data_2HVY
# 
_entry.id   2HVY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HVY         
NDB   PR0224       
RCSB  RCSB038825   
WWPDB D_1000038825 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HVY 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Ye, K.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of an H/ACA box ribonucleoprotein particle' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            443 
_citation.page_first                302 
_citation.page_last                 307 
_citation.year                      2006 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16943774 
_citation.pdbx_database_id_DOI      10.1038/nature05151 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, L.' 1 
primary 'Ye, K.' 2 
# 
_cell.entry_id           2HVY 
_cell.length_a           83.031 
_cell.length_b           90.950 
_cell.length_c           114.064 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HVY 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'H/ACA RNA'                              21021.512 1   ?        ?   ? ? 
2 polymer     man 'Probable tRNA pseudouridine synthase B' 39453.898 1   5.4.99.- ?   ? ? 
3 polymer     man 'Small nucleolar rnp similar to gar1'    12340.823 1   ?        ?   ? ? 
4 polymer     man 'Ribosome biogenesis protein Nop10'      7214.603  1   ?        R2K ? ? 
5 polymer     man '50S ribosomal protein L7Ae'             14314.623 1   ?        M2A ? ? 
6 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"              507.181   1   ?        ?   ? ? 
7 non-polymer syn 'ZINC ION'                               65.409    1   ?        ?   ? ? 
8 water       nat water                                    18.015    118 ?        ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 'tRNA pseudouridine 55 synthase, Psi55 synthase, tRNA-uridine isomerase, tRNA pseudouridylate synthase' 
3 Gar1                                                                                                    
4 Nop10                                                                                                   
5 L7ae                                                                                                    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGGUCCGCCUUGAGUGCCCGGGUGAGAAGCAUGAUCCCGGGUAAUUAUGGCGGACCCACAGAAUU 
GGGUCCGCCUUGAGUGCCCGGGUGAGAAGCAUGAUCCCGGGUAAUUAUGGCGGACCCACAGAAUU E ? 
2 'polypeptide(L)'   no no 
;MARDEVRRILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGT
LDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEV
LEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAI
QPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDV
EKVFMPRDWYPKLWEKRDRSHHHHHH
;
;MARDEVRRILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGT
LDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEV
LEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAI
QPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDV
EKVFMPRDWYPKLWEKRDRSHHHHHH
;
A ? 
3 'polypeptide(L)'   no no 
;MEKQGEKMKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVD
ERKRKESPKKNKEKRMKKKKRLNR
;
;MEKQGEKMKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVD
ERKRKESPKKNKEKRMKKKKRLNR
;
B ? 
4 'polypeptide(L)'   no no MKFRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGIGRKEK 
MKFRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGIGRKEK C ? 
5 'polypeptide(L)'   no no 
;MAAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIY
VPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMKHHHHHH
;
;MAAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIY
VPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMKHHHHHH
;
D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   G   n 
1 3   G   n 
1 4   U   n 
1 5   C   n 
1 6   C   n 
1 7   G   n 
1 8   C   n 
1 9   C   n 
1 10  U   n 
1 11  U   n 
1 12  G   n 
1 13  A   n 
1 14  G   n 
1 15  U   n 
1 16  G   n 
1 17  C   n 
1 18  C   n 
1 19  C   n 
1 20  G   n 
1 21  G   n 
1 22  G   n 
1 23  U   n 
1 24  G   n 
1 25  A   n 
1 26  G   n 
1 27  A   n 
1 28  A   n 
1 29  G   n 
1 30  C   n 
1 31  A   n 
1 32  U   n 
1 33  G   n 
1 34  A   n 
1 35  U   n 
1 36  C   n 
1 37  C   n 
1 38  C   n 
1 39  G   n 
1 40  G   n 
1 41  G   n 
1 42  U   n 
1 43  A   n 
1 44  A   n 
1 45  U   n 
1 46  U   n 
1 47  A   n 
1 48  U   n 
1 49  G   n 
1 50  G   n 
1 51  C   n 
1 52  G   n 
1 53  G   n 
1 54  A   n 
1 55  C   n 
1 56  C   n 
1 57  C   n 
1 58  A   n 
1 59  C   n 
1 60  A   n 
1 61  G   n 
1 62  A   n 
1 63  A   n 
1 64  U   n 
1 65  U   n 
2 1   MET n 
2 2   ALA n 
2 3   ARG n 
2 4   ASP n 
2 5   GLU n 
2 6   VAL n 
2 7   ARG n 
2 8   ARG n 
2 9   ILE n 
2 10  LEU n 
2 11  PRO n 
2 12  ALA n 
2 13  ASP n 
2 14  ILE n 
2 15  LYS n 
2 16  ARG n 
2 17  GLU n 
2 18  VAL n 
2 19  LEU n 
2 20  ILE n 
2 21  LYS n 
2 22  ASP n 
2 23  GLU n 
2 24  ASN n 
2 25  ALA n 
2 26  GLU n 
2 27  THR n 
2 28  ASN n 
2 29  PRO n 
2 30  ASP n 
2 31  TRP n 
2 32  GLY n 
2 33  PHE n 
2 34  PRO n 
2 35  PRO n 
2 36  GLU n 
2 37  LYS n 
2 38  ARG n 
2 39  PRO n 
2 40  ILE n 
2 41  GLU n 
2 42  MET n 
2 43  HIS n 
2 44  ILE n 
2 45  GLN n 
2 46  PHE n 
2 47  GLY n 
2 48  VAL n 
2 49  ILE n 
2 50  ASN n 
2 51  LEU n 
2 52  ASP n 
2 53  LYS n 
2 54  PRO n 
2 55  PRO n 
2 56  GLY n 
2 57  PRO n 
2 58  THR n 
2 59  SER n 
2 60  HIS n 
2 61  GLU n 
2 62  VAL n 
2 63  VAL n 
2 64  ALA n 
2 65  TRP n 
2 66  ILE n 
2 67  LYS n 
2 68  LYS n 
2 69  ILE n 
2 70  LEU n 
2 71  ASN n 
2 72  LEU n 
2 73  GLU n 
2 74  LYS n 
2 75  ALA n 
2 76  GLY n 
2 77  HIS n 
2 78  GLY n 
2 79  GLY n 
2 80  THR n 
2 81  LEU n 
2 82  ASP n 
2 83  PRO n 
2 84  LYS n 
2 85  VAL n 
2 86  SER n 
2 87  GLY n 
2 88  VAL n 
2 89  LEU n 
2 90  PRO n 
2 91  VAL n 
2 92  ALA n 
2 93  LEU n 
2 94  GLU n 
2 95  LYS n 
2 96  ALA n 
2 97  THR n 
2 98  ARG n 
2 99  VAL n 
2 100 VAL n 
2 101 GLN n 
2 102 ALA n 
2 103 LEU n 
2 104 LEU n 
2 105 PRO n 
2 106 ALA n 
2 107 GLY n 
2 108 LYS n 
2 109 GLU n 
2 110 TYR n 
2 111 VAL n 
2 112 ALA n 
2 113 LEU n 
2 114 MET n 
2 115 HIS n 
2 116 LEU n 
2 117 HIS n 
2 118 GLY n 
2 119 ASP n 
2 120 VAL n 
2 121 PRO n 
2 122 GLU n 
2 123 ASP n 
2 124 LYS n 
2 125 ILE n 
2 126 ILE n 
2 127 GLN n 
2 128 VAL n 
2 129 MET n 
2 130 LYS n 
2 131 GLU n 
2 132 PHE n 
2 133 GLU n 
2 134 GLY n 
2 135 GLU n 
2 136 ILE n 
2 137 ILE n 
2 138 GLN n 
2 139 ARG n 
2 140 PRO n 
2 141 PRO n 
2 142 LEU n 
2 143 ARG n 
2 144 SER n 
2 145 ALA n 
2 146 VAL n 
2 147 LYS n 
2 148 ARG n 
2 149 ARG n 
2 150 LEU n 
2 151 ARG n 
2 152 THR n 
2 153 ARG n 
2 154 LYS n 
2 155 VAL n 
2 156 TYR n 
2 157 TYR n 
2 158 ILE n 
2 159 GLU n 
2 160 VAL n 
2 161 LEU n 
2 162 GLU n 
2 163 ILE n 
2 164 GLU n 
2 165 GLY n 
2 166 ARG n 
2 167 ASP n 
2 168 VAL n 
2 169 LEU n 
2 170 PHE n 
2 171 ARG n 
2 172 VAL n 
2 173 GLY n 
2 174 VAL n 
2 175 GLU n 
2 176 ALA n 
2 177 GLY n 
2 178 THR n 
2 179 TYR n 
2 180 ILE n 
2 181 ARG n 
2 182 SER n 
2 183 LEU n 
2 184 ILE n 
2 185 HIS n 
2 186 HIS n 
2 187 ILE n 
2 188 GLY n 
2 189 LEU n 
2 190 ALA n 
2 191 LEU n 
2 192 GLY n 
2 193 VAL n 
2 194 GLY n 
2 195 ALA n 
2 196 HIS n 
2 197 MET n 
2 198 SER n 
2 199 GLU n 
2 200 LEU n 
2 201 ARG n 
2 202 ARG n 
2 203 THR n 
2 204 ARG n 
2 205 SER n 
2 206 GLY n 
2 207 PRO n 
2 208 PHE n 
2 209 LYS n 
2 210 GLU n 
2 211 ASP n 
2 212 GLU n 
2 213 THR n 
2 214 LEU n 
2 215 ILE n 
2 216 THR n 
2 217 LEU n 
2 218 HIS n 
2 219 ASP n 
2 220 LEU n 
2 221 VAL n 
2 222 ASP n 
2 223 TYR n 
2 224 TYR n 
2 225 TYR n 
2 226 PHE n 
2 227 TRP n 
2 228 LYS n 
2 229 GLU n 
2 230 ASP n 
2 231 GLY n 
2 232 ILE n 
2 233 GLU n 
2 234 GLU n 
2 235 TYR n 
2 236 PHE n 
2 237 ARG n 
2 238 LYS n 
2 239 ALA n 
2 240 ILE n 
2 241 GLN n 
2 242 PRO n 
2 243 MET n 
2 244 GLU n 
2 245 LYS n 
2 246 ALA n 
2 247 VAL n 
2 248 GLU n 
2 249 HIS n 
2 250 LEU n 
2 251 PRO n 
2 252 LYS n 
2 253 VAL n 
2 254 TRP n 
2 255 ILE n 
2 256 LYS n 
2 257 ASP n 
2 258 SER n 
2 259 ALA n 
2 260 VAL n 
2 261 ALA n 
2 262 ALA n 
2 263 VAL n 
2 264 THR n 
2 265 HIS n 
2 266 GLY n 
2 267 ALA n 
2 268 ASP n 
2 269 LEU n 
2 270 ALA n 
2 271 VAL n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 ALA n 
2 276 LYS n 
2 277 LEU n 
2 278 HIS n 
2 279 ALA n 
2 280 GLY n 
2 281 ILE n 
2 282 LYS n 
2 283 ARG n 
2 284 GLY n 
2 285 ASP n 
2 286 LEU n 
2 287 VAL n 
2 288 ALA n 
2 289 ILE n 
2 290 MET n 
2 291 THR n 
2 292 LEU n 
2 293 LYS n 
2 294 ASP n 
2 295 GLU n 
2 296 LEU n 
2 297 VAL n 
2 298 ALA n 
2 299 LEU n 
2 300 GLY n 
2 301 LYS n 
2 302 ALA n 
2 303 MET n 
2 304 MET n 
2 305 THR n 
2 306 SER n 
2 307 GLN n 
2 308 GLU n 
2 309 MET n 
2 310 LEU n 
2 311 GLU n 
2 312 LYS n 
2 313 THR n 
2 314 LYS n 
2 315 GLY n 
2 316 ILE n 
2 317 ALA n 
2 318 VAL n 
2 319 ASP n 
2 320 VAL n 
2 321 GLU n 
2 322 LYS n 
2 323 VAL n 
2 324 PHE n 
2 325 MET n 
2 326 PRO n 
2 327 ARG n 
2 328 ASP n 
2 329 TRP n 
2 330 TYR n 
2 331 PRO n 
2 332 LYS n 
2 333 LEU n 
2 334 TRP n 
2 335 GLU n 
2 336 LYS n 
2 337 ARG n 
2 338 ASP n 
2 339 ARG n 
2 340 SER n 
2 341 HIS n 
2 342 HIS n 
2 343 HIS n 
2 344 HIS n 
2 345 HIS n 
2 346 HIS n 
3 1   MET n 
3 2   GLU n 
3 3   LYS n 
3 4   GLN n 
3 5   GLY n 
3 6   GLU n 
3 7   LYS n 
3 8   MET n 
3 9   LYS n 
3 10  ARG n 
3 11  LEU n 
3 12  GLY n 
3 13  LYS n 
3 14  VAL n 
3 15  LEU n 
3 16  HIS n 
3 17  TYR n 
3 18  ALA n 
3 19  LYS n 
3 20  GLN n 
3 21  GLY n 
3 22  PHE n 
3 23  LEU n 
3 24  ILE n 
3 25  VAL n 
3 26  ARG n 
3 27  THR n 
3 28  ASN n 
3 29  TRP n 
3 30  VAL n 
3 31  PRO n 
3 32  SER n 
3 33  LEU n 
3 34  ASN n 
3 35  ASP n 
3 36  ARG n 
3 37  VAL n 
3 38  VAL n 
3 39  ASP n 
3 40  LYS n 
3 41  ARG n 
3 42  LEU n 
3 43  GLN n 
3 44  PHE n 
3 45  VAL n 
3 46  GLY n 
3 47  ILE n 
3 48  VAL n 
3 49  LYS n 
3 50  ASP n 
3 51  VAL n 
3 52  PHE n 
3 53  GLY n 
3 54  PRO n 
3 55  VAL n 
3 56  LYS n 
3 57  MET n 
3 58  PRO n 
3 59  TYR n 
3 60  VAL n 
3 61  ALA n 
3 62  ILE n 
3 63  LYS n 
3 64  PRO n 
3 65  LYS n 
3 66  VAL n 
3 67  SER n 
3 68  ASN n 
3 69  PRO n 
3 70  GLU n 
3 71  ILE n 
3 72  TYR n 
3 73  VAL n 
3 74  GLY n 
3 75  GLU n 
3 76  VAL n 
3 77  LEU n 
3 78  TYR n 
3 79  VAL n 
3 80  ASP n 
3 81  GLU n 
3 82  ARG n 
3 83  LYS n 
3 84  ARG n 
3 85  LYS n 
3 86  GLU n 
3 87  SER n 
3 88  PRO n 
3 89  LYS n 
3 90  LYS n 
3 91  ASN n 
3 92  LYS n 
3 93  GLU n 
3 94  LYS n 
3 95  ARG n 
3 96  MET n 
3 97  LYS n 
3 98  LYS n 
3 99  LYS n 
3 100 LYS n 
3 101 ARG n 
3 102 LEU n 
3 103 ASN n 
3 104 ARG n 
4 1   MET n 
4 2   LYS n 
4 3   PHE n 
4 4   ARG n 
4 5   ILE n 
4 6   ARG n 
4 7   LYS n 
4 8   CYS n 
4 9   PRO n 
4 10  LYS n 
4 11  CYS n 
4 12  GLY n 
4 13  ARG n 
4 14  TYR n 
4 15  THR n 
4 16  LEU n 
4 17  LYS n 
4 18  GLU n 
4 19  VAL n 
4 20  CYS n 
4 21  PRO n 
4 22  VAL n 
4 23  CYS n 
4 24  GLY n 
4 25  GLU n 
4 26  LYS n 
4 27  THR n 
4 28  LYS n 
4 29  VAL n 
4 30  ALA n 
4 31  HIS n 
4 32  PRO n 
4 33  PRO n 
4 34  ARG n 
4 35  PHE n 
4 36  SER n 
4 37  PRO n 
4 38  GLU n 
4 39  ASP n 
4 40  PRO n 
4 41  TYR n 
4 42  GLY n 
4 43  GLU n 
4 44  TYR n 
4 45  ARG n 
4 46  ARG n 
4 47  ARG n 
4 48  TRP n 
4 49  LYS n 
4 50  ARG n 
4 51  GLU n 
4 52  VAL n 
4 53  LEU n 
4 54  GLY n 
4 55  ILE n 
4 56  GLY n 
4 57  ARG n 
4 58  LYS n 
4 59  GLU n 
4 60  LYS n 
5 1   MET n 
5 2   ALA n 
5 3   ALA n 
5 4   LYS n 
5 5   PRO n 
5 6   SER n 
5 7   TYR n 
5 8   VAL n 
5 9   LYS n 
5 10  PHE n 
5 11  GLU n 
5 12  VAL n 
5 13  PRO n 
5 14  LYS n 
5 15  GLU n 
5 16  LEU n 
5 17  ALA n 
5 18  GLU n 
5 19  LYS n 
5 20  ALA n 
5 21  LEU n 
5 22  GLN n 
5 23  ALA n 
5 24  VAL n 
5 25  GLU n 
5 26  ILE n 
5 27  ALA n 
5 28  ARG n 
5 29  ASP n 
5 30  THR n 
5 31  GLY n 
5 32  LYS n 
5 33  ILE n 
5 34  ARG n 
5 35  LYS n 
5 36  GLY n 
5 37  THR n 
5 38  ASN n 
5 39  GLU n 
5 40  THR n 
5 41  THR n 
5 42  LYS n 
5 43  ALA n 
5 44  VAL n 
5 45  GLU n 
5 46  ARG n 
5 47  GLY n 
5 48  GLN n 
5 49  ALA n 
5 50  LYS n 
5 51  LEU n 
5 52  VAL n 
5 53  ILE n 
5 54  ILE n 
5 55  ALA n 
5 56  GLU n 
5 57  ASP n 
5 58  VAL n 
5 59  ASP n 
5 60  PRO n 
5 61  GLU n 
5 62  GLU n 
5 63  ILE n 
5 64  VAL n 
5 65  ALA n 
5 66  HIS n 
5 67  LEU n 
5 68  PRO n 
5 69  PRO n 
5 70  LEU n 
5 71  CYS n 
5 72  GLU n 
5 73  GLU n 
5 74  LYS n 
5 75  GLU n 
5 76  ILE n 
5 77  PRO n 
5 78  TYR n 
5 79  ILE n 
5 80  TYR n 
5 81  VAL n 
5 82  PRO n 
5 83  SER n 
5 84  LYS n 
5 85  LYS n 
5 86  GLU n 
5 87  LEU n 
5 88  GLY n 
5 89  ALA n 
5 90  ALA n 
5 91  ALA n 
5 92  GLY n 
5 93  ILE n 
5 94  GLU n 
5 95  VAL n 
5 96  ALA n 
5 97  ALA n 
5 98  ALA n 
5 99  SER n 
5 100 VAL n 
5 101 ALA n 
5 102 ILE n 
5 103 ILE n 
5 104 GLU n 
5 105 PRO n 
5 106 GLY n 
5 107 LYS n 
5 108 ALA n 
5 109 ARG n 
5 110 ASP n 
5 111 LEU n 
5 112 VAL n 
5 113 GLU n 
5 114 GLU n 
5 115 ILE n 
5 116 ALA n 
5 117 MET n 
5 118 LYS n 
5 119 VAL n 
5 120 LYS n 
5 121 GLU n 
5 122 LEU n 
5 123 MET n 
5 124 LYS n 
5 125 HIS n 
5 126 HIS n 
5 127 HIS n 
5 128 HIS n 
5 129 HIS n 
5 130 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
2 1 sample ? ? ? ? Pyrococcus truB   ? ? ? ? ? ? 'Pyrococcus furiosus' 2261 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? 
? ? ? 'BL21(DE3) Rosseta2' ? ? ? ? ? ? ? Plasmid ? ? ? pETDuet-1  ? ? 
3 1 sample ? ? ? ? Pyrococcus GAR1   ? ? ? ? ? ? 'Pyrococcus furiosus' 2261 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? 
? ? ? 'BL21(DE3) Rosseta2' ? ? ? ? ? ? ? Plasmid ? ? ? pRSFDuet-1 ? ? 
4 1 sample ? ? ? ? Pyrococcus NOP10  ? ? ? ? ? ? 'Pyrococcus furiosus' 2261 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? 
? ? ? 'BL21(DE3) Rosseta2' ? ? ? ? ? ? ? Plasmid ? ? ? pETDuet-1  ? ? 
5 1 sample ? ? ? ? Pyrococcus rpl7ae ? ? ? ? ? ? 'Pyrococcus furiosus' 2261 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? 
? ? ? 'BL21(DE3) Rosseta2' ? ? ? ? ? ? ? Plasmid ? ? ? pRSFDuet-1 ? ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Derived from Afu-46 RNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TRUB_PYRFU   Q7LWY0 2 
;MARDEVRRILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGT
LDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEV
LEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAI
QPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDV
EKVFMPRDWYPKLWEKRDRS
;
1 ? 
2 UNP Q8U029_PYRFU Q8U029 3 
;MEKQGEKMKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVD
ERKRKESPKKNKEKRMKKKKRLNR
;
1 ? 
3 UNP NOP10_PYRFU  Q8U1R4 4 MRFRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGIGRKEK 1 ? 
4 UNP RL7A_PYRFU   Q8U160 5 
;MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYV
PSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
;
1 ? 
5 PDB 2HVY         2HVY   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HVY A 1 ? 340 ? Q7LWY0 1 ? 340 ? 4  343 
2 2 2HVY B 1 ? 104 ? Q8U029 1 ? 104 ? -6 97  
3 3 2HVY C 1 ? 60  ? Q8U1R4 1 ? 60  ? 1  60  
4 4 2HVY D 2 ? 124 ? Q8U160 1 ? 123 ? 2  124 
5 5 2HVY E 1 ? 65  ? 2HVY   1 ? 65  ? 1  65  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HVY HIS A 341 ? UNP Q7LWY0 ?   ? 'EXPRESSION TAG'        344 1  
1 2HVY HIS A 342 ? UNP Q7LWY0 ?   ? 'EXPRESSION TAG'        345 2  
1 2HVY HIS A 343 ? UNP Q7LWY0 ?   ? 'EXPRESSION TAG'        346 3  
1 2HVY HIS A 344 ? UNP Q7LWY0 ?   ? 'EXPRESSION TAG'        347 4  
1 2HVY HIS A 345 ? UNP Q7LWY0 ?   ? 'EXPRESSION TAG'        348 5  
1 2HVY HIS A 346 ? UNP Q7LWY0 ?   ? 'EXPRESSION TAG'        349 6  
3 2HVY LYS C 2   ? UNP Q8U1R4 ARG 2 ENGINEERED              2   7  
4 2HVY MET D 1   ? UNP Q8U160 ?   ? 'INITIATING METHIONINE' 1   8  
4 2HVY ALA D 2   ? UNP Q8U160 MET 1 ENGINEERED              2   9  
4 2HVY HIS D 125 ? UNP Q8U160 ?   ? 'EXPRESSION TAG'        125 10 
4 2HVY HIS D 126 ? UNP Q8U160 ?   ? 'EXPRESSION TAG'        126 11 
4 2HVY HIS D 127 ? UNP Q8U160 ?   ? 'EXPRESSION TAG'        127 12 
4 2HVY HIS D 128 ? UNP Q8U160 ?   ? 'EXPRESSION TAG'        128 13 
4 2HVY HIS D 129 ? UNP Q8U160 ?   ? 'EXPRESSION TAG'        129 14 
4 2HVY HIS D 130 ? UNP Q8U160 ?   ? 'EXPRESSION TAG'        130 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"  ? 'C10 H16 N5 O13 P3' 507.181 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'      121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                        ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                   ? 'Zn 2'              65.409  
# 
_exptl.entry_id          2HVY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   46.09 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            303 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
'30% MPD, 35mM CH3COOMg, 10mM ATP, 50mM cacodylate , pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 303K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 MPD        ? ? ? 
1 2  1 CH3COOMg   ? ? ? 
1 3  1 ATP        ? ? ? 
1 4  1 cacodylate ? ? ? 
1 5  1 H2O        ? ? ? 
1 6  2 MPD        ? ? ? 
1 7  2 CH3COOMg   ? ? ? 
1 8  2 ATP        ? ? ? 
1 9  2 cacodylate ? ? ? 
1 10 2 H2O        ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-07-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double-crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2HVY 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            2.3 
_reflns.d_resolution_low             20 
_reflns.number_all                   39340 
_reflns.number_obs                   39234 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.055 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        38.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.8 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.34 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.331 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.7 
_reflns_shell.pdbx_redundancy        7.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1950 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HVY 
_refine.ls_number_reflns_obs                     36983 
_refine.ls_number_reflns_all                     37072 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.76 
_refine.ls_R_factor_obs                          0.23984 
_refine.ls_R_factor_all                          0.23984 
_refine.ls_R_factor_R_work                       0.23786 
_refine.ls_R_factor_R_free                       0.27807 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1914 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.B_iso_mean                               43.191 
_refine.aniso_B[1][1]                            -0.27 
_refine.aniso_B[2][2]                            2.40 
_refine.aniso_B[3][3]                            -2.14 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      2EY4 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'TLS isotropic' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.369 
_refine.pdbx_overall_ESU_R_Free                  0.260 
_refine.overall_SU_ML                            0.196 
_refine.overall_SU_B                             16.054 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4512 
_refine_hist.pdbx_number_atoms_nucleic_acid   1235 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             118 
_refine_hist.number_atoms_total               5897 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.006  0.022  ? 6019 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.045  2.250  ? 8420 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   4.815  5.000  ? 563  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   34.482 23.617 ? 188  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   14.902 15.000 ? 860  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   15.315 15.000 ? 32   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.081  0.200  ? 989  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.002  0.020  ? 3993 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.155  0.200  ? 2440 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.288  0.200  ? 3940 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.111  0.200  ? 236  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.134  0.200  ? 57   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.134  0.200  ? 5    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.193  1.500  ? 2950 'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.341  2.000  ? 4605 'X-RAY DIFFRACTION' ? 
r_scbond_it              0.379  3.000  ? 3913 'X-RAY DIFFRACTION' ? 
r_scangle_it             0.641  4.500  ? 3815 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.359 
_refine_ls_shell.number_reflns_R_work             2680 
_refine_ls_shell.R_factor_R_work                  0.298 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.355 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             120 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HVY 
_struct.title                     'Crystal structure of an H/ACA box RNP from Pyrococcus furiosus' 
_struct.pdbx_descriptor           
;tRNA pseudouridine synthase B(5.4.99.-)/Small nucleolar rnp similar to gar1/Ribosome biogenesis protein Nop10/50S ribosomal protein L7Ae/RNA
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HVY 
_struct_keywords.pdbx_keywords   'ISOMERASE/BIOSYNTHETIC PROTEIN/RNA' 
_struct_keywords.text            'H/ACA RNA, RNP, PSEUDOURIDINE synthase, Guide RNA, ISOMERASE-BIOSYNTHETIC PROTEIN-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 8 ? 
I N N 8 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO B 34  ? ARG B 38  ? PRO A 37  ARG A 41  5 ? 5  
HELX_P HELX_P2  2  PRO B 39  ? PHE B 46  ? PRO A 42  PHE A 49  1 ? 8  
HELX_P HELX_P3  3  THR B 58  ? LEU B 70  ? THR A 61  LEU A 73  1 ? 13 
HELX_P HELX_P4  4  LYS B 95  ? LEU B 103 ? LYS A 98  LEU A 106 5 ? 9  
HELX_P HELX_P5  5  PRO B 121 ? PHE B 132 ? PRO A 124 PHE A 135 1 ? 12 
HELX_P HELX_P6  6  TYR B 179 ? LEU B 191 ? TYR A 182 LEU A 194 1 ? 13 
HELX_P HELX_P7  7  THR B 216 ? GLU B 229 ? THR A 219 GLU A 232 1 ? 14 
HELX_P HELX_P8  8  GLU B 233 ? ALA B 239 ? GLU A 236 ALA A 242 1 ? 7  
HELX_P HELX_P9  9  GLU B 244 ? GLU B 248 ? GLU A 247 GLU A 251 5 ? 5  
HELX_P HELX_P10 10 LYS B 256 ? HIS B 265 ? LYS A 259 HIS A 268 1 ? 10 
HELX_P HELX_P11 11 THR B 305 ? LYS B 312 ? THR A 308 LYS A 315 1 ? 8  
HELX_P HELX_P12 12 ASN C 68  ? VAL C 73  ? ASN B 61  VAL B 66  5 ? 6  
HELX_P HELX_P13 13 TYR D 41  ? GLY D 54  ? TYR C 41  GLY C 54  1 ? 14 
HELX_P HELX_P14 14 PRO E 13  ? GLY E 31  ? PRO D 13  GLY D 31  1 ? 19 
HELX_P HELX_P15 15 GLY E 36  ? ARG E 46  ? GLY D 36  ARG D 46  1 ? 11 
HELX_P HELX_P16 16 GLU E 61  ? HIS E 66  ? GLU D 61  HIS D 66  1 ? 6  
HELX_P HELX_P17 17 HIS E 66  ? LYS E 74  ? HIS D 66  LYS D 74  1 ? 9  
HELX_P HELX_P18 18 SER E 83  ? ALA E 91  ? SER D 83  ALA D 91  1 ? 9  
HELX_P HELX_P19 19 PRO E 105 ? LYS E 107 ? PRO D 105 LYS D 107 5 ? 3  
HELX_P HELX_P20 20 ALA E 108 ? LYS E 124 ? ALA D 108 LYS D 124 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 11 SG ? ? C ZN 201 C CYS 11 1_555 ? ? ? ? ? ? ?             2.382 ? 
metalc2  metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 20 SG ? ? C ZN 201 C CYS 20 1_555 ? ? ? ? ? ? ?             2.139 ? 
metalc3  metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 23 SG ? ? C ZN 201 C CYS 23 1_555 ? ? ? ? ? ? ?             2.370 ? 
metalc4  metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 8  SG ? ? C ZN 201 C CYS 8  1_555 ? ? ? ? ? ? ?             2.467 ? 
hydrog1  hydrog ? ? A G  1  N1 ? ? ? 1_555 A C   57 N3 ? ? E G  1   E C   57 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog2  hydrog ? ? A G  1  N2 ? ? ? 1_555 A C   57 O2 ? ? E G  1   E C   57 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog3  hydrog ? ? A G  1  O6 ? ? ? 1_555 A C   57 N4 ? ? E G  1   E C   57 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog4  hydrog ? ? A G  2  N1 ? ? ? 1_555 A C   56 N3 ? ? E G  2   E C   56 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog5  hydrog ? ? A G  2  N2 ? ? ? 1_555 A C   56 O2 ? ? E G  2   E C   56 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog6  hydrog ? ? A G  2  O6 ? ? ? 1_555 A C   56 N4 ? ? E G  2   E C   56 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog7  hydrog ? ? A G  3  N1 ? ? ? 1_555 A C   55 N3 ? ? E G  3   E C   55 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog8  hydrog ? ? A G  3  N2 ? ? ? 1_555 A C   55 O2 ? ? E G  3   E C   55 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog9  hydrog ? ? A G  3  O6 ? ? ? 1_555 A C   55 N4 ? ? E G  3   E C   55 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog10 hydrog ? ? A U  4  N3 ? ? ? 1_555 A A   54 N1 ? ? E U  4   E A   54 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog11 hydrog ? ? A U  4  O4 ? ? ? 1_555 A A   54 N6 ? ? E U  4   E A   54 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog12 hydrog ? ? A C  5  N3 ? ? ? 1_555 A G   53 N1 ? ? E C  5   E G   53 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog13 hydrog ? ? A C  5  N4 ? ? ? 1_555 A G   53 O6 ? ? E C  5   E G   53 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog14 hydrog ? ? A C  5  O2 ? ? ? 1_555 A G   53 N2 ? ? E C  5   E G   53 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog15 hydrog ? ? A C  6  N3 ? ? ? 1_555 A G   52 N1 ? ? E C  6   E G   52 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog16 hydrog ? ? A C  6  N4 ? ? ? 1_555 A G   52 O6 ? ? E C  6   E G   52 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog17 hydrog ? ? A C  6  O2 ? ? ? 1_555 A G   52 N2 ? ? E C  6   E G   52 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog18 hydrog ? ? A G  7  N1 ? ? ? 1_555 A C   51 N3 ? ? E G  7   E C   51 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog19 hydrog ? ? A G  7  N2 ? ? ? 1_555 A C   51 O2 ? ? E G  7   E C   51 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog20 hydrog ? ? A G  7  O6 ? ? ? 1_555 A C   51 N4 ? ? E G  7   E C   51 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog21 hydrog ? ? A C  8  N3 ? ? ? 1_555 A G   50 N1 ? ? E C  8   E G   50 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog22 hydrog ? ? A C  8  N4 ? ? ? 1_555 A G   50 O6 ? ? E C  8   E G   50 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog23 hydrog ? ? A C  8  O2 ? ? ? 1_555 A G   50 N2 ? ? E C  8   E G   50 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog24 hydrog ? ? A C  9  N3 ? ? ? 1_555 A G   49 N1 ? ? E C  9   E G   49 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog25 hydrog ? ? A C  9  N4 ? ? ? 1_555 A G   49 O6 ? ? E C  9   E G   49 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog26 hydrog ? ? A C  9  O2 ? ? ? 1_555 A G   49 N2 ? ? E C  9   E G   49 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog27 hydrog ? ? A U  11 O2 ? ? ? 1_555 A A   44 N6 ? ? E U  11  E A   44 1_555 ? ? ? ? ? ? 'U-A PAIR'    ?     ? 
hydrog28 hydrog ? ? A G  16 N1 ? ? ? 1_555 A U   42 O2 ? ? E G  16  E U   42 1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog29 hydrog ? ? A G  16 O6 ? ? ? 1_555 A U   42 N3 ? ? E G  16  E U   42 1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog30 hydrog ? ? A C  17 N3 ? ? ? 1_555 A G   41 N1 ? ? E C  17  E G   41 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog31 hydrog ? ? A C  17 N4 ? ? ? 1_555 A G   41 O6 ? ? E C  17  E G   41 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog32 hydrog ? ? A C  17 O2 ? ? ? 1_555 A G   41 N2 ? ? E C  17  E G   41 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog33 hydrog ? ? A C  18 N3 ? ? ? 1_555 A G   40 N1 ? ? E C  18  E G   40 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog34 hydrog ? ? A C  18 N4 ? ? ? 1_555 A G   40 O6 ? ? E C  18  E G   40 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog35 hydrog ? ? A C  18 O2 ? ? ? 1_555 A G   40 N2 ? ? E C  18  E G   40 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog36 hydrog ? ? A C  19 N3 ? ? ? 1_555 A G   39 N1 ? ? E C  19  E G   39 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog37 hydrog ? ? A C  19 N4 ? ? ? 1_555 A G   39 O6 ? ? E C  19  E G   39 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog38 hydrog ? ? A C  19 O2 ? ? ? 1_555 A G   39 N2 ? ? E C  19  E G   39 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog39 hydrog ? ? A G  20 N1 ? ? ? 1_555 A C   38 N3 ? ? E G  20  E C   38 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog40 hydrog ? ? A G  20 N2 ? ? ? 1_555 A C   38 O2 ? ? E G  20  E C   38 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog41 hydrog ? ? A G  20 O6 ? ? ? 1_555 A C   38 N4 ? ? E G  20  E C   38 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog42 hydrog ? ? A G  21 N1 ? ? ? 1_555 A C   37 N3 ? ? E G  21  E C   37 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog43 hydrog ? ? A G  21 N2 ? ? ? 1_555 A C   37 O2 ? ? E G  21  E C   37 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog44 hydrog ? ? A G  21 O6 ? ? ? 1_555 A C   37 N4 ? ? E G  21  E C   37 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog45 hydrog ? ? A G  22 N1 ? ? ? 1_555 A C   36 N3 ? ? E G  22  E C   36 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog46 hydrog ? ? A G  22 N2 ? ? ? 1_555 A C   36 O2 ? ? E G  22  E C   36 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog47 hydrog ? ? A G  22 O6 ? ? ? 1_555 A C   36 N4 ? ? E G  22  E C   36 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog48 hydrog ? ? A U  23 N3 ? ? ? 1_555 A U   35 O4 ? ? E U  23  E U   35 1_555 ? ? ? ? ? ? TYPE_16_PAIR  ?     ? 
hydrog49 hydrog ? ? A U  23 O2 ? ? ? 1_555 A U   35 N3 ? ? E U  23  E U   35 1_555 ? ? ? ? ? ? TYPE_16_PAIR  ?     ? 
hydrog50 hydrog ? ? A G  24 N2 ? ? ? 1_555 A A   34 N7 ? ? E G  24  E A   34 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ?     ? 
hydrog51 hydrog ? ? A G  24 N3 ? ? ? 1_555 A A   34 N6 ? ? E G  24  E A   34 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ?     ? 
hydrog52 hydrog ? ? A A  25 N6 ? ? ? 1_555 A G   33 N3 ? ? E A  25  E G   33 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ?     ? 
hydrog53 hydrog ? ? A A  25 N7 ? ? ? 1_555 A G   33 N2 ? ? E A  25  E G   33 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ?     ? 
hydrog54 hydrog ? ? A C  56 O2 ? ? ? 1_555 A A   58 N6 ? ? E C  56  E A   58 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           59 
_struct_mon_prot_cis.label_asym_id          E 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            59 
_struct_mon_prot_cis.auth_asym_id           D 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    60 
_struct_mon_prot_cis.pdbx_label_asym_id_2   E 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     60 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    D 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.29 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7  ? 
B ? 20 ? 
C ? 5  ? 
D ? 4  ? 
E ? 3  ? 
F ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? parallel      
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
B 10 11 ? anti-parallel 
B 11 12 ? anti-parallel 
B 12 13 ? anti-parallel 
B 13 14 ? anti-parallel 
B 14 15 ? anti-parallel 
B 15 16 ? anti-parallel 
B 16 17 ? anti-parallel 
B 17 18 ? anti-parallel 
B 18 19 ? parallel      
B 19 20 ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? parallel      
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL B 18  ? ILE B 20  ? VAL A 21  ILE A 23  
A 2  ILE B 274 ? HIS B 278 ? ILE A 277 HIS A 281 
A 3  LYS B 252 ? ILE B 255 ? LYS A 255 ILE A 258 
A 4  LEU B 286 ? THR B 291 ? LEU A 289 THR A 294 
A 5  LEU B 296 ? ALA B 302 ? LEU A 299 ALA A 305 
A 6  ILE B 316 ? VAL B 323 ? ILE A 319 VAL A 326 
A 7  LEU B 269 ? ALA B 270 ? LEU A 272 ALA A 273 
B 1  PHE B 208 ? LYS B 209 ? PHE A 211 LYS A 212 
B 2  ALA B 195 ? SER B 205 ? ALA A 198 SER A 208 
B 3  LYS B 108 ? LEU B 116 ? LYS A 111 LEU A 119 
B 4  ASP B 167 ? VAL B 174 ? ASP A 170 VAL A 177 
B 5  ARG B 151 ? GLU B 164 ? ARG A 154 GLU A 167 
B 6  GLY B 134 ? ARG B 139 ? GLY A 137 ARG A 142 
B 7  PHE C 44  ? PRO C 54  ? PHE B 37  PRO B 47  
B 8  TYR C 59  ? PRO C 64  ? TYR B 52  PRO B 57  
B 9  PHE C 22  ? ARG C 26  ? PHE B 15  ARG B 19  
B 10 LYS C 9   ? ALA C 18  ? LYS B 2   ALA B 11  
B 11 VAL C 76  ? VAL C 79  ? VAL B 69  VAL B 72  
B 12 ARG C 36  ? VAL C 38  ? ARG B 29  VAL B 31  
B 13 PHE C 44  ? PRO C 54  ? PHE B 37  PRO B 47  
B 14 GLY B 134 ? ARG B 139 ? GLY A 137 ARG A 142 
B 15 ARG B 151 ? GLU B 164 ? ARG A 154 GLU A 167 
B 16 ASP B 167 ? VAL B 174 ? ASP A 170 VAL A 177 
B 17 LYS B 108 ? LEU B 116 ? LYS A 111 LEU A 119 
B 18 ALA B 195 ? SER B 205 ? ALA A 198 SER A 208 
B 19 SER B 86  ? LEU B 93  ? SER A 89  LEU A 96  
B 20 ALA B 75  ? HIS B 77  ? ALA A 78  HIS A 80  
C 1  PHE B 208 ? LYS B 209 ? PHE A 211 LYS A 212 
C 2  ALA B 195 ? SER B 205 ? ALA A 198 SER A 208 
C 3  SER B 86  ? LEU B 93  ? SER A 89  LEU A 96  
C 4  GLY B 47  ? LYS B 53  ? GLY A 50  LYS A 56  
C 5  ILE B 240 ? PRO B 242 ? ILE A 243 PRO A 245 
D 1  ALA B 75  ? HIS B 77  ? ALA A 78  HIS A 80  
D 2  SER B 86  ? LEU B 93  ? SER A 89  LEU A 96  
D 3  GLY B 47  ? LYS B 53  ? GLY A 50  LYS A 56  
D 4  ILE B 240 ? PRO B 242 ? ILE A 243 PRO A 245 
E 1  TYR D 14  ? THR D 15  ? TYR C 14  THR C 15  
E 2  ARG D 6   ? LYS D 7   ? ARG C 6   LYS C 7   
E 3  LYS D 28  ? VAL D 29  ? LYS C 28  VAL C 29  
F 1  LYS E 32  ? LYS E 35  ? LYS D 32  LYS D 35  
F 2  SER E 99  ? GLU E 104 ? SER D 99  GLU D 104 
F 3  LEU E 51  ? ALA E 55  ? LEU D 51  ALA D 55  
F 4  TYR E 78  ? VAL E 81  ? TYR D 78  VAL D 81  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N LEU B 19  ? N LEU A 22  O LEU B 277 ? O LEU A 280 
A 2  3  O ALA B 275 ? O ALA A 278 N TRP B 254 ? N TRP A 257 
A 3  4  N ILE B 255 ? N ILE A 258 O MET B 290 ? O MET A 293 
A 4  5  N ILE B 289 ? N ILE A 292 O ALA B 298 ? O ALA A 301 
A 5  6  N LYS B 301 ? N LYS A 304 O ASP B 319 ? O ASP A 322 
A 6  7  O ALA B 317 ? O ALA A 320 N LEU B 269 ? N LEU A 272 
B 1  2  O PHE B 208 ? O PHE A 211 N SER B 205 ? N SER A 208 
B 2  3  O ARG B 201 ? O ARG A 204 N VAL B 111 ? N VAL A 114 
B 3  4  N LYS B 108 ? N LYS A 111 O VAL B 174 ? O VAL A 177 
B 4  5  O ARG B 171 ? O ARG A 174 N GLU B 159 ? N GLU A 162 
B 5  6  O VAL B 155 ? O VAL A 158 N GLY B 134 ? N GLY A 137 
B 6  7  N ILE B 137 ? N ILE A 140 O GLY C 53  ? O GLY B 46  
B 7  8  N PHE C 52  ? N PHE B 45  O TYR C 59  ? O TYR B 52  
B 8  9  O ILE C 62  ? O ILE B 55  N LEU C 23  ? N LEU B 16  
B 9  10 O PHE C 22  ? O PHE B 15  N ALA C 18  ? N ALA B 11  
B 10 11 N LYS C 9   ? N LYS B 2   O VAL C 79  ? O VAL B 72  
B 11 12 O TYR C 78  ? O TYR B 71  N VAL C 38  ? N VAL B 31  
B 12 13 N VAL C 37  ? N VAL B 30  O VAL C 45  ? O VAL B 38  
B 13 14 O GLY C 53  ? O GLY B 46  N ILE B 137 ? N ILE A 140 
B 14 15 N GLY B 134 ? N GLY A 137 O VAL B 155 ? O VAL A 158 
B 15 16 N GLU B 159 ? N GLU A 162 O ARG B 171 ? O ARG A 174 
B 16 17 O VAL B 174 ? O VAL A 177 N LYS B 108 ? N LYS A 111 
B 17 18 N VAL B 111 ? N VAL A 114 O ARG B 201 ? O ARG A 204 
B 18 19 O ARG B 202 ? O ARG A 205 N SER B 86  ? N SER A 89  
B 19 20 O ALA B 92  ? O ALA A 95  N GLY B 76  ? N GLY A 79  
C 1  2  O PHE B 208 ? O PHE A 211 N SER B 205 ? N SER A 208 
C 2  3  O ARG B 202 ? O ARG A 205 N SER B 86  ? N SER A 89  
C 3  4  O LEU B 93  ? O LEU A 96  N GLY B 47  ? N GLY A 50  
C 4  5  N VAL B 48  ? N VAL A 51  O GLN B 241 ? O GLN A 244 
D 1  2  N GLY B 76  ? N GLY A 79  O ALA B 92  ? O ALA A 95  
D 2  3  O LEU B 93  ? O LEU A 96  N GLY B 47  ? N GLY A 50  
D 3  4  N VAL B 48  ? N VAL A 51  O GLN B 241 ? O GLN A 244 
E 1  2  O THR D 15  ? O THR C 15  N ARG D 6   ? N ARG C 6   
E 2  3  N LYS D 7   ? N LYS C 7   O LYS D 28  ? O LYS C 28  
F 1  2  N ARG E 34  ? N ARG D 34  O ALA E 101 ? O ALA D 101 
F 2  3  O VAL E 100 ? O VAL D 100 N ILE E 53  ? N ILE D 53  
F 3  4  N ILE E 54  ? N ILE D 54  O ILE E 79  ? O ILE D 79  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 201'  
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE ATP A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS D 8   ? CYS C 8   . ? 1_555 ? 
2  AC1 4 CYS D 11  ? CYS C 11  . ? 1_555 ? 
3  AC1 4 CYS D 20  ? CYS C 20  . ? 1_555 ? 
4  AC1 4 CYS D 23  ? CYS C 23  . ? 1_555 ? 
5  AC2 9 HIS B 115 ? HIS A 118 . ? 1_555 ? 
6  AC2 9 HIS B 117 ? HIS A 120 . ? 1_555 ? 
7  AC2 9 ARG B 166 ? ARG A 169 . ? 1_555 ? 
8  AC2 9 HIS B 196 ? HIS A 199 . ? 1_555 ? 
9  AC2 9 LYS C 19  ? LYS B 12  . ? 1_555 ? 
10 AC2 9 C   A 8   ? C   E 8   . ? 3_445 ? 
11 AC2 9 C   A 9   ? C   E 9   . ? 3_445 ? 
12 AC2 9 G   A 49  ? G   E 49  . ? 3_445 ? 
13 AC2 9 G   A 50  ? G   E 50  . ? 3_445 ? 
# 
_database_PDB_matrix.entry_id          2HVY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HVY 
_atom_sites.fract_transf_matrix[1][1]   0.012044 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010995 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008767 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . G   A 1 1   ? -44.419 27.862  32.910  1.00 52.64 ? 1   G   E P     1 
ATOM   2    O  OP1   . G   A 1 1   ? -45.350 26.798  32.466  1.00 52.77 ? 1   G   E OP1   1 
ATOM   3    O  OP2   . G   A 1 1   ? -43.346 27.538  33.879  1.00 52.50 ? 1   G   E OP2   1 
ATOM   4    O  "O5'" . G   A 1 1   ? -43.735 28.569  31.643  1.00 52.24 ? 1   G   E "O5'" 1 
ATOM   5    C  "C5'" . G   A 1 1   ? -44.192 28.324  30.310  1.00 51.39 ? 1   G   E "C5'" 1 
ATOM   6    C  "C4'" . G   A 1 1   ? -43.063 28.437  29.296  1.00 50.58 ? 1   G   E "C4'" 1 
ATOM   7    O  "O4'" . G   A 1 1   ? -42.361 29.697  29.466  1.00 50.32 ? 1   G   E "O4'" 1 
ATOM   8    C  "C3'" . G   A 1 1   ? -41.972 27.376  29.393  1.00 49.98 ? 1   G   E "C3'" 1 
ATOM   9    O  "O3'" . G   A 1 1   ? -42.341 26.189  28.695  1.00 49.12 ? 1   G   E "O3'" 1 
ATOM   10   C  "C2'" . G   A 1 1   ? -40.795 28.092  28.735  1.00 50.12 ? 1   G   E "C2'" 1 
ATOM   11   O  "O2'" . G   A 1 1   ? -40.853 28.099  27.319  1.00 50.02 ? 1   G   E "O2'" 1 
ATOM   12   C  "C1'" . G   A 1 1   ? -40.967 29.506  29.286  1.00 50.24 ? 1   G   E "C1'" 1 
ATOM   13   N  N9    . G   A 1 1   ? -40.273 29.723  30.559  1.00 50.28 ? 1   G   E N9    1 
ATOM   14   C  C8    . G   A 1 1   ? -40.849 30.003  31.777  1.00 50.28 ? 1   G   E C8    1 
ATOM   15   N  N7    . G   A 1 1   ? -39.989 30.145  32.747  1.00 50.34 ? 1   G   E N7    1 
ATOM   16   C  C5    . G   A 1 1   ? -38.757 29.947  32.139  1.00 50.23 ? 1   G   E C5    1 
ATOM   17   C  C6    . G   A 1 1   ? -37.451 29.980  32.692  1.00 50.28 ? 1   G   E C6    1 
ATOM   18   O  O6    . G   A 1 1   ? -37.126 30.199  33.868  1.00 50.27 ? 1   G   E O6    1 
ATOM   19   N  N1    . G   A 1 1   ? -36.465 29.728  31.733  1.00 50.30 ? 1   G   E N1    1 
ATOM   20   C  C2    . G   A 1 1   ? -36.717 29.476  30.402  1.00 50.25 ? 1   G   E C2    1 
ATOM   21   N  N2    . G   A 1 1   ? -35.650 29.254  29.621  1.00 50.22 ? 1   G   E N2    1 
ATOM   22   N  N3    . G   A 1 1   ? -37.937 29.442  29.874  1.00 50.21 ? 1   G   E N3    1 
ATOM   23   C  C4    . G   A 1 1   ? -38.911 29.686  30.792  1.00 50.23 ? 1   G   E C4    1 
ATOM   24   P  P     . G   A 1 2   ? -41.857 24.748  29.208  1.00 48.36 ? 2   G   E P     1 
ATOM   25   O  OP1   . G   A 1 2   ? -42.486 23.739  28.326  1.00 48.29 ? 2   G   E OP1   1 
ATOM   26   O  OP2   . G   A 1 2   ? -42.056 24.674  30.673  1.00 48.33 ? 2   G   E OP2   1 
ATOM   27   O  "O5'" . G   A 1 2   ? -40.278 24.768  28.946  1.00 48.00 ? 2   G   E "O5'" 1 
ATOM   28   C  "C5'" . G   A 1 2   ? -39.775 24.690  27.615  1.00 47.35 ? 2   G   E "C5'" 1 
ATOM   29   C  "C4'" . G   A 1 2   ? -38.277 24.922  27.558  1.00 46.79 ? 2   G   E "C4'" 1 
ATOM   30   O  "O4'" . G   A 1 2   ? -37.915 26.117  28.295  1.00 46.72 ? 2   G   E "O4'" 1 
ATOM   31   C  "C3'" . G   A 1 2   ? -37.429 23.836  28.198  1.00 46.28 ? 2   G   E "C3'" 1 
ATOM   32   O  "O3'" . G   A 1 2   ? -37.307 22.718  27.325  1.00 45.55 ? 2   G   E "O3'" 1 
ATOM   33   C  "C2'" . G   A 1 2   ? -36.114 24.583  28.405  1.00 46.50 ? 2   G   E "C2'" 1 
ATOM   34   O  "O2'" . G   A 1 2   ? -35.346 24.701  27.221  1.00 46.43 ? 2   G   E "O2'" 1 
ATOM   35   C  "C1'" . G   A 1 2   ? -36.618 25.955  28.847  1.00 46.66 ? 2   G   E "C1'" 1 
ATOM   36   N  N9    . G   A 1 2   ? -36.676 26.148  30.301  1.00 46.76 ? 2   G   E N9    1 
ATOM   37   C  C8    . G   A 1 2   ? -37.809 26.212  31.080  1.00 46.65 ? 2   G   E C8    1 
ATOM   38   N  N7    . G   A 1 2   ? -37.566 26.398  32.348  1.00 46.73 ? 2   G   E N7    1 
ATOM   39   C  C5    . G   A 1 2   ? -36.181 26.464  32.424  1.00 46.77 ? 2   G   E C5    1 
ATOM   40   C  C6    . G   A 1 2   ? -35.334 26.655  33.549  1.00 46.80 ? 2   G   E C6    1 
ATOM   41   O  O6    . G   A 1 2   ? -35.656 26.806  34.737  1.00 46.71 ? 2   G   E O6    1 
ATOM   42   N  N1    . G   A 1 2   ? -33.984 26.659  33.195  1.00 46.74 ? 2   G   E N1    1 
ATOM   43   C  C2    . G   A 1 2   ? -33.509 26.499  31.912  1.00 46.72 ? 2   G   E C2    1 
ATOM   44   N  N2    . G   A 1 2   ? -32.175 26.531  31.764  1.00 46.58 ? 2   G   E N2    1 
ATOM   45   N  N3    . G   A 1 2   ? -34.293 26.321  30.851  1.00 46.79 ? 2   G   E N3    1 
ATOM   46   C  C4    . G   A 1 2   ? -35.615 26.312  31.173  1.00 46.77 ? 2   G   E C4    1 
ATOM   47   P  P     . G   A 1 3   ? -37.146 21.235  27.917  1.00 45.09 ? 3   G   E P     1 
ATOM   48   O  OP1   . G   A 1 3   ? -37.321 20.285  26.795  1.00 44.92 ? 3   G   E OP1   1 
ATOM   49   O  OP2   . G   A 1 3   ? -37.998 21.103  29.122  1.00 45.04 ? 3   G   E OP2   1 
ATOM   50   O  "O5'" . G   A 1 3   ? -35.619 21.213  28.397  1.00 44.90 ? 3   G   E "O5'" 1 
ATOM   51   C  "C5'" . G   A 1 3   ? -34.553 21.279  27.447  1.00 44.56 ? 3   G   E "C5'" 1 
ATOM   52   C  "C4'" . G   A 1 3   ? -33.214 21.439  28.143  1.00 44.45 ? 3   G   E "C4'" 1 
ATOM   53   O  "O4'" . G   A 1 3   ? -33.181 22.690  28.874  1.00 44.70 ? 3   G   E "O4'" 1 
ATOM   54   C  "C3'" . G   A 1 3   ? -32.908 20.392  29.203  1.00 44.31 ? 3   G   E "C3'" 1 
ATOM   55   O  "O3'" . G   A 1 3   ? -32.390 19.217  28.603  1.00 43.19 ? 3   G   E "O3'" 1 
ATOM   56   C  "C2'" . G   A 1 3   ? -31.871 21.115  30.055  1.00 44.67 ? 3   G   E "C2'" 1 
ATOM   57   O  "O2'" . G   A 1 3   ? -30.571 21.080  29.498  1.00 45.20 ? 3   G   E "O2'" 1 
ATOM   58   C  "C1'" . G   A 1 3   ? -32.421 22.537  30.061  1.00 44.75 ? 3   G   E "C1'" 1 
ATOM   59   N  N9    . G   A 1 3   ? -33.264 22.839  31.222  1.00 44.75 ? 3   G   E N9    1 
ATOM   60   C  C8    . G   A 1 3   ? -34.636 22.925  31.247  1.00 44.83 ? 3   G   E C8    1 
ATOM   61   N  N7    . G   A 1 3   ? -35.126 23.213  32.419  1.00 44.85 ? 3   G   E N7    1 
ATOM   62   C  C5    . G   A 1 3   ? -34.010 23.326  33.235  1.00 44.84 ? 3   G   E C5    1 
ATOM   63   C  C6    . G   A 1 3   ? -33.918 23.626  34.620  1.00 44.92 ? 3   G   E C6    1 
ATOM   64   O  O6    . G   A 1 3   ? -34.836 23.857  35.420  1.00 44.84 ? 3   G   E O6    1 
ATOM   65   N  N1    . G   A 1 3   ? -32.596 23.639  35.067  1.00 44.93 ? 3   G   E N1    1 
ATOM   66   C  C2    . G   A 1 3   ? -31.499 23.395  34.270  1.00 44.92 ? 3   G   E C2    1 
ATOM   67   N  N2    . G   A 1 3   ? -30.304 23.456  34.877  1.00 44.78 ? 3   G   E N2    1 
ATOM   68   N  N3    . G   A 1 3   ? -31.573 23.118  32.969  1.00 44.79 ? 3   G   E N3    1 
ATOM   69   C  C4    . G   A 1 3   ? -32.854 23.098  32.515  1.00 44.75 ? 3   G   E C4    1 
ATOM   70   P  P     . U   A 1 4   ? -32.624 17.785  29.277  1.00 42.88 ? 4   U   E P     1 
ATOM   71   O  OP1   . U   A 1 4   ? -32.220 16.776  28.272  1.00 43.36 ? 4   U   E OP1   1 
ATOM   72   O  OP2   . U   A 1 4   ? -33.982 17.733  29.860  1.00 42.90 ? 4   U   E OP2   1 
ATOM   73   O  "O5'" . U   A 1 4   ? -31.601 17.764  30.509  1.00 42.62 ? 4   U   E "O5'" 1 
ATOM   74   C  "C5'" . U   A 1 4   ? -30.186 17.802  30.327  1.00 41.82 ? 4   U   E "C5'" 1 
ATOM   75   C  "C4'" . U   A 1 4   ? -29.482 18.092  31.642  1.00 41.18 ? 4   U   E "C4'" 1 
ATOM   76   O  "O4'" . U   A 1 4   ? -29.877 19.398  32.145  1.00 41.77 ? 4   U   E "O4'" 1 
ATOM   77   C  "C3'" . U   A 1 4   ? -29.842 17.163  32.789  1.00 40.82 ? 4   U   E "C3'" 1 
ATOM   78   O  "O3'" . U   A 1 4   ? -29.139 15.932  32.696  1.00 39.78 ? 4   U   E "O3'" 1 
ATOM   79   C  "C2'" . U   A 1 4   ? -29.447 18.005  34.000  1.00 41.02 ? 4   U   E "C2'" 1 
ATOM   80   O  "O2'" . U   A 1 4   ? -28.051 18.067  34.227  1.00 40.90 ? 4   U   E "O2'" 1 
ATOM   81   C  "C1'" . U   A 1 4   ? -29.964 19.372  33.564  1.00 41.37 ? 4   U   E "C1'" 1 
ATOM   82   N  N1    . U   A 1 4   ? -31.372 19.684  34.028  1.00 41.45 ? 4   U   E N1    1 
ATOM   83   C  C2    . U   A 1 4   ? -31.586 20.118  35.329  1.00 41.79 ? 4   U   E C2    1 
ATOM   84   O  O2    . U   A 1 4   ? -30.698 20.268  36.148  1.00 41.65 ? 4   U   E O2    1 
ATOM   85   N  N3    . U   A 1 4   ? -32.901 20.380  35.651  1.00 41.98 ? 4   U   E N3    1 
ATOM   86   C  C4    . U   A 1 4   ? -34.007 20.256  34.823  1.00 41.87 ? 4   U   E C4    1 
ATOM   87   O  O4    . U   A 1 4   ? -35.125 20.527  35.253  1.00 41.79 ? 4   U   E O4    1 
ATOM   88   C  C5    . U   A 1 4   ? -33.713 19.799  33.487  1.00 41.56 ? 4   U   E C5    1 
ATOM   89   C  C6    . U   A 1 4   ? -32.440 19.540  33.154  1.00 41.41 ? 4   U   E C6    1 
ATOM   90   P  P     . C   A 1 5   ? -29.821 14.578  33.208  1.00 39.17 ? 5   C   E P     1 
ATOM   91   O  OP1   . C   A 1 5   ? -28.956 13.456  32.782  1.00 39.31 ? 5   C   E OP1   1 
ATOM   92   O  OP2   . C   A 1 5   ? -31.249 14.577  32.827  1.00 39.49 ? 5   C   E OP2   1 
ATOM   93   O  "O5'" . C   A 1 5   ? -29.763 14.708  34.799  1.00 39.73 ? 5   C   E "O5'" 1 
ATOM   94   C  "C5'" . C   A 1 5   ? -28.526 14.653  35.495  1.00 40.35 ? 5   C   E "C5'" 1 
ATOM   95   C  "C4'" . C   A 1 5   ? -28.726 15.037  36.945  1.00 41.19 ? 5   C   E "C4'" 1 
ATOM   96   O  "O4'" . C   A 1 5   ? -29.254 16.384  37.025  1.00 41.04 ? 5   C   E "O4'" 1 
ATOM   97   C  "C3'" . C   A 1 5   ? -29.769 14.217  37.686  1.00 41.96 ? 5   C   E "C3'" 1 
ATOM   98   O  "O3'" . C   A 1 5   ? -29.252 12.964  38.099  1.00 42.92 ? 5   C   E "O3'" 1 
ATOM   99   C  "C2'" . C   A 1 5   ? -30.105 15.139  38.850  1.00 41.59 ? 5   C   E "C2'" 1 
ATOM   100  O  "O2'" . C   A 1 5   ? -29.129 15.138  39.874  1.00 41.97 ? 5   C   E "O2'" 1 
ATOM   101  C  "C1'" . C   A 1 5   ? -30.141 16.484  38.131  1.00 41.19 ? 5   C   E "C1'" 1 
ATOM   102  N  N1    . C   A 1 5   ? -31.534 16.877  37.688  1.00 40.97 ? 5   C   E N1    1 
ATOM   103  C  C2    . C   A 1 5   ? -32.396 17.513  38.604  1.00 41.01 ? 5   C   E C2    1 
ATOM   104  O  O2    . C   A 1 5   ? -32.011 17.750  39.758  1.00 40.87 ? 5   C   E O2    1 
ATOM   105  N  N3    . C   A 1 5   ? -33.647 17.862  38.199  1.00 40.74 ? 5   C   E N3    1 
ATOM   106  C  C4    . C   A 1 5   ? -34.053 17.598  36.952  1.00 40.96 ? 5   C   E C4    1 
ATOM   107  N  N4    . C   A 1 5   ? -35.293 17.964  36.611  1.00 40.78 ? 5   C   E N4    1 
ATOM   108  C  C5    . C   A 1 5   ? -33.199 16.949  36.002  1.00 40.83 ? 5   C   E C5    1 
ATOM   109  C  C6    . C   A 1 5   ? -31.967 16.611  36.410  1.00 40.71 ? 5   C   E C6    1 
ATOM   110  P  P     . C   A 1 6   ? -30.218 11.690  38.094  1.00 44.10 ? 6   C   E P     1 
ATOM   111  O  OP1   . C   A 1 6   ? -29.378 10.499  38.355  1.00 43.91 ? 6   C   E OP1   1 
ATOM   112  O  OP2   . C   A 1 6   ? -31.051 11.743  36.873  1.00 44.26 ? 6   C   E OP2   1 
ATOM   113  O  "O5'" . C   A 1 6   ? -31.184 11.963  39.347  1.00 44.70 ? 6   C   E "O5'" 1 
ATOM   114  C  "C5'" . C   A 1 6   ? -30.691 11.889  40.689  1.00 45.13 ? 6   C   E "C5'" 1 
ATOM   115  C  "C4'" . C   A 1 6   ? -31.619 12.562  41.689  1.00 45.35 ? 6   C   E "C4'" 1 
ATOM   116  O  "O4'" . C   A 1 6   ? -31.957 13.904  41.252  1.00 45.72 ? 6   C   E "O4'" 1 
ATOM   117  C  "C3'" . C   A 1 6   ? -32.986 11.921  41.872  1.00 45.44 ? 6   C   E "C3'" 1 
ATOM   118  O  "O3'" . C   A 1 6   ? -32.929 10.757  42.680  1.00 45.29 ? 6   C   E "O3'" 1 
ATOM   119  C  "C2'" . C   A 1 6   ? -33.760 13.061  42.531  1.00 45.63 ? 6   C   E "C2'" 1 
ATOM   120  O  "O2'" . C   A 1 6   ? -33.459 13.245  43.904  1.00 45.86 ? 6   C   E "O2'" 1 
ATOM   121  C  "C1'" . C   A 1 6   ? -33.263 14.242  41.702  1.00 45.66 ? 6   C   E "C1'" 1 
ATOM   122  N  N1    . C   A 1 6   ? -34.185 14.562  40.546  1.00 45.72 ? 6   C   E N1    1 
ATOM   123  C  C2    . C   A 1 6   ? -35.348 15.325  40.776  1.00 45.60 ? 6   C   E C2    1 
ATOM   124  O  O2    . C   A 1 6   ? -35.611 15.738  41.915  1.00 45.58 ? 6   C   E O2    1 
ATOM   125  N  N3    . C   A 1 6   ? -36.170 15.600  39.732  1.00 45.68 ? 6   C   E N3    1 
ATOM   126  C  C4    . C   A 1 6   ? -35.882 15.150  38.505  1.00 45.74 ? 6   C   E C4    1 
ATOM   127  N  N4    . C   A 1 6   ? -36.730 15.454  37.517  1.00 45.36 ? 6   C   E N4    1 
ATOM   128  C  C5    . C   A 1 6   ? -34.711 14.370  38.245  1.00 45.72 ? 6   C   E C5    1 
ATOM   129  C  C6    . C   A 1 6   ? -33.904 14.105  39.282  1.00 45.69 ? 6   C   E C6    1 
ATOM   130  P  P     . G   A 1 7   ? -33.968 9.567   42.414  1.00 45.38 ? 7   G   E P     1 
ATOM   131  O  OP1   . G   A 1 7   ? -33.499 8.385   43.171  1.00 45.40 ? 7   G   E OP1   1 
ATOM   132  O  OP2   . G   A 1 7   ? -34.204 9.461   40.957  1.00 45.39 ? 7   G   E OP2   1 
ATOM   133  O  "O5'" . G   A 1 7   ? -35.318 10.106  43.082  1.00 44.98 ? 7   G   E "O5'" 1 
ATOM   134  C  "C5'" . G   A 1 7   ? -35.388 10.337  44.486  1.00 44.32 ? 7   G   E "C5'" 1 
ATOM   135  C  "C4'" . G   A 1 7   ? -36.651 11.097  44.838  1.00 43.84 ? 7   G   E "C4'" 1 
ATOM   136  O  "O4'" . G   A 1 7   ? -36.669 12.394  44.185  1.00 43.54 ? 7   G   E "O4'" 1 
ATOM   137  C  "C3'" . G   A 1 7   ? -37.944 10.458  44.360  1.00 43.47 ? 7   G   E "C3'" 1 
ATOM   138  O  "O3'" . G   A 1 7   ? -38.318 9.352   45.173  1.00 43.22 ? 7   G   E "O3'" 1 
ATOM   139  C  "C2'" . G   A 1 7   ? -38.893 11.644  44.486  1.00 43.35 ? 7   G   E "C2'" 1 
ATOM   140  O  "O2'" . G   A 1 7   ? -39.285 11.913  45.822  1.00 43.49 ? 7   G   E "O2'" 1 
ATOM   141  C  "C1'" . G   A 1 7   ? -38.014 12.764  43.924  1.00 42.98 ? 7   G   E "C1'" 1 
ATOM   142  N  N9    . G   A 1 7   ? -38.203 12.948  42.483  1.00 42.80 ? 7   G   E N9    1 
ATOM   143  C  C8    . G   A 1 7   ? -37.320 12.619  41.481  1.00 42.69 ? 7   G   E C8    1 
ATOM   144  N  N7    . G   A 1 7   ? -37.760 12.891  40.283  1.00 42.72 ? 7   G   E N7    1 
ATOM   145  C  C5    . G   A 1 7   ? -39.021 13.435  40.499  1.00 42.70 ? 7   G   E C5    1 
ATOM   146  C  C6    . G   A 1 7   ? -39.983 13.917  39.574  1.00 42.75 ? 7   G   E C6    1 
ATOM   147  O  O6    . G   A 1 7   ? -39.899 13.961  38.339  1.00 42.61 ? 7   G   E O6    1 
ATOM   148  N  N1    . G   A 1 7   ? -41.138 14.385  40.206  1.00 42.67 ? 7   G   E N1    1 
ATOM   149  C  C2    . G   A 1 7   ? -41.337 14.382  41.569  1.00 42.46 ? 7   G   E C2    1 
ATOM   150  N  N2    . G   A 1 7   ? -42.505 14.869  42.005  1.00 42.63 ? 7   G   E N2    1 
ATOM   151  N  N3    . G   A 1 7   ? -40.444 13.937  42.446  1.00 42.48 ? 7   G   E N3    1 
ATOM   152  C  C4    . G   A 1 7   ? -39.311 13.476  41.848  1.00 42.76 ? 7   G   E C4    1 
ATOM   153  P  P     . C   A 1 8   ? -39.065 8.097   44.512  1.00 42.77 ? 8   C   E P     1 
ATOM   154  O  OP1   . C   A 1 8   ? -39.114 7.017   45.525  1.00 43.12 ? 8   C   E OP1   1 
ATOM   155  O  OP2   . C   A 1 8   ? -38.453 7.833   43.191  1.00 42.86 ? 8   C   E OP2   1 
ATOM   156  O  "O5'" . C   A 1 8   ? -40.544 8.649   44.261  1.00 42.56 ? 8   C   E "O5'" 1 
ATOM   157  C  "C5'" . C   A 1 8   ? -41.362 9.064   45.354  1.00 41.96 ? 8   C   E "C5'" 1 
ATOM   158  C  "C4'" . C   A 1 8   ? -42.572 9.831   44.858  1.00 41.60 ? 8   C   E "C4'" 1 
ATOM   159  O  "O4'" . C   A 1 8   ? -42.154 10.974  44.062  1.00 41.28 ? 8   C   E "O4'" 1 
ATOM   160  C  "C3'" . C   A 1 8   ? -43.478 9.056   43.912  1.00 41.49 ? 8   C   E "C3'" 1 
ATOM   161  O  "O3'" . C   A 1 8   ? -44.321 8.143   44.615  1.00 41.49 ? 8   C   E "O3'" 1 
ATOM   162  C  "C2'" . C   A 1 8   ? -44.231 10.203  43.240  1.00 41.19 ? 8   C   E "C2'" 1 
ATOM   163  O  "O2'" . C   A 1 8   ? -45.243 10.766  44.050  1.00 41.07 ? 8   C   E "O2'" 1 
ATOM   164  C  "C1'" . C   A 1 8   ? -43.095 11.207  43.025  1.00 40.98 ? 8   C   E "C1'" 1 
ATOM   165  N  N1    . C   A 1 8   ? -42.450 11.079  41.661  1.00 40.57 ? 8   C   E N1    1 
ATOM   166  C  C2    . C   A 1 8   ? -43.115 11.565  40.518  1.00 40.54 ? 8   C   E C2    1 
ATOM   167  O  O2    . C   A 1 8   ? -44.221 12.108  40.626  1.00 40.37 ? 8   C   E O2    1 
ATOM   168  N  N3    . C   A 1 8   ? -42.524 11.433  39.301  1.00 40.59 ? 8   C   E N3    1 
ATOM   169  C  C4    . C   A 1 8   ? -41.329 10.846  39.188  1.00 40.82 ? 8   C   E C4    1 
ATOM   170  N  N4    . C   A 1 8   ? -40.797 10.746  37.964  1.00 40.63 ? 8   C   E N4    1 
ATOM   171  C  C5    . C   A 1 8   ? -40.632 10.342  40.330  1.00 40.85 ? 8   C   E C5    1 
ATOM   172  C  C6    . C   A 1 8   ? -41.224 10.479  41.527  1.00 40.84 ? 8   C   E C6    1 
ATOM   173  P  P     . C   A 1 9   ? -44.701 6.730   43.952  1.00 41.38 ? 9   C   E P     1 
ATOM   174  O  OP1   . C   A 1 9   ? -45.306 5.894   45.012  1.00 41.31 ? 9   C   E OP1   1 
ATOM   175  O  OP2   . C   A 1 9   ? -43.533 6.227   43.193  1.00 41.22 ? 9   C   E OP2   1 
ATOM   176  O  "O5'" . C   A 1 9   ? -45.824 7.129   42.884  1.00 41.62 ? 9   C   E "O5'" 1 
ATOM   177  C  "C5'" . C   A 1 9   ? -47.065 7.694   43.310  1.00 41.69 ? 9   C   E "C5'" 1 
ATOM   178  C  "C4'" . C   A 1 9   ? -47.912 8.126   42.126  1.00 41.89 ? 9   C   E "C4'" 1 
ATOM   179  O  "O4'" . C   A 1 9   ? -47.239 9.184   41.396  1.00 41.94 ? 9   C   E "O4'" 1 
ATOM   180  C  "C3'" . C   A 1 9   ? -48.174 7.055   41.076  1.00 41.84 ? 9   C   E "C3'" 1 
ATOM   181  O  "O3'" . C   A 1 9   ? -49.255 6.218   41.482  1.00 42.26 ? 9   C   E "O3'" 1 
ATOM   182  C  "C2'" . C   A 1 9   ? -48.511 7.904   39.852  1.00 41.91 ? 9   C   E "C2'" 1 
ATOM   183  O  "O2'" . C   A 1 9   ? -49.851 8.360   39.839  1.00 41.79 ? 9   C   E "O2'" 1 
ATOM   184  C  "C1'" . C   A 1 9   ? -47.554 9.088   40.015  1.00 41.92 ? 9   C   E "C1'" 1 
ATOM   185  N  N1    . C   A 1 9   ? -46.294 8.967   39.191  1.00 41.90 ? 9   C   E N1    1 
ATOM   186  C  C2    . C   A 1 9   ? -46.301 9.362   37.838  1.00 42.01 ? 9   C   E C2    1 
ATOM   187  O  O2    . C   A 1 9   ? -47.336 9.810   37.328  1.00 42.21 ? 9   C   E O2    1 
ATOM   188  N  N3    . C   A 1 9   ? -45.158 9.243   37.110  1.00 41.98 ? 9   C   E N3    1 
ATOM   189  C  C4    . C   A 1 9   ? -44.046 8.757   37.672  1.00 41.98 ? 9   C   E C4    1 
ATOM   190  N  N4    . C   A 1 9   ? -42.951 8.662   36.910  1.00 41.95 ? 9   C   E N4    1 
ATOM   191  C  C5    . C   A 1 9   ? -44.013 8.350   39.042  1.00 41.94 ? 9   C   E C5    1 
ATOM   192  C  C6    . C   A 1 9   ? -45.144 8.470   39.751  1.00 41.75 ? 9   C   E C6    1 
ATOM   193  P  P     . U   A 1 10  ? -49.109 4.621   41.493  1.00 41.89 ? 10  U   E P     1 
ATOM   194  O  OP1   . U   A 1 10  ? -50.201 4.085   42.336  1.00 41.93 ? 10  U   E OP1   1 
ATOM   195  O  OP2   . U   A 1 10  ? -47.708 4.266   41.813  1.00 41.91 ? 10  U   E OP2   1 
ATOM   196  O  "O5'" . U   A 1 10  ? -49.371 4.230   39.962  1.00 41.94 ? 10  U   E "O5'" 1 
ATOM   197  C  "C5'" . U   A 1 10  ? -50.691 4.267   39.422  1.00 41.94 ? 10  U   E "C5'" 1 
ATOM   198  C  "C4'" . U   A 1 10  ? -50.785 3.554   38.083  1.00 41.96 ? 10  U   E "C4'" 1 
ATOM   199  O  "O4'" . U   A 1 10  ? -49.858 4.135   37.136  1.00 41.99 ? 10  U   E "O4'" 1 
ATOM   200  C  "C3'" . U   A 1 10  ? -50.399 2.082   38.066  1.00 41.93 ? 10  U   E "C3'" 1 
ATOM   201  O  "O3'" . U   A 1 10  ? -51.435 1.271   38.623  1.00 41.90 ? 10  U   E "O3'" 1 
ATOM   202  C  "C2'" . U   A 1 10  ? -50.196 1.848   36.568  1.00 41.95 ? 10  U   E "C2'" 1 
ATOM   203  O  "O2'" . U   A 1 10  ? -51.397 1.569   35.874  1.00 41.93 ? 10  U   E "O2'" 1 
ATOM   204  C  "C1'" . U   A 1 10  ? -49.628 3.192   36.101  1.00 42.08 ? 10  U   E "C1'" 1 
ATOM   205  N  N1    . U   A 1 10  ? -48.163 3.154   35.738  1.00 42.11 ? 10  U   E N1    1 
ATOM   206  C  C2    . U   A 1 10  ? -47.794 3.146   34.399  1.00 42.14 ? 10  U   E C2    1 
ATOM   207  O  O2    . U   A 1 10  ? -48.587 3.168   33.472  1.00 42.17 ? 10  U   E O2    1 
ATOM   208  N  N3    . U   A 1 10  ? -46.436 3.110   34.172  1.00 42.15 ? 10  U   E N3    1 
ATOM   209  C  C4    . U   A 1 10  ? -45.429 3.082   35.125  1.00 42.18 ? 10  U   E C4    1 
ATOM   210  O  O4    . U   A 1 10  ? -44.255 3.051   34.769  1.00 42.17 ? 10  U   E O4    1 
ATOM   211  C  C5    . U   A 1 10  ? -45.886 3.092   36.494  1.00 42.19 ? 10  U   E C5    1 
ATOM   212  C  C6    . U   A 1 10  ? -47.204 3.127   36.741  1.00 42.14 ? 10  U   E C6    1 
ATOM   213  P  P     . U   A 1 11  ? -51.123 -0.191  39.209  1.00 41.80 ? 11  U   E P     1 
ATOM   214  O  OP1   . U   A 1 11  ? -52.179 -0.512  40.195  1.00 41.83 ? 11  U   E OP1   1 
ATOM   215  O  OP2   . U   A 1 11  ? -49.702 -0.256  39.620  1.00 41.76 ? 11  U   E OP2   1 
ATOM   216  O  "O5'" . U   A 1 11  ? -51.294 -1.130  37.925  1.00 41.79 ? 11  U   E "O5'" 1 
ATOM   217  C  "C5'" . U   A 1 11  ? -52.556 -1.251  37.264  1.00 41.74 ? 11  U   E "C5'" 1 
ATOM   218  C  "C4'" . U   A 1 11  ? -52.416 -2.002  35.951  1.00 41.69 ? 11  U   E "C4'" 1 
ATOM   219  O  "O4'" . U   A 1 11  ? -51.460 -1.325  35.098  1.00 41.51 ? 11  U   E "O4'" 1 
ATOM   220  C  "C3'" . U   A 1 11  ? -51.888 -3.424  36.080  1.00 41.68 ? 11  U   E "C3'" 1 
ATOM   221  O  "O3'" . U   A 1 11  ? -52.965 -4.321  36.351  1.00 41.87 ? 11  U   E "O3'" 1 
ATOM   222  C  "C2'" . U   A 1 11  ? -51.238 -3.668  34.719  1.00 41.56 ? 11  U   E "C2'" 1 
ATOM   223  O  "O2'" . U   A 1 11  ? -52.142 -4.158  33.746  1.00 41.42 ? 11  U   E "O2'" 1 
ATOM   224  C  "C1'" . U   A 1 11  ? -50.741 -2.273  34.326  1.00 41.49 ? 11  U   E "C1'" 1 
ATOM   225  N  N1    . U   A 1 11  ? -49.253 -2.066  34.502  1.00 41.46 ? 11  U   E N1    1 
ATOM   226  C  C2    . U   A 1 11  ? -48.379 -2.464  33.498  1.00 41.45 ? 11  U   E C2    1 
ATOM   227  O  O2    . U   A 1 11  ? -48.734 -2.985  32.454  1.00 41.46 ? 11  U   E O2    1 
ATOM   228  N  N3    . U   A 1 11  ? -47.047 -2.229  33.758  1.00 41.42 ? 11  U   E N3    1 
ATOM   229  C  C4    . U   A 1 11  ? -46.506 -1.648  34.894  1.00 41.41 ? 11  U   E C4    1 
ATOM   230  O  O4    . U   A 1 11  ? -45.292 -1.502  34.983  1.00 41.39 ? 11  U   E O4    1 
ATOM   231  C  C5    . U   A 1 11  ? -47.471 -1.259  35.895  1.00 41.41 ? 11  U   E C5    1 
ATOM   232  C  C6    . U   A 1 11  ? -48.774 -1.479  35.665  1.00 41.42 ? 11  U   E C6    1 
ATOM   233  P  P     . G   A 1 12  ? -52.770 -5.586  37.317  1.00 42.10 ? 12  G   E P     1 
ATOM   234  O  OP1   . G   A 1 12  ? -54.116 -6.050  37.727  1.00 42.07 ? 12  G   E OP1   1 
ATOM   235  O  OP2   . G   A 1 12  ? -51.770 -5.250  38.357  1.00 42.03 ? 12  G   E OP2   1 
ATOM   236  O  "O5'" . G   A 1 12  ? -52.114 -6.674  36.346  1.00 42.33 ? 12  G   E "O5'" 1 
ATOM   237  C  "C5'" . G   A 1 12  ? -52.819 -7.156  35.201  1.00 42.72 ? 12  G   E "C5'" 1 
ATOM   238  C  "C4'" . G   A 1 12  ? -51.882 -7.893  34.258  1.00 43.00 ? 12  G   E "C4'" 1 
ATOM   239  O  "O4'" . G   A 1 12  ? -50.748 -7.046  33.937  1.00 43.08 ? 12  G   E "O4'" 1 
ATOM   240  C  "C3'" . G   A 1 12  ? -51.322 -9.201  34.811  1.00 43.14 ? 12  G   E "C3'" 1 
ATOM   241  O  "O3'" . G   A 1 12  ? -51.570 -10.257 33.885  1.00 43.42 ? 12  G   E "O3'" 1 
ATOM   242  C  "C2'" . G   A 1 12  ? -49.828 -8.943  35.019  1.00 43.11 ? 12  G   E "C2'" 1 
ATOM   243  O  "O2'" . G   A 1 12  ? -49.020 -10.047 34.656  1.00 42.98 ? 12  G   E "O2'" 1 
ATOM   244  C  "C1'" . G   A 1 12  ? -49.535 -7.753  34.105  1.00 43.17 ? 12  G   E "C1'" 1 
ATOM   245  N  N9    . G   A 1 12  ? -48.538 -6.830  34.651  1.00 43.18 ? 12  G   E N9    1 
ATOM   246  C  C8    . G   A 1 12  ? -48.694 -5.996  35.734  1.00 43.19 ? 12  G   E C8    1 
ATOM   247  N  N7    . G   A 1 12  ? -47.639 -5.279  36.004  1.00 43.16 ? 12  G   E N7    1 
ATOM   248  C  C5    . G   A 1 12  ? -46.718 -5.659  35.039  1.00 43.17 ? 12  G   E C5    1 
ATOM   249  C  C6    . G   A 1 12  ? -45.386 -5.217  34.826  1.00 43.16 ? 12  G   E C6    1 
ATOM   250  O  O6    . G   A 1 12  ? -44.747 -4.378  35.475  1.00 43.17 ? 12  G   E O6    1 
ATOM   251  N  N1    . G   A 1 12  ? -44.788 -5.852  33.736  1.00 43.19 ? 12  G   E N1    1 
ATOM   252  C  C2    . G   A 1 12  ? -45.406 -6.800  32.949  1.00 43.23 ? 12  G   E C2    1 
ATOM   253  N  N2    . G   A 1 12  ? -44.675 -7.302  31.943  1.00 43.23 ? 12  G   E N2    1 
ATOM   254  N  N3    . G   A 1 12  ? -46.654 -7.223  33.137  1.00 43.17 ? 12  G   E N3    1 
ATOM   255  C  C4    . G   A 1 12  ? -47.253 -6.614  34.196  1.00 43.16 ? 12  G   E C4    1 
ATOM   256  P  P     . A   A 1 13  ? -52.736 -11.331 34.130  1.00 43.68 ? 13  A   E P     1 
ATOM   257  O  OP1   . A   A 1 13  ? -53.703 -11.194 33.018  1.00 43.62 ? 13  A   E OP1   1 
ATOM   258  O  OP2   . A   A 1 13  ? -53.210 -11.245 35.532  1.00 43.62 ? 13  A   E OP2   1 
ATOM   259  O  "O5'" . A   A 1 13  ? -51.947 -12.714 33.978  1.00 43.69 ? 13  A   E "O5'" 1 
ATOM   260  C  "C5'" . A   A 1 13  ? -52.661 -13.942 33.996  1.00 43.92 ? 13  A   E "C5'" 1 
ATOM   261  C  "C4'" . A   A 1 13  ? -51.898 -15.059 33.296  1.00 44.11 ? 13  A   E "C4'" 1 
ATOM   262  O  "O4'" . A   A 1 13  ? -52.781 -16.192 33.108  1.00 44.29 ? 13  A   E "O4'" 1 
ATOM   263  C  "C3'" . A   A 1 13  ? -51.338 -14.759 31.907  1.00 44.17 ? 13  A   E "C3'" 1 
ATOM   264  O  "O3'" . A   A 1 13  ? -50.152 -15.525 31.684  1.00 44.22 ? 13  A   E "O3'" 1 
ATOM   265  C  "C2'" . A   A 1 13  ? -52.469 -15.191 30.974  1.00 44.19 ? 13  A   E "C2'" 1 
ATOM   266  O  "O2'" . A   A 1 13  ? -51.996 -15.645 29.720  1.00 44.14 ? 13  A   E "O2'" 1 
ATOM   267  C  "C1'" . A   A 1 13  ? -53.110 -16.349 31.740  1.00 44.28 ? 13  A   E "C1'" 1 
ATOM   268  N  N9    . A   A 1 13  ? -54.569 -16.438 31.653  1.00 44.34 ? 13  A   E N9    1 
ATOM   269  C  C8    . A   A 1 13  ? -55.476 -15.419 31.520  1.00 44.30 ? 13  A   E C8    1 
ATOM   270  N  N7    . A   A 1 13  ? -56.725 -15.820 31.477  1.00 44.27 ? 13  A   E N7    1 
ATOM   271  C  C5    . A   A 1 13  ? -56.635 -17.198 31.595  1.00 44.34 ? 13  A   E C5    1 
ATOM   272  C  C6    . A   A 1 13  ? -57.606 -18.224 31.621  1.00 44.28 ? 13  A   E C6    1 
ATOM   273  N  N6    . A   A 1 13  ? -58.921 -18.003 31.525  1.00 44.33 ? 13  A   E N6    1 
ATOM   274  N  N1    . A   A 1 13  ? -57.173 -19.498 31.750  1.00 44.26 ? 13  A   E N1    1 
ATOM   275  C  C2    . A   A 1 13  ? -55.857 -19.731 31.849  1.00 44.32 ? 13  A   E C2    1 
ATOM   276  N  N3    . A   A 1 13  ? -54.853 -18.853 31.837  1.00 44.31 ? 13  A   E N3    1 
ATOM   277  C  C4    . A   A 1 13  ? -55.312 -17.594 31.707  1.00 44.26 ? 13  A   E C4    1 
ATOM   278  P  P     . G   A 1 14  ? -48.710 -14.955 32.082  1.00 44.21 ? 14  G   E P     1 
ATOM   279  O  OP1   . G   A 1 14  ? -48.349 -13.895 31.114  1.00 44.05 ? 14  G   E OP1   1 
ATOM   280  O  OP2   . G   A 1 14  ? -47.810 -16.111 32.292  1.00 44.07 ? 14  G   E OP2   1 
ATOM   281  P  P     . U   A 1 15  ? -49.679 -16.162 37.501  1.00 43.78 ? 15  U   E P     1 
ATOM   282  O  OP1   . U   A 1 15  ? -48.647 -15.146 37.189  1.00 43.75 ? 15  U   E OP1   1 
ATOM   283  O  OP2   . U   A 1 15  ? -50.931 -16.197 36.712  1.00 43.54 ? 15  U   E OP2   1 
ATOM   284  O  "O5'" . U   A 1 15  ? -49.010 -17.618 37.457  1.00 43.68 ? 15  U   E "O5'" 1 
ATOM   285  C  "C5'" . U   A 1 15  ? -48.730 -18.325 38.664  1.00 43.74 ? 15  U   E "C5'" 1 
ATOM   286  C  "C4'" . U   A 1 15  ? -49.116 -19.795 38.572  1.00 43.77 ? 15  U   E "C4'" 1 
ATOM   287  O  "O4'" . U   A 1 15  ? -50.356 -19.954 37.827  1.00 43.95 ? 15  U   E "O4'" 1 
ATOM   288  C  "C3'" . U   A 1 15  ? -48.116 -20.698 37.858  1.00 43.74 ? 15  U   E "C3'" 1 
ATOM   289  O  "O3'" . U   A 1 15  ? -47.116 -21.190 38.755  1.00 43.49 ? 15  U   E "O3'" 1 
ATOM   290  C  "C2'" . U   A 1 15  ? -49.025 -21.810 37.339  1.00 43.90 ? 15  U   E "C2'" 1 
ATOM   291  O  "O2'" . U   A 1 15  ? -49.413 -22.735 38.338  1.00 43.96 ? 15  U   E "O2'" 1 
ATOM   292  C  "C1'" . U   A 1 15  ? -50.228 -20.995 36.870  1.00 44.05 ? 15  U   E "C1'" 1 
ATOM   293  N  N1    . U   A 1 15  ? -50.142 -20.393 35.471  1.00 44.18 ? 15  U   E N1    1 
ATOM   294  C  C2    . U   A 1 15  ? -49.444 -21.005 34.427  1.00 44.21 ? 15  U   E C2    1 
ATOM   295  O  O2    . U   A 1 15  ? -48.837 -22.059 34.509  1.00 44.20 ? 15  U   E O2    1 
ATOM   296  N  N3    . U   A 1 15  ? -49.472 -20.324 33.230  1.00 44.27 ? 15  U   E N3    1 
ATOM   297  C  C4    . U   A 1 15  ? -50.109 -19.125 32.958  1.00 44.21 ? 15  U   E C4    1 
ATOM   298  O  O4    . U   A 1 15  ? -50.043 -18.638 31.833  1.00 44.20 ? 15  U   E O4    1 
ATOM   299  C  C5    . U   A 1 15  ? -50.811 -18.550 34.078  1.00 44.22 ? 15  U   E C5    1 
ATOM   300  C  C6    . U   A 1 15  ? -50.802 -19.192 35.254  1.00 44.23 ? 15  U   E C6    1 
ATOM   301  P  P     . G   A 1 16  ? -45.818 -21.970 38.219  1.00 43.31 ? 16  G   E P     1 
ATOM   302  O  OP1   . G   A 1 16  ? -46.140 -23.415 38.199  1.00 43.36 ? 16  G   E OP1   1 
ATOM   303  O  OP2   . G   A 1 16  ? -44.662 -21.495 39.013  1.00 43.25 ? 16  G   E OP2   1 
ATOM   304  O  "O5'" . G   A 1 16  ? -45.633 -21.432 36.719  1.00 43.21 ? 16  G   E "O5'" 1 
ATOM   305  C  "C5'" . G   A 1 16  ? -45.422 -22.321 35.618  1.00 42.98 ? 16  G   E "C5'" 1 
ATOM   306  C  "C4'" . G   A 1 16  ? -44.716 -21.631 34.460  1.00 42.66 ? 16  G   E "C4'" 1 
ATOM   307  O  "O4'" . G   A 1 16  ? -45.137 -20.243 34.379  1.00 42.33 ? 16  G   E "O4'" 1 
ATOM   308  C  "C3'" . G   A 1 16  ? -43.195 -21.615 34.556  1.00 42.71 ? 16  G   E "C3'" 1 
ATOM   309  O  "O3'" . G   A 1 16  ? -42.644 -22.723 33.835  1.00 43.10 ? 16  G   E "O3'" 1 
ATOM   310  C  "C2'" . G   A 1 16  ? -42.812 -20.281 33.915  1.00 42.35 ? 16  G   E "C2'" 1 
ATOM   311  O  "O2'" . G   A 1 16  ? -42.554 -20.388 32.529  1.00 42.40 ? 16  G   E "O2'" 1 
ATOM   312  C  "C1'" . G   A 1 16  ? -44.030 -19.388 34.157  1.00 41.88 ? 16  G   E "C1'" 1 
ATOM   313  N  N9    . G   A 1 16  ? -43.887 -18.466 35.291  1.00 41.71 ? 16  G   E N9    1 
ATOM   314  C  C8    . G   A 1 16  ? -44.627 -18.470 36.450  1.00 41.68 ? 16  G   E C8    1 
ATOM   315  N  N7    . G   A 1 16  ? -44.295 -17.537 37.297  1.00 41.64 ? 16  G   E N7    1 
ATOM   316  C  C5    . G   A 1 16  ? -43.264 -16.858 36.663  1.00 41.63 ? 16  G   E C5    1 
ATOM   317  C  C6    . G   A 1 16  ? -42.505 -15.743 37.102  1.00 41.64 ? 16  G   E C6    1 
ATOM   318  O  O6    . G   A 1 16  ? -42.605 -15.123 38.170  1.00 41.59 ? 16  G   E O6    1 
ATOM   319  N  N1    . G   A 1 16  ? -41.551 -15.354 36.161  1.00 41.67 ? 16  G   E N1    1 
ATOM   320  C  C2    . G   A 1 16  ? -41.356 -15.971 34.945  1.00 41.68 ? 16  G   E C2    1 
ATOM   321  N  N2    . G   A 1 16  ? -40.390 -15.460 34.166  1.00 41.65 ? 16  G   E N2    1 
ATOM   322  N  N3    . G   A 1 16  ? -42.061 -17.017 34.523  1.00 41.63 ? 16  G   E N3    1 
ATOM   323  C  C4    . G   A 1 16  ? -42.999 -17.413 35.426  1.00 41.67 ? 16  G   E C4    1 
ATOM   324  P  P     . C   A 1 17  ? -41.393 -23.567 34.381  1.00 43.76 ? 17  C   E P     1 
ATOM   325  O  OP1   . C   A 1 17  ? -41.016 -24.535 33.326  1.00 43.53 ? 17  C   E OP1   1 
ATOM   326  O  OP2   . C   A 1 17  ? -41.726 -24.063 35.736  1.00 43.83 ? 17  C   E OP2   1 
ATOM   327  O  "O5'" . C   A 1 17  ? -40.224 -22.477 34.539  1.00 43.70 ? 17  C   E "O5'" 1 
ATOM   328  C  "C5'" . C   A 1 17  ? -39.436 -22.074 33.415  1.00 43.45 ? 17  C   E "C5'" 1 
ATOM   329  C  "C4'" . C   A 1 17  ? -38.611 -20.836 33.722  1.00 43.33 ? 17  C   E "C4'" 1 
ATOM   330  O  "O4'" . C   A 1 17  ? -39.483 -19.730 34.081  1.00 43.49 ? 17  C   E "O4'" 1 
ATOM   331  C  "C3'" . C   A 1 17  ? -37.677 -20.953 34.919  1.00 43.29 ? 17  C   E "C3'" 1 
ATOM   332  O  "O3'" . C   A 1 17  ? -36.476 -21.647 34.588  1.00 43.06 ? 17  C   E "O3'" 1 
ATOM   333  C  "C2'" . C   A 1 17  ? -37.458 -19.482 35.258  1.00 43.18 ? 17  C   E "C2'" 1 
ATOM   334  O  "O2'" . C   A 1 17  ? -36.556 -18.837 34.379  1.00 43.20 ? 17  C   E "O2'" 1 
ATOM   335  C  "C1'" . C   A 1 17  ? -38.867 -18.925 35.078  1.00 43.02 ? 17  C   E "C1'" 1 
ATOM   336  N  N1    . C   A 1 17  ? -39.700 -18.887 36.353  1.00 42.87 ? 17  C   E N1    1 
ATOM   337  C  C2    . C   A 1 17  ? -39.574 -17.810 37.256  1.00 42.75 ? 17  C   E C2    1 
ATOM   338  O  O2    . C   A 1 17  ? -38.783 -16.887 37.027  1.00 42.72 ? 17  C   E O2    1 
ATOM   339  N  N3    . C   A 1 17  ? -40.333 -17.803 38.386  1.00 42.77 ? 17  C   E N3    1 
ATOM   340  C  C4    . C   A 1 17  ? -41.188 -18.800 38.638  1.00 42.78 ? 17  C   E C4    1 
ATOM   341  N  N4    . C   A 1 17  ? -41.906 -18.737 39.763  1.00 42.65 ? 17  C   E N4    1 
ATOM   342  C  C5    . C   A 1 17  ? -41.337 -19.902 37.741  1.00 42.63 ? 17  C   E C5    1 
ATOM   343  C  C6    . C   A 1 17  ? -40.584 -19.901 36.632  1.00 42.65 ? 17  C   E C6    1 
ATOM   344  P  P     . C   A 1 18  ? -35.738 -22.539 35.696  1.00 43.50 ? 18  C   E P     1 
ATOM   345  O  OP1   . C   A 1 18  ? -34.635 -23.275 35.040  1.00 43.69 ? 18  C   E OP1   1 
ATOM   346  O  OP2   . C   A 1 18  ? -36.764 -23.299 36.448  1.00 44.15 ? 18  C   E OP2   1 
ATOM   347  O  "O5'" . C   A 1 18  ? -35.109 -21.452 36.689  1.00 43.13 ? 18  C   E "O5'" 1 
ATOM   348  C  "C5'" . C   A 1 18  ? -34.111 -20.538 36.233  1.00 42.41 ? 18  C   E "C5'" 1 
ATOM   349  C  "C4'" . C   A 1 18  ? -33.898 -19.420 37.237  1.00 41.86 ? 18  C   E "C4'" 1 
ATOM   350  O  "O4'" . C   A 1 18  ? -35.127 -18.688 37.475  1.00 41.47 ? 18  C   E "O4'" 1 
ATOM   351  C  "C3'" . C   A 1 18  ? -33.488 -19.887 38.619  1.00 41.86 ? 18  C   E "C3'" 1 
ATOM   352  O  "O3'" . C   A 1 18  ? -32.101 -20.185 38.634  1.00 42.26 ? 18  C   E "O3'" 1 
ATOM   353  C  "C2'" . C   A 1 18  ? -33.869 -18.681 39.471  1.00 41.70 ? 18  C   E "C2'" 1 
ATOM   354  O  "O2'" . C   A 1 18  ? -32.952 -17.606 39.368  1.00 41.57 ? 18  C   E "O2'" 1 
ATOM   355  C  "C1'" . C   A 1 18  ? -35.203 -18.298 38.838  1.00 41.42 ? 18  C   E "C1'" 1 
ATOM   356  N  N1    . C   A 1 18  ? -36.428 -18.910 39.495  1.00 41.65 ? 18  C   E N1    1 
ATOM   357  C  C2    . C   A 1 18  ? -36.909 -18.417 40.727  1.00 41.56 ? 18  C   E C2    1 
ATOM   358  O  O2    . C   A 1 18  ? -36.334 -17.480 41.299  1.00 41.42 ? 18  C   E O2    1 
ATOM   359  N  N3    . C   A 1 18  ? -38.015 -18.989 41.275  1.00 41.26 ? 18  C   E N3    1 
ATOM   360  C  C4    . C   A 1 18  ? -38.638 -20.001 40.661  1.00 41.36 ? 18  C   E C4    1 
ATOM   361  N  N4    . C   A 1 18  ? -39.721 -20.524 41.249  1.00 41.28 ? 18  C   E N4    1 
ATOM   362  C  C5    . C   A 1 18  ? -38.175 -20.518 39.414  1.00 41.36 ? 18  C   E C5    1 
ATOM   363  C  C6    . C   A 1 18  ? -37.086 -19.948 38.880  1.00 41.59 ? 18  C   E C6    1 
ATOM   364  P  P     . C   A 1 19  ? -31.566 -21.428 39.485  1.00 42.11 ? 19  C   E P     1 
ATOM   365  O  OP1   . C   A 1 19  ? -30.164 -21.669 39.077  1.00 42.39 ? 19  C   E OP1   1 
ATOM   366  O  OP2   . C   A 1 19  ? -32.552 -22.532 39.412  1.00 42.89 ? 19  C   E OP2   1 
ATOM   367  O  "O5'" . C   A 1 19  ? -31.604 -20.864 40.980  1.00 41.86 ? 19  C   E "O5'" 1 
ATOM   368  C  "C5'" . C   A 1 19  ? -30.825 -19.729 41.363  1.00 40.83 ? 19  C   E "C5'" 1 
ATOM   369  C  "C4'" . C   A 1 19  ? -31.241 -19.241 42.738  1.00 40.48 ? 19  C   E "C4'" 1 
ATOM   370  O  "O4'" . C   A 1 19  ? -32.573 -18.656 42.687  1.00 39.81 ? 19  C   E "O4'" 1 
ATOM   371  C  "C3'" . C   A 1 19  ? -31.385 -20.313 43.810  1.00 39.94 ? 19  C   E "C3'" 1 
ATOM   372  O  "O3'" . C   A 1 19  ? -30.134 -20.746 44.315  1.00 41.05 ? 19  C   E "O3'" 1 
ATOM   373  C  "C2'" . C   A 1 19  ? -32.193 -19.538 44.840  1.00 39.53 ? 19  C   E "C2'" 1 
ATOM   374  O  "O2'" . C   A 1 19  ? -31.431 -18.559 45.525  1.00 39.01 ? 19  C   E "O2'" 1 
ATOM   375  C  "C1'" . C   A 1 19  ? -33.229 -18.891 43.924  1.00 38.80 ? 19  C   E "C1'" 1 
ATOM   376  N  N1    . C   A 1 19  ? -34.478 -19.736 43.739  1.00 38.46 ? 19  C   E N1    1 
ATOM   377  C  C2    . C   A 1 19  ? -35.481 -19.711 44.726  1.00 38.22 ? 19  C   E C2    1 
ATOM   378  O  O2    . C   A 1 19  ? -35.340 -18.997 45.730  1.00 38.10 ? 19  C   E O2    1 
ATOM   379  N  N3    . C   A 1 19  ? -36.596 -20.471 44.552  1.00 37.85 ? 19  C   E N3    1 
ATOM   380  C  C4    . C   A 1 19  ? -36.735 -21.233 43.463  1.00 37.99 ? 19  C   E C4    1 
ATOM   381  N  N4    . C   A 1 19  ? -37.853 -21.958 43.351  1.00 38.07 ? 19  C   E N4    1 
ATOM   382  C  C5    . C   A 1 19  ? -35.732 -21.284 42.447  1.00 37.69 ? 19  C   E C5    1 
ATOM   383  C  C6    . C   A 1 19  ? -34.638 -20.530 42.628  1.00 38.18 ? 19  C   E C6    1 
ATOM   384  P  P     . G   A 1 20  ? -29.946 -22.239 44.857  1.00 41.87 ? 20  G   E P     1 
ATOM   385  O  OP1   . G   A 1 20  ? -28.506 -22.415 45.144  1.00 42.49 ? 20  G   E OP1   1 
ATOM   386  O  OP2   . G   A 1 20  ? -30.621 -23.166 43.918  1.00 42.20 ? 20  G   E OP2   1 
ATOM   387  O  "O5'" . G   A 1 20  ? -30.777 -22.273 46.224  1.00 42.51 ? 20  G   E "O5'" 1 
ATOM   388  C  "C5'" . G   A 1 20  ? -30.281 -21.670 47.415  1.00 42.72 ? 20  G   E "C5'" 1 
ATOM   389  C  "C4'" . G   A 1 20  ? -31.379 -21.451 48.445  1.00 42.66 ? 20  G   E "C4'" 1 
ATOM   390  O  "O4'" . G   A 1 20  ? -32.550 -20.837 47.842  1.00 42.59 ? 20  G   E "O4'" 1 
ATOM   391  C  "C3'" . G   A 1 20  ? -31.933 -22.705 49.103  1.00 42.65 ? 20  G   E "C3'" 1 
ATOM   392  O  "O3'" . G   A 1 20  ? -31.063 -23.186 50.127  1.00 43.29 ? 20  G   E "O3'" 1 
ATOM   393  C  "C2'" . G   A 1 20  ? -33.252 -22.171 49.653  1.00 42.42 ? 20  G   E "C2'" 1 
ATOM   394  O  "O2'" . G   A 1 20  ? -33.102 -21.373 50.815  1.00 42.18 ? 20  G   E "O2'" 1 
ATOM   395  C  "C1'" . G   A 1 20  ? -33.725 -21.324 48.472  1.00 42.15 ? 20  G   E "C1'" 1 
ATOM   396  N  N9    . G   A 1 20  ? -34.534 -22.088 47.514  1.00 42.03 ? 20  G   E N9    1 
ATOM   397  C  C8    . G   A 1 20  ? -34.186 -22.470 46.237  1.00 41.91 ? 20  G   E C8    1 
ATOM   398  N  N7    . G   A 1 20  ? -35.113 -23.151 45.619  1.00 41.92 ? 20  G   E N7    1 
ATOM   399  C  C5    . G   A 1 20  ? -36.146 -23.238 46.545  1.00 42.04 ? 20  G   E C5    1 
ATOM   400  C  C6    . G   A 1 20  ? -37.422 -23.862 46.449  1.00 42.07 ? 20  G   E C6    1 
ATOM   401  O  O6    . G   A 1 20  ? -37.906 -24.486 45.491  1.00 41.89 ? 20  G   E O6    1 
ATOM   402  N  N1    . G   A 1 20  ? -38.167 -23.712 47.622  1.00 41.89 ? 20  G   E N1    1 
ATOM   403  C  C2    . G   A 1 20  ? -37.737 -23.043 48.746  1.00 41.86 ? 20  G   E C2    1 
ATOM   404  N  N2    . G   A 1 20  ? -38.580 -23.000 49.787  1.00 41.89 ? 20  G   E N2    1 
ATOM   405  N  N3    . G   A 1 20  ? -36.550 -22.458 48.845  1.00 42.03 ? 20  G   E N3    1 
ATOM   406  C  C4    . G   A 1 20  ? -35.805 -22.590 47.715  1.00 42.06 ? 20  G   E C4    1 
ATOM   407  P  P     . G   A 1 21  ? -31.023 -24.750 50.485  1.00 43.29 ? 21  G   E P     1 
ATOM   408  O  OP1   . G   A 1 21  ? -29.846 -24.976 51.355  1.00 43.42 ? 21  G   E OP1   1 
ATOM   409  O  OP2   . G   A 1 21  ? -31.160 -25.521 49.227  1.00 43.48 ? 21  G   E OP2   1 
ATOM   410  O  "O5'" . G   A 1 21  ? -32.345 -24.949 51.358  1.00 43.29 ? 21  G   E "O5'" 1 
ATOM   411  C  "C5'" . G   A 1 21  ? -32.441 -24.394 52.667  1.00 43.32 ? 21  G   E "C5'" 1 
ATOM   412  C  "C4'" . G   A 1 21  ? -33.727 -24.826 53.343  1.00 43.22 ? 21  G   E "C4'" 1 
ATOM   413  O  "O4'" . G   A 1 21  ? -34.854 -24.177 52.698  1.00 43.67 ? 21  G   E "O4'" 1 
ATOM   414  C  "C3'" . G   A 1 21  ? -34.063 -26.307 53.229  1.00 43.22 ? 21  G   E "C3'" 1 
ATOM   415  O  "O3'" . G   A 1 21  ? -33.335 -27.099 54.161  1.00 42.90 ? 21  G   E "O3'" 1 
ATOM   416  C  "C2'" . G   A 1 21  ? -35.565 -26.277 53.492  1.00 43.14 ? 21  G   E "C2'" 1 
ATOM   417  O  "O2'" . G   A 1 21  ? -35.889 -26.049 54.850  1.00 43.27 ? 21  G   E "O2'" 1 
ATOM   418  C  "C1'" . G   A 1 21  ? -35.950 -25.080 52.627  1.00 43.41 ? 21  G   E "C1'" 1 
ATOM   419  N  N9    . G   A 1 21  ? -36.193 -25.453 51.229  1.00 43.42 ? 21  G   E N9    1 
ATOM   420  C  C8    . G   A 1 21  ? -35.353 -25.246 50.158  1.00 43.25 ? 21  G   E C8    1 
ATOM   421  N  N7    . G   A 1 21  ? -35.822 -25.692 49.028  1.00 43.36 ? 21  G   E N7    1 
ATOM   422  C  C5    . G   A 1 21  ? -37.055 -26.235 49.362  1.00 43.21 ? 21  G   E C5    1 
ATOM   423  C  C6    . G   A 1 21  ? -38.027 -26.863 48.541  1.00 43.41 ? 21  G   E C6    1 
ATOM   424  O  O6    . G   A 1 21  ? -37.973 -27.070 47.320  1.00 43.40 ? 21  G   E O6    1 
ATOM   425  N  N1    . G   A 1 21  ? -39.144 -27.279 49.270  1.00 43.27 ? 21  G   E N1    1 
ATOM   426  C  C2    . G   A 1 21  ? -39.300 -27.100 50.628  1.00 43.28 ? 21  G   E C2    1 
ATOM   427  N  N2    . G   A 1 21  ? -40.440 -27.558 51.161  1.00 43.32 ? 21  G   E N2    1 
ATOM   428  N  N3    . G   A 1 21  ? -38.397 -26.509 51.407  1.00 43.25 ? 21  G   E N3    1 
ATOM   429  C  C4    . G   A 1 21  ? -37.300 -26.099 50.714  1.00 43.33 ? 21  G   E C4    1 
ATOM   430  P  P     . G   A 1 22  ? -32.809 -28.550 53.729  1.00 42.78 ? 22  G   E P     1 
ATOM   431  O  OP1   . G   A 1 22  ? -32.050 -29.106 54.872  1.00 42.86 ? 22  G   E OP1   1 
ATOM   432  O  OP2   . G   A 1 22  ? -32.169 -28.455 52.401  1.00 42.58 ? 22  G   E OP2   1 
ATOM   433  O  "O5'" . G   A 1 22  ? -34.161 -29.383 53.526  1.00 42.74 ? 22  G   E "O5'" 1 
ATOM   434  C  "C5'" . G   A 1 22  ? -34.959 -29.771 54.638  1.00 42.31 ? 22  G   E "C5'" 1 
ATOM   435  C  "C4'" . G   A 1 22  ? -36.228 -30.460 54.173  1.00 42.21 ? 22  G   E "C4'" 1 
ATOM   436  O  "O4'" . G   A 1 22  ? -36.971 -29.606 53.265  1.00 42.11 ? 22  G   E "O4'" 1 
ATOM   437  C  "C3'" . G   A 1 22  ? -36.033 -31.718 53.342  1.00 42.16 ? 22  G   E "C3'" 1 
ATOM   438  O  "O3'" . G   A 1 22  ? -35.614 -32.828 54.132  1.00 42.02 ? 22  G   E "O3'" 1 
ATOM   439  C  "C2'" . G   A 1 22  ? -37.438 -31.869 52.763  1.00 42.03 ? 22  G   E "C2'" 1 
ATOM   440  O  "O2'" . G   A 1 22  ? -38.398 -32.333 53.695  1.00 42.05 ? 22  G   E "O2'" 1 
ATOM   441  C  "C1'" . G   A 1 22  ? -37.724 -30.418 52.376  1.00 41.97 ? 22  G   E "C1'" 1 
ATOM   442  N  N9    . G   A 1 22  ? -37.360 -30.128 50.986  1.00 41.94 ? 22  G   E N9    1 
ATOM   443  C  C8    . G   A 1 22  ? -36.273 -29.414 50.532  1.00 41.90 ? 22  G   E C8    1 
ATOM   444  N  N7    . G   A 1 22  ? -36.207 -29.330 49.233  1.00 41.91 ? 22  G   E N7    1 
ATOM   445  C  C5    . G   A 1 22  ? -37.321 -30.033 48.789  1.00 42.03 ? 22  G   E C5    1 
ATOM   446  C  C6    . G   A 1 22  ? -37.786 -30.285 47.470  1.00 41.97 ? 22  G   E C6    1 
ATOM   447  O  O6    . G   A 1 22  ? -37.281 -29.923 46.398  1.00 41.84 ? 22  G   E O6    1 
ATOM   448  N  N1    . G   A 1 22  ? -38.959 -31.043 47.460  1.00 41.86 ? 22  G   E N1    1 
ATOM   449  C  C2    . G   A 1 22  ? -39.605 -31.500 48.587  1.00 41.96 ? 22  G   E C2    1 
ATOM   450  N  N2    . G   A 1 22  ? -40.724 -32.215 48.395  1.00 41.97 ? 22  G   E N2    1 
ATOM   451  N  N3    . G   A 1 22  ? -39.181 -31.267 49.824  1.00 41.97 ? 22  G   E N3    1 
ATOM   452  C  C4    . G   A 1 22  ? -38.039 -30.531 49.855  1.00 41.85 ? 22  G   E C4    1 
ATOM   453  P  P     . U   A 1 23  ? -34.479 -33.819 53.578  1.00 42.09 ? 23  U   E P     1 
ATOM   454  O  OP1   . U   A 1 23  ? -34.137 -34.772 54.657  1.00 42.67 ? 23  U   E OP1   1 
ATOM   455  O  OP2   . U   A 1 23  ? -33.405 -33.009 52.963  1.00 42.20 ? 23  U   E OP2   1 
ATOM   456  O  "O5'" . U   A 1 23  ? -35.233 -34.627 52.418  1.00 42.53 ? 23  U   E "O5'" 1 
ATOM   457  C  "C5'" . U   A 1 23  ? -36.395 -35.415 52.684  1.00 42.97 ? 23  U   E "C5'" 1 
ATOM   458  C  "C4'" . U   A 1 23  ? -37.116 -35.771 51.396  1.00 43.34 ? 23  U   E "C4'" 1 
ATOM   459  O  "O4'" . U   A 1 23  ? -37.418 -34.575 50.637  1.00 43.40 ? 23  U   E "O4'" 1 
ATOM   460  C  "C3'" . U   A 1 23  ? -36.305 -36.621 50.431  1.00 43.68 ? 23  U   E "C3'" 1 
ATOM   461  O  "O3'" . U   A 1 23  ? -36.401 -37.990 50.799  1.00 44.18 ? 23  U   E "O3'" 1 
ATOM   462  C  "C2'" . U   A 1 23  ? -36.968 -36.324 49.087  1.00 43.65 ? 23  U   E "C2'" 1 
ATOM   463  O  "O2'" . U   A 1 23  ? -38.097 -37.145 48.833  1.00 43.90 ? 23  U   E "O2'" 1 
ATOM   464  C  "C1'" . U   A 1 23  ? -37.394 -34.864 49.247  1.00 43.46 ? 23  U   E "C1'" 1 
ATOM   465  N  N1    . U   A 1 23  ? -36.510 -33.866 48.539  1.00 43.57 ? 23  U   E N1    1 
ATOM   466  C  C2    . U   A 1 23  ? -36.679 -33.626 47.180  1.00 43.47 ? 23  U   E C2    1 
ATOM   467  O  O2    . U   A 1 23  ? -37.511 -34.184 46.484  1.00 43.44 ? 23  U   E O2    1 
ATOM   468  N  N3    . U   A 1 23  ? -35.820 -32.692 46.645  1.00 43.24 ? 23  U   E N3    1 
ATOM   469  C  C4    . U   A 1 23  ? -34.835 -31.984 47.314  1.00 43.47 ? 23  U   E C4    1 
ATOM   470  O  O4    . U   A 1 23  ? -34.143 -31.175 46.702  1.00 43.63 ? 23  U   E O4    1 
ATOM   471  C  C5    . U   A 1 23  ? -34.716 -32.281 48.720  1.00 43.47 ? 23  U   E C5    1 
ATOM   472  C  C6    . U   A 1 23  ? -35.541 -33.188 49.264  1.00 43.53 ? 23  U   E C6    1 
ATOM   473  P  P     . G   A 1 24  ? -35.083 -38.890 50.938  1.00 44.66 ? 24  G   E P     1 
ATOM   474  O  OP1   . G   A 1 24  ? -35.505 -40.234 51.394  1.00 44.54 ? 24  G   E OP1   1 
ATOM   475  O  OP2   . G   A 1 24  ? -34.078 -38.137 51.721  1.00 44.70 ? 24  G   E OP2   1 
ATOM   476  O  "O5'" . G   A 1 24  ? -34.560 -38.978 49.429  1.00 44.86 ? 24  G   E "O5'" 1 
ATOM   477  C  "C5'" . G   A 1 24  ? -35.356 -39.597 48.417  1.00 45.63 ? 24  G   E "C5'" 1 
ATOM   478  C  "C4'" . G   A 1 24  ? -34.852 -39.210 47.040  1.00 46.00 ? 24  G   E "C4'" 1 
ATOM   479  O  "O4'" . G   A 1 24  ? -34.645 -37.772 46.984  1.00 46.28 ? 24  G   E "O4'" 1 
ATOM   480  C  "C3'" . G   A 1 24  ? -33.525 -39.863 46.658  1.00 46.25 ? 24  G   E "C3'" 1 
ATOM   481  O  "O3'" . G   A 1 24  ? -33.605 -40.410 45.345  1.00 46.41 ? 24  G   E "O3'" 1 
ATOM   482  C  "C2'" . G   A 1 24  ? -32.518 -38.718 46.768  1.00 46.26 ? 24  G   E "C2'" 1 
ATOM   483  O  "O2'" . G   A 1 24  ? -31.427 -38.833 45.875  1.00 46.49 ? 24  G   E "O2'" 1 
ATOM   484  C  "C1'" . G   A 1 24  ? -33.380 -37.509 46.417  1.00 46.29 ? 24  G   E "C1'" 1 
ATOM   485  N  N9    . G   A 1 24  ? -32.838 -36.250 46.929  1.00 46.35 ? 24  G   E N9    1 
ATOM   486  C  C8    . G   A 1 24  ? -32.390 -35.995 48.205  1.00 46.32 ? 24  G   E C8    1 
ATOM   487  N  N7    . G   A 1 24  ? -31.942 -34.782 48.370  1.00 46.55 ? 24  G   E N7    1 
ATOM   488  C  C5    . G   A 1 24  ? -32.098 -34.189 47.123  1.00 46.33 ? 24  G   E C5    1 
ATOM   489  C  C6    . G   A 1 24  ? -31.783 -32.878 46.688  1.00 46.40 ? 24  G   E C6    1 
ATOM   490  O  O6    . G   A 1 24  ? -31.296 -31.948 47.342  1.00 46.50 ? 24  G   E O6    1 
ATOM   491  N  N1    . G   A 1 24  ? -32.103 -32.673 45.346  1.00 46.38 ? 24  G   E N1    1 
ATOM   492  C  C2    . G   A 1 24  ? -32.655 -33.626 44.522  1.00 46.32 ? 24  G   E C2    1 
ATOM   493  N  N2    . G   A 1 24  ? -32.885 -33.249 43.257  1.00 46.29 ? 24  G   E N2    1 
ATOM   494  N  N3    . G   A 1 24  ? -32.948 -34.865 44.913  1.00 46.21 ? 24  G   E N3    1 
ATOM   495  C  C4    . G   A 1 24  ? -32.647 -35.079 46.223  1.00 46.33 ? 24  G   E C4    1 
ATOM   496  P  P     . A   A 1 25  ? -32.859 -41.784 44.991  1.00 46.44 ? 25  A   E P     1 
ATOM   497  O  OP1   . A   A 1 25  ? -33.148 -42.774 46.053  1.00 46.42 ? 25  A   E OP1   1 
ATOM   498  O  OP2   . A   A 1 25  ? -31.458 -41.438 44.662  1.00 46.60 ? 25  A   E OP2   1 
ATOM   499  O  "O5'" . A   A 1 25  ? -33.571 -42.251 43.638  1.00 45.94 ? 25  A   E "O5'" 1 
ATOM   500  C  "C5'" . A   A 1 25  ? -34.987 -42.402 43.558  1.00 45.97 ? 25  A   E "C5'" 1 
ATOM   501  C  "C4'" . A   A 1 25  ? -35.525 -41.848 42.246  1.00 45.84 ? 25  A   E "C4'" 1 
ATOM   502  O  "O4'" . A   A 1 25  ? -35.189 -40.442 42.133  1.00 46.00 ? 25  A   E "O4'" 1 
ATOM   503  C  "C3'" . A   A 1 25  ? -34.998 -42.508 40.972  1.00 45.93 ? 25  A   E "C3'" 1 
ATOM   504  O  "O3'" . A   A 1 25  ? -36.041 -42.605 39.997  1.00 46.32 ? 25  A   E "O3'" 1 
ATOM   505  C  "C2'" . A   A 1 25  ? -33.888 -41.556 40.527  1.00 45.70 ? 25  A   E "C2'" 1 
ATOM   506  O  "O2'" . A   A 1 25  ? -33.632 -41.604 39.137  1.00 45.41 ? 25  A   E "O2'" 1 
ATOM   507  C  "C1'" . A   A 1 25  ? -34.497 -40.214 40.920  1.00 45.76 ? 25  A   E "C1'" 1 
ATOM   508  N  N9    . A   A 1 25  ? -33.531 -39.139 41.132  1.00 45.70 ? 25  A   E N9    1 
ATOM   509  C  C8    . A   A 1 25  ? -33.040 -38.694 42.329  1.00 45.73 ? 25  A   E C8    1 
ATOM   510  N  N7    . A   A 1 25  ? -32.187 -37.705 42.221  1.00 45.65 ? 25  A   E N7    1 
ATOM   511  C  C5    . A   A 1 25  ? -32.112 -37.483 40.858  1.00 45.59 ? 25  A   E C5    1 
ATOM   512  C  C6    . A   A 1 25  ? -31.377 -36.562 40.082  1.00 45.68 ? 25  A   E C6    1 
ATOM   513  N  N6    . A   A 1 25  ? -30.540 -35.663 40.606  1.00 45.70 ? 25  A   E N6    1 
ATOM   514  N  N1    . A   A 1 25  ? -31.530 -36.605 38.740  1.00 45.74 ? 25  A   E N1    1 
ATOM   515  C  C2    . A   A 1 25  ? -32.365 -37.510 38.206  1.00 45.68 ? 25  A   E C2    1 
ATOM   516  N  N3    . A   A 1 25  ? -33.109 -38.422 38.832  1.00 45.65 ? 25  A   E N3    1 
ATOM   517  C  C4    . A   A 1 25  ? -32.936 -38.358 40.168  1.00 45.76 ? 25  A   E C4    1 
ATOM   518  P  P     . G   A 1 26  ? -37.003 -43.886 39.935  1.00 46.68 ? 26  G   E P     1 
ATOM   519  O  OP1   . G   A 1 26  ? -37.959 -43.802 41.063  1.00 46.72 ? 26  G   E OP1   1 
ATOM   520  O  OP2   . G   A 1 26  ? -36.172 -45.099 39.751  1.00 46.65 ? 26  G   E OP2   1 
ATOM   521  P  P     . A   A 1 27  ? -34.163 -44.121 32.834  1.00 54.28 ? 27  A   E P     1 
ATOM   522  O  OP1   . A   A 1 27  ? -32.910 -43.880 33.587  1.00 54.33 ? 27  A   E OP1   1 
ATOM   523  O  OP2   . A   A 1 27  ? -34.851 -42.996 32.162  1.00 54.51 ? 27  A   E OP2   1 
ATOM   524  O  "O5'" . A   A 1 27  ? -33.938 -45.279 31.749  1.00 53.96 ? 27  A   E "O5'" 1 
ATOM   525  C  "C5'" . A   A 1 27  ? -32.708 -45.394 31.036  1.00 53.55 ? 27  A   E "C5'" 1 
ATOM   526  C  "C4'" . A   A 1 27  ? -32.888 -45.116 29.550  1.00 53.19 ? 27  A   E "C4'" 1 
ATOM   527  O  "O4'" . A   A 1 27  ? -34.151 -45.657 29.080  1.00 52.91 ? 27  A   E "O4'" 1 
ATOM   528  C  "C3'" . A   A 1 27  ? -32.872 -43.639 29.162  1.00 52.92 ? 27  A   E "C3'" 1 
ATOM   529  O  "O3'" . A   A 1 27  ? -31.993 -43.446 28.052  1.00 52.72 ? 27  A   E "O3'" 1 
ATOM   530  C  "C2'" . A   A 1 27  ? -34.327 -43.329 28.806  1.00 52.87 ? 27  A   E "C2'" 1 
ATOM   531  O  "O2'" . A   A 1 27  ? -34.450 -42.357 27.785  1.00 52.82 ? 27  A   E "O2'" 1 
ATOM   532  C  "C1'" . A   A 1 27  ? -34.841 -44.684 28.322  1.00 52.75 ? 27  A   E "C1'" 1 
ATOM   533  N  N9    . A   A 1 27  ? -36.278 -44.874 28.517  1.00 52.67 ? 27  A   E N9    1 
ATOM   534  C  C8    . A   A 1 27  ? -36.941 -44.960 29.712  1.00 52.65 ? 27  A   E C8    1 
ATOM   535  N  N7    . A   A 1 27  ? -38.236 -45.131 29.594  1.00 52.67 ? 27  A   E N7    1 
ATOM   536  C  C5    . A   A 1 27  ? -38.442 -45.162 28.226  1.00 52.63 ? 27  A   E C5    1 
ATOM   537  C  C6    . A   A 1 27  ? -39.606 -45.318 27.442  1.00 52.66 ? 27  A   E C6    1 
ATOM   538  N  N6    . A   A 1 27  ? -40.825 -45.476 27.967  1.00 52.70 ? 27  A   E N6    1 
ATOM   539  N  N1    . A   A 1 27  ? -39.471 -45.302 26.095  1.00 52.69 ? 27  A   E N1    1 
ATOM   540  C  C2    . A   A 1 27  ? -38.247 -45.142 25.570  1.00 52.67 ? 27  A   E C2    1 
ATOM   541  N  N3    . A   A 1 27  ? -37.082 -44.987 26.206  1.00 52.63 ? 27  A   E N3    1 
ATOM   542  C  C4    . A   A 1 27  ? -37.245 -45.007 27.543  1.00 52.64 ? 27  A   E C4    1 
ATOM   543  P  P     . A   A 1 28  ? -30.490 -42.920 28.239  1.00 52.56 ? 28  A   E P     1 
ATOM   544  O  OP1   . A   A 1 28  ? -29.615 -43.789 27.421  1.00 52.48 ? 28  A   E OP1   1 
ATOM   545  O  OP2   . A   A 1 28  ? -30.212 -42.743 29.684  1.00 52.53 ? 28  A   E OP2   1 
ATOM   546  O  "O5'" . A   A 1 28  ? -30.532 -41.461 27.580  1.00 52.36 ? 28  A   E "O5'" 1 
ATOM   547  C  "C5'" . A   A 1 28  ? -31.124 -41.260 26.296  1.00 51.92 ? 28  A   E "C5'" 1 
ATOM   548  C  "C4'" . A   A 1 28  ? -30.558 -40.038 25.585  1.00 51.50 ? 28  A   E "C4'" 1 
ATOM   549  O  "O4'" . A   A 1 28  ? -31.411 -39.691 24.464  1.00 51.26 ? 28  A   E "O4'" 1 
ATOM   550  C  "C3'" . A   A 1 28  ? -30.429 -38.765 26.417  1.00 51.32 ? 28  A   E "C3'" 1 
ATOM   551  O  "O3'" . A   A 1 28  ? -29.231 -38.073 26.051  1.00 51.39 ? 28  A   E "O3'" 1 
ATOM   552  C  "C2'" . A   A 1 28  ? -31.692 -37.968 26.080  1.00 51.17 ? 28  A   E "C2'" 1 
ATOM   553  O  "O2'" . A   A 1 28  ? -31.482 -36.568 26.079  1.00 51.21 ? 28  A   E "O2'" 1 
ATOM   554  C  "C1'" . A   A 1 28  ? -32.048 -38.443 24.671  1.00 50.83 ? 28  A   E "C1'" 1 
ATOM   555  N  N9    . A   A 1 28  ? -33.483 -38.625 24.426  1.00 50.71 ? 28  A   E N9    1 
ATOM   556  C  C8    . A   A 1 28  ? -34.472 -38.804 25.357  1.00 50.60 ? 28  A   E C8    1 
ATOM   557  N  N7    . A   A 1 28  ? -35.672 -38.944 24.845  1.00 50.57 ? 28  A   E N7    1 
ATOM   558  C  C5    . A   A 1 28  ? -35.460 -38.855 23.480  1.00 50.59 ? 28  A   E C5    1 
ATOM   559  C  C6    . A   A 1 28  ? -36.336 -38.925 22.374  1.00 50.56 ? 28  A   E C6    1 
ATOM   560  N  N6    . A   A 1 28  ? -37.654 -39.109 22.495  1.00 50.59 ? 28  A   E N6    1 
ATOM   561  N  N1    . A   A 1 28  ? -35.807 -38.796 21.136  1.00 50.59 ? 28  A   E N1    1 
ATOM   562  C  C2    . A   A 1 28  ? -34.484 -38.610 21.016  1.00 50.57 ? 28  A   E C2    1 
ATOM   563  N  N3    . A   A 1 28  ? -33.563 -38.529 21.980  1.00 50.56 ? 28  A   E N3    1 
ATOM   564  C  C4    . A   A 1 28  ? -34.117 -38.659 23.202  1.00 50.63 ? 28  A   E C4    1 
ATOM   565  P  P     . G   A 1 29  ? -28.312 -37.345 27.145  1.00 51.44 ? 29  G   E P     1 
ATOM   566  O  OP1   . G   A 1 29  ? -27.131 -36.797 26.441  1.00 51.61 ? 29  G   E OP1   1 
ATOM   567  O  OP2   . G   A 1 29  ? -28.112 -38.269 28.285  1.00 51.51 ? 29  G   E OP2   1 
ATOM   568  O  "O5'" . G   A 1 29  ? -29.225 -36.121 27.621  1.00 51.52 ? 29  G   E "O5'" 1 
ATOM   569  C  "C5'" . G   A 1 29  ? -29.752 -36.115 28.935  1.00 51.51 ? 29  G   E "C5'" 1 
ATOM   570  C  "C4'" . G   A 1 29  ? -30.606 -34.892 29.206  1.00 51.44 ? 29  G   E "C4'" 1 
ATOM   571  O  "O4'" . G   A 1 29  ? -32.007 -35.211 28.990  1.00 51.73 ? 29  G   E "O4'" 1 
ATOM   572  C  "C3'" . G   A 1 29  ? -30.493 -34.428 30.650  1.00 51.34 ? 29  G   E "C3'" 1 
ATOM   573  O  "O3'" . G   A 1 29  ? -29.715 -33.222 30.711  1.00 50.23 ? 29  G   E "O3'" 1 
ATOM   574  C  "C2'" . G   A 1 29  ? -31.945 -34.267 31.114  1.00 51.76 ? 29  G   E "C2'" 1 
ATOM   575  O  "O2'" . G   A 1 29  ? -32.451 -32.961 30.913  1.00 52.06 ? 29  G   E "O2'" 1 
ATOM   576  C  "C1'" . G   A 1 29  ? -32.696 -35.261 30.226  1.00 52.14 ? 29  G   E "C1'" 1 
ATOM   577  N  N9    . G   A 1 29  ? -32.761 -36.663 30.683  1.00 52.34 ? 29  G   E N9    1 
ATOM   578  C  C8    . G   A 1 29  ? -32.519 -37.776 29.907  1.00 52.47 ? 29  G   E C8    1 
ATOM   579  N  N7    . G   A 1 29  ? -32.640 -38.911 30.533  1.00 52.56 ? 29  G   E N7    1 
ATOM   580  C  C5    . G   A 1 29  ? -32.996 -38.541 31.821  1.00 52.51 ? 29  G   E C5    1 
ATOM   581  C  C6    . G   A 1 29  ? -33.267 -39.356 32.951  1.00 52.40 ? 29  G   E C6    1 
ATOM   582  O  O6    . G   A 1 29  ? -33.240 -40.592 33.025  1.00 52.45 ? 29  G   E O6    1 
ATOM   583  N  N1    . G   A 1 29  ? -33.596 -38.602 34.077  1.00 52.34 ? 29  G   E N1    1 
ATOM   584  C  C2    . G   A 1 29  ? -33.653 -37.227 34.098  1.00 52.46 ? 29  G   E C2    1 
ATOM   585  N  N2    . G   A 1 29  ? -33.984 -36.666 35.268  1.00 52.50 ? 29  G   E N2    1 
ATOM   586  N  N3    . G   A 1 29  ? -33.402 -36.451 33.046  1.00 52.58 ? 29  G   E N3    1 
ATOM   587  C  C4    . G   A 1 29  ? -33.079 -37.165 31.935  1.00 52.42 ? 29  G   E C4    1 
ATOM   588  P  P     . C   A 1 30  ? -28.182 -33.250 31.193  1.00 49.31 ? 30  C   E P     1 
ATOM   589  O  OP1   . C   A 1 30  ? -27.642 -31.882 31.050  1.00 49.69 ? 30  C   E OP1   1 
ATOM   590  O  OP2   . C   A 1 30  ? -27.482 -34.376 30.536  1.00 49.42 ? 30  C   E OP2   1 
ATOM   591  O  "O5'" . C   A 1 30  ? -28.289 -33.602 32.750  1.00 48.57 ? 30  C   E "O5'" 1 
ATOM   592  C  "C5'" . C   A 1 30  ? -29.087 -32.821 33.641  1.00 47.00 ? 30  C   E "C5'" 1 
ATOM   593  C  "C4'" . C   A 1 30  ? -29.656 -33.695 34.743  1.00 46.05 ? 30  C   E "C4'" 1 
ATOM   594  O  "O4'" . C   A 1 30  ? -30.475 -34.758 34.181  1.00 46.32 ? 30  C   E "O4'" 1 
ATOM   595  C  "C3'" . C   A 1 30  ? -28.626 -34.470 35.551  1.00 45.14 ? 30  C   E "C3'" 1 
ATOM   596  O  "O3'" . C   A 1 30  ? -27.955 -33.657 36.498  1.00 43.11 ? 30  C   E "O3'" 1 
ATOM   597  C  "C2'" . C   A 1 30  ? -29.526 -35.509 36.206  1.00 45.86 ? 30  C   E "C2'" 1 
ATOM   598  O  "O2'" . C   A 1 30  ? -30.330 -34.948 37.227  1.00 46.04 ? 30  C   E "O2'" 1 
ATOM   599  C  "C1'" . C   A 1 30  ? -30.387 -35.914 35.009  1.00 46.27 ? 30  C   E "C1'" 1 
ATOM   600  N  N1    . C   A 1 30  ? -29.856 -37.111 34.231  1.00 46.52 ? 30  C   E N1    1 
ATOM   601  C  C2    . C   A 1 30  ? -29.988 -38.423 34.737  1.00 46.53 ? 30  C   E C2    1 
ATOM   602  O  O2    . C   A 1 30  ? -30.538 -38.630 35.827  1.00 46.59 ? 30  C   E O2    1 
ATOM   603  N  N3    . C   A 1 30  ? -29.501 -39.465 34.011  1.00 46.61 ? 30  C   E N3    1 
ATOM   604  C  C4    . C   A 1 30  ? -28.907 -39.252 32.832  1.00 46.59 ? 30  C   E C4    1 
ATOM   605  N  N4    . C   A 1 30  ? -28.448 -40.314 32.162  1.00 46.39 ? 30  C   E N4    1 
ATOM   606  C  C5    . C   A 1 30  ? -28.760 -37.936 32.294  1.00 46.54 ? 30  C   E C5    1 
ATOM   607  C  C6    . C   A 1 30  ? -29.243 -36.916 33.018  1.00 46.63 ? 30  C   E C6    1 
ATOM   608  P  P     . A   A 1 31  ? -26.382 -33.844 36.743  1.00 41.64 ? 31  A   E P     1 
ATOM   609  O  OP1   . A   A 1 31  ? -25.690 -32.704 36.108  1.00 42.00 ? 31  A   E OP1   1 
ATOM   610  O  OP2   . A   A 1 31  ? -25.991 -35.224 36.372  1.00 41.87 ? 31  A   E OP2   1 
ATOM   611  O  "O5'" . A   A 1 31  ? -26.256 -33.702 38.332  1.00 41.28 ? 31  A   E "O5'" 1 
ATOM   612  C  "C5'" . A   A 1 31  ? -26.970 -34.580 39.197  1.00 39.84 ? 31  A   E "C5'" 1 
ATOM   613  C  "C4'" . A   A 1 31  ? -26.497 -34.445 40.638  1.00 39.14 ? 31  A   E "C4'" 1 
ATOM   614  O  "O4'" . A   A 1 31  ? -27.377 -35.203 41.509  1.00 39.15 ? 31  A   E "O4'" 1 
ATOM   615  C  "C3'" . A   A 1 31  ? -25.103 -34.981 40.944  1.00 38.87 ? 31  A   E "C3'" 1 
ATOM   616  O  "O3'" . A   A 1 31  ? -24.570 -34.286 42.074  1.00 38.80 ? 31  A   E "O3'" 1 
ATOM   617  C  "C2'" . A   A 1 31  ? -25.406 -36.444 41.264  1.00 38.71 ? 31  A   E "C2'" 1 
ATOM   618  O  "O2'" . A   A 1 31  ? -24.389 -37.091 42.005  1.00 38.48 ? 31  A   E "O2'" 1 
ATOM   619  C  "C1'" . A   A 1 31  ? -26.663 -36.269 42.110  1.00 38.71 ? 31  A   E "C1'" 1 
ATOM   620  N  N9    . A   A 1 31  ? -27.534 -37.440 42.181  1.00 38.62 ? 31  A   E N9    1 
ATOM   621  C  C8    . A   A 1 31  ? -27.881 -38.104 43.322  1.00 38.42 ? 31  A   E C8    1 
ATOM   622  N  N7    . A   A 1 31  ? -28.682 -39.122 43.123  1.00 38.70 ? 31  A   E N7    1 
ATOM   623  C  C5    . A   A 1 31  ? -28.874 -39.132 41.754  1.00 38.59 ? 31  A   E C5    1 
ATOM   624  C  C6    . A   A 1 31  ? -29.627 -39.973 40.908  1.00 38.55 ? 31  A   E C6    1 
ATOM   625  N  N6    . A   A 1 31  ? -30.346 -41.005 41.359  1.00 38.54 ? 31  A   E N6    1 
ATOM   626  N  N1    . A   A 1 31  ? -29.612 -39.714 39.580  1.00 38.66 ? 31  A   E N1    1 
ATOM   627  C  C2    . A   A 1 31  ? -28.887 -38.678 39.131  1.00 38.56 ? 31  A   E C2    1 
ATOM   628  N  N3    . A   A 1 31  ? -28.143 -37.817 39.831  1.00 38.55 ? 31  A   E N3    1 
ATOM   629  C  C4    . A   A 1 31  ? -28.175 -38.098 41.150  1.00 38.79 ? 31  A   E C4    1 
ATOM   630  P  P     . U   A 1 32  ? -23.156 -33.539 42.023  1.00 38.25 ? 32  U   E P     1 
ATOM   631  O  OP1   . U   A 1 32  ? -22.211 -34.364 41.242  1.00 38.40 ? 32  U   E OP1   1 
ATOM   632  O  OP2   . U   A 1 32  ? -22.816 -33.130 43.403  1.00 39.01 ? 32  U   E OP2   1 
ATOM   633  O  "O5'" . U   A 1 32  ? -23.471 -32.210 41.201  1.00 38.93 ? 32  U   E "O5'" 1 
ATOM   634  C  "C5'" . U   A 1 32  ? -24.308 -31.183 41.722  1.00 39.43 ? 32  U   E "C5'" 1 
ATOM   635  C  "C4'" . U   A 1 32  ? -24.442 -30.063 40.702  1.00 39.79 ? 32  U   E "C4'" 1 
ATOM   636  O  "O4'" . U   A 1 32  ? -23.127 -29.610 40.286  1.00 39.86 ? 32  U   E "O4'" 1 
ATOM   637  C  "C3'" . U   A 1 32  ? -25.175 -30.418 39.410  1.00 40.10 ? 32  U   E "C3'" 1 
ATOM   638  O  "O3'" . U   A 1 32  ? -25.895 -29.274 38.928  1.00 41.19 ? 32  U   E "O3'" 1 
ATOM   639  C  "C2'" . U   A 1 32  ? -24.029 -30.816 38.479  1.00 39.78 ? 32  U   E "C2'" 1 
ATOM   640  O  "O2'" . U   A 1 32  ? -24.349 -30.706 37.108  1.00 38.98 ? 32  U   E "O2'" 1 
ATOM   641  C  "C1'" . U   A 1 32  ? -22.979 -29.785 38.887  1.00 39.86 ? 32  U   E "C1'" 1 
ATOM   642  N  N1    . U   A 1 32  ? -21.555 -30.158 38.606  1.00 39.85 ? 32  U   E N1    1 
ATOM   643  C  C2    . U   A 1 32  ? -20.848 -29.431 37.660  1.00 39.91 ? 32  U   E C2    1 
ATOM   644  O  O2    . U   A 1 32  ? -21.317 -28.498 37.031  1.00 39.91 ? 32  U   E O2    1 
ATOM   645  N  N3    . U   A 1 32  ? -19.545 -29.833 37.478  1.00 39.93 ? 32  U   E N3    1 
ATOM   646  C  C4    . U   A 1 32  ? -18.895 -30.867 38.130  1.00 39.74 ? 32  U   E C4    1 
ATOM   647  O  O4    . U   A 1 32  ? -17.726 -31.109 37.852  1.00 40.16 ? 32  U   E O4    1 
ATOM   648  C  C5    . U   A 1 32  ? -19.692 -31.579 39.099  1.00 39.55 ? 32  U   E C5    1 
ATOM   649  C  C6    . U   A 1 32  ? -20.963 -31.204 39.299  1.00 39.29 ? 32  U   E C6    1 
ATOM   650  P  P     . G   A 1 33  ? -27.349 -28.901 39.495  1.00 41.83 ? 33  G   E P     1 
ATOM   651  O  OP1   . G   A 1 33  ? -28.005 -28.031 38.493  1.00 42.11 ? 33  G   E OP1   1 
ATOM   652  O  OP2   . G   A 1 33  ? -27.204 -28.414 40.887  1.00 42.07 ? 33  G   E OP2   1 
ATOM   653  O  "O5'" . G   A 1 33  ? -28.071 -30.327 39.558  1.00 41.59 ? 33  G   E "O5'" 1 
ATOM   654  C  "C5'" . G   A 1 33  ? -28.794 -30.874 38.455  1.00 42.26 ? 33  G   E "C5'" 1 
ATOM   655  C  "C4'" . G   A 1 33  ? -29.944 -31.726 38.969  1.00 42.67 ? 33  G   E "C4'" 1 
ATOM   656  O  "O4'" . G   A 1 33  ? -29.480 -32.573 40.053  1.00 42.65 ? 33  G   E "O4'" 1 
ATOM   657  C  "C3'" . G   A 1 33  ? -31.126 -30.949 39.542  1.00 43.25 ? 33  G   E "C3'" 1 
ATOM   658  O  "O3'" . G   A 1 33  ? -32.335 -31.651 39.272  1.00 43.86 ? 33  G   E "O3'" 1 
ATOM   659  C  "C2'" . G   A 1 33  ? -30.809 -30.907 41.036  1.00 43.24 ? 33  G   E "C2'" 1 
ATOM   660  O  "O2'" . G   A 1 33  ? -31.942 -30.706 41.862  1.00 43.35 ? 33  G   E "O2'" 1 
ATOM   661  C  "C1'" . G   A 1 33  ? -30.217 -32.302 41.228  1.00 42.87 ? 33  G   E "C1'" 1 
ATOM   662  N  N9    . G   A 1 33  ? -29.338 -32.422 42.391  1.00 42.89 ? 33  G   E N9    1 
ATOM   663  C  C8    . G   A 1 33  ? -28.400 -31.514 42.827  1.00 42.71 ? 33  G   E C8    1 
ATOM   664  N  N7    . G   A 1 33  ? -27.770 -31.893 43.904  1.00 42.73 ? 33  G   E N7    1 
ATOM   665  C  C5    . G   A 1 33  ? -28.322 -33.130 44.202  1.00 42.67 ? 33  G   E C5    1 
ATOM   666  C  C6    . G   A 1 33  ? -28.036 -34.025 45.262  1.00 42.83 ? 33  G   E C6    1 
ATOM   667  O  O6    . G   A 1 33  ? -27.209 -33.886 46.172  1.00 42.79 ? 33  G   E O6    1 
ATOM   668  N  N1    . G   A 1 33  ? -28.823 -35.178 45.203  1.00 42.75 ? 33  G   E N1    1 
ATOM   669  C  C2    . G   A 1 33  ? -29.772 -35.432 44.236  1.00 42.78 ? 33  G   E C2    1 
ATOM   670  N  N2    . G   A 1 33  ? -30.440 -36.591 44.333  1.00 42.75 ? 33  G   E N2    1 
ATOM   671  N  N3    . G   A 1 33  ? -30.046 -34.599 43.237  1.00 42.87 ? 33  G   E N3    1 
ATOM   672  C  C4    . G   A 1 33  ? -29.291 -33.470 43.282  1.00 42.70 ? 33  G   E C4    1 
ATOM   673  P  P     . A   A 1 34  ? -33.704 -30.842 39.083  1.00 44.67 ? 34  A   E P     1 
ATOM   674  O  OP1   . A   A 1 34  ? -33.481 -29.733 38.124  1.00 44.58 ? 34  A   E OP1   1 
ATOM   675  O  OP2   . A   A 1 34  ? -34.246 -30.552 40.431  1.00 44.95 ? 34  A   E OP2   1 
ATOM   676  O  "O5'" . A   A 1 34  ? -34.641 -31.937 38.402  1.00 44.24 ? 34  A   E "O5'" 1 
ATOM   677  C  "C5'" . A   A 1 34  ? -34.295 -32.480 37.132  1.00 44.06 ? 34  A   E "C5'" 1 
ATOM   678  C  "C4'" . A   A 1 34  ? -35.060 -33.762 36.879  1.00 43.72 ? 34  A   E "C4'" 1 
ATOM   679  O  "O4'" . A   A 1 34  ? -34.410 -34.857 37.573  1.00 43.50 ? 34  A   E "O4'" 1 
ATOM   680  C  "C3'" . A   A 1 34  ? -36.492 -33.771 37.397  1.00 43.72 ? 34  A   E "C3'" 1 
ATOM   681  O  "O3'" . A   A 1 34  ? -37.383 -33.203 36.438  1.00 43.81 ? 34  A   E "O3'" 1 
ATOM   682  C  "C2'" . A   A 1 34  ? -36.736 -35.260 37.618  1.00 43.50 ? 34  A   E "C2'" 1 
ATOM   683  O  "O2'" . A   A 1 34  ? -37.030 -35.952 36.420  1.00 43.51 ? 34  A   E "O2'" 1 
ATOM   684  C  "C1'" . A   A 1 34  ? -35.382 -35.700 38.171  1.00 43.39 ? 34  A   E "C1'" 1 
ATOM   685  N  N9    . A   A 1 34  ? -35.263 -35.621 39.631  1.00 43.35 ? 34  A   E N9    1 
ATOM   686  C  C8    . A   A 1 34  ? -34.470 -34.763 40.348  1.00 43.26 ? 34  A   E C8    1 
ATOM   687  N  N7    . A   A 1 34  ? -34.557 -34.908 41.648  1.00 43.14 ? 34  A   E N7    1 
ATOM   688  C  C5    . A   A 1 34  ? -35.471 -35.937 41.803  1.00 43.35 ? 34  A   E C5    1 
ATOM   689  C  C6    . A   A 1 34  ? -36.003 -36.576 42.946  1.00 43.26 ? 34  A   E C6    1 
ATOM   690  N  N6    . A   A 1 34  ? -35.666 -36.242 44.195  1.00 43.23 ? 34  A   E N6    1 
ATOM   691  N  N1    . A   A 1 34  ? -36.901 -37.570 42.756  1.00 43.36 ? 34  A   E N1    1 
ATOM   692  C  C2    . A   A 1 34  ? -37.245 -37.904 41.503  1.00 43.26 ? 34  A   E C2    1 
ATOM   693  N  N3    . A   A 1 34  ? -36.811 -37.379 40.355  1.00 43.28 ? 34  A   E N3    1 
ATOM   694  C  C4    . A   A 1 34  ? -35.918 -36.391 40.571  1.00 43.26 ? 34  A   E C4    1 
ATOM   695  P  P     . U   A 1 35  ? -38.458 -32.099 36.882  1.00 43.75 ? 35  U   E P     1 
ATOM   696  O  OP1   . U   A 1 35  ? -39.239 -31.722 35.682  1.00 43.60 ? 35  U   E OP1   1 
ATOM   697  O  OP2   . U   A 1 35  ? -37.750 -31.047 37.648  1.00 43.92 ? 35  U   E OP2   1 
ATOM   698  O  "O5'" . U   A 1 35  ? -39.415 -32.903 37.885  1.00 43.91 ? 35  U   E "O5'" 1 
ATOM   699  C  "C5'" . U   A 1 35  ? -40.256 -33.963 37.422  1.00 44.07 ? 35  U   E "C5'" 1 
ATOM   700  C  "C4'" . U   A 1 35  ? -40.739 -34.829 38.574  1.00 44.17 ? 35  U   E "C4'" 1 
ATOM   701  O  "O4'" . U   A 1 35  ? -39.608 -35.354 39.317  1.00 44.16 ? 35  U   E "O4'" 1 
ATOM   702  C  "C3'" . U   A 1 35  ? -41.565 -34.105 39.627  1.00 44.44 ? 35  U   E "C3'" 1 
ATOM   703  O  "O3'" . U   A 1 35  ? -42.921 -33.982 39.207  1.00 44.92 ? 35  U   E "O3'" 1 
ATOM   704  C  "C2'" . U   A 1 35  ? -41.386 -35.013 40.841  1.00 44.26 ? 35  U   E "C2'" 1 
ATOM   705  O  "O2'" . U   A 1 35  ? -42.219 -36.158 40.820  1.00 44.47 ? 35  U   E "O2'" 1 
ATOM   706  C  "C1'" . U   A 1 35  ? -39.918 -35.417 40.702  1.00 44.07 ? 35  U   E "C1'" 1 
ATOM   707  N  N1    . U   A 1 35  ? -38.949 -34.568 41.509  1.00 43.92 ? 35  U   E N1    1 
ATOM   708  C  C2    . U   A 1 35  ? -38.862 -34.731 42.889  1.00 43.88 ? 35  U   E C2    1 
ATOM   709  O  O2    . U   A 1 35  ? -39.527 -35.529 43.531  1.00 43.67 ? 35  U   E O2    1 
ATOM   710  N  N3    . U   A 1 35  ? -37.950 -33.910 43.516  1.00 43.61 ? 35  U   E N3    1 
ATOM   711  C  C4    . U   A 1 35  ? -37.127 -32.964 42.924  1.00 43.92 ? 35  U   E C4    1 
ATOM   712  O  O4    . U   A 1 35  ? -36.359 -32.303 43.618  1.00 43.80 ? 35  U   E O4    1 
ATOM   713  C  C5    . U   A 1 35  ? -37.269 -32.847 41.492  1.00 43.81 ? 35  U   E C5    1 
ATOM   714  C  C6    . U   A 1 35  ? -38.152 -33.636 40.860  1.00 43.94 ? 35  U   E C6    1 
ATOM   715  P  P     . C   A 1 36  ? -43.565 -32.538 38.933  1.00 45.25 ? 36  C   E P     1 
ATOM   716  O  OP1   . C   A 1 36  ? -44.664 -32.725 37.959  1.00 45.51 ? 36  C   E OP1   1 
ATOM   717  O  OP2   . C   A 1 36  ? -42.487 -31.573 38.628  1.00 45.37 ? 36  C   E OP2   1 
ATOM   718  O  "O5'" . C   A 1 36  ? -44.180 -32.146 40.359  1.00 45.67 ? 36  C   E "O5'" 1 
ATOM   719  C  "C5'" . C   A 1 36  ? -45.276 -32.888 40.902  1.00 46.07 ? 36  C   E "C5'" 1 
ATOM   720  C  "C4'" . C   A 1 36  ? -45.063 -33.226 42.367  1.00 46.38 ? 36  C   E "C4'" 1 
ATOM   721  O  "O4'" . C   A 1 36  ? -43.692 -33.632 42.601  1.00 46.63 ? 36  C   E "O4'" 1 
ATOM   722  C  "C3'" . C   A 1 36  ? -45.260 -32.074 43.340  1.00 46.55 ? 36  C   E "C3'" 1 
ATOM   723  O  "O3'" . C   A 1 36  ? -46.643 -31.866 43.604  1.00 46.71 ? 36  C   E "O3'" 1 
ATOM   724  C  "C2'" . C   A 1 36  ? -44.490 -32.563 44.565  1.00 46.67 ? 36  C   E "C2'" 1 
ATOM   725  O  "O2'" . C   A 1 36  ? -45.226 -33.462 45.374  1.00 46.68 ? 36  C   E "O2'" 1 
ATOM   726  C  "C1'" . C   A 1 36  ? -43.301 -33.276 43.918  1.00 46.65 ? 36  C   E "C1'" 1 
ATOM   727  N  N1    . C   A 1 36  ? -42.035 -32.447 43.898  1.00 46.56 ? 36  C   E N1    1 
ATOM   728  C  C2    . C   A 1 36  ? -41.129 -32.531 44.973  1.00 46.55 ? 36  C   E C2    1 
ATOM   729  O  O2    . C   A 1 36  ? -41.365 -33.282 45.928  1.00 46.65 ? 36  C   E O2    1 
ATOM   730  N  N3    . C   A 1 36  ? -39.997 -31.778 44.940  1.00 46.73 ? 36  C   E N3    1 
ATOM   731  C  C4    . C   A 1 36  ? -39.750 -30.970 43.905  1.00 46.58 ? 36  C   E C4    1 
ATOM   732  N  N4    . C   A 1 36  ? -38.622 -30.254 43.927  1.00 46.64 ? 36  C   E N4    1 
ATOM   733  C  C5    . C   A 1 36  ? -40.653 -30.865 42.802  1.00 46.62 ? 36  C   E C5    1 
ATOM   734  C  C6    . C   A 1 36  ? -41.765 -31.613 42.843  1.00 46.61 ? 36  C   E C6    1 
ATOM   735  P  P     . C   A 1 37  ? -47.203 -30.380 43.824  1.00 46.83 ? 37  C   E P     1 
ATOM   736  O  OP1   . C   A 1 37  ? -48.681 -30.446 43.762  1.00 46.85 ? 37  C   E OP1   1 
ATOM   737  O  OP2   . C   A 1 37  ? -46.473 -29.456 42.924  1.00 46.48 ? 37  C   E OP2   1 
ATOM   738  O  "O5'" . C   A 1 37  ? -46.748 -30.056 45.324  1.00 46.62 ? 37  C   E "O5'" 1 
ATOM   739  C  "C5'" . C   A 1 37  ? -47.322 -30.760 46.423  1.00 46.02 ? 37  C   E "C5'" 1 
ATOM   740  C  "C4'" . C   A 1 37  ? -46.604 -30.451 47.725  1.00 45.69 ? 37  C   E "C4'" 1 
ATOM   741  O  "O4'" . C   A 1 37  ? -45.257 -30.992 47.702  1.00 45.62 ? 37  C   E "O4'" 1 
ATOM   742  C  "C3'" . C   A 1 37  ? -46.371 -28.979 48.038  1.00 45.36 ? 37  C   E "C3'" 1 
ATOM   743  O  "O3'" . C   A 1 37  ? -47.556 -28.332 48.488  1.00 45.05 ? 37  C   E "O3'" 1 
ATOM   744  C  "C2'" . C   A 1 37  ? -45.316 -29.106 49.130  1.00 45.46 ? 37  C   E "C2'" 1 
ATOM   745  O  "O2'" . C   A 1 37  ? -45.848 -29.518 50.377  1.00 45.31 ? 37  C   E "O2'" 1 
ATOM   746  C  "C1'" . C   A 1 37  ? -44.422 -30.195 48.532  1.00 45.44 ? 37  C   E "C1'" 1 
ATOM   747  N  N1    . C   A 1 37  ? -43.248 -29.639 47.754  1.00 45.38 ? 37  C   E N1    1 
ATOM   748  C  C2    . C   A 1 37  ? -42.107 -29.169 48.438  1.00 45.50 ? 37  C   E C2    1 
ATOM   749  O  O2    . C   A 1 37  ? -42.058 -29.216 49.675  1.00 45.49 ? 37  C   E O2    1 
ATOM   750  N  N3    . C   A 1 37  ? -41.066 -28.669 47.718  1.00 45.38 ? 37  C   E N3    1 
ATOM   751  C  C4    . C   A 1 37  ? -41.122 -28.622 46.383  1.00 45.32 ? 37  C   E C4    1 
ATOM   752  N  N4    . C   A 1 37  ? -40.068 -28.119 45.729  1.00 45.30 ? 37  C   E N4    1 
ATOM   753  C  C5    . C   A 1 37  ? -42.267 -29.087 45.666  1.00 45.37 ? 37  C   E C5    1 
ATOM   754  C  C6    . C   A 1 37  ? -43.289 -29.580 46.383  1.00 45.40 ? 37  C   E C6    1 
ATOM   755  P  P     . C   A 1 38  ? -47.834 -26.803 48.094  1.00 44.73 ? 38  C   E P     1 
ATOM   756  O  OP1   . C   A 1 38  ? -49.211 -26.464 48.518  1.00 44.95 ? 38  C   E OP1   1 
ATOM   757  O  OP2   . C   A 1 38  ? -47.448 -26.605 46.679  1.00 44.91 ? 38  C   E OP2   1 
ATOM   758  O  "O5'" . C   A 1 38  ? -46.790 -26.002 49.003  1.00 44.51 ? 38  C   E "O5'" 1 
ATOM   759  C  "C5'" . C   A 1 38  ? -46.947 -25.956 50.419  1.00 44.30 ? 38  C   E "C5'" 1 
ATOM   760  C  "C4'" . C   A 1 38  ? -45.692 -25.437 51.096  1.00 44.11 ? 38  C   E "C4'" 1 
ATOM   761  O  "O4'" . C   A 1 38  ? -44.531 -26.191 50.662  1.00 43.99 ? 38  C   E "O4'" 1 
ATOM   762  C  "C3'" . C   A 1 38  ? -45.324 -23.999 50.768  1.00 44.04 ? 38  C   E "C3'" 1 
ATOM   763  O  "O3'" . C   A 1 38  ? -46.103 -23.084 51.528  1.00 44.33 ? 38  C   E "O3'" 1 
ATOM   764  C  "C2'" . C   A 1 38  ? -43.849 -23.983 51.154  1.00 43.89 ? 38  C   E "C2'" 1 
ATOM   765  O  "O2'" . C   A 1 38  ? -43.636 -23.883 52.551  1.00 43.87 ? 38  C   E "O2'" 1 
ATOM   766  C  "C1'" . C   A 1 38  ? -43.390 -25.347 50.637  1.00 43.58 ? 38  C   E "C1'" 1 
ATOM   767  N  N1    . C   A 1 38  ? -42.789 -25.306 49.248  1.00 43.45 ? 38  C   E N1    1 
ATOM   768  C  C2    . C   A 1 38  ? -41.492 -24.786 49.047  1.00 43.44 ? 38  C   E C2    1 
ATOM   769  O  O2    . C   A 1 38  ? -40.834 -24.360 50.006  1.00 43.40 ? 38  C   E O2    1 
ATOM   770  N  N3    . C   A 1 38  ? -40.977 -24.762 47.787  1.00 43.21 ? 38  C   E N3    1 
ATOM   771  C  C4    . C   A 1 38  ? -41.694 -25.224 46.757  1.00 43.35 ? 38  C   E C4    1 
ATOM   772  N  N4    . C   A 1 38  ? -41.141 -25.176 45.541  1.00 43.33 ? 38  C   E N4    1 
ATOM   773  C  C5    . C   A 1 38  ? -43.010 -25.755 46.933  1.00 43.29 ? 38  C   E C5    1 
ATOM   774  C  C6    . C   A 1 38  ? -43.507 -25.776 48.178  1.00 43.23 ? 38  C   E C6    1 
ATOM   775  P  P     . G   A 1 39  ? -46.470 -21.645 50.926  1.00 44.38 ? 39  G   E P     1 
ATOM   776  O  OP1   . G   A 1 39  ? -47.493 -21.042 51.811  1.00 44.55 ? 39  G   E OP1   1 
ATOM   777  O  OP2   . G   A 1 39  ? -46.755 -21.798 49.482  1.00 44.44 ? 39  G   E OP2   1 
ATOM   778  O  "O5'" . G   A 1 39  ? -45.095 -20.837 51.059  1.00 44.51 ? 39  G   E "O5'" 1 
ATOM   779  C  "C5'" . G   A 1 39  ? -44.579 -20.463 52.337  1.00 44.26 ? 39  G   E "C5'" 1 
ATOM   780  C  "C4'" . G   A 1 39  ? -43.187 -19.860 52.228  1.00 44.07 ? 39  G   E "C4'" 1 
ATOM   781  O  "O4'" . G   A 1 39  ? -42.252 -20.837 51.698  1.00 43.89 ? 39  G   E "O4'" 1 
ATOM   782  C  "C3'" . G   A 1 39  ? -43.022 -18.692 51.266  1.00 44.03 ? 39  G   E "C3'" 1 
ATOM   783  O  "O3'" . G   A 1 39  ? -43.549 -17.471 51.781  1.00 44.56 ? 39  G   E "O3'" 1 
ATOM   784  C  "C2'" . G   A 1 39  ? -41.502 -18.668 51.128  1.00 43.78 ? 39  G   E "C2'" 1 
ATOM   785  O  "O2'" . G   A 1 39  ? -40.830 -18.106 52.242  1.00 43.38 ? 39  G   E "O2'" 1 
ATOM   786  C  "C1'" . G   A 1 39  ? -41.206 -20.162 51.016  1.00 43.36 ? 39  G   E "C1'" 1 
ATOM   787  N  N9    . G   A 1 39  ? -41.132 -20.619 49.624  1.00 43.26 ? 39  G   E N9    1 
ATOM   788  C  C8    . G   A 1 39  ? -42.089 -21.321 48.928  1.00 43.23 ? 39  G   E C8    1 
ATOM   789  N  N7    . G   A 1 39  ? -41.752 -21.589 47.697  1.00 43.18 ? 39  G   E N7    1 
ATOM   790  C  C5    . G   A 1 39  ? -40.490 -21.028 47.561  1.00 43.09 ? 39  G   E C5    1 
ATOM   791  C  C6    . G   A 1 39  ? -39.618 -21.002 46.442  1.00 43.13 ? 39  G   E C6    1 
ATOM   792  O  O6    . G   A 1 39  ? -39.803 -21.487 45.318  1.00 43.17 ? 39  G   E O6    1 
ATOM   793  N  N1    . G   A 1 39  ? -38.426 -20.330 46.718  1.00 43.23 ? 39  G   E N1    1 
ATOM   794  C  C2    . G   A 1 39  ? -38.115 -19.752 47.930  1.00 43.22 ? 39  G   E C2    1 
ATOM   795  N  N2    . G   A 1 39  ? -36.920 -19.146 48.010  1.00 43.04 ? 39  G   E N2    1 
ATOM   796  N  N3    . G   A 1 39  ? -38.924 -19.772 48.987  1.00 43.04 ? 39  G   E N3    1 
ATOM   797  C  C4    . G   A 1 39  ? -40.092 -20.422 48.736  1.00 43.12 ? 39  G   E C4    1 
ATOM   798  P  P     . G   A 1 40  ? -44.168 -16.385 50.773  1.00 45.12 ? 40  G   E P     1 
ATOM   799  O  OP1   . G   A 1 40  ? -44.812 -15.337 51.596  1.00 45.18 ? 40  G   E OP1   1 
ATOM   800  O  OP2   . G   A 1 40  ? -44.967 -17.100 49.751  1.00 45.36 ? 40  G   E OP2   1 
ATOM   801  O  "O5'" . G   A 1 40  ? -42.889 -15.781 50.018  1.00 44.73 ? 40  G   E "O5'" 1 
ATOM   802  C  "C5'" . G   A 1 40  ? -41.986 -14.910 50.692  1.00 44.19 ? 40  G   E "C5'" 1 
ATOM   803  C  "C4'" . G   A 1 40  ? -40.611 -14.865 50.048  1.00 43.58 ? 40  G   E "C4'" 1 
ATOM   804  O  "O4'" . G   A 1 40  ? -40.205 -16.192 49.630  1.00 43.26 ? 40  G   E "O4'" 1 
ATOM   805  C  "C3'" . G   A 1 40  ? -40.489 -14.032 48.780  1.00 43.50 ? 40  G   E "C3'" 1 
ATOM   806  O  "O3'" . G   A 1 40  ? -40.356 -12.643 49.088  1.00 43.87 ? 40  G   E "O3'" 1 
ATOM   807  C  "C2'" . G   A 1 40  ? -39.210 -14.618 48.186  1.00 43.19 ? 40  G   E "C2'" 1 
ATOM   808  O  "O2'" . G   A 1 40  ? -38.029 -14.153 48.813  1.00 43.01 ? 40  G   E "O2'" 1 
ATOM   809  C  "C1'" . G   A 1 40  ? -39.402 -16.104 48.468  1.00 42.43 ? 40  G   E "C1'" 1 
ATOM   810  N  N9    . G   A 1 40  ? -40.047 -16.825 47.368  1.00 42.24 ? 40  G   E N9    1 
ATOM   811  C  C8    . G   A 1 40  ? -41.322 -17.341 47.338  1.00 41.94 ? 40  G   E C8    1 
ATOM   812  N  N7    . G   A 1 40  ? -41.620 -17.934 46.216  1.00 41.85 ? 40  G   E N7    1 
ATOM   813  C  C5    . G   A 1 40  ? -40.471 -17.803 45.447  1.00 42.07 ? 40  G   E C5    1 
ATOM   814  C  C6    . G   A 1 40  ? -40.189 -18.248 44.127  1.00 42.17 ? 40  G   E C6    1 
ATOM   815  O  O6    . G   A 1 40  ? -40.928 -18.868 43.353  1.00 42.07 ? 40  G   E O6    1 
ATOM   816  N  N1    . G   A 1 40  ? -38.896 -17.908 43.720  1.00 42.05 ? 40  G   E N1    1 
ATOM   817  C  C2    . G   A 1 40  ? -37.987 -17.223 44.495  1.00 41.95 ? 40  G   E C2    1 
ATOM   818  N  N2    . G   A 1 40  ? -36.790 -16.978 43.943  1.00 41.97 ? 40  G   E N2    1 
ATOM   819  N  N3    . G   A 1 40  ? -38.239 -16.801 45.729  1.00 41.92 ? 40  G   E N3    1 
ATOM   820  C  C4    . G   A 1 40  ? -39.493 -17.123 46.142  1.00 42.05 ? 40  G   E C4    1 
ATOM   821  P  P     . G   A 1 41  ? -40.793 -11.512 48.037  1.00 44.06 ? 41  G   E P     1 
ATOM   822  O  OP1   . G   A 1 41  ? -40.636 -10.199 48.702  1.00 44.27 ? 41  G   E OP1   1 
ATOM   823  O  OP2   . G   A 1 41  ? -42.107 -11.887 47.466  1.00 44.03 ? 41  G   E OP2   1 
ATOM   824  O  "O5'" . G   A 1 41  ? -39.691 -11.639 46.880  1.00 44.00 ? 41  G   E "O5'" 1 
ATOM   825  C  "C5'" . G   A 1 41  ? -38.340 -11.223 47.106  1.00 43.40 ? 41  G   E "C5'" 1 
ATOM   826  C  "C4'" . G   A 1 41  ? -37.445 -11.597 45.938  1.00 42.76 ? 41  G   E "C4'" 1 
ATOM   827  O  "O4'" . G   A 1 41  ? -37.574 -13.011 45.642  1.00 42.66 ? 41  G   E "O4'" 1 
ATOM   828  C  "C3'" . G   A 1 41  ? -37.786 -10.885 44.639  1.00 42.39 ? 41  G   E "C3'" 1 
ATOM   829  O  "O3'" . G   A 1 41  ? -37.094 -9.638  44.573  1.00 42.14 ? 41  G   E "O3'" 1 
ATOM   830  C  "C2'" . G   A 1 41  ? -37.323 -11.871 43.568  1.00 42.29 ? 41  G   E "C2'" 1 
ATOM   831  O  "O2'" . G   A 1 41  ? -35.960 -11.724 43.228  1.00 42.22 ? 41  G   E "O2'" 1 
ATOM   832  C  "C1'" . G   A 1 41  ? -37.542 -13.224 44.240  1.00 42.09 ? 41  G   E "C1'" 1 
ATOM   833  N  N9    . G   A 1 41  ? -38.761 -13.921 43.816  1.00 41.90 ? 41  G   E N9    1 
ATOM   834  C  C8    . G   A 1 41  ? -39.909 -14.109 44.551  1.00 41.93 ? 41  G   E C8    1 
ATOM   835  N  N7    . G   A 1 41  ? -40.833 -14.779 43.920  1.00 41.93 ? 41  G   E N7    1 
ATOM   836  C  C5    . G   A 1 41  ? -40.265 -15.060 42.685  1.00 41.91 ? 41  G   E C5    1 
ATOM   837  C  C6    . G   A 1 41  ? -40.795 -15.765 41.573  1.00 41.98 ? 41  G   E C6    1 
ATOM   838  O  O6    . G   A 1 41  ? -41.910 -16.294 41.467  1.00 41.77 ? 41  G   E O6    1 
ATOM   839  N  N1    . G   A 1 41  ? -39.894 -15.826 40.508  1.00 41.84 ? 41  G   E N1    1 
ATOM   840  C  C2    . G   A 1 41  ? -38.632 -15.273 40.518  1.00 42.03 ? 41  G   E C2    1 
ATOM   841  N  N2    . G   A 1 41  ? -37.900 -15.431 39.405  1.00 41.83 ? 41  G   E N2    1 
ATOM   842  N  N3    . G   A 1 41  ? -38.124 -14.609 41.553  1.00 42.01 ? 41  G   E N3    1 
ATOM   843  C  C4    . G   A 1 41  ? -38.989 -14.539 42.602  1.00 41.93 ? 41  G   E C4    1 
ATOM   844  P  P     . U   A 1 42  ? -37.793 -8.354  43.914  1.00 41.07 ? 42  U   E P     1 
ATOM   845  O  OP1   . U   A 1 42  ? -36.885 -7.202  44.106  1.00 41.18 ? 42  U   E OP1   1 
ATOM   846  O  OP2   . U   A 1 42  ? -39.186 -8.272  44.409  1.00 41.18 ? 42  U   E OP2   1 
ATOM   847  O  "O5'" . U   A 1 42  ? -37.855 -8.736  42.361  1.00 40.67 ? 42  U   E "O5'" 1 
ATOM   848  C  "C5'" . U   A 1 42  ? -36.683 -8.712  41.549  1.00 39.90 ? 42  U   E "C5'" 1 
ATOM   849  C  "C4'" . U   A 1 42  ? -36.936 -9.340  40.189  1.00 39.40 ? 42  U   E "C4'" 1 
ATOM   850  O  "O4'" . U   A 1 42  ? -37.293 -10.739 40.348  1.00 38.94 ? 42  U   E "O4'" 1 
ATOM   851  C  "C3'" . U   A 1 42  ? -38.117 -8.788  39.401  1.00 39.26 ? 42  U   E "C3'" 1 
ATOM   852  O  "O3'" . U   A 1 42  ? -37.867 -7.505  38.814  1.00 39.70 ? 42  U   E "O3'" 1 
ATOM   853  C  "C2'" . U   A 1 42  ? -38.314 -9.906  38.380  1.00 38.89 ? 42  U   E "C2'" 1 
ATOM   854  O  "O2'" . U   A 1 42  ? -37.347 -9.904  37.345  1.00 38.77 ? 42  U   E "O2'" 1 
ATOM   855  C  "C1'" . U   A 1 42  ? -38.140 -11.133 39.277  1.00 38.52 ? 42  U   E "C1'" 1 
ATOM   856  N  N1    . U   A 1 42  ? -39.449 -11.696 39.789  1.00 38.18 ? 42  U   E N1    1 
ATOM   857  C  C2    . U   A 1 42  ? -40.143 -12.614 39.013  1.00 38.01 ? 42  U   E C2    1 
ATOM   858  O  O2    . U   A 1 42  ? -39.760 -13.013 37.927  1.00 37.99 ? 42  U   E O2    1 
ATOM   859  N  N3    . U   A 1 42  ? -41.324 -13.066 39.558  1.00 38.02 ? 42  U   E N3    1 
ATOM   860  C  C4    . U   A 1 42  ? -41.878 -12.701 40.775  1.00 38.11 ? 42  U   E C4    1 
ATOM   861  O  O4    . U   A 1 42  ? -42.944 -13.194 41.131  1.00 38.06 ? 42  U   E O4    1 
ATOM   862  C  C5    . U   A 1 42  ? -41.106 -11.743 41.529  1.00 38.08 ? 42  U   E C5    1 
ATOM   863  C  C6    . U   A 1 42  ? -39.952 -11.289 41.017  1.00 38.14 ? 42  U   E C6    1 
ATOM   864  P  P     . A   A 1 43  ? -39.062 -6.432  38.776  1.00 40.00 ? 43  A   E P     1 
ATOM   865  O  OP1   . A   A 1 43  ? -38.583 -5.208  38.098  1.00 40.02 ? 43  A   E OP1   1 
ATOM   866  O  OP2   . A   A 1 43  ? -39.615 -6.322  40.146  1.00 39.96 ? 43  A   E OP2   1 
ATOM   867  O  "O5'" . A   A 1 43  ? -40.168 -7.158  37.867  1.00 40.06 ? 43  A   E "O5'" 1 
ATOM   868  C  "C5'" . A   A 1 43  ? -40.487 -6.694  36.557  1.00 40.22 ? 43  A   E "C5'" 1 
ATOM   869  C  "C4'" . A   A 1 43  ? -40.419 -7.813  35.528  1.00 40.31 ? 43  A   E "C4'" 1 
ATOM   870  O  "O4'" . A   A 1 43  ? -40.883 -9.067  36.099  1.00 40.22 ? 43  A   E "O4'" 1 
ATOM   871  C  "C3'" . A   A 1 43  ? -41.260 -7.571  34.269  1.00 40.47 ? 43  A   E "C3'" 1 
ATOM   872  O  "O3'" . A   A 1 43  ? -40.566 -7.811  33.012  1.00 40.75 ? 43  A   E "O3'" 1 
ATOM   873  C  "C2'" . A   A 1 43  ? -42.402 -8.576  34.432  1.00 40.39 ? 43  A   E "C2'" 1 
ATOM   874  O  "O2'" . A   A 1 43  ? -42.941 -9.016  33.199  1.00 40.46 ? 43  A   E "O2'" 1 
ATOM   875  C  "C1'" . A   A 1 43  ? -41.676 -9.720  35.130  1.00 40.14 ? 43  A   E "C1'" 1 
ATOM   876  N  N9    . A   A 1 43  ? -42.573 -10.698 35.749  1.00 40.06 ? 43  A   E N9    1 
ATOM   877  C  C8    . A   A 1 43  ? -43.009 -10.728 37.047  1.00 39.99 ? 43  A   E C8    1 
ATOM   878  N  N7    . A   A 1 43  ? -43.817 -11.727 37.317  1.00 39.91 ? 43  A   E N7    1 
ATOM   879  C  C5    . A   A 1 43  ? -43.924 -12.403 36.113  1.00 39.98 ? 43  A   E C5    1 
ATOM   880  C  C6    . A   A 1 43  ? -44.639 -13.560 35.723  1.00 39.98 ? 43  A   E C6    1 
ATOM   881  N  N6    . A   A 1 43  ? -45.412 -14.263 36.557  1.00 40.00 ? 43  A   E N6    1 
ATOM   882  N  N1    . A   A 1 43  ? -44.528 -13.973 34.439  1.00 40.00 ? 43  A   E N1    1 
ATOM   883  C  C2    . A   A 1 43  ? -43.754 -13.271 33.598  1.00 39.99 ? 43  A   E C2    1 
ATOM   884  N  N3    . A   A 1 43  ? -43.038 -12.172 33.849  1.00 40.06 ? 43  A   E N3    1 
ATOM   885  C  C4    . A   A 1 43  ? -43.164 -11.783 35.134  1.00 40.05 ? 43  A   E C4    1 
ATOM   886  P  P     . A   A 1 44  ? -39.058 -7.429  32.584  1.00 40.99 ? 44  A   E P     1 
ATOM   887  O  OP1   . A   A 1 44  ? -38.667 -8.646  33.344  1.00 41.10 ? 44  A   E OP1   1 
ATOM   888  O  OP2   . A   A 1 44  ? -39.233 -5.992  33.081  1.00 41.07 ? 44  A   E OP2   1 
ATOM   889  O  "O5'" . A   A 1 44  ? -39.610 -7.631  31.081  1.00 40.87 ? 44  A   E "O5'" 1 
ATOM   890  C  "C5'" . A   A 1 44  ? -40.656 -6.804  30.536  1.00 40.79 ? 44  A   E "C5'" 1 
ATOM   891  C  "C4'" . A   A 1 44  ? -40.168 -5.610  29.715  1.00 40.75 ? 44  A   E "C4'" 1 
ATOM   892  O  "O4'" . A   A 1 44  ? -41.298 -5.022  29.018  1.00 40.79 ? 44  A   E "O4'" 1 
ATOM   893  C  "C3'" . A   A 1 44  ? -39.563 -4.433  30.475  1.00 40.67 ? 44  A   E "C3'" 1 
ATOM   894  O  "O3'" . A   A 1 44  ? -38.666 -3.684  29.641  1.00 40.57 ? 44  A   E "O3'" 1 
ATOM   895  C  "C2'" . A   A 1 44  ? -40.797 -3.615  30.856  1.00 40.79 ? 44  A   E "C2'" 1 
ATOM   896  O  "O2'" . A   A 1 44  ? -40.519 -2.239  31.033  1.00 40.88 ? 44  A   E "O2'" 1 
ATOM   897  C  "C1'" . A   A 1 44  ? -41.725 -3.826  29.657  1.00 40.94 ? 44  A   E "C1'" 1 
ATOM   898  N  N9    . A   A 1 44  ? -43.146 -3.915  30.020  1.00 41.02 ? 44  A   E N9    1 
ATOM   899  C  C8    . A   A 1 44  ? -43.817 -3.054  30.846  1.00 41.03 ? 44  A   E C8    1 
ATOM   900  N  N7    . A   A 1 44  ? -45.084 -3.340  31.020  1.00 41.02 ? 44  A   E N7    1 
ATOM   901  C  C5    . A   A 1 44  ? -45.270 -4.476  30.253  1.00 41.13 ? 44  A   E C5    1 
ATOM   902  C  C6    . A   A 1 44  ? -46.407 -5.281  30.011  1.00 41.06 ? 44  A   E C6    1 
ATOM   903  N  N6    . A   A 1 44  ? -47.606 -5.037  30.550  1.00 41.07 ? 44  A   E N6    1 
ATOM   904  N  N1    . A   A 1 44  ? -46.267 -6.349  29.194  1.00 41.03 ? 44  A   E N1    1 
ATOM   905  C  C2    . A   A 1 44  ? -45.065 -6.593  28.654  1.00 41.04 ? 44  A   E C2    1 
ATOM   906  N  N3    . A   A 1 44  ? -43.928 -5.909  28.808  1.00 41.09 ? 44  A   E N3    1 
ATOM   907  C  C4    . A   A 1 44  ? -44.090 -4.849  29.626  1.00 41.14 ? 44  A   E C4    1 
ATOM   908  P  P     . U   A 1 45  ? -37.126 -3.435  30.023  1.00 40.31 ? 45  U   E P     1 
ATOM   909  O  OP1   . U   A 1 45  ? -36.538 -2.642  28.920  1.00 40.20 ? 45  U   E OP1   1 
ATOM   910  O  OP2   . U   A 1 45  ? -36.527 -4.742  30.380  1.00 40.26 ? 45  U   E OP2   1 
ATOM   911  O  "O5'" . U   A 1 45  ? -37.172 -2.469  31.306  1.00 39.98 ? 45  U   E "O5'" 1 
ATOM   912  C  "C5'" . U   A 1 45  ? -37.098 -2.971  32.647  1.00 39.59 ? 45  U   E "C5'" 1 
ATOM   913  C  "C4'" . U   A 1 45  ? -35.836 -2.538  33.383  1.00 39.31 ? 45  U   E "C4'" 1 
ATOM   914  O  "O4'" . U   A 1 45  ? -34.673 -3.129  32.748  1.00 39.12 ? 45  U   E "O4'" 1 
ATOM   915  C  "C3'" . U   A 1 45  ? -35.569 -1.034  33.463  1.00 39.16 ? 45  U   E "C3'" 1 
ATOM   916  O  "O3'" . U   A 1 45  ? -35.202 -0.684  34.799  1.00 39.15 ? 45  U   E "O3'" 1 
ATOM   917  C  "C2'" . U   A 1 45  ? -34.418 -0.813  32.481  1.00 39.06 ? 45  U   E "C2'" 1 
ATOM   918  O  "O2'" . U   A 1 45  ? -33.569 0.251   32.864  1.00 38.99 ? 45  U   E "O2'" 1 
ATOM   919  C  "C1'" . U   A 1 45  ? -33.676 -2.142  32.575  1.00 38.83 ? 45  U   E "C1'" 1 
ATOM   920  N  N1    . U   A 1 45  ? -32.839 -2.496  31.377  1.00 38.64 ? 45  U   E N1    1 
ATOM   921  C  C2    . U   A 1 45  ? -31.459 -2.373  31.451  1.00 38.52 ? 45  U   E C2    1 
ATOM   922  O  O2    . U   A 1 45  ? -30.858 -1.984  32.441  1.00 38.37 ? 45  U   E O2    1 
ATOM   923  N  N3    . U   A 1 45  ? -30.789 -2.727  30.303  1.00 38.42 ? 45  U   E N3    1 
ATOM   924  C  C4    . U   A 1 45  ? -31.342 -3.181  29.118  1.00 38.55 ? 45  U   E C4    1 
ATOM   925  O  O4    . U   A 1 45  ? -30.608 -3.461  28.179  1.00 38.55 ? 45  U   E O4    1 
ATOM   926  C  C5    . U   A 1 45  ? -32.781 -3.287  29.113  1.00 38.53 ? 45  U   E C5    1 
ATOM   927  C  C6    . U   A 1 45  ? -33.458 -2.947  30.220  1.00 38.67 ? 45  U   E C6    1 
ATOM   928  P  P     . U   A 1 46  ? -36.104 0.297   35.687  1.00 39.07 ? 46  U   E P     1 
ATOM   929  O  OP1   . U   A 1 46  ? -35.419 0.476   36.987  1.00 39.06 ? 46  U   E OP1   1 
ATOM   930  O  OP2   . U   A 1 46  ? -37.500 -0.197  35.653  1.00 39.08 ? 46  U   E OP2   1 
ATOM   931  O  "O5'" . U   A 1 46  ? -36.023 1.687   34.897  1.00 39.07 ? 46  U   E "O5'" 1 
ATOM   932  P  P     . A   A 1 47  ? -38.682 5.341   32.671  1.00 44.41 ? 47  A   E P     1 
ATOM   933  O  OP1   . A   A 1 47  ? -38.123 6.712   32.678  1.00 44.58 ? 47  A   E OP1   1 
ATOM   934  O  OP2   . A   A 1 47  ? -37.964 4.243   33.357  1.00 44.45 ? 47  A   E OP2   1 
ATOM   935  O  "O5'" . A   A 1 47  ? -38.953 4.893   31.159  1.00 44.37 ? 47  A   E "O5'" 1 
ATOM   936  C  "C5'" . A   A 1 47  ? -37.876 4.744   30.236  1.00 44.36 ? 47  A   E "C5'" 1 
ATOM   937  C  "C4'" . A   A 1 47  ? -38.382 4.304   28.871  1.00 44.45 ? 47  A   E "C4'" 1 
ATOM   938  O  "O4'" . A   A 1 47  ? -39.226 3.133   29.016  1.00 44.45 ? 47  A   E "O4'" 1 
ATOM   939  C  "C3'" . A   A 1 47  ? -39.240 5.330   28.141  1.00 44.55 ? 47  A   E "C3'" 1 
ATOM   940  O  "O3'" . A   A 1 47  ? -38.429 6.185   27.334  1.00 44.72 ? 47  A   E "O3'" 1 
ATOM   941  C  "C2'" . A   A 1 47  ? -40.178 4.461   27.306  1.00 44.51 ? 47  A   E "C2'" 1 
ATOM   942  O  "O2'" . A   A 1 47  ? -39.616 4.048   26.074  1.00 44.54 ? 47  A   E "O2'" 1 
ATOM   943  C  "C1'" . A   A 1 47  ? -40.394 3.255   28.221  1.00 44.34 ? 47  A   E "C1'" 1 
ATOM   944  N  N9    . A   A 1 47  ? -41.571 3.342   29.097  1.00 44.24 ? 47  A   E N9    1 
ATOM   945  C  C8    . A   A 1 47  ? -41.578 3.275   30.465  1.00 44.20 ? 47  A   E C8    1 
ATOM   946  N  N7    . A   A 1 47  ? -42.767 3.376   31.006  1.00 44.16 ? 47  A   E N7    1 
ATOM   947  C  C5    . A   A 1 47  ? -43.611 3.519   29.919  1.00 44.21 ? 47  A   E C5    1 
ATOM   948  C  C6    . A   A 1 47  ? -45.013 3.671   29.817  1.00 44.23 ? 47  A   E C6    1 
ATOM   949  N  N6    . A   A 1 47  ? -45.826 3.707   30.878  1.00 44.25 ? 47  A   E N6    1 
ATOM   950  N  N1    . A   A 1 47  ? -45.551 3.787   28.581  1.00 44.22 ? 47  A   E N1    1 
ATOM   951  C  C2    . A   A 1 47  ? -44.736 3.752   27.516  1.00 44.24 ? 47  A   E C2    1 
ATOM   952  N  N3    . A   A 1 47  ? -43.408 3.611   27.489  1.00 44.28 ? 47  A   E N3    1 
ATOM   953  C  C4    . A   A 1 47  ? -42.895 3.497   28.732  1.00 44.23 ? 47  A   E C4    1 
ATOM   954  P  P     . U   A 1 48  ? -38.447 7.771   27.566  1.00 45.02 ? 48  U   E P     1 
ATOM   955  O  OP1   . U   A 1 48  ? -37.551 8.390   26.562  1.00 45.14 ? 48  U   E OP1   1 
ATOM   956  O  OP2   . U   A 1 48  ? -38.213 8.033   29.005  1.00 44.89 ? 48  U   E OP2   1 
ATOM   957  O  "O5'" . U   A 1 48  ? -39.967 8.160   27.243  1.00 44.81 ? 48  U   E "O5'" 1 
ATOM   958  C  "C5'" . U   A 1 48  ? -40.443 8.222   25.900  1.00 44.60 ? 48  U   E "C5'" 1 
ATOM   959  C  "C4'" . U   A 1 48  ? -41.960 8.207   25.859  1.00 44.38 ? 48  U   E "C4'" 1 
ATOM   960  O  "O4'" . U   A 1 48  ? -42.456 7.026   26.543  1.00 44.25 ? 48  U   E "O4'" 1 
ATOM   961  C  "C3'" . U   A 1 48  ? -42.654 9.352   26.584  1.00 44.41 ? 48  U   E "C3'" 1 
ATOM   962  O  "O3'" . U   A 1 48  ? -42.667 10.551  25.809  1.00 44.58 ? 48  U   E "O3'" 1 
ATOM   963  C  "C2'" . U   A 1 48  ? -44.045 8.758   26.791  1.00 44.23 ? 48  U   E "C2'" 1 
ATOM   964  O  "O2'" . U   A 1 48  ? -44.854 8.782   25.629  1.00 44.26 ? 48  U   E "O2'" 1 
ATOM   965  C  "C1'" . U   A 1 48  ? -43.697 7.319   27.169  1.00 43.96 ? 48  U   E "C1'" 1 
ATOM   966  N  N1    . U   A 1 48  ? -43.618 7.083   28.664  1.00 43.75 ? 48  U   E N1    1 
ATOM   967  C  C2    . U   A 1 48  ? -44.787 6.956   29.406  1.00 43.62 ? 48  U   E C2    1 
ATOM   968  O  O2    . U   A 1 48  ? -45.910 7.020   28.934  1.00 43.58 ? 48  U   E O2    1 
ATOM   969  N  N3    . U   A 1 48  ? -44.599 6.747   30.754  1.00 43.62 ? 48  U   E N3    1 
ATOM   970  C  C4    . U   A 1 48  ? -43.392 6.650   31.427  1.00 43.68 ? 48  U   E C4    1 
ATOM   971  O  O4    . U   A 1 48  ? -43.383 6.459   32.639  1.00 43.67 ? 48  U   E O4    1 
ATOM   972  C  C5    . U   A 1 48  ? -42.221 6.792   30.596  1.00 43.62 ? 48  U   E C5    1 
ATOM   973  C  C6    . U   A 1 48  ? -42.378 6.998   29.280  1.00 43.63 ? 48  U   E C6    1 
ATOM   974  P  P     . G   A 1 49  ? -42.497 11.979  26.522  1.00 44.83 ? 49  G   E P     1 
ATOM   975  O  OP1   . G   A 1 49  ? -42.420 12.999  25.451  1.00 45.13 ? 49  G   E OP1   1 
ATOM   976  O  OP2   . G   A 1 49  ? -41.400 11.895  27.513  1.00 44.65 ? 49  G   E OP2   1 
ATOM   977  O  "O5'" . G   A 1 49  ? -43.873 12.154  27.327  1.00 44.21 ? 49  G   E "O5'" 1 
ATOM   978  C  "C5'" . G   A 1 49  ? -45.103 12.367  26.631  1.00 43.59 ? 49  G   E "C5'" 1 
ATOM   979  C  "C4'" . G   A 1 49  ? -46.313 12.175  27.531  1.00 43.09 ? 49  G   E "C4'" 1 
ATOM   980  O  "O4'" . G   A 1 49  ? -46.349 10.825  28.068  1.00 42.78 ? 49  G   E "O4'" 1 
ATOM   981  C  "C3'" . G   A 1 49  ? -46.357 13.048  28.776  1.00 42.90 ? 49  G   E "C3'" 1 
ATOM   982  O  "O3'" . G   A 1 49  ? -46.784 14.369  28.470  1.00 42.90 ? 49  G   E "O3'" 1 
ATOM   983  C  "C2'" . G   A 1 49  ? -47.354 12.272  29.633  1.00 42.65 ? 49  G   E "C2'" 1 
ATOM   984  O  "O2'" . G   A 1 49  ? -48.700 12.415  29.219  1.00 42.40 ? 49  G   E "O2'" 1 
ATOM   985  C  "C1'" . G   A 1 49  ? -46.859 10.847  29.394  1.00 42.39 ? 49  G   E "C1'" 1 
ATOM   986  N  N9    . G   A 1 49  ? -45.811 10.454  30.343  1.00 42.25 ? 49  G   E N9    1 
ATOM   987  C  C8    . G   A 1 49  ? -44.475 10.268  30.075  1.00 42.17 ? 49  G   E C8    1 
ATOM   988  N  N7    . G   A 1 49  ? -43.769 9.927   31.117  1.00 42.16 ? 49  G   E N7    1 
ATOM   989  C  C5    . G   A 1 49  ? -44.692 9.888   32.152  1.00 42.22 ? 49  G   E C5    1 
ATOM   990  C  C6    . G   A 1 49  ? -44.511 9.577   33.524  1.00 42.26 ? 49  G   E C6    1 
ATOM   991  O  O6    . G   A 1 49  ? -43.462 9.268   34.106  1.00 42.24 ? 49  G   E O6    1 
ATOM   992  N  N1    . G   A 1 49  ? -45.705 9.652   34.242  1.00 42.16 ? 49  G   E N1    1 
ATOM   993  C  C2    . G   A 1 49  ? -46.926 9.985   33.699  1.00 42.22 ? 49  G   E C2    1 
ATOM   994  N  N2    . G   A 1 49  ? -47.966 10.004  34.545  1.00 42.24 ? 49  G   E N2    1 
ATOM   995  N  N3    . G   A 1 49  ? -47.109 10.277  32.414  1.00 42.15 ? 49  G   E N3    1 
ATOM   996  C  C4    . G   A 1 49  ? -45.955 10.210  31.696  1.00 42.22 ? 49  G   E C4    1 
ATOM   997  P  P     . G   A 1 50  ? -46.102 15.619  29.210  1.00 42.95 ? 50  G   E P     1 
ATOM   998  O  OP1   . G   A 1 50  ? -46.569 16.847  28.524  1.00 43.00 ? 50  G   E OP1   1 
ATOM   999  O  OP2   . G   A 1 50  ? -44.650 15.363  29.351  1.00 42.45 ? 50  G   E OP2   1 
ATOM   1000 O  "O5'" . G   A 1 50  ? -46.747 15.560  30.671  1.00 42.49 ? 50  G   E "O5'" 1 
ATOM   1001 C  "C5'" . G   A 1 50  ? -48.149 15.728  30.851  1.00 42.40 ? 50  G   E "C5'" 1 
ATOM   1002 C  "C4'" . G   A 1 50  ? -48.555 15.312  32.251  1.00 42.42 ? 50  G   E "C4'" 1 
ATOM   1003 O  "O4'" . G   A 1 50  ? -48.141 13.947  32.517  1.00 42.36 ? 50  G   E "O4'" 1 
ATOM   1004 C  "C3'" . G   A 1 50  ? -47.896 16.107  33.366  1.00 42.41 ? 50  G   E "C3'" 1 
ATOM   1005 O  "O3'" . G   A 1 50  ? -48.550 17.356  33.541  1.00 42.26 ? 50  G   E "O3'" 1 
ATOM   1006 C  "C2'" . G   A 1 50  ? -48.083 15.164  34.548  1.00 42.43 ? 50  G   E "C2'" 1 
ATOM   1007 O  "O2'" . G   A 1 50  ? -49.395 15.188  35.085  1.00 42.20 ? 50  G   E "O2'" 1 
ATOM   1008 C  "C1'" . G   A 1 50  ? -47.786 13.819  33.883  1.00 42.74 ? 50  G   E "C1'" 1 
ATOM   1009 N  N9    . G   A 1 50  ? -46.379 13.424  33.992  1.00 42.85 ? 50  G   E N9    1 
ATOM   1010 C  C8    . G   A 1 50  ? -45.454 13.333  32.977  1.00 42.95 ? 50  G   E C8    1 
ATOM   1011 N  N7    . G   A 1 50  ? -44.272 12.954  33.377  1.00 42.98 ? 50  G   E N7    1 
ATOM   1012 C  C5    . G   A 1 50  ? -44.414 12.784  34.747  1.00 42.91 ? 50  G   E C5    1 
ATOM   1013 C  C6    . G   A 1 50  ? -43.469 12.381  35.726  1.00 42.97 ? 50  G   E C6    1 
ATOM   1014 O  O6    . G   A 1 50  ? -42.278 12.088  35.556  1.00 42.97 ? 50  G   E O6    1 
ATOM   1015 N  N1    . G   A 1 50  ? -44.022 12.333  37.010  1.00 42.93 ? 50  G   E N1    1 
ATOM   1016 C  C2    . G   A 1 50  ? -45.334 12.641  37.304  1.00 42.99 ? 50  G   E C2    1 
ATOM   1017 N  N2    . G   A 1 50  ? -45.712 12.550  38.587  1.00 42.91 ? 50  G   E N2    1 
ATOM   1018 N  N3    . G   A 1 50  ? -46.224 13.017  36.395  1.00 42.96 ? 50  G   E N3    1 
ATOM   1019 C  C4    . G   A 1 50  ? -45.704 13.068  35.141  1.00 42.84 ? 50  G   E C4    1 
ATOM   1020 P  P     . C   A 1 51  ? -47.717 18.640  34.011  1.00 41.96 ? 51  C   E P     1 
ATOM   1021 O  OP1   . C   A 1 51  ? -48.587 19.824  33.824  1.00 41.70 ? 51  C   E OP1   1 
ATOM   1022 O  OP2   . C   A 1 51  ? -46.377 18.602  33.379  1.00 42.11 ? 51  C   E OP2   1 
ATOM   1023 O  "O5'" . C   A 1 51  ? -47.519 18.369  35.572  1.00 41.51 ? 51  C   E "O5'" 1 
ATOM   1024 C  "C5'" . C   A 1 51  ? -48.658 18.320  36.419  1.00 41.17 ? 51  C   E "C5'" 1 
ATOM   1025 C  "C4'" . C   A 1 51  ? -48.290 17.918  37.832  1.00 40.81 ? 51  C   E "C4'" 1 
ATOM   1026 O  "O4'" . C   A 1 51  ? -47.749 16.572  37.857  1.00 40.41 ? 51  C   E "O4'" 1 
ATOM   1027 C  "C3'" . C   A 1 51  ? -47.232 18.780  38.504  1.00 40.78 ? 51  C   E "C3'" 1 
ATOM   1028 O  "O3'" . C   A 1 51  ? -47.810 19.975  39.020  1.00 41.36 ? 51  C   E "O3'" 1 
ATOM   1029 C  "C2'" . C   A 1 51  ? -46.763 17.836  39.605  1.00 40.58 ? 51  C   E "C2'" 1 
ATOM   1030 O  "O2'" . C   A 1 51  ? -47.630 17.817  40.724  1.00 40.41 ? 51  C   E "O2'" 1 
ATOM   1031 C  "C1'" . C   A 1 51  ? -46.768 16.486  38.879  1.00 40.47 ? 51  C   E "C1'" 1 
ATOM   1032 N  N1    . C   A 1 51  ? -45.429 16.129  38.280  1.00 40.30 ? 51  C   E N1    1 
ATOM   1033 C  C2    . C   A 1 51  ? -44.374 15.693  39.107  1.00 40.38 ? 51  C   E C2    1 
ATOM   1034 O  O2    . C   A 1 51  ? -44.538 15.598  40.332  1.00 40.40 ? 51  C   E O2    1 
ATOM   1035 N  N3    . C   A 1 51  ? -43.178 15.385  38.537  1.00 40.46 ? 51  C   E N3    1 
ATOM   1036 C  C4    . C   A 1 51  ? -43.010 15.492  37.214  1.00 40.46 ? 51  C   E C4    1 
ATOM   1037 N  N4    . C   A 1 51  ? -41.815 15.175  36.708  1.00 40.57 ? 51  C   E N4    1 
ATOM   1038 C  C5    . C   A 1 51  ? -44.063 15.931  36.354  1.00 40.38 ? 51  C   E C5    1 
ATOM   1039 C  C6    . C   A 1 51  ? -45.237 16.234  36.925  1.00 40.30 ? 51  C   E C6    1 
ATOM   1040 P  P     . G   A 1 52  ? -46.973 21.340  39.075  1.00 41.51 ? 52  G   E P     1 
ATOM   1041 O  OP1   . G   A 1 52  ? -47.845 22.363  39.700  1.00 41.77 ? 52  G   E OP1   1 
ATOM   1042 O  OP2   . G   A 1 52  ? -46.421 21.587  37.724  1.00 41.98 ? 52  G   E OP2   1 
ATOM   1043 O  "O5'" . G   A 1 52  ? -45.732 20.996  40.033  1.00 41.16 ? 52  G   E "O5'" 1 
ATOM   1044 C  "C5'" . G   A 1 52  ? -45.706 21.406  41.394  1.00 40.96 ? 52  G   E "C5'" 1 
ATOM   1045 C  "C4'" . G   A 1 52  ? -44.839 20.512  42.265  1.00 40.99 ? 52  G   E "C4'" 1 
ATOM   1046 O  "O4'" . G   A 1 52  ? -44.597 19.220  41.650  1.00 40.63 ? 52  G   E "O4'" 1 
ATOM   1047 C  "C3'" . G   A 1 52  ? -43.430 21.019  42.528  1.00 41.11 ? 52  G   E "C3'" 1 
ATOM   1048 O  "O3'" . G   A 1 52  ? -43.423 22.082  43.471  1.00 41.65 ? 52  G   E "O3'" 1 
ATOM   1049 C  "C2'" . G   A 1 52  ? -42.769 19.752  43.062  1.00 40.75 ? 52  G   E "C2'" 1 
ATOM   1050 O  "O2'" . G   A 1 52  ? -43.106 19.443  44.402  1.00 40.45 ? 52  G   E "O2'" 1 
ATOM   1051 C  "C1'" . G   A 1 52  ? -43.353 18.710  42.110  1.00 40.47 ? 52  G   E "C1'" 1 
ATOM   1052 N  N9    . G   A 1 52  ? -42.477 18.419  40.971  1.00 40.37 ? 52  G   E N9    1 
ATOM   1053 C  C8    . G   A 1 52  ? -42.744 18.637  39.638  1.00 40.23 ? 52  G   E C8    1 
ATOM   1054 N  N7    . G   A 1 52  ? -41.774 18.280  38.843  1.00 40.18 ? 52  G   E N7    1 
ATOM   1055 C  C5    . G   A 1 52  ? -40.795 17.794  39.699  1.00 40.18 ? 52  G   E C5    1 
ATOM   1056 C  C6    . G   A 1 52  ? -39.510 17.264  39.413  1.00 40.31 ? 52  G   E C6    1 
ATOM   1057 O  O6    . G   A 1 52  ? -38.973 17.116  38.306  1.00 40.49 ? 52  G   E O6    1 
ATOM   1058 N  N1    . G   A 1 52  ? -38.827 16.880  40.568  1.00 40.27 ? 52  G   E N1    1 
ATOM   1059 C  C2    . G   A 1 52  ? -39.323 17.000  41.848  1.00 40.31 ? 52  G   E C2    1 
ATOM   1060 N  N2    . G   A 1 52  ? -38.524 16.584  42.841  1.00 40.32 ? 52  G   E N2    1 
ATOM   1061 N  N3    . G   A 1 52  ? -40.525 17.495  42.130  1.00 40.37 ? 52  G   E N3    1 
ATOM   1062 C  C4    . G   A 1 52  ? -41.209 17.872  41.014  1.00 40.36 ? 52  G   E C4    1 
ATOM   1063 P  P     . G   A 1 53  ? -42.325 23.241  43.343  1.00 42.30 ? 53  G   E P     1 
ATOM   1064 O  OP1   . G   A 1 53  ? -42.717 24.342  44.256  1.00 41.78 ? 53  G   E OP1   1 
ATOM   1065 O  OP2   . G   A 1 53  ? -42.106 23.523  41.905  1.00 42.25 ? 53  G   E OP2   1 
ATOM   1066 O  "O5'" . G   A 1 53  ? -41.000 22.534  43.891  1.00 42.45 ? 53  G   E "O5'" 1 
ATOM   1067 C  "C5'" . G   A 1 53  ? -40.858 22.204  45.269  1.00 42.92 ? 53  G   E "C5'" 1 
ATOM   1068 C  "C4'" . G   A 1 53  ? -39.550 21.475  45.514  1.00 43.27 ? 53  G   E "C4'" 1 
ATOM   1069 O  "O4'" . G   A 1 53  ? -39.518 20.243  44.747  1.00 43.56 ? 53  G   E "O4'" 1 
ATOM   1070 C  "C3'" . G   A 1 53  ? -38.295 22.205  45.057  1.00 43.29 ? 53  G   E "C3'" 1 
ATOM   1071 O  "O3'" . G   A 1 53  ? -37.891 23.189  45.999  1.00 43.33 ? 53  G   E "O3'" 1 
ATOM   1072 C  "C2'" . G   A 1 53  ? -37.309 21.047  44.958  1.00 43.32 ? 53  G   E "C2'" 1 
ATOM   1073 O  "O2'" . G   A 1 53  ? -36.851 20.602  46.222  1.00 43.16 ? 53  G   E "O2'" 1 
ATOM   1074 C  "C1'" . G   A 1 53  ? -38.194 19.994  44.299  1.00 43.49 ? 53  G   E "C1'" 1 
ATOM   1075 N  N9    . G   A 1 53  ? -38.144 20.009  42.832  1.00 43.55 ? 53  G   E N9    1 
ATOM   1076 C  C8    . G   A 1 53  ? -39.109 20.469  41.967  1.00 43.53 ? 53  G   E C8    1 
ATOM   1077 N  N7    . G   A 1 53  ? -38.788 20.352  40.708  1.00 43.50 ? 53  G   E N7    1 
ATOM   1078 C  C5    . G   A 1 53  ? -37.524 19.778  40.731  1.00 43.54 ? 53  G   E C5    1 
ATOM   1079 C  C6    . G   A 1 53  ? -36.664 19.408  39.661  1.00 43.74 ? 53  G   E C6    1 
ATOM   1080 O  O6    . G   A 1 53  ? -36.859 19.527  38.442  1.00 43.59 ? 53  G   E O6    1 
ATOM   1081 N  N1    . G   A 1 53  ? -35.466 18.851  40.116  1.00 43.54 ? 53  G   E N1    1 
ATOM   1082 C  C2    . G   A 1 53  ? -35.142 18.676  41.445  1.00 43.61 ? 53  G   E C2    1 
ATOM   1083 N  N2    . G   A 1 53  ? -33.946 18.123  41.700  1.00 43.54 ? 53  G   E N2    1 
ATOM   1084 N  N3    . G   A 1 53  ? -35.940 19.014  42.455  1.00 43.52 ? 53  G   E N3    1 
ATOM   1085 C  C4    . G   A 1 53  ? -37.112 19.559  42.030  1.00 43.57 ? 53  G   E C4    1 
ATOM   1086 P  P     . A   A 1 54  ? -37.188 24.536  45.493  1.00 43.29 ? 54  A   E P     1 
ATOM   1087 O  OP1   . A   A 1 54  ? -37.171 25.478  46.636  1.00 43.75 ? 54  A   E OP1   1 
ATOM   1088 O  OP2   . A   A 1 54  ? -37.808 24.949  44.212  1.00 43.45 ? 54  A   E OP2   1 
ATOM   1089 O  "O5'" . A   A 1 54  ? -35.699 24.067  45.149  1.00 43.61 ? 54  A   E "O5'" 1 
ATOM   1090 C  "C5'" . A   A 1 54  ? -34.831 23.548  46.154  1.00 43.73 ? 54  A   E "C5'" 1 
ATOM   1091 C  "C4'" . A   A 1 54  ? -33.603 22.913  45.526  1.00 43.67 ? 54  A   E "C4'" 1 
ATOM   1092 O  "O4'" . A   A 1 54  ? -33.989 21.808  44.666  1.00 43.54 ? 54  A   E "O4'" 1 
ATOM   1093 C  "C3'" . A   A 1 54  ? -32.798 23.823  44.610  1.00 43.63 ? 54  A   E "C3'" 1 
ATOM   1094 O  "O3'" . A   A 1 54  ? -31.948 24.680  45.358  1.00 43.78 ? 54  A   E "O3'" 1 
ATOM   1095 C  "C2'" . A   A 1 54  ? -32.034 22.790  43.786  1.00 43.68 ? 54  A   E "C2'" 1 
ATOM   1096 O  "O2'" . A   A 1 54  ? -30.933 22.223  44.473  1.00 43.80 ? 54  A   E "O2'" 1 
ATOM   1097 C  "C1'" . A   A 1 54  ? -33.112 21.737  43.553  1.00 43.62 ? 54  A   E "C1'" 1 
ATOM   1098 N  N9    . A   A 1 54  ? -33.852 21.944  42.303  1.00 43.71 ? 54  A   E N9    1 
ATOM   1099 C  C8    . A   A 1 54  ? -35.087 22.518  42.149  1.00 43.70 ? 54  A   E C8    1 
ATOM   1100 N  N7    . A   A 1 54  ? -35.499 22.576  40.904  1.00 43.67 ? 54  A   E N7    1 
ATOM   1101 C  C5    . A   A 1 54  ? -34.466 22.000  40.184  1.00 43.77 ? 54  A   E C5    1 
ATOM   1102 C  C6    . A   A 1 54  ? -34.281 21.754  38.802  1.00 43.89 ? 54  A   E C6    1 
ATOM   1103 N  N6    . A   A 1 54  ? -35.182 22.079  37.867  1.00 43.80 ? 54  A   E N6    1 
ATOM   1104 N  N1    . A   A 1 54  ? -33.128 21.161  38.412  1.00 43.77 ? 54  A   E N1    1 
ATOM   1105 C  C2    . A   A 1 54  ? -32.220 20.838  39.344  1.00 43.69 ? 54  A   E C2    1 
ATOM   1106 N  N3    . A   A 1 54  ? -32.285 21.016  40.667  1.00 43.79 ? 54  A   E N3    1 
ATOM   1107 C  C4    . A   A 1 54  ? -33.440 21.608  41.030  1.00 43.64 ? 54  A   E C4    1 
ATOM   1108 P  P     . C   A 1 55  ? -31.618 26.162  44.840  1.00 44.10 ? 55  C   E P     1 
ATOM   1109 O  OP1   . C   A 1 55  ? -30.895 26.864  45.924  1.00 43.92 ? 55  C   E OP1   1 
ATOM   1110 O  OP2   . C   A 1 55  ? -32.858 26.750  44.285  1.00 44.35 ? 55  C   E OP2   1 
ATOM   1111 O  "O5'" . C   A 1 55  ? -30.618 25.916  43.614  1.00 44.38 ? 55  C   E "O5'" 1 
ATOM   1112 C  "C5'" . C   A 1 55  ? -29.332 25.333  43.818  1.00 44.64 ? 55  C   E "C5'" 1 
ATOM   1113 C  "C4'" . C   A 1 55  ? -28.760 24.794  42.519  1.00 44.84 ? 55  C   E "C4'" 1 
ATOM   1114 O  "O4'" . C   A 1 55  ? -29.695 23.886  41.884  1.00 44.91 ? 55  C   E "O4'" 1 
ATOM   1115 C  "C3'" . C   A 1 55  ? -28.490 25.838  41.447  1.00 44.89 ? 55  C   E "C3'" 1 
ATOM   1116 O  "O3'" . C   A 1 55  ? -27.262 26.496  41.709  1.00 45.15 ? 55  C   E "O3'" 1 
ATOM   1117 C  "C2'" . C   A 1 55  ? -28.443 24.974  40.189  1.00 45.01 ? 55  C   E "C2'" 1 
ATOM   1118 O  "O2'" . C   A 1 55  ? -27.203 24.314  40.008  1.00 44.60 ? 55  C   E "O2'" 1 
ATOM   1119 C  "C1'" . C   A 1 55  ? -29.551 23.958  40.474  1.00 44.97 ? 55  C   E "C1'" 1 
ATOM   1120 N  N1    . C   A 1 55  ? -30.878 24.296  39.835  1.00 45.10 ? 55  C   E N1    1 
ATOM   1121 C  C2    . C   A 1 55  ? -31.110 24.001  38.476  1.00 45.17 ? 55  C   E C2    1 
ATOM   1122 O  O2    . C   A 1 55  ? -30.227 23.464  37.793  1.00 45.17 ? 55  C   E O2    1 
ATOM   1123 N  N3    . C   A 1 55  ? -32.319 24.315  37.935  1.00 45.21 ? 55  C   E N3    1 
ATOM   1124 C  C4    . C   A 1 55  ? -33.266 24.898  38.681  1.00 45.14 ? 55  C   E C4    1 
ATOM   1125 N  N4    . C   A 1 55  ? -34.435 25.183  38.098  1.00 45.11 ? 55  C   E N4    1 
ATOM   1126 C  C5    . C   A 1 55  ? -33.056 25.206  40.060  1.00 44.89 ? 55  C   E C5    1 
ATOM   1127 C  C6    . C   A 1 55  ? -31.864 24.890  40.585  1.00 44.89 ? 55  C   E C6    1 
ATOM   1128 P  P     . C   A 1 56  ? -27.051 28.023  41.280  1.00 45.63 ? 56  C   E P     1 
ATOM   1129 O  OP1   . C   A 1 56  ? -25.877 28.530  42.021  1.00 45.83 ? 56  C   E OP1   1 
ATOM   1130 O  OP2   . C   A 1 56  ? -28.344 28.743  41.393  1.00 45.43 ? 56  C   E OP2   1 
ATOM   1131 O  "O5'" . C   A 1 56  ? -26.632 27.878  39.743  1.00 45.55 ? 56  C   E "O5'" 1 
ATOM   1132 C  "C5'" . C   A 1 56  ? -27.168 28.746  38.760  1.00 45.52 ? 56  C   E "C5'" 1 
ATOM   1133 C  "C4'" . C   A 1 56  ? -27.203 28.046  37.418  1.00 45.62 ? 56  C   E "C4'" 1 
ATOM   1134 O  "O4'" . C   A 1 56  ? -28.181 26.975  37.446  1.00 45.79 ? 56  C   E "O4'" 1 
ATOM   1135 C  "C3'" . C   A 1 56  ? -27.649 28.923  36.262  1.00 45.56 ? 56  C   E "C3'" 1 
ATOM   1136 O  "O3'" . C   A 1 56  ? -26.557 29.681  35.777  1.00 45.59 ? 56  C   E "O3'" 1 
ATOM   1137 C  "C2'" . C   A 1 56  ? -28.131 27.875  35.266  1.00 45.80 ? 56  C   E "C2'" 1 
ATOM   1138 O  "O2'" . C   A 1 56  ? -27.073 27.209  34.603  1.00 45.78 ? 56  C   E "O2'" 1 
ATOM   1139 C  "C1'" . C   A 1 56  ? -28.857 26.909  36.200  1.00 45.70 ? 56  C   E "C1'" 1 
ATOM   1140 N  N1    . C   A 1 56  ? -30.326 27.214  36.391  1.00 45.83 ? 56  C   E N1    1 
ATOM   1141 C  C2    . C   A 1 56  ? -31.255 26.916  35.373  1.00 45.67 ? 56  C   E C2    1 
ATOM   1142 O  O2    . C   A 1 56  ? -30.878 26.406  34.310  1.00 45.70 ? 56  C   E O2    1 
ATOM   1143 N  N3    . C   A 1 56  ? -32.568 27.203  35.579  1.00 45.66 ? 56  C   E N3    1 
ATOM   1144 C  C4    . C   A 1 56  ? -32.969 27.757  36.727  1.00 45.75 ? 56  C   E C4    1 
ATOM   1145 N  N4    . C   A 1 56  ? -34.271 28.018  36.874  1.00 45.81 ? 56  C   E N4    1 
ATOM   1146 C  C5    . C   A 1 56  ? -32.049 28.069  37.775  1.00 45.74 ? 56  C   E C5    1 
ATOM   1147 C  C6    . C   A 1 56  ? -30.758 27.783  37.563  1.00 45.64 ? 56  C   E C6    1 
ATOM   1148 P  P     . C   A 1 57  ? -26.729 31.242  35.468  1.00 45.35 ? 57  C   E P     1 
ATOM   1149 O  OP1   . C   A 1 57  ? -25.380 31.798  35.223  1.00 45.36 ? 57  C   E OP1   1 
ATOM   1150 O  OP2   . C   A 1 57  ? -27.582 31.853  36.513  1.00 45.44 ? 57  C   E OP2   1 
ATOM   1151 O  "O5'" . C   A 1 57  ? -27.538 31.216  34.089  1.00 45.41 ? 57  C   E "O5'" 1 
ATOM   1152 C  "C5'" . C   A 1 57  ? -26.924 30.708  32.909  1.00 45.25 ? 57  C   E "C5'" 1 
ATOM   1153 C  "C4'" . C   A 1 57  ? -27.929 30.481  31.794  1.00 45.25 ? 57  C   E "C4'" 1 
ATOM   1154 O  "O4'" . C   A 1 57  ? -28.926 29.509  32.203  1.00 45.10 ? 57  C   E "O4'" 1 
ATOM   1155 C  "C3'" . C   A 1 57  ? -28.786 31.678  31.395  1.00 45.19 ? 57  C   E "C3'" 1 
ATOM   1156 O  "O3'" . C   A 1 57  ? -28.037 32.750  30.758  1.00 44.99 ? 57  C   E "O3'" 1 
ATOM   1157 C  "C2'" . C   A 1 57  ? -29.883 30.968  30.599  1.00 45.34 ? 57  C   E "C2'" 1 
ATOM   1158 O  "O2'" . C   A 1 57  ? -29.469 30.481  29.336  1.00 45.26 ? 57  C   E "O2'" 1 
ATOM   1159 C  "C1'" . C   A 1 57  ? -30.150 29.784  31.529  1.00 45.52 ? 57  C   E "C1'" 1 
ATOM   1160 N  N1    . C   A 1 57  ? -31.285 30.013  32.511  1.00 45.64 ? 57  C   E N1    1 
ATOM   1161 C  C2    . C   A 1 57  ? -32.625 29.887  32.088  1.00 45.76 ? 57  C   E C2    1 
ATOM   1162 O  O2    . C   A 1 57  ? -32.890 29.587  30.915  1.00 45.88 ? 57  C   E O2    1 
ATOM   1163 N  N3    . C   A 1 57  ? -33.622 30.097  32.988  1.00 45.84 ? 57  C   E N3    1 
ATOM   1164 C  C4    . C   A 1 57  ? -33.336 30.418  34.253  1.00 45.78 ? 57  C   E C4    1 
ATOM   1165 N  N4    . C   A 1 57  ? -34.358 30.613  35.094  1.00 45.74 ? 57  C   E N4    1 
ATOM   1166 C  C5    . C   A 1 57  ? -31.988 30.552  34.707  1.00 45.84 ? 57  C   E C5    1 
ATOM   1167 C  C6    . C   A 1 57  ? -31.011 30.342  33.814  1.00 45.70 ? 57  C   E C6    1 
ATOM   1168 P  P     . A   A 1 58  ? -27.592 32.908  29.224  1.00 44.39 ? 58  A   E P     1 
ATOM   1169 O  OP1   . A   A 1 58  ? -26.956 34.241  29.127  1.00 44.89 ? 58  A   E OP1   1 
ATOM   1170 O  OP2   . A   A 1 58  ? -28.726 32.609  28.321  1.00 44.33 ? 58  A   E OP2   1 
ATOM   1171 O  "O5'" . A   A 1 58  ? -26.444 31.809  29.057  1.00 43.75 ? 58  A   E "O5'" 1 
ATOM   1172 C  "C5'" . A   A 1 58  ? -25.090 32.205  29.256  1.00 42.53 ? 58  A   E "C5'" 1 
ATOM   1173 C  "C4'" . A   A 1 58  ? -24.189 31.045  29.636  1.00 41.07 ? 58  A   E "C4'" 1 
ATOM   1174 O  "O4'" . A   A 1 58  ? -24.877 30.106  30.491  1.00 40.44 ? 58  A   E "O4'" 1 
ATOM   1175 C  "C3'" . A   A 1 58  ? -23.664 30.230  28.462  1.00 40.87 ? 58  A   E "C3'" 1 
ATOM   1176 O  "O3'" . A   A 1 58  ? -22.255 30.399  28.433  1.00 41.01 ? 58  A   E "O3'" 1 
ATOM   1177 C  "C2'" . A   A 1 58  ? -24.081 28.785  28.758  1.00 40.25 ? 58  A   E "C2'" 1 
ATOM   1178 O  "O2'" . A   A 1 58  ? -23.060 27.862  28.445  1.00 40.31 ? 58  A   E "O2'" 1 
ATOM   1179 C  "C1'" . A   A 1 58  ? -24.335 28.825  30.263  1.00 39.65 ? 58  A   E "C1'" 1 
ATOM   1180 N  N9    . A   A 1 58  ? -25.299 27.880  30.827  1.00 39.32 ? 58  A   E N9    1 
ATOM   1181 C  C8    . A   A 1 58  ? -25.133 27.199  31.999  1.00 39.08 ? 58  A   E C8    1 
ATOM   1182 N  N7    . A   A 1 58  ? -26.140 26.426  32.315  1.00 39.01 ? 58  A   E N7    1 
ATOM   1183 C  C5    . A   A 1 58  ? -27.044 26.617  31.287  1.00 38.84 ? 58  A   E C5    1 
ATOM   1184 C  C6    . A   A 1 58  ? -28.324 26.077  31.038  1.00 39.00 ? 58  A   E C6    1 
ATOM   1185 N  N6    . A   A 1 58  ? -28.913 25.199  31.854  1.00 39.15 ? 58  A   E N6    1 
ATOM   1186 N  N1    . A   A 1 58  ? -28.974 26.468  29.918  1.00 39.10 ? 58  A   E N1    1 
ATOM   1187 C  C2    . A   A 1 58  ? -28.376 27.348  29.102  1.00 39.08 ? 58  A   E C2    1 
ATOM   1188 N  N3    . A   A 1 58  ? -27.179 27.926  29.235  1.00 39.13 ? 58  A   E N3    1 
ATOM   1189 C  C4    . A   A 1 58  ? -26.550 27.517  30.357  1.00 39.28 ? 58  A   E C4    1 
ATOM   1190 P  P     . C   A 1 59  ? -21.578 31.417  27.402  1.00 41.28 ? 59  C   E P     1 
ATOM   1191 O  OP1   . C   A 1 59  ? -20.305 31.888  28.000  1.00 40.85 ? 59  C   E OP1   1 
ATOM   1192 O  OP2   . C   A 1 59  ? -22.579 32.413  26.952  1.00 40.69 ? 59  C   E OP2   1 
ATOM   1193 O  "O5'" . C   A 1 59  ? -21.280 30.419  26.182  1.00 41.10 ? 59  C   E "O5'" 1 
ATOM   1194 C  "C5'" . C   A 1 59  ? -19.958 30.056  25.835  1.00 40.57 ? 59  C   E "C5'" 1 
ATOM   1195 C  "C4'" . C   A 1 59  ? -19.719 30.127  24.338  1.00 40.74 ? 59  C   E "C4'" 1 
ATOM   1196 O  "O4'" . C   A 1 59  ? -20.742 29.383  23.624  1.00 40.41 ? 59  C   E "O4'" 1 
ATOM   1197 C  "C3'" . C   A 1 59  ? -19.724 31.542  23.763  1.00 41.01 ? 59  C   E "C3'" 1 
ATOM   1198 O  "O3'" . C   A 1 59  ? -18.523 31.743  23.021  1.00 41.76 ? 59  C   E "O3'" 1 
ATOM   1199 C  "C2'" . C   A 1 59  ? -20.969 31.574  22.877  1.00 40.69 ? 59  C   E "C2'" 1 
ATOM   1200 O  "O2'" . C   A 1 59  ? -20.827 32.417  21.749  1.00 40.82 ? 59  C   E "O2'" 1 
ATOM   1201 C  "C1'" . C   A 1 59  ? -21.060 30.109  22.455  1.00 40.34 ? 59  C   E "C1'" 1 
ATOM   1202 N  N1    . C   A 1 59  ? -22.400 29.688  21.919  1.00 40.09 ? 59  C   E N1    1 
ATOM   1203 C  C2    . C   A 1 59  ? -22.531 29.335  20.563  1.00 39.97 ? 59  C   E C2    1 
ATOM   1204 O  O2    . C   A 1 59  ? -21.544 29.364  19.817  1.00 40.01 ? 59  C   E O2    1 
ATOM   1205 N  N3    . C   A 1 59  ? -23.752 28.961  20.094  1.00 40.09 ? 59  C   E N3    1 
ATOM   1206 C  C4    . C   A 1 59  ? -24.809 28.932  20.913  1.00 40.23 ? 59  C   E C4    1 
ATOM   1207 N  N4    . C   A 1 59  ? -25.986 28.557  20.400  1.00 40.18 ? 59  C   E N4    1 
ATOM   1208 C  C5    . C   A 1 59  ? -24.701 29.287  22.294  1.00 40.15 ? 59  C   E C5    1 
ATOM   1209 C  C6    . C   A 1 59  ? -23.493 29.654  22.747  1.00 40.16 ? 59  C   E C6    1 
ATOM   1210 P  P     . A   A 1 60  ? -17.370 32.715  23.555  1.00 42.01 ? 60  A   E P     1 
ATOM   1211 O  OP1   . A   A 1 60  ? -17.999 33.975  24.011  1.00 41.89 ? 60  A   E OP1   1 
ATOM   1212 O  OP2   . A   A 1 60  ? -16.316 32.746  22.513  1.00 42.28 ? 60  A   E OP2   1 
ATOM   1213 O  "O5'" . A   A 1 60  ? -16.807 31.959  24.848  1.00 42.40 ? 60  A   E "O5'" 1 
ATOM   1214 C  "C5'" . A   A 1 60  ? -15.864 30.904  24.724  1.00 42.45 ? 60  A   E "C5'" 1 
ATOM   1215 C  "C4'" . A   A 1 60  ? -15.613 30.251  26.071  1.00 42.68 ? 60  A   E "C4'" 1 
ATOM   1216 O  "O4'" . A   A 1 60  ? -16.871 29.830  26.656  1.00 42.35 ? 60  A   E "O4'" 1 
ATOM   1217 C  "C3'" . A   A 1 60  ? -14.724 29.009  26.029  1.00 42.98 ? 60  A   E "C3'" 1 
ATOM   1218 O  "O3'" . A   A 1 60  ? -13.698 29.122  27.016  1.00 44.33 ? 60  A   E "O3'" 1 
ATOM   1219 C  "C2'" . A   A 1 60  ? -15.686 27.863  26.341  1.00 42.42 ? 60  A   E "C2'" 1 
ATOM   1220 O  "O2'" . A   A 1 60  ? -15.069 26.780  27.008  1.00 41.98 ? 60  A   E "O2'" 1 
ATOM   1221 C  "C1'" . A   A 1 60  ? -16.686 28.566  27.256  1.00 42.08 ? 60  A   E "C1'" 1 
ATOM   1222 N  N9    . A   A 1 60  ? -17.994 27.926  27.448  1.00 41.84 ? 60  A   E N9    1 
ATOM   1223 C  C8    . A   A 1 60  ? -18.809 28.129  28.527  1.00 41.83 ? 60  A   E C8    1 
ATOM   1224 N  N7    . A   A 1 60  ? -19.934 27.457  28.485  1.00 41.83 ? 60  A   E N7    1 
ATOM   1225 C  C5    . A   A 1 60  ? -19.860 26.753  27.297  1.00 41.78 ? 60  A   E C5    1 
ATOM   1226 C  C6    . A   A 1 60  ? -20.746 25.844  26.669  1.00 41.82 ? 60  A   E C6    1 
ATOM   1227 N  N6    . A   A 1 60  ? -21.926 25.483  27.185  1.00 41.77 ? 60  A   E N6    1 
ATOM   1228 N  N1    . A   A 1 60  ? -20.377 25.316  25.481  1.00 41.88 ? 60  A   E N1    1 
ATOM   1229 C  C2    . A   A 1 60  ? -19.194 25.671  24.959  1.00 41.91 ? 60  A   E C2    1 
ATOM   1230 N  N3    . A   A 1 60  ? -18.285 26.513  25.455  1.00 42.00 ? 60  A   E N3    1 
ATOM   1231 C  C4    . A   A 1 60  ? -18.671 27.028  26.639  1.00 41.91 ? 60  A   E C4    1 
ATOM   1232 P  P     . G   A 1 61  ? -12.255 29.720  26.667  1.00 44.90 ? 61  G   E P     1 
ATOM   1233 O  OP1   . G   A 1 61  ? -12.309 31.175  26.930  1.00 45.28 ? 61  G   E OP1   1 
ATOM   1234 O  OP2   . G   A 1 61  ? -11.830 29.224  25.341  1.00 44.79 ? 61  G   E OP2   1 
ATOM   1235 O  "O5'" . G   A 1 61  ? -11.327 29.050  27.786  1.00 45.27 ? 61  G   E "O5'" 1 
ATOM   1236 N  N     . ARG B 2 8   ? -12.813 -11.520 15.118  1.00 53.12 ? 11  ARG A N     1 
ATOM   1237 C  CA    . ARG B 2 8   ? -11.888 -10.689 14.295  1.00 53.07 ? 11  ARG A CA    1 
ATOM   1238 C  C     . ARG B 2 8   ? -11.949 -9.225  14.726  1.00 53.05 ? 11  ARG A C     1 
ATOM   1239 O  O     . ARG B 2 8   ? -11.289 -8.835  15.692  1.00 53.14 ? 11  ARG A O     1 
ATOM   1240 C  CB    . ARG B 2 8   ? -12.203 -10.836 12.801  1.00 53.06 ? 11  ARG A CB    1 
ATOM   1241 C  CG    . ARG B 2 8   ? -12.034 -12.245 12.260  1.00 53.00 ? 11  ARG A CG    1 
ATOM   1242 C  CD    . ARG B 2 8   ? -12.528 -12.341 10.827  1.00 52.94 ? 11  ARG A CD    1 
ATOM   1243 N  NE    . ARG B 2 8   ? -12.705 -13.727 10.400  1.00 52.70 ? 11  ARG A NE    1 
ATOM   1244 C  CZ    . ARG B 2 8   ? -13.353 -14.103 9.301   1.00 52.64 ? 11  ARG A CZ    1 
ATOM   1245 N  NH1   . ARG B 2 8   ? -13.902 -13.200 8.497   1.00 52.50 ? 11  ARG A NH1   1 
ATOM   1246 N  NH2   . ARG B 2 8   ? -13.456 -15.392 9.005   1.00 52.68 ? 11  ARG A NH2   1 
ATOM   1247 N  N     . ILE B 2 9   ? -12.743 -8.422  14.017  1.00 52.99 ? 12  ILE A N     1 
ATOM   1248 C  CA    . ILE B 2 9   ? -12.878 -6.993  14.322  1.00 52.90 ? 12  ILE A CA    1 
ATOM   1249 C  C     . ILE B 2 9   ? -14.326 -6.497  14.317  1.00 52.76 ? 12  ILE A C     1 
ATOM   1250 O  O     . ILE B 2 9   ? -15.065 -6.691  13.348  1.00 52.71 ? 12  ILE A O     1 
ATOM   1251 C  CB    . ILE B 2 9   ? -12.012 -6.093  13.387  1.00 52.92 ? 12  ILE A CB    1 
ATOM   1252 C  CG1   . ILE B 2 9   ? -12.111 -6.552  11.924  1.00 53.04 ? 12  ILE A CG1   1 
ATOM   1253 C  CG2   . ILE B 2 9   ? -10.559 -6.063  13.865  1.00 53.04 ? 12  ILE A CG2   1 
ATOM   1254 C  CD1   . ILE B 2 9   ? -11.704 -5.498  10.902  1.00 53.01 ? 12  ILE A CD1   1 
ATOM   1255 N  N     . LEU B 2 10  ? -14.713 -5.868  15.423  1.00 52.59 ? 13  LEU A N     1 
ATOM   1256 C  CA    . LEU B 2 10  ? -15.978 -5.150  15.534  1.00 52.48 ? 13  LEU A CA    1 
ATOM   1257 C  C     . LEU B 2 10  ? -15.740 -3.664  15.246  1.00 52.45 ? 13  LEU A C     1 
ATOM   1258 O  O     . LEU B 2 10  ? -14.606 -3.196  15.356  1.00 52.44 ? 13  LEU A O     1 
ATOM   1259 C  CB    . LEU B 2 10  ? -16.564 -5.334  16.941  1.00 52.45 ? 13  LEU A CB    1 
ATOM   1260 C  CG    . LEU B 2 10  ? -17.790 -6.228  17.179  1.00 52.41 ? 13  LEU A CG    1 
ATOM   1261 C  CD1   . LEU B 2 10  ? -17.719 -7.560  16.449  1.00 52.31 ? 13  LEU A CD1   1 
ATOM   1262 C  CD2   . LEU B 2 10  ? -17.993 -6.454  18.670  1.00 52.42 ? 13  LEU A CD2   1 
ATOM   1263 N  N     . PRO B 2 11  ? -16.797 -2.920  14.853  1.00 52.47 ? 14  PRO A N     1 
ATOM   1264 C  CA    . PRO B 2 11  ? -16.708 -1.456  14.715  1.00 52.56 ? 14  PRO A CA    1 
ATOM   1265 C  C     . PRO B 2 11  ? -16.209 -0.729  15.971  1.00 52.54 ? 14  PRO A C     1 
ATOM   1266 O  O     . PRO B 2 11  ? -15.917 0.465   15.914  1.00 52.58 ? 14  PRO A O     1 
ATOM   1267 C  CB    . PRO B 2 11  ? -18.153 -1.050  14.412  1.00 52.60 ? 14  PRO A CB    1 
ATOM   1268 C  CG    . PRO B 2 11  ? -18.730 -2.240  13.742  1.00 52.54 ? 14  PRO A CG    1 
ATOM   1269 C  CD    . PRO B 2 11  ? -18.131 -3.414  14.463  1.00 52.49 ? 14  PRO A CD    1 
ATOM   1270 N  N     . ALA B 2 12  ? -16.115 -1.450  17.086  1.00 52.58 ? 15  ALA A N     1 
ATOM   1271 C  CA    . ALA B 2 12  ? -15.567 -0.910  18.330  1.00 52.63 ? 15  ALA A CA    1 
ATOM   1272 C  C     . ALA B 2 12  ? -14.036 -0.981  18.363  1.00 52.61 ? 15  ALA A C     1 
ATOM   1273 O  O     . ALA B 2 12  ? -13.398 -0.350  19.211  1.00 52.67 ? 15  ALA A O     1 
ATOM   1274 C  CB    . ALA B 2 12  ? -16.161 -1.645  19.530  1.00 52.58 ? 15  ALA A CB    1 
ATOM   1275 N  N     . ASP B 2 13  ? -13.458 -1.741  17.434  1.00 52.48 ? 16  ASP A N     1 
ATOM   1276 C  CA    . ASP B 2 13  ? -12.015 -1.991  17.407  1.00 52.43 ? 16  ASP A CA    1 
ATOM   1277 C  C     . ASP B 2 13  ? -11.230 -1.049  16.495  1.00 52.37 ? 16  ASP A C     1 
ATOM   1278 O  O     . ASP B 2 13  ? -10.063 -0.758  16.764  1.00 52.43 ? 16  ASP A O     1 
ATOM   1279 C  CB    . ASP B 2 13  ? -11.729 -3.444  17.016  1.00 52.39 ? 16  ASP A CB    1 
ATOM   1280 C  CG    . ASP B 2 13  ? -12.171 -4.434  18.078  1.00 52.37 ? 16  ASP A CG    1 
ATOM   1281 O  OD1   . ASP B 2 13  ? -12.010 -4.139  19.281  1.00 52.35 ? 16  ASP A OD1   1 
ATOM   1282 O  OD2   . ASP B 2 13  ? -12.671 -5.517  17.708  1.00 52.44 ? 16  ASP A OD2   1 
ATOM   1283 N  N     . ILE B 2 14  ? -11.866 -0.586  15.421  1.00 52.26 ? 17  ILE A N     1 
ATOM   1284 C  CA    . ILE B 2 14  ? -11.207 0.293   14.449  1.00 52.09 ? 17  ILE A CA    1 
ATOM   1285 C  C     . ILE B 2 14  ? -10.965 1.694   15.017  1.00 51.89 ? 17  ILE A C     1 
ATOM   1286 O  O     . ILE B 2 14  ? -11.907 2.425   15.339  1.00 51.91 ? 17  ILE A O     1 
ATOM   1287 C  CB    . ILE B 2 14  ? -11.951 0.344   13.080  1.00 52.15 ? 17  ILE A CB    1 
ATOM   1288 C  CG1   . ILE B 2 14  ? -13.458 0.586   13.268  1.00 52.29 ? 17  ILE A CG1   1 
ATOM   1289 C  CG2   . ILE B 2 14  ? -11.692 -0.944  12.292  1.00 52.09 ? 17  ILE A CG2   1 
ATOM   1290 C  CD1   . ILE B 2 14  ? -14.214 0.895   11.976  1.00 52.24 ? 17  ILE A CD1   1 
ATOM   1291 N  N     . LYS B 2 15  ? -9.687  2.043   15.150  1.00 51.58 ? 18  LYS A N     1 
ATOM   1292 C  CA    . LYS B 2 15  ? -9.274  3.313   15.751  1.00 51.34 ? 18  LYS A CA    1 
ATOM   1293 C  C     . LYS B 2 15  ? -9.716  4.523   14.932  1.00 50.92 ? 18  LYS A C     1 
ATOM   1294 O  O     . LYS B 2 15  ? -9.698  4.496   13.699  1.00 50.85 ? 18  LYS A O     1 
ATOM   1295 C  CB    . LYS B 2 15  ? -7.756  3.348   15.984  1.00 51.34 ? 18  LYS A CB    1 
ATOM   1296 C  CG    . LYS B 2 15  ? -6.905  3.074   14.740  1.00 51.60 ? 18  LYS A CG    1 
ATOM   1297 C  CD    . LYS B 2 15  ? -5.458  3.531   14.916  1.00 51.63 ? 18  LYS A CD    1 
ATOM   1298 C  CE    . LYS B 2 15  ? -5.305  5.032   14.685  1.00 52.14 ? 18  LYS A CE    1 
ATOM   1299 N  NZ    . LYS B 2 15  ? -3.874  5.448   14.658  1.00 52.29 ? 18  LYS A NZ    1 
ATOM   1300 N  N     . ARG B 2 16  ? -10.125 5.573   15.638  1.00 50.47 ? 19  ARG A N     1 
ATOM   1301 C  CA    . ARG B 2 16  ? -10.503 6.834   15.013  1.00 50.09 ? 19  ARG A CA    1 
ATOM   1302 C  C     . ARG B 2 16  ? -9.407  7.868   15.227  1.00 49.63 ? 19  ARG A C     1 
ATOM   1303 O  O     . ARG B 2 16  ? -8.727  7.861   16.257  1.00 49.58 ? 19  ARG A O     1 
ATOM   1304 C  CB    . ARG B 2 16  ? -11.822 7.354   15.587  1.00 50.26 ? 19  ARG A CB    1 
ATOM   1305 C  CG    . ARG B 2 16  ? -13.041 6.510   15.256  1.00 50.95 ? 19  ARG A CG    1 
ATOM   1306 C  CD    . ARG B 2 16  ? -14.323 7.278   15.541  1.00 52.13 ? 19  ARG A CD    1 
ATOM   1307 N  NE    . ARG B 2 16  ? -15.515 6.480   15.254  1.00 52.93 ? 19  ARG A NE    1 
ATOM   1308 C  CZ    . ARG B 2 16  ? -16.704 6.986   14.932  1.00 53.13 ? 19  ARG A CZ    1 
ATOM   1309 N  NH1   . ARG B 2 16  ? -16.875 8.299   14.838  1.00 53.04 ? 19  ARG A NH1   1 
ATOM   1310 N  NH2   . ARG B 2 16  ? -17.724 6.172   14.692  1.00 53.13 ? 19  ARG A NH2   1 
ATOM   1311 N  N     . GLU B 2 17  ? -9.240  8.753   14.248  1.00 49.08 ? 20  GLU A N     1 
ATOM   1312 C  CA    . GLU B 2 17  ? -8.277  9.845   14.343  1.00 48.54 ? 20  GLU A CA    1 
ATOM   1313 C  C     . GLU B 2 17  ? -8.777  10.907  15.319  1.00 48.14 ? 20  GLU A C     1 
ATOM   1314 O  O     . GLU B 2 17  ? -9.964  11.241  15.331  1.00 48.03 ? 20  GLU A O     1 
ATOM   1315 C  CB    . GLU B 2 17  ? -8.036  10.464  12.963  1.00 48.55 ? 20  GLU A CB    1 
ATOM   1316 C  CG    . GLU B 2 17  ? -6.836  11.405  12.886  1.00 48.58 ? 20  GLU A CG    1 
ATOM   1317 C  CD    . GLU B 2 17  ? -6.645  12.016  11.506  1.00 48.64 ? 20  GLU A CD    1 
ATOM   1318 O  OE1   . GLU B 2 17  ? -6.096  13.136  11.426  1.00 48.74 ? 20  GLU A OE1   1 
ATOM   1319 O  OE2   . GLU B 2 17  ? -7.040  11.384  10.502  1.00 48.63 ? 20  GLU A OE2   1 
ATOM   1320 N  N     . VAL B 2 18  ? -7.869  11.421  16.144  1.00 47.66 ? 21  VAL A N     1 
ATOM   1321 C  CA    . VAL B 2 18  ? -8.191  12.514  17.055  1.00 47.24 ? 21  VAL A CA    1 
ATOM   1322 C  C     . VAL B 2 18  ? -7.809  13.842  16.404  1.00 46.99 ? 21  VAL A C     1 
ATOM   1323 O  O     . VAL B 2 18  ? -6.627  14.124  16.179  1.00 46.89 ? 21  VAL A O     1 
ATOM   1324 C  CB    . VAL B 2 18  ? -7.503  12.352  18.436  1.00 47.25 ? 21  VAL A CB    1 
ATOM   1325 C  CG1   . VAL B 2 18  ? -7.853  13.520  19.356  1.00 47.22 ? 21  VAL A CG1   1 
ATOM   1326 C  CG2   . VAL B 2 18  ? -7.905  11.031  19.085  1.00 47.13 ? 21  VAL A CG2   1 
ATOM   1327 N  N     . LEU B 2 19  ? -8.825  14.640  16.089  1.00 46.67 ? 22  LEU A N     1 
ATOM   1328 C  CA    . LEU B 2 19  ? -8.635  15.948  15.470  1.00 46.37 ? 22  LEU A CA    1 
ATOM   1329 C  C     . LEU B 2 19  ? -8.441  17.013  16.545  1.00 46.24 ? 22  LEU A C     1 
ATOM   1330 O  O     . LEU B 2 19  ? -9.217  17.089  17.500  1.00 45.99 ? 22  LEU A O     1 
ATOM   1331 C  CB    . LEU B 2 19  ? -9.831  16.304  14.578  1.00 46.28 ? 22  LEU A CB    1 
ATOM   1332 C  CG    . LEU B 2 19  ? -10.286 15.304  13.507  1.00 46.15 ? 22  LEU A CG    1 
ATOM   1333 C  CD1   . LEU B 2 19  ? -11.678 15.658  13.010  1.00 46.03 ? 22  LEU A CD1   1 
ATOM   1334 C  CD2   . LEU B 2 19  ? -9.300  15.219  12.343  1.00 46.11 ? 22  LEU A CD2   1 
ATOM   1335 N  N     . ILE B 2 20  ? -7.400  17.827  16.382  1.00 46.22 ? 23  ILE A N     1 
ATOM   1336 C  CA    . ILE B 2 20  ? -7.062  18.873  17.348  1.00 46.24 ? 23  ILE A CA    1 
ATOM   1337 C  C     . ILE B 2 20  ? -7.640  20.220  16.914  1.00 46.25 ? 23  ILE A C     1 
ATOM   1338 O  O     . ILE B 2 20  ? -7.318  20.724  15.836  1.00 46.25 ? 23  ILE A O     1 
ATOM   1339 C  CB    . ILE B 2 20  ? -5.519  19.008  17.545  1.00 46.26 ? 23  ILE A CB    1 
ATOM   1340 C  CG1   . ILE B 2 20  ? -4.839  17.633  17.691  1.00 46.27 ? 23  ILE A CG1   1 
ATOM   1341 C  CG2   . ILE B 2 20  ? -5.191  19.951  18.716  1.00 46.16 ? 23  ILE A CG2   1 
ATOM   1342 C  CD1   . ILE B 2 20  ? -5.193  16.849  18.953  1.00 46.05 ? 23  ILE A CD1   1 
ATOM   1343 N  N     . LYS B 2 21  ? -8.495  20.790  17.761  1.00 46.26 ? 24  LYS A N     1 
ATOM   1344 C  CA    . LYS B 2 21  ? -9.081  22.108  17.510  1.00 46.32 ? 24  LYS A CA    1 
ATOM   1345 C  C     . LYS B 2 21  ? -8.288  23.208  18.218  1.00 46.38 ? 24  LYS A C     1 
ATOM   1346 O  O     . LYS B 2 21  ? -7.987  24.246  17.627  1.00 46.37 ? 24  LYS A O     1 
ATOM   1347 C  CB    . LYS B 2 21  ? -10.550 22.138  17.944  1.00 46.31 ? 24  LYS A CB    1 
ATOM   1348 C  CG    . LYS B 2 21  ? -11.302 23.385  17.504  1.00 46.20 ? 24  LYS A CG    1 
ATOM   1349 C  CD    . LYS B 2 21  ? -12.759 23.335  17.934  1.00 46.17 ? 24  LYS A CD    1 
ATOM   1350 C  CE    . LYS B 2 21  ? -13.469 24.646  17.631  1.00 46.04 ? 24  LYS A CE    1 
ATOM   1351 N  NZ    . LYS B 2 21  ? -13.687 24.857  16.169  1.00 45.56 ? 24  LYS A NZ    1 
ATOM   1352 N  N     . ASP B 2 22  ? -7.959  22.967  19.485  1.00 46.48 ? 25  ASP A N     1 
ATOM   1353 C  CA    . ASP B 2 22  ? -7.159  23.890  20.281  1.00 46.60 ? 25  ASP A CA    1 
ATOM   1354 C  C     . ASP B 2 22  ? -5.896  23.179  20.762  1.00 46.59 ? 25  ASP A C     1 
ATOM   1355 O  O     . ASP B 2 22  ? -5.945  22.338  21.663  1.00 46.54 ? 25  ASP A O     1 
ATOM   1356 C  CB    . ASP B 2 22  ? -7.977  24.423  21.465  1.00 46.68 ? 25  ASP A CB    1 
ATOM   1357 C  CG    . ASP B 2 22  ? -7.279  25.554  22.215  1.00 47.08 ? 25  ASP A CG    1 
ATOM   1358 O  OD1   . ASP B 2 22  ? -6.234  26.062  21.751  1.00 47.08 ? 25  ASP A OD1   1 
ATOM   1359 O  OD2   . ASP B 2 22  ? -7.789  25.940  23.287  1.00 48.10 ? 25  ASP A OD2   1 
ATOM   1360 N  N     . GLU B 2 23  ? -4.770  23.525  20.142  1.00 46.65 ? 26  GLU A N     1 
ATOM   1361 C  CA    . GLU B 2 23  ? -3.469  22.935  20.466  1.00 46.68 ? 26  GLU A CA    1 
ATOM   1362 C  C     . GLU B 2 23  ? -2.962  23.398  21.830  1.00 46.57 ? 26  GLU A C     1 
ATOM   1363 O  O     . GLU B 2 23  ? -2.160  22.713  22.468  1.00 46.58 ? 26  GLU A O     1 
ATOM   1364 C  CB    . GLU B 2 23  ? -2.428  23.280  19.392  1.00 46.73 ? 26  GLU A CB    1 
ATOM   1365 C  CG    . GLU B 2 23  ? -2.880  23.076  17.948  1.00 47.08 ? 26  GLU A CG    1 
ATOM   1366 C  CD    . GLU B 2 23  ? -3.455  24.339  17.322  1.00 47.45 ? 26  GLU A CD    1 
ATOM   1367 O  OE1   . GLU B 2 23  ? -4.467  24.864  17.837  1.00 47.38 ? 26  GLU A OE1   1 
ATOM   1368 O  OE2   . GLU B 2 23  ? -2.896  24.804  16.305  1.00 47.69 ? 26  GLU A OE2   1 
ATOM   1369 N  N     . ASN B 2 24  ? -3.431  24.565  22.265  1.00 46.47 ? 27  ASN A N     1 
ATOM   1370 C  CA    . ASN B 2 24  ? -3.008  25.151  23.534  1.00 46.43 ? 27  ASN A CA    1 
ATOM   1371 C  C     . ASN B 2 24  ? -3.992  24.890  24.676  1.00 46.32 ? 27  ASN A C     1 
ATOM   1372 O  O     . ASN B 2 24  ? -3.960  25.567  25.706  1.00 46.29 ? 27  ASN A O     1 
ATOM   1373 C  CB    . ASN B 2 24  ? -2.747  26.653  23.366  1.00 46.42 ? 27  ASN A CB    1 
ATOM   1374 C  CG    . ASN B 2 24  ? -1.606  26.945  22.407  1.00 46.48 ? 27  ASN A CG    1 
ATOM   1375 O  OD1   . ASN B 2 24  ? -0.614  26.215  22.357  1.00 46.58 ? 27  ASN A OD1   1 
ATOM   1376 N  ND2   . ASN B 2 24  ? -1.740  28.023  21.643  1.00 46.65 ? 27  ASN A ND2   1 
ATOM   1377 N  N     . ALA B 2 25  ? -4.857  23.897  24.483  1.00 46.29 ? 28  ALA A N     1 
ATOM   1378 C  CA    . ALA B 2 25  ? -5.802  23.474  25.511  1.00 46.20 ? 28  ALA A CA    1 
ATOM   1379 C  C     . ALA B 2 25  ? -5.073  22.763  26.647  1.00 46.12 ? 28  ALA A C     1 
ATOM   1380 O  O     . ALA B 2 25  ? -4.303  21.825  26.419  1.00 46.14 ? 28  ALA A O     1 
ATOM   1381 C  CB    . ALA B 2 25  ? -6.870  22.579  24.916  1.00 46.28 ? 28  ALA A CB    1 
ATOM   1382 N  N     . GLU B 2 26  ? -5.320  23.234  27.866  1.00 45.91 ? 29  GLU A N     1 
ATOM   1383 C  CA    . GLU B 2 26  ? -4.677  22.718  29.069  1.00 45.69 ? 29  GLU A CA    1 
ATOM   1384 C  C     . GLU B 2 26  ? -5.737  22.463  30.135  1.00 45.15 ? 29  GLU A C     1 
ATOM   1385 O  O     . GLU B 2 26  ? -6.719  23.202  30.230  1.00 45.22 ? 29  GLU A O     1 
ATOM   1386 C  CB    . GLU B 2 26  ? -3.642  23.727  29.577  1.00 45.73 ? 29  GLU A CB    1 
ATOM   1387 C  CG    . GLU B 2 26  ? -2.826  23.280  30.792  1.00 46.19 ? 29  GLU A CG    1 
ATOM   1388 C  CD    . GLU B 2 26  ? -1.951  24.390  31.362  1.00 46.34 ? 29  GLU A CD    1 
ATOM   1389 O  OE1   . GLU B 2 26  ? -1.778  24.432  32.599  1.00 47.59 ? 29  GLU A OE1   1 
ATOM   1390 O  OE2   . GLU B 2 26  ? -1.436  25.220  30.581  1.00 47.04 ? 29  GLU A OE2   1 
ATOM   1391 N  N     . THR B 2 27  ? -5.539  21.415  30.930  1.00 44.47 ? 30  THR A N     1 
ATOM   1392 C  CA    . THR B 2 27  ? -6.463  21.098  32.014  1.00 43.76 ? 30  THR A CA    1 
ATOM   1393 C  C     . THR B 2 27  ? -5.875  21.430  33.393  1.00 43.33 ? 30  THR A C     1 
ATOM   1394 O  O     . THR B 2 27  ? -4.695  21.185  33.662  1.00 43.25 ? 30  THR A O     1 
ATOM   1395 C  CB    . THR B 2 27  ? -6.981  19.630  31.932  1.00 43.86 ? 30  THR A CB    1 
ATOM   1396 O  OG1   . THR B 2 27  ? -8.111  19.464  32.799  1.00 43.77 ? 30  THR A OG1   1 
ATOM   1397 C  CG2   . THR B 2 27  ? -5.888  18.614  32.286  1.00 43.61 ? 30  THR A CG2   1 
ATOM   1398 N  N     . ASN B 2 28  ? -6.709  22.020  34.245  1.00 42.66 ? 31  ASN A N     1 
ATOM   1399 C  CA    . ASN B 2 28  ? -6.314  22.417  35.590  1.00 42.06 ? 31  ASN A CA    1 
ATOM   1400 C  C     . ASN B 2 28  ? -6.475  21.241  36.561  1.00 41.82 ? 31  ASN A C     1 
ATOM   1401 O  O     . ASN B 2 28  ? -7.593  20.767  36.773  1.00 41.48 ? 31  ASN A O     1 
ATOM   1402 C  CB    . ASN B 2 28  ? -7.147  23.624  36.044  1.00 41.88 ? 31  ASN A CB    1 
ATOM   1403 C  CG    . ASN B 2 28  ? -6.684  24.211  37.374  1.00 41.45 ? 31  ASN A CG    1 
ATOM   1404 O  OD1   . ASN B 2 28  ? -5.951  23.582  38.136  1.00 40.40 ? 31  ASN A OD1   1 
ATOM   1405 N  ND2   . ASN B 2 28  ? -7.125  25.432  37.658  1.00 41.01 ? 31  ASN A ND2   1 
ATOM   1406 N  N     . PRO B 2 29  ? -5.356  20.780  37.159  1.00 41.61 ? 32  PRO A N     1 
ATOM   1407 C  CA    . PRO B 2 29  ? -5.358  19.649  38.094  1.00 41.55 ? 32  PRO A CA    1 
ATOM   1408 C  C     . PRO B 2 29  ? -6.174  19.892  39.373  1.00 41.48 ? 32  PRO A C     1 
ATOM   1409 O  O     . PRO B 2 29  ? -6.540  18.932  40.053  1.00 41.30 ? 32  PRO A O     1 
ATOM   1410 C  CB    . PRO B 2 29  ? -3.872  19.468  38.434  1.00 41.51 ? 32  PRO A CB    1 
ATOM   1411 C  CG    . PRO B 2 29  ? -3.249  20.800  38.157  1.00 41.68 ? 32  PRO A CG    1 
ATOM   1412 C  CD    . PRO B 2 29  ? -3.998  21.329  36.973  1.00 41.74 ? 32  PRO A CD    1 
ATOM   1413 N  N     . ASP B 2 30  ? -6.448  21.161  39.685  1.00 41.41 ? 33  ASP A N     1 
ATOM   1414 C  CA    . ASP B 2 30  ? -7.253  21.542  40.853  1.00 41.48 ? 33  ASP A CA    1 
ATOM   1415 C  C     . ASP B 2 30  ? -8.676  20.992  40.807  1.00 41.59 ? 33  ASP A C     1 
ATOM   1416 O  O     . ASP B 2 30  ? -9.298  20.770  41.849  1.00 41.58 ? 33  ASP A O     1 
ATOM   1417 C  CB    . ASP B 2 30  ? -7.327  23.067  40.982  1.00 41.47 ? 33  ASP A CB    1 
ATOM   1418 C  CG    . ASP B 2 30  ? -6.003  23.699  41.385  1.00 41.19 ? 33  ASP A CG    1 
ATOM   1419 O  OD1   . ASP B 2 30  ? -6.004  24.914  41.661  1.00 41.31 ? 33  ASP A OD1   1 
ATOM   1420 O  OD2   . ASP B 2 30  ? -4.969  23.001  41.433  1.00 40.94 ? 33  ASP A OD2   1 
ATOM   1421 N  N     . TRP B 2 31  ? -9.185  20.779  39.596  1.00 41.67 ? 34  TRP A N     1 
ATOM   1422 C  CA    . TRP B 2 31  ? -10.574 20.382  39.405  1.00 41.82 ? 34  TRP A CA    1 
ATOM   1423 C  C     . TRP B 2 31  ? -10.706 18.969  38.842  1.00 41.91 ? 34  TRP A C     1 
ATOM   1424 O  O     . TRP B 2 31  ? -9.839  18.500  38.105  1.00 41.84 ? 34  TRP A O     1 
ATOM   1425 C  CB    . TRP B 2 31  ? -11.292 21.383  38.490  1.00 41.85 ? 34  TRP A CB    1 
ATOM   1426 C  CG    . TRP B 2 31  ? -11.049 22.830  38.837  1.00 41.80 ? 34  TRP A CG    1 
ATOM   1427 C  CD1   . TRP B 2 31  ? -11.047 23.390  40.087  1.00 42.00 ? 34  TRP A CD1   1 
ATOM   1428 C  CD2   . TRP B 2 31  ? -10.793 23.901  37.920  1.00 42.00 ? 34  TRP A CD2   1 
ATOM   1429 N  NE1   . TRP B 2 31  ? -10.792 24.738  40.003  1.00 42.00 ? 34  TRP A NE1   1 
ATOM   1430 C  CE2   . TRP B 2 31  ? -10.633 25.079  38.686  1.00 42.05 ? 34  TRP A CE2   1 
ATOM   1431 C  CE3   . TRP B 2 31  ? -10.683 23.982  36.524  1.00 42.05 ? 34  TRP A CE3   1 
ATOM   1432 C  CZ2   . TRP B 2 31  ? -10.370 26.323  38.103  1.00 41.74 ? 34  TRP A CZ2   1 
ATOM   1433 C  CZ3   . TRP B 2 31  ? -10.419 25.220  35.945  1.00 41.87 ? 34  TRP A CZ3   1 
ATOM   1434 C  CH2   . TRP B 2 31  ? -10.266 26.373  36.736  1.00 41.89 ? 34  TRP A CH2   1 
ATOM   1435 N  N     . GLY B 2 32  ? -11.791 18.294  39.211  1.00 42.06 ? 35  GLY A N     1 
ATOM   1436 C  CA    . GLY B 2 32  ? -12.148 17.004  38.625  1.00 42.26 ? 35  GLY A CA    1 
ATOM   1437 C  C     . GLY B 2 32  ? -11.646 15.776  39.355  1.00 42.54 ? 35  GLY A C     1 
ATOM   1438 O  O     . GLY B 2 32  ? -10.756 15.859  40.203  1.00 42.46 ? 35  GLY A O     1 
ATOM   1439 N  N     . PHE B 2 33  ? -12.235 14.632  39.017  1.00 42.80 ? 36  PHE A N     1 
ATOM   1440 C  CA    . PHE B 2 33  ? -11.818 13.346  39.554  1.00 43.04 ? 36  PHE A CA    1 
ATOM   1441 C  C     . PHE B 2 33  ? -11.672 12.315  38.430  1.00 43.48 ? 36  PHE A C     1 
ATOM   1442 O  O     . PHE B 2 33  ? -12.637 11.621  38.090  1.00 43.30 ? 36  PHE A O     1 
ATOM   1443 C  CB    . PHE B 2 33  ? -12.809 12.845  40.612  1.00 43.04 ? 36  PHE A CB    1 
ATOM   1444 C  CG    . PHE B 2 33  ? -12.819 13.658  41.877  1.00 42.87 ? 36  PHE A CG    1 
ATOM   1445 C  CD1   . PHE B 2 33  ? -13.645 14.773  41.999  1.00 42.91 ? 36  PHE A CD1   1 
ATOM   1446 C  CD2   . PHE B 2 33  ? -12.017 13.299  42.953  1.00 42.42 ? 36  PHE A CD2   1 
ATOM   1447 C  CE1   . PHE B 2 33  ? -13.661 15.526  43.174  1.00 42.61 ? 36  PHE A CE1   1 
ATOM   1448 C  CE2   . PHE B 2 33  ? -12.027 14.044  44.129  1.00 42.47 ? 36  PHE A CE2   1 
ATOM   1449 C  CZ    . PHE B 2 33  ? -12.851 15.158  44.239  1.00 42.47 ? 36  PHE A CZ    1 
ATOM   1450 N  N     . PRO B 2 34  ? -10.459 12.213  37.846  1.00 43.95 ? 37  PRO A N     1 
ATOM   1451 C  CA    . PRO B 2 34  ? -10.183 11.152  36.878  1.00 44.17 ? 37  PRO A CA    1 
ATOM   1452 C  C     . PRO B 2 34  ? -10.297 9.791   37.569  1.00 44.46 ? 37  PRO A C     1 
ATOM   1453 O  O     . PRO B 2 34  ? -10.064 9.712   38.778  1.00 44.41 ? 37  PRO A O     1 
ATOM   1454 C  CB    . PRO B 2 34  ? -8.727  11.412  36.467  1.00 44.16 ? 37  PRO A CB    1 
ATOM   1455 C  CG    . PRO B 2 34  ? -8.435  12.806  36.883  1.00 44.03 ? 37  PRO A CG    1 
ATOM   1456 C  CD    . PRO B 2 34  ? -9.283  13.075  38.072  1.00 43.85 ? 37  PRO A CD    1 
ATOM   1457 N  N     . PRO B 2 35  ? -10.654 8.728   36.814  1.00 44.72 ? 38  PRO A N     1 
ATOM   1458 C  CA    . PRO B 2 35  ? -10.870 7.386   37.373  1.00 45.04 ? 38  PRO A CA    1 
ATOM   1459 C  C     . PRO B 2 35  ? -9.772  6.912   38.333  1.00 45.46 ? 38  PRO A C     1 
ATOM   1460 O  O     . PRO B 2 35  ? -10.068 6.229   39.313  1.00 45.76 ? 38  PRO A O     1 
ATOM   1461 C  CB    . PRO B 2 35  ? -10.890 6.497   36.130  1.00 45.05 ? 38  PRO A CB    1 
ATOM   1462 C  CG    . PRO B 2 35  ? -11.415 7.375   35.060  1.00 44.72 ? 38  PRO A CG    1 
ATOM   1463 C  CD    . PRO B 2 35  ? -10.878 8.748   35.354  1.00 44.77 ? 38  PRO A CD    1 
ATOM   1464 N  N     . GLU B 2 36  ? -8.527  7.288   38.048  1.00 45.86 ? 39  GLU A N     1 
ATOM   1465 C  CA    . GLU B 2 36  ? -7.356  6.845   38.809  1.00 46.07 ? 39  GLU A CA    1 
ATOM   1466 C  C     . GLU B 2 36  ? -7.326  7.348   40.253  1.00 45.85 ? 39  GLU A C     1 
ATOM   1467 O  O     . GLU B 2 36  ? -6.861  6.635   41.146  1.00 46.13 ? 39  GLU A O     1 
ATOM   1468 C  CB    . GLU B 2 36  ? -6.064  7.258   38.092  1.00 46.26 ? 39  GLU A CB    1 
ATOM   1469 C  CG    . GLU B 2 36  ? -5.797  6.531   36.768  1.00 47.68 ? 39  GLU A CG    1 
ATOM   1470 C  CD    . GLU B 2 36  ? -6.754  6.931   35.645  1.00 49.23 ? 39  GLU A CD    1 
ATOM   1471 O  OE1   . GLU B 2 36  ? -7.221  8.095   35.626  1.00 49.69 ? 39  GLU A OE1   1 
ATOM   1472 O  OE2   . GLU B 2 36  ? -7.035  6.075   34.777  1.00 49.68 ? 39  GLU A OE2   1 
ATOM   1473 N  N     . LYS B 2 37  ? -7.814  8.566   40.481  1.00 45.34 ? 40  LYS A N     1 
ATOM   1474 C  CA    . LYS B 2 37  ? -7.764  9.168   41.814  1.00 44.76 ? 40  LYS A CA    1 
ATOM   1475 C  C     . LYS B 2 37  ? -9.143  9.296   42.480  1.00 44.26 ? 40  LYS A C     1 
ATOM   1476 O  O     . LYS B 2 37  ? -9.385  10.206  43.281  1.00 44.18 ? 40  LYS A O     1 
ATOM   1477 C  CB    . LYS B 2 37  ? -7.025  10.513  41.771  1.00 45.03 ? 40  LYS A CB    1 
ATOM   1478 C  CG    . LYS B 2 37  ? -6.232  10.822  43.045  1.00 45.47 ? 40  LYS A CG    1 
ATOM   1479 C  CD    . LYS B 2 37  ? -5.130  11.853  42.808  1.00 46.62 ? 40  LYS A CD    1 
ATOM   1480 C  CE    . LYS B 2 37  ? -3.857  11.203  42.269  1.00 47.21 ? 40  LYS A CE    1 
ATOM   1481 N  NZ    . LYS B 2 37  ? -2.769  12.194  42.033  1.00 47.20 ? 40  LYS A NZ    1 
ATOM   1482 N  N     . ARG B 2 38  ? -10.038 8.366   42.151  1.00 43.45 ? 41  ARG A N     1 
ATOM   1483 C  CA    . ARG B 2 38  ? -11.337 8.279   42.811  1.00 42.72 ? 41  ARG A CA    1 
ATOM   1484 C  C     . ARG B 2 38  ? -11.245 7.374   44.037  1.00 42.59 ? 41  ARG A C     1 
ATOM   1485 O  O     . ARG B 2 38  ? -10.781 6.240   43.928  1.00 42.58 ? 41  ARG A O     1 
ATOM   1486 C  CB    . ARG B 2 38  ? -12.411 7.761   41.847  1.00 42.59 ? 41  ARG A CB    1 
ATOM   1487 C  CG    . ARG B 2 38  ? -12.865 8.790   40.833  1.00 42.26 ? 41  ARG A CG    1 
ATOM   1488 C  CD    . ARG B 2 38  ? -13.797 8.214   39.779  1.00 41.90 ? 41  ARG A CD    1 
ATOM   1489 N  NE    . ARG B 2 38  ? -13.873 9.128   38.643  1.00 40.38 ? 41  ARG A NE    1 
ATOM   1490 C  CZ    . ARG B 2 38  ? -14.384 8.839   37.450  1.00 39.48 ? 41  ARG A CZ    1 
ATOM   1491 N  NH1   . ARG B 2 38  ? -14.894 7.636   37.198  1.00 38.68 ? 41  ARG A NH1   1 
ATOM   1492 N  NH2   . ARG B 2 38  ? -14.377 9.767   36.500  1.00 38.02 ? 41  ARG A NH2   1 
ATOM   1493 N  N     . PRO B 2 39  ? -11.666 7.879   45.215  1.00 42.40 ? 42  PRO A N     1 
ATOM   1494 C  CA    . PRO B 2 39  ? -11.778 7.019   46.395  1.00 42.28 ? 42  PRO A CA    1 
ATOM   1495 C  C     . PRO B 2 39  ? -12.778 5.894   46.137  1.00 42.14 ? 42  PRO A C     1 
ATOM   1496 O  O     . PRO B 2 39  ? -13.676 6.056   45.303  1.00 42.03 ? 42  PRO A O     1 
ATOM   1497 C  CB    . PRO B 2 39  ? -12.314 7.967   47.474  1.00 42.31 ? 42  PRO A CB    1 
ATOM   1498 C  CG    . PRO B 2 39  ? -11.949 9.330   47.003  1.00 42.40 ? 42  PRO A CG    1 
ATOM   1499 C  CD    . PRO B 2 39  ? -12.045 9.271   45.514  1.00 42.34 ? 42  PRO A CD    1 
ATOM   1500 N  N     . ILE B 2 40  ? -12.622 4.776   46.846  1.00 41.95 ? 43  ILE A N     1 
ATOM   1501 C  CA    . ILE B 2 40  ? -13.437 3.573   46.615  1.00 41.81 ? 43  ILE A CA    1 
ATOM   1502 C  C     . ILE B 2 40  ? -14.943 3.865   46.543  1.00 41.65 ? 43  ILE A C     1 
ATOM   1503 O  O     . ILE B 2 40  ? -15.622 3.373   45.643  1.00 41.72 ? 43  ILE A O     1 
ATOM   1504 C  CB    . ILE B 2 40  ? -13.097 2.409   47.624  1.00 41.85 ? 43  ILE A CB    1 
ATOM   1505 C  CG1   . ILE B 2 40  ? -13.857 1.122   47.281  1.00 42.02 ? 43  ILE A CG1   1 
ATOM   1506 C  CG2   . ILE B 2 40  ? -13.346 2.815   49.072  1.00 41.50 ? 43  ILE A CG2   1 
ATOM   1507 C  CD1   . ILE B 2 40  ? -13.249 0.320   46.151  1.00 42.38 ? 43  ILE A CD1   1 
ATOM   1508 N  N     . GLU B 2 41  ? -15.442 4.682   47.469  1.00 41.46 ? 44  GLU A N     1 
ATOM   1509 C  CA    . GLU B 2 41  ? -16.856 5.062   47.510  1.00 41.48 ? 44  GLU A CA    1 
ATOM   1510 C  C     . GLU B 2 41  ? -17.305 5.807   46.246  1.00 41.38 ? 44  GLU A C     1 
ATOM   1511 O  O     . GLU B 2 41  ? -18.375 5.524   45.704  1.00 41.27 ? 44  GLU A O     1 
ATOM   1512 C  CB    . GLU B 2 41  ? -17.159 5.898   48.760  1.00 41.66 ? 44  GLU A CB    1 
ATOM   1513 C  CG    . GLU B 2 41  ? -17.156 5.108   50.080  1.00 42.40 ? 44  GLU A CG    1 
ATOM   1514 C  CD    . GLU B 2 41  ? -15.760 4.911   50.675  1.00 43.46 ? 44  GLU A CD    1 
ATOM   1515 O  OE1   . GLU B 2 41  ? -15.630 4.099   51.618  1.00 44.03 ? 44  GLU A OE1   1 
ATOM   1516 O  OE2   . GLU B 2 41  ? -14.796 5.565   50.213  1.00 43.44 ? 44  GLU A OE2   1 
ATOM   1517 N  N     . MET B 2 42  ? -16.485 6.755   45.789  1.00 41.11 ? 45  MET A N     1 
ATOM   1518 C  CA    . MET B 2 42  ? -16.759 7.504   44.561  1.00 40.81 ? 45  MET A CA    1 
ATOM   1519 C  C     . MET B 2 42  ? -16.602 6.605   43.330  1.00 40.93 ? 45  MET A C     1 
ATOM   1520 O  O     . MET B 2 42  ? -17.346 6.733   42.356  1.00 40.79 ? 45  MET A O     1 
ATOM   1521 C  CB    . MET B 2 42  ? -15.833 8.719   44.460  1.00 40.87 ? 45  MET A CB    1 
ATOM   1522 C  CG    . MET B 2 42  ? -16.105 9.627   43.270  1.00 40.54 ? 45  MET A CG    1 
ATOM   1523 S  SD    . MET B 2 42  ? -14.870 10.923  43.079  1.00 40.34 ? 45  MET A SD    1 
ATOM   1524 C  CE    . MET B 2 42  ? -15.396 12.100  44.329  1.00 39.92 ? 45  MET A CE    1 
ATOM   1525 N  N     . HIS B 2 43  ? -15.627 5.701   43.394  1.00 40.87 ? 46  HIS A N     1 
ATOM   1526 C  CA    . HIS B 2 43  ? -15.378 4.716   42.350  1.00 40.86 ? 46  HIS A CA    1 
ATOM   1527 C  C     . HIS B 2 43  ? -16.614 3.837   42.107  1.00 40.90 ? 46  HIS A C     1 
ATOM   1528 O  O     . HIS B 2 43  ? -16.977 3.579   40.959  1.00 40.90 ? 46  HIS A O     1 
ATOM   1529 C  CB    . HIS B 2 43  ? -14.150 3.874   42.719  1.00 40.76 ? 46  HIS A CB    1 
ATOM   1530 C  CG    . HIS B 2 43  ? -13.755 2.876   41.676  1.00 41.02 ? 46  HIS A CG    1 
ATOM   1531 N  ND1   . HIS B 2 43  ? -13.821 1.516   41.887  1.00 41.46 ? 46  HIS A ND1   1 
ATOM   1532 C  CD2   . HIS B 2 43  ? -13.290 3.039   40.415  1.00 40.82 ? 46  HIS A CD2   1 
ATOM   1533 C  CE1   . HIS B 2 43  ? -13.408 0.884   40.804  1.00 41.11 ? 46  HIS A CE1   1 
ATOM   1534 N  NE2   . HIS B 2 43  ? -13.084 1.785   39.894  1.00 41.38 ? 46  HIS A NE2   1 
ATOM   1535 N  N     . ILE B 2 44  ? -17.254 3.407   43.195  1.00 40.97 ? 47  ILE A N     1 
ATOM   1536 C  CA    . ILE B 2 44  ? -18.494 2.621   43.153  1.00 41.00 ? 47  ILE A CA    1 
ATOM   1537 C  C     . ILE B 2 44  ? -19.661 3.441   42.599  1.00 40.89 ? 47  ILE A C     1 
ATOM   1538 O  O     . ILE B 2 44  ? -20.432 2.948   41.768  1.00 40.71 ? 47  ILE A O     1 
ATOM   1539 C  CB    . ILE B 2 44  ? -18.868 2.067   44.558  1.00 41.06 ? 47  ILE A CB    1 
ATOM   1540 C  CG1   . ILE B 2 44  ? -17.762 1.146   45.084  1.00 41.36 ? 47  ILE A CG1   1 
ATOM   1541 C  CG2   . ILE B 2 44  ? -20.198 1.299   44.519  1.00 41.31 ? 47  ILE A CG2   1 
ATOM   1542 C  CD1   . ILE B 2 44  ? -17.826 0.892   46.577  1.00 41.74 ? 47  ILE A CD1   1 
ATOM   1543 N  N     . GLN B 2 45  ? -19.778 4.689   43.060  1.00 40.68 ? 48  GLN A N     1 
ATOM   1544 C  CA    . GLN B 2 45  ? -20.828 5.605   42.607  1.00 40.64 ? 48  GLN A CA    1 
ATOM   1545 C  C     . GLN B 2 45  ? -20.836 5.813   41.093  1.00 40.21 ? 48  GLN A C     1 
ATOM   1546 O  O     . GLN B 2 45  ? -21.898 5.986   40.498  1.00 40.09 ? 48  GLN A O     1 
ATOM   1547 C  CB    . GLN B 2 45  ? -20.724 6.955   43.323  1.00 40.83 ? 48  GLN A CB    1 
ATOM   1548 C  CG    . GLN B 2 45  ? -21.236 6.945   44.762  1.00 42.52 ? 48  GLN A CG    1 
ATOM   1549 C  CD    . GLN B 2 45  ? -22.726 6.663   44.861  1.00 44.24 ? 48  GLN A CD    1 
ATOM   1550 O  OE1   . GLN B 2 45  ? -23.545 7.350   44.245  1.00 45.37 ? 48  GLN A OE1   1 
ATOM   1551 N  NE2   . GLN B 2 45  ? -23.085 5.649   45.641  1.00 44.66 ? 48  GLN A NE2   1 
ATOM   1552 N  N     . PHE B 2 46  ? -19.652 5.793   40.482  1.00 39.79 ? 49  PHE A N     1 
ATOM   1553 C  CA    . PHE B 2 46  ? -19.515 5.952   39.033  1.00 39.51 ? 49  PHE A CA    1 
ATOM   1554 C  C     . PHE B 2 46  ? -18.875 4.708   38.408  1.00 39.35 ? 49  PHE A C     1 
ATOM   1555 O  O     . PHE B 2 46  ? -17.980 4.807   37.568  1.00 39.47 ? 49  PHE A O     1 
ATOM   1556 C  CB    . PHE B 2 46  ? -18.707 7.216   38.706  1.00 39.26 ? 49  PHE A CB    1 
ATOM   1557 C  CG    . PHE B 2 46  ? -19.261 8.469   39.334  1.00 39.03 ? 49  PHE A CG    1 
ATOM   1558 C  CD1   . PHE B 2 46  ? -20.256 9.202   38.697  1.00 38.43 ? 49  PHE A CD1   1 
ATOM   1559 C  CD2   . PHE B 2 46  ? -18.788 8.913   40.567  1.00 38.58 ? 49  PHE A CD2   1 
ATOM   1560 C  CE1   . PHE B 2 46  ? -20.771 10.358  39.278  1.00 38.34 ? 49  PHE A CE1   1 
ATOM   1561 C  CE2   . PHE B 2 46  ? -19.302 10.062  41.157  1.00 38.68 ? 49  PHE A CE2   1 
ATOM   1562 C  CZ    . PHE B 2 46  ? -20.294 10.786  40.510  1.00 38.41 ? 49  PHE A CZ    1 
ATOM   1563 N  N     . GLY B 2 47  ? -19.352 3.538   38.818  1.00 39.32 ? 50  GLY A N     1 
ATOM   1564 C  CA    . GLY B 2 47  ? -18.742 2.276   38.416  1.00 39.11 ? 50  GLY A CA    1 
ATOM   1565 C  C     . GLY B 2 47  ? -19.598 1.377   37.545  1.00 39.01 ? 50  GLY A C     1 
ATOM   1566 O  O     . GLY B 2 47  ? -20.823 1.523   37.490  1.00 38.72 ? 50  GLY A O     1 
ATOM   1567 N  N     . VAL B 2 48  ? -18.929 0.452   36.858  1.00 38.90 ? 51  VAL A N     1 
ATOM   1568 C  CA    . VAL B 2 48  ? -19.575 -0.576  36.043  1.00 38.89 ? 51  VAL A CA    1 
ATOM   1569 C  C     . VAL B 2 48  ? -18.872 -1.912  36.290  1.00 38.95 ? 51  VAL A C     1 
ATOM   1570 O  O     . VAL B 2 48  ? -17.661 -2.021  36.114  1.00 39.03 ? 51  VAL A O     1 
ATOM   1571 C  CB    . VAL B 2 48  ? -19.529 -0.242  34.516  1.00 38.85 ? 51  VAL A CB    1 
ATOM   1572 C  CG1   . VAL B 2 48  ? -20.258 -1.314  33.700  1.00 38.36 ? 51  VAL A CG1   1 
ATOM   1573 C  CG2   . VAL B 2 48  ? -20.125 1.130   34.226  1.00 38.64 ? 51  VAL A CG2   1 
ATOM   1574 N  N     . ILE B 2 49  ? -19.634 -2.919  36.706  1.00 39.16 ? 52  ILE A N     1 
ATOM   1575 C  CA    . ILE B 2 49  ? -19.108 -4.272  36.879  1.00 39.33 ? 52  ILE A CA    1 
ATOM   1576 C  C     . ILE B 2 49  ? -19.137 -5.024  35.545  1.00 39.44 ? 52  ILE A C     1 
ATOM   1577 O  O     . ILE B 2 49  ? -20.180 -5.102  34.895  1.00 39.42 ? 52  ILE A O     1 
ATOM   1578 C  CB    . ILE B 2 49  ? -19.918 -5.076  37.932  1.00 39.37 ? 52  ILE A CB    1 
ATOM   1579 C  CG1   . ILE B 2 49  ? -19.997 -4.317  39.263  1.00 39.43 ? 52  ILE A CG1   1 
ATOM   1580 C  CG2   . ILE B 2 49  ? -19.318 -6.469  38.131  1.00 39.03 ? 52  ILE A CG2   1 
ATOM   1581 C  CD1   . ILE B 2 49  ? -21.054 -4.852  40.213  1.00 39.31 ? 52  ILE A CD1   1 
ATOM   1582 N  N     . ASN B 2 50  ? -17.986 -5.557  35.139  1.00 39.49 ? 53  ASN A N     1 
ATOM   1583 C  CA    . ASN B 2 50  ? -17.914 -6.458  33.994  1.00 39.54 ? 53  ASN A CA    1 
ATOM   1584 C  C     . ASN B 2 50  ? -18.224 -7.872  34.488  1.00 39.54 ? 53  ASN A C     1 
ATOM   1585 O  O     . ASN B 2 50  ? -17.319 -8.645  34.815  1.00 39.37 ? 53  ASN A O     1 
ATOM   1586 C  CB    . ASN B 2 50  ? -16.531 -6.384  33.328  1.00 39.57 ? 53  ASN A CB    1 
ATOM   1587 C  CG    . ASN B 2 50  ? -16.458 -7.156  32.008  1.00 39.60 ? 53  ASN A CG    1 
ATOM   1588 O  OD1   . ASN B 2 50  ? -15.370 -7.459  31.520  1.00 40.33 ? 53  ASN A OD1   1 
ATOM   1589 N  ND2   . ASN B 2 50  ? -17.609 -7.463  31.426  1.00 39.84 ? 53  ASN A ND2   1 
ATOM   1590 N  N     . LEU B 2 51  ? -19.514 -8.188  34.565  1.00 39.46 ? 54  LEU A N     1 
ATOM   1591 C  CA    . LEU B 2 51  ? -19.957 -9.425  35.202  1.00 39.65 ? 54  LEU A CA    1 
ATOM   1592 C  C     . LEU B 2 51  ? -20.066 -10.596 34.234  1.00 39.65 ? 54  LEU A C     1 
ATOM   1593 O  O     . LEU B 2 51  ? -20.509 -10.443 33.097  1.00 39.82 ? 54  LEU A O     1 
ATOM   1594 C  CB    . LEU B 2 51  ? -21.296 -9.220  35.922  1.00 39.47 ? 54  LEU A CB    1 
ATOM   1595 C  CG    . LEU B 2 51  ? -21.702 -10.309 36.922  1.00 39.57 ? 54  LEU A CG    1 
ATOM   1596 C  CD1   . LEU B 2 51  ? -21.164 -10.005 38.320  1.00 39.32 ? 54  LEU A CD1   1 
ATOM   1597 C  CD2   . LEU B 2 51  ? -23.206 -10.460 36.955  1.00 38.84 ? 54  LEU A CD2   1 
ATOM   1598 N  N     . ASP B 2 52  ? -19.646 -11.764 34.705  1.00 39.79 ? 55  ASP A N     1 
ATOM   1599 C  CA    . ASP B 2 52  ? -19.904 -13.017 34.021  1.00 39.87 ? 55  ASP A CA    1 
ATOM   1600 C  C     . ASP B 2 52  ? -21.226 -13.572 34.557  1.00 39.90 ? 55  ASP A C     1 
ATOM   1601 O  O     . ASP B 2 52  ? -21.265 -14.166 35.639  1.00 39.83 ? 55  ASP A O     1 
ATOM   1602 C  CB    . ASP B 2 52  ? -18.754 -14.000 34.267  1.00 39.85 ? 55  ASP A CB    1 
ATOM   1603 C  CG    . ASP B 2 52  ? -18.789 -15.207 33.330  1.00 40.12 ? 55  ASP A CG    1 
ATOM   1604 O  OD1   . ASP B 2 52  ? -19.799 -15.419 32.624  1.00 40.56 ? 55  ASP A OD1   1 
ATOM   1605 O  OD2   . ASP B 2 52  ? -17.791 -15.952 33.303  1.00 40.26 ? 55  ASP A OD2   1 
ATOM   1606 N  N     . LYS B 2 53  ? -22.306 -13.351 33.808  1.00 39.94 ? 56  LYS A N     1 
ATOM   1607 C  CA    . LYS B 2 53  ? -23.636 -13.812 34.213  1.00 40.08 ? 56  LYS A CA    1 
ATOM   1608 C  C     . LYS B 2 53  ? -23.727 -15.336 34.191  1.00 39.89 ? 56  LYS A C     1 
ATOM   1609 O  O     . LYS B 2 53  ? -23.298 -15.963 33.227  1.00 39.83 ? 56  LYS A O     1 
ATOM   1610 C  CB    . LYS B 2 53  ? -24.734 -13.210 33.321  1.00 40.06 ? 56  LYS A CB    1 
ATOM   1611 C  CG    . LYS B 2 53  ? -26.154 -13.499 33.815  1.00 40.21 ? 56  LYS A CG    1 
ATOM   1612 C  CD    . LYS B 2 53  ? -27.239 -12.943 32.904  1.00 40.53 ? 56  LYS A CD    1 
ATOM   1613 C  CE    . LYS B 2 53  ? -27.811 -13.991 31.969  1.00 41.07 ? 56  LYS A CE    1 
ATOM   1614 N  NZ    . LYS B 2 53  ? -28.373 -15.197 32.661  1.00 41.50 ? 56  LYS A NZ    1 
ATOM   1615 N  N     . PRO B 2 54  ? -24.272 -15.933 35.264  1.00 39.90 ? 57  PRO A N     1 
ATOM   1616 C  CA    . PRO B 2 54  ? -24.544 -17.367 35.255  1.00 39.92 ? 57  PRO A CA    1 
ATOM   1617 C  C     . PRO B 2 54  ? -25.790 -17.693 34.429  1.00 39.95 ? 57  PRO A C     1 
ATOM   1618 O  O     . PRO B 2 54  ? -26.686 -16.848 34.313  1.00 39.92 ? 57  PRO A O     1 
ATOM   1619 C  CB    . PRO B 2 54  ? -24.788 -17.685 36.730  1.00 39.80 ? 57  PRO A CB    1 
ATOM   1620 C  CG    . PRO B 2 54  ? -25.303 -16.421 37.311  1.00 39.80 ? 57  PRO A CG    1 
ATOM   1621 C  CD    . PRO B 2 54  ? -24.656 -15.303 36.543  1.00 39.95 ? 57  PRO A CD    1 
ATOM   1622 N  N     . PRO B 2 55  ? -25.844 -18.901 33.838  1.00 39.99 ? 58  PRO A N     1 
ATOM   1623 C  CA    . PRO B 2 55  ? -27.080 -19.334 33.192  1.00 40.01 ? 58  PRO A CA    1 
ATOM   1624 C  C     . PRO B 2 55  ? -28.147 -19.667 34.235  1.00 39.94 ? 58  PRO A C     1 
ATOM   1625 O  O     . PRO B 2 55  ? -27.837 -20.245 35.282  1.00 40.00 ? 58  PRO A O     1 
ATOM   1626 C  CB    . PRO B 2 55  ? -26.655 -20.590 32.423  1.00 40.08 ? 58  PRO A CB    1 
ATOM   1627 C  CG    . PRO B 2 55  ? -25.473 -21.109 33.161  1.00 40.28 ? 58  PRO A CG    1 
ATOM   1628 C  CD    . PRO B 2 55  ? -24.771 -19.908 33.727  1.00 40.09 ? 58  PRO A CD    1 
ATOM   1629 N  N     . GLY B 2 56  ? -29.389 -19.290 33.951  1.00 39.83 ? 59  GLY A N     1 
ATOM   1630 C  CA    . GLY B 2 56  ? -30.496 -19.528 34.872  1.00 39.61 ? 59  GLY A CA    1 
ATOM   1631 C  C     . GLY B 2 56  ? -31.343 -18.284 35.069  1.00 39.43 ? 59  GLY A C     1 
ATOM   1632 O  O     . GLY B 2 56  ? -32.408 -18.161 34.464  1.00 39.51 ? 59  GLY A O     1 
ATOM   1633 N  N     . PRO B 2 57  ? -30.877 -17.352 35.921  1.00 39.22 ? 60  PRO A N     1 
ATOM   1634 C  CA    . PRO B 2 57  ? -31.598 -16.102 36.185  1.00 39.13 ? 60  PRO A CA    1 
ATOM   1635 C  C     . PRO B 2 57  ? -31.638 -15.171 34.974  1.00 39.07 ? 60  PRO A C     1 
ATOM   1636 O  O     . PRO B 2 57  ? -30.770 -15.251 34.103  1.00 38.82 ? 60  PRO A O     1 
ATOM   1637 C  CB    . PRO B 2 57  ? -30.761 -15.448 37.287  1.00 39.08 ? 60  PRO A CB    1 
ATOM   1638 C  CG    . PRO B 2 57  ? -29.391 -15.999 37.091  1.00 39.15 ? 60  PRO A CG    1 
ATOM   1639 C  CD    . PRO B 2 57  ? -29.623 -17.427 36.692  1.00 39.15 ? 60  PRO A CD    1 
ATOM   1640 N  N     . THR B 2 58  ? -32.637 -14.293 34.936  1.00 39.06 ? 61  THR A N     1 
ATOM   1641 C  CA    . THR B 2 58  ? -32.678 -13.221 33.945  1.00 39.16 ? 61  THR A CA    1 
ATOM   1642 C  C     . THR B 2 58  ? -31.592 -12.196 34.273  1.00 39.19 ? 61  THR A C     1 
ATOM   1643 O  O     . THR B 2 58  ? -31.085 -12.159 35.401  1.00 39.05 ? 61  THR A O     1 
ATOM   1644 C  CB    . THR B 2 58  ? -34.055 -12.501 33.908  1.00 39.22 ? 61  THR A CB    1 
ATOM   1645 O  OG1   . THR B 2 58  ? -34.317 -11.890 35.177  1.00 39.40 ? 61  THR A OG1   1 
ATOM   1646 C  CG2   . THR B 2 58  ? -35.185 -13.472 33.566  1.00 39.21 ? 61  THR A CG2   1 
ATOM   1647 N  N     . SER B 2 59  ? -31.235 -11.375 33.287  1.00 39.20 ? 62  SER A N     1 
ATOM   1648 C  CA    . SER B 2 59  ? -30.284 -10.287 33.492  1.00 39.34 ? 62  SER A CA    1 
ATOM   1649 C  C     . SER B 2 59  ? -30.782 -9.304  34.555  1.00 39.38 ? 62  SER A C     1 
ATOM   1650 O  O     . SER B 2 59  ? -29.992 -8.792  35.349  1.00 39.50 ? 62  SER A O     1 
ATOM   1651 C  CB    . SER B 2 59  ? -29.999 -9.562  32.174  1.00 39.29 ? 62  SER A CB    1 
ATOM   1652 O  OG    . SER B 2 59  ? -29.388 -10.440 31.243  1.00 39.51 ? 62  SER A OG    1 
ATOM   1653 N  N     . HIS B 2 60  ? -32.090 -9.063  34.575  1.00 39.37 ? 63  HIS A N     1 
ATOM   1654 C  CA    . HIS B 2 60  ? -32.699 -8.158  35.553  1.00 39.67 ? 63  HIS A CA    1 
ATOM   1655 C  C     . HIS B 2 60  ? -32.711 -8.703  36.990  1.00 39.38 ? 63  HIS A C     1 
ATOM   1656 O  O     . HIS B 2 60  ? -32.601 -7.934  37.941  1.00 39.28 ? 63  HIS A O     1 
ATOM   1657 C  CB    . HIS B 2 60  ? -34.115 -7.756  35.123  1.00 39.89 ? 63  HIS A CB    1 
ATOM   1658 C  CG    . HIS B 2 60  ? -34.633 -6.546  35.834  1.00 41.11 ? 63  HIS A CG    1 
ATOM   1659 N  ND1   . HIS B 2 60  ? -35.804 -6.551  36.562  1.00 42.30 ? 63  HIS A ND1   1 
ATOM   1660 C  CD2   . HIS B 2 60  ? -34.123 -5.297  35.952  1.00 42.26 ? 63  HIS A CD2   1 
ATOM   1661 C  CE1   . HIS B 2 60  ? -35.999 -5.353  37.085  1.00 42.62 ? 63  HIS A CE1   1 
ATOM   1662 N  NE2   . HIS B 2 60  ? -34.993 -4.574  36.732  1.00 43.15 ? 63  HIS A NE2   1 
ATOM   1663 N  N     . GLU B 2 61  ? -32.853 -10.019 37.140  1.00 39.31 ? 64  GLU A N     1 
ATOM   1664 C  CA    . GLU B 2 61  ? -32.745 -10.665 38.454  1.00 39.34 ? 64  GLU A CA    1 
ATOM   1665 C  C     . GLU B 2 61  ? -31.337 -10.531 39.029  1.00 39.03 ? 64  GLU A C     1 
ATOM   1666 O  O     . GLU B 2 61  ? -31.161 -10.251 40.214  1.00 38.99 ? 64  GLU A O     1 
ATOM   1667 C  CB    . GLU B 2 61  ? -33.126 -12.144 38.369  1.00 39.35 ? 64  GLU A CB    1 
ATOM   1668 C  CG    . GLU B 2 61  ? -34.618 -12.413 38.375  1.00 39.67 ? 64  GLU A CG    1 
ATOM   1669 C  CD    . GLU B 2 61  ? -34.946 -13.869 38.109  1.00 39.74 ? 64  GLU A CD    1 
ATOM   1670 O  OE1   . GLU B 2 61  ? -34.665 -14.359 36.994  1.00 40.79 ? 64  GLU A OE1   1 
ATOM   1671 O  OE2   . GLU B 2 61  ? -35.491 -14.524 39.016  1.00 40.57 ? 64  GLU A OE2   1 
ATOM   1672 N  N     . VAL B 2 62  ? -30.342 -10.734 38.173  1.00 39.01 ? 65  VAL A N     1 
ATOM   1673 C  CA    . VAL B 2 62  ? -28.936 -10.643 38.552  1.00 38.84 ? 65  VAL A CA    1 
ATOM   1674 C  C     . VAL B 2 62  ? -28.594 -9.237  39.052  1.00 38.92 ? 65  VAL A C     1 
ATOM   1675 O  O     . VAL B 2 62  ? -27.880 -9.086  40.048  1.00 38.92 ? 65  VAL A O     1 
ATOM   1676 C  CB    . VAL B 2 62  ? -28.024 -11.067 37.373  1.00 38.99 ? 65  VAL A CB    1 
ATOM   1677 C  CG1   . VAL B 2 62  ? -26.578 -10.670 37.615  1.00 38.51 ? 65  VAL A CG1   1 
ATOM   1678 C  CG2   . VAL B 2 62  ? -28.135 -12.575 37.136  1.00 38.64 ? 65  VAL A CG2   1 
ATOM   1679 N  N     . VAL B 2 63  ? -29.132 -8.224  38.372  1.00 38.69 ? 66  VAL A N     1 
ATOM   1680 C  CA    . VAL B 2 63  ? -28.951 -6.827  38.762  1.00 38.78 ? 66  VAL A CA    1 
ATOM   1681 C  C     . VAL B 2 63  ? -29.591 -6.542  40.127  1.00 38.92 ? 66  VAL A C     1 
ATOM   1682 O  O     . VAL B 2 63  ? -29.030 -5.797  40.940  1.00 38.79 ? 66  VAL A O     1 
ATOM   1683 C  CB    . VAL B 2 63  ? -29.490 -5.854  37.672  1.00 38.78 ? 66  VAL A CB    1 
ATOM   1684 C  CG1   . VAL B 2 63  ? -29.526 -4.414  38.179  1.00 38.84 ? 66  VAL A CG1   1 
ATOM   1685 C  CG2   . VAL B 2 63  ? -28.637 -5.938  36.419  1.00 38.48 ? 66  VAL A CG2   1 
ATOM   1686 N  N     . ALA B 2 64  ? -30.757 -7.141  40.368  1.00 39.03 ? 67  ALA A N     1 
ATOM   1687 C  CA    . ALA B 2 64  ? -31.446 -7.018  41.652  1.00 39.43 ? 67  ALA A CA    1 
ATOM   1688 C  C     . ALA B 2 64  ? -30.658 -7.676  42.785  1.00 39.64 ? 67  ALA A C     1 
ATOM   1689 O  O     . ALA B 2 64  ? -30.634 -7.159  43.903  1.00 39.75 ? 67  ALA A O     1 
ATOM   1690 C  CB    . ALA B 2 64  ? -32.856 -7.596  41.567  1.00 39.35 ? 67  ALA A CB    1 
ATOM   1691 N  N     . TRP B 2 65  ? -30.013 -8.807  42.491  1.00 39.89 ? 68  TRP A N     1 
ATOM   1692 C  CA    . TRP B 2 65  ? -29.145 -9.478  43.463  1.00 40.10 ? 68  TRP A CA    1 
ATOM   1693 C  C     . TRP B 2 65  ? -27.963 -8.586  43.848  1.00 40.38 ? 68  TRP A C     1 
ATOM   1694 O  O     . TRP B 2 65  ? -27.624 -8.469  45.026  1.00 40.34 ? 68  TRP A O     1 
ATOM   1695 C  CB    . TRP B 2 65  ? -28.629 -10.819 42.922  1.00 39.84 ? 68  TRP A CB    1 
ATOM   1696 C  CG    . TRP B 2 65  ? -29.679 -11.874 42.690  1.00 39.74 ? 68  TRP A CG    1 
ATOM   1697 C  CD1   . TRP B 2 65  ? -30.963 -11.882 43.161  1.00 39.36 ? 68  TRP A CD1   1 
ATOM   1698 C  CD2   . TRP B 2 65  ? -29.516 -13.096 41.955  1.00 39.38 ? 68  TRP A CD2   1 
ATOM   1699 N  NE1   . TRP B 2 65  ? -31.612 -13.022 42.748  1.00 39.34 ? 68  TRP A NE1   1 
ATOM   1700 C  CE2   . TRP B 2 65  ? -30.747 -13.786 42.010  1.00 39.23 ? 68  TRP A CE2   1 
ATOM   1701 C  CE3   . TRP B 2 65  ? -28.448 -13.671 41.249  1.00 39.24 ? 68  TRP A CE3   1 
ATOM   1702 C  CZ2   . TRP B 2 65  ? -30.944 -15.026 41.388  1.00 39.27 ? 68  TRP A CZ2   1 
ATOM   1703 C  CZ3   . TRP B 2 65  ? -28.643 -14.903 40.630  1.00 39.33 ? 68  TRP A CZ3   1 
ATOM   1704 C  CH2   . TRP B 2 65  ? -29.884 -15.567 40.706  1.00 39.45 ? 68  TRP A CH2   1 
ATOM   1705 N  N     . ILE B 2 66  ? -27.352 -7.962  42.842  1.00 40.80 ? 69  ILE A N     1 
ATOM   1706 C  CA    . ILE B 2 66  ? -26.218 -7.053  43.031  1.00 41.41 ? 69  ILE A CA    1 
ATOM   1707 C  C     . ILE B 2 66  ? -26.589 -5.840  43.898  1.00 41.91 ? 69  ILE A C     1 
ATOM   1708 O  O     . ILE B 2 66  ? -25.849 -5.481  44.816  1.00 41.84 ? 69  ILE A O     1 
ATOM   1709 C  CB    . ILE B 2 66  ? -25.611 -6.615  41.666  1.00 41.25 ? 69  ILE A CB    1 
ATOM   1710 C  CG1   . ILE B 2 66  ? -24.928 -7.810  40.984  1.00 41.35 ? 69  ILE A CG1   1 
ATOM   1711 C  CG2   . ILE B 2 66  ? -24.629 -5.448  41.842  1.00 41.26 ? 69  ILE A CG2   1 
ATOM   1712 C  CD1   . ILE B 2 66  ? -24.572 -7.599  39.512  1.00 41.27 ? 69  ILE A CD1   1 
ATOM   1713 N  N     . LYS B 2 67  ? -27.738 -5.228  43.611  1.00 42.65 ? 70  LYS A N     1 
ATOM   1714 C  CA    . LYS B 2 67  ? -28.225 -4.084  44.389  1.00 43.52 ? 70  LYS A CA    1 
ATOM   1715 C  C     . LYS B 2 67  ? -28.461 -4.434  45.857  1.00 43.97 ? 70  LYS A C     1 
ATOM   1716 O  O     . LYS B 2 67  ? -28.105 -3.662  46.747  1.00 44.10 ? 70  LYS A O     1 
ATOM   1717 C  CB    . LYS B 2 67  ? -29.515 -3.520  43.792  1.00 43.50 ? 70  LYS A CB    1 
ATOM   1718 C  CG    . LYS B 2 67  ? -29.330 -2.777  42.483  1.00 44.26 ? 70  LYS A CG    1 
ATOM   1719 C  CD    . LYS B 2 67  ? -30.426 -1.740  42.275  1.00 45.58 ? 70  LYS A CD    1 
ATOM   1720 C  CE    . LYS B 2 67  ? -31.759 -2.370  41.908  1.00 45.88 ? 70  LYS A CE    1 
ATOM   1721 N  NZ    . LYS B 2 67  ? -32.839 -1.349  41.923  1.00 46.57 ? 70  LYS A NZ    1 
ATOM   1722 N  N     . LYS B 2 68  ? -29.064 -5.597  46.092  1.00 44.45 ? 71  LYS A N     1 
ATOM   1723 C  CA    . LYS B 2 68  ? -29.391 -6.059  47.439  1.00 45.05 ? 71  LYS A CA    1 
ATOM   1724 C  C     . LYS B 2 68  ? -28.139 -6.380  48.257  1.00 45.23 ? 71  LYS A C     1 
ATOM   1725 O  O     . LYS B 2 68  ? -28.045 -6.016  49.430  1.00 45.26 ? 71  LYS A O     1 
ATOM   1726 C  CB    . LYS B 2 68  ? -30.304 -7.288  47.369  1.00 45.08 ? 71  LYS A CB    1 
ATOM   1727 C  CG    . LYS B 2 68  ? -30.812 -7.773  48.721  1.00 45.95 ? 71  LYS A CG    1 
ATOM   1728 C  CD    . LYS B 2 68  ? -31.329 -9.199  48.642  1.00 46.98 ? 71  LYS A CD    1 
ATOM   1729 C  CE    . LYS B 2 68  ? -31.461 -9.819  50.028  1.00 47.84 ? 71  LYS A CE    1 
ATOM   1730 N  NZ    . LYS B 2 68  ? -30.150 -9.880  50.749  1.00 48.42 ? 71  LYS A NZ    1 
ATOM   1731 N  N     . ILE B 2 69  ? -27.182 -7.057  47.627  1.00 45.49 ? 72  ILE A N     1 
ATOM   1732 C  CA    . ILE B 2 69  ? -25.984 -7.531  48.317  1.00 45.81 ? 72  ILE A CA    1 
ATOM   1733 C  C     . ILE B 2 69  ? -24.979 -6.407  48.583  1.00 45.94 ? 72  ILE A C     1 
ATOM   1734 O  O     . ILE B 2 69  ? -24.432 -6.308  49.683  1.00 45.83 ? 72  ILE A O     1 
ATOM   1735 C  CB    . ILE B 2 69  ? -25.338 -8.731  47.569  1.00 45.87 ? 72  ILE A CB    1 
ATOM   1736 C  CG1   . ILE B 2 69  ? -26.229 -9.971  47.719  1.00 46.10 ? 72  ILE A CG1   1 
ATOM   1737 C  CG2   . ILE B 2 69  ? -23.934 -9.021  48.099  1.00 45.92 ? 72  ILE A CG2   1 
ATOM   1738 C  CD1   . ILE B 2 69  ? -26.055 -11.011 46.632  1.00 46.56 ? 72  ILE A CD1   1 
ATOM   1739 N  N     . LEU B 2 70  ? -24.760 -5.552  47.588  1.00 46.19 ? 73  LEU A N     1 
ATOM   1740 C  CA    . LEU B 2 70  ? -23.830 -4.431  47.738  1.00 46.59 ? 73  LEU A CA    1 
ATOM   1741 C  C     . LEU B 2 70  ? -24.488 -3.180  48.335  1.00 46.74 ? 73  LEU A C     1 
ATOM   1742 O  O     . LEU B 2 70  ? -23.847 -2.133  48.436  1.00 46.92 ? 73  LEU A O     1 
ATOM   1743 C  CB    . LEU B 2 70  ? -23.149 -4.097  46.403  1.00 46.49 ? 73  LEU A CB    1 
ATOM   1744 C  CG    . LEU B 2 70  ? -22.492 -5.208  45.572  1.00 46.63 ? 73  LEU A CG    1 
ATOM   1745 C  CD1   . LEU B 2 70  ? -21.868 -4.619  44.316  1.00 46.20 ? 73  LEU A CD1   1 
ATOM   1746 C  CD2   . LEU B 2 70  ? -21.453 -5.998  46.364  1.00 46.77 ? 73  LEU A CD2   1 
ATOM   1747 N  N     . ASN B 2 71  ? -25.755 -3.306  48.738  1.00 47.01 ? 74  ASN A N     1 
ATOM   1748 C  CA    . ASN B 2 71  ? -26.552 -2.201  49.298  1.00 47.32 ? 74  ASN A CA    1 
ATOM   1749 C  C     . ASN B 2 71  ? -26.526 -0.948  48.416  1.00 47.38 ? 74  ASN A C     1 
ATOM   1750 O  O     . ASN B 2 71  ? -26.034 0.111   48.819  1.00 47.46 ? 74  ASN A O     1 
ATOM   1751 C  CB    . ASN B 2 71  ? -26.130 -1.886  50.745  1.00 47.40 ? 74  ASN A CB    1 
ATOM   1752 C  CG    . ASN B 2 71  ? -27.162 -1.045  51.498  1.00 48.00 ? 74  ASN A CG    1 
ATOM   1753 O  OD1   . ASN B 2 71  ? -26.814 -0.056  52.146  1.00 48.95 ? 74  ASN A OD1   1 
ATOM   1754 N  ND2   . ASN B 2 71  ? -28.429 -1.441  51.422  1.00 47.94 ? 74  ASN A ND2   1 
ATOM   1755 N  N     . LEU B 2 72  ? -27.055 -1.089  47.204  1.00 47.42 ? 75  LEU A N     1 
ATOM   1756 C  CA    . LEU B 2 72  ? -27.064 -0.004  46.223  1.00 47.39 ? 75  LEU A CA    1 
ATOM   1757 C  C     . LEU B 2 72  ? -28.491 0.439   45.916  1.00 47.39 ? 75  LEU A C     1 
ATOM   1758 O  O     . LEU B 2 72  ? -29.411 -0.382  45.882  1.00 47.51 ? 75  LEU A O     1 
ATOM   1759 C  CB    . LEU B 2 72  ? -26.355 -0.435  44.930  1.00 47.36 ? 75  LEU A CB    1 
ATOM   1760 C  CG    . LEU B 2 72  ? -24.919 -0.971  45.013  1.00 47.36 ? 75  LEU A CG    1 
ATOM   1761 C  CD1   . LEU B 2 72  ? -24.569 -1.747  43.756  1.00 47.88 ? 75  LEU A CD1   1 
ATOM   1762 C  CD2   . LEU B 2 72  ? -23.895 0.134   45.265  1.00 47.05 ? 75  LEU A CD2   1 
ATOM   1763 N  N     . GLU B 2 73  ? -28.664 1.740   45.695  1.00 47.31 ? 76  GLU A N     1 
ATOM   1764 C  CA    . GLU B 2 73  ? -29.974 2.311   45.392  1.00 47.37 ? 76  GLU A CA    1 
ATOM   1765 C  C     . GLU B 2 73  ? -30.377 2.061   43.941  1.00 46.95 ? 76  GLU A C     1 
ATOM   1766 O  O     . GLU B 2 73  ? -31.550 1.813   43.653  1.00 46.96 ? 76  GLU A O     1 
ATOM   1767 C  CB    . GLU B 2 73  ? -29.995 3.816   45.682  1.00 47.43 ? 76  GLU A CB    1 
ATOM   1768 C  CG    . GLU B 2 73  ? -29.591 4.201   47.100  1.00 48.03 ? 76  GLU A CG    1 
ATOM   1769 C  CD    . GLU B 2 73  ? -29.904 5.650   47.423  1.00 48.22 ? 76  GLU A CD    1 
ATOM   1770 O  OE1   . GLU B 2 73  ? -28.953 6.421   47.678  1.00 49.33 ? 76  GLU A OE1   1 
ATOM   1771 O  OE2   . GLU B 2 73  ? -31.102 6.018   47.420  1.00 49.53 ? 76  GLU A OE2   1 
ATOM   1772 N  N     . LYS B 2 74  ? -29.400 2.140   43.037  1.00 46.50 ? 77  LYS A N     1 
ATOM   1773 C  CA    . LYS B 2 74  ? -29.635 1.963   41.604  1.00 46.04 ? 77  LYS A CA    1 
ATOM   1774 C  C     . LYS B 2 74  ? -28.560 1.123   40.921  1.00 45.47 ? 77  LYS A C     1 
ATOM   1775 O  O     . LYS B 2 74  ? -27.388 1.165   41.301  1.00 45.26 ? 77  LYS A O     1 
ATOM   1776 C  CB    . LYS B 2 74  ? -29.728 3.317   40.892  1.00 46.12 ? 77  LYS A CB    1 
ATOM   1777 C  CG    . LYS B 2 74  ? -31.033 4.073   41.106  1.00 46.73 ? 77  LYS A CG    1 
ATOM   1778 C  CD    . LYS B 2 74  ? -31.688 4.469   39.776  1.00 47.69 ? 77  LYS A CD    1 
ATOM   1779 C  CE    . LYS B 2 74  ? -30.759 5.273   38.864  1.00 47.63 ? 77  LYS A CE    1 
ATOM   1780 N  NZ    . LYS B 2 74  ? -31.311 5.378   37.478  1.00 47.39 ? 77  LYS A NZ    1 
ATOM   1781 N  N     . ALA B 2 75  ? -28.983 0.371   39.906  1.00 45.00 ? 78  ALA A N     1 
ATOM   1782 C  CA    . ALA B 2 75  ? -28.085 -0.350  38.999  1.00 44.56 ? 78  ALA A CA    1 
ATOM   1783 C  C     . ALA B 2 75  ? -28.815 -0.726  37.711  1.00 44.27 ? 78  ALA A C     1 
ATOM   1784 O  O     . ALA B 2 75  ? -30.044 -0.784  37.681  1.00 44.02 ? 78  ALA A O     1 
ATOM   1785 C  CB    . ALA B 2 75  ? -27.499 -1.589  39.668  1.00 44.54 ? 78  ALA A CB    1 
ATOM   1786 N  N     . GLY B 2 76  ? -28.051 -0.966  36.648  1.00 44.06 ? 79  GLY A N     1 
ATOM   1787 C  CA    . GLY B 2 76  ? -28.610 -1.344  35.350  1.00 43.92 ? 79  GLY A CA    1 
ATOM   1788 C  C     . GLY B 2 76  ? -27.629 -2.171  34.543  1.00 43.87 ? 79  GLY A C     1 
ATOM   1789 O  O     . GLY B 2 76  ? -26.426 -2.109  34.784  1.00 43.88 ? 79  GLY A O     1 
ATOM   1790 N  N     . HIS B 2 77  ? -28.143 -2.943  33.588  1.00 43.84 ? 80  HIS A N     1 
ATOM   1791 C  CA    . HIS B 2 77  ? -27.310 -3.829  32.773  1.00 43.96 ? 80  HIS A CA    1 
ATOM   1792 C  C     . HIS B 2 77  ? -27.212 -3.365  31.318  1.00 44.18 ? 80  HIS A C     1 
ATOM   1793 O  O     . HIS B 2 77  ? -28.125 -2.720  30.804  1.00 44.09 ? 80  HIS A O     1 
ATOM   1794 C  CB    . HIS B 2 77  ? -27.800 -5.280  32.858  1.00 43.82 ? 80  HIS A CB    1 
ATOM   1795 C  CG    . HIS B 2 77  ? -29.167 -5.496  32.289  1.00 43.52 ? 80  HIS A CG    1 
ATOM   1796 N  ND1   . HIS B 2 77  ? -29.375 -5.927  30.997  1.00 43.02 ? 80  HIS A ND1   1 
ATOM   1797 C  CD2   . HIS B 2 77  ? -30.395 -5.347  32.838  1.00 43.50 ? 80  HIS A CD2   1 
ATOM   1798 C  CE1   . HIS B 2 77  ? -30.673 -6.030  30.773  1.00 42.99 ? 80  HIS A CE1   1 
ATOM   1799 N  NE2   . HIS B 2 77  ? -31.315 -5.683  31.874  1.00 43.11 ? 80  HIS A NE2   1 
ATOM   1800 N  N     . GLY B 2 78  ? -26.096 -3.697  30.672  1.00 44.39 ? 81  GLY A N     1 
ATOM   1801 C  CA    . GLY B 2 78  ? -25.795 -3.217  29.325  1.00 44.99 ? 81  GLY A CA    1 
ATOM   1802 C  C     . GLY B 2 78  ? -26.023 -4.245  28.230  1.00 45.29 ? 81  GLY A C     1 
ATOM   1803 O  O     . GLY B 2 78  ? -25.076 -4.865  27.740  1.00 45.34 ? 81  GLY A O     1 
ATOM   1804 N  N     . GLY B 2 79  ? -27.284 -4.407  27.840  1.00 45.57 ? 82  GLY A N     1 
ATOM   1805 C  CA    . GLY B 2 79  ? -27.673 -5.379  26.822  1.00 45.74 ? 82  GLY A CA    1 
ATOM   1806 C  C     . GLY B 2 79  ? -28.157 -6.658  27.470  1.00 45.87 ? 82  GLY A C     1 
ATOM   1807 O  O     . GLY B 2 79  ? -27.371 -7.376  28.091  1.00 46.19 ? 82  GLY A O     1 
ATOM   1808 N  N     . THR B 2 80  ? -29.451 -6.939  27.322  1.00 45.98 ? 83  THR A N     1 
ATOM   1809 C  CA    . THR B 2 80  ? -30.083 -8.112  27.934  1.00 46.04 ? 83  THR A CA    1 
ATOM   1810 C  C     . THR B 2 80  ? -29.507 -9.434  27.432  1.00 46.01 ? 83  THR A C     1 
ATOM   1811 O  O     . THR B 2 80  ? -29.500 -9.712  26.230  1.00 45.92 ? 83  THR A O     1 
ATOM   1812 C  CB    . THR B 2 80  ? -31.620 -8.111  27.719  1.00 46.07 ? 83  THR A CB    1 
ATOM   1813 O  OG1   . THR B 2 80  ? -32.175 -6.886  28.211  1.00 46.40 ? 83  THR A OG1   1 
ATOM   1814 C  CG2   . THR B 2 80  ? -32.283 -9.286  28.445  1.00 46.15 ? 83  THR A CG2   1 
ATOM   1815 N  N     . LEU B 2 81  ? -29.014 -10.234 28.372  1.00 45.98 ? 84  LEU A N     1 
ATOM   1816 C  CA    . LEU B 2 81  ? -28.708 -11.628 28.114  1.00 46.03 ? 84  LEU A CA    1 
ATOM   1817 C  C     . LEU B 2 81  ? -29.895 -12.482 28.538  1.00 46.22 ? 84  LEU A C     1 
ATOM   1818 O  O     . LEU B 2 81  ? -30.429 -12.308 29.635  1.00 46.22 ? 84  LEU A O     1 
ATOM   1819 C  CB    . LEU B 2 81  ? -27.455 -12.064 28.874  1.00 45.91 ? 84  LEU A CB    1 
ATOM   1820 C  CG    . LEU B 2 81  ? -26.088 -11.711 28.294  1.00 45.84 ? 84  LEU A CG    1 
ATOM   1821 C  CD1   . LEU B 2 81  ? -24.984 -12.213 29.213  1.00 44.61 ? 84  LEU A CD1   1 
ATOM   1822 C  CD2   . LEU B 2 81  ? -25.938 -12.286 26.891  1.00 45.55 ? 84  LEU A CD2   1 
ATOM   1823 N  N     . ASP B 2 82  ? -30.303 -13.396 27.661  1.00 46.38 ? 85  ASP A N     1 
ATOM   1824 C  CA    . ASP B 2 82  ? -31.389 -14.334 27.947  1.00 46.63 ? 85  ASP A CA    1 
ATOM   1825 C  C     . ASP B 2 82  ? -31.033 -15.262 29.118  1.00 46.45 ? 85  ASP A C     1 
ATOM   1826 O  O     . ASP B 2 82  ? -29.853 -15.516 29.357  1.00 46.57 ? 85  ASP A O     1 
ATOM   1827 C  CB    . ASP B 2 82  ? -31.733 -15.138 26.688  1.00 46.92 ? 85  ASP A CB    1 
ATOM   1828 C  CG    . ASP B 2 82  ? -32.444 -14.302 25.629  1.00 48.01 ? 85  ASP A CG    1 
ATOM   1829 O  OD1   . ASP B 2 82  ? -32.437 -14.714 24.450  1.00 49.48 ? 85  ASP A OD1   1 
ATOM   1830 O  OD2   . ASP B 2 82  ? -33.013 -13.239 25.967  1.00 49.20 ? 85  ASP A OD2   1 
ATOM   1831 N  N     . PRO B 2 83  ? -32.051 -15.758 29.857  1.00 46.32 ? 86  PRO A N     1 
ATOM   1832 C  CA    . PRO B 2 83  ? -31.849 -16.544 31.083  1.00 46.19 ? 86  PRO A CA    1 
ATOM   1833 C  C     . PRO B 2 83  ? -30.826 -17.682 30.975  1.00 46.12 ? 86  PRO A C     1 
ATOM   1834 O  O     . PRO B 2 83  ? -29.980 -17.824 31.858  1.00 46.06 ? 86  PRO A O     1 
ATOM   1835 C  CB    . PRO B 2 83  ? -33.244 -17.118 31.360  1.00 46.18 ? 86  PRO A CB    1 
ATOM   1836 C  CG    . PRO B 2 83  ? -34.168 -16.126 30.788  1.00 46.31 ? 86  PRO A CG    1 
ATOM   1837 C  CD    . PRO B 2 83  ? -33.488 -15.587 29.562  1.00 46.31 ? 86  PRO A CD    1 
ATOM   1838 N  N     . LYS B 2 84  ? -30.904 -18.476 29.908  1.00 46.01 ? 87  LYS A N     1 
ATOM   1839 C  CA    . LYS B 2 84  ? -30.046 -19.656 29.749  1.00 46.02 ? 87  LYS A CA    1 
ATOM   1840 C  C     . LYS B 2 84  ? -28.637 -19.300 29.280  1.00 45.60 ? 87  LYS A C     1 
ATOM   1841 O  O     . LYS B 2 84  ? -27.762 -20.169 29.199  1.00 45.60 ? 87  LYS A O     1 
ATOM   1842 C  CB    . LYS B 2 84  ? -30.676 -20.655 28.773  1.00 46.03 ? 87  LYS A CB    1 
ATOM   1843 C  CG    . LYS B 2 84  ? -31.894 -21.400 29.309  1.00 46.34 ? 87  LYS A CG    1 
ATOM   1844 C  CD    . LYS B 2 84  ? -32.470 -22.357 28.259  1.00 46.84 ? 87  LYS A CD    1 
ATOM   1845 C  CE    . LYS B 2 84  ? -31.575 -23.581 28.038  1.00 48.53 ? 87  LYS A CE    1 
ATOM   1846 N  NZ    . LYS B 2 84  ? -31.946 -24.346 26.805  1.00 49.68 ? 87  LYS A NZ    1 
ATOM   1847 N  N     . VAL B 2 85  ? -28.425 -18.020 28.982  1.00 45.12 ? 88  VAL A N     1 
ATOM   1848 C  CA    . VAL B 2 85  ? -27.178 -17.549 28.388  1.00 44.60 ? 88  VAL A CA    1 
ATOM   1849 C  C     . VAL B 2 85  ? -26.231 -17.001 29.457  1.00 44.33 ? 88  VAL A C     1 
ATOM   1850 O  O     . VAL B 2 85  ? -26.640 -16.224 30.324  1.00 44.19 ? 88  VAL A O     1 
ATOM   1851 C  CB    . VAL B 2 85  ? -27.454 -16.481 27.291  1.00 44.66 ? 88  VAL A CB    1 
ATOM   1852 C  CG1   . VAL B 2 85  ? -26.160 -16.039 26.606  1.00 44.48 ? 88  VAL A CG1   1 
ATOM   1853 C  CG2   . VAL B 2 85  ? -28.441 -17.025 26.259  1.00 44.36 ? 88  VAL A CG2   1 
ATOM   1854 N  N     . SER B 2 86  ? -24.971 -17.427 29.390  1.00 43.86 ? 89  SER A N     1 
ATOM   1855 C  CA    . SER B 2 86  ? -23.926 -16.925 30.277  1.00 43.36 ? 89  SER A CA    1 
ATOM   1856 C  C     . SER B 2 86  ? -23.072 -15.855 29.588  1.00 43.16 ? 89  SER A C     1 
ATOM   1857 O  O     . SER B 2 86  ? -23.216 -15.601 28.387  1.00 43.08 ? 89  SER A O     1 
ATOM   1858 C  CB    . SER B 2 86  ? -23.044 -18.079 30.768  1.00 43.33 ? 89  SER A CB    1 
ATOM   1859 O  OG    . SER B 2 86  ? -22.121 -18.488 29.771  1.00 43.44 ? 89  SER A OG    1 
ATOM   1860 N  N     . GLY B 2 87  ? -22.195 -15.218 30.358  1.00 42.76 ? 90  GLY A N     1 
ATOM   1861 C  CA    . GLY B 2 87  ? -21.191 -14.334 29.788  1.00 42.25 ? 90  GLY A CA    1 
ATOM   1862 C  C     . GLY B 2 87  ? -21.292 -12.861 30.127  1.00 41.93 ? 90  GLY A C     1 
ATOM   1863 O  O     . GLY B 2 87  ? -21.973 -12.465 31.077  1.00 41.61 ? 90  GLY A O     1 
ATOM   1864 N  N     . VAL B 2 88  ? -20.604 -12.057 29.320  1.00 41.75 ? 91  VAL A N     1 
ATOM   1865 C  CA    . VAL B 2 88  ? -20.398 -10.633 29.579  1.00 41.60 ? 91  VAL A CA    1 
ATOM   1866 C  C     . VAL B 2 88  ? -21.707 -9.870  29.783  1.00 41.44 ? 91  VAL A C     1 
ATOM   1867 O  O     . VAL B 2 88  ? -22.516 -9.733  28.865  1.00 41.52 ? 91  VAL A O     1 
ATOM   1868 C  CB    . VAL B 2 88  ? -19.554 -9.967  28.460  1.00 41.64 ? 91  VAL A CB    1 
ATOM   1869 C  CG1   . VAL B 2 88  ? -19.352 -8.478  28.740  1.00 41.77 ? 91  VAL A CG1   1 
ATOM   1870 C  CG2   . VAL B 2 88  ? -18.209 -10.663 28.318  1.00 41.50 ? 91  VAL A CG2   1 
ATOM   1871 N  N     . LEU B 2 89  ? -21.903 -9.393  31.008  1.00 41.06 ? 92  LEU A N     1 
ATOM   1872 C  CA    . LEU B 2 89  ? -23.022 -8.523  31.328  1.00 40.77 ? 92  LEU A CA    1 
ATOM   1873 C  C     . LEU B 2 89  ? -22.521 -7.315  32.119  1.00 40.61 ? 92  LEU A C     1 
ATOM   1874 O  O     . LEU B 2 89  ? -22.260 -7.418  33.323  1.00 40.55 ? 92  LEU A O     1 
ATOM   1875 C  CB    . LEU B 2 89  ? -24.107 -9.278  32.110  1.00 40.67 ? 92  LEU A CB    1 
ATOM   1876 C  CG    . LEU B 2 89  ? -25.366 -8.479  32.472  1.00 40.58 ? 92  LEU A CG    1 
ATOM   1877 C  CD1   . LEU B 2 89  ? -26.270 -8.274  31.259  1.00 40.29 ? 92  LEU A CD1   1 
ATOM   1878 C  CD2   . LEU B 2 89  ? -26.124 -9.149  33.611  1.00 40.52 ? 92  LEU A CD2   1 
ATOM   1879 N  N     . PRO B 2 90  ? -22.362 -6.167  31.438  1.00 40.38 ? 93  PRO A N     1 
ATOM   1880 C  CA    . PRO B 2 90  ? -21.983 -4.946  32.142  1.00 40.23 ? 93  PRO A CA    1 
ATOM   1881 C  C     . PRO B 2 90  ? -23.101 -4.507  33.082  1.00 40.14 ? 93  PRO A C     1 
ATOM   1882 O  O     . PRO B 2 90  ? -24.251 -4.389  32.662  1.00 40.22 ? 93  PRO A O     1 
ATOM   1883 C  CB    . PRO B 2 90  ? -21.789 -3.930  31.008  1.00 40.27 ? 93  PRO A CB    1 
ATOM   1884 C  CG    . PRO B 2 90  ? -21.611 -4.760  29.770  1.00 39.99 ? 93  PRO A CG    1 
ATOM   1885 C  CD    . PRO B 2 90  ? -22.500 -5.937  29.990  1.00 40.32 ? 93  PRO A CD    1 
ATOM   1886 N  N     . VAL B 2 91  ? -22.768 -4.316  34.354  1.00 39.95 ? 94  VAL A N     1 
ATOM   1887 C  CA    . VAL B 2 91  ? -23.738 -3.848  35.339  1.00 39.65 ? 94  VAL A CA    1 
ATOM   1888 C  C     . VAL B 2 91  ? -23.260 -2.508  35.894  1.00 39.72 ? 94  VAL A C     1 
ATOM   1889 O  O     . VAL B 2 91  ? -22.373 -2.455  36.750  1.00 39.63 ? 94  VAL A O     1 
ATOM   1890 C  CB    . VAL B 2 91  ? -23.986 -4.885  36.479  1.00 39.71 ? 94  VAL A CB    1 
ATOM   1891 C  CG1   . VAL B 2 91  ? -24.989 -4.345  37.498  1.00 39.30 ? 94  VAL A CG1   1 
ATOM   1892 C  CG2   . VAL B 2 91  ? -24.477 -6.226  35.907  1.00 39.16 ? 94  VAL A CG2   1 
ATOM   1893 N  N     . ALA B 2 92  ? -23.842 -1.432  35.369  1.00 39.64 ? 95  ALA A N     1 
ATOM   1894 C  CA    . ALA B 2 92  ? -23.520 -0.077  35.794  1.00 39.69 ? 95  ALA A CA    1 
ATOM   1895 C  C     . ALA B 2 92  ? -24.220 0.234   37.112  1.00 39.76 ? 95  ALA A C     1 
ATOM   1896 O  O     . ALA B 2 92  ? -25.361 -0.182  37.334  1.00 39.78 ? 95  ALA A O     1 
ATOM   1897 C  CB    . ALA B 2 92  ? -23.922 0.922   34.720  1.00 39.68 ? 95  ALA A CB    1 
ATOM   1898 N  N     . LEU B 2 93  ? -23.532 0.968   37.982  1.00 39.71 ? 96  LEU A N     1 
ATOM   1899 C  CA    . LEU B 2 93  ? -23.997 1.170   39.353  1.00 39.64 ? 96  LEU A CA    1 
ATOM   1900 C  C     . LEU B 2 93  ? -24.301 2.627   39.660  1.00 39.76 ? 96  LEU A C     1 
ATOM   1901 O  O     . LEU B 2 93  ? -23.645 3.528   39.139  1.00 39.57 ? 96  LEU A O     1 
ATOM   1902 C  CB    . LEU B 2 93  ? -22.955 0.655   40.351  1.00 39.43 ? 96  LEU A CB    1 
ATOM   1903 C  CG    . LEU B 2 93  ? -22.322 -0.724  40.143  1.00 39.76 ? 96  LEU A CG    1 
ATOM   1904 C  CD1   . LEU B 2 93  ? -21.211 -0.947  41.163  1.00 39.81 ? 96  LEU A CD1   1 
ATOM   1905 C  CD2   . LEU B 2 93  ? -23.357 -1.851  40.209  1.00 38.94 ? 96  LEU A CD2   1 
ATOM   1906 N  N     . GLU B 2 94  ? -25.306 2.837   40.510  1.00 39.99 ? 97  GLU A N     1 
ATOM   1907 C  CA    . GLU B 2 94  ? -25.621 4.146   41.096  1.00 40.24 ? 97  GLU A CA    1 
ATOM   1908 C  C     . GLU B 2 94  ? -25.688 5.290   40.078  1.00 40.14 ? 97  GLU A C     1 
ATOM   1909 O  O     . GLU B 2 94  ? -26.556 5.286   39.206  1.00 40.06 ? 97  GLU A O     1 
ATOM   1910 C  CB    . GLU B 2 94  ? -24.656 4.466   42.249  1.00 40.45 ? 97  GLU A CB    1 
ATOM   1911 C  CG    . GLU B 2 94  ? -24.641 3.424   43.379  1.00 41.52 ? 97  GLU A CG    1 
ATOM   1912 C  CD    . GLU B 2 94  ? -25.841 3.530   44.317  1.00 43.03 ? 97  GLU A CD    1 
ATOM   1913 O  OE1   . GLU B 2 94  ? -26.994 3.408   43.851  1.00 43.51 ? 97  GLU A OE1   1 
ATOM   1914 O  OE2   . GLU B 2 94  ? -25.629 3.722   45.534  1.00 44.60 ? 97  GLU A OE2   1 
ATOM   1915 N  N     . LYS B 2 95  ? -24.774 6.256   40.191  1.00 40.03 ? 98  LYS A N     1 
ATOM   1916 C  CA    . LYS B 2 95  ? -24.751 7.436   39.316  1.00 39.99 ? 98  LYS A CA    1 
ATOM   1917 C  C     . LYS B 2 95  ? -24.384 7.096   37.869  1.00 39.81 ? 98  LYS A C     1 
ATOM   1918 O  O     . LYS B 2 95  ? -24.686 7.862   36.952  1.00 39.71 ? 98  LYS A O     1 
ATOM   1919 C  CB    . LYS B 2 95  ? -23.785 8.501   39.856  1.00 40.05 ? 98  LYS A CB    1 
ATOM   1920 C  CG    . LYS B 2 95  ? -24.116 9.047   41.247  1.00 41.08 ? 98  LYS A CG    1 
ATOM   1921 C  CD    . LYS B 2 95  ? -25.210 10.103  41.204  1.00 42.22 ? 98  LYS A CD    1 
ATOM   1922 C  CE    . LYS B 2 95  ? -25.529 10.633  42.594  1.00 43.32 ? 98  LYS A CE    1 
ATOM   1923 N  NZ    . LYS B 2 95  ? -24.464 11.533  43.122  1.00 44.18 ? 98  LYS A NZ    1 
ATOM   1924 N  N     . ALA B 2 96  ? -23.728 5.952   37.679  1.00 39.60 ? 99  ALA A N     1 
ATOM   1925 C  CA    . ALA B 2 96  ? -23.350 5.473   36.349  1.00 39.56 ? 99  ALA A CA    1 
ATOM   1926 C  C     . ALA B 2 96  ? -24.461 4.677   35.658  1.00 39.54 ? 99  ALA A C     1 
ATOM   1927 O  O     . ALA B 2 96  ? -24.386 4.431   34.456  1.00 39.43 ? 99  ALA A O     1 
ATOM   1928 C  CB    . ALA B 2 96  ? -22.066 4.637   36.427  1.00 39.19 ? 99  ALA A CB    1 
ATOM   1929 N  N     . THR B 2 97  ? -25.487 4.287   36.416  1.00 39.67 ? 100 THR A N     1 
ATOM   1930 C  CA    . THR B 2 97  ? -26.549 3.391   35.926  1.00 39.89 ? 100 THR A CA    1 
ATOM   1931 C  C     . THR B 2 97  ? -26.933 3.605   34.453  1.00 40.10 ? 100 THR A C     1 
ATOM   1932 O  O     . THR B 2 97  ? -26.975 2.651   33.672  1.00 40.21 ? 100 THR A O     1 
ATOM   1933 C  CB    . THR B 2 97  ? -27.810 3.450   36.832  1.00 39.95 ? 100 THR A CB    1 
ATOM   1934 O  OG1   . THR B 2 97  ? -27.468 3.018   38.154  1.00 39.75 ? 100 THR A OG1   1 
ATOM   1935 C  CG2   . THR B 2 97  ? -28.930 2.554   36.290  1.00 39.93 ? 100 THR A CG2   1 
ATOM   1936 N  N     . ARG B 2 98  ? -27.179 4.857   34.080  1.00 40.37 ? 101 ARG A N     1 
ATOM   1937 C  CA    . ARG B 2 98  ? -27.666 5.191   32.742  1.00 40.75 ? 101 ARG A CA    1 
ATOM   1938 C  C     . ARG B 2 98  ? -26.645 5.066   31.597  1.00 41.26 ? 101 ARG A C     1 
ATOM   1939 O  O     . ARG B 2 98  ? -27.032 5.189   30.435  1.00 41.38 ? 101 ARG A O     1 
ATOM   1940 C  CB    . ARG B 2 98  ? -28.307 6.582   32.736  1.00 40.67 ? 101 ARG A CB    1 
ATOM   1941 C  CG    . ARG B 2 98  ? -29.572 6.697   33.579  1.00 40.15 ? 101 ARG A CG    1 
ATOM   1942 C  CD    . ARG B 2 98  ? -30.027 8.145   33.680  1.00 39.48 ? 101 ARG A CD    1 
ATOM   1943 N  NE    . ARG B 2 98  ? -28.985 9.005   34.241  1.00 38.94 ? 101 ARG A NE    1 
ATOM   1944 C  CZ    . ARG B 2 98  ? -28.805 10.283  33.918  1.00 37.98 ? 101 ARG A CZ    1 
ATOM   1945 N  NH1   . ARG B 2 98  ? -29.593 10.870  33.027  1.00 37.64 ? 101 ARG A NH1   1 
ATOM   1946 N  NH2   . ARG B 2 98  ? -27.826 10.973  34.483  1.00 37.75 ? 101 ARG A NH2   1 
ATOM   1947 N  N     . VAL B 2 99  ? -25.363 4.832   31.905  1.00 41.81 ? 102 VAL A N     1 
ATOM   1948 C  CA    . VAL B 2 99  ? -24.339 4.656   30.848  1.00 42.54 ? 102 VAL A CA    1 
ATOM   1949 C  C     . VAL B 2 99  ? -24.593 3.430   29.963  1.00 42.96 ? 102 VAL A C     1 
ATOM   1950 O  O     . VAL B 2 99  ? -24.052 3.340   28.858  1.00 43.04 ? 102 VAL A O     1 
ATOM   1951 C  CB    . VAL B 2 99  ? -22.858 4.605   31.373  1.00 42.45 ? 102 VAL A CB    1 
ATOM   1952 C  CG1   . VAL B 2 99  ? -22.480 5.874   32.109  1.00 43.24 ? 102 VAL A CG1   1 
ATOM   1953 C  CG2   . VAL B 2 99  ? -22.596 3.369   32.230  1.00 42.10 ? 102 VAL A CG2   1 
ATOM   1954 N  N     . VAL B 2 100 ? -25.412 2.500   30.458  1.00 43.58 ? 103 VAL A N     1 
ATOM   1955 C  CA    . VAL B 2 100 ? -25.803 1.294   29.714  1.00 44.16 ? 103 VAL A CA    1 
ATOM   1956 C  C     . VAL B 2 100 ? -26.474 1.618   28.377  1.00 44.68 ? 103 VAL A C     1 
ATOM   1957 O  O     . VAL B 2 100 ? -26.495 0.786   27.474  1.00 44.95 ? 103 VAL A O     1 
ATOM   1958 C  CB    . VAL B 2 100 ? -26.728 0.351   30.548  1.00 44.04 ? 103 VAL A CB    1 
ATOM   1959 C  CG1   . VAL B 2 100 ? -26.026 -0.120  31.806  1.00 44.03 ? 103 VAL A CG1   1 
ATOM   1960 C  CG2   . VAL B 2 100 ? -28.062 1.026   30.892  1.00 44.37 ? 103 VAL A CG2   1 
ATOM   1961 N  N     . GLN B 2 101 ? -27.012 2.832   28.270  1.00 45.43 ? 104 GLN A N     1 
ATOM   1962 C  CA    . GLN B 2 101 ? -27.645 3.330   27.051  1.00 46.20 ? 104 GLN A CA    1 
ATOM   1963 C  C     . GLN B 2 101 ? -26.656 3.375   25.881  1.00 46.46 ? 104 GLN A C     1 
ATOM   1964 O  O     . GLN B 2 101 ? -27.050 3.244   24.721  1.00 46.48 ? 104 GLN A O     1 
ATOM   1965 C  CB    . GLN B 2 101 ? -28.249 4.714   27.320  1.00 46.32 ? 104 GLN A CB    1 
ATOM   1966 C  CG    . GLN B 2 101 ? -29.098 5.305   26.196  1.00 47.50 ? 104 GLN A CG    1 
ATOM   1967 C  CD    . GLN B 2 101 ? -28.381 6.403   25.425  1.00 48.91 ? 104 GLN A CD    1 
ATOM   1968 O  OE1   . GLN B 2 101 ? -27.230 6.243   25.010  1.00 50.03 ? 104 GLN A OE1   1 
ATOM   1969 N  NE2   . GLN B 2 101 ? -29.063 7.525   25.226  1.00 48.69 ? 104 GLN A NE2   1 
ATOM   1970 N  N     . ALA B 2 102 ? -25.376 3.563   26.199  1.00 46.77 ? 105 ALA A N     1 
ATOM   1971 C  CA    . ALA B 2 102 ? -24.307 3.522   25.204  1.00 47.08 ? 105 ALA A CA    1 
ATOM   1972 C  C     . ALA B 2 102 ? -23.960 2.084   24.797  1.00 47.28 ? 105 ALA A C     1 
ATOM   1973 O  O     . ALA B 2 102 ? -23.308 1.864   23.777  1.00 47.41 ? 105 ALA A O     1 
ATOM   1974 C  CB    . ALA B 2 102 ? -23.073 4.240   25.731  1.00 46.95 ? 105 ALA A CB    1 
ATOM   1975 N  N     . LEU B 2 103 ? -24.410 1.117   25.594  1.00 47.62 ? 106 LEU A N     1 
ATOM   1976 C  CA    . LEU B 2 103 ? -24.089 -0.301  25.392  1.00 47.93 ? 106 LEU A CA    1 
ATOM   1977 C  C     . LEU B 2 103 ? -25.170 -1.083  24.643  1.00 48.15 ? 106 LEU A C     1 
ATOM   1978 O  O     . LEU B 2 103 ? -24.875 -2.095  24.002  1.00 48.32 ? 106 LEU A O     1 
ATOM   1979 C  CB    . LEU B 2 103 ? -23.799 -0.971  26.739  1.00 47.82 ? 106 LEU A CB    1 
ATOM   1980 C  CG    . LEU B 2 103 ? -22.372 -1.055  27.297  1.00 48.01 ? 106 LEU A CG    1 
ATOM   1981 C  CD1   . LEU B 2 103 ? -21.412 -0.038  26.701  1.00 48.18 ? 106 LEU A CD1   1 
ATOM   1982 C  CD2   . LEU B 2 103 ? -22.403 -0.936  28.815  1.00 48.12 ? 106 LEU A CD2   1 
ATOM   1983 N  N     . LEU B 2 104 ? -26.413 -0.615  24.729  1.00 48.39 ? 107 LEU A N     1 
ATOM   1984 C  CA    . LEU B 2 104 ? -27.537 -1.240  24.019  1.00 48.65 ? 107 LEU A CA    1 
ATOM   1985 C  C     . LEU B 2 104 ? -27.353 -1.363  22.492  1.00 48.50 ? 107 LEU A C     1 
ATOM   1986 O  O     . LEU B 2 104 ? -27.637 -2.425  21.930  1.00 48.65 ? 107 LEU A O     1 
ATOM   1987 C  CB    . LEU B 2 104 ? -28.865 -0.541  24.352  1.00 48.72 ? 107 LEU A CB    1 
ATOM   1988 C  CG    . LEU B 2 104 ? -29.724 -1.088  25.500  1.00 48.93 ? 107 LEU A CG    1 
ATOM   1989 C  CD1   . LEU B 2 104 ? -29.048 -0.936  26.853  1.00 49.00 ? 107 LEU A CD1   1 
ATOM   1990 C  CD2   . LEU B 2 104 ? -31.074 -0.384  25.507  1.00 48.96 ? 107 LEU A CD2   1 
ATOM   1991 N  N     . PRO B 2 105 ? -26.882 -0.289  21.818  1.00 48.29 ? 108 PRO A N     1 
ATOM   1992 C  CA    . PRO B 2 105 ? -26.698 -0.389  20.371  1.00 48.08 ? 108 PRO A CA    1 
ATOM   1993 C  C     . PRO B 2 105 ? -25.302 -0.867  19.936  1.00 47.90 ? 108 PRO A C     1 
ATOM   1994 O  O     . PRO B 2 105 ? -24.993 -0.855  18.741  1.00 47.93 ? 108 PRO A O     1 
ATOM   1995 C  CB    . PRO B 2 105 ? -26.942 1.047   19.899  1.00 48.10 ? 108 PRO A CB    1 
ATOM   1996 C  CG    . PRO B 2 105 ? -26.547 1.908   21.064  1.00 48.16 ? 108 PRO A CG    1 
ATOM   1997 C  CD    . PRO B 2 105 ? -26.518 1.054   22.308  1.00 48.21 ? 108 PRO A CD    1 
ATOM   1998 N  N     . ALA B 2 106 ? -24.480 -1.292  20.893  1.00 47.67 ? 109 ALA A N     1 
ATOM   1999 C  CA    . ALA B 2 106 ? -23.111 -1.724  20.611  1.00 47.52 ? 109 ALA A CA    1 
ATOM   2000 C  C     . ALA B 2 106 ? -23.048 -3.125  19.991  1.00 47.41 ? 109 ALA A C     1 
ATOM   2001 O  O     . ALA B 2 106 ? -23.962 -3.932  20.164  1.00 47.21 ? 109 ALA A O     1 
ATOM   2002 C  CB    . ALA B 2 106 ? -22.269 -1.663  21.877  1.00 47.45 ? 109 ALA A CB    1 
ATOM   2003 N  N     . GLY B 2 107 ? -21.962 -3.400  19.270  1.00 47.35 ? 110 GLY A N     1 
ATOM   2004 C  CA    . GLY B 2 107 ? -21.727 -4.714  18.674  1.00 47.38 ? 110 GLY A CA    1 
ATOM   2005 C  C     . GLY B 2 107 ? -21.450 -5.775  19.723  1.00 47.40 ? 110 GLY A C     1 
ATOM   2006 O  O     . GLY B 2 107 ? -20.776 -5.512  20.723  1.00 47.52 ? 110 GLY A O     1 
ATOM   2007 N  N     . LYS B 2 108 ? -21.978 -6.974  19.496  1.00 47.24 ? 111 LYS A N     1 
ATOM   2008 C  CA    . LYS B 2 108 ? -21.829 -8.079  20.441  1.00 47.18 ? 111 LYS A CA    1 
ATOM   2009 C  C     . LYS B 2 108 ? -21.032 -9.225  19.832  1.00 47.02 ? 111 LYS A C     1 
ATOM   2010 O  O     . LYS B 2 108 ? -21.035 -9.419  18.613  1.00 47.13 ? 111 LYS A O     1 
ATOM   2011 C  CB    . LYS B 2 108 ? -23.200 -8.596  20.904  1.00 47.17 ? 111 LYS A CB    1 
ATOM   2012 C  CG    . LYS B 2 108 ? -24.204 -7.525  21.336  1.00 47.43 ? 111 LYS A CG    1 
ATOM   2013 C  CD    . LYS B 2 108 ? -23.830 -6.872  22.664  1.00 47.85 ? 111 LYS A CD    1 
ATOM   2014 C  CE    . LYS B 2 108 ? -24.972 -6.020  23.212  1.00 48.03 ? 111 LYS A CE    1 
ATOM   2015 N  NZ    . LYS B 2 108 ? -25.297 -4.848  22.348  1.00 48.23 ? 111 LYS A NZ    1 
ATOM   2016 N  N     . GLU B 2 109 ? -20.344 -9.977  20.686  1.00 46.71 ? 112 GLU A N     1 
ATOM   2017 C  CA    . GLU B 2 109 ? -19.693 -11.213 20.270  1.00 46.54 ? 112 GLU A CA    1 
ATOM   2018 C  C     . GLU B 2 109 ? -20.202 -12.379 21.108  1.00 45.92 ? 112 GLU A C     1 
ATOM   2019 O  O     . GLU B 2 109 ? -20.464 -12.229 22.304  1.00 45.75 ? 112 GLU A O     1 
ATOM   2020 C  CB    . GLU B 2 109 ? -18.173 -11.104 20.375  1.00 46.56 ? 112 GLU A CB    1 
ATOM   2021 C  CG    . GLU B 2 109 ? -17.411 -12.178 19.604  1.00 47.11 ? 112 GLU A CG    1 
ATOM   2022 C  CD    . GLU B 2 109 ? -15.932 -12.199 19.939  1.00 47.46 ? 112 GLU A CD    1 
ATOM   2023 O  OE1   . GLU B 2 109 ? -15.589 -12.379 21.128  1.00 49.16 ? 112 GLU A OE1   1 
ATOM   2024 O  OE2   . GLU B 2 109 ? -15.110 -12.046 19.009  1.00 48.82 ? 112 GLU A OE2   1 
ATOM   2025 N  N     . TYR B 2 110 ? -20.346 -13.534 20.464  1.00 45.32 ? 113 TYR A N     1 
ATOM   2026 C  CA    . TYR B 2 110 ? -20.819 -14.745 21.123  1.00 44.59 ? 113 TYR A CA    1 
ATOM   2027 C  C     . TYR B 2 110 ? -19.979 -15.949 20.729  1.00 44.06 ? 113 TYR A C     1 
ATOM   2028 O  O     . TYR B 2 110 ? -19.380 -15.979 19.653  1.00 43.88 ? 113 TYR A O     1 
ATOM   2029 C  CB    . TYR B 2 110 ? -22.271 -15.043 20.738  1.00 44.76 ? 113 TYR A CB    1 
ATOM   2030 C  CG    . TYR B 2 110 ? -23.298 -14.006 21.133  1.00 44.92 ? 113 TYR A CG    1 
ATOM   2031 C  CD1   . TYR B 2 110 ? -23.615 -12.952 20.278  1.00 45.28 ? 113 TYR A CD1   1 
ATOM   2032 C  CD2   . TYR B 2 110 ? -23.983 -14.101 22.343  1.00 45.07 ? 113 TYR A CD2   1 
ATOM   2033 C  CE1   . TYR B 2 110 ? -24.570 -12.006 20.627  1.00 45.40 ? 113 TYR A CE1   1 
ATOM   2034 C  CE2   . TYR B 2 110 ? -24.943 -13.162 22.701  1.00 45.19 ? 113 TYR A CE2   1 
ATOM   2035 C  CZ    . TYR B 2 110 ? -25.231 -12.117 21.838  1.00 45.31 ? 113 TYR A CZ    1 
ATOM   2036 O  OH    . TYR B 2 110 ? -26.181 -11.183 22.185  1.00 45.57 ? 113 TYR A OH    1 
ATOM   2037 N  N     . VAL B 2 111 ? -19.938 -16.934 21.620  1.00 43.45 ? 114 VAL A N     1 
ATOM   2038 C  CA    . VAL B 2 111 ? -19.541 -18.288 21.271  1.00 42.88 ? 114 VAL A CA    1 
ATOM   2039 C  C     . VAL B 2 111 ? -20.805 -19.136 21.393  1.00 42.62 ? 114 VAL A C     1 
ATOM   2040 O  O     . VAL B 2 111 ? -21.466 -19.131 22.434  1.00 42.45 ? 114 VAL A O     1 
ATOM   2041 C  CB    . VAL B 2 111 ? -18.405 -18.821 22.180  1.00 42.92 ? 114 VAL A CB    1 
ATOM   2042 C  CG1   . VAL B 2 111 ? -18.143 -20.303 21.925  1.00 42.36 ? 114 VAL A CG1   1 
ATOM   2043 C  CG2   . VAL B 2 111 ? -17.132 -18.020 21.956  1.00 43.00 ? 114 VAL A CG2   1 
ATOM   2044 N  N     . ALA B 2 112 ? -21.143 -19.838 20.316  1.00 42.26 ? 115 ALA A N     1 
ATOM   2045 C  CA    . ALA B 2 112 ? -22.384 -20.598 20.241  1.00 41.99 ? 115 ALA A CA    1 
ATOM   2046 C  C     . ALA B 2 112 ? -22.133 -22.040 19.827  1.00 41.89 ? 115 ALA A C     1 
ATOM   2047 O  O     . ALA B 2 112 ? -21.182 -22.331 19.093  1.00 41.80 ? 115 ALA A O     1 
ATOM   2048 C  CB    . ALA B 2 112 ? -23.348 -19.931 19.266  1.00 41.90 ? 115 ALA A CB    1 
ATOM   2049 N  N     . LEU B 2 113 ? -22.987 -22.939 20.308  1.00 41.70 ? 116 LEU A N     1 
ATOM   2050 C  CA    . LEU B 2 113 ? -22.966 -24.327 19.870  1.00 41.72 ? 116 LEU A CA    1 
ATOM   2051 C  C     . LEU B 2 113 ? -24.231 -24.634 19.076  1.00 41.76 ? 116 LEU A C     1 
ATOM   2052 O  O     . LEU B 2 113 ? -25.343 -24.549 19.598  1.00 41.83 ? 116 LEU A O     1 
ATOM   2053 C  CB    . LEU B 2 113 ? -22.801 -25.290 21.059  1.00 41.60 ? 116 LEU A CB    1 
ATOM   2054 C  CG    . LEU B 2 113 ? -22.562 -26.781 20.769  1.00 41.56 ? 116 LEU A CG    1 
ATOM   2055 C  CD1   . LEU B 2 113 ? -21.378 -27.017 19.827  1.00 41.05 ? 116 LEU A CD1   1 
ATOM   2056 C  CD2   . LEU B 2 113 ? -22.372 -27.559 22.065  1.00 41.47 ? 116 LEU A CD2   1 
ATOM   2057 N  N     . MET B 2 114 ? -24.039 -24.960 17.801  1.00 41.98 ? 117 MET A N     1 
ATOM   2058 C  CA    . MET B 2 114 ? -25.124 -25.330 16.902  1.00 42.00 ? 117 MET A CA    1 
ATOM   2059 C  C     . MET B 2 114 ? -25.155 -26.843 16.750  1.00 42.05 ? 117 MET A C     1 
ATOM   2060 O  O     . MET B 2 114 ? -24.143 -27.456 16.402  1.00 42.04 ? 117 MET A O     1 
ATOM   2061 C  CB    . MET B 2 114 ? -24.927 -24.662 15.535  1.00 42.03 ? 117 MET A CB    1 
ATOM   2062 C  CG    . MET B 2 114 ? -25.784 -25.240 14.409  1.00 41.99 ? 117 MET A CG    1 
ATOM   2063 S  SD    . MET B 2 114 ? -25.654 -24.353 12.843  1.00 42.40 ? 117 MET A SD    1 
ATOM   2064 C  CE    . MET B 2 114 ? -24.026 -24.842 12.277  1.00 41.67 ? 117 MET A CE    1 
ATOM   2065 N  N     . HIS B 2 115 ? -26.314 -27.441 17.016  1.00 42.00 ? 118 HIS A N     1 
ATOM   2066 C  CA    . HIS B 2 115 ? -26.501 -28.869 16.783  1.00 41.99 ? 118 HIS A CA    1 
ATOM   2067 C  C     . HIS B 2 115 ? -27.336 -29.115 15.531  1.00 41.92 ? 118 HIS A C     1 
ATOM   2068 O  O     . HIS B 2 115 ? -28.519 -28.769 15.486  1.00 41.80 ? 118 HIS A O     1 
ATOM   2069 C  CB    . HIS B 2 115 ? -27.138 -29.557 17.993  1.00 41.94 ? 118 HIS A CB    1 
ATOM   2070 C  CG    . HIS B 2 115 ? -27.162 -31.050 17.885  1.00 42.50 ? 118 HIS A CG    1 
ATOM   2071 N  ND1   . HIS B 2 115 ? -26.135 -31.845 18.345  1.00 42.62 ? 118 HIS A ND1   1 
ATOM   2072 C  CD2   . HIS B 2 115 ? -28.079 -31.891 17.350  1.00 42.63 ? 118 HIS A CD2   1 
ATOM   2073 C  CE1   . HIS B 2 115 ? -26.422 -33.113 18.107  1.00 42.75 ? 118 HIS A CE1   1 
ATOM   2074 N  NE2   . HIS B 2 115 ? -27.596 -33.168 17.504  1.00 42.85 ? 118 HIS A NE2   1 
ATOM   2075 N  N     . LEU B 2 116 ? -26.707 -29.714 14.521  1.00 41.88 ? 119 LEU A N     1 
ATOM   2076 C  CA    . LEU B 2 116 ? -27.386 -30.056 13.271  1.00 41.99 ? 119 LEU A CA    1 
ATOM   2077 C  C     . LEU B 2 116 ? -28.287 -31.270 13.464  1.00 41.98 ? 119 LEU A C     1 
ATOM   2078 O  O     . LEU B 2 116 ? -27.992 -32.144 14.281  1.00 41.92 ? 119 LEU A O     1 
ATOM   2079 C  CB    . LEU B 2 116 ? -26.373 -30.322 12.150  1.00 42.07 ? 119 LEU A CB    1 
ATOM   2080 C  CG    . LEU B 2 116 ? -25.391 -29.200 11.788  1.00 42.28 ? 119 LEU A CG    1 
ATOM   2081 C  CD1   . LEU B 2 116 ? -24.304 -29.722 10.868  1.00 42.29 ? 119 LEU A CD1   1 
ATOM   2082 C  CD2   . LEU B 2 116 ? -26.107 -28.016 11.156  1.00 42.41 ? 119 LEU A CD2   1 
ATOM   2083 N  N     . HIS B 2 117 ? -29.388 -31.313 12.718  1.00 42.12 ? 120 HIS A N     1 
ATOM   2084 C  CA    . HIS B 2 117 ? -30.353 -32.411 12.826  1.00 42.30 ? 120 HIS A CA    1 
ATOM   2085 C  C     . HIS B 2 117 ? -30.132 -33.482 11.760  1.00 42.47 ? 120 HIS A C     1 
ATOM   2086 O  O     . HIS B 2 117 ? -30.990 -34.334 11.530  1.00 42.54 ? 120 HIS A O     1 
ATOM   2087 C  CB    . HIS B 2 117 ? -31.789 -31.881 12.778  1.00 42.18 ? 120 HIS A CB    1 
ATOM   2088 C  CG    . HIS B 2 117 ? -32.107 -30.894 13.859  1.00 42.04 ? 120 HIS A CG    1 
ATOM   2089 N  ND1   . HIS B 2 117 ? -33.091 -29.939 13.727  1.00 42.04 ? 120 HIS A ND1   1 
ATOM   2090 C  CD2   . HIS B 2 117 ? -31.559 -30.702 15.082  1.00 41.64 ? 120 HIS A CD2   1 
ATOM   2091 C  CE1   . HIS B 2 117 ? -33.145 -29.209 14.826  1.00 41.64 ? 120 HIS A CE1   1 
ATOM   2092 N  NE2   . HIS B 2 117 ? -32.226 -29.652 15.664  1.00 41.70 ? 120 HIS A NE2   1 
ATOM   2093 N  N     . GLY B 2 118 ? -28.969 -33.431 11.122  1.00 42.79 ? 121 GLY A N     1 
ATOM   2094 C  CA    . GLY B 2 118 ? -28.583 -34.405 10.110  1.00 43.22 ? 121 GLY A CA    1 
ATOM   2095 C  C     . GLY B 2 118 ? -27.101 -34.294 9.826   1.00 43.51 ? 121 GLY A C     1 
ATOM   2096 O  O     . GLY B 2 118 ? -26.453 -33.329 10.241  1.00 43.47 ? 121 GLY A O     1 
ATOM   2097 N  N     . ASP B 2 119 ? -26.566 -35.278 9.111   1.00 43.80 ? 122 ASP A N     1 
ATOM   2098 C  CA    . ASP B 2 119 ? -25.132 -35.339 8.848   1.00 44.12 ? 122 ASP A CA    1 
ATOM   2099 C  C     . ASP B 2 119 ? -24.731 -34.526 7.614   1.00 44.17 ? 122 ASP A C     1 
ATOM   2100 O  O     . ASP B 2 119 ? -25.188 -34.798 6.502   1.00 44.28 ? 122 ASP A O     1 
ATOM   2101 C  CB    . ASP B 2 119 ? -24.671 -36.796 8.737   1.00 44.28 ? 122 ASP A CB    1 
ATOM   2102 C  CG    . ASP B 2 119 ? -24.948 -37.595 10.005  1.00 44.71 ? 122 ASP A CG    1 
ATOM   2103 O  OD1   . ASP B 2 119 ? -24.601 -37.121 11.110  1.00 45.00 ? 122 ASP A OD1   1 
ATOM   2104 O  OD2   . ASP B 2 119 ? -25.510 -38.703 9.894   1.00 45.59 ? 122 ASP A OD2   1 
ATOM   2105 N  N     . VAL B 2 120 ? -23.887 -33.519 7.835   1.00 44.15 ? 123 VAL A N     1 
ATOM   2106 C  CA    . VAL B 2 120 ? -23.381 -32.646 6.774   1.00 44.15 ? 123 VAL A CA    1 
ATOM   2107 C  C     . VAL B 2 120 ? -21.848 -32.677 6.784   1.00 44.19 ? 123 VAL A C     1 
ATOM   2108 O  O     . VAL B 2 120 ? -21.243 -32.613 7.855   1.00 44.13 ? 123 VAL A O     1 
ATOM   2109 C  CB    . VAL B 2 120 ? -23.870 -31.171 6.953   1.00 44.14 ? 123 VAL A CB    1 
ATOM   2110 C  CG1   . VAL B 2 120 ? -23.448 -30.297 5.774   1.00 43.87 ? 123 VAL A CG1   1 
ATOM   2111 C  CG2   . VAL B 2 120 ? -25.377 -31.106 7.122   1.00 44.02 ? 123 VAL A CG2   1 
ATOM   2112 N  N     . PRO B 2 121 ? -21.215 -32.803 5.595   1.00 44.31 ? 124 PRO A N     1 
ATOM   2113 C  CA    . PRO B 2 121 ? -19.752 -32.725 5.490   1.00 44.42 ? 124 PRO A CA    1 
ATOM   2114 C  C     . PRO B 2 121 ? -19.195 -31.389 5.985   1.00 44.59 ? 124 PRO A C     1 
ATOM   2115 O  O     . PRO B 2 121 ? -19.835 -30.349 5.807   1.00 44.50 ? 124 PRO A O     1 
ATOM   2116 C  CB    . PRO B 2 121 ? -19.498 -32.874 3.986   1.00 44.36 ? 124 PRO A CB    1 
ATOM   2117 C  CG    . PRO B 2 121 ? -20.699 -33.574 3.463   1.00 44.32 ? 124 PRO A CG    1 
ATOM   2118 C  CD    . PRO B 2 121 ? -21.839 -33.059 4.283   1.00 44.34 ? 124 PRO A CD    1 
ATOM   2119 N  N     . GLU B 2 122 ? -18.010 -31.436 6.595   1.00 44.75 ? 125 GLU A N     1 
ATOM   2120 C  CA    . GLU B 2 122 ? -17.358 -30.262 7.187   1.00 45.12 ? 125 GLU A CA    1 
ATOM   2121 C  C     . GLU B 2 122 ? -17.179 -29.097 6.212   1.00 45.08 ? 125 GLU A C     1 
ATOM   2122 O  O     . GLU B 2 122 ? -17.344 -27.940 6.595   1.00 45.04 ? 125 GLU A O     1 
ATOM   2123 C  CB    . GLU B 2 122 ? -16.001 -30.643 7.793   1.00 45.15 ? 125 GLU A CB    1 
ATOM   2124 C  CG    . GLU B 2 122 ? -16.077 -31.316 9.161   1.00 45.50 ? 125 GLU A CG    1 
ATOM   2125 C  CD    . GLU B 2 122 ? -14.704 -31.573 9.766   1.00 45.65 ? 125 GLU A CD    1 
ATOM   2126 O  OE1   . GLU B 2 122 ? -13.923 -32.352 9.179   1.00 46.17 ? 125 GLU A OE1   1 
ATOM   2127 O  OE2   . GLU B 2 122 ? -14.406 -31.000 10.836  1.00 46.78 ? 125 GLU A OE2   1 
ATOM   2128 N  N     . ASP B 2 123 ? -16.844 -29.413 4.962   1.00 45.21 ? 126 ASP A N     1 
ATOM   2129 C  CA    . ASP B 2 123 ? -16.634 -28.400 3.923   1.00 45.31 ? 126 ASP A CA    1 
ATOM   2130 C  C     . ASP B 2 123 ? -17.903 -27.606 3.592   1.00 45.17 ? 126 ASP A C     1 
ATOM   2131 O  O     . ASP B 2 123 ? -17.837 -26.406 3.321   1.00 45.08 ? 126 ASP A O     1 
ATOM   2132 C  CB    . ASP B 2 123 ? -16.028 -29.026 2.653   1.00 45.44 ? 126 ASP A CB    1 
ATOM   2133 C  CG    . ASP B 2 123 ? -16.827 -30.219 2.133   1.00 46.21 ? 126 ASP A CG    1 
ATOM   2134 O  OD1   . ASP B 2 123 ? -18.020 -30.054 1.792   1.00 47.07 ? 126 ASP A OD1   1 
ATOM   2135 O  OD2   . ASP B 2 123 ? -16.249 -31.326 2.040   1.00 46.97 ? 126 ASP A OD2   1 
ATOM   2136 N  N     . LYS B 2 124 ? -19.047 -28.286 3.621   1.00 45.12 ? 127 LYS A N     1 
ATOM   2137 C  CA    . LYS B 2 124 ? -20.337 -27.670 3.319   1.00 45.10 ? 127 LYS A CA    1 
ATOM   2138 C  C     . LYS B 2 124 ? -20.807 -26.783 4.473   1.00 44.88 ? 127 LYS A C     1 
ATOM   2139 O  O     . LYS B 2 124 ? -21.397 -25.723 4.246   1.00 44.79 ? 127 LYS A O     1 
ATOM   2140 C  CB    . LYS B 2 124 ? -21.382 -28.747 3.007   1.00 45.16 ? 127 LYS A CB    1 
ATOM   2141 C  CG    . LYS B 2 124 ? -22.331 -28.406 1.864   1.00 46.00 ? 127 LYS A CG    1 
ATOM   2142 C  CD    . LYS B 2 124 ? -23.532 -27.588 2.324   1.00 47.71 ? 127 LYS A CD    1 
ATOM   2143 C  CE    . LYS B 2 124 ? -24.507 -27.344 1.174   1.00 48.57 ? 127 LYS A CE    1 
ATOM   2144 N  NZ    . LYS B 2 124 ? -25.735 -26.627 1.631   1.00 49.37 ? 127 LYS A NZ    1 
ATOM   2145 N  N     . ILE B 2 125 ? -20.539 -27.224 5.703   1.00 44.65 ? 128 ILE A N     1 
ATOM   2146 C  CA    . ILE B 2 125 ? -20.839 -26.441 6.905   1.00 44.53 ? 128 ILE A CA    1 
ATOM   2147 C  C     . ILE B 2 125 ? -20.125 -25.085 6.866   1.00 44.48 ? 128 ILE A C     1 
ATOM   2148 O  O     . ILE B 2 125 ? -20.762 -24.042 7.024   1.00 44.50 ? 128 ILE A O     1 
ATOM   2149 C  CB    . ILE B 2 125 ? -20.479 -27.210 8.210   1.00 44.49 ? 128 ILE A CB    1 
ATOM   2150 C  CG1   . ILE B 2 125 ? -21.359 -28.457 8.363   1.00 44.50 ? 128 ILE A CG1   1 
ATOM   2151 C  CG2   . ILE B 2 125 ? -20.624 -26.306 9.438   1.00 44.44 ? 128 ILE A CG2   1 
ATOM   2152 C  CD1   . ILE B 2 125 ? -20.873 -29.447 9.415   1.00 44.33 ? 128 ILE A CD1   1 
ATOM   2153 N  N     . ILE B 2 126 ? -18.814 -25.115 6.631   1.00 44.42 ? 129 ILE A N     1 
ATOM   2154 C  CA    . ILE B 2 126 ? -17.978 -23.909 6.595   1.00 44.40 ? 129 ILE A CA    1 
ATOM   2155 C  C     . ILE B 2 126 ? -18.380 -22.954 5.464   1.00 44.30 ? 129 ILE A C     1 
ATOM   2156 O  O     . ILE B 2 126 ? -18.449 -21.740 5.672   1.00 44.30 ? 129 ILE A O     1 
ATOM   2157 C  CB    . ILE B 2 126 ? -16.467 -24.267 6.490   1.00 44.43 ? 129 ILE A CB    1 
ATOM   2158 C  CG1   . ILE B 2 126 ? -16.036 -25.128 7.683   1.00 44.51 ? 129 ILE A CG1   1 
ATOM   2159 C  CG2   . ILE B 2 126 ? -15.605 -23.001 6.407   1.00 44.67 ? 129 ILE A CG2   1 
ATOM   2160 C  CD1   . ILE B 2 126 ? -14.747 -25.904 7.464   1.00 44.72 ? 129 ILE A CD1   1 
ATOM   2161 N  N     . GLN B 2 127 ? -18.649 -23.509 4.283   1.00 44.19 ? 130 GLN A N     1 
ATOM   2162 C  CA    . GLN B 2 127 ? -19.042 -22.723 3.109   1.00 44.17 ? 130 GLN A CA    1 
ATOM   2163 C  C     . GLN B 2 127 ? -20.352 -21.955 3.326   1.00 44.01 ? 130 GLN A C     1 
ATOM   2164 O  O     . GLN B 2 127 ? -20.446 -20.771 2.997   1.00 43.83 ? 130 GLN A O     1 
ATOM   2165 C  CB    . GLN B 2 127 ? -19.155 -23.626 1.874   1.00 44.09 ? 130 GLN A CB    1 
ATOM   2166 C  CG    . GLN B 2 127 ? -19.415 -22.878 0.566   1.00 44.37 ? 130 GLN A CG    1 
ATOM   2167 C  CD    . GLN B 2 127 ? -19.847 -23.790 -0.572  1.00 44.52 ? 130 GLN A CD    1 
ATOM   2168 O  OE1   . GLN B 2 127 ? -19.354 -23.669 -1.695  1.00 44.73 ? 130 GLN A OE1   1 
ATOM   2169 N  NE2   . GLN B 2 127 ? -20.774 -24.706 -0.289  1.00 44.78 ? 130 GLN A NE2   1 
ATOM   2170 N  N     . VAL B 2 128 ? -21.353 -22.639 3.877   1.00 44.02 ? 131 VAL A N     1 
ATOM   2171 C  CA    . VAL B 2 128 ? -22.670 -22.050 4.120   1.00 44.17 ? 131 VAL A CA    1 
ATOM   2172 C  C     . VAL B 2 128 ? -22.623 -21.000 5.237   1.00 44.36 ? 131 VAL A C     1 
ATOM   2173 O  O     . VAL B 2 128 ? -23.247 -19.944 5.125   1.00 44.23 ? 131 VAL A O     1 
ATOM   2174 C  CB    . VAL B 2 128 ? -23.744 -23.146 4.394   1.00 44.20 ? 131 VAL A CB    1 
ATOM   2175 C  CG1   . VAL B 2 128 ? -24.998 -22.564 5.046   1.00 44.00 ? 131 VAL A CG1   1 
ATOM   2176 C  CG2   . VAL B 2 128 ? -24.103 -23.864 3.098   1.00 43.96 ? 131 VAL A CG2   1 
ATOM   2177 N  N     . MET B 2 129 ? -21.864 -21.284 6.294   1.00 44.66 ? 132 MET A N     1 
ATOM   2178 C  CA    . MET B 2 129 ? -21.697 -20.337 7.397   1.00 45.10 ? 132 MET A CA    1 
ATOM   2179 C  C     . MET B 2 129 ? -20.922 -19.086 6.980   1.00 44.90 ? 132 MET A C     1 
ATOM   2180 O  O     . MET B 2 129 ? -21.181 -17.997 7.492   1.00 44.95 ? 132 MET A O     1 
ATOM   2181 C  CB    . MET B 2 129 ? -21.053 -21.014 8.612   1.00 45.10 ? 132 MET A CB    1 
ATOM   2182 C  CG    . MET B 2 129 ? -21.972 -22.021 9.292   1.00 45.44 ? 132 MET A CG    1 
ATOM   2183 S  SD    . MET B 2 129 ? -21.283 -22.783 10.770  1.00 46.22 ? 132 MET A SD    1 
ATOM   2184 C  CE    . MET B 2 129 ? -21.696 -21.552 12.002  1.00 45.42 ? 132 MET A CE    1 
ATOM   2185 N  N     . LYS B 2 130 ? -19.993 -19.246 6.036   1.00 44.81 ? 133 LYS A N     1 
ATOM   2186 C  CA    . LYS B 2 130 ? -19.240 -18.119 5.476   1.00 44.73 ? 133 LYS A CA    1 
ATOM   2187 C  C     . LYS B 2 130 ? -20.155 -17.156 4.710   1.00 44.34 ? 133 LYS A C     1 
ATOM   2188 O  O     . LYS B 2 130 ? -19.898 -15.951 4.656   1.00 44.29 ? 133 LYS A O     1 
ATOM   2189 C  CB    . LYS B 2 130 ? -18.114 -18.628 4.566   1.00 44.71 ? 133 LYS A CB    1 
ATOM   2190 C  CG    . LYS B 2 130 ? -17.094 -17.565 4.152   1.00 45.13 ? 133 LYS A CG    1 
ATOM   2191 C  CD    . LYS B 2 130 ? -16.136 -18.078 3.075   1.00 45.45 ? 133 LYS A CD    1 
ATOM   2192 C  CE    . LYS B 2 130 ? -14.959 -18.852 3.667   1.00 46.75 ? 133 LYS A CE    1 
ATOM   2193 N  NZ    . LYS B 2 130 ? -13.993 -17.960 4.378   1.00 47.20 ? 133 LYS A NZ    1 
ATOM   2194 N  N     . GLU B 2 131 ? -21.225 -17.698 4.131   1.00 44.02 ? 134 GLU A N     1 
ATOM   2195 C  CA    . GLU B 2 131 ? -22.217 -16.907 3.402   1.00 43.75 ? 134 GLU A CA    1 
ATOM   2196 C  C     . GLU B 2 131 ? -23.059 -16.017 4.319   1.00 43.41 ? 134 GLU A C     1 
ATOM   2197 O  O     . GLU B 2 131 ? -23.625 -15.023 3.870   1.00 43.40 ? 134 GLU A O     1 
ATOM   2198 C  CB    . GLU B 2 131 ? -23.128 -17.821 2.575   1.00 43.81 ? 134 GLU A CB    1 
ATOM   2199 C  CG    . GLU B 2 131 ? -22.423 -18.513 1.413   1.00 44.05 ? 134 GLU A CG    1 
ATOM   2200 C  CD    . GLU B 2 131 ? -23.257 -19.608 0.768   1.00 44.15 ? 134 GLU A CD    1 
ATOM   2201 O  OE1   . GLU B 2 131 ? -24.129 -20.185 1.452   1.00 44.84 ? 134 GLU A OE1   1 
ATOM   2202 O  OE2   . GLU B 2 131 ? -23.033 -19.897 -0.427  1.00 44.53 ? 134 GLU A OE2   1 
ATOM   2203 N  N     . PHE B 2 132 ? -23.128 -16.367 5.601   1.00 43.02 ? 135 PHE A N     1 
ATOM   2204 C  CA    . PHE B 2 132 ? -23.916 -15.597 6.563   1.00 42.79 ? 135 PHE A CA    1 
ATOM   2205 C  C     . PHE B 2 132 ? -23.160 -14.412 7.179   1.00 42.94 ? 135 PHE A C     1 
ATOM   2206 O  O     . PHE B 2 132 ? -23.685 -13.729 8.056   1.00 42.90 ? 135 PHE A O     1 
ATOM   2207 C  CB    . PHE B 2 132 ? -24.512 -16.513 7.639   1.00 42.47 ? 135 PHE A CB    1 
ATOM   2208 C  CG    . PHE B 2 132 ? -25.756 -17.234 7.194   1.00 42.01 ? 135 PHE A CG    1 
ATOM   2209 C  CD1   . PHE B 2 132 ? -27.014 -16.757 7.548   1.00 41.57 ? 135 PHE A CD1   1 
ATOM   2210 C  CD2   . PHE B 2 132 ? -25.671 -18.381 6.404   1.00 41.40 ? 135 PHE A CD2   1 
ATOM   2211 C  CE1   . PHE B 2 132 ? -28.172 -17.416 7.134   1.00 41.77 ? 135 PHE A CE1   1 
ATOM   2212 C  CE2   . PHE B 2 132 ? -26.821 -19.048 5.982   1.00 41.47 ? 135 PHE A CE2   1 
ATOM   2213 C  CZ    . PHE B 2 132 ? -28.075 -18.566 6.348   1.00 41.77 ? 135 PHE A CZ    1 
ATOM   2214 N  N     . GLU B 2 133 ? -21.938 -14.170 6.709   1.00 43.10 ? 136 GLU A N     1 
ATOM   2215 C  CA    . GLU B 2 133 ? -21.205 -12.952 7.050   1.00 43.51 ? 136 GLU A CA    1 
ATOM   2216 C  C     . GLU B 2 133 ? -21.667 -11.807 6.154   1.00 43.54 ? 136 GLU A C     1 
ATOM   2217 O  O     . GLU B 2 133 ? -21.949 -12.012 4.972   1.00 43.60 ? 136 GLU A O     1 
ATOM   2218 C  CB    . GLU B 2 133 ? -19.699 -13.155 6.890   1.00 43.42 ? 136 GLU A CB    1 
ATOM   2219 C  CG    . GLU B 2 133 ? -19.063 -14.057 7.940   1.00 43.65 ? 136 GLU A CG    1 
ATOM   2220 C  CD    . GLU B 2 133 ? -17.555 -14.183 7.771   1.00 43.85 ? 136 GLU A CD    1 
ATOM   2221 O  OE1   . GLU B 2 133 ? -16.884 -14.622 8.728   1.00 43.83 ? 136 GLU A OE1   1 
ATOM   2222 O  OE2   . GLU B 2 133 ? -17.037 -13.841 6.683   1.00 44.83 ? 136 GLU A OE2   1 
ATOM   2223 N  N     . GLY B 2 134 ? -21.740 -10.608 6.724   1.00 43.71 ? 137 GLY A N     1 
ATOM   2224 C  CA    . GLY B 2 134 ? -22.182 -9.415  5.996   1.00 43.88 ? 137 GLY A CA    1 
ATOM   2225 C  C     . GLY B 2 134 ? -23.590 -9.004  6.385   1.00 44.09 ? 137 GLY A C     1 
ATOM   2226 O  O     . GLY B 2 134 ? -24.071 -9.353  7.468   1.00 44.04 ? 137 GLY A O     1 
ATOM   2227 N  N     . GLU B 2 135 ? -24.248 -8.256  5.502   1.00 44.29 ? 138 GLU A N     1 
ATOM   2228 C  CA    . GLU B 2 135 ? -25.640 -7.858  5.699   1.00 44.74 ? 138 GLU A CA    1 
ATOM   2229 C  C     . GLU B 2 135 ? -26.570 -9.037  5.423   1.00 44.86 ? 138 GLU A C     1 
ATOM   2230 O  O     . GLU B 2 135 ? -26.595 -9.571  4.311   1.00 44.66 ? 138 GLU A O     1 
ATOM   2231 C  CB    . GLU B 2 135 ? -26.003 -6.678  4.791   1.00 44.76 ? 138 GLU A CB    1 
ATOM   2232 C  CG    . GLU B 2 135 ? -25.421 -5.335  5.214   1.00 45.73 ? 138 GLU A CG    1 
ATOM   2233 C  CD    . GLU B 2 135 ? -26.373 -4.502  6.063   1.00 46.78 ? 138 GLU A CD    1 
ATOM   2234 O  OE1   . GLU B 2 135 ? -27.003 -5.047  6.996   1.00 47.21 ? 138 GLU A OE1   1 
ATOM   2235 O  OE2   . GLU B 2 135 ? -26.483 -3.286  5.798   1.00 47.54 ? 138 GLU A OE2   1 
ATOM   2236 N  N     . ILE B 2 136 ? -27.321 -9.444  6.445   1.00 45.26 ? 139 ILE A N     1 
ATOM   2237 C  CA    . ILE B 2 136 ? -28.277 -10.549 6.321   1.00 45.64 ? 139 ILE A CA    1 
ATOM   2238 C  C     . ILE B 2 136 ? -29.700 -10.124 6.694   1.00 46.13 ? 139 ILE A C     1 
ATOM   2239 O  O     . ILE B 2 136 ? -29.894 -9.213  7.497   1.00 46.01 ? 139 ILE A O     1 
ATOM   2240 C  CB    . ILE B 2 136 ? -27.849 -11.807 7.140   1.00 45.59 ? 139 ILE A CB    1 
ATOM   2241 C  CG1   . ILE B 2 136 ? -27.757 -11.495 8.640   1.00 45.31 ? 139 ILE A CG1   1 
ATOM   2242 C  CG2   . ILE B 2 136 ? -26.536 -12.389 6.597   1.00 45.44 ? 139 ILE A CG2   1 
ATOM   2243 C  CD1   . ILE B 2 136 ? -27.813 -12.717 9.533   1.00 45.64 ? 139 ILE A CD1   1 
ATOM   2244 N  N     . ILE B 2 137 ? -30.685 -10.793 6.101   1.00 46.84 ? 140 ILE A N     1 
ATOM   2245 C  CA    . ILE B 2 137 ? -32.096 -10.484 6.326   1.00 47.75 ? 140 ILE A CA    1 
ATOM   2246 C  C     . ILE B 2 137 ? -32.594 -11.127 7.622   1.00 48.54 ? 140 ILE A C     1 
ATOM   2247 O  O     . ILE B 2 137 ? -32.497 -12.345 7.795   1.00 48.64 ? 140 ILE A O     1 
ATOM   2248 C  CB    . ILE B 2 137 ? -32.974 -10.944 5.125   1.00 47.64 ? 140 ILE A CB    1 
ATOM   2249 C  CG1   . ILE B 2 137 ? -32.484 -10.297 3.824   1.00 47.46 ? 140 ILE A CG1   1 
ATOM   2250 C  CG2   . ILE B 2 137 ? -34.451 -10.628 5.370   1.00 47.57 ? 140 ILE A CG2   1 
ATOM   2251 C  CD1   . ILE B 2 137 ? -32.929 -11.011 2.559   1.00 47.49 ? 140 ILE A CD1   1 
ATOM   2252 N  N     . GLN B 2 138 ? -33.117 -10.306 8.533   1.00 49.57 ? 141 GLN A N     1 
ATOM   2253 C  CA    . GLN B 2 138 ? -33.705 -10.822 9.774   1.00 50.59 ? 141 GLN A CA    1 
ATOM   2254 C  C     . GLN B 2 138 ? -35.238 -10.747 9.791   1.00 50.92 ? 141 GLN A C     1 
ATOM   2255 O  O     . GLN B 2 138 ? -35.881 -11.304 10.683  1.00 51.09 ? 141 GLN A O     1 
ATOM   2256 C  CB    . GLN B 2 138 ? -33.084 -10.166 11.019  1.00 50.56 ? 141 GLN A CB    1 
ATOM   2257 C  CG    . GLN B 2 138 ? -33.503 -8.725  11.291  1.00 51.07 ? 141 GLN A CG    1 
ATOM   2258 C  CD    . GLN B 2 138 ? -33.244 -8.289  12.731  1.00 51.21 ? 141 GLN A CD    1 
ATOM   2259 O  OE1   . GLN B 2 138 ? -32.695 -9.042  13.540  1.00 52.57 ? 141 GLN A OE1   1 
ATOM   2260 N  NE2   . GLN B 2 138 ? -33.644 -7.067  13.054  1.00 52.36 ? 141 GLN A NE2   1 
ATOM   2261 N  N     . ARG B 2 139 ? -35.811 -10.062 8.803   1.00 51.46 ? 142 ARG A N     1 
ATOM   2262 C  CA    . ARG B 2 139 ? -37.261 -10.061 8.598   1.00 51.95 ? 142 ARG A CA    1 
ATOM   2263 C  C     . ARG B 2 139 ? -37.621 -9.868  7.122   1.00 52.12 ? 142 ARG A C     1 
ATOM   2264 O  O     . ARG B 2 139 ? -37.316 -8.824  6.540   1.00 52.21 ? 142 ARG A O     1 
ATOM   2265 C  CB    . ARG B 2 139 ? -37.952 -8.999  9.464   1.00 51.90 ? 142 ARG A CB    1 
ATOM   2266 C  CG    . ARG B 2 139 ? -39.418 -9.304  9.750   1.00 52.08 ? 142 ARG A CG    1 
ATOM   2267 C  CD    . ARG B 2 139 ? -40.036 -8.278  10.688  1.00 52.34 ? 142 ARG A CD    1 
ATOM   2268 N  NE    . ARG B 2 139 ? -40.564 -7.115  9.974   1.00 53.02 ? 142 ARG A NE    1 
ATOM   2269 C  CZ    . ARG B 2 139 ? -41.154 -6.074  10.557  1.00 53.27 ? 142 ARG A CZ    1 
ATOM   2270 N  NH1   . ARG B 2 139 ? -41.298 -6.031  11.877  1.00 53.36 ? 142 ARG A NH1   1 
ATOM   2271 N  NH2   . ARG B 2 139 ? -41.602 -5.068  9.818   1.00 53.42 ? 142 ARG A NH2   1 
ATOM   2272 N  N     . PRO B 2 140 ? -38.260 -10.886 6.512   1.00 52.35 ? 143 PRO A N     1 
ATOM   2273 C  CA    . PRO B 2 140 ? -38.764 -10.811 5.138   1.00 52.53 ? 143 PRO A CA    1 
ATOM   2274 C  C     . PRO B 2 140 ? -39.860 -9.747  4.982   1.00 52.79 ? 143 PRO A C     1 
ATOM   2275 O  O     . PRO B 2 140 ? -40.626 -9.521  5.924   1.00 52.88 ? 143 PRO A O     1 
ATOM   2276 C  CB    . PRO B 2 140 ? -39.331 -12.215 4.893   1.00 52.54 ? 143 PRO A CB    1 
ATOM   2277 C  CG    . PRO B 2 140 ? -39.586 -12.772 6.246   1.00 52.40 ? 143 PRO A CG    1 
ATOM   2278 C  CD    . PRO B 2 140 ? -38.521 -12.205 7.118   1.00 52.36 ? 143 PRO A CD    1 
ATOM   2279 N  N     . PRO B 2 141 ? -39.932 -9.093  3.802   1.00 52.92 ? 144 PRO A N     1 
ATOM   2280 C  CA    . PRO B 2 141 ? -40.867 -7.986  3.570   1.00 53.06 ? 144 PRO A CA    1 
ATOM   2281 C  C     . PRO B 2 141 ? -42.333 -8.420  3.478   1.00 53.21 ? 144 PRO A C     1 
ATOM   2282 O  O     . PRO B 2 141 ? -42.617 -9.613  3.341   1.00 53.24 ? 144 PRO A O     1 
ATOM   2283 C  CB    . PRO B 2 141 ? -40.400 -7.411  2.229   1.00 53.04 ? 144 PRO A CB    1 
ATOM   2284 C  CG    . PRO B 2 141 ? -39.776 -8.558  1.532   1.00 53.00 ? 144 PRO A CG    1 
ATOM   2285 C  CD    . PRO B 2 141 ? -39.113 -9.372  2.607   1.00 52.90 ? 144 PRO A CD    1 
ATOM   2286 N  N     . LEU B 2 142 ? -43.237 -7.439  3.548   1.00 53.42 ? 145 LEU A N     1 
ATOM   2287 C  CA    . LEU B 2 142 ? -44.693 -7.649  3.504   1.00 53.51 ? 145 LEU A CA    1 
ATOM   2288 C  C     . LEU B 2 142 ? -45.191 -8.529  4.652   1.00 53.57 ? 145 LEU A C     1 
ATOM   2289 O  O     . LEU B 2 142 ? -45.693 -8.027  5.659   1.00 53.61 ? 145 LEU A O     1 
ATOM   2290 C  CB    . LEU B 2 142 ? -45.139 -8.212  2.145   1.00 53.46 ? 145 LEU A CB    1 
ATOM   2291 C  CG    . LEU B 2 142 ? -46.634 -8.404  1.860   1.00 53.54 ? 145 LEU A CG    1 
ATOM   2292 C  CD1   . LEU B 2 142 ? -47.333 -7.075  1.577   1.00 53.74 ? 145 LEU A CD1   1 
ATOM   2293 C  CD2   . LEU B 2 142 ? -46.831 -9.363  0.695   1.00 53.58 ? 145 LEU A CD2   1 
ATOM   2294 N  N     . LEU B 2 150 ? -37.605 -3.694  4.276   1.00 49.94 ? 153 LEU A N     1 
ATOM   2295 C  CA    . LEU B 2 150 ? -36.640 -4.761  4.519   1.00 49.95 ? 153 LEU A CA    1 
ATOM   2296 C  C     . LEU B 2 150 ? -35.758 -4.438  5.722   1.00 49.88 ? 153 LEU A C     1 
ATOM   2297 O  O     . LEU B 2 150 ? -35.052 -3.425  5.737   1.00 50.01 ? 153 LEU A O     1 
ATOM   2298 C  CB    . LEU B 2 150 ? -35.781 -5.006  3.270   1.00 49.98 ? 153 LEU A CB    1 
ATOM   2299 C  CG    . LEU B 2 150 ? -34.647 -6.039  3.328   1.00 50.01 ? 153 LEU A CG    1 
ATOM   2300 C  CD1   . LEU B 2 150 ? -35.181 -7.467  3.365   1.00 49.93 ? 153 LEU A CD1   1 
ATOM   2301 C  CD2   . LEU B 2 150 ? -33.712 -5.854  2.144   1.00 50.07 ? 153 LEU A CD2   1 
ATOM   2302 N  N     . ARG B 2 151 ? -35.810 -5.307  6.727   1.00 49.63 ? 154 ARG A N     1 
ATOM   2303 C  CA    . ARG B 2 151 ? -35.004 -5.147  7.929   1.00 49.44 ? 154 ARG A CA    1 
ATOM   2304 C  C     . ARG B 2 151 ? -33.822 -6.118  7.922   1.00 48.94 ? 154 ARG A C     1 
ATOM   2305 O  O     . ARG B 2 151 ? -34.001 -7.335  7.821   1.00 48.90 ? 154 ARG A O     1 
ATOM   2306 C  CB    . ARG B 2 151 ? -35.872 -5.301  9.185   1.00 49.68 ? 154 ARG A CB    1 
ATOM   2307 C  CG    . ARG B 2 151 ? -35.104 -5.530  10.475  1.00 50.66 ? 154 ARG A CG    1 
ATOM   2308 C  CD    . ARG B 2 151 ? -35.674 -4.718  11.629  1.00 52.28 ? 154 ARG A CD    1 
ATOM   2309 N  NE    . ARG B 2 151 ? -34.771 -3.637  12.026  1.00 53.39 ? 154 ARG A NE    1 
ATOM   2310 C  CZ    . ARG B 2 151 ? -34.888 -2.365  11.652  1.00 53.75 ? 154 ARG A CZ    1 
ATOM   2311 N  NH1   . ARG B 2 151 ? -35.883 -1.977  10.862  1.00 54.22 ? 154 ARG A NH1   1 
ATOM   2312 N  NH2   . ARG B 2 151 ? -34.004 -1.472  12.077  1.00 53.96 ? 154 ARG A NH2   1 
ATOM   2313 N  N     . THR B 2 152 ? -32.618 -5.558  8.010   1.00 48.28 ? 155 THR A N     1 
ATOM   2314 C  CA    . THR B 2 152 ? -31.387 -6.336  7.940   1.00 47.64 ? 155 THR A CA    1 
ATOM   2315 C  C     . THR B 2 152 ? -30.537 -6.155  9.194   1.00 47.33 ? 155 THR A C     1 
ATOM   2316 O  O     . THR B 2 152 ? -30.750 -5.226  9.979   1.00 47.27 ? 155 THR A O     1 
ATOM   2317 C  CB    . THR B 2 152 ? -30.529 -5.974  6.695   1.00 47.65 ? 155 THR A CB    1 
ATOM   2318 O  OG1   . THR B 2 152 ? -30.026 -4.638  6.820   1.00 47.51 ? 155 THR A OG1   1 
ATOM   2319 C  CG2   . THR B 2 152 ? -31.336 -6.105  5.401   1.00 47.55 ? 155 THR A CG2   1 
ATOM   2320 N  N     . ARG B 2 153 ? -29.571 -7.052  9.367   1.00 46.78 ? 156 ARG A N     1 
ATOM   2321 C  CA    . ARG B 2 153 ? -28.631 -6.982  10.472  1.00 46.47 ? 156 ARG A CA    1 
ATOM   2322 C  C     . ARG B 2 153 ? -27.259 -7.441  9.990   1.00 46.05 ? 156 ARG A C     1 
ATOM   2323 O  O     . ARG B 2 153 ? -27.161 -8.297  9.108   1.00 45.97 ? 156 ARG A O     1 
ATOM   2324 C  CB    . ARG B 2 153 ? -29.114 -7.855  11.630  1.00 46.51 ? 156 ARG A CB    1 
ATOM   2325 C  CG    . ARG B 2 153 ? -28.901 -7.242  13.001  1.00 47.24 ? 156 ARG A CG    1 
ATOM   2326 C  CD    . ARG B 2 153 ? -30.136 -6.518  13.520  1.00 47.87 ? 156 ARG A CD    1 
ATOM   2327 N  NE    . ARG B 2 153 ? -30.246 -5.161  12.996  1.00 48.79 ? 156 ARG A NE    1 
ATOM   2328 C  CZ    . ARG B 2 153 ? -31.163 -4.275  13.380  1.00 49.53 ? 156 ARG A CZ    1 
ATOM   2329 N  NH1   . ARG B 2 153 ? -32.064 -4.593  14.304  1.00 49.51 ? 156 ARG A NH1   1 
ATOM   2330 N  NH2   . ARG B 2 153 ? -31.178 -3.065  12.837  1.00 49.60 ? 156 ARG A NH2   1 
ATOM   2331 N  N     . LYS B 2 154 ? -26.205 -6.873  10.567  1.00 45.54 ? 157 LYS A N     1 
ATOM   2332 C  CA    . LYS B 2 154 ? -24.843 -7.171  10.131  1.00 45.08 ? 157 LYS A CA    1 
ATOM   2333 C  C     . LYS B 2 154 ? -24.177 -8.261  10.966  1.00 44.64 ? 157 LYS A C     1 
ATOM   2334 O  O     . LYS B 2 154 ? -24.150 -8.189  12.197  1.00 44.61 ? 157 LYS A O     1 
ATOM   2335 C  CB    . LYS B 2 154 ? -23.980 -5.903  10.137  1.00 45.16 ? 157 LYS A CB    1 
ATOM   2336 C  CG    . LYS B 2 154 ? -24.359 -4.881  9.082   1.00 45.16 ? 157 LYS A CG    1 
ATOM   2337 C  CD    . LYS B 2 154 ? -23.567 -3.591  9.249   1.00 45.46 ? 157 LYS A CD    1 
ATOM   2338 C  CE    . LYS B 2 154 ? -23.970 -2.544  8.220   1.00 45.60 ? 157 LYS A CE    1 
ATOM   2339 N  NZ    . LYS B 2 154 ? -23.543 -2.908  6.839   1.00 46.04 ? 157 LYS A NZ    1 
ATOM   2340 N  N     . VAL B 2 155 ? -23.662 -9.278  10.279  1.00 44.02 ? 158 VAL A N     1 
ATOM   2341 C  CA    . VAL B 2 155 ? -22.765 -10.253 10.883  1.00 43.39 ? 158 VAL A CA    1 
ATOM   2342 C  C     . VAL B 2 155 ? -21.350 -9.903  10.432  1.00 43.24 ? 158 VAL A C     1 
ATOM   2343 O  O     . VAL B 2 155 ? -21.024 -9.993  9.244   1.00 43.02 ? 158 VAL A O     1 
ATOM   2344 C  CB    . VAL B 2 155 ? -23.126 -11.708 10.488  1.00 43.49 ? 158 VAL A CB    1 
ATOM   2345 C  CG1   . VAL B 2 155 ? -22.068 -12.688 10.988  1.00 42.87 ? 158 VAL A CG1   1 
ATOM   2346 C  CG2   . VAL B 2 155 ? -24.500 -12.089 11.029  1.00 43.10 ? 158 VAL A CG2   1 
ATOM   2347 N  N     . TYR B 2 156 ? -20.520 -9.492  11.385  1.00 42.99 ? 159 TYR A N     1 
ATOM   2348 C  CA    . TYR B 2 156 ? -19.173 -9.018  11.077  1.00 42.82 ? 159 TYR A CA    1 
ATOM   2349 C  C     . TYR B 2 156 ? -18.199 -10.153 10.777  1.00 42.83 ? 159 TYR A C     1 
ATOM   2350 O  O     . TYR B 2 156 ? -17.300 -9.996  9.950   1.00 42.72 ? 159 TYR A O     1 
ATOM   2351 C  CB    . TYR B 2 156 ? -18.648 -8.116  12.200  1.00 42.77 ? 159 TYR A CB    1 
ATOM   2352 C  CG    . TYR B 2 156 ? -19.521 -6.904  12.446  1.00 42.50 ? 159 TYR A CG    1 
ATOM   2353 C  CD1   . TYR B 2 156 ? -20.236 -6.767  13.632  1.00 42.23 ? 159 TYR A CD1   1 
ATOM   2354 C  CD2   . TYR B 2 156 ? -19.646 -5.904  11.481  1.00 42.31 ? 159 TYR A CD2   1 
ATOM   2355 C  CE1   . TYR B 2 156 ? -21.046 -5.658  13.860  1.00 42.43 ? 159 TYR A CE1   1 
ATOM   2356 C  CE2   . TYR B 2 156 ? -20.455 -4.795  11.695  1.00 42.40 ? 159 TYR A CE2   1 
ATOM   2357 C  CZ    . TYR B 2 156 ? -21.152 -4.679  12.886  1.00 42.57 ? 159 TYR A CZ    1 
ATOM   2358 O  OH    . TYR B 2 156 ? -21.950 -3.578  13.104  1.00 42.79 ? 159 TYR A OH    1 
ATOM   2359 N  N     . TYR B 2 157 ? -18.387 -11.288 11.450  1.00 42.94 ? 160 TYR A N     1 
ATOM   2360 C  CA    . TYR B 2 157 ? -17.564 -12.481 11.233  1.00 43.07 ? 160 TYR A CA    1 
ATOM   2361 C  C     . TYR B 2 157 ? -18.176 -13.727 11.858  1.00 43.12 ? 160 TYR A C     1 
ATOM   2362 O  O     . TYR B 2 157 ? -18.868 -13.651 12.876  1.00 42.87 ? 160 TYR A O     1 
ATOM   2363 C  CB    . TYR B 2 157 ? -16.136 -12.287 11.772  1.00 43.23 ? 160 TYR A CB    1 
ATOM   2364 C  CG    . TYR B 2 157 ? -16.071 -11.796 13.202  1.00 43.45 ? 160 TYR A CG    1 
ATOM   2365 C  CD1   . TYR B 2 157 ? -15.958 -10.438 13.481  1.00 43.34 ? 160 TYR A CD1   1 
ATOM   2366 C  CD2   . TYR B 2 157 ? -16.122 -12.689 14.275  1.00 43.59 ? 160 TYR A CD2   1 
ATOM   2367 C  CE1   . TYR B 2 157 ? -15.899 -9.976  14.787  1.00 43.61 ? 160 TYR A CE1   1 
ATOM   2368 C  CE2   . TYR B 2 157 ? -16.069 -12.234 15.591  1.00 43.55 ? 160 TYR A CE2   1 
ATOM   2369 C  CZ    . TYR B 2 157 ? -15.956 -10.876 15.835  1.00 43.59 ? 160 TYR A CZ    1 
ATOM   2370 O  OH    . TYR B 2 157 ? -15.903 -10.407 17.125  1.00 44.15 ? 160 TYR A OH    1 
ATOM   2371 N  N     . ILE B 2 158 ? -17.919 -14.867 11.223  1.00 43.30 ? 161 ILE A N     1 
ATOM   2372 C  CA    . ILE B 2 158 ? -18.192 -16.176 11.801  1.00 43.60 ? 161 ILE A CA    1 
ATOM   2373 C  C     . ILE B 2 158 ? -16.903 -16.995 11.728  1.00 43.66 ? 161 ILE A C     1 
ATOM   2374 O  O     . ILE B 2 158 ? -16.334 -17.181 10.650  1.00 43.57 ? 161 ILE A O     1 
ATOM   2375 C  CB    . ILE B 2 158 ? -19.366 -16.907 11.088  1.00 43.63 ? 161 ILE A CB    1 
ATOM   2376 C  CG1   . ILE B 2 158 ? -20.686 -16.168 11.335  1.00 43.88 ? 161 ILE A CG1   1 
ATOM   2377 C  CG2   . ILE B 2 158 ? -19.476 -18.362 11.566  1.00 43.71 ? 161 ILE A CG2   1 
ATOM   2378 C  CD1   . ILE B 2 158 ? -21.836 -16.595 10.432  1.00 43.81 ? 161 ILE A CD1   1 
ATOM   2379 N  N     . GLU B 2 159 ? -16.435 -17.454 12.886  1.00 43.81 ? 162 GLU A N     1 
ATOM   2380 C  CA    . GLU B 2 159 ? -15.238 -18.285 12.967  1.00 44.02 ? 162 GLU A CA    1 
ATOM   2381 C  C     . GLU B 2 159 ? -15.612 -19.656 13.515  1.00 43.84 ? 162 GLU A C     1 
ATOM   2382 O  O     . GLU B 2 159 ? -15.894 -19.798 14.708  1.00 43.94 ? 162 GLU A O     1 
ATOM   2383 C  CB    . GLU B 2 159 ? -14.175 -17.621 13.856  1.00 43.97 ? 162 GLU A CB    1 
ATOM   2384 C  CG    . GLU B 2 159 ? -12.856 -18.400 13.967  1.00 44.52 ? 162 GLU A CG    1 
ATOM   2385 C  CD    . GLU B 2 159 ? -11.961 -17.927 15.111  1.00 44.78 ? 162 GLU A CD    1 
ATOM   2386 O  OE1   . GLU B 2 159 ? -10.835 -18.456 15.241  1.00 45.79 ? 162 GLU A OE1   1 
ATOM   2387 O  OE2   . GLU B 2 159 ? -12.375 -17.035 15.884  1.00 46.09 ? 162 GLU A OE2   1 
ATOM   2388 N  N     . VAL B 2 160 ? -15.629 -20.657 12.639  1.00 43.67 ? 163 VAL A N     1 
ATOM   2389 C  CA    . VAL B 2 160 ? -15.871 -22.037 13.053  1.00 43.59 ? 163 VAL A CA    1 
ATOM   2390 C  C     . VAL B 2 160 ? -14.650 -22.549 13.816  1.00 43.55 ? 163 VAL A C     1 
ATOM   2391 O  O     . VAL B 2 160 ? -13.550 -22.643 13.263  1.00 43.48 ? 163 VAL A O     1 
ATOM   2392 C  CB    . VAL B 2 160 ? -16.202 -22.964 11.854  1.00 43.54 ? 163 VAL A CB    1 
ATOM   2393 C  CG1   . VAL B 2 160 ? -16.373 -24.408 12.317  1.00 43.49 ? 163 VAL A CG1   1 
ATOM   2394 C  CG2   . VAL B 2 160 ? -17.460 -22.491 11.136  1.00 43.48 ? 163 VAL A CG2   1 
ATOM   2395 N  N     . LEU B 2 161 ? -14.854 -22.862 15.092  1.00 43.47 ? 164 LEU A N     1 
ATOM   2396 C  CA    . LEU B 2 161 ? -13.768 -23.304 15.964  1.00 43.46 ? 164 LEU A CA    1 
ATOM   2397 C  C     . LEU B 2 161 ? -13.509 -24.803 15.831  1.00 43.60 ? 164 LEU A C     1 
ATOM   2398 O  O     . LEU B 2 161 ? -12.365 -25.223 15.643  1.00 43.69 ? 164 LEU A O     1 
ATOM   2399 C  CB    . LEU B 2 161 ? -14.044 -22.909 17.420  1.00 43.34 ? 164 LEU A CB    1 
ATOM   2400 C  CG    . LEU B 2 161 ? -14.204 -21.405 17.685  1.00 43.06 ? 164 LEU A CG    1 
ATOM   2401 C  CD1   . LEU B 2 161 ? -14.781 -21.143 19.070  1.00 42.82 ? 164 LEU A CD1   1 
ATOM   2402 C  CD2   . LEU B 2 161 ? -12.887 -20.653 17.491  1.00 42.63 ? 164 LEU A CD2   1 
ATOM   2403 N  N     . GLU B 2 162 ? -14.571 -25.601 15.923  1.00 43.74 ? 165 GLU A N     1 
ATOM   2404 C  CA    . GLU B 2 162 ? -14.477 -27.049 15.720  1.00 43.93 ? 165 GLU A CA    1 
ATOM   2405 C  C     . GLU B 2 162 ? -15.822 -27.698 15.397  1.00 43.96 ? 165 GLU A C     1 
ATOM   2406 O  O     . GLU B 2 162 ? -16.878 -27.212 15.805  1.00 44.04 ? 165 GLU A O     1 
ATOM   2407 C  CB    . GLU B 2 162 ? -13.811 -27.747 16.921  1.00 44.02 ? 165 GLU A CB    1 
ATOM   2408 C  CG    . GLU B 2 162 ? -14.433 -27.459 18.283  1.00 43.92 ? 165 GLU A CG    1 
ATOM   2409 C  CD    . GLU B 2 162 ? -13.645 -28.087 19.424  1.00 44.12 ? 165 GLU A CD    1 
ATOM   2410 O  OE1   . GLU B 2 162 ? -14.215 -28.938 20.137  1.00 44.37 ? 165 GLU A OE1   1 
ATOM   2411 O  OE2   . GLU B 2 162 ? -12.455 -27.743 19.603  1.00 43.69 ? 165 GLU A OE2   1 
ATOM   2412 N  N     . ILE B 2 163 ? -15.763 -28.795 14.648  1.00 44.13 ? 166 ILE A N     1 
ATOM   2413 C  CA    . ILE B 2 163 ? -16.942 -29.593 14.330  1.00 44.24 ? 166 ILE A CA    1 
ATOM   2414 C  C     . ILE B 2 163 ? -16.767 -30.993 14.917  1.00 44.44 ? 166 ILE A C     1 
ATOM   2415 O  O     . ILE B 2 163 ? -15.808 -31.697 14.595  1.00 44.45 ? 166 ILE A O     1 
ATOM   2416 C  CB    . ILE B 2 163 ? -17.212 -29.651 12.799  1.00 44.18 ? 166 ILE A CB    1 
ATOM   2417 C  CG1   . ILE B 2 163 ? -17.563 -28.258 12.266  1.00 44.11 ? 166 ILE A CG1   1 
ATOM   2418 C  CG2   . ILE B 2 163 ? -18.334 -30.646 12.478  1.00 43.96 ? 166 ILE A CG2   1 
ATOM   2419 C  CD1   . ILE B 2 163 ? -17.304 -28.062 10.781  1.00 44.11 ? 166 ILE A CD1   1 
ATOM   2420 N  N     . GLU B 2 164 ? -17.692 -31.372 15.794  1.00 44.64 ? 167 GLU A N     1 
ATOM   2421 C  CA    . GLU B 2 164 ? -17.691 -32.683 16.432  1.00 44.91 ? 167 GLU A CA    1 
ATOM   2422 C  C     . GLU B 2 164 ? -18.992 -33.411 16.078  1.00 44.73 ? 167 GLU A C     1 
ATOM   2423 O  O     . GLU B 2 164 ? -19.964 -33.380 16.838  1.00 44.78 ? 167 GLU A O     1 
ATOM   2424 C  CB    . GLU B 2 164 ? -17.536 -32.524 17.950  1.00 44.92 ? 167 GLU A CB    1 
ATOM   2425 C  CG    . GLU B 2 164 ? -17.113 -33.785 18.699  1.00 45.33 ? 167 GLU A CG    1 
ATOM   2426 C  CD    . GLU B 2 164 ? -17.109 -33.591 20.210  1.00 45.57 ? 167 GLU A CD    1 
ATOM   2427 O  OE1   . GLU B 2 164 ? -18.196 -33.370 20.789  1.00 46.80 ? 167 GLU A OE1   1 
ATOM   2428 O  OE2   . GLU B 2 164 ? -16.021 -33.662 20.823  1.00 46.18 ? 167 GLU A OE2   1 
ATOM   2429 N  N     . GLY B 2 165 ? -19.002 -34.051 14.911  1.00 44.69 ? 168 GLY A N     1 
ATOM   2430 C  CA    . GLY B 2 165 ? -20.192 -34.738 14.404  1.00 44.49 ? 168 GLY A CA    1 
ATOM   2431 C  C     . GLY B 2 165 ? -21.254 -33.765 13.924  1.00 44.30 ? 168 GLY A C     1 
ATOM   2432 O  O     . GLY B 2 165 ? -21.072 -33.087 12.909  1.00 44.49 ? 168 GLY A O     1 
ATOM   2433 N  N     . ARG B 2 166 ? -22.363 -33.698 14.657  1.00 43.93 ? 169 ARG A N     1 
ATOM   2434 C  CA    . ARG B 2 166 ? -23.454 -32.768 14.345  1.00 43.55 ? 169 ARG A CA    1 
ATOM   2435 C  C     . ARG B 2 166 ? -23.328 -31.450 15.113  1.00 43.20 ? 169 ARG A C     1 
ATOM   2436 O  O     . ARG B 2 166 ? -24.085 -30.504 14.873  1.00 43.10 ? 169 ARG A O     1 
ATOM   2437 C  CB    . ARG B 2 166 ? -24.815 -33.424 14.605  1.00 43.60 ? 169 ARG A CB    1 
ATOM   2438 C  CG    . ARG B 2 166 ? -25.132 -34.562 13.643  1.00 43.95 ? 169 ARG A CG    1 
ATOM   2439 C  CD    . ARG B 2 166 ? -26.515 -35.136 13.872  1.00 44.42 ? 169 ARG A CD    1 
ATOM   2440 N  NE    . ARG B 2 166 ? -26.802 -36.210 12.923  1.00 44.86 ? 169 ARG A NE    1 
ATOM   2441 C  CZ    . ARG B 2 166 ? -27.976 -36.823 12.800  1.00 45.38 ? 169 ARG A CZ    1 
ATOM   2442 N  NH1   . ARG B 2 166 ? -29.003 -36.476 13.566  1.00 45.41 ? 169 ARG A NH1   1 
ATOM   2443 N  NH2   . ARG B 2 166 ? -28.125 -37.789 11.902  1.00 45.05 ? 169 ARG A NH2   1 
ATOM   2444 N  N     . ASP B 2 167 ? -22.362 -31.397 16.028  1.00 42.72 ? 170 ASP A N     1 
ATOM   2445 C  CA    . ASP B 2 167 ? -22.097 -30.197 16.816  1.00 42.27 ? 170 ASP A CA    1 
ATOM   2446 C  C     . ASP B 2 167 ? -21.100 -29.278 16.125  1.00 41.74 ? 170 ASP A C     1 
ATOM   2447 O  O     . ASP B 2 167 ? -20.030 -29.717 15.689  1.00 41.49 ? 170 ASP A O     1 
ATOM   2448 C  CB    . ASP B 2 167 ? -21.586 -30.570 18.208  1.00 42.48 ? 170 ASP A CB    1 
ATOM   2449 C  CG    . ASP B 2 167 ? -22.654 -31.211 19.069  1.00 43.11 ? 170 ASP A CG    1 
ATOM   2450 O  OD1   . ASP B 2 167 ? -22.342 -32.215 19.741  1.00 44.36 ? 170 ASP A OD1   1 
ATOM   2451 O  OD2   . ASP B 2 167 ? -23.803 -30.717 19.077  1.00 44.00 ? 170 ASP A OD2   1 
ATOM   2452 N  N     . VAL B 2 168 ? -21.469 -28.004 16.018  1.00 41.12 ? 171 VAL A N     1 
ATOM   2453 C  CA    . VAL B 2 168 ? -20.604 -26.985 15.433  1.00 40.71 ? 171 VAL A CA    1 
ATOM   2454 C  C     . VAL B 2 168 ? -20.408 -25.838 16.425  1.00 40.45 ? 171 VAL A C     1 
ATOM   2455 O  O     . VAL B 2 168 ? -21.350 -25.109 16.748  1.00 40.30 ? 171 VAL A O     1 
ATOM   2456 C  CB    . VAL B 2 168 ? -21.148 -26.450 14.078  1.00 40.68 ? 171 VAL A CB    1 
ATOM   2457 C  CG1   . VAL B 2 168 ? -20.236 -25.359 13.517  1.00 40.41 ? 171 VAL A CG1   1 
ATOM   2458 C  CG2   . VAL B 2 168 ? -21.295 -27.583 13.064  1.00 40.79 ? 171 VAL A CG2   1 
ATOM   2459 N  N     . LEU B 2 169 ? -19.177 -25.702 16.909  1.00 40.12 ? 172 LEU A N     1 
ATOM   2460 C  CA    . LEU B 2 169 ? -18.809 -24.627 17.820  1.00 39.94 ? 172 LEU A CA    1 
ATOM   2461 C  C     . LEU B 2 169 ? -18.207 -23.473 17.030  1.00 39.90 ? 172 LEU A C     1 
ATOM   2462 O  O     . LEU B 2 169 ? -17.250 -23.657 16.277  1.00 39.82 ? 172 LEU A O     1 
ATOM   2463 C  CB    . LEU B 2 169 ? -17.818 -25.130 18.874  1.00 39.82 ? 172 LEU A CB    1 
ATOM   2464 C  CG    . LEU B 2 169 ? -17.412 -24.163 19.990  1.00 39.64 ? 172 LEU A CG    1 
ATOM   2465 C  CD1   . LEU B 2 169 ? -18.544 -23.966 20.994  1.00 39.46 ? 172 LEU A CD1   1 
ATOM   2466 C  CD2   . LEU B 2 169 ? -16.169 -24.673 20.685  1.00 39.24 ? 172 LEU A CD2   1 
ATOM   2467 N  N     . PHE B 2 170 ? -18.773 -22.284 17.203  1.00 39.99 ? 173 PHE A N     1 
ATOM   2468 C  CA    . PHE B 2 170 ? -18.320 -21.118 16.454  1.00 40.05 ? 173 PHE A CA    1 
ATOM   2469 C  C     . PHE B 2 170 ? -18.402 -19.811 17.233  1.00 40.27 ? 173 PHE A C     1 
ATOM   2470 O  O     . PHE B 2 170 ? -19.245 -19.646 18.118  1.00 40.35 ? 173 PHE A O     1 
ATOM   2471 C  CB    . PHE B 2 170 ? -19.061 -21.006 15.111  1.00 39.92 ? 173 PHE A CB    1 
ATOM   2472 C  CG    . PHE B 2 170 ? -20.518 -20.638 15.233  1.00 39.68 ? 173 PHE A CG    1 
ATOM   2473 C  CD1   . PHE B 2 170 ? -20.944 -19.345 14.946  1.00 39.34 ? 173 PHE A CD1   1 
ATOM   2474 C  CD2   . PHE B 2 170 ? -21.469 -21.593 15.600  1.00 39.80 ? 173 PHE A CD2   1 
ATOM   2475 C  CE1   . PHE B 2 170 ? -22.294 -18.996 15.042  1.00 39.64 ? 173 PHE A CE1   1 
ATOM   2476 C  CE2   . PHE B 2 170 ? -22.819 -21.258 15.698  1.00 39.18 ? 173 PHE A CE2   1 
ATOM   2477 C  CZ    . PHE B 2 170 ? -23.233 -19.958 15.417  1.00 39.81 ? 173 PHE A CZ    1 
ATOM   2478 N  N     . ARG B 2 171 ? -17.501 -18.895 16.894  1.00 40.50 ? 174 ARG A N     1 
ATOM   2479 C  CA    . ARG B 2 171 ? -17.530 -17.539 17.415  1.00 40.94 ? 174 ARG A CA    1 
ATOM   2480 C  C     . ARG B 2 171 ? -18.177 -16.628 16.373  1.00 40.79 ? 174 ARG A C     1 
ATOM   2481 O  O     . ARG B 2 171 ? -17.956 -16.792 15.173  1.00 40.90 ? 174 ARG A O     1 
ATOM   2482 C  CB    . ARG B 2 171 ? -16.112 -17.067 17.745  1.00 41.10 ? 174 ARG A CB    1 
ATOM   2483 C  CG    . ARG B 2 171 ? -16.054 -15.946 18.765  1.00 42.69 ? 174 ARG A CG    1 
ATOM   2484 C  CD    . ARG B 2 171 ? -14.642 -15.403 18.919  1.00 44.96 ? 174 ARG A CD    1 
ATOM   2485 N  NE    . ARG B 2 171 ? -13.798 -16.237 19.775  1.00 46.78 ? 174 ARG A NE    1 
ATOM   2486 C  CZ    . ARG B 2 171 ? -13.514 -15.974 21.051  1.00 47.86 ? 174 ARG A CZ    1 
ATOM   2487 N  NH1   . ARG B 2 171 ? -14.007 -14.893 21.649  1.00 48.22 ? 174 ARG A NH1   1 
ATOM   2488 N  NH2   . ARG B 2 171 ? -12.727 -16.798 21.735  1.00 48.15 ? 174 ARG A NH2   1 
ATOM   2489 N  N     . VAL B 2 172 ? -18.982 -15.675 16.834  1.00 40.68 ? 175 VAL A N     1 
ATOM   2490 C  CA    . VAL B 2 172 ? -19.726 -14.802 15.933  1.00 40.61 ? 175 VAL A CA    1 
ATOM   2491 C  C     . VAL B 2 172 ? -19.822 -13.369 16.471  1.00 40.88 ? 175 VAL A C     1 
ATOM   2492 O  O     . VAL B 2 172 ? -20.204 -13.146 17.618  1.00 40.85 ? 175 VAL A O     1 
ATOM   2493 C  CB    . VAL B 2 172 ? -21.133 -15.402 15.568  1.00 40.50 ? 175 VAL A CB    1 
ATOM   2494 C  CG1   . VAL B 2 172 ? -22.002 -15.632 16.814  1.00 40.37 ? 175 VAL A CG1   1 
ATOM   2495 C  CG2   . VAL B 2 172 ? -21.857 -14.542 14.535  1.00 39.90 ? 175 VAL A CG2   1 
ATOM   2496 N  N     . GLY B 2 173 ? -19.446 -12.411 15.628  1.00 41.15 ? 176 GLY A N     1 
ATOM   2497 C  CA    . GLY B 2 173 ? -19.556 -10.990 15.948  1.00 41.53 ? 176 GLY A CA    1 
ATOM   2498 C  C     . GLY B 2 173 ? -20.698 -10.388 15.160  1.00 41.68 ? 176 GLY A C     1 
ATOM   2499 O  O     . GLY B 2 173 ? -20.743 -10.513 13.936  1.00 41.78 ? 176 GLY A O     1 
ATOM   2500 N  N     . VAL B 2 174 ? -21.624 -9.742  15.864  1.00 41.82 ? 177 VAL A N     1 
ATOM   2501 C  CA    . VAL B 2 174 ? -22.865 -9.261  15.258  1.00 42.08 ? 177 VAL A CA    1 
ATOM   2502 C  C     . VAL B 2 174 ? -23.227 -7.826  15.644  1.00 42.34 ? 177 VAL A C     1 
ATOM   2503 O  O     . VAL B 2 174 ? -22.788 -7.312  16.678  1.00 42.23 ? 177 VAL A O     1 
ATOM   2504 C  CB    . VAL B 2 174 ? -24.077 -10.181 15.601  1.00 42.04 ? 177 VAL A CB    1 
ATOM   2505 C  CG1   . VAL B 2 174 ? -23.965 -11.534 14.903  1.00 42.24 ? 177 VAL A CG1   1 
ATOM   2506 C  CG2   . VAL B 2 174 ? -24.242 -10.350 17.108  1.00 41.90 ? 177 VAL A CG2   1 
ATOM   2507 N  N     . GLU B 2 175 ? -24.036 -7.197  14.793  1.00 42.67 ? 178 GLU A N     1 
ATOM   2508 C  CA    . GLU B 2 175 ? -24.685 -5.929  15.098  1.00 43.00 ? 178 GLU A CA    1 
ATOM   2509 C  C     . GLU B 2 175 ? -25.693 -6.156  16.225  1.00 43.16 ? 178 GLU A C     1 
ATOM   2510 O  O     . GLU B 2 175 ? -26.226 -7.261  16.375  1.00 43.10 ? 178 GLU A O     1 
ATOM   2511 C  CB    . GLU B 2 175 ? -25.397 -5.401  13.848  1.00 43.03 ? 178 GLU A CB    1 
ATOM   2512 C  CG    . GLU B 2 175 ? -25.796 -3.924  13.897  1.00 43.26 ? 178 GLU A CG    1 
ATOM   2513 C  CD    . GLU B 2 175 ? -26.486 -3.441  12.627  1.00 43.31 ? 178 GLU A CD    1 
ATOM   2514 O  OE1   . GLU B 2 175 ? -26.700 -4.250  11.699  1.00 43.74 ? 178 GLU A OE1   1 
ATOM   2515 O  OE2   . GLU B 2 175 ? -26.816 -2.237  12.554  1.00 44.70 ? 178 GLU A OE2   1 
ATOM   2516 N  N     . ALA B 2 176 ? -25.940 -5.115  17.019  1.00 43.44 ? 179 ALA A N     1 
ATOM   2517 C  CA    . ALA B 2 176 ? -26.936 -5.164  18.090  1.00 43.57 ? 179 ALA A CA    1 
ATOM   2518 C  C     . ALA B 2 176 ? -28.310 -5.530  17.539  1.00 43.74 ? 179 ALA A C     1 
ATOM   2519 O  O     . ALA B 2 176 ? -28.705 -5.057  16.474  1.00 43.66 ? 179 ALA A O     1 
ATOM   2520 C  CB    . ALA B 2 176 ? -26.998 -3.835  18.812  1.00 43.70 ? 179 ALA A CB    1 
ATOM   2521 N  N     . GLY B 2 177 ? -29.026 -6.382  18.265  1.00 43.98 ? 180 GLY A N     1 
ATOM   2522 C  CA    . GLY B 2 177 ? -30.343 -6.838  17.837  1.00 44.45 ? 180 GLY A CA    1 
ATOM   2523 C  C     . GLY B 2 177 ? -30.316 -8.068  16.941  1.00 44.66 ? 180 GLY A C     1 
ATOM   2524 O  O     . GLY B 2 177 ? -31.345 -8.451  16.377  1.00 44.61 ? 180 GLY A O     1 
ATOM   2525 N  N     . THR B 2 178 ? -29.143 -8.682  16.799  1.00 44.89 ? 181 THR A N     1 
ATOM   2526 C  CA    . THR B 2 178 ? -29.032 -9.931  16.047  1.00 45.16 ? 181 THR A CA    1 
ATOM   2527 C  C     . THR B 2 178 ? -29.285 -11.103 16.981  1.00 45.29 ? 181 THR A C     1 
ATOM   2528 O  O     . THR B 2 178 ? -28.575 -11.291 17.974  1.00 45.50 ? 181 THR A O     1 
ATOM   2529 C  CB    . THR B 2 178 ? -27.665 -10.101 15.349  1.00 45.13 ? 181 THR A CB    1 
ATOM   2530 O  OG1   . THR B 2 178 ? -27.319 -8.900  14.651  1.00 44.97 ? 181 THR A OG1   1 
ATOM   2531 C  CG2   . THR B 2 178 ? -27.711 -11.256 14.352  1.00 45.32 ? 181 THR A CG2   1 
ATOM   2532 N  N     . TYR B 2 179 ? -30.314 -11.875 16.647  1.00 45.42 ? 182 TYR A N     1 
ATOM   2533 C  CA    . TYR B 2 179 ? -30.749 -13.019 17.433  1.00 45.56 ? 182 TYR A CA    1 
ATOM   2534 C  C     . TYR B 2 179 ? -30.011 -14.264 16.941  1.00 45.00 ? 182 TYR A C     1 
ATOM   2535 O  O     . TYR B 2 179 ? -30.237 -14.727 15.822  1.00 44.84 ? 182 TYR A O     1 
ATOM   2536 C  CB    . TYR B 2 179 ? -32.271 -13.175 17.296  1.00 46.25 ? 182 TYR A CB    1 
ATOM   2537 C  CG    . TYR B 2 179 ? -32.948 -14.032 18.347  1.00 47.54 ? 182 TYR A CG    1 
ATOM   2538 C  CD1   . TYR B 2 179 ? -32.716 -13.825 19.708  1.00 48.70 ? 182 TYR A CD1   1 
ATOM   2539 C  CD2   . TYR B 2 179 ? -33.854 -15.028 17.978  1.00 48.26 ? 182 TYR A CD2   1 
ATOM   2540 C  CE1   . TYR B 2 179 ? -33.347 -14.612 20.673  1.00 48.96 ? 182 TYR A CE1   1 
ATOM   2541 C  CE2   . TYR B 2 179 ? -34.495 -15.812 18.934  1.00 48.64 ? 182 TYR A CE2   1 
ATOM   2542 C  CZ    . TYR B 2 179 ? -34.235 -15.599 20.278  1.00 48.44 ? 182 TYR A CZ    1 
ATOM   2543 O  OH    . TYR B 2 179 ? -34.867 -16.370 21.229  1.00 48.63 ? 182 TYR A OH    1 
ATOM   2544 N  N     . ILE B 2 180 ? -29.116 -14.782 17.780  1.00 44.43 ? 183 ILE A N     1 
ATOM   2545 C  CA    . ILE B 2 180 ? -28.243 -15.900 17.410  1.00 43.92 ? 183 ILE A CA    1 
ATOM   2546 C  C     . ILE B 2 180 ? -29.038 -17.193 17.215  1.00 43.54 ? 183 ILE A C     1 
ATOM   2547 O  O     . ILE B 2 180 ? -28.746 -17.969 16.307  1.00 43.38 ? 183 ILE A O     1 
ATOM   2548 C  CB    . ILE B 2 180 ? -27.080 -16.097 18.436  1.00 43.89 ? 183 ILE A CB    1 
ATOM   2549 C  CG1   . ILE B 2 180 ? -26.301 -14.787 18.647  1.00 44.03 ? 183 ILE A CG1   1 
ATOM   2550 C  CG2   . ILE B 2 180 ? -26.142 -17.236 18.017  1.00 43.43 ? 183 ILE A CG2   1 
ATOM   2551 C  CD1   . ILE B 2 180 ? -25.683 -14.170 17.381  1.00 43.41 ? 183 ILE A CD1   1 
ATOM   2552 N  N     . ARG B 2 181 ? -30.044 -17.400 18.064  1.00 43.17 ? 184 ARG A N     1 
ATOM   2553 C  CA    . ARG B 2 181 ? -30.982 -18.519 17.934  1.00 42.92 ? 184 ARG A CA    1 
ATOM   2554 C  C     . ARG B 2 181 ? -31.592 -18.563 16.531  1.00 42.22 ? 184 ARG A C     1 
ATOM   2555 O  O     . ARG B 2 181 ? -31.715 -19.633 15.931  1.00 42.15 ? 184 ARG A O     1 
ATOM   2556 C  CB    . ARG B 2 181 ? -32.099 -18.395 18.973  1.00 43.13 ? 184 ARG A CB    1 
ATOM   2557 C  CG    . ARG B 2 181 ? -32.958 -19.640 19.148  1.00 44.64 ? 184 ARG A CG    1 
ATOM   2558 C  CD    . ARG B 2 181 ? -32.711 -20.274 20.503  1.00 47.98 ? 184 ARG A CD    1 
ATOM   2559 N  NE    . ARG B 2 181 ? -32.996 -21.709 20.520  1.00 50.04 ? 184 ARG A NE    1 
ATOM   2560 C  CZ    . ARG B 2 181 ? -32.650 -22.528 21.510  1.00 50.95 ? 184 ARG A CZ    1 
ATOM   2561 N  NH1   . ARG B 2 181 ? -32.005 -22.061 22.574  1.00 51.66 ? 184 ARG A NH1   1 
ATOM   2562 N  NH2   . ARG B 2 181 ? -32.946 -23.819 21.437  1.00 51.78 ? 184 ARG A NH2   1 
ATOM   2563 N  N     . SER B 2 182 ? -31.968 -17.391 16.026  1.00 41.37 ? 185 SER A N     1 
ATOM   2564 C  CA    . SER B 2 182 ? -32.567 -17.257 14.704  1.00 40.88 ? 185 SER A CA    1 
ATOM   2565 C  C     . SER B 2 182 ? -31.545 -17.512 13.591  1.00 40.39 ? 185 SER A C     1 
ATOM   2566 O  O     . SER B 2 182 ? -31.845 -18.211 12.619  1.00 40.34 ? 185 SER A O     1 
ATOM   2567 C  CB    . SER B 2 182 ? -33.199 -15.871 14.548  1.00 40.87 ? 185 SER A CB    1 
ATOM   2568 O  OG    . SER B 2 182 ? -33.837 -15.747 13.292  1.00 41.17 ? 185 SER A OG    1 
ATOM   2569 N  N     . LEU B 2 183 ? -30.349 -16.942 13.746  1.00 39.70 ? 186 LEU A N     1 
ATOM   2570 C  CA    . LEU B 2 183 ? -29.231 -17.160 12.824  1.00 39.35 ? 186 LEU A CA    1 
ATOM   2571 C  C     . LEU B 2 183 ? -28.927 -18.650 12.629  1.00 38.86 ? 186 LEU A C     1 
ATOM   2572 O  O     . LEU B 2 183 ? -28.706 -19.102 11.506  1.00 38.71 ? 186 LEU A O     1 
ATOM   2573 C  CB    . LEU B 2 183 ? -27.977 -16.417 13.317  1.00 39.24 ? 186 LEU A CB    1 
ATOM   2574 C  CG    . LEU B 2 183 ? -26.608 -16.727 12.686  1.00 39.64 ? 186 LEU A CG    1 
ATOM   2575 C  CD1   . LEU B 2 183 ? -26.539 -16.319 11.211  1.00 39.43 ? 186 LEU A CD1   1 
ATOM   2576 C  CD2   . LEU B 2 183 ? -25.476 -16.071 13.474  1.00 39.63 ? 186 LEU A CD2   1 
ATOM   2577 N  N     . ILE B 2 184 ? -28.923 -19.397 13.729  1.00 38.31 ? 187 ILE A N     1 
ATOM   2578 C  CA    . ILE B 2 184 ? -28.640 -20.827 13.698  1.00 38.21 ? 187 ILE A CA    1 
ATOM   2579 C  C     . ILE B 2 184 ? -29.765 -21.610 13.011  1.00 37.87 ? 187 ILE A C     1 
ATOM   2580 O  O     . ILE B 2 184 ? -29.501 -22.498 12.192  1.00 37.87 ? 187 ILE A O     1 
ATOM   2581 C  CB    . ILE B 2 184 ? -28.326 -21.370 15.119  1.00 38.26 ? 187 ILE A CB    1 
ATOM   2582 C  CG1   . ILE B 2 184 ? -26.916 -20.923 15.530  1.00 38.46 ? 187 ILE A CG1   1 
ATOM   2583 C  CG2   . ILE B 2 184 ? -28.471 -22.895 15.170  1.00 37.74 ? 187 ILE A CG2   1 
ATOM   2584 C  CD1   . ILE B 2 184 ? -26.540 -21.201 16.968  1.00 38.44 ? 187 ILE A CD1   1 
ATOM   2585 N  N     . HIS B 2 185 ? -31.009 -21.263 13.335  1.00 37.59 ? 188 HIS A N     1 
ATOM   2586 C  CA    . HIS B 2 185 ? -32.179 -21.855 12.690  1.00 37.41 ? 188 HIS A CA    1 
ATOM   2587 C  C     . HIS B 2 185 ? -32.125 -21.677 11.174  1.00 37.17 ? 188 HIS A C     1 
ATOM   2588 O  O     . HIS B 2 185 ? -32.438 -22.601 10.427  1.00 37.17 ? 188 HIS A O     1 
ATOM   2589 C  CB    . HIS B 2 185 ? -33.470 -21.254 13.257  1.00 37.49 ? 188 HIS A CB    1 
ATOM   2590 C  CG    . HIS B 2 185 ? -34.710 -21.711 12.552  1.00 37.85 ? 188 HIS A CG    1 
ATOM   2591 N  ND1   . HIS B 2 185 ? -35.270 -22.953 12.759  1.00 38.40 ? 188 HIS A ND1   1 
ATOM   2592 C  CD2   . HIS B 2 185 ? -35.494 -21.093 11.638  1.00 38.29 ? 188 HIS A CD2   1 
ATOM   2593 C  CE1   . HIS B 2 185 ? -36.346 -23.080 12.003  1.00 38.60 ? 188 HIS A CE1   1 
ATOM   2594 N  NE2   . HIS B 2 185 ? -36.505 -21.965 11.314  1.00 38.55 ? 188 HIS A NE2   1 
ATOM   2595 N  N     . HIS B 2 186 ? -31.710 -20.492 10.730  1.00 37.06 ? 189 HIS A N     1 
ATOM   2596 C  CA    . HIS B 2 186 ? -31.577 -20.202 9.304   1.00 37.01 ? 189 HIS A CA    1 
ATOM   2597 C  C     . HIS B 2 186 ? -30.420 -20.948 8.631   1.00 37.02 ? 189 HIS A C     1 
ATOM   2598 O  O     . HIS B 2 186 ? -30.544 -21.368 7.481   1.00 36.98 ? 189 HIS A O     1 
ATOM   2599 C  CB    . HIS B 2 186 ? -31.476 -18.694 9.065   1.00 37.03 ? 189 HIS A CB    1 
ATOM   2600 C  CG    . HIS B 2 186 ? -32.777 -17.971 9.236   1.00 36.70 ? 189 HIS A CG    1 
ATOM   2601 N  ND1   . HIS B 2 186 ? -32.878 -16.766 9.895   1.00 37.05 ? 189 HIS A ND1   1 
ATOM   2602 C  CD2   . HIS B 2 186 ? -34.034 -18.292 8.847   1.00 36.61 ? 189 HIS A CD2   1 
ATOM   2603 C  CE1   . HIS B 2 186 ? -34.137 -16.367 9.892   1.00 37.13 ? 189 HIS A CE1   1 
ATOM   2604 N  NE2   . HIS B 2 186 ? -34.860 -17.276 9.262   1.00 37.02 ? 189 HIS A NE2   1 
ATOM   2605 N  N     . ILE B 2 187 ? -29.305 -21.105 9.344   1.00 37.02 ? 190 ILE A N     1 
ATOM   2606 C  CA    . ILE B 2 187 ? -28.173 -21.896 8.848   1.00 37.17 ? 190 ILE A CA    1 
ATOM   2607 C  C     . ILE B 2 187 ? -28.602 -23.357 8.638   1.00 37.18 ? 190 ILE A C     1 
ATOM   2608 O  O     . ILE B 2 187 ? -28.263 -23.971 7.623   1.00 37.11 ? 190 ILE A O     1 
ATOM   2609 C  CB    . ILE B 2 187 ? -26.926 -21.782 9.780   1.00 37.14 ? 190 ILE A CB    1 
ATOM   2610 C  CG1   . ILE B 2 187 ? -26.339 -20.365 9.715   1.00 37.31 ? 190 ILE A CG1   1 
ATOM   2611 C  CG2   . ILE B 2 187 ? -25.853 -22.795 9.393   1.00 36.80 ? 190 ILE A CG2   1 
ATOM   2612 C  CD1   . ILE B 2 187 ? -25.387 -20.017 10.856  1.00 37.28 ? 190 ILE A CD1   1 
ATOM   2613 N  N     . GLY B 2 188 ? -29.372 -23.887 9.588   1.00 37.27 ? 191 GLY A N     1 
ATOM   2614 C  CA    . GLY B 2 188 ? -29.946 -25.230 9.482   1.00 37.49 ? 191 GLY A CA    1 
ATOM   2615 C  C     . GLY B 2 188 ? -30.843 -25.429 8.271   1.00 37.71 ? 191 GLY A C     1 
ATOM   2616 O  O     . GLY B 2 188 ? -30.850 -26.504 7.675   1.00 37.71 ? 191 GLY A O     1 
ATOM   2617 N  N     . LEU B 2 189 ? -31.594 -24.390 7.904   1.00 37.95 ? 192 LEU A N     1 
ATOM   2618 C  CA    . LEU B 2 189 ? -32.456 -24.435 6.720   1.00 38.15 ? 192 LEU A CA    1 
ATOM   2619 C  C     . LEU B 2 189 ? -31.645 -24.377 5.428   1.00 38.40 ? 192 LEU A C     1 
ATOM   2620 O  O     . LEU B 2 189 ? -31.956 -25.080 4.460   1.00 38.37 ? 192 LEU A O     1 
ATOM   2621 C  CB    . LEU B 2 189 ? -33.489 -23.304 6.747   1.00 38.15 ? 192 LEU A CB    1 
ATOM   2622 C  CG    . LEU B 2 189 ? -34.620 -23.357 7.779   1.00 38.34 ? 192 LEU A CG    1 
ATOM   2623 C  CD1   . LEU B 2 189 ? -35.410 -22.060 7.757   1.00 38.34 ? 192 LEU A CD1   1 
ATOM   2624 C  CD2   . LEU B 2 189 ? -35.544 -24.554 7.546   1.00 38.08 ? 192 LEU A CD2   1 
ATOM   2625 N  N     . ALA B 2 190 ? -30.609 -23.539 5.424   1.00 38.57 ? 193 ALA A N     1 
ATOM   2626 C  CA    . ALA B 2 190 ? -29.690 -23.424 4.289   1.00 38.93 ? 193 ALA A CA    1 
ATOM   2627 C  C     . ALA B 2 190 ? -28.876 -24.705 4.080   1.00 39.17 ? 193 ALA A C     1 
ATOM   2628 O  O     . ALA B 2 190 ? -28.475 -25.016 2.959   1.00 39.24 ? 193 ALA A O     1 
ATOM   2629 C  CB    . ALA B 2 190 ? -28.769 -22.227 4.475   1.00 38.81 ? 193 ALA A CB    1 
ATOM   2630 N  N     . LEU B 2 191 ? -28.641 -25.439 5.166   1.00 39.55 ? 194 LEU A N     1 
ATOM   2631 C  CA    . LEU B 2 191 ? -27.941 -26.722 5.110   1.00 39.90 ? 194 LEU A CA    1 
ATOM   2632 C  C     . LEU B 2 191 ? -28.894 -27.885 4.836   1.00 40.06 ? 194 LEU A C     1 
ATOM   2633 O  O     . LEU B 2 191 ? -28.453 -29.001 4.546   1.00 40.27 ? 194 LEU A O     1 
ATOM   2634 C  CB    . LEU B 2 191 ? -27.160 -26.971 6.406   1.00 39.90 ? 194 LEU A CB    1 
ATOM   2635 C  CG    . LEU B 2 191 ? -25.876 -26.164 6.628   1.00 40.03 ? 194 LEU A CG    1 
ATOM   2636 C  CD1   . LEU B 2 191 ? -25.410 -26.305 8.060   1.00 40.08 ? 194 LEU A CD1   1 
ATOM   2637 C  CD2   . LEU B 2 191 ? -24.775 -26.589 5.670   1.00 40.20 ? 194 LEU A CD2   1 
ATOM   2638 N  N     . GLY B 2 192 ? -30.195 -27.618 4.946   1.00 40.19 ? 195 GLY A N     1 
ATOM   2639 C  CA    . GLY B 2 192 ? -31.229 -28.602 4.635   1.00 40.17 ? 195 GLY A CA    1 
ATOM   2640 C  C     . GLY B 2 192 ? -31.692 -29.430 5.818   1.00 40.24 ? 195 GLY A C     1 
ATOM   2641 O  O     . GLY B 2 192 ? -32.891 -29.633 6.010   1.00 40.45 ? 195 GLY A O     1 
ATOM   2642 N  N     . VAL B 2 193 ? -30.741 -29.902 6.618   1.00 40.08 ? 196 VAL A N     1 
ATOM   2643 C  CA    . VAL B 2 193 ? -31.032 -30.854 7.693   1.00 39.84 ? 196 VAL A CA    1 
ATOM   2644 C  C     . VAL B 2 193 ? -31.707 -30.237 8.924   1.00 39.71 ? 196 VAL A C     1 
ATOM   2645 O  O     . VAL B 2 193 ? -32.316 -30.946 9.724   1.00 39.38 ? 196 VAL A O     1 
ATOM   2646 C  CB    . VAL B 2 193 ? -29.761 -31.629 8.123   1.00 39.97 ? 196 VAL A CB    1 
ATOM   2647 C  CG1   . VAL B 2 193 ? -29.207 -32.449 6.953   1.00 39.96 ? 196 VAL A CG1   1 
ATOM   2648 C  CG2   . VAL B 2 193 ? -28.699 -30.681 8.678   1.00 40.22 ? 196 VAL A CG2   1 
ATOM   2649 N  N     . GLY B 2 194 ? -31.602 -28.917 9.062   1.00 39.53 ? 197 GLY A N     1 
ATOM   2650 C  CA    . GLY B 2 194 ? -32.108 -28.221 10.239  1.00 39.58 ? 197 GLY A CA    1 
ATOM   2651 C  C     . GLY B 2 194 ? -31.067 -28.159 11.340  1.00 39.67 ? 197 GLY A C     1 
ATOM   2652 O  O     . GLY B 2 194 ? -30.136 -28.964 11.374  1.00 39.59 ? 197 GLY A O     1 
ATOM   2653 N  N     . ALA B 2 195 ? -31.227 -27.194 12.241  1.00 39.96 ? 198 ALA A N     1 
ATOM   2654 C  CA    . ALA B 2 195 ? -30.301 -27.006 13.356  1.00 40.27 ? 198 ALA A CA    1 
ATOM   2655 C  C     . ALA B 2 195 ? -30.937 -26.188 14.468  1.00 40.54 ? 198 ALA A C     1 
ATOM   2656 O  O     . ALA B 2 195 ? -31.881 -25.427 14.233  1.00 40.77 ? 198 ALA A O     1 
ATOM   2657 C  CB    . ALA B 2 195 ? -29.018 -26.330 12.879  1.00 40.31 ? 198 ALA A CB    1 
ATOM   2658 N  N     . HIS B 2 196 ? -30.418 -26.351 15.681  1.00 40.72 ? 199 HIS A N     1 
ATOM   2659 C  CA    . HIS B 2 196 ? -30.821 -25.511 16.800  1.00 40.88 ? 199 HIS A CA    1 
ATOM   2660 C  C     . HIS B 2 196 ? -29.624 -25.088 17.646  1.00 41.15 ? 199 HIS A C     1 
ATOM   2661 O  O     . HIS B 2 196 ? -28.565 -25.720 17.608  1.00 41.17 ? 199 HIS A O     1 
ATOM   2662 C  CB    . HIS B 2 196 ? -31.895 -26.198 17.656  1.00 40.87 ? 199 HIS A CB    1 
ATOM   2663 C  CG    . HIS B 2 196 ? -31.371 -27.275 18.557  1.00 40.64 ? 199 HIS A CG    1 
ATOM   2664 N  ND1   . HIS B 2 196 ? -31.304 -28.598 18.176  1.00 40.74 ? 199 HIS A ND1   1 
ATOM   2665 C  CD2   . HIS B 2 196 ? -30.913 -27.228 19.830  1.00 40.61 ? 199 HIS A CD2   1 
ATOM   2666 C  CE1   . HIS B 2 196 ? -30.820 -29.319 19.172  1.00 40.48 ? 199 HIS A CE1   1 
ATOM   2667 N  NE2   . HIS B 2 196 ? -30.572 -28.511 20.187  1.00 40.82 ? 199 HIS A NE2   1 
ATOM   2668 N  N     . MET B 2 197 ? -29.810 -24.003 18.391  1.00 41.43 ? 200 MET A N     1 
ATOM   2669 C  CA    . MET B 2 197 ? -28.821 -23.506 19.333  1.00 41.83 ? 200 MET A CA    1 
ATOM   2670 C  C     . MET B 2 197 ? -28.972 -24.273 20.645  1.00 42.08 ? 200 MET A C     1 
ATOM   2671 O  O     . MET B 2 197 ? -29.992 -24.158 21.320  1.00 42.41 ? 200 MET A O     1 
ATOM   2672 C  CB    . MET B 2 197 ? -29.041 -22.007 19.560  1.00 41.73 ? 200 MET A CB    1 
ATOM   2673 C  CG    . MET B 2 197 ? -27.911 -21.282 20.268  1.00 41.56 ? 200 MET A CG    1 
ATOM   2674 S  SD    . MET B 2 197 ? -28.241 -19.514 20.404  1.00 41.74 ? 200 MET A SD    1 
ATOM   2675 C  CE    . MET B 2 197 ? -29.323 -19.484 21.834  1.00 41.58 ? 200 MET A CE    1 
ATOM   2676 N  N     . SER B 2 198 ? -27.965 -25.065 20.998  1.00 42.37 ? 201 SER A N     1 
ATOM   2677 C  CA    . SER B 2 198 ? -28.014 -25.834 22.240  1.00 42.57 ? 201 SER A CA    1 
ATOM   2678 C  C     . SER B 2 198 ? -27.316 -25.120 23.397  1.00 42.57 ? 201 SER A C     1 
ATOM   2679 O  O     . SER B 2 198 ? -27.552 -25.445 24.558  1.00 42.69 ? 201 SER A O     1 
ATOM   2680 C  CB    . SER B 2 198 ? -27.426 -27.236 22.042  1.00 42.74 ? 201 SER A CB    1 
ATOM   2681 O  OG    . SER B 2 198 ? -26.029 -27.182 21.816  1.00 43.36 ? 201 SER A OG    1 
ATOM   2682 N  N     . GLU B 2 199 ? -26.474 -24.140 23.074  1.00 42.71 ? 202 GLU A N     1 
ATOM   2683 C  CA    . GLU B 2 199 ? -25.690 -23.425 24.079  1.00 42.80 ? 202 GLU A CA    1 
ATOM   2684 C  C     . GLU B 2 199 ? -25.197 -22.077 23.550  1.00 42.78 ? 202 GLU A C     1 
ATOM   2685 O  O     . GLU B 2 199 ? -24.759 -21.974 22.403  1.00 42.79 ? 202 GLU A O     1 
ATOM   2686 C  CB    . GLU B 2 199 ? -24.503 -24.286 24.517  1.00 42.77 ? 202 GLU A CB    1 
ATOM   2687 C  CG    . GLU B 2 199 ? -24.058 -24.075 25.953  1.00 43.43 ? 202 GLU A CG    1 
ATOM   2688 C  CD    . GLU B 2 199 ? -23.160 -25.195 26.452  1.00 44.17 ? 202 GLU A CD    1 
ATOM   2689 O  OE1   . GLU B 2 199 ? -23.438 -26.375 26.141  1.00 44.90 ? 202 GLU A OE1   1 
ATOM   2690 O  OE2   . GLU B 2 199 ? -22.177 -24.898 27.160  1.00 44.44 ? 202 GLU A OE2   1 
ATOM   2691 N  N     . LEU B 2 200 ? -25.270 -21.050 24.396  1.00 42.79 ? 203 LEU A N     1 
ATOM   2692 C  CA    . LEU B 2 200 ? -24.819 -19.708 24.032  1.00 42.81 ? 203 LEU A CA    1 
ATOM   2693 C  C     . LEU B 2 200 ? -24.072 -19.019 25.176  1.00 43.02 ? 203 LEU A C     1 
ATOM   2694 O  O     . LEU B 2 200 ? -24.451 -19.136 26.345  1.00 42.86 ? 203 LEU A O     1 
ATOM   2695 C  CB    . LEU B 2 200 ? -25.999 -18.842 23.567  1.00 42.77 ? 203 LEU A CB    1 
ATOM   2696 C  CG    . LEU B 2 200 ? -25.682 -17.480 22.923  1.00 42.77 ? 203 LEU A CG    1 
ATOM   2697 C  CD1   . LEU B 2 200 ? -24.927 -17.641 21.609  1.00 42.36 ? 203 LEU A CD1   1 
ATOM   2698 C  CD2   . LEU B 2 200 ? -26.944 -16.658 22.706  1.00 42.51 ? 203 LEU A CD2   1 
ATOM   2699 N  N     . ARG B 2 201 ? -23.005 -18.306 24.819  1.00 43.21 ? 204 ARG A N     1 
ATOM   2700 C  CA    . ARG B 2 201 ? -22.245 -17.492 25.763  1.00 43.37 ? 204 ARG A CA    1 
ATOM   2701 C  C     . ARG B 2 201 ? -21.802 -16.194 25.094  1.00 43.67 ? 204 ARG A C     1 
ATOM   2702 O  O     . ARG B 2 201 ? -21.200 -16.220 24.020  1.00 43.87 ? 204 ARG A O     1 
ATOM   2703 C  CB    . ARG B 2 201 ? -21.037 -18.272 26.299  1.00 43.26 ? 204 ARG A CB    1 
ATOM   2704 C  CG    . ARG B 2 201 ? -20.073 -17.457 27.160  1.00 43.33 ? 204 ARG A CG    1 
ATOM   2705 C  CD    . ARG B 2 201 ? -19.043 -18.349 27.839  1.00 43.03 ? 204 ARG A CD    1 
ATOM   2706 N  NE    . ARG B 2 201 ? -18.077 -17.591 28.635  1.00 42.45 ? 204 ARG A NE    1 
ATOM   2707 C  CZ    . ARG B 2 201 ? -18.284 -17.153 29.876  1.00 42.32 ? 204 ARG A CZ    1 
ATOM   2708 N  NH1   . ARG B 2 201 ? -19.439 -17.378 30.493  1.00 42.32 ? 204 ARG A NH1   1 
ATOM   2709 N  NH2   . ARG B 2 201 ? -17.330 -16.476 30.502  1.00 42.15 ? 204 ARG A NH2   1 
ATOM   2710 N  N     . ARG B 2 202 ? -22.110 -15.064 25.728  1.00 43.91 ? 205 ARG A N     1 
ATOM   2711 C  CA    . ARG B 2 202 ? -21.641 -13.765 25.247  1.00 44.06 ? 205 ARG A CA    1 
ATOM   2712 C  C     . ARG B 2 202 ? -20.210 -13.518 25.718  1.00 44.20 ? 205 ARG A C     1 
ATOM   2713 O  O     . ARG B 2 202 ? -19.908 -13.622 26.909  1.00 43.90 ? 205 ARG A O     1 
ATOM   2714 C  CB    . ARG B 2 202 ? -22.568 -12.634 25.708  1.00 44.23 ? 205 ARG A CB    1 
ATOM   2715 C  CG    . ARG B 2 202 ? -22.312 -11.293 25.013  1.00 44.66 ? 205 ARG A CG    1 
ATOM   2716 C  CD    . ARG B 2 202 ? -22.877 -10.138 25.813  1.00 46.14 ? 205 ARG A CD    1 
ATOM   2717 N  NE    . ARG B 2 202 ? -24.175 -9.687  25.323  1.00 47.48 ? 205 ARG A NE    1 
ATOM   2718 C  CZ    . ARG B 2 202 ? -25.018 -8.918  26.010  1.00 47.78 ? 205 ARG A CZ    1 
ATOM   2719 N  NH1   . ARG B 2 202 ? -24.726 -8.517  27.243  1.00 48.20 ? 205 ARG A NH1   1 
ATOM   2720 N  NH2   . ARG B 2 202 ? -26.169 -8.562  25.464  1.00 47.85 ? 205 ARG A NH2   1 
ATOM   2721 N  N     . THR B 2 203 ? -19.336 -13.197 24.769  1.00 44.43 ? 206 THR A N     1 
ATOM   2722 C  CA    . THR B 2 203 ? -17.918 -12.995 25.049  1.00 44.72 ? 206 THR A CA    1 
ATOM   2723 C  C     . THR B 2 203 ? -17.519 -11.524 24.918  1.00 44.90 ? 206 THR A C     1 
ATOM   2724 O  O     . THR B 2 203 ? -16.414 -11.133 25.298  1.00 44.73 ? 206 THR A O     1 
ATOM   2725 C  CB    . THR B 2 203 ? -17.038 -13.858 24.123  1.00 44.77 ? 206 THR A CB    1 
ATOM   2726 O  OG1   . THR B 2 203 ? -17.362 -13.578 22.755  1.00 45.00 ? 206 THR A OG1   1 
ATOM   2727 C  CG2   . THR B 2 203 ? -17.263 -15.337 24.401  1.00 44.61 ? 206 THR A CG2   1 
ATOM   2728 N  N     . ARG B 2 204 ? -18.429 -10.717 24.384  1.00 45.29 ? 207 ARG A N     1 
ATOM   2729 C  CA    . ARG B 2 204 ? -18.200 -9.288  24.239  1.00 45.93 ? 207 ARG A CA    1 
ATOM   2730 C  C     . ARG B 2 204 ? -19.509 -8.509  24.209  1.00 46.01 ? 207 ARG A C     1 
ATOM   2731 O  O     . ARG B 2 204 ? -20.463 -8.904  23.539  1.00 46.01 ? 207 ARG A O     1 
ATOM   2732 C  CB    . ARG B 2 204 ? -17.374 -9.002  22.979  1.00 46.08 ? 207 ARG A CB    1 
ATOM   2733 C  CG    . ARG B 2 204 ? -16.830 -7.596  22.903  1.00 47.43 ? 207 ARG A CG    1 
ATOM   2734 C  CD    . ARG B 2 204 ? -15.702 -7.490  21.905  1.00 49.18 ? 207 ARG A CD    1 
ATOM   2735 N  NE    . ARG B 2 204 ? -15.119 -6.152  21.927  1.00 50.24 ? 207 ARG A NE    1 
ATOM   2736 C  CZ    . ARG B 2 204 ? -14.201 -5.716  21.072  1.00 50.95 ? 207 ARG A CZ    1 
ATOM   2737 N  NH1   . ARG B 2 204 ? -13.744 -6.509  20.110  1.00 50.96 ? 207 ARG A NH1   1 
ATOM   2738 N  NH2   . ARG B 2 204 ? -13.740 -4.478  21.182  1.00 51.86 ? 207 ARG A NH2   1 
ATOM   2739 N  N     . SER B 2 205 ? -19.543 -7.407  24.954  1.00 46.24 ? 208 SER A N     1 
ATOM   2740 C  CA    . SER B 2 205 ? -20.649 -6.456  24.899  1.00 46.50 ? 208 SER A CA    1 
ATOM   2741 C  C     . SER B 2 205 ? -20.071 -5.047  24.794  1.00 46.41 ? 208 SER A C     1 
ATOM   2742 O  O     . SER B 2 205 ? -19.740 -4.418  25.805  1.00 46.49 ? 208 SER A O     1 
ATOM   2743 C  CB    . SER B 2 205 ? -21.556 -6.591  26.127  1.00 46.59 ? 208 SER A CB    1 
ATOM   2744 O  OG    . SER B 2 205 ? -22.669 -5.712  26.038  1.00 47.46 ? 208 SER A OG    1 
ATOM   2745 N  N     . GLY B 2 206 ? -19.936 -4.568  23.559  1.00 46.36 ? 209 GLY A N     1 
ATOM   2746 C  CA    . GLY B 2 206 ? -19.291 -3.284  23.287  1.00 46.21 ? 209 GLY A CA    1 
ATOM   2747 C  C     . GLY B 2 206 ? -17.811 -3.326  23.630  1.00 45.99 ? 209 GLY A C     1 
ATOM   2748 O  O     . GLY B 2 206 ? -17.091 -4.194  23.143  1.00 46.03 ? 209 GLY A O     1 
ATOM   2749 N  N     . PRO B 2 207 ? -17.351 -2.391  24.482  1.00 45.87 ? 210 PRO A N     1 
ATOM   2750 C  CA    . PRO B 2 207 ? -15.954 -2.368  24.931  1.00 45.72 ? 210 PRO A CA    1 
ATOM   2751 C  C     . PRO B 2 207 ? -15.626 -3.412  26.012  1.00 45.65 ? 210 PRO A C     1 
ATOM   2752 O  O     . PRO B 2 207 ? -14.448 -3.635  26.304  1.00 45.76 ? 210 PRO A O     1 
ATOM   2753 C  CB    . PRO B 2 207 ? -15.794 -0.951  25.488  1.00 45.70 ? 210 PRO A CB    1 
ATOM   2754 C  CG    . PRO B 2 207 ? -17.161 -0.577  25.952  1.00 45.74 ? 210 PRO A CG    1 
ATOM   2755 C  CD    . PRO B 2 207 ? -18.139 -1.284  25.060  1.00 45.69 ? 210 PRO A CD    1 
ATOM   2756 N  N     . PHE B 2 208 ? -16.653 -4.035  26.590  1.00 45.43 ? 211 PHE A N     1 
ATOM   2757 C  CA    . PHE B 2 208 ? -16.477 -5.056  27.629  1.00 45.38 ? 211 PHE A CA    1 
ATOM   2758 C  C     . PHE B 2 208 ? -16.249 -6.441  27.029  1.00 45.51 ? 211 PHE A C     1 
ATOM   2759 O  O     . PHE B 2 208 ? -16.991 -6.878  26.152  1.00 45.38 ? 211 PHE A O     1 
ATOM   2760 C  CB    . PHE B 2 208 ? -17.681 -5.083  28.580  1.00 45.07 ? 211 PHE A CB    1 
ATOM   2761 C  CG    . PHE B 2 208 ? -17.852 -3.821  29.374  1.00 45.03 ? 211 PHE A CG    1 
ATOM   2762 C  CD1   . PHE B 2 208 ? -17.175 -3.642  30.577  1.00 44.71 ? 211 PHE A CD1   1 
ATOM   2763 C  CD2   . PHE B 2 208 ? -18.681 -2.802  28.913  1.00 44.59 ? 211 PHE A CD2   1 
ATOM   2764 C  CE1   . PHE B 2 208 ? -17.328 -2.471  31.313  1.00 44.71 ? 211 PHE A CE1   1 
ATOM   2765 C  CE2   . PHE B 2 208 ? -18.838 -1.629  29.638  1.00 44.58 ? 211 PHE A CE2   1 
ATOM   2766 C  CZ    . PHE B 2 208 ? -18.157 -1.461  30.840  1.00 44.83 ? 211 PHE A CZ    1 
ATOM   2767 N  N     . LYS B 2 209 ? -15.219 -7.128  27.509  1.00 45.87 ? 212 LYS A N     1 
ATOM   2768 C  CA    . LYS B 2 209 ? -14.875 -8.451  26.984  1.00 46.35 ? 212 LYS A CA    1 
ATOM   2769 C  C     . LYS B 2 209 ? -14.358 -9.411  28.058  1.00 46.44 ? 212 LYS A C     1 
ATOM   2770 O  O     . LYS B 2 209 ? -14.225 -9.051  29.230  1.00 46.36 ? 212 LYS A O     1 
ATOM   2771 C  CB    . LYS B 2 209 ? -13.863 -8.332  25.833  1.00 46.33 ? 212 LYS A CB    1 
ATOM   2772 C  CG    . LYS B 2 209 ? -12.584 -7.602  26.194  1.00 47.09 ? 212 LYS A CG    1 
ATOM   2773 C  CD    . LYS B 2 209 ? -11.537 -7.727  25.102  1.00 48.29 ? 212 LYS A CD    1 
ATOM   2774 C  CE    . LYS B 2 209 ? -10.327 -6.848  25.393  1.00 49.33 ? 212 LYS A CE    1 
ATOM   2775 N  NZ    . LYS B 2 209 ? -9.618  -7.219  26.655  1.00 50.08 ? 212 LYS A NZ    1 
ATOM   2776 N  N     . GLU B 2 210 ? -14.073 -10.637 27.633  1.00 46.79 ? 213 GLU A N     1 
ATOM   2777 C  CA    . GLU B 2 210 ? -13.500 -11.655 28.495  1.00 47.13 ? 213 GLU A CA    1 
ATOM   2778 C  C     . GLU B 2 210 ? -12.016 -11.418 28.726  1.00 47.02 ? 213 GLU A C     1 
ATOM   2779 O  O     . GLU B 2 210 ? -11.170 -11.905 27.976  1.00 47.20 ? 213 GLU A O     1 
ATOM   2780 C  CB    . GLU B 2 210 ? -13.697 -13.032 27.881  1.00 47.32 ? 213 GLU A CB    1 
ATOM   2781 C  CG    . GLU B 2 210 ? -15.068 -13.603 28.072  1.00 48.71 ? 213 GLU A CG    1 
ATOM   2782 C  CD    . GLU B 2 210 ? -15.068 -15.090 27.865  1.00 50.81 ? 213 GLU A CD    1 
ATOM   2783 O  OE1   . GLU B 2 210 ? -14.880 -15.518 26.706  1.00 51.47 ? 213 GLU A OE1   1 
ATOM   2784 O  OE2   . GLU B 2 210 ? -15.238 -15.832 28.857  1.00 51.71 ? 213 GLU A OE2   1 
ATOM   2785 N  N     . ASP B 2 211 ? -11.713 -10.659 29.771  1.00 46.97 ? 214 ASP A N     1 
ATOM   2786 C  CA    . ASP B 2 211 ? -10.342 -10.415 30.180  1.00 46.76 ? 214 ASP A CA    1 
ATOM   2787 C  C     . ASP B 2 211 ? -10.242 -10.483 31.703  1.00 46.53 ? 214 ASP A C     1 
ATOM   2788 O  O     . ASP B 2 211 ? -11.129 -11.030 32.364  1.00 46.47 ? 214 ASP A O     1 
ATOM   2789 C  CB    . ASP B 2 211 ? -9.839  -9.066  29.631  1.00 46.92 ? 214 ASP A CB    1 
ATOM   2790 C  CG    . ASP B 2 211 ? -10.740 -7.892  30.008  1.00 47.22 ? 214 ASP A CG    1 
ATOM   2791 O  OD1   . ASP B 2 211 ? -11.517 -7.999  30.980  1.00 47.59 ? 214 ASP A OD1   1 
ATOM   2792 O  OD2   . ASP B 2 211 ? -10.664 -6.850  29.325  1.00 47.69 ? 214 ASP A OD2   1 
ATOM   2793 N  N     . GLU B 2 212 ? -9.166  -9.919  32.245  1.00 46.24 ? 215 GLU A N     1 
ATOM   2794 C  CA    . GLU B 2 212 ? -8.890  -9.907  33.683  1.00 45.99 ? 215 GLU A CA    1 
ATOM   2795 C  C     . GLU B 2 212 ? -10.019 -9.280  34.504  1.00 45.40 ? 215 GLU A C     1 
ATOM   2796 O  O     . GLU B 2 212 ? -10.188 -9.598  35.683  1.00 45.48 ? 215 GLU A O     1 
ATOM   2797 C  CB    . GLU B 2 212 ? -7.588  -9.145  33.966  1.00 46.25 ? 215 GLU A CB    1 
ATOM   2798 C  CG    . GLU B 2 212 ? -6.522  -9.242  32.867  1.00 47.53 ? 215 GLU A CG    1 
ATOM   2799 C  CD    . GLU B 2 212 ? -6.807  -8.337  31.669  1.00 48.98 ? 215 GLU A CD    1 
ATOM   2800 O  OE1   . GLU B 2 212 ? -7.286  -7.198  31.874  1.00 49.26 ? 215 GLU A OE1   1 
ATOM   2801 O  OE2   . GLU B 2 212 ? -6.550  -8.768  30.522  1.00 49.64 ? 215 GLU A OE2   1 
ATOM   2802 N  N     . THR B 2 213 ? -10.785 -8.391  33.874  1.00 44.69 ? 216 THR A N     1 
ATOM   2803 C  CA    . THR B 2 213 ? -11.811 -7.611  34.567  1.00 43.88 ? 216 THR A CA    1 
ATOM   2804 C  C     . THR B 2 213 ? -13.144 -8.351  34.699  1.00 43.48 ? 216 THR A C     1 
ATOM   2805 O  O     . THR B 2 213 ? -14.002 -7.949  35.491  1.00 43.20 ? 216 THR A O     1 
ATOM   2806 C  CB    . THR B 2 213 ? -12.053 -6.245  33.884  1.00 43.98 ? 216 THR A CB    1 
ATOM   2807 O  OG1   . THR B 2 213 ? -12.786 -6.434  32.667  1.00 43.71 ? 216 THR A OG1   1 
ATOM   2808 C  CG2   . THR B 2 213 ? -10.726 -5.531  33.591  1.00 43.75 ? 216 THR A CG2   1 
ATOM   2809 N  N     . LEU B 2 214 ? -13.316 -9.420  33.920  1.00 42.83 ? 217 LEU A N     1 
ATOM   2810 C  CA    . LEU B 2 214 ? -14.532 -10.224 33.993  1.00 42.39 ? 217 LEU A CA    1 
ATOM   2811 C  C     . LEU B 2 214 ? -14.603 -10.926 35.343  1.00 42.01 ? 217 LEU A C     1 
ATOM   2812 O  O     . LEU B 2 214 ? -13.649 -11.585 35.763  1.00 41.82 ? 217 LEU A O     1 
ATOM   2813 C  CB    . LEU B 2 214 ? -14.617 -11.235 32.843  1.00 42.40 ? 217 LEU A CB    1 
ATOM   2814 C  CG    . LEU B 2 214 ? -15.971 -11.934 32.655  1.00 42.45 ? 217 LEU A CG    1 
ATOM   2815 C  CD1   . LEU B 2 214 ? -17.056 -10.961 32.200  1.00 41.76 ? 217 LEU A CD1   1 
ATOM   2816 C  CD2   . LEU B 2 214 ? -15.857 -13.096 31.676  1.00 42.30 ? 217 LEU A CD2   1 
ATOM   2817 N  N     . ILE B 2 215 ? -15.736 -10.766 36.018  1.00 41.52 ? 218 ILE A N     1 
ATOM   2818 C  CA    . ILE B 2 215 ? -15.888 -11.252 37.383  1.00 41.09 ? 218 ILE A CA    1 
ATOM   2819 C  C     . ILE B 2 215 ? -17.217 -11.973 37.596  1.00 40.74 ? 218 ILE A C     1 
ATOM   2820 O  O     . ILE B 2 215 ? -18.253 -11.555 37.084  1.00 40.52 ? 218 ILE A O     1 
ATOM   2821 C  CB    . ILE B 2 215 ? -15.685 -10.101 38.419  1.00 41.21 ? 218 ILE A CB    1 
ATOM   2822 C  CG1   . ILE B 2 215 ? -15.529 -10.661 39.836  1.00 41.12 ? 218 ILE A CG1   1 
ATOM   2823 C  CG2   . ILE B 2 215 ? -16.803 -9.044  38.325  1.00 40.80 ? 218 ILE A CG2   1 
ATOM   2824 C  CD1   . ILE B 2 215 ? -14.956 -9.674  40.822  1.00 41.53 ? 218 ILE A CD1   1 
ATOM   2825 N  N     . THR B 2 216 ? -17.167 -13.074 38.341  1.00 40.38 ? 219 THR A N     1 
ATOM   2826 C  CA    . THR B 2 216 ? -18.369 -13.815 38.699  1.00 40.02 ? 219 THR A CA    1 
ATOM   2827 C  C     . THR B 2 216 ? -19.046 -13.143 39.891  1.00 39.89 ? 219 THR A C     1 
ATOM   2828 O  O     . THR B 2 216 ? -18.435 -12.318 40.581  1.00 39.77 ? 219 THR A O     1 
ATOM   2829 C  CB    . THR B 2 216 ? -18.053 -15.281 39.058  1.00 39.88 ? 219 THR A CB    1 
ATOM   2830 O  OG1   . THR B 2 216 ? -17.227 -15.319 40.225  1.00 39.47 ? 219 THR A OG1   1 
ATOM   2831 C  CG2   . THR B 2 216 ? -17.344 -15.994 37.906  1.00 40.09 ? 219 THR A CG2   1 
ATOM   2832 N  N     . LEU B 2 217 ? -20.306 -13.503 40.127  1.00 39.67 ? 220 LEU A N     1 
ATOM   2833 C  CA    . LEU B 2 217 ? -21.041 -13.035 41.300  1.00 39.48 ? 220 LEU A CA    1 
ATOM   2834 C  C     . LEU B 2 217 ? -20.375 -13.496 42.593  1.00 39.37 ? 220 LEU A C     1 
ATOM   2835 O  O     . LEU B 2 217 ? -20.342 -12.753 43.570  1.00 39.33 ? 220 LEU A O     1 
ATOM   2836 C  CB    . LEU B 2 217 ? -22.497 -13.508 41.250  1.00 39.36 ? 220 LEU A CB    1 
ATOM   2837 C  CG    . LEU B 2 217 ? -23.448 -12.759 40.315  1.00 38.88 ? 220 LEU A CG    1 
ATOM   2838 C  CD1   . LEU B 2 217 ? -24.590 -13.663 39.882  1.00 38.66 ? 220 LEU A CD1   1 
ATOM   2839 C  CD2   . LEU B 2 217 ? -23.981 -11.495 40.975  1.00 38.68 ? 220 LEU A CD2   1 
ATOM   2840 N  N     . HIS B 2 218 ? -19.845 -14.720 42.580  1.00 39.46 ? 221 HIS A N     1 
ATOM   2841 C  CA    . HIS B 2 218 ? -19.134 -15.298 43.723  1.00 39.47 ? 221 HIS A CA    1 
ATOM   2842 C  C     . HIS B 2 218 ? -17.925 -14.461 44.136  1.00 39.68 ? 221 HIS A C     1 
ATOM   2843 O  O     . HIS B 2 218 ? -17.776 -14.123 45.308  1.00 39.59 ? 221 HIS A O     1 
ATOM   2844 C  CB    . HIS B 2 218 ? -18.693 -16.732 43.418  1.00 39.27 ? 221 HIS A CB    1 
ATOM   2845 C  CG    . HIS B 2 218 ? -19.830 -17.685 43.213  1.00 39.01 ? 221 HIS A CG    1 
ATOM   2846 N  ND1   . HIS B 2 218 ? -20.329 -18.478 44.223  1.00 38.28 ? 221 HIS A ND1   1 
ATOM   2847 C  CD2   . HIS B 2 218 ? -20.565 -17.972 42.113  1.00 38.40 ? 221 HIS A CD2   1 
ATOM   2848 C  CE1   . HIS B 2 218 ? -21.322 -19.212 43.755  1.00 38.02 ? 221 HIS A CE1   1 
ATOM   2849 N  NE2   . HIS B 2 218 ? -21.484 -18.926 42.477  1.00 38.22 ? 221 HIS A NE2   1 
ATOM   2850 N  N     . ASP B 2 219 ? -17.072 -14.127 43.170  1.00 39.99 ? 222 ASP A N     1 
ATOM   2851 C  CA    . ASP B 2 219 ? -15.890 -13.309 43.437  1.00 40.40 ? 222 ASP A CA    1 
ATOM   2852 C  C     . ASP B 2 219 ? -16.256 -11.871 43.796  1.00 40.44 ? 222 ASP A C     1 
ATOM   2853 O  O     . ASP B 2 219 ? -15.608 -11.259 44.644  1.00 40.53 ? 222 ASP A O     1 
ATOM   2854 C  CB    . ASP B 2 219 ? -14.925 -13.340 42.248  1.00 40.62 ? 222 ASP A CB    1 
ATOM   2855 C  CG    . ASP B 2 219 ? -14.065 -14.589 42.222  1.00 41.04 ? 222 ASP A CG    1 
ATOM   2856 O  OD1   . ASP B 2 219 ? -13.868 -15.217 43.281  1.00 41.70 ? 222 ASP A OD1   1 
ATOM   2857 O  OD2   . ASP B 2 219 ? -13.570 -14.943 41.136  1.00 42.55 ? 222 ASP A OD2   1 
ATOM   2858 N  N     . LEU B 2 220 ? -17.300 -11.346 43.157  1.00 40.55 ? 223 LEU A N     1 
ATOM   2859 C  CA    . LEU B 2 220 ? -17.799 -10.004 43.455  1.00 40.58 ? 223 LEU A CA    1 
ATOM   2860 C  C     . LEU B 2 220 ? -18.200 -9.858  44.925  1.00 40.68 ? 223 LEU A C     1 
ATOM   2861 O  O     . LEU B 2 220 ? -17.736 -8.940  45.608  1.00 40.63 ? 223 LEU A O     1 
ATOM   2862 C  CB    . LEU B 2 220 ? -18.981 -9.649  42.545  1.00 40.49 ? 223 LEU A CB    1 
ATOM   2863 C  CG    . LEU B 2 220 ? -19.751 -8.355  42.830  1.00 40.58 ? 223 LEU A CG    1 
ATOM   2864 C  CD1   . LEU B 2 220 ? -18.943 -7.119  42.429  1.00 40.51 ? 223 LEU A CD1   1 
ATOM   2865 C  CD2   . LEU B 2 220 ? -21.101 -8.370  42.121  1.00 40.54 ? 223 LEU A CD2   1 
ATOM   2866 N  N     . VAL B 2 221 ? -19.052 -10.765 45.402  1.00 40.77 ? 224 VAL A N     1 
ATOM   2867 C  CA    . VAL B 2 221 ? -19.557 -10.699 46.775  1.00 41.00 ? 224 VAL A CA    1 
ATOM   2868 C  C     . VAL B 2 221 ? -18.455 -10.975 47.803  1.00 40.99 ? 224 VAL A C     1 
ATOM   2869 O  O     . VAL B 2 221 ? -18.433 -10.360 48.865  1.00 40.95 ? 224 VAL A O     1 
ATOM   2870 C  CB    . VAL B 2 221 ? -20.802 -11.618 47.022  1.00 41.11 ? 224 VAL A CB    1 
ATOM   2871 C  CG1   . VAL B 2 221 ? -21.903 -11.326 46.007  1.00 41.38 ? 224 VAL A CG1   1 
ATOM   2872 C  CG2   . VAL B 2 221 ? -20.432 -13.094 47.003  1.00 41.28 ? 224 VAL A CG2   1 
ATOM   2873 N  N     . ASP B 2 222 ? -17.542 -11.886 47.469  1.00 41.09 ? 225 ASP A N     1 
ATOM   2874 C  CA    . ASP B 2 222 ? -16.425 -12.223 48.349  1.00 41.29 ? 225 ASP A CA    1 
ATOM   2875 C  C     . ASP B 2 222 ? -15.413 -11.082 48.470  1.00 41.47 ? 225 ASP A C     1 
ATOM   2876 O  O     . ASP B 2 222 ? -14.901 -10.829 49.559  1.00 41.46 ? 225 ASP A O     1 
ATOM   2877 C  CB    . ASP B 2 222 ? -15.739 -13.517 47.895  1.00 41.21 ? 225 ASP A CB    1 
ATOM   2878 C  CG    . ASP B 2 222 ? -16.599 -14.757 48.127  1.00 41.20 ? 225 ASP A CG    1 
ATOM   2879 O  OD1   . ASP B 2 222 ? -17.682 -14.650 48.743  1.00 41.22 ? 225 ASP A OD1   1 
ATOM   2880 O  OD2   . ASP B 2 222 ? -16.186 -15.850 47.692  1.00 41.07 ? 225 ASP A OD2   1 
ATOM   2881 N  N     . TYR B 2 223 ? -15.141 -10.393 47.360  1.00 41.77 ? 226 TYR A N     1 
ATOM   2882 C  CA    . TYR B 2 223 ? -14.250 -9.225  47.371  1.00 42.10 ? 226 TYR A CA    1 
ATOM   2883 C  C     . TYR B 2 223 ? -14.869 -8.061  48.143  1.00 42.37 ? 226 TYR A C     1 
ATOM   2884 O  O     . TYR B 2 223 ? -14.157 -7.279  48.777  1.00 42.25 ? 226 TYR A O     1 
ATOM   2885 C  CB    . TYR B 2 223 ? -13.885 -8.775  45.951  1.00 42.04 ? 226 TYR A CB    1 
ATOM   2886 C  CG    . TYR B 2 223 ? -13.060 -9.763  45.142  1.00 42.02 ? 226 TYR A CG    1 
ATOM   2887 C  CD1   . TYR B 2 223 ? -12.455 -10.873 45.741  1.00 42.18 ? 226 TYR A CD1   1 
ATOM   2888 C  CD2   . TYR B 2 223 ? -12.857 -9.566  43.779  1.00 41.72 ? 226 TYR A CD2   1 
ATOM   2889 C  CE1   . TYR B 2 223 ? -11.696 -11.769 44.997  1.00 41.75 ? 226 TYR A CE1   1 
ATOM   2890 C  CE2   . TYR B 2 223 ? -12.095 -10.456 43.027  1.00 41.73 ? 226 TYR A CE2   1 
ATOM   2891 C  CZ    . TYR B 2 223 ? -11.520 -11.552 43.642  1.00 41.88 ? 226 TYR A CZ    1 
ATOM   2892 O  OH    . TYR B 2 223 ? -10.766 -12.431 42.901  1.00 42.36 ? 226 TYR A OH    1 
ATOM   2893 N  N     . TYR B 2 224 ? -16.195 -7.959  48.078  1.00 42.77 ? 227 TYR A N     1 
ATOM   2894 C  CA    . TYR B 2 224 ? -16.950 -7.004  48.885  1.00 43.30 ? 227 TYR A CA    1 
ATOM   2895 C  C     . TYR B 2 224 ? -16.792 -7.311  50.375  1.00 43.52 ? 227 TYR A C     1 
ATOM   2896 O  O     . TYR B 2 224 ? -16.590 -6.401  51.180  1.00 43.47 ? 227 TYR A O     1 
ATOM   2897 C  CB    . TYR B 2 224 ? -18.427 -7.009  48.471  1.00 43.40 ? 227 TYR A CB    1 
ATOM   2898 C  CG    . TYR B 2 224 ? -19.318 -6.069  49.257  1.00 43.58 ? 227 TYR A CG    1 
ATOM   2899 C  CD1   . TYR B 2 224 ? -19.242 -4.687  49.081  1.00 43.68 ? 227 TYR A CD1   1 
ATOM   2900 C  CD2   . TYR B 2 224 ? -20.256 -6.567  50.161  1.00 43.68 ? 227 TYR A CD2   1 
ATOM   2901 C  CE1   . TYR B 2 224 ? -20.070 -3.823  49.799  1.00 43.56 ? 227 TYR A CE1   1 
ATOM   2902 C  CE2   . TYR B 2 224 ? -21.087 -5.714  50.880  1.00 43.89 ? 227 TYR A CE2   1 
ATOM   2903 C  CZ    . TYR B 2 224 ? -20.988 -4.346  50.694  1.00 43.77 ? 227 TYR A CZ    1 
ATOM   2904 O  OH    . TYR B 2 224 ? -21.811 -3.507  51.409  1.00 44.22 ? 227 TYR A OH    1 
ATOM   2905 N  N     . TYR B 2 225 ? -16.868 -8.595  50.728  1.00 43.90 ? 228 TYR A N     1 
ATOM   2906 C  CA    . TYR B 2 225 ? -16.653 -9.042  52.107  1.00 44.34 ? 228 TYR A CA    1 
ATOM   2907 C  C     . TYR B 2 225 ? -15.222 -8.816  52.595  1.00 44.50 ? 228 TYR A C     1 
ATOM   2908 O  O     . TYR B 2 225 ? -15.016 -8.487  53.763  1.00 44.60 ? 228 TYR A O     1 
ATOM   2909 C  CB    . TYR B 2 225 ? -17.043 -10.513 52.273  1.00 44.47 ? 228 TYR A CB    1 
ATOM   2910 C  CG    . TYR B 2 225 ? -18.486 -10.727 52.675  1.00 44.77 ? 228 TYR A CG    1 
ATOM   2911 C  CD1   . TYR B 2 225 ? -19.508 -10.693 51.726  1.00 45.00 ? 228 TYR A CD1   1 
ATOM   2912 C  CD2   . TYR B 2 225 ? -18.829 -10.969 54.004  1.00 44.92 ? 228 TYR A CD2   1 
ATOM   2913 C  CE1   . TYR B 2 225 ? -20.836 -10.890 52.090  1.00 45.19 ? 228 TYR A CE1   1 
ATOM   2914 C  CE2   . TYR B 2 225 ? -20.155 -11.170 54.380  1.00 45.01 ? 228 TYR A CE2   1 
ATOM   2915 C  CZ    . TYR B 2 225 ? -21.151 -11.129 53.416  1.00 44.83 ? 228 TYR A CZ    1 
ATOM   2916 O  OH    . TYR B 2 225 ? -22.462 -11.324 53.778  1.00 44.86 ? 228 TYR A OH    1 
ATOM   2917 N  N     . PHE B 2 226 ? -14.244 -8.984  51.704  1.00 44.79 ? 229 PHE A N     1 
ATOM   2918 C  CA    . PHE B 2 226 ? -12.840 -8.707  52.033  1.00 45.05 ? 229 PHE A CA    1 
ATOM   2919 C  C     . PHE B 2 226 ? -12.617 -7.217  52.307  1.00 45.33 ? 229 PHE A C     1 
ATOM   2920 O  O     . PHE B 2 226 ? -11.691 -6.845  53.027  1.00 45.36 ? 229 PHE A O     1 
ATOM   2921 C  CB    . PHE B 2 226 ? -11.887 -9.179  50.922  1.00 44.92 ? 229 PHE A CB    1 
ATOM   2922 C  CG    . PHE B 2 226 ? -11.962 -10.657 50.619  1.00 44.81 ? 229 PHE A CG    1 
ATOM   2923 C  CD1   . PHE B 2 226 ? -11.669 -11.122 49.340  1.00 44.79 ? 229 PHE A CD1   1 
ATOM   2924 C  CD2   . PHE B 2 226 ? -12.321 -11.581 51.598  1.00 44.72 ? 229 PHE A CD2   1 
ATOM   2925 C  CE1   . PHE B 2 226 ? -11.731 -12.482 49.040  1.00 44.75 ? 229 PHE A CE1   1 
ATOM   2926 C  CE2   . PHE B 2 226 ? -12.389 -12.940 51.306  1.00 44.71 ? 229 PHE A CE2   1 
ATOM   2927 C  CZ    . PHE B 2 226 ? -12.093 -13.391 50.025  1.00 44.76 ? 229 PHE A CZ    1 
ATOM   2928 N  N     . TRP B 2 227 ? -13.469 -6.375  51.726  1.00 45.80 ? 230 TRP A N     1 
ATOM   2929 C  CA    . TRP B 2 227 ? -13.424 -4.933  51.959  1.00 46.30 ? 230 TRP A CA    1 
ATOM   2930 C  C     . TRP B 2 227 ? -14.109 -4.541  53.271  1.00 46.62 ? 230 TRP A C     1 
ATOM   2931 O  O     . TRP B 2 227 ? -13.533 -3.816  54.081  1.00 46.75 ? 230 TRP A O     1 
ATOM   2932 C  CB    . TRP B 2 227 ? -14.017 -4.170  50.762  1.00 46.33 ? 230 TRP A CB    1 
ATOM   2933 C  CG    . TRP B 2 227 ? -14.132 -2.676  50.959  1.00 46.56 ? 230 TRP A CG    1 
ATOM   2934 C  CD1   . TRP B 2 227 ? -13.205 -1.845  51.530  1.00 46.69 ? 230 TRP A CD1   1 
ATOM   2935 C  CD2   . TRP B 2 227 ? -15.229 -1.840  50.568  1.00 46.65 ? 230 TRP A CD2   1 
ATOM   2936 N  NE1   . TRP B 2 227 ? -13.663 -0.550  51.528  1.00 46.89 ? 230 TRP A NE1   1 
ATOM   2937 C  CE2   . TRP B 2 227 ? -14.901 -0.517  50.943  1.00 46.74 ? 230 TRP A CE2   1 
ATOM   2938 C  CE3   . TRP B 2 227 ? -16.459 -2.080  49.939  1.00 46.64 ? 230 TRP A CE3   1 
ATOM   2939 C  CZ2   . TRP B 2 227 ? -15.758 0.564   50.710  1.00 46.71 ? 230 TRP A CZ2   1 
ATOM   2940 C  CZ3   . TRP B 2 227 ? -17.311 -1.004  49.706  1.00 46.76 ? 230 TRP A CZ3   1 
ATOM   2941 C  CH2   . TRP B 2 227 ? -16.954 0.302   50.093  1.00 46.72 ? 230 TRP A CH2   1 
ATOM   2942 N  N     . LYS B 2 228 ? -15.328 -5.033  53.476  1.00 47.13 ? 231 LYS A N     1 
ATOM   2943 C  CA    . LYS B 2 228 ? -16.126 -4.696  54.658  1.00 47.61 ? 231 LYS A CA    1 
ATOM   2944 C  C     . LYS B 2 228 ? -15.605 -5.263  55.978  1.00 47.73 ? 231 LYS A C     1 
ATOM   2945 O  O     . LYS B 2 228 ? -15.731 -4.621  57.022  1.00 47.83 ? 231 LYS A O     1 
ATOM   2946 C  CB    . LYS B 2 228 ? -17.589 -5.105  54.452  1.00 47.72 ? 231 LYS A CB    1 
ATOM   2947 C  CG    . LYS B 2 228 ? -18.538 -3.939  54.192  1.00 48.46 ? 231 LYS A CG    1 
ATOM   2948 C  CD    . LYS B 2 228 ? -18.244 -3.231  52.880  1.00 48.94 ? 231 LYS A CD    1 
ATOM   2949 C  CE    . LYS B 2 228 ? -19.022 -1.926  52.772  1.00 49.71 ? 231 LYS A CE    1 
ATOM   2950 N  NZ    . LYS B 2 228 ? -18.391 -0.816  53.542  1.00 50.19 ? 231 LYS A NZ    1 
ATOM   2951 N  N     . GLU B 2 229 ? -15.027 -6.461  55.929  1.00 47.89 ? 232 GLU A N     1 
ATOM   2952 C  CA    . GLU B 2 229 ? -14.584 -7.153  57.139  1.00 48.02 ? 232 GLU A CA    1 
ATOM   2953 C  C     . GLU B 2 229 ? -13.076 -7.078  57.366  1.00 48.03 ? 232 GLU A C     1 
ATOM   2954 O  O     . GLU B 2 229 ? -12.626 -6.904  58.501  1.00 48.11 ? 232 GLU A O     1 
ATOM   2955 C  CB    . GLU B 2 229 ? -15.030 -8.619  57.118  1.00 48.04 ? 232 GLU A CB    1 
ATOM   2956 C  CG    . GLU B 2 229 ? -16.541 -8.816  57.105  1.00 48.25 ? 232 GLU A CG    1 
ATOM   2957 C  CD    . GLU B 2 229 ? -16.945 -10.276 57.041  1.00 48.16 ? 232 GLU A CD    1 
ATOM   2958 O  OE1   . GLU B 2 229 ? -17.891 -10.658 57.761  1.00 48.52 ? 232 GLU A OE1   1 
ATOM   2959 O  OE2   . GLU B 2 229 ? -16.320 -11.044 56.278  1.00 48.57 ? 232 GLU A OE2   1 
ATOM   2960 N  N     . ASP B 2 230 ? -12.305 -7.213  56.291  1.00 48.03 ? 233 ASP A N     1 
ATOM   2961 C  CA    . ASP B 2 230 ? -10.845 -7.267  56.386  1.00 48.04 ? 233 ASP A CA    1 
ATOM   2962 C  C     . ASP B 2 230 ? -10.167 -5.920  56.113  1.00 48.02 ? 233 ASP A C     1 
ATOM   2963 O  O     . ASP B 2 230 ? -8.976  -5.757  56.384  1.00 48.03 ? 233 ASP A O     1 
ATOM   2964 C  CB    . ASP B 2 230 ? -10.286 -8.348  55.450  1.00 48.05 ? 233 ASP A CB    1 
ATOM   2965 C  CG    . ASP B 2 230 ? -10.962 -9.700  55.635  1.00 48.12 ? 233 ASP A CG    1 
ATOM   2966 O  OD1   . ASP B 2 230 ? -11.081 -10.443 54.638  1.00 48.06 ? 233 ASP A OD1   1 
ATOM   2967 O  OD2   . ASP B 2 230 ? -11.376 -10.024 56.770  1.00 48.28 ? 233 ASP A OD2   1 
ATOM   2968 N  N     . GLY B 2 231 ? -10.926 -4.964  55.579  1.00 48.08 ? 234 GLY A N     1 
ATOM   2969 C  CA    . GLY B 2 231 ? -10.400 -3.633  55.256  1.00 48.12 ? 234 GLY A CA    1 
ATOM   2970 C  C     . GLY B 2 231 ? -9.597  -3.577  53.966  1.00 48.15 ? 234 GLY A C     1 
ATOM   2971 O  O     . GLY B 2 231 ? -9.022  -2.539  53.630  1.00 48.16 ? 234 GLY A O     1 
ATOM   2972 N  N     . ILE B 2 232 ? -9.568  -4.697  53.246  1.00 48.18 ? 235 ILE A N     1 
ATOM   2973 C  CA    . ILE B 2 232 ? -8.831  -4.830  51.992  1.00 48.22 ? 235 ILE A CA    1 
ATOM   2974 C  C     . ILE B 2 232 ? -9.690  -4.327  50.833  1.00 48.19 ? 235 ILE A C     1 
ATOM   2975 O  O     . ILE B 2 232 ? -10.646 -4.990  50.429  1.00 48.20 ? 235 ILE A O     1 
ATOM   2976 C  CB    . ILE B 2 232 ? -8.432  -6.318  51.730  1.00 48.32 ? 235 ILE A CB    1 
ATOM   2977 C  CG1   . ILE B 2 232 ? -7.753  -6.956  52.958  1.00 48.36 ? 235 ILE A CG1   1 
ATOM   2978 C  CG2   . ILE B 2 232 ? -7.581  -6.454  50.465  1.00 48.36 ? 235 ILE A CG2   1 
ATOM   2979 C  CD1   . ILE B 2 232 ? -6.431  -6.313  53.388  1.00 48.82 ? 235 ILE A CD1   1 
ATOM   2980 N  N     . GLU B 2 233 ? -9.348  -3.159  50.295  1.00 48.15 ? 236 GLU A N     1 
ATOM   2981 C  CA    . GLU B 2 233 ? -10.152 -2.558  49.228  1.00 48.18 ? 236 GLU A CA    1 
ATOM   2982 C  C     . GLU B 2 233 ? -9.694  -2.929  47.812  1.00 47.90 ? 236 GLU A C     1 
ATOM   2983 O  O     . GLU B 2 233 ? -10.457 -2.761  46.859  1.00 47.86 ? 236 GLU A O     1 
ATOM   2984 C  CB    . GLU B 2 233 ? -10.253 -1.034  49.393  1.00 48.16 ? 236 GLU A CB    1 
ATOM   2985 C  CG    . GLU B 2 233 ? -9.081  -0.240  48.831  1.00 48.60 ? 236 GLU A CG    1 
ATOM   2986 C  CD    . GLU B 2 233 ? -9.376  1.247   48.724  1.00 48.65 ? 236 GLU A CD    1 
ATOM   2987 O  OE1   . GLU B 2 233 ? -9.228  1.802   47.611  1.00 49.34 ? 236 GLU A OE1   1 
ATOM   2988 O  OE2   . GLU B 2 233 ? -9.761  1.857   49.747  1.00 48.89 ? 236 GLU A OE2   1 
ATOM   2989 N  N     . GLU B 2 234 ? -8.468  -3.437  47.681  1.00 47.68 ? 237 GLU A N     1 
ATOM   2990 C  CA    . GLU B 2 234 ? -7.870  -3.681  46.358  1.00 47.49 ? 237 GLU A CA    1 
ATOM   2991 C  C     . GLU B 2 234 ? -8.645  -4.656  45.469  1.00 47.15 ? 237 GLU A C     1 
ATOM   2992 O  O     . GLU B 2 234 ? -8.763  -4.435  44.262  1.00 47.11 ? 237 GLU A O     1 
ATOM   2993 C  CB    . GLU B 2 234 ? -6.382  -4.066  46.443  1.00 47.64 ? 237 GLU A CB    1 
ATOM   2994 C  CG    . GLU B 2 234 ? -6.003  -5.069  47.530  1.00 48.30 ? 237 GLU A CG    1 
ATOM   2995 C  CD    . GLU B 2 234 ? -5.175  -4.454  48.655  1.00 49.24 ? 237 GLU A CD    1 
ATOM   2996 O  OE1   . GLU B 2 234 ? -5.469  -3.312  49.080  1.00 49.36 ? 237 GLU A OE1   1 
ATOM   2997 O  OE2   . GLU B 2 234 ? -4.225  -5.123  49.119  1.00 49.36 ? 237 GLU A OE2   1 
ATOM   2998 N  N     . TYR B 2 235 ? -9.174  -5.724  46.066  1.00 46.72 ? 238 TYR A N     1 
ATOM   2999 C  CA    . TYR B 2 235 ? -9.935  -6.727  45.315  1.00 46.29 ? 238 TYR A CA    1 
ATOM   3000 C  C     . TYR B 2 235 ? -11.285 -6.194  44.823  1.00 45.91 ? 238 TYR A C     1 
ATOM   3001 O  O     . TYR B 2 235 ? -11.660 -6.423  43.672  1.00 45.67 ? 238 TYR A O     1 
ATOM   3002 C  CB    . TYR B 2 235 ? -10.132 -8.006  46.138  1.00 46.47 ? 238 TYR A CB    1 
ATOM   3003 C  CG    . TYR B 2 235 ? -8.858  -8.773  46.424  1.00 46.54 ? 238 TYR A CG    1 
ATOM   3004 C  CD1   . TYR B 2 235 ? -8.282  -8.755  47.693  1.00 46.48 ? 238 TYR A CD1   1 
ATOM   3005 C  CD2   . TYR B 2 235 ? -8.232  -9.523  45.428  1.00 46.64 ? 238 TYR A CD2   1 
ATOM   3006 C  CE1   . TYR B 2 235 ? -7.112  -9.459  47.964  1.00 46.63 ? 238 TYR A CE1   1 
ATOM   3007 C  CE2   . TYR B 2 235 ? -7.060  -10.232 45.688  1.00 46.77 ? 238 TYR A CE2   1 
ATOM   3008 C  CZ    . TYR B 2 235 ? -6.508  -10.195 46.958  1.00 46.68 ? 238 TYR A CZ    1 
ATOM   3009 O  OH    . TYR B 2 235 ? -5.352  -10.895 47.221  1.00 46.87 ? 238 TYR A OH    1 
ATOM   3010 N  N     . PHE B 2 236 ? -12.005 -5.487  45.693  1.00 45.49 ? 239 PHE A N     1 
ATOM   3011 C  CA    . PHE B 2 236 ? -13.296 -4.903  45.320  1.00 45.26 ? 239 PHE A CA    1 
ATOM   3012 C  C     . PHE B 2 236 ? -13.157 -3.705  44.375  1.00 45.21 ? 239 PHE A C     1 
ATOM   3013 O  O     . PHE B 2 236 ? -14.050 -3.451  43.563  1.00 45.36 ? 239 PHE A O     1 
ATOM   3014 C  CB    . PHE B 2 236 ? -14.129 -4.536  46.553  1.00 45.07 ? 239 PHE A CB    1 
ATOM   3015 C  CG    . PHE B 2 236 ? -15.578 -4.247  46.244  1.00 44.84 ? 239 PHE A CG    1 
ATOM   3016 C  CD1   . PHE B 2 236 ? -16.419 -5.250  45.767  1.00 44.53 ? 239 PHE A CD1   1 
ATOM   3017 C  CD2   . PHE B 2 236 ? -16.101 -2.972  46.428  1.00 44.45 ? 239 PHE A CD2   1 
ATOM   3018 C  CE1   . PHE B 2 236 ? -17.759 -4.988  45.477  1.00 44.29 ? 239 PHE A CE1   1 
ATOM   3019 C  CE2   . PHE B 2 236 ? -17.439 -2.701  46.142  1.00 44.36 ? 239 PHE A CE2   1 
ATOM   3020 C  CZ    . PHE B 2 236 ? -18.268 -3.711  45.666  1.00 44.46 ? 239 PHE A CZ    1 
ATOM   3021 N  N     . ARG B 2 237 ? -12.044 -2.978  44.478  1.00 45.02 ? 240 ARG A N     1 
ATOM   3022 C  CA    . ARG B 2 237 ? -11.727 -1.918  43.513  1.00 44.96 ? 240 ARG A CA    1 
ATOM   3023 C  C     . ARG B 2 237 ? -11.584 -2.491  42.103  1.00 44.74 ? 240 ARG A C     1 
ATOM   3024 O  O     . ARG B 2 237 ? -12.105 -1.924  41.147  1.00 44.81 ? 240 ARG A O     1 
ATOM   3025 C  CB    . ARG B 2 237 ? -10.459 -1.148  43.917  1.00 44.90 ? 240 ARG A CB    1 
ATOM   3026 C  CG    . ARG B 2 237 ? -9.958  -0.163  42.855  1.00 44.98 ? 240 ARG A CG    1 
ATOM   3027 C  CD    . ARG B 2 237 ? -8.946  0.825   43.409  1.00 45.03 ? 240 ARG A CD    1 
ATOM   3028 N  NE    . ARG B 2 237 ? -9.591  1.823   44.260  1.00 45.55 ? 240 ARG A NE    1 
ATOM   3029 C  CZ    . ARG B 2 237 ? -9.943  3.045   43.868  1.00 44.71 ? 240 ARG A CZ    1 
ATOM   3030 N  NH1   . ARG B 2 237 ? -9.705  3.458   42.630  1.00 44.02 ? 240 ARG A NH1   1 
ATOM   3031 N  NH2   . ARG B 2 237 ? -10.530 3.860   44.729  1.00 44.82 ? 240 ARG A NH2   1 
ATOM   3032 N  N     . LYS B 2 238 ? -10.888 -3.622  41.993  1.00 44.57 ? 241 LYS A N     1 
ATOM   3033 C  CA    . LYS B 2 238 ? -10.654 -4.294  40.713  1.00 44.34 ? 241 LYS A CA    1 
ATOM   3034 C  C     . LYS B 2 238 ? -11.906 -4.962  40.141  1.00 43.89 ? 241 LYS A C     1 
ATOM   3035 O  O     . LYS B 2 238 ? -11.972 -5.236  38.940  1.00 43.88 ? 241 LYS A O     1 
ATOM   3036 C  CB    . LYS B 2 238 ? -9.522  -5.316  40.848  1.00 44.60 ? 241 LYS A CB    1 
ATOM   3037 C  CG    . LYS B 2 238 ? -8.135  -4.696  40.847  1.00 45.65 ? 241 LYS A CG    1 
ATOM   3038 C  CD    . LYS B 2 238 ? -7.080  -5.684  41.321  1.00 47.30 ? 241 LYS A CD    1 
ATOM   3039 C  CE    . LYS B 2 238 ? -5.686  -5.074  41.258  1.00 48.37 ? 241 LYS A CE    1 
ATOM   3040 N  NZ    . LYS B 2 238 ? -5.208  -4.905  39.853  1.00 49.26 ? 241 LYS A NZ    1 
ATOM   3041 N  N     . ALA B 2 239 ? -12.885 -5.222  41.007  1.00 43.39 ? 242 ALA A N     1 
ATOM   3042 C  CA    . ALA B 2 239 ? -14.175 -5.799  40.615  1.00 42.93 ? 242 ALA A CA    1 
ATOM   3043 C  C     . ALA B 2 239 ? -15.016 -4.826  39.789  1.00 42.69 ? 242 ALA A C     1 
ATOM   3044 O  O     . ALA B 2 239 ? -15.912 -5.236  39.043  1.00 42.57 ? 242 ALA A O     1 
ATOM   3045 C  CB    . ALA B 2 239 ? -14.949 -6.226  41.851  1.00 42.90 ? 242 ALA A CB    1 
ATOM   3046 N  N     . ILE B 2 240 ? -14.710 -3.539  39.932  1.00 42.32 ? 243 ILE A N     1 
ATOM   3047 C  CA    . ILE B 2 240 ? -15.508 -2.461  39.362  1.00 41.89 ? 243 ILE A CA    1 
ATOM   3048 C  C     . ILE B 2 240 ? -14.659 -1.628  38.404  1.00 41.59 ? 243 ILE A C     1 
ATOM   3049 O  O     . ILE B 2 240 ? -13.532 -1.254  38.726  1.00 41.45 ? 243 ILE A O     1 
ATOM   3050 C  CB    . ILE B 2 240 ? -16.105 -1.572  40.495  1.00 42.04 ? 243 ILE A CB    1 
ATOM   3051 C  CG1   . ILE B 2 240 ? -17.139 -2.368  41.307  1.00 42.11 ? 243 ILE A CG1   1 
ATOM   3052 C  CG2   . ILE B 2 240 ? -16.726 -0.292  39.938  1.00 41.72 ? 243 ILE A CG2   1 
ATOM   3053 C  CD1   . ILE B 2 240 ? -17.461 -1.768  42.656  1.00 42.32 ? 243 ILE A CD1   1 
ATOM   3054 N  N     . GLN B 2 241 ? -15.200 -1.362  37.219  1.00 41.08 ? 244 GLN A N     1 
ATOM   3055 C  CA    . GLN B 2 241 ? -14.532 -0.506  36.244  1.00 40.82 ? 244 GLN A CA    1 
ATOM   3056 C  C     . GLN B 2 241 ? -15.120 0.901   36.311  1.00 40.44 ? 244 GLN A C     1 
ATOM   3057 O  O     . GLN B 2 241 ? -16.276 1.064   36.706  1.00 40.46 ? 244 GLN A O     1 
ATOM   3058 C  CB    . GLN B 2 241 ? -14.672 -1.083  34.826  1.00 40.84 ? 244 GLN A CB    1 
ATOM   3059 C  CG    . GLN B 2 241 ? -14.348 -2.575  34.710  1.00 40.94 ? 244 GLN A CG    1 
ATOM   3060 C  CD    . GLN B 2 241 ? -13.007 -2.943  35.324  1.00 40.96 ? 244 GLN A CD    1 
ATOM   3061 O  OE1   . GLN B 2 241 ? -11.970 -2.385  34.966  1.00 41.90 ? 244 GLN A OE1   1 
ATOM   3062 N  NE2   . GLN B 2 241 ? -13.024 -3.890  36.253  1.00 41.05 ? 244 GLN A NE2   1 
ATOM   3063 N  N     . PRO B 2 242 ? -14.327 1.928   35.946  1.00 40.17 ? 245 PRO A N     1 
ATOM   3064 C  CA    . PRO B 2 242 ? -14.892 3.277   35.881  1.00 39.88 ? 245 PRO A CA    1 
ATOM   3065 C  C     . PRO B 2 242 ? -15.942 3.378   34.775  1.00 39.70 ? 245 PRO A C     1 
ATOM   3066 O  O     . PRO B 2 242 ? -15.859 2.645   33.784  1.00 39.77 ? 245 PRO A O     1 
ATOM   3067 C  CB    . PRO B 2 242 ? -13.680 4.152   35.545  1.00 39.95 ? 245 PRO A CB    1 
ATOM   3068 C  CG    . PRO B 2 242 ? -12.697 3.227   34.905  1.00 40.01 ? 245 PRO A CG    1 
ATOM   3069 C  CD    . PRO B 2 242 ? -12.896 1.909   35.588  1.00 40.15 ? 245 PRO A CD    1 
ATOM   3070 N  N     . MET B 2 243 ? -16.916 4.270   34.946  1.00 39.19 ? 246 MET A N     1 
ATOM   3071 C  CA    . MET B 2 243 ? -17.970 4.467   33.942  1.00 38.97 ? 246 MET A CA    1 
ATOM   3072 C  C     . MET B 2 243 ? -17.416 4.842   32.560  1.00 38.60 ? 246 MET A C     1 
ATOM   3073 O  O     . MET B 2 243 ? -18.065 4.605   31.542  1.00 38.60 ? 246 MET A O     1 
ATOM   3074 C  CB    . MET B 2 243 ? -19.005 5.500   34.416  1.00 38.78 ? 246 MET A CB    1 
ATOM   3075 C  CG    . MET B 2 243 ? -18.483 6.922   34.584  1.00 38.93 ? 246 MET A CG    1 
ATOM   3076 S  SD    . MET B 2 243 ? -19.786 8.075   35.071  1.00 39.20 ? 246 MET A SD    1 
ATOM   3077 C  CE    . MET B 2 243 ? -18.838 9.575   35.313  1.00 38.40 ? 246 MET A CE    1 
ATOM   3078 N  N     . GLU B 2 244 ? -16.216 5.423   32.544  1.00 38.28 ? 247 GLU A N     1 
ATOM   3079 C  CA    . GLU B 2 244 ? -15.524 5.809   31.308  1.00 38.11 ? 247 GLU A CA    1 
ATOM   3080 C  C     . GLU B 2 244 ? -15.258 4.619   30.377  1.00 38.05 ? 247 GLU A C     1 
ATOM   3081 O  O     . GLU B 2 244 ? -15.257 4.775   29.158  1.00 37.93 ? 247 GLU A O     1 
ATOM   3082 C  CB    . GLU B 2 244 ? -14.210 6.533   31.631  1.00 37.97 ? 247 GLU A CB    1 
ATOM   3083 C  CG    . GLU B 2 244 ? -14.371 7.980   32.109  1.00 37.50 ? 247 GLU A CG    1 
ATOM   3084 C  CD    . GLU B 2 244 ? -14.842 8.112   33.559  1.00 37.21 ? 247 GLU A CD    1 
ATOM   3085 O  OE1   . GLU B 2 244 ? -15.152 9.248   33.975  1.00 36.58 ? 247 GLU A OE1   1 
ATOM   3086 O  OE2   . GLU B 2 244 ? -14.908 7.094   34.285  1.00 37.27 ? 247 GLU A OE2   1 
ATOM   3087 N  N     . LYS B 2 245 ? -15.040 3.440   30.959  1.00 38.13 ? 248 LYS A N     1 
ATOM   3088 C  CA    . LYS B 2 245 ? -14.870 2.203   30.192  1.00 38.38 ? 248 LYS A CA    1 
ATOM   3089 C  C     . LYS B 2 245 ? -16.105 1.883   29.341  1.00 38.54 ? 248 LYS A C     1 
ATOM   3090 O  O     . LYS B 2 245 ? -15.974 1.444   28.201  1.00 38.52 ? 248 LYS A O     1 
ATOM   3091 C  CB    . LYS B 2 245 ? -14.530 1.028   31.124  1.00 38.39 ? 248 LYS A CB    1 
ATOM   3092 C  CG    . LYS B 2 245 ? -14.483 -0.351  30.456  1.00 38.66 ? 248 LYS A CG    1 
ATOM   3093 C  CD    . LYS B 2 245 ? -13.215 -0.544  29.648  1.00 39.43 ? 248 LYS A CD    1 
ATOM   3094 C  CE    . LYS B 2 245 ? -13.210 -1.874  28.917  1.00 39.96 ? 248 LYS A CE    1 
ATOM   3095 N  NZ    . LYS B 2 245 ? -11.993 -1.978  28.052  1.00 41.22 ? 248 LYS A NZ    1 
ATOM   3096 N  N     . ALA B 2 246 ? -17.294 2.124   29.896  1.00 38.77 ? 249 ALA A N     1 
ATOM   3097 C  CA    . ALA B 2 246 ? -18.561 1.898   29.187  1.00 39.08 ? 249 ALA A CA    1 
ATOM   3098 C  C     . ALA B 2 246 ? -18.722 2.785   27.952  1.00 39.36 ? 249 ALA A C     1 
ATOM   3099 O  O     . ALA B 2 246 ? -19.682 2.641   27.191  1.00 39.39 ? 249 ALA A O     1 
ATOM   3100 C  CB    . ALA B 2 246 ? -19.738 2.101   30.133  1.00 39.13 ? 249 ALA A CB    1 
ATOM   3101 N  N     . VAL B 2 247 ? -17.762 3.683   27.756  1.00 39.48 ? 250 VAL A N     1 
ATOM   3102 C  CA    . VAL B 2 247 ? -17.843 4.711   26.729  1.00 39.94 ? 250 VAL A CA    1 
ATOM   3103 C  C     . VAL B 2 247 ? -16.691 4.623   25.703  1.00 40.23 ? 250 VAL A C     1 
ATOM   3104 O  O     . VAL B 2 247 ? -16.624 5.419   24.763  1.00 40.09 ? 250 VAL A O     1 
ATOM   3105 C  CB    . VAL B 2 247 ? -18.008 6.113   27.416  1.00 39.99 ? 250 VAL A CB    1 
ATOM   3106 C  CG1   . VAL B 2 247 ? -16.910 7.096   27.053  1.00 39.63 ? 250 VAL A CG1   1 
ATOM   3107 C  CG2   . VAL B 2 247 ? -19.406 6.668   27.177  1.00 39.87 ? 250 VAL A CG2   1 
ATOM   3108 N  N     . GLU B 2 248 ? -15.826 3.620   25.873  1.00 40.76 ? 251 GLU A N     1 
ATOM   3109 C  CA    . GLU B 2 248 ? -14.624 3.425   25.040  1.00 41.63 ? 251 GLU A CA    1 
ATOM   3110 C  C     . GLU B 2 248 ? -14.886 3.236   23.545  1.00 41.40 ? 251 GLU A C     1 
ATOM   3111 O  O     . GLU B 2 248 ? -14.022 3.529   22.723  1.00 41.50 ? 251 GLU A O     1 
ATOM   3112 C  CB    . GLU B 2 248 ? -13.800 2.237   25.550  1.00 41.57 ? 251 GLU A CB    1 
ATOM   3113 C  CG    . GLU B 2 248 ? -12.864 2.561   26.704  1.00 42.87 ? 251 GLU A CG    1 
ATOM   3114 C  CD    . GLU B 2 248 ? -11.830 1.470   26.963  1.00 43.04 ? 251 GLU A CD    1 
ATOM   3115 O  OE1   . GLU B 2 248 ? -12.026 0.317   26.503  1.00 44.58 ? 251 GLU A OE1   1 
ATOM   3116 O  OE2   . GLU B 2 248 ? -10.818 1.770   27.637  1.00 44.24 ? 251 GLU A OE2   1 
ATOM   3117 N  N     . HIS B 2 249 ? -16.070 2.736   23.208  1.00 41.59 ? 252 HIS A N     1 
ATOM   3118 C  CA    . HIS B 2 249 ? -16.438 2.423   21.827  1.00 41.81 ? 252 HIS A CA    1 
ATOM   3119 C  C     . HIS B 2 249 ? -17.100 3.593   21.091  1.00 41.79 ? 252 HIS A C     1 
ATOM   3120 O  O     . HIS B 2 249 ? -17.341 3.511   19.884  1.00 41.85 ? 252 HIS A O     1 
ATOM   3121 C  CB    . HIS B 2 249 ? -17.367 1.205   21.809  1.00 42.07 ? 252 HIS A CB    1 
ATOM   3122 C  CG    . HIS B 2 249 ? -18.676 1.436   22.501  1.00 42.70 ? 252 HIS A CG    1 
ATOM   3123 N  ND1   . HIS B 2 249 ? -18.762 1.874   23.807  1.00 42.57 ? 252 HIS A ND1   1 
ATOM   3124 C  CD2   . HIS B 2 249 ? -19.950 1.296   22.067  1.00 43.17 ? 252 HIS A CD2   1 
ATOM   3125 C  CE1   . HIS B 2 249 ? -20.033 1.993   24.145  1.00 43.26 ? 252 HIS A CE1   1 
ATOM   3126 N  NE2   . HIS B 2 249 ? -20.774 1.648   23.108  1.00 43.66 ? 252 HIS A NE2   1 
ATOM   3127 N  N     . LEU B 2 250 ? -17.388 4.674   21.816  1.00 41.66 ? 253 LEU A N     1 
ATOM   3128 C  CA    . LEU B 2 250 ? -18.084 5.830   21.245  1.00 41.69 ? 253 LEU A CA    1 
ATOM   3129 C  C     . LEU B 2 250 ? -17.138 6.914   20.724  1.00 41.71 ? 253 LEU A C     1 
ATOM   3130 O  O     . LEU B 2 250 ? -16.042 7.094   21.264  1.00 41.68 ? 253 LEU A O     1 
ATOM   3131 C  CB    . LEU B 2 250 ? -19.035 6.456   22.272  1.00 41.62 ? 253 LEU A CB    1 
ATOM   3132 C  CG    . LEU B 2 250 ? -20.252 5.673   22.768  1.00 41.62 ? 253 LEU A CG    1 
ATOM   3133 C  CD1   . LEU B 2 250 ? -20.996 6.525   23.774  1.00 41.11 ? 253 LEU A CD1   1 
ATOM   3134 C  CD2   . LEU B 2 250 ? -21.181 5.253   21.627  1.00 41.02 ? 253 LEU A CD2   1 
ATOM   3135 N  N     . PRO B 2 251 ? -17.561 7.640   19.667  1.00 41.69 ? 254 PRO A N     1 
ATOM   3136 C  CA    . PRO B 2 251 ? -16.841 8.851   19.275  1.00 41.77 ? 254 PRO A CA    1 
ATOM   3137 C  C     . PRO B 2 251 ? -16.869 9.873   20.411  1.00 41.85 ? 254 PRO A C     1 
ATOM   3138 O  O     . PRO B 2 251 ? -17.900 10.052  21.065  1.00 41.94 ? 254 PRO A O     1 
ATOM   3139 C  CB    . PRO B 2 251 ? -17.629 9.362   18.063  1.00 41.66 ? 254 PRO A CB    1 
ATOM   3140 C  CG    . PRO B 2 251 ? -18.955 8.689   18.131  1.00 41.65 ? 254 PRO A CG    1 
ATOM   3141 C  CD    . PRO B 2 251 ? -18.708 7.368   18.780  1.00 41.62 ? 254 PRO A CD    1 
ATOM   3142 N  N     . LYS B 2 252 ? -15.736 10.518  20.650  1.00 41.98 ? 255 LYS A N     1 
ATOM   3143 C  CA    . LYS B 2 252 ? -15.601 11.425  21.781  1.00 42.11 ? 255 LYS A CA    1 
ATOM   3144 C  C     . LYS B 2 252 ? -15.323 12.853  21.358  1.00 42.28 ? 255 LYS A C     1 
ATOM   3145 O  O     . LYS B 2 252 ? -14.706 13.102  20.317  1.00 42.19 ? 255 LYS A O     1 
ATOM   3146 C  CB    . LYS B 2 252 ? -14.509 10.935  22.731  1.00 42.12 ? 255 LYS A CB    1 
ATOM   3147 C  CG    . LYS B 2 252 ? -14.872 9.654   23.463  1.00 41.78 ? 255 LYS A CG    1 
ATOM   3148 C  CD    . LYS B 2 252 ? -13.669 9.055   24.150  1.00 41.85 ? 255 LYS A CD    1 
ATOM   3149 C  CE    . LYS B 2 252 ? -14.031 7.742   24.814  1.00 42.30 ? 255 LYS A CE    1 
ATOM   3150 N  NZ    . LYS B 2 252 ? -12.836 7.102   25.424  1.00 42.84 ? 255 LYS A NZ    1 
ATOM   3151 N  N     . VAL B 2 253 ? -15.816 13.785  22.169  1.00 42.48 ? 256 VAL A N     1 
ATOM   3152 C  CA    . VAL B 2 253 ? -15.478 15.196  22.052  1.00 42.60 ? 256 VAL A CA    1 
ATOM   3153 C  C     . VAL B 2 253 ? -14.884 15.657  23.386  1.00 42.54 ? 256 VAL A C     1 
ATOM   3154 O  O     . VAL B 2 253 ? -15.550 15.608  24.423  1.00 42.64 ? 256 VAL A O     1 
ATOM   3155 C  CB    . VAL B 2 253 ? -16.697 16.069  21.614  1.00 42.75 ? 256 VAL A CB    1 
ATOM   3156 C  CG1   . VAL B 2 253 ? -17.027 15.833  20.148  1.00 42.92 ? 256 VAL A CG1   1 
ATOM   3157 C  CG2   . VAL B 2 253 ? -17.925 15.784  22.468  1.00 43.51 ? 256 VAL A CG2   1 
ATOM   3158 N  N     . TRP B 2 254 ? -13.616 16.061  23.353  1.00 42.43 ? 257 TRP A N     1 
ATOM   3159 C  CA    . TRP B 2 254 ? -12.903 16.532  24.540  1.00 42.28 ? 257 TRP A CA    1 
ATOM   3160 C  C     . TRP B 2 254 ? -13.068 18.040  24.679  1.00 42.31 ? 257 TRP A C     1 
ATOM   3161 O  O     . TRP B 2 254 ? -12.769 18.792  23.751  1.00 42.43 ? 257 TRP A O     1 
ATOM   3162 C  CB    . TRP B 2 254 ? -11.416 16.179  24.461  1.00 42.12 ? 257 TRP A CB    1 
ATOM   3163 C  CG    . TRP B 2 254 ? -11.113 14.719  24.631  1.00 42.08 ? 257 TRP A CG    1 
ATOM   3164 C  CD1   . TRP B 2 254 ? -10.826 14.075  25.800  1.00 42.02 ? 257 TRP A CD1   1 
ATOM   3165 C  CD2   . TRP B 2 254 ? -11.045 13.726  23.599  1.00 41.80 ? 257 TRP A CD2   1 
ATOM   3166 N  NE1   . TRP B 2 254 ? -10.592 12.744  25.563  1.00 42.11 ? 257 TRP A NE1   1 
ATOM   3167 C  CE2   . TRP B 2 254 ? -10.720 12.501  24.221  1.00 42.11 ? 257 TRP A CE2   1 
ATOM   3168 C  CE3   . TRP B 2 254 ? -11.232 13.752  22.210  1.00 41.85 ? 257 TRP A CE3   1 
ATOM   3169 C  CZ2   . TRP B 2 254 ? -10.576 11.307  23.502  1.00 41.96 ? 257 TRP A CZ2   1 
ATOM   3170 C  CZ3   . TRP B 2 254 ? -11.089 12.566  21.494  1.00 41.95 ? 257 TRP A CZ3   1 
ATOM   3171 C  CH2   . TRP B 2 254 ? -10.763 11.360  22.144  1.00 41.98 ? 257 TRP A CH2   1 
ATOM   3172 N  N     . ILE B 2 255 ? -13.536 18.475  25.845  1.00 42.21 ? 258 ILE A N     1 
ATOM   3173 C  CA    . ILE B 2 255 ? -13.895 19.877  26.052  1.00 42.14 ? 258 ILE A CA    1 
ATOM   3174 C  C     . ILE B 2 255 ? -12.974 20.582  27.049  1.00 42.05 ? 258 ILE A C     1 
ATOM   3175 O  O     . ILE B 2 255 ? -12.352 19.936  27.899  1.00 42.07 ? 258 ILE A O     1 
ATOM   3176 C  CB    . ILE B 2 255 ? -15.393 20.039  26.458  1.00 42.25 ? 258 ILE A CB    1 
ATOM   3177 C  CG1   . ILE B 2 255 ? -15.663 19.450  27.850  1.00 42.01 ? 258 ILE A CG1   1 
ATOM   3178 C  CG2   . ILE B 2 255 ? -16.297 19.391  25.408  1.00 42.44 ? 258 ILE A CG2   1 
ATOM   3179 C  CD1   . ILE B 2 255 ? -17.005 19.854  28.448  1.00 41.96 ? 258 ILE A CD1   1 
ATOM   3180 N  N     . LYS B 2 256 ? -12.889 21.905  26.922  1.00 41.79 ? 259 LYS A N     1 
ATOM   3181 C  CA    . LYS B 2 256 ? -12.080 22.738  27.814  1.00 41.76 ? 259 LYS A CA    1 
ATOM   3182 C  C     . LYS B 2 256 ? -12.709 22.801  29.198  1.00 41.67 ? 259 LYS A C     1 
ATOM   3183 O  O     . LYS B 2 256 ? -13.929 22.686  29.334  1.00 41.73 ? 259 LYS A O     1 
ATOM   3184 C  CB    . LYS B 2 256 ? -11.945 24.162  27.259  1.00 41.74 ? 259 LYS A CB    1 
ATOM   3185 C  CG    . LYS B 2 256 ? -11.407 24.262  25.842  1.00 41.75 ? 259 LYS A CG    1 
ATOM   3186 C  CD    . LYS B 2 256 ? -11.524 25.693  25.329  1.00 41.60 ? 259 LYS A CD    1 
ATOM   3187 C  CE    . LYS B 2 256 ? -11.154 25.797  23.861  1.00 41.42 ? 259 LYS A CE    1 
ATOM   3188 N  NZ    . LYS B 2 256 ? -11.269 27.203  23.365  1.00 41.96 ? 259 LYS A NZ    1 
ATOM   3189 N  N     . ASP B 2 257 ? -11.872 23.001  30.215  1.00 41.72 ? 260 ASP A N     1 
ATOM   3190 C  CA    . ASP B 2 257 ? -12.327 23.122  31.604  1.00 41.90 ? 260 ASP A CA    1 
ATOM   3191 C  C     . ASP B 2 257 ? -13.470 24.126  31.765  1.00 41.95 ? 260 ASP A C     1 
ATOM   3192 O  O     . ASP B 2 257 ? -14.414 23.883  32.521  1.00 42.21 ? 260 ASP A O     1 
ATOM   3193 C  CB    . ASP B 2 257 ? -11.164 23.525  32.519  1.00 42.05 ? 260 ASP A CB    1 
ATOM   3194 C  CG    . ASP B 2 257 ? -10.115 22.432  32.670  1.00 42.24 ? 260 ASP A CG    1 
ATOM   3195 O  OD1   . ASP B 2 257 ? -10.243 21.354  32.051  1.00 42.76 ? 260 ASP A OD1   1 
ATOM   3196 O  OD2   . ASP B 2 257 ? -9.147  22.661  33.423  1.00 42.61 ? 260 ASP A OD2   1 
ATOM   3197 N  N     . SER B 2 258 ? -13.381 25.235  31.033  1.00 41.88 ? 261 SER A N     1 
ATOM   3198 C  CA    . SER B 2 258 ? -14.329 26.348  31.126  1.00 41.84 ? 261 SER A CA    1 
ATOM   3199 C  C     . SER B 2 258 ? -15.734 26.041  30.594  1.00 41.92 ? 261 SER A C     1 
ATOM   3200 O  O     . SER B 2 258 ? -16.656 26.842  30.771  1.00 41.76 ? 261 SER A O     1 
ATOM   3201 C  CB    . SER B 2 258 ? -13.758 27.577  30.410  1.00 41.81 ? 261 SER A CB    1 
ATOM   3202 O  OG    . SER B 2 258 ? -13.424 27.270  29.068  1.00 41.48 ? 261 SER A OG    1 
ATOM   3203 N  N     . ALA B 2 259 ? -15.888 24.886  29.948  1.00 42.06 ? 262 ALA A N     1 
ATOM   3204 C  CA    . ALA B 2 259 ? -17.173 24.462  29.391  1.00 42.16 ? 262 ALA A CA    1 
ATOM   3205 C  C     . ALA B 2 259 ? -17.828 23.343  30.202  1.00 42.19 ? 262 ALA A C     1 
ATOM   3206 O  O     . ALA B 2 259 ? -19.012 23.049  30.017  1.00 42.44 ? 262 ALA A O     1 
ATOM   3207 C  CB    . ALA B 2 259 ? -16.998 24.025  27.939  1.00 42.15 ? 262 ALA A CB    1 
ATOM   3208 N  N     . VAL B 2 260 ? -17.059 22.730  31.099  1.00 42.14 ? 263 VAL A N     1 
ATOM   3209 C  CA    . VAL B 2 260 ? -17.503 21.541  31.835  1.00 42.14 ? 263 VAL A CA    1 
ATOM   3210 C  C     . VAL B 2 260 ? -18.708 21.806  32.746  1.00 42.18 ? 263 VAL A C     1 
ATOM   3211 O  O     . VAL B 2 260 ? -19.710 21.089  32.669  1.00 42.25 ? 263 VAL A O     1 
ATOM   3212 C  CB    . VAL B 2 260 ? -16.348 20.893  32.643  1.00 42.12 ? 263 VAL A CB    1 
ATOM   3213 C  CG1   . VAL B 2 260 ? -16.841 19.667  33.390  1.00 42.01 ? 263 VAL A CG1   1 
ATOM   3214 C  CG2   . VAL B 2 260 ? -15.195 20.515  31.723  1.00 42.09 ? 263 VAL A CG2   1 
ATOM   3215 N  N     . ALA B 2 261 ? -18.610 22.833  33.593  1.00 41.99 ? 264 ALA A N     1 
ATOM   3216 C  CA    . ALA B 2 261 ? -19.688 23.169  34.528  1.00 41.99 ? 264 ALA A CA    1 
ATOM   3217 C  C     . ALA B 2 261 ? -20.963 23.635  33.827  1.00 42.00 ? 264 ALA A C     1 
ATOM   3218 O  O     . ALA B 2 261 ? -22.062 23.394  34.322  1.00 42.22 ? 264 ALA A O     1 
ATOM   3219 C  CB    . ALA B 2 261 ? -19.227 24.204  35.547  1.00 41.89 ? 264 ALA A CB    1 
ATOM   3220 N  N     . ALA B 2 262 ? -20.816 24.296  32.680  1.00 41.90 ? 265 ALA A N     1 
ATOM   3221 C  CA    . ALA B 2 262 ? -21.967 24.694  31.874  1.00 41.84 ? 265 ALA A CA    1 
ATOM   3222 C  C     . ALA B 2 262 ? -22.793 23.477  31.448  1.00 41.80 ? 265 ALA A C     1 
ATOM   3223 O  O     . ALA B 2 262 ? -24.012 23.460  31.621  1.00 41.94 ? 265 ALA A O     1 
ATOM   3224 C  CB    . ALA B 2 262 ? -21.522 25.499  30.664  1.00 41.81 ? 265 ALA A CB    1 
ATOM   3225 N  N     . VAL B 2 263 ? -22.116 22.462  30.914  1.00 41.71 ? 266 VAL A N     1 
ATOM   3226 C  CA    . VAL B 2 263 ? -22.760 21.215  30.486  1.00 41.59 ? 266 VAL A CA    1 
ATOM   3227 C  C     . VAL B 2 263 ? -23.431 20.488  31.659  1.00 41.59 ? 266 VAL A C     1 
ATOM   3228 O  O     . VAL B 2 263 ? -24.548 19.981  31.524  1.00 41.66 ? 266 VAL A O     1 
ATOM   3229 C  CB    . VAL B 2 263 ? -21.760 20.281  29.740  1.00 41.57 ? 266 VAL A CB    1 
ATOM   3230 C  CG1   . VAL B 2 263 ? -22.359 18.894  29.492  1.00 41.55 ? 266 VAL A CG1   1 
ATOM   3231 C  CG2   . VAL B 2 263 ? -21.321 20.912  28.421  1.00 41.28 ? 266 VAL A CG2   1 
ATOM   3232 N  N     . THR B 2 264 ? -22.761 20.462  32.809  1.00 41.53 ? 267 THR A N     1 
ATOM   3233 C  CA    . THR B 2 264 ? -23.309 19.806  34.000  1.00 41.50 ? 267 THR A CA    1 
ATOM   3234 C  C     . THR B 2 264 ? -24.462 20.584  34.634  1.00 41.39 ? 267 THR A C     1 
ATOM   3235 O  O     . THR B 2 264 ? -25.193 20.050  35.466  1.00 41.45 ? 267 THR A O     1 
ATOM   3236 C  CB    . THR B 2 264 ? -22.224 19.499  35.059  1.00 41.42 ? 267 THR A CB    1 
ATOM   3237 O  OG1   . THR B 2 264 ? -21.655 20.721  35.543  1.00 41.56 ? 267 THR A OG1   1 
ATOM   3238 C  CG2   . THR B 2 264 ? -21.123 18.617  34.468  1.00 41.59 ? 267 THR A CG2   1 
ATOM   3239 N  N     . HIS B 2 265 ? -24.624 21.841  34.230  1.00 41.42 ? 268 HIS A N     1 
ATOM   3240 C  CA    . HIS B 2 265 ? -25.731 22.675  34.695  1.00 41.40 ? 268 HIS A CA    1 
ATOM   3241 C  C     . HIS B 2 265 ? -26.875 22.756  33.678  1.00 41.50 ? 268 HIS A C     1 
ATOM   3242 O  O     . HIS B 2 265 ? -27.844 23.491  33.879  1.00 41.54 ? 268 HIS A O     1 
ATOM   3243 C  CB    . HIS B 2 265 ? -25.232 24.074  35.064  1.00 41.33 ? 268 HIS A CB    1 
ATOM   3244 C  CG    . HIS B 2 265 ? -24.563 24.141  36.401  1.00 41.20 ? 268 HIS A CG    1 
ATOM   3245 N  ND1   . HIS B 2 265 ? -25.175 24.680  37.511  1.00 41.09 ? 268 HIS A ND1   1 
ATOM   3246 C  CD2   . HIS B 2 265 ? -23.338 23.731  36.809  1.00 41.05 ? 268 HIS A CD2   1 
ATOM   3247 C  CE1   . HIS B 2 265 ? -24.355 24.605  38.544  1.00 41.33 ? 268 HIS A CE1   1 
ATOM   3248 N  NE2   . HIS B 2 265 ? -23.233 24.034  38.144  1.00 41.27 ? 268 HIS A NE2   1 
ATOM   3249 N  N     . GLY B 2 266 ? -26.757 22.001  32.589  1.00 41.51 ? 269 GLY A N     1 
ATOM   3250 C  CA    . GLY B 2 266 ? -27.835 21.901  31.608  1.00 41.59 ? 269 GLY A CA    1 
ATOM   3251 C  C     . GLY B 2 266 ? -27.627 22.582  30.268  1.00 41.51 ? 269 GLY A C     1 
ATOM   3252 O  O     . GLY B 2 266 ? -28.511 22.542  29.415  1.00 41.71 ? 269 GLY A O     1 
ATOM   3253 N  N     . ALA B 2 267 ? -26.472 23.215  30.076  1.00 41.41 ? 270 ALA A N     1 
ATOM   3254 C  CA    . ALA B 2 267 ? -26.144 23.816  28.784  1.00 41.34 ? 270 ALA A CA    1 
ATOM   3255 C  C     . ALA B 2 267 ? -25.747 22.748  27.773  1.00 41.37 ? 270 ALA A C     1 
ATOM   3256 O  O     . ALA B 2 267 ? -25.084 21.764  28.119  1.00 41.35 ? 270 ALA A O     1 
ATOM   3257 C  CB    . ALA B 2 267 ? -25.028 24.835  28.929  1.00 41.25 ? 270 ALA A CB    1 
ATOM   3258 N  N     . ASP B 2 268 ? -26.166 22.940  26.527  1.00 41.31 ? 271 ASP A N     1 
ATOM   3259 C  CA    . ASP B 2 268 ? -25.676 22.123  25.426  1.00 41.42 ? 271 ASP A CA    1 
ATOM   3260 C  C     . ASP B 2 268 ? -24.260 22.575  25.083  1.00 41.52 ? 271 ASP A C     1 
ATOM   3261 O  O     . ASP B 2 268 ? -23.868 23.703  25.402  1.00 41.39 ? 271 ASP A O     1 
ATOM   3262 C  CB    . ASP B 2 268 ? -26.597 22.236  24.208  1.00 41.39 ? 271 ASP A CB    1 
ATOM   3263 C  CG    . ASP B 2 268 ? -27.973 21.636  24.455  1.00 41.29 ? 271 ASP A CG    1 
ATOM   3264 O  OD1   . ASP B 2 268 ? -28.068 20.590  25.134  1.00 40.95 ? 271 ASP A OD1   1 
ATOM   3265 O  OD2   . ASP B 2 268 ? -28.964 22.213  23.965  1.00 41.37 ? 271 ASP A OD2   1 
ATOM   3266 N  N     . LEU B 2 269 ? -23.494 21.692  24.448  1.00 41.54 ? 272 LEU A N     1 
ATOM   3267 C  CA    . LEU B 2 269 ? -22.108 21.992  24.116  1.00 41.65 ? 272 LEU A CA    1 
ATOM   3268 C  C     . LEU B 2 269 ? -21.998 22.821  22.845  1.00 41.79 ? 272 LEU A C     1 
ATOM   3269 O  O     . LEU B 2 269 ? -22.424 22.392  21.770  1.00 41.82 ? 272 LEU A O     1 
ATOM   3270 C  CB    . LEU B 2 269 ? -21.284 20.707  23.985  1.00 41.76 ? 272 LEU A CB    1 
ATOM   3271 C  CG    . LEU B 2 269 ? -19.824 20.877  23.549  1.00 41.73 ? 272 LEU A CG    1 
ATOM   3272 C  CD1   . LEU B 2 269 ? -18.996 21.547  24.646  1.00 41.67 ? 272 LEU A CD1   1 
ATOM   3273 C  CD2   . LEU B 2 269 ? -19.232 19.535  23.153  1.00 41.65 ? 272 LEU A CD2   1 
ATOM   3274 N  N     . ALA B 2 270 ? -21.416 24.008  22.983  1.00 41.85 ? 273 ALA A N     1 
ATOM   3275 C  CA    . ALA B 2 270 ? -21.135 24.865  21.843  1.00 42.03 ? 273 ALA A CA    1 
ATOM   3276 C  C     . ALA B 2 270 ? -19.708 24.653  21.336  1.00 42.18 ? 273 ALA A C     1 
ATOM   3277 O  O     . ALA B 2 270 ? -18.847 24.146  22.059  1.00 42.06 ? 273 ALA A O     1 
ATOM   3278 C  CB    . ALA B 2 270 ? -21.380 26.326  22.195  1.00 41.96 ? 273 ALA A CB    1 
ATOM   3279 N  N     . VAL B 2 271 ? -19.479 25.063  20.090  1.00 42.42 ? 274 VAL A N     1 
ATOM   3280 C  CA    . VAL B 2 271 ? -18.204 24.886  19.383  1.00 42.63 ? 274 VAL A CA    1 
ATOM   3281 C  C     . VAL B 2 271 ? -16.963 25.504  20.068  1.00 42.75 ? 274 VAL A C     1 
ATOM   3282 O  O     . VAL B 2 271 ? -15.912 24.858  20.106  1.00 42.83 ? 274 VAL A O     1 
ATOM   3283 C  CB    . VAL B 2 271 ? -18.328 25.352  17.897  1.00 42.75 ? 274 VAL A CB    1 
ATOM   3284 C  CG1   . VAL B 2 271 ? -16.977 25.429  17.218  1.00 42.73 ? 274 VAL A CG1   1 
ATOM   3285 C  CG2   . VAL B 2 271 ? -19.245 24.417  17.127  1.00 42.81 ? 274 VAL A CG2   1 
ATOