.634 1.00 15.27  ? 835 GLU D N     1 
ATOM   9773  C  CA    . GLU F 3 539 ? 107.585 -36.803 -15.407 1.00 15.82  ? 835 GLU D CA    1 
ATOM   9774  C  C     . GLU F 3 539 ? 106.871 -37.798 -14.519 1.00 16.35  ? 835 GLU D C     1 
ATOM   9775  O  O     . GLU F 3 539 ? 107.500 -38.477 -13.690 1.00 16.85  ? 835 GLU D O     1 
ATOM   9776  C  CB    . GLU F 3 539 ? 108.045 -37.448 -16.718 1.00 15.74  ? 835 GLU D CB    1 
ATOM   9777  C  CG    . GLU F 3 539 ? 108.939 -38.642 -16.538 1.00 16.75  ? 835 GLU D CG    1 
ATOM   9778  C  CD    . GLU F 3 539 ? 109.304 -39.286 -17.848 1.00 19.50  ? 835 GLU D CD    1 
ATOM   9779  O  OE1   . GLU F 3 539 ? 108.965 -38.711 -18.911 1.00 18.52  ? 835 GLU D OE1   1 
ATOM   9780  O  OE2   . GLU F 3 539 ? 109.937 -40.371 -17.814 1.00 20.92  ? 835 GLU D OE2   1 
ATOM   9781  N  N     . ALA F 3 540 ? 105.554 -37.868 -14.677 1.00 16.52  ? 836 ALA D N     1 
ATOM   9782  C  CA    . ALA F 3 540 ? 104.733 -38.773 -13.890 1.00 16.63  ? 836 ALA D CA    1 
ATOM   9783  C  C     . ALA F 3 540 ? 103.448 -39.049 -14.636 1.00 16.83  ? 836 ALA D C     1 
ATOM   9784  O  O     . ALA F 3 540 ? 103.072 -38.283 -15.526 1.00 16.69  ? 836 ALA D O     1 
ATOM   9785  C  CB    . ALA F 3 540 ? 104.432 -38.168 -12.529 1.00 16.78  ? 836 ALA D CB    1 
ATOM   9786  N  N     . PRO F 3 541 ? 102.780 -40.165 -14.303 1.00 17.08  ? 837 PRO D N     1 
ATOM   9787  C  CA    . PRO F 3 541 ? 101.502 -40.422 -14.946 1.00 17.24  ? 837 PRO D CA    1 
ATOM   9788  C  C     . PRO F 3 541 ? 100.440 -39.432 -14.467 1.00 17.67  ? 837 PRO D C     1 
ATOM   9789  O  O     . PRO F 3 541 ? 100.482 -39.010 -13.314 1.00 17.81  ? 837 PRO D O     1 
ATOM   9790  C  CB    . PRO F 3 541 ? 101.174 -41.857 -14.513 1.00 17.24  ? 837 PRO D CB    1 
ATOM   9791  C  CG    . PRO F 3 541 ? 101.934 -42.078 -13.267 1.00 16.92  ? 837 PRO D CG    1 
ATOM   9792  C  CD    . PRO F 3 541 ? 103.172 -41.241 -13.373 1.00 16.88  ? 837 PRO D CD    1 
ATOM   9793  N  N     . LYS F 3 542 ? 99.499  -39.079 -15.343 1.00 18.33  ? 838 LYS D N     1 
ATOM   9794  C  CA    . LYS F 3 542 ? 98.424  -38.128 -15.022 1.00 19.59  ? 838 LYS D CA    1 
ATOM   9795  C  C     . LYS F 3 542 ? 97.805  -38.264 -13.627 1.00 19.70  ? 838 LYS D C     1 
ATOM   9796  O  O     . LYS F 3 542 ? 97.494  -37.255 -12.987 1.00 19.53  ? 838 LYS D O     1 
ATOM   9797  C  CB    . LYS F 3 542 ? 97.291  -38.198 -16.060 1.00 19.87  ? 838 LYS D CB    1 
ATOM   9798  C  CG    . LYS F 3 542 ? 97.730  -37.880 -17.456 1.00 22.64  ? 838 LYS D CG    1 
ATOM   9799  C  CD    . LYS F 3 542 ? 96.585  -37.550 -18.412 1.00 26.47  ? 838 LYS D CD    1 
ATOM   9800  C  CE    . LYS F 3 542 ? 97.165  -37.252 -19.816 1.00 28.72  ? 838 LYS D CE    1 
ATOM   9801  N  NZ    . LYS F 3 542 ? 96.309  -36.328 -20.621 1.00 31.14  ? 838 LYS D NZ    1 
ATOM   9802  N  N     . GLU F 3 543 ? 97.621  -39.497 -13.161 1.00 19.85  ? 839 GLU D N     1 
ATOM   9803  C  CA    . GLU F 3 543 ? 96.940  -39.715 -11.889 1.00 20.82  ? 839 GLU D CA    1 
ATOM   9804  C  C     . GLU F 3 543 ? 97.726  -39.273 -10.646 1.00 20.97  ? 839 GLU D C     1 
ATOM   9805  O  O     . GLU F 3 543 ? 97.227  -39.399 -9.525  1.00 20.77  ? 839 GLU D O     1 
ATOM   9806  C  CB    . GLU F 3 543 ? 96.513  -41.181 -11.718 1.00 21.23  ? 839 GLU D CB    1 
ATOM   9807  C  CG    . GLU F 3 543 ? 96.232  -41.934 -12.998 1.00 23.74  ? 839 GLU D CG    1 
ATOM   9808  C  CD    . GLU F 3 543 ? 97.495  -42.560 -13.555 1.00 26.86  ? 839 GLU D CD    1 
ATOM   9809  O  OE1   . GLU F 3 543 ? 98.239  -43.192 -12.766 1.00 26.37  ? 839 GLU D OE1   1 
ATOM   9810  O  OE2   . GLU F 3 543 ? 97.747  -42.410 -14.773 1.00 29.02  ? 839 GLU D OE2   1 
ATOM   9811  N  N     . GLU F 3 544 ? 98.943  -38.764 -10.842 1.00 21.18  ? 840 GLU D N     1 
ATOM   9812  C  CA    . GLU F 3 544 ? 99.777  -38.330 -9.721  1.00 21.13  ? 840 GLU D CA    1 
ATOM   9813  C  C     . GLU F 3 544 ? 99.988  -36.821 -9.706  1.00 21.40  ? 840 GLU D C     1 
ATOM   9814  O  O     . GLU F 3 544 ? 100.523 -36.275 -8.734  1.00 21.40  ? 840 GLU D O     1 
ATOM   9815  C  CB    . GLU F 3 544 ? 101.148 -39.007 -9.759  1.00 21.34  ? 840 GLU D CB    1 
ATOM   9816  C  CG    . GLU F 3 544 ? 101.149 -40.527 -9.748  1.00 20.01  ? 840 GLU D CG    1 
ATOM   9817  C  CD    . GLU F 3 544 ? 102.550 -41.064 -9.629  1.00 19.46  ? 840 GLU D CD    1 
ATOM   9818  O  OE1   . GLU F 3 544 ? 102.705 -42.271 -9.364  1.00 18.29  ? 840 GLU D OE1   1 
ATOM   9819  O  OE2   . GLU F 3 544 ? 103.503 -40.262 -9.776  1.00 19.29  ? 840 GLU D OE2   1 
ATOM   9820  N  N     . MET F 3 545 ? 99.588  -36.157 -10.785 1.00 21.16  ? 841 MET D N     1 
ATOM   9821  C  CA    . MET F 3 545 ? 99.739  -34.717 -10.881 1.00 21.51  ? 841 MET D CA    1 
ATOM   9822  C  C     . MET F 3 545 ? 99.233  -33.990 -9.647  1.00 21.21  ? 841 MET D C     1 
ATOM   9823  O  O     . MET F 3 545 ? 99.910  -33.111 -9.119  1.00 21.28  ? 841 MET D O     1 
ATOM   9824  C  CB    . MET F 3 545 ? 99.023  -34.168 -12.116 1.00 21.75  ? 841 MET D CB    1 
ATOM   9825  C  CG    . MET F 3 545 ? 99.804  -34.275 -13.406 1.00 23.32  ? 841 MET D CG    1 
ATOM   9826  S  SD    . MET F 3 545 ? 101.522 -33.749 -13.200 1.00 26.49  ? 841 MET D SD    1 
ATOM   9827  C  CE    . MET F 3 545 ? 102.381 -35.303 -13.393 1.00 26.28  ? 841 MET D CE    1 
ATOM   9828  N  N     . GLU F 3 546 ? 98.045  -34.359 -9.190  1.00 21.07  ? 842 GLU D N     1 
ATOM   9829  C  CA    . GLU F 3 546 ? 97.418  -33.682 -8.056  1.00 21.18  ? 842 GLU D CA    1 
ATOM   9830  C  C     . GLU F 3 546 ? 98.160  -33.910 -6.756  1.00 20.74  ? 842 GLU D C     1 
ATOM   9831  O  O     . GLU F 3 546 ? 98.187  -33.031 -5.901  1.00 20.06  ? 842 GLU D O     1 
ATOM   9832  C  CB    . GLU F 3 546 ? 95.967  -34.109 -7.901  1.00 21.47  ? 842 GLU D CB    1 
ATOM   9833  C  CG    . GLU F 3 546 ? 95.125  -33.816 -9.125  1.00 23.58  ? 842 GLU D CG    1 
ATOM   9834  C  CD    . GLU F 3 546 ? 93.663  -33.761 -8.793  1.00 26.07  ? 842 GLU D CD    1 
ATOM   9835  O  OE1   . GLU F 3 546 ? 93.265  -32.839 -8.046  1.00 25.91  ? 842 GLU D OE1   1 
ATOM   9836  O  OE2   . GLU F 3 546 ? 92.917  -34.642 -9.277  1.00 28.13  ? 842 GLU D OE2   1 
ATOM   9837  N  N     . ARG F 3 547 ? 98.751  -35.095 -6.603  1.00 20.51  ? 843 ARG D N     1 
ATOM   9838  C  CA    . ARG F 3 547 ? 99.562  -35.348 -5.430  1.00 20.78  ? 843 ARG D CA    1 
ATOM   9839  C  C     . ARG F 3 547 ? 100.894 -34.613 -5.505  1.00 20.51  ? 843 ARG D C     1 
ATOM   9840  O  O     . ARG F 3 547 ? 101.431 -34.208 -4.485  1.00 20.11  ? 843 ARG D O     1 
ATOM   9841  C  CB    . ARG F 3 547 ? 99.742  -36.841 -5.162  1.00 20.89  ? 843 ARG D CB    1 
ATOM   9842  C  CG    . ARG F 3 547 ? 98.525  -37.449 -4.459  1.00 23.02  ? 843 ARG D CG    1 
ATOM   9843  C  CD    . ARG F 3 547 ? 98.889  -38.626 -3.558  1.00 24.46  ? 843 ARG D CD    1 
ATOM   9844  N  NE    . ARG F 3 547 ? 98.929  -39.884 -4.284  1.00 26.72  ? 843 ARG D NE    1 
ATOM   9845  C  CZ    . ARG F 3 547 ? 99.737  -40.901 -3.990  1.00 29.13  ? 843 ARG D CZ    1 
ATOM   9846  N  NH1   . ARG F 3 547 ? 100.616 -40.808 -2.994  1.00 29.70  ? 843 ARG D NH1   1 
ATOM   9847  N  NH2   . ARG F 3 547 ? 99.690  -42.012 -4.723  1.00 31.15  ? 843 ARG D NH2   1 
ATOM   9848  N  N     . LEU F 3 548 ? 101.387 -34.409 -6.727  1.00 20.72  ? 844 LEU D N     1 
ATOM   9849  C  CA    . LEU F 3 548 ? 102.662 -33.739 -6.973  1.00 20.41  ? 844 LEU D CA    1 
ATOM   9850  C  C     . LEU F 3 548 ? 102.552 -32.241 -6.856  1.00 20.53  ? 844 LEU D C     1 
ATOM   9851  O  O     . LEU F 3 548 ? 103.522 -31.581 -6.497  1.00 21.27  ? 844 LEU D O     1 
ATOM   9852  C  CB    . LEU F 3 548 ? 103.203 -34.063 -8.363  1.00 20.33  ? 844 LEU D CB    1 
ATOM   9853  C  CG    . LEU F 3 548 ? 103.860 -35.403 -8.664  1.00 20.27  ? 844 LEU D CG    1 
ATOM   9854  C  CD1   . LEU F 3 548 ? 104.386 -35.368 -10.073 1.00 19.78  ? 844 LEU D CD1   1 
ATOM   9855  C  CD2   . LEU F 3 548 ? 104.980 -35.698 -7.693  1.00 20.51  ? 844 LEU D CD2   1 
ATOM   9856  N  N     . CYS F 3 549 ? 101.389 -31.694 -7.192  1.00 20.43  ? 845 CYS D N     1 
ATOM   9857  C  CA    . CYS F 3 549 ? 101.182 -30.256 -7.092  1.00 20.00  ? 845 CYS D CA    1 
ATOM   9858  C  C     . CYS F 3 549 ? 101.376 -29.795 -5.652  1.00 19.44  ? 845 CYS D C     1 
ATOM   9859  O  O     . CYS F 3 549 ? 101.774 -28.654 -5.413  1.00 19.52  ? 845 CYS D O     1 
ATOM   9860  C  CB    . CYS F 3 549 ? 99.806  -29.858 -7.631  1.00 20.12  ? 845 CYS D CB    1 
ATOM   9861  S  SG    . CYS F 3 549 ? 99.687  -29.824 -9.469  1.00 21.51  ? 845 CYS D SG    1 
ATOM   9862  N  N     . ARG F 3 550 ? 101.126 -30.693 -4.701  1.00 18.72  ? 846 ARG D N     1 
ATOM   9863  C  CA    . ARG F 3 550 ? 101.337 -30.392 -3.279  1.00 18.58  ? 846 ARG D CA    1 
ATOM   9864  C  C     . ARG F 3 550 ? 102.727 -30.777 -2.810  1.00 18.23  ? 846 ARG D C     1 
ATOM   9865  O  O     . ARG F 3 550 ? 103.456 -29.952 -2.259  1.00 18.36  ? 846 ARG D O     1 
ATOM   9866  C  CB    . ARG F 3 550 ? 100.302 -31.089 -2.396  1.00 18.24  ? 846 ARG D CB    1 
ATOM   9867  C  CG    . ARG F 3 550 ? 98.897  -30.582 -2.627  1.00 18.68  ? 846 ARG D CG    1 
ATOM   9868  C  CD    . ARG F 3 550 ? 97.862  -31.343 -1.833  1.00 17.92  ? 846 ARG D CD    1 
ATOM   9869  N  NE    . ARG F 3 550 ? 97.960  -31.171 -0.379  1.00 16.96  ? 846 ARG D NE    1 
ATOM   9870  C  CZ    . ARG F 3 550 ? 97.652  -30.050 0.273   1.00 16.40  ? 846 ARG D CZ    1 
ATOM   9871  N  NH1   . ARG F 3 550 ? 97.281  -28.967 -0.397  1.00 15.53  ? 846 ARG D NH1   1 
ATOM   9872  N  NH2   . ARG F 3 550 ? 97.744  -30.001 1.600   1.00 16.02  ? 846 ARG D NH2   1 
ATOM   9873  N  N     . LEU F 3 551 ? 103.079 -32.033 -3.056  1.00 17.83  ? 847 LEU D N     1 
ATOM   9874  C  CA    . LEU F 3 551 ? 104.314 -32.648 -2.579  1.00 17.31  ? 847 LEU D CA    1 
ATOM   9875  C  C     . LEU F 3 551 ? 105.591 -31.956 -3.038  1.00 17.11  ? 847 LEU D C     1 
ATOM   9876  O  O     . LEU F 3 551 ? 106.438 -31.621 -2.206  1.00 16.78  ? 847 LEU D O     1 
ATOM   9877  C  CB    . LEU F 3 551 ? 104.317 -34.120 -2.988  1.00 17.43  ? 847 LEU D CB    1 
ATOM   9878  C  CG    . LEU F 3 551 ? 105.414 -35.101 -2.605  1.00 18.11  ? 847 LEU D CG    1 
ATOM   9879  C  CD1   . LEU F 3 551 ? 104.977 -36.500 -2.984  1.00 18.86  ? 847 LEU D CD1   1 
ATOM   9880  C  CD2   . LEU F 3 551 ? 106.728 -34.780 -3.295  1.00 19.47  ? 847 LEU D CD2   1 
ATOM   9881  N  N     . VAL F 3 552 ? 105.730 -31.740 -4.350  1.00 16.83  ? 848 VAL D N     1 
ATOM   9882  C  CA    . VAL F 3 552 ? 106.953 -31.135 -4.901  1.00 16.50  ? 848 VAL D CA    1 
ATOM   9883  C  C     . VAL F 3 552 ? 107.309 -29.754 -4.296  1.00 16.47  ? 848 VAL D C     1 
ATOM   9884  O  O     . VAL F 3 552 ? 108.405 -29.577 -3.757  1.00 16.27  ? 848 VAL D O     1 
ATOM   9885  C  CB    . VAL F 3 552 ? 106.947 -31.088 -6.457  1.00 16.69  ? 848 VAL D CB    1 
ATOM   9886  C  CG1   . VAL F 3 552 ? 108.193 -30.382 -6.977  1.00 16.17  ? 848 VAL D CG1   1 
ATOM   9887  C  CG2   . VAL F 3 552 ? 106.847 -32.493 -7.052  1.00 16.29  ? 848 VAL D CG2   1 
ATOM   9888  N  N     . PRO F 3 553 ? 106.391 -28.777 -4.378  1.00 16.23  ? 849 PRO D N     1 
ATOM   9889  C  CA    . PRO F 3 553 ? 106.679 -27.450 -3.837  1.00 16.23  ? 849 PRO D CA    1 
ATOM   9890  C  C     . PRO F 3 553 ? 106.983 -27.476 -2.345  1.00 16.35  ? 849 PRO D C     1 
ATOM   9891  O  O     . PRO F 3 553 ? 107.968 -26.887 -1.919  1.00 15.56  ? 849 PRO D O     1 
ATOM   9892  C  CB    . PRO F 3 553 ? 105.382 -26.685 -4.099  1.00 16.10  ? 849 PRO D CB    1 
ATOM   9893  C  CG    . PRO F 3 553 ? 104.782 -27.376 -5.214  1.00 16.14  ? 849 PRO D CG    1 
ATOM   9894  C  CD    . PRO F 3 553 ? 105.059 -28.816 -4.987  1.00 16.11  ? 849 PRO D CD    1 
ATOM   9895  N  N     . GLU F 3 554 ? 106.133 -28.155 -1.573  1.00 16.99  ? 850 GLU D N     1 
ATOM   9896  C  CA    . GLU F 3 554 ? 106.351 -28.358 -0.141  1.00 17.62  ? 850 GLU D CA    1 
ATOM   9897  C  C     . GLU F 3 554 ? 107.761 -28.881 0.180   1.00 17.54  ? 850 GLU D C     1 
ATOM   9898  O  O     . GLU F 3 554 ? 108.421 -28.369 1.079   1.00 17.63  ? 850 GLU D O     1 
ATOM   9899  C  CB    . GLU F 3 554 ? 105.305 -29.309 0.421   1.00 17.88  ? 850 GLU D CB    1 
ATOM   9900  C  CG    . GLU F 3 554 ? 105.596 -29.813 1.837   1.00 21.77  ? 850 GLU D CG    1 
ATOM   9901  C  CD    . GLU F 3 554 ? 105.218 -28.824 2.955   1.00 27.49  ? 850 GLU D CD    1 
ATOM   9902  O  OE1   . GLU F 3 554 ? 104.629 -29.299 3.964   1.00 30.54  ? 850 GLU D OE1   1 
ATOM   9903  O  OE2   . GLU F 3 554 ? 105.491 -27.592 2.845   1.00 29.56  ? 850 GLU D OE2   1 
ATOM   9904  N  N     . VAL F 3 555 ? 108.227 -29.887 -0.555  1.00 17.25  ? 851 VAL D N     1 
ATOM   9905  C  CA    . VAL F 3 555 ? 109.573 -30.409 -0.336  1.00 17.29  ? 851 VAL D CA    1 
ATOM   9906  C  C     . VAL F 3 555 ? 110.644 -29.367 -0.656  1.00 17.25  ? 851 VAL D C     1 
ATOM   9907  O  O     . VAL F 3 555 ? 111.618 -29.207 0.089   1.00 17.14  ? 851 VAL D O     1 
ATOM   9908  C  CB    . VAL F 3 555 ? 109.861 -31.665 -1.190  1.00 17.31  ? 851 VAL D CB    1 
ATOM   9909  C  CG1   . VAL F 3 555 ? 111.299 -32.079 -1.043  1.00 17.29  ? 851 VAL D CG1   1 
ATOM   9910  C  CG2   . VAL F 3 555 ? 108.967 -32.804 -0.774  1.00 17.94  ? 851 VAL D CG2   1 
ATOM   9911  N  N     . MET F 3 556 ? 110.472 -28.669 -1.773  1.00 17.13  ? 852 MET D N     1 
ATOM   9912  C  CA    . MET F 3 556 ? 111.457 -27.682 -2.186  1.00 17.02  ? 852 MET D CA    1 
ATOM   9913  C  C     . MET F 3 556 ? 111.534 -26.498 -1.237  1.00 17.53  ? 852 MET D C     1 
ATOM   9914  O  O     . MET F 3 556 ? 112.622 -26.023 -0.941  1.00 17.65  ? 852 MET D O     1 
ATOM   9915  C  CB    . MET F 3 556 ? 111.222 -27.235 -3.621  1.00 16.56  ? 852 MET D CB    1 
ATOM   9916  C  CG    . MET F 3 556 ? 111.645 -28.281 -4.623  1.00 16.21  ? 852 MET D CG    1 
ATOM   9917  S  SD    . MET F 3 556 ? 111.141 -27.994 -6.333  1.00 16.95  ? 852 MET D SD    1 
ATOM   9918  C  CE    . MET F 3 556 ? 112.053 -26.523 -6.767  1.00 14.83  ? 852 MET D CE    1 
ATOM   9919  N  N     . GLU F 3 557 ? 110.388 -26.042 -0.740  1.00 18.22  ? 853 GLU D N     1 
ATOM   9920  C  CA    . GLU F 3 557 ? 110.335 -24.886 0.165   1.00 18.87  ? 853 GLU D CA    1 
ATOM   9921  C  C     . GLU F 3 557 ? 110.951 -25.163 1.526   1.00 18.76  ? 853 GLU D C     1 
ATOM   9922  O  O     . GLU F 3 557 ? 111.471 -24.253 2.172   1.00 18.46  ? 853 GLU D O     1 
ATOM   9923  C  CB    . GLU F 3 557 ? 108.892 -24.422 0.356   1.00 18.95  ? 853 GLU D CB    1 
ATOM   9924  C  CG    . GLU F 3 557 ? 108.272 -23.869 -0.905  1.00 21.24  ? 853 GLU D CG    1 
ATOM   9925  C  CD    . GLU F 3 557 ? 106.802 -23.527 -0.754  1.00 23.35  ? 853 GLU D CD    1 
ATOM   9926  O  OE1   . GLU F 3 557 ? 106.277 -22.850 -1.669  1.00 24.94  ? 853 GLU D OE1   1 
ATOM   9927  O  OE2   . GLU F 3 557 ? 106.180 -23.921 0.260   1.00 22.98  ? 853 GLU D OE2   1 
ATOM   9928  N  N     . GLN F 3 558 ? 110.901 -26.431 1.927   1.00 18.91  ? 854 GLN D N     1 
ATOM   9929  C  CA    . GLN F 3 558 ? 111.324 -26.871 3.244   1.00 19.16  ? 854 GLN D CA    1 
ATOM   9930  C  C     . GLN F 3 558 ? 112.724 -27.494 3.247   1.00 18.93  ? 854 GLN D C     1 
ATOM   9931  O  O     . GLN F 3 558 ? 113.133 -28.116 4.229   1.00 19.08  ? 854 GLN D O     1 
ATOM   9932  C  CB    . GLN F 3 558 ? 110.291 -27.864 3.799   1.00 19.63  ? 854 GLN D CB    1 
ATOM   9933  C  CG    . GLN F 3 558 ? 108.893 -27.272 4.075   1.00 21.37  ? 854 GLN D CG    1 
ATOM   9934  C  CD    . GLN F 3 558 ? 108.843 -26.395 5.329   1.00 25.54  ? 854 GLN D CD    1 
ATOM   9935  O  OE1   . GLN F 3 558 ? 109.191 -26.842 6.435   1.00 26.79  ? 854 GLN D OE1   1 
ATOM   9936  N  NE2   . GLN F 3 558 ? 108.392 -25.142 5.167   1.00 25.11  ? 854 GLN D NE2   1 
ATOM   9937  N  N     . ALA F 3 559 ? 113.458 -27.314 2.151   1.00 18.53  ? 855 ALA D N     1 
ATOM   9938  C  CA    . ALA F 3 559 ? 114.805 -27.879 1.998   1.00 17.84  ? 855 ALA D CA    1 
ATOM   9939  C  C     . ALA F 3 559 ? 115.730 -27.402 3.100   1.00 17.53  ? 855 ALA D C     1 
ATOM   9940  O  O     . ALA F 3 559 ? 116.421 -28.199 3.720   1.00 17.14  ? 855 ALA D O     1 
ATOM   9941  C  CB    . ALA F 3 559 ? 115.391 -27.509 0.636   1.00 17.59  ? 855 ALA D CB    1 
ATOM   9942  N  N     . VAL F 3 560 ? 115.757 -26.087 3.306   1.00 17.22  ? 856 VAL D N     1 
ATOM   9943  C  CA    . VAL F 3 560 ? 116.547 -25.462 4.363   1.00 16.98  ? 856 VAL D CA    1 
ATOM   9944  C  C     . VAL F 3 560 ? 115.652 -24.426 5.023   1.00 17.19  ? 856 VAL D C     1 
ATOM   9945  O  O     . VAL F 3 560 ? 114.624 -24.055 4.455   1.00 17.08  ? 856 VAL D O     1 
ATOM   9946  C  CB    . VAL F 3 560 ? 117.777 -24.749 3.808   1.00 16.64  ? 856 VAL D CB    1 
ATOM   9947  C  CG1   . VAL F 3 560 ? 118.779 -25.735 3.239   1.00 15.62  ? 856 VAL D CG1   1 
ATOM   9948  C  CG2   . VAL F 3 560 ? 117.352 -23.750 2.749   1.00 17.80  ? 856 VAL D CG2   1 
ATOM   9949  N  N     . THR F 3 561 ? 116.012 -23.975 6.224   1.00 17.20  ? 857 THR D N     1 
ATOM   9950  C  CA    . THR F 3 561 ? 115.242 -22.916 6.881   1.00 17.42  ? 857 THR D CA    1 
ATOM   9951  C  C     . THR F 3 561 ? 116.038 -21.623 6.826   1.00 17.08  ? 857 THR D C     1 
ATOM   9952  O  O     . THR F 3 561 ? 117.136 -21.540 7.374   1.00 17.34  ? 857 THR D O     1 
ATOM   9953  C  CB    . THR F 3 561 ? 114.889 -23.268 8.346   1.00 17.92  ? 857 THR D CB    1 
ATOM   9954  O  OG1   . THR F 3 561 ? 114.056 -24.435 8.366   1.00 19.08  ? 857 THR D OG1   1 
ATOM   9955  C  CG2   . THR F 3 561 ? 114.132 -22.115 9.029   1.00 17.73  ? 857 THR D CG2   1 
ATOM   9956  N  N     . LEU F 3 562 ? 115.502 -20.617 6.146   1.00 16.63  ? 858 LEU D N     1 
ATOM   9957  C  CA    . LEU F 3 562 ? 116.204 -19.344 6.028   1.00 16.09  ? 858 LEU D CA    1 
ATOM   9958  C  C     . LEU F 3 562 ? 115.464 -18.291 6.828   1.00 16.23  ? 858 LEU D C     1 
ATOM   9959  O  O     . LEU F 3 562 ? 114.429 -18.580 7.426   1.00 16.17  ? 858 LEU D O     1 
ATOM   9960  C  CB    . LEU F 3 562 ? 116.359 -18.937 4.560   1.00 15.52  ? 858 LEU D CB    1 
ATOM   9961  C  CG    . LEU F 3 562 ? 117.130 -19.944 3.688   1.00 15.19  ? 858 LEU D CG    1 
ATOM   9962  C  CD1   . LEU F 3 562 ? 117.169 -19.530 2.219   1.00 14.55  ? 858 LEU D CD1   1 
ATOM   9963  C  CD2   . LEU F 3 562 ? 118.546 -20.179 4.202   1.00 14.41  ? 858 LEU D CD2   1 
ATOM   9964  N  N     . ARG F 3 563 ? 116.000 -17.077 6.850   1.00 16.49  ? 859 ARG D N     1 
ATOM   9965  C  CA    . ARG F 3 563 ? 115.361 -15.969 7.557   1.00 16.92  ? 859 ARG D CA    1 
ATOM   9966  C  C     . ARG F 3 563 ? 114.147 -15.469 6.790   1.00 16.89  ? 859 ARG D C     1 
ATOM   9967  O  O     . ARG F 3 563 ? 113.289 -14.778 7.351   1.00 16.89  ? 859 ARG D O     1 
ATOM   9968  C  CB    . ARG F 3 563 ? 116.358 -14.837 7.807   1.00 17.16  ? 859 ARG D CB    1 
ATOM   9969  C  CG    . ARG F 3 563 ? 117.430 -15.242 8.798   1.00 17.90  ? 859 ARG D CG    1 
ATOM   9970  C  CD    . ARG F 3 563 ? 118.554 -14.261 8.897   1.00 17.80  ? 859 ARG D CD    1 
ATOM   9971  N  NE    . ARG F 3 563 ? 119.373 -14.603 10.057  1.00 19.77  ? 859 ARG D NE    1 
ATOM   9972  C  CZ    . ARG F 3 563 ? 120.642 -15.006 10.025  1.00 18.42  ? 859 ARG D CZ    1 
ATOM   9973  N  NH1   . ARG F 3 563 ? 121.299 -15.104 8.873   1.00 16.47  ? 859 ARG D NH1   1 
ATOM   9974  N  NH2   . ARG F 3 563 ? 121.257 -15.277 11.173  1.00 17.63  ? 859 ARG D NH2   1 
ATOM   9975  N  N     . VAL F 3 564 ? 114.097 -15.821 5.507   1.00 16.60  ? 860 VAL D N     1 
ATOM   9976  C  CA    . VAL F 3 564 ? 112.958 -15.528 4.654   1.00 16.84  ? 860 VAL D CA    1 
ATOM   9977  C  C     . VAL F 3 564 ? 112.386 -16.854 4.168   1.00 17.34  ? 860 VAL D C     1 
ATOM   9978  O  O     . VAL F 3 564 ? 113.049 -17.891 4.243   1.00 17.63  ? 860 VAL D O     1 
ATOM   9979  C  CB    . VAL F 3 564 ? 113.339 -14.670 3.420   1.00 16.80  ? 860 VAL D CB    1 
ATOM   9980  C  CG1   . VAL F 3 564 ? 113.925 -13.327 3.846   1.00 16.02  ? 860 VAL D CG1   1 
ATOM   9981  C  CG2   . VAL F 3 564 ? 114.273 -15.428 2.487   1.00 15.69  ? 860 VAL D CG2   1 
ATOM   9982  N  N     . PRO F 3 565 ? 111.141 -16.843 3.685   1.00 17.63  ? 861 PRO D N     1 
ATOM   9983  C  CA    . PRO F 3 565 ? 110.645 -18.116 3.181   1.00 17.50  ? 861 PRO D CA    1 
ATOM   9984  C  C     . PRO F 3 565 ? 111.099 -18.381 1.747   1.00 17.73  ? 861 PRO D C     1 
ATOM   9985  O  O     . PRO F 3 565 ? 111.441 -17.448 1.010   1.00 17.67  ? 861 PRO D O     1 
ATOM   9986  C  CB    . PRO F 3 565 ? 109.127 -17.939 3.231   1.00 17.28  ? 861 PRO D CB    1 
ATOM   9987  C  CG    . PRO F 3 565 ? 108.901 -16.476 3.114   1.00 17.22  ? 861 PRO D CG    1 
ATOM   9988  C  CD    . PRO F 3 565 ? 110.139 -15.763 3.590   1.00 17.42  ? 861 PRO D CD    1 
ATOM   9989  N  N     . LEU F 3 566 ? 111.122 -19.650 1.367   1.00 17.94  ? 862 LEU D N     1 
ATOM   9990  C  CA    . LEU F 3 566 ? 111.396 -20.008 -0.006  1.00 18.33  ? 862 LEU D CA    1 
ATOM   9991  C  C     . LEU F 3 566 ? 110.060 -20.105 -0.736  1.00 18.86  ? 862 LEU D C     1 
ATOM   9992  O  O     . LEU F 3 566 ? 109.036 -20.371 -0.119  1.00 19.20  ? 862 LEU D O     1 
ATOM   9993  C  CB    . LEU F 3 566 ? 112.168 -21.318 -0.079  1.00 18.10  ? 862 LEU D CB    1 
ATOM   9994  C  CG    . LEU F 3 566 ? 113.635 -21.221 0.348   1.00 17.91  ? 862 LEU D CG    1 
ATOM   9995  C  CD1   . LEU F 3 566 ? 114.293 -22.606 0.372   1.00 17.70  ? 862 LEU D CD1   1 
ATOM   9996  C  CD2   . LEU F 3 566 ? 114.392 -20.269 -0.567  1.00 16.96  ? 862 LEU D CD2   1 
ATOM   9997  N  N     . LYS F 3 567 ? 110.058 -19.844 -2.037  1.00 19.36  ? 863 LYS D N     1 
ATOM   9998  C  CA    . LYS F 3 567 ? 108.828 -19.911 -2.807  1.00 19.53  ? 863 LYS D CA    1 
ATOM   9999  C  C     . LYS F 3 567 ? 109.071 -20.584 -4.140  1.00 19.51  ? 863 LYS D C     1 
ATOM   10000 O  O     . LYS F 3 567 ? 110.096 -20.366 -4.765  1.00 19.56  ? 863 LYS D O     1 
ATOM   10001 C  CB    . LYS F 3 567 ? 108.236 -18.522 -3.028  1.00 19.64  ? 863 LYS D CB    1 
ATOM   10002 C  CG    . LYS F 3 567 ? 106.845 -18.608 -3.567  1.00 20.42  ? 863 LYS D CG    1 
ATOM   10003 C  CD    . LYS F 3 567 ? 106.255 -17.265 -3.854  1.00 23.65  ? 863 LYS D CD    1 
ATOM   10004 C  CE    . LYS F 3 567 ? 104.799 -17.442 -4.259  1.00 23.86  ? 863 LYS D CE    1 
ATOM   10005 N  NZ    . LYS F 3 567 ? 104.335 -16.275 -5.022  1.00 24.38  ? 863 LYS D NZ    1 
ATOM   10006 N  N     . VAL F 3 568 ? 108.113 -21.398 -4.569  1.00 19.95  ? 864 VAL D N     1 
ATOM   10007 C  CA    . VAL F 3 568 ? 108.240 -22.168 -5.791  1.00 20.15  ? 864 VAL D CA    1 
ATOM   10008 C  C     . VAL F 3 568 ? 107.031 -22.029 -6.694  1.00 20.65  ? 864 VAL D C     1 
ATOM   10009 O  O     . VAL F 3 568 ? 105.912 -22.117 -6.235  1.00 20.87  ? 864 VAL D O     1 
ATOM   10010 C  CB    . VAL F 3 568 ? 108.424 -23.662 -5.465  1.00 20.05  ? 864 VAL D CB    1 
ATOM   10011 C  CG1   . VAL F 3 568 ? 108.158 -24.529 -6.690  1.00 18.87  ? 864 VAL D CG1   1 
ATOM   10012 C  CG2   . VAL F 3 568 ? 109.804 -23.904 -4.908  1.00 19.53  ? 864 VAL D CG2   1 
ATOM   10013 N  N     . ASP F 3 569 ? 107.279 -21.800 -7.977  1.00 21.62  ? 865 ASP D N     1 
ATOM   10014 C  CA    . ASP F 3 569 ? 106.244 -21.797 -9.002  1.00 22.67  ? 865 ASP D CA    1 
ATOM   10015 C  C     . ASP F 3 569 ? 106.259 -23.152 -9.722  1.00 23.02  ? 865 ASP D C     1 
ATOM   10016 O  O     . ASP F 3 569 ? 107.315 -23.722 -9.995  1.00 22.99  ? 865 ASP D O     1 
ATOM   10017 C  CB    . ASP F 3 569 ? 106.513 -20.698 -10.028 1.00 23.01  ? 865 ASP D CB    1 
ATOM   10018 C  CG    . ASP F 3 569 ? 106.978 -19.398 -9.393  1.00 25.19  ? 865 ASP D CG    1 
ATOM   10019 O  OD1   . ASP F 3 569 ? 106.396 -18.968 -8.359  1.00 27.30  ? 865 ASP D OD1   1 
ATOM   10020 O  OD2   . ASP F 3 569 ? 107.939 -18.800 -9.938  1.00 27.14  ? 865 ASP D OD2   1 
ATOM   10021 N  N     . TYR F 3 570 ? 105.089 -23.671 -10.050 1.00 23.59  ? 866 TYR D N     1 
ATOM   10022 C  CA    . TYR F 3 570 ? 105.043 -24.953 -10.713 1.00 24.10  ? 866 TYR D CA    1 
ATOM   10023 C  C     . TYR F 3 570 ? 103.954 -25.001 -11.746 1.00 23.88  ? 866 TYR D C     1 
ATOM   10024 O  O     . TYR F 3 570 ? 102.934 -24.337 -11.631 1.00 23.64  ? 866 TYR D O     1 
ATOM   10025 C  CB    . TYR F 3 570 ? 104.857 -26.073 -9.705  1.00 24.97  ? 866 TYR D CB    1 
ATOM   10026 C  CG    . TYR F 3 570 ? 103.682 -25.869 -8.787  1.00 26.42  ? 866 TYR D CG    1 
ATOM   10027 C  CD1   . TYR F 3 570 ? 102.444 -26.440 -9.069  1.00 27.08  ? 866 TYR D CD1   1 
ATOM   10028 C  CD2   . TYR F 3 570 ? 103.809 -25.096 -7.632  1.00 27.43  ? 866 TYR D CD2   1 
ATOM   10029 C  CE1   . TYR F 3 570 ? 101.368 -26.254 -8.212  1.00 27.73  ? 866 TYR D CE1   1 
ATOM   10030 C  CE2   . TYR F 3 570 ? 102.742 -24.905 -6.772  1.00 27.39  ? 866 TYR D CE2   1 
ATOM   10031 C  CZ    . TYR F 3 570 ? 101.529 -25.487 -7.067  1.00 27.20  ? 866 TYR D CZ    1 
ATOM   10032 O  OH    . TYR F 3 570 ? 100.470 -25.292 -6.207  1.00 28.10  ? 866 TYR D OH    1 
ATOM   10033 N  N     . HIS F 3 571 ? 104.193 -25.806 -12.765 1.00 23.79  ? 867 HIS D N     1 
ATOM   10034 C  CA    . HIS F 3 571 ? 103.275 -25.959 -13.861 1.00 23.77  ? 867 HIS D CA    1 
ATOM   10035 C  C     . HIS F 3 571 ? 103.457 -27.360 -14.402 1.00 23.50  ? 867 HIS D C     1 
ATOM   10036 O  O     . HIS F 3 571 ? 104.508 -27.972 -14.205 1.00 23.69  ? 867 HIS D O     1 
ATOM   10037 C  CB    . HIS F 3 571 ? 103.601 -24.947 -14.950 1.00 23.95  ? 867 HIS D CB    1 
ATOM   10038 C  CG    . HIS F 3 571 ? 103.542 -23.518 -14.500 1.00 25.70  ? 867 HIS D CG    1 
ATOM   10039 N  ND1   . HIS F 3 571 ? 104.670 -22.786 -14.189 1.00 27.66  ? 867 HIS D ND1   1 
ATOM   10040 C  CD2   . HIS F 3 571 ? 102.490 -22.687 -14.304 1.00 26.60  ? 867 HIS D CD2   1 
ATOM   10041 C  CE1   . HIS F 3 571 ? 104.315 -21.565 -13.827 1.00 27.96  ? 867 HIS D CE1   1 
ATOM   10042 N  NE2   . HIS F 3 571 ? 102.997 -21.480 -13.891 1.00 27.66  ? 867 HIS D NE2   1 
ATOM   10043 N  N     . TYR F 3 572 ? 102.438 -27.882 -15.070 1.00 23.25  ? 868 TYR D N     1 
ATOM   10044 C  CA    . TYR F 3 572 ? 102.547 -29.202 -15.674 1.00 23.05  ? 868 TYR D CA    1 
ATOM   10045 C  C     . TYR F 3 572 ? 101.888 -29.169 -17.036 1.00 22.51  ? 868 TYR D C     1 
ATOM   10046 O  O     . TYR F 3 572 ? 101.110 -28.269 -17.318 1.00 22.34  ? 868 TYR D O     1 
ATOM   10047 C  CB    . TYR F 3 572 ? 101.945 -30.285 -14.779 1.00 23.63  ? 868 TYR D CB    1 
ATOM   10048 C  CG    . TYR F 3 572 ? 100.504 -30.061 -14.460 1.00 23.98  ? 868 TYR D CG    1 
ATOM   10049 C  CD1   . TYR F 3 572 ? 99.520  -30.378 -15.383 1.00 25.13  ? 868 TYR D CD1   1 
ATOM   10050 C  CD2   . TYR F 3 572 ? 100.120 -29.528 -13.236 1.00 25.23  ? 868 TYR D CD2   1 
ATOM   10051 C  CE1   . TYR F 3 572 ? 98.193  -30.167 -15.113 1.00 26.62  ? 868 TYR D CE1   1 
ATOM   10052 C  CE2   . TYR F 3 572 ? 98.785  -29.314 -12.939 1.00 26.83  ? 868 TYR D CE2   1 
ATOM   10053 C  CZ    . TYR F 3 572 ? 97.820  -29.636 -13.889 1.00 26.93  ? 868 TYR D CZ    1 
ATOM   10054 O  OH    . TYR F 3 572 ? 96.477  -29.429 -13.632 1.00 26.71  ? 868 TYR D OH    1 
ATOM   10055 N  N     . GLY F 3 573 ? 102.193 -30.143 -17.881 1.00 22.07  ? 869 GLY D N     1 
ATOM   10056 C  CA    . GLY F 3 573 ? 101.686 -30.115 -19.247 1.00 21.98  ? 869 GLY D CA    1 
ATOM   10057 C  C     . GLY F 3 573 ? 102.116 -31.290 -20.097 1.00 21.90  ? 869 GLY D C     1 
ATOM   10058 O  O     . GLY F 3 573 ? 102.916 -32.119 -19.667 1.00 21.96  ? 869 GLY D O     1 
ATOM   10059 N  N     . SER F 3 574 ? 101.590 -31.343 -21.317 1.00 21.96  ? 870 SER D N     1 
ATOM   10060 C  CA    . SER F 3 574 ? 101.837 -32.458 -22.230 1.00 21.93  ? 870 SER D CA    1 
ATOM   10061 C  C     . SER F 3 574 ? 103.264 -32.491 -22.742 1.00 21.77  ? 870 SER D C     1 
ATOM   10062 O  O     . SER F 3 574 ? 103.759 -33.557 -23.115 1.00 21.89  ? 870 SER D O     1 
ATOM   10063 C  CB    . SER F 3 574 ? 100.868 -32.414 -23.411 1.00 21.89  ? 870 SER D CB    1 
ATOM   10064 O  OG    . SER F 3 574 ? 99.529  -32.466 -22.956 1.00 22.40  ? 870 SER D OG    1 
ATOM   10065 N  N     . THR F 3 575 ? 103.904 -31.323 -22.781 1.00 21.36  ? 871 THR D N     1 
ATOM   10066 C  CA    . THR F 3 575 ? 105.296 -31.204 -23.201 1.00 21.28  ? 871 THR D CA    1 
ATOM   10067 C  C     . THR F 3 575 ? 106.027 -30.215 -22.286 1.00 21.64  ? 871 THR D C     1 
ATOM   10068 O  O     . THR F 3 575 ? 105.399 -29.518 -21.491 1.00 21.70  ? 871 THR D O     1 
ATOM   10069 C  CB    . THR F 3 575 ? 105.421 -30.751 -24.679 1.00 21.23  ? 871 THR D CB    1 
ATOM   10070 O  OG1   . THR F 3 575 ? 104.993 -29.392 -24.814 1.00 20.84  ? 871 THR D OG1   1 
ATOM   10071 C  CG2   . THR F 3 575 ? 104.586 -31.640 -25.601 1.00 20.72  ? 871 THR D CG2   1 
ATOM   10072 N  N     . TRP F 3 576 ? 107.351 -30.154 -22.392 1.00 21.89  ? 872 TRP D N     1 
ATOM   10073 C  CA    . TRP F 3 576 ? 108.122 -29.220 -21.582 1.00 22.20  ? 872 TRP D CA    1 
ATOM   10074 C  C     . TRP F 3 576 ? 107.705 -27.775 -21.882 1.00 23.12  ? 872 TRP D C     1 
ATOM   10075 O  O     . TRP F 3 576 ? 107.629 -26.948 -20.975 1.00 23.52  ? 872 TRP D O     1 
ATOM   10076 C  CB    . TRP F 3 576 ? 109.632 -29.467 -21.773 1.00 21.36  ? 872 TRP D CB    1 
ATOM   10077 C  CG    . TRP F 3 576 ? 110.565 -28.722 -20.831 1.00 20.35  ? 872 TRP D CG    1 
ATOM   10078 C  CD1   . TRP F 3 576 ? 110.236 -28.080 -19.666 1.00 19.57  ? 872 TRP D CD1   1 
ATOM   10079 C  CD2   . TRP F 3 576 ? 111.996 -28.623 -20.944 1.00 20.51  ? 872 TRP D CD2   1 
ATOM   10080 N  NE1   . TRP F 3 576 ? 111.365 -27.546 -19.077 1.00 18.67  ? 872 TRP D NE1   1 
ATOM   10081 C  CE2   . TRP F 3 576 ? 112.456 -27.871 -19.840 1.00 19.39  ? 872 TRP D CE2   1 
ATOM   10082 C  CE3   . TRP F 3 576 ? 112.932 -29.092 -21.874 1.00 19.79  ? 872 TRP D CE3   1 
ATOM   10083 C  CZ2   . TRP F 3 576 ? 113.806 -27.576 -19.651 1.00 19.77  ? 872 TRP D CZ2   1 
ATOM   10084 C  CZ3   . TRP F 3 576 ? 114.274 -28.787 -21.682 1.00 19.17  ? 872 TRP D CZ3   1 
ATOM   10085 C  CH2   . TRP F 3 576 ? 114.695 -28.040 -20.582 1.00 19.20  ? 872 TRP D CH2   1 
ATOM   10086 N  N     . TYR F 3 577 ? 107.414 -27.475 -23.145 1.00 24.18  ? 873 TYR D N     1 
ATOM   10087 C  CA    . TYR F 3 577 ? 106.923 -26.148 -23.523 1.00 25.41  ? 873 TYR D CA    1 
ATOM   10088 C  C     . TYR F 3 577 ? 105.658 -25.814 -22.754 1.00 26.62  ? 873 TYR D C     1 
ATOM   10089 O  O     . TYR F 3 577 ? 105.513 -24.705 -22.253 1.00 27.00  ? 873 TYR D O     1 
ATOM   10090 C  CB    . TYR F 3 577 ? 106.632 -26.094 -25.022 1.00 25.05  ? 873 TYR D CB    1 
ATOM   10091 C  CG    . TYR F 3 577 ? 105.974 -24.821 -25.541 1.00 24.44  ? 873 TYR D CG    1 
ATOM   10092 C  CD1   . TYR F 3 577 ? 106.732 -23.817 -26.136 1.00 24.94  ? 873 TYR D CD1   1 
ATOM   10093 C  CD2   . TYR F 3 577 ? 104.596 -24.648 -25.489 1.00 24.04  ? 873 TYR D CD2   1 
ATOM   10094 C  CE1   . TYR F 3 577 ? 106.146 -22.668 -26.636 1.00 23.89  ? 873 TYR D CE1   1 
ATOM   10095 C  CE2   . TYR F 3 577 ? 103.998 -23.500 -25.987 1.00 23.66  ? 873 TYR D CE2   1 
ATOM   10096 C  CZ    . TYR F 3 577 ? 104.782 -22.518 -26.553 1.00 24.38  ? 873 TYR D CZ    1 
ATOM   10097 O  OH    . TYR F 3 577 ? 104.206 -21.383 -27.047 1.00 24.13  ? 873 TYR D OH    1 
ATOM   10098 N  N     . ASP F 3 578 ? 104.750 -26.779 -22.658 1.00 27.95  ? 874 ASP D N     1 
ATOM   10099 C  CA    . ASP F 3 578 ? 103.476 -26.567 -21.980 1.00 29.66  ? 874 ASP D CA    1 
ATOM   10100 C  C     . ASP F 3 578 ? 103.583 -26.543 -20.450 1.00 30.73  ? 874 ASP D C     1 
ATOM   10101 O  O     . ASP F 3 578 ? 102.679 -26.079 -19.762 1.00 30.72  ? 874 ASP D O     1 
ATOM   10102 C  CB    . ASP F 3 578 ? 102.440 -27.591 -22.464 1.00 29.60  ? 874 ASP D CB    1 
ATOM   10103 C  CG    . ASP F 3 578 ? 101.800 -27.184 -23.780 1.00 30.58  ? 874 ASP D CG    1 
ATOM   10104 O  OD1   . ASP F 3 578 ? 102.118 -27.771 -24.850 1.00 31.43  ? 874 ASP D OD1   1 
ATOM   10105 O  OD2   . ASP F 3 578 ? 100.995 -26.235 -23.744 1.00 31.59  ? 874 ASP D OD2   1 
ATOM   10106 N  N     . ALA F 3 579 ? 104.695 -27.028 -19.915 1.00 32.24  ? 875 ALA D N     1 
ATOM   10107 C  CA    . ALA F 3 579 ? 104.877 -27.010 -18.469 1.00 33.88  ? 875 ALA D CA    1 
ATOM   10108 C  C     . ALA F 3 579 ? 105.406 -25.656 -18.015 1.00 35.07  ? 875 ALA D C     1 
ATOM   10109 O  O     . ALA F 3 579 ? 105.432 -25.368 -16.826 1.00 35.39  ? 875 ALA D O     1 
ATOM   10110 C  CB    . ALA F 3 579 ? 105.800 -28.131 -18.018 1.00 33.55  ? 875 ALA D CB    1 
ATOM   10111 N  N     . LYS F 3 580 ? 105.844 -24.836 -18.969 1.00 36.49  ? 876 LYS D N     1 
ATOM   10112 C  CA    . LYS F 3 580 ? 106.324 -23.471 -18.688 1.00 37.55  ? 876 LYS D CA    1 
ATOM   10113 C  C     . LYS F 3 580 ? 107.506 -23.403 -17.689 1.00 37.77  ? 876 LYS D C     1 
ATOM   10114 O  O     . LYS F 3 580 ? 107.748 -24.337 -16.923 1.00 37.91  ? 876 LYS D O     1 
ATOM   10115 C  CB    . LYS F 3 580 ? 105.148 -22.595 -18.231 1.00 37.77  ? 876 LYS D CB    1 
ATOM   10116 C  CG    . LYS F 3 580 ? 104.017 -22.506 -19.264 1.00 38.87  ? 876 LYS D CG    1 
ATOM   10117 C  CD    . LYS F 3 580 ? 102.711 -22.060 -18.618 1.00 40.47  ? 876 LYS D CD    1 
ATOM   10118 C  CE    . LYS F 3 580 ? 102.180 -23.161 -17.728 1.00 41.78  ? 876 LYS D CE    1 
ATOM   10119 N  NZ    . LYS F 3 580 ? 100.960 -22.781 -16.969 1.00 43.33  ? 876 LYS D NZ    1 
ATOM   10120 O  OXT   . LYS F 3 580 ? 108.270 -22.429 -17.618 1.00 37.93  ? 876 LYS D OXT   1 
HETATM 10121 C  C1    . GLC G 4 .   ? 112.874 -45.704 30.385  1.00 91.18  ? 1   GLC G C1    1 
HETATM 10122 C  C2    . GLC G 4 .   ? 111.653 -44.770 30.319  1.00 91.53  ? 1   GLC G C2    1 
HETATM 10123 C  C3    . GLC G 4 .   ? 111.771 -43.534 31.246  1.00 91.71  ? 1   GLC G C3    1 
HETATM 10124 C  C4    . GLC G 4 .   ? 112.450 -43.825 32.602  1.00 91.61  ? 1   GLC G C4    1 
HETATM 10125 C  C5    . GLC G 4 .   ? 113.616 -44.819 32.461  1.00 91.62  ? 1   GLC G C5    1 
HETATM 10126 C  C6    . GLC G 4 .   ? 114.245 -45.141 33.835  1.00 91.48  ? 1   GLC G C6    1 
HETATM 10127 O  O2    . GLC G 4 .   ? 111.478 -44.335 28.964  1.00 91.49  ? 1   GLC G O2    1 
HETATM 10128 O  O3    . GLC G 4 .   ? 110.464 -42.999 31.488  1.00 91.59  ? 1   GLC G O3    1 
HETATM 10129 O  O4    . GLC G 4 .   ? 112.939 -42.600 33.171  1.00 90.98  ? 1   GLC G O4    1 
HETATM 10130 O  O5    . GLC G 4 .   ? 113.179 -46.017 31.767  1.00 91.21  ? 1   GLC G O5    1 
HETATM 10131 O  O6    . GLC G 4 .   ? 113.305 -45.825 34.664  1.00 91.44  ? 1   GLC G O6    1 
HETATM 10132 C  C1    . FRU G 4 .   ? 114.106 -46.848 27.982  1.00 89.62  ? 2   FRU G C1    1 
HETATM 10133 C  C2    . FRU G 4 .   ? 114.878 -45.978 28.987  1.00 90.09  ? 2   FRU G C2    1 
HETATM 10134 C  C3    . FRU G 4 .   ? 115.967 -45.153 28.303  1.00 89.97  ? 2   FRU G C3    1 
HETATM 10135 C  C4    . FRU G 4 .   ? 116.826 -44.818 29.510  1.00 89.51  ? 2   FRU G C4    1 
HETATM 10136 C  C5    . FRU G 4 .   ? 116.923 -46.198 30.147  1.00 89.68  ? 2   FRU G C5    1 
HETATM 10137 C  C6    . FRU G 4 .   ? 117.191 -46.093 31.639  1.00 89.42  ? 2   FRU G C6    1 
HETATM 10138 O  O1    . FRU G 4 .   ? 114.909 -47.964 27.575  1.00 88.75  ? 2   FRU G O1    1 
HETATM 10139 O  O2    . FRU G 4 .   ? 113.986 -45.071 29.690  1.00 90.53  ? 2   FRU G O2    1 
HETATM 10140 O  O3    . FRU G 4 .   ? 115.408 -43.962 27.749  1.00 90.52  ? 2   FRU G O3    1 
HETATM 10141 O  O4    . FRU G 4 .   ? 118.125 -44.363 29.123  1.00 88.36  ? 2   FRU G O4    1 
HETATM 10142 O  O5    . FRU G 4 .   ? 115.610 -46.813 29.933  1.00 90.06  ? 2   FRU G O5    1 
HETATM 10143 O  O6    . FRU G 4 .   ? 117.252 -47.418 32.167  1.00 89.44  ? 2   FRU G O6    1 
HETATM 10144 C  C1    . GLC H 4 .   ? 141.469 -35.994 19.221  1.00 46.10  ? 1   GLC H C1    1 
HETATM 10145 C  C2    . GLC H 4 .   ? 142.654 -35.109 19.616  1.00 46.16  ? 1   GLC H C2    1 
HETATM 10146 C  C3    . GLC H 4 .   ? 142.219 -33.648 19.753  1.00 46.17  ? 1   GLC H C3    1 
HETATM 10147 C  C4    . GLC H 4 .   ? 141.306 -33.170 18.615  1.00 45.80  ? 1   GLC H C4    1 
HETATM 10148 C  C5    . GLC H 4 .   ? 140.488 -34.274 17.926  1.00 45.98  ? 1   GLC H C5    1 
HETATM 10149 C  C6    . GLC H 4 .   ? 140.299 -33.808 16.483  1.00 45.85  ? 1   GLC H C6    1 
HETATM 10150 O  O2    . GLC H 4 .   ? 143.217 -35.576 20.850  1.00 44.88  ? 1   GLC H O2    1 
HETATM 10151 O  O3    . GLC H 4 .   ? 143.396 -32.830 19.742  1.00 47.24  ? 1   GLC H O3    1 
HETATM 10152 O  O4    . GLC H 4 .   ? 140.411 -32.196 19.138  1.00 44.90  ? 1   GLC H O4    1 
HETATM 10153 O  O5    . GLC H 4 .   ? 141.061 -35.604 17.902  1.00 46.04  ? 1   GLC H O5    1 
HETATM 10154 O  O6    . GLC H 4 .   ? 140.698 -34.857 15.601  1.00 46.11  ? 1   GLC H O6    1 
HETATM 10155 C  C1    . FRU H 4 .   ? 141.215 -38.111 20.926  1.00 45.74  ? 2   FRU H C1    1 
HETATM 10156 C  C2    . FRU H 4 .   ? 139.942 -37.329 20.530  1.00 45.94  ? 2   FRU H C2    1 
HETATM 10157 C  C3    . FRU H 4 .   ? 138.931 -37.386 21.712  1.00 45.00  ? 2   FRU H C3    1 
HETATM 10158 C  C4    . FRU H 4 .   ? 137.637 -37.887 21.067  1.00 44.08  ? 2   FRU H C4    1 
HETATM 10159 C  C5    . FRU H 4 .   ? 138.203 -38.802 19.998  1.00 43.93  ? 2   FRU H C5    1 
HETATM 10160 C  C6    . FRU H 4 .   ? 137.111 -39.356 19.076  1.00 42.29  ? 2   FRU H C6    1 
HETATM 10161 O  O1    . FRU H 4 .   ? 142.137 -38.244 19.829  1.00 45.06  ? 2   FRU H O1    1 
HETATM 10162 O  O2    . FRU H 4 .   ? 140.373 -35.959 20.203  1.00 46.49  ? 2   FRU H O2    1 
HETATM 10163 O  O3    . FRU H 4 .   ? 138.733 -36.090 22.270  1.00 45.35  ? 2   FRU H O3    1 
HETATM 10164 O  O4    . FRU H 4 .   ? 136.906 -38.669 21.994  1.00 43.43  ? 2   FRU H O4    1 
HETATM 10165 O  O5    . FRU H 4 .   ? 139.192 -37.921 19.379  1.00 45.07  ? 2   FRU H O5    1 
HETATM 10166 O  O6    . FRU H 4 .   ? 137.693 -40.241 18.113  1.00 39.93  ? 2   FRU H O6    1 
HETATM 10167 C  C1    . GLC I 4 .   ? 135.055 -36.501 -18.022 1.00 53.81  ? 1   GLC I C1    1 
HETATM 10168 C  C2    . GLC I 4 .   ? 135.836 -35.786 -19.118 1.00 53.47  ? 1   GLC I C2    1 
HETATM 10169 C  C3    . GLC I 4 .   ? 134.987 -34.670 -19.754 1.00 53.65  ? 1   GLC I C3    1 
HETATM 10170 C  C4    . GLC I 4 .   ? 133.599 -35.180 -20.197 1.00 53.42  ? 1   GLC I C4    1 
HETATM 10171 C  C5    . GLC I 4 .   ? 132.898 -35.932 -19.046 1.00 53.39  ? 1   GLC I C5    1 
HETATM 10172 C  C6    . GLC I 4 .   ? 131.526 -36.535 -19.442 1.00 53.40  ? 1   GLC I C6    1 
HETATM 10173 O  O2    . GLC I 4 .   ? 136.985 -35.208 -18.502 1.00 53.33  ? 1   GLC I O2    1 
HETATM 10174 O  O3    . GLC I 4 .   ? 135.683 -34.080 -20.860 1.00 53.76  ? 1   GLC I O3    1 
HETATM 10175 O  O4    . GLC I 4 .   ? 132.789 -34.073 -20.610 1.00 51.91  ? 1   GLC I O4    1 
HETATM 10176 O  O5    . GLC I 4 .   ? 133.754 -36.981 -18.502 1.00 53.44  ? 1   GLC I O5    1 
HETATM 10177 O  O6    . GLC I 4 .   ? 131.490 -36.931 -20.821 1.00 52.94  ? 1   GLC I O6    1 
HETATM 10178 C  C1    . FRU I 4 .   ? 136.838 -36.114 -15.391 1.00 53.98  ? 2   FRU I C1    1 
HETATM 10179 C  C2    . FRU I 4 .   ? 135.325 -36.000 -15.586 1.00 53.78  ? 2   FRU I C2    1 
HETATM 10180 C  C3    . FRU I 4 .   ? 134.747 -35.016 -14.577 1.00 53.79  ? 2   FRU I C3    1 
HETATM 10181 C  C4    . FRU I 4 .   ? 133.284 -35.436 -14.572 1.00 53.92  ? 2   FRU I C4    1 
HETATM 10182 C  C5    . FRU I 4 .   ? 133.377 -36.970 -14.669 1.00 53.40  ? 2   FRU I C5    1 
HETATM 10183 C  C6    . FRU I 4 .   ? 132.305 -37.570 -15.584 1.00 52.74  ? 2   FRU I C6    1 
HETATM 10184 O  O1    . FRU I 4 .   ? 137.282 -37.400 -15.811 1.00 54.35  ? 2   FRU I O1    1 
HETATM 10185 O  O2    . FRU I 4 .   ? 134.989 -35.529 -16.926 1.00 53.98  ? 2   FRU I O2    1 
HETATM 10186 O  O3    . FRU I 4 .   ? 134.876 -33.676 -15.072 1.00 53.34  ? 2   FRU I O3    1 
HETATM 10187 O  O4    . FRU I 4 .   ? 132.670 -35.017 -13.342 1.00 52.86  ? 2   FRU I O4    1 
HETATM 10188 O  O5    . FRU I 4 .   ? 134.681 -37.263 -15.272 1.00 53.51  ? 2   FRU I O5    1 
HETATM 10189 O  O6    . FRU I 4 .   ? 132.696 -38.904 -15.942 1.00 52.28  ? 2   FRU I O6    1 
HETATM 10190 MN MN    . MN  J 5 .   ? 132.513 -29.183 42.801  1.00 64.00  ? 879 MN  A MN    1 
HETATM 10191 S  S     . SO4 K 6 .   ? 123.951 -78.905 20.965  1.00 112.49 ? 880 SO4 A S     1 
HETATM 10192 O  O1    . SO4 K 6 .   ? 122.992 -78.385 19.993  1.00 112.26 ? 880 SO4 A O1    1 
HETATM 10193 O  O2    . SO4 K 6 .   ? 125.049 -79.564 20.261  1.00 112.41 ? 880 SO4 A O2    1 
HETATM 10194 O  O3    . SO4 K 6 .   ? 124.489 -77.806 21.762  1.00 112.53 ? 880 SO4 A O3    1 
HETATM 10195 O  O4    . SO4 K 6 .   ? 123.285 -79.865 21.844  1.00 112.34 ? 880 SO4 A O4    1 
HETATM 10196 S  S     . SO4 L 6 .   ? 107.230 -14.796 14.674  1.00 43.94  ? 881 SO4 A S     1 
HETATM 10197 O  O1    . SO4 L 6 .   ? 108.585 -15.110 14.256  1.00 44.75  ? 881 SO4 A O1    1 
HETATM 10198 O  O2    . SO4 L 6 .   ? 106.761 -13.608 13.966  1.00 44.40  ? 881 SO4 A O2    1 
HETATM 10199 O  O3    . SO4 L 6 .   ? 106.379 -15.947 14.350  1.00 44.24  ? 881 SO4 A O3    1 
HETATM 10200 O  O4    . SO4 L 6 .   ? 107.219 -14.516 16.108  1.00 44.03  ? 881 SO4 A O4    1 
HETATM 10201 S  S     . SO4 M 6 .   ? 107.009 -6.608  14.513  1.00 62.29  ? 882 SO4 A S     1 
HETATM 10202 O  O1    . SO4 M 6 .   ? 108.035 -7.612  14.237  1.00 62.79  ? 882 SO4 A O1    1 
HETATM 10203 O  O2    . SO4 M 6 .   ? 105.831 -6.903  13.697  1.00 62.45  ? 882 SO4 A O2    1 
HETATM 10204 O  O3    . SO4 M 6 .   ? 106.670 -6.630  15.933  1.00 61.55  ? 882 SO4 A O3    1 
HETATM 10205 O  O4    . SO4 M 6 .   ? 107.518 -5.279  14.171  1.00 62.54  ? 882 SO4 A O4    1 
HETATM 10206 N  N1    . DCT N 7 .   ? 125.746 -24.813 38.725  1.00 56.45  ? 883 DCT A N1    1 
HETATM 10207 C  C2    . DCT N 7 .   ? 125.061 -23.712 38.184  1.00 56.26  ? 883 DCT A C2    1 
HETATM 10208 N  N3    . DCT N 7 .   ? 124.498 -22.754 39.048  1.00 56.24  ? 883 DCT A N3    1 
HETATM 10209 C  C4    . DCT N 7 .   ? 124.628 -22.897 40.436  1.00 56.49  ? 883 DCT A C4    1 
HETATM 10210 C  C5    . DCT N 7 .   ? 125.313 -23.983 40.972  1.00 56.16  ? 883 DCT A C5    1 
HETATM 10211 C  C6    . DCT N 7 .   ? 125.870 -24.937 40.126  1.00 56.08  ? 883 DCT A C6    1 
HETATM 10212 O  O2    . DCT N 7 .   ? 124.950 -23.588 36.960  1.00 56.34  ? 883 DCT A O2    1 
HETATM 10213 N  N4    . DCT N 7 .   ? 124.092 -21.987 41.241  1.00 56.77  ? 883 DCT A N4    1 
HETATM 10214 C  "C1'" . DCT N 7 .   ? 126.348 -25.825 37.802  1.00 57.22  ? 883 DCT A "C1'" 1 
HETATM 10215 C  "C2'" . DCT N 7 .   ? 127.576 -25.158 37.203  1.00 57.90  ? 883 DCT A "C2'" 1 
HETATM 10216 C  "C3'" . DCT N 7 .   ? 128.720 -25.679 38.056  1.00 57.87  ? 883 DCT A "C3'" 1 
HETATM 10217 C  "C4'" . DCT N 7 .   ? 128.298 -27.091 38.311  1.00 58.23  ? 883 DCT A "C4'" 1 
HETATM 10218 O  "O4'" . DCT N 7 .   ? 126.841 -27.045 38.448  1.00 57.98  ? 883 DCT A "O4'" 1 
HETATM 10219 C  "C5'" . DCT N 7 .   ? 129.021 -27.459 39.609  1.00 58.87  ? 883 DCT A "C5'" 1 
HETATM 10220 O  "O5'" . DCT N 7 .   ? 128.782 -26.533 40.700  1.00 60.37  ? 883 DCT A "O5'" 1 
HETATM 10221 P  PA    . DCT N 7 .   ? 129.088 -26.917 42.281  1.00 60.60  ? 883 DCT A PA    1 
HETATM 10222 O  O1A   . DCT N 7 .   ? 127.976 -26.384 43.101  1.00 60.96  ? 883 DCT A O1A   1 
HETATM 10223 O  O2A   . DCT N 7 .   ? 129.454 -28.340 42.412  1.00 60.33  ? 883 DCT A O2A   1 
HETATM 10224 O  O3A   . DCT N 7 .   ? 130.400 -26.039 42.627  1.00 61.55  ? 883 DCT A O3A   1 
HETATM 10225 P  PB    . DCT N 7 .   ? 131.807 -25.926 41.786  1.00 61.13  ? 883 DCT A PB    1 
HETATM 10226 O  O1B   . DCT N 7 .   ? 131.936 -24.483 41.449  1.00 61.44  ? 883 DCT A O1B   1 
HETATM 10227 O  O2B   . DCT N 7 .   ? 131.938 -26.942 40.709  1.00 60.76  ? 883 DCT A O2B   1 
HETATM 10228 O  O3B   . DCT N 7 .   ? 132.858 -26.333 42.958  1.00 60.82  ? 883 DCT A O3B   1 
HETATM 10229 P  PG    . DCT N 7 .   ? 132.797 -25.775 44.479  1.00 59.91  ? 883 DCT A PG    1 
HETATM 10230 O  O1G   . DCT N 7 .   ? 132.289 -24.223 44.463  1.00 60.01  ? 883 DCT A O1G   1 
HETATM 10231 O  O2G   . DCT N 7 .   ? 131.988 -26.635 45.376  1.00 60.20  ? 883 DCT A O2G   1 
HETATM 10232 O  O3G   . DCT N 7 .   ? 134.345 -25.678 44.968  1.00 60.46  ? 883 DCT A O3G   1 
HETATM 10233 MN MN    . MN  O 5 .   ? 114.130 -19.095 -10.273 1.00 23.11  ? 878 MN  D MN    1 
HETATM 10234 S  S     . SO4 P 6 .   ? 153.543 -55.288 -2.671  1.00 30.07  ? 879 SO4 D S     1 
HETATM 10235 O  O1    . SO4 P 6 .   ? 153.413 -54.191 -1.718  1.00 29.72  ? 879 SO4 D O1    1 
HETATM 10236 O  O2    . SO4 P 6 .   ? 154.659 -56.124 -2.261  1.00 31.34  ? 879 SO4 D O2    1 
HETATM 10237 O  O3    . SO4 P 6 .   ? 152.350 -56.135 -2.673  1.00 30.03  ? 879 SO4 D O3    1 
HETATM 10238 O  O4    . SO4 P 6 .   ? 153.788 -54.781 -4.021  1.00 30.04  ? 879 SO4 D O4    1 
HETATM 10239 S  S     . SO4 Q 6 .   ? 120.558 -3.504  8.077   1.00 70.80  ? 880 SO4 D S     1 
HETATM 10240 O  O1    . SO4 Q 6 .   ? 121.828 -2.800  7.889   1.00 70.88  ? 880 SO4 D O1    1 
HETATM 10241 O  O2    . SO4 Q 6 .   ? 120.078 -4.053  6.812   1.00 70.62  ? 880 SO4 D O2    1 
HETATM 10242 O  O3    . SO4 Q 6 .   ? 120.754 -4.591  9.031   1.00 71.27  ? 880 SO4 D O3    1 
HETATM 10243 O  O4    . SO4 Q 6 .   ? 119.561 -2.574  8.601   1.00 71.26  ? 880 SO4 D O4    1 
HETATM 10244 N  N1    . DCT R 7 .   ? 121.189 -15.729 -12.422 1.00 18.86  ? 881 DCT D N1    1 
HETATM 10245 C  C2    . DCT R 7 .   ? 122.134 -14.699 -12.439 1.00 18.58  ? 881 DCT D C2    1 
HETATM 10246 N  N3    . DCT R 7 .   ? 122.081 -13.717 -13.440 1.00 18.66  ? 881 DCT D N3    1 
HETATM 10247 C  C4    . DCT R 7 .   ? 121.063 -13.774 -14.415 1.00 19.37  ? 881 DCT D C4    1 
HETATM 10248 C  C5    . DCT R 7 .   ? 120.113 -14.797 -14.398 1.00 17.85  ? 881 DCT D C5    1 
HETATM 10249 C  C6    . DCT R 7 .   ? 120.175 -15.767 -13.405 1.00 18.48  ? 881 DCT D C6    1 
HETATM 10250 O  O2    . DCT R 7 .   ? 123.010 -14.673 -11.573 1.00 18.77  ? 881 DCT D O2    1 
HETATM 10251 N  N4    . DCT R 7 .   ? 121.017 -12.846 -15.370 1.00 19.16  ? 881 DCT D N4    1 
HETATM 10252 C  "C1'" . DCT R 7 .   ? 121.251 -16.748 -11.336 1.00 19.37  ? 881 DCT D "C1'" 1 
HETATM 10253 C  "C2'" . DCT R 7 .   ? 120.722 -16.088 -10.045 1.00 19.33  ? 881 DCT D "C2'" 1 
HETATM 10254 C  "C3'" . DCT R 7 .   ? 119.309 -16.606 -9.928  1.00 19.82  ? 881 DCT D "C3'" 1 
HETATM 10255 C  "C4'" . DCT R 7 .   ? 119.461 -18.000 -10.488 1.00 20.96  ? 881 DCT D "C4'" 1 
HETATM 10256 O  "O4'" . DCT R 7 .   ? 120.336 -17.822 -11.621 1.00 20.79  ? 881 DCT D "O4'" 1 
HETATM 10257 C  "C5'" . DCT R 7 .   ? 118.097 -18.495 -11.006 1.00 21.79  ? 881 DCT D "C5'" 1 
HETATM 10258 O  "O5'" . DCT R 7 .   ? 117.687 -17.734 -12.151 1.00 22.33  ? 881 DCT D "O5'" 1 
HETATM 10259 P  PA    . DCT R 7 .   ? 116.148 -17.499 -12.466 1.00 21.68  ? 881 DCT D PA    1 
HETATM 10260 O  O1A   . DCT R 7 .   ? 115.936 -16.974 -13.836 1.00 22.19  ? 881 DCT D O1A   1 
HETATM 10261 O  O2A   . DCT R 7 .   ? 115.425 -18.710 -12.017 1.00 21.49  ? 881 DCT D O2A   1 
HETATM 10262 O  O3A   . DCT R 7 .   ? 115.901 -16.194 -11.633 1.00 22.60  ? 881 DCT D O3A   1 
HETATM 10263 P  PB    . DCT R 7 .   ? 115.237 -16.092 -10.215 1.00 23.25  ? 881 DCT D PB    1 
HETATM 10264 O  O1B   . DCT R 7 .   ? 115.997 -15.031 -9.497  1.00 23.24  ? 881 DCT D O1B   1 
HETATM 10265 O  O2B   . DCT R 7 .   ? 115.090 -17.435 -9.588  1.00 24.24  ? 881 DCT D O2B   1 
HETATM 10266 O  O3B   . DCT R 7 .   ? 113.842 -15.432 -10.635 1.00 22.01  ? 881 DCT D O3B   1 
HETATM 10267 P  PG    . DCT R 7 .   ? 112.498 -16.206 -11.012 1.00 19.51  ? 881 DCT D PG    1 
HETATM 10268 O  O1G   . DCT R 7 .   ? 111.975 -15.572 -12.408 1.00 17.77  ? 881 DCT D O1G   1 
HETATM 10269 O  O2G   . DCT R 7 .   ? 112.615 -17.679 -11.076 1.00 20.50  ? 881 DCT D O2G   1 
HETATM 10270 O  O3G   . DCT R 7 .   ? 111.423 -15.679 -9.920  1.00 20.71  ? 881 DCT D O3G   1 
HETATM 10271 O  O     . HOH S 8 .   ? 120.889 -32.718 40.754  1.00 8.79   ? 10  HOH B O     1 
HETATM 10272 O  O     . HOH S 8 .   ? 118.321 -27.361 51.709  1.00 13.20  ? 91  HOH B O     1 
HETATM 10273 O  O     . HOH S 8 .   ? 121.040 -24.477 42.206  1.00 16.62  ? 95  HOH B O     1 
HETATM 10274 O  O     . HOH S 8 .   ? 107.011 -29.192 35.965  1.00 12.61  ? 117 HOH B O     1 
HETATM 10275 O  O     . HOH S 8 .   ? 104.971 -18.933 39.295  1.00 28.85  ? 148 HOH B O     1 
HETATM 10276 O  O     . HOH T 8 .   ? 121.155 -32.074 35.911  1.00 12.60  ? 26  HOH C O     1 
HETATM 10277 O  O     . HOH T 8 .   ? 117.043 -28.839 32.513  1.00 9.85   ? 31  HOH C O     1 
HETATM 10278 O  O     . HOH T 8 .   ? 118.368 -33.566 39.557  1.00 10.60  ? 54  HOH C O     1 
HETATM 10279 O  O     . HOH T 8 .   ? 100.855 -27.939 44.702  1.00 11.90  ? 110 HOH C O     1 
HETATM 10280 O  O     . HOH T 8 .   ? 111.829 -38.695 36.134  1.00 23.38  ? 127 HOH C O     1 
HETATM 10281 O  O     . HOH T 8 .   ? 114.402 -26.485 35.883  1.00 26.41  ? 147 HOH C O     1 
HETATM 10282 O  O     . HOH T 8 .   ? 115.016 -24.006 31.420  1.00 26.91  ? 159 HOH C O     1 
HETATM 10283 O  O     . HOH T 8 .   ? 109.039 -38.060 39.061  1.00 27.01  ? 189 HOH C O     1 
HETATM 10284 O  O     . HOH T 8 .   ? 116.207 -29.512 27.658  1.00 25.07  ? 228 HOH C O     1 
HETATM 10285 O  O     . HOH T 8 .   ? 118.103 -20.936 38.598  1.00 28.70  ? 248 HOH C O     1 
HETATM 10286 O  O     . HOH T 8 .   ? 90.478  -24.416 40.975  1.00 30.39  ? 250 HOH C O     1 
HETATM 10287 O  O     . HOH U 8 .   ? 115.512 -17.540 -26.756 1.00 26.56  ? 46  HOH E O     1 
HETATM 10288 O  O     . HOH U 8 .   ? 126.706 -18.907 -32.260 1.00 21.42  ? 53  HOH E O     1 
HETATM 10289 O  O     . HOH U 8 .   ? 117.781 -15.524 -26.471 1.00 14.27  ? 92  HOH E O     1 
HETATM 10290 O  O     . HOH U 8 .   ? 135.545 -15.595 -34.331 1.00 26.20  ? 119 HOH E O     1 
HETATM 10291 O  O     . HOH U 8 .   ? 133.730 -20.584 -25.737 1.00 27.74  ? 131 HOH E O     1 
HETATM 10292 O  O     . HOH U 8 .   ? 123.822 -12.992 -20.734 1.00 32.31  ? 139 HOH E O     1 
HETATM 10293 O  O     . HOH U 8 .   ? 122.288 -13.169 -22.828 1.00 21.50  ? 141 HOH E O     1 
HETATM 10294 O  O     . HOH U 8 .   ? 121.568 -12.873 -27.500 1.00 25.61  ? 173 HOH E O     1 
HETATM 10295 O  O     . HOH U 8 .   ? 121.896 -14.077 -19.127 1.00 27.62  ? 190 HOH E O     1 
HETATM 10296 O  O     . HOH U 8 .   ? 131.298 -11.540 -28.116 1.00 15.87  ? 257 HOH E O     1 
HETATM 10297 O  O     . HOH V 8 .   ? 124.957 -23.957 -19.527 1.00 12.39  ? 21  HOH F O     1 
HETATM 10298 O  O     . HOH V 8 .   ? 124.555 -24.215 -27.298 1.00 12.72  ? 28  HOH F O     1 
HETATM 10299 O  O     . HOH V 8 .   ? 135.210 -24.013 -13.794 1.00 6.15   ? 43  HOH F O     1 
HETATM 10300 O  O     . HOH V 8 .   ? 131.551 -19.104 -16.565 1.00 5.86   ? 50  HOH F O     1 
HETATM 10301 O  O     . HOH V 8 .   ? 132.306 -25.583 -21.616 1.00 27.11  ? 71  HOH F O     1 
HETATM 10302 O  O     . HOH V 8 .   ? 132.249 -16.445 -15.399 1.00 8.86   ? 97  HOH F O     1 
HETATM 10303 O  O     . HOH V 8 .   ? 131.075 -18.669 -22.870 1.00 18.55  ? 111 HOH F O     1 
HETATM 10304 O  O     . HOH V 8 .   ? 136.956 -6.634  -17.989 1.00 25.63  ? 135 HOH F O     1 
HETATM 10305 O  O     . HOH V 8 .   ? 127.047 -11.631 -18.712 1.00 9.85   ? 137 HOH F O     1 
HETATM 10306 O  O     . HOH V 8 .   ? 135.239 -13.920 -12.882 1.00 9.58   ? 177 HOH F O     1 
HETATM 10307 O  O     . HOH V 8 .   ? 130.380 -17.226 -19.433 1.00 19.47  ? 184 HOH F O     1 
HETATM 10308 O  O     . HOH V 8 .   ? 130.049 -14.767 -17.263 1.00 19.82  ? 191 HOH F O     1 
HETATM 10309 O  O     . HOH V 8 .   ? 132.293 -21.928 -19.437 1.00 23.71  ? 192 HOH F O     1 
HETATM 10310 O  O     . HOH V 8 .   ? 135.480 -19.255 -14.007 1.00 18.08  ? 198 HOH F O     1 
HETATM 10311 O  O     . HOH V 8 .   ? 133.480 -26.643 -32.722 1.00 18.04  ? 236 HOH F O     1 
HETATM 10312 O  O     . HOH V 8 .   ? 129.108 -5.769  -17.542 1.00 26.21  ? 263 HOH F O     1 
HETATM 10313 O  O     . HOH W 8 .   ? 122.174 -35.845 45.901  1.00 9.81   ? 24  HOH A O     1 
HETATM 10314 O  O     . HOH W 8 .   ? 142.481 -13.781 27.377  1.00 17.69  ? 37  HOH A O     1 
HETATM 10315 O  O     . HOH W 8 .   ? 128.233 -33.665 35.036  1.00 37.35  ? 38  HOH A O     1 
HETATM 10316 O  O     . HOH W 8 .   ? 121.471 -38.521 30.824  1.00 2.00   ? 39  HOH A O     1 
HETATM 10317 O  O     . HOH W 8 .   ? 126.153 -36.182 36.146  1.00 43.34  ? 49  HOH A O     1 
HETATM 10318 O  O     . HOH W 8 .   ? 113.169 -56.098 12.974  1.00 44.86  ? 51  HOH A O     1 
HETATM 10319 O  O     . HOH W 8 .   ? 128.472 -30.730 34.144  1.00 26.94  ? 62  HOH A O     1 
HETATM 10320 O  O     . HOH W 8 .   ? 120.458 -34.821 36.015  1.00 28.40  ? 63  HOH A O     1 
HETATM 10321 O  O     . HOH W 8 .   ? 125.739 -25.660 34.001  1.00 41.51  ? 65  HOH A O     1 
HETATM 10322 O  O     . HOH W 8 .   ? 119.473 -36.125 38.250  1.00 8.83   ? 66  HOH A O     1 
HETATM 10323 O  O     . HOH W 8 .   ? 135.928 -10.577 40.702  1.00 18.51  ? 67  HOH A O     1 
HETATM 10324 O  O     . HOH W 8 .   ? 118.489 -39.918 21.299  1.00 19.72  ? 68  HOH A O     1 
HETATM 10325 O  O     . HOH W 8 .   ? 123.099 -46.664 30.238  1.00 2.61   ? 76  HOH A O     1 
HETATM 10326 O  O     . HOH W 8 .   ? 111.275 -51.629 19.845  1.00 7.81   ? 79  HOH A O     1 
HETATM 10327 O  O     . HOH W 8 .   ? 129.569 -30.562 36.337  1.00 14.92  ? 81  HOH A O     1 
HETATM 10328 O  O     . HOH W 8 .   ? 113.999 -51.312 22.978  1.00 25.96  ? 82  HOH A O     1 
HETATM 10329 O  O     . HOH W 8 .   ? 112.083 -48.817 60.560  1.00 22.88  ? 86  HOH A O     1 
HETATM 10330 O  O     . HOH W 8 .   ? 124.809 -39.934 30.025  1.00 29.50  ? 88  HOH A O     1 
HETATM 10331 O  O     . HOH W 8 .   ? 124.409 -46.285 44.413  1.00 33.36  ? 94  HOH A O     1 
HETATM 10332 O  O     . HOH W 8 .   ? 119.787 -48.017 31.511  1.00 19.97  ? 99  HOH A O     1 
HETATM 10333 O  O     . HOH W 8 .   ? 108.287 -51.012 37.555  1.00 25.20  ? 101 HOH A O     1 
HETATM 10334 O  O     . HOH W 8 .   ? 98.816  -30.258 52.240  1.00 17.46  ? 102 HOH A O     1 
HETATM 10335 O  O     . HOH W 8 .   ? 125.249 -37.126 24.441  1.00 38.81  ? 104 HOH A O     1 
HETATM 10336 O  O     . HOH W 8 .   ? 101.987 -22.992 47.798  1.00 31.14  ? 105 HOH A O     1 
HETATM 10337 O  O     . HOH W 8 .   ? 137.945 -28.633 40.311  1.00 30.35  ? 108 HOH A O     1 
HETATM 10338 O  O     . HOH W 8 .   ? 113.678 -36.283 44.833  1.00 53.81  ? 109 HOH A O     1 
HETATM 10339 O  O     . HOH W 8 .   ? 102.473 -12.239 42.198  1.00 23.27  ? 112 HOH A O     1 
HETATM 10340 O  O     . HOH W 8 .   ? 116.063 -32.056 60.831  1.00 27.27  ? 114 HOH A O     1 
HETATM 10341 O  O     . HOH W 8 .   ? 104.526 -11.438 33.725  1.00 47.02  ? 120 HOH A O     1 
HETATM 10342 O  O     . HOH W 8 .   ? 108.600 -55.531 16.150  1.00 35.86  ? 121 HOH A O     1 
HETATM 10343 O  O     . HOH W 8 .   ? 131.680 -32.463 36.552  1.00 28.21  ? 124 HOH A O     1 
HETATM 10344 O  O     . HOH W 8 .   ? 115.076 -48.898 45.581  1.00 26.18  ? 125 HOH A O     1 
HETATM 10345 O  O     . HOH W 8 .   ? 95.857  -28.355 54.047  1.00 12.29  ? 138 HOH A O     1 
HETATM 10346 O  O     . HOH W 8 .   ? 134.829 -21.013 20.284  1.00 24.41  ? 144 HOH A O     1 
HETATM 10347 O  O     . HOH W 8 .   ? 130.341 -69.596 16.588  1.00 44.73  ? 145 HOH A O     1 
HETATM 10348 O  O     . HOH W 8 .   ? 107.779 -47.250 22.670  1.00 20.35  ? 149 HOH A O     1 
HETATM 10349 O  O     . HOH W 8 .   ? 137.784 -42.194 28.079  1.00 26.12  ? 152 HOH A O     1 
HETATM 10350 O  O     . HOH W 8 .   ? 129.299 -31.048 44.651  1.00 29.29  ? 155 HOH A O     1 
HETATM 10351 O  O     . HOH W 8 .   ? 118.893 -31.190 13.652  1.00 15.33  ? 158 HOH A O     1 
HETATM 10352 O  O     . HOH W 8 .   ? 122.025 -17.306 44.528  1.00 37.44  ? 160 HOH A O     1 
HETATM 10353 O  O     . HOH W 8 .   ? 112.856 -22.645 53.554  1.00 22.34  ? 162 HOH A O     1 
HETATM 10354 O  O     . HOH W 8 .   ? 97.191  -7.188  45.297  1.00 39.22  ? 167 HOH A O     1 
HETATM 10355 O  O     . HOH W 8 .   ? 123.270 -25.770 27.576  1.00 16.78  ? 178 HOH A O     1 
HETATM 10356 O  O     . HOH W 8 .   ? 97.263  -26.141 54.151  1.00 17.58  ? 180 HOH A O     1 
HETATM 10357 O  O     . HOH W 8 .   ? 137.236 -18.464 21.506  1.00 36.56  ? 183 HOH A O     1 
HETATM 10358 O  O     . HOH W 8 .   ? 122.163 -42.468 61.280  1.00 26.68  ? 188 HOH A O     1 
HETATM 10359 O  O     . HOH W 8 .   ? 120.649 -45.421 31.038  1.00 13.01  ? 194 HOH A O     1 
HETATM 10360 O  O     . HOH W 8 .   ? 117.240 -19.390 9.654   1.00 24.54  ? 195 HOH A O     1 
HETATM 10361 O  O     . HOH W 8 .   ? 106.926 -16.498 63.504  1.00 31.55  ? 199 HOH A O     1 
HETATM 10362 O  O     . HOH W 8 .   ? 133.618 -48.507 42.039  1.00 26.59  ? 200 HOH A O     1 
HETATM 10363 O  O     . HOH W 8 .   ? 109.942 -53.440 38.910  1.00 26.29  ? 201 HOH A O     1 
HETATM 10364 O  O     . HOH W 8 .   ? 137.141 -49.079 34.606  1.00 18.17  ? 202 HOH A O     1 
HETATM 10365 O  O     . HOH W 8 .   ? 120.360 -34.910 13.399  1.00 21.34  ? 203 HOH A O     1 
HETATM 10366 O  O     . HOH W 8 .   ? 107.965 -49.935 56.989  1.00 18.52  ? 204 HOH A O     1 
HETATM 10367 O  O     . HOH W 8 .   ? 125.362 -62.324 8.802   1.00 20.37  ? 206 HOH A O     1 
HETATM 10368 O  O     . HOH W 8 .   ? 137.374 -50.431 17.179  1.00 35.05  ? 209 HOH A O     1 
HETATM 10369 O  O     . HOH W 8 .   ? 91.236  -27.169 50.028  1.00 26.97  ? 210 HOH A O     1 
HETATM 10370 O  O     . HOH W 8 .   ? 142.128 -11.699 26.814  1.00 19.44  ? 212 HOH A O     1 
HETATM 10371 O  O     . HOH W 8 .   ? 94.840  -17.097 43.306  1.00 44.23  ? 219 HOH A O     1 
HETATM 10372 O  O     . HOH W 8 .   ? 127.737 -62.402 9.792   1.00 15.74  ? 220 HOH A O     1 
HETATM 10373 O  O     . HOH W 8 .   ? 132.621 -57.309 29.431  1.00 30.86  ? 221 HOH A O     1 
HETATM 10374 O  O     . HOH W 8 .   ? 127.686 -42.664 7.761   1.00 25.60  ? 224 HOH A O     1 
HETATM 10375 O  O     . HOH W 8 .   ? 117.539 -25.588 18.767  1.00 24.44  ? 225 HOH A O     1 
HETATM 10376 O  O     . HOH W 8 .   ? 95.751  -20.448 39.093  1.00 36.57  ? 227 HOH A O     1 
HETATM 10377 O  O     . HOH W 8 .   ? 134.054 -1.785  42.090  1.00 17.16  ? 229 HOH A O     1 
HETATM 10378 O  O     . HOH W 8 .   ? 136.239 -6.538  49.723  1.00 25.42  ? 231 HOH A O     1 
HETATM 10379 O  O     . HOH W 8 .   ? 113.018 -13.873 53.806  1.00 22.14  ? 233 HOH A O     1 
HETATM 10380 O  O     . HOH W 8 .   ? 108.802 -19.296 60.153  1.00 34.60  ? 234 HOH A O     1 
HETATM 10381 O  O     . HOH W 8 .   ? 136.648 -7.153  42.940  1.00 23.85  ? 235 HOH A O     1 
HETATM 10382 O  O     . HOH W 8 .   ? 100.786 -19.601 40.747  1.00 21.58  ? 238 HOH A O     1 
HETATM 10383 O  O     . HOH W 8 .   ? 132.968 -59.131 33.541  1.00 31.06  ? 245 HOH A O     1 
HETATM 10384 O  O     . HOH W 8 .   ? 99.715  -4.868  42.774  1.00 23.02  ? 246 HOH A O     1 
HETATM 10385 O  O     . HOH W 8 .   ? 108.255 -18.203 21.236  1.00 32.38  ? 251 HOH A O     1 
HETATM 10386 O  O     . HOH W 8 .   ? 115.314 -75.829 20.229  1.00 29.41  ? 256 HOH A O     1 
HETATM 10387 O  O     . HOH W 8 .   ? 116.309 -14.636 38.215  1.00 18.72  ? 259 HOH A O     1 
HETATM 10388 O  O     . HOH W 8 .   ? 138.772 -23.593 46.529  1.00 35.93  ? 260 HOH A O     1 
HETATM 10389 O  O     . HOH W 8 .   ? 126.872 -65.772 34.744  1.00 21.02  ? 262 HOH A O     1 
HETATM 10390 O  O     . HOH W 8 .   ? 115.399 -10.600 13.891  1.00 45.50  ? 264 HOH A O     1 
HETATM 10391 O  O     . HOH W 8 .   ? 139.932 -57.344 33.538  1.00 35.50  ? 265 HOH A O     1 
HETATM 10392 O  O     . HOH W 8 .   ? 122.998 -12.224 47.768  1.00 20.66  ? 267 HOH A O     1 
HETATM 10393 O  O     . HOH W 8 .   ? 92.352  -24.544 38.562  1.00 29.48  ? 268 HOH A O     1 
HETATM 10394 O  O     . HOH W 8 .   ? 89.304  -24.142 46.845  1.00 29.13  ? 270 HOH A O     1 
HETATM 10395 O  O     . HOH W 8 .   ? 117.926 -78.610 17.603  1.00 33.18  ? 271 HOH A O     1 
HETATM 10396 O  O     . HOH W 8 .   ? 138.920 -9.764  59.707  1.00 34.18  ? 272 HOH A O     1 
HETATM 10397 O  O     . HOH W 8 .   ? 129.005 -26.536 53.729  1.00 38.33  ? 274 HOH A O     1 
HETATM 10398 O  O     . HOH W 8 .   ? 136.769 -1.616  42.588  1.00 36.54  ? 278 HOH A O     1 
HETATM 10399 O  O     . HOH X 8 .   ? 131.893 -16.087 -8.275  1.00 24.23  ? 1   HOH D O     1 
HETATM 10400 O  O     . HOH X 8 .   ? 129.886 -29.043 -11.655 1.00 2.00   ? 2   HOH D O     1 
HETATM 10401 O  O     . HOH X 8 .   ? 148.634 -46.888 -6.211  1.00 6.82   ? 3   HOH D O     1 
HETATM 10402 O  O     . HOH X 8 .   ? 126.670 -25.174 -15.366 1.00 8.38   ? 4   HOH D O     1 
HETATM 10403 O  O     . HOH X 8 .   ? 117.287 -25.923 -20.369 1.00 19.31  ? 5   HOH D O     1 
HETATM 10404 O  O     . HOH X 8 .   ? 125.893 -22.555 -14.671 1.00 13.79  ? 6   HOH D O     1 
HETATM 10405 O  O     . HOH X 8 .   ? 122.577 -24.407 -8.340  1.00 20.08  ? 7   HOH D O     1 
HETATM 10406 O  O     . HOH X 8 .   ? 136.533 -46.401 -9.439  1.00 19.59  ? 8   HOH D O     1 
HETATM 10407 O  O     . HOH X 8 .   ? 138.385 -55.386 3.160   1.00 18.06  ? 9   HOH D O     1 
HETATM 10408 O  O     . HOH X 8 .   ? 129.046 -29.566 -8.744  1.00 16.94  ? 11  HOH D O     1 
HETATM 10409 O  O     . HOH X 8 .   ? 135.277 -47.377 -22.379 1.00 28.88  ? 12  HOH D O     1 
HETATM 10410 O  O     . HOH X 8 .   ? 144.153 -18.658 -0.525  1.00 11.18  ? 13  HOH D O     1 
HETATM 10411 O  O     . HOH X 8 .   ? 125.522 -25.907 -17.760 1.00 2.00   ? 14  HOH D O     1 
HETATM 10412 O  O     . HOH X 8 .   ? 118.989 -36.720 -20.362 1.00 12.36  ? 15  HOH D O     1 
HETATM 10413 O  O     . HOH X 8 .   ? 148.768 -46.349 -12.517 1.00 11.87  ? 16  HOH D O     1 
HETATM 10414 O  O     . HOH X 8 .   ? 123.153 -26.629 -11.117 1.00 12.73  ? 17  HOH D O     1 
HETATM 10415 O  O     . HOH X 8 .   ? 112.642 -30.612 2.020   1.00 18.34  ? 18  HOH D O     1 
HETATM 10416 O  O     . HOH X 8 .   ? 117.862 -36.983 -18.221 1.00 19.31  ? 19  HOH D O     1 
HETATM 10417 O  O     . HOH X 8 .   ? 143.429 -20.469 3.348   1.00 4.54   ? 20  HOH D O     1 
HETATM 10418 O  O     . HOH X 8 .   ? 145.129 -41.854 -12.770 1.00 34.81  ? 22  HOH D O     1 
HETATM 10419 O  O     . HOH X 8 .   ? 140.053 -27.585 1.427   1.00 19.00  ? 23  HOH D O     1 
HETATM 10420 O  O     . HOH X 8 .   ? 132.583 -27.580 -4.771  1.00 21.02  ? 25  HOH D O     1 
HETATM 10421 O  O     . HOH X 8 .   ? 125.005 -16.008 -9.810  1.00 14.16  ? 27  HOH D O     1 
HETATM 10422 O  O     . HOH X 8 .   ? 126.965 -41.743 1.120   1.00 10.29  ? 29  HOH D O     1 
HETATM 10423 O  O     . HOH X 8 .   ? 97.055  -37.217 -7.744  1.00 15.24  ? 30  HOH D O     1 
HETATM 10424 O  O     . HOH X 8 .   ? 129.844 -37.522 -10.119 1.00 9.27   ? 32  HOH D O     1 
HETATM 10425 O  O     . HOH X 8 .   ? 139.534 -23.213 -4.690  1.00 35.36  ? 33  HOH D O     1 
HETATM 10426 O  O     . HOH X 8 .   ? 157.463 -39.908 -7.938  1.00 8.43   ? 34  HOH D O     1 
HETATM 10427 O  O     . HOH X 8 .   ? 130.509 -39.867 -8.902  1.00 9.27   ? 35  HOH D O     1 
HETATM 10428 O  O     . HOH X 8 .   ? 142.229 -44.973 3.830   1.00 18.52  ? 36  HOH D O     1 
HETATM 10429 O  O     . HOH X 8 .   ? 124.446 -49.285 -11.715 1.00 8.07   ? 40  HOH D O     1 
HETATM 10430 O  O     . HOH X 8 .   ? 141.249 -42.159 -12.964 1.00 11.71  ? 41  HOH D O     1 
HETATM 10431 O  O     . HOH X 8 .   ? 127.895 -49.595 -20.834 1.00 27.90  ? 42  HOH D O     1 
HETATM 10432 O  O     . HOH X 8 .   ? 118.018 -2.608  5.049   1.00 24.48  ? 44  HOH D O     1 
HETATM 10433 O  O     . HOH X 8 .   ? 112.449 -41.018 -19.281 1.00 2.00   ? 45  HOH D O     1 
HETATM 10434 O  O     . HOH X 8 .   ? 113.397 -39.442 -8.968  1.00 44.82  ? 47  HOH D O     1 
HETATM 10435 O  O     . HOH X 8 .   ? 109.159 -24.553 -20.619 1.00 36.78  ? 48  HOH D O     1 
HETATM 10436 O  O     . HOH X 8 .   ? 126.093 -44.396 -2.830  1.00 7.69   ? 52  HOH D O     1 
HETATM 10437 O  O     . HOH X 8 .   ? 121.473 -12.445 -31.868 1.00 17.25  ? 55  HOH D O     1 
HETATM 10438 O  O     . HOH X 8 .   ? 140.760 -20.813 -6.536  1.00 17.52  ? 56  HOH D O     1 
HETATM 10439 O  O     . HOH X 8 .   ? 124.318 -17.983 -34.948 1.00 39.18  ? 57  HOH D O     1 
HETATM 10440 O  O     . HOH X 8 .   ? 115.096 -40.492 -12.652 1.00 24.11  ? 58  HOH D O     1 
HETATM 10441 O  O     . HOH X 8 .   ? 96.347  -31.165 -4.877  1.00 6.43   ? 59  HOH D O     1 
HETATM 10442 O  O     . HOH X 8 .   ? 117.608 -44.854 -24.389 1.00 6.84   ? 60  HOH D O     1 
HETATM 10443 O  O     . HOH X 8 .   ? 112.364 -19.060 -3.835  1.00 2.00   ? 61  HOH D O     1 
HETATM 10444 O  O     . HOH X 8 .   ? 136.314 -39.618 -14.595 1.00 18.09  ? 64  HOH D O     1 
HETATM 10445 O  O     . HOH X 8 .   ? 137.942 -21.052 -8.369  1.00 23.50  ? 69  HOH D O     1 
HETATM 10446 O  O     . HOH X 8 .   ? 136.083 -46.966 -12.081 1.00 16.88  ? 70  HOH D O     1 
HETATM 104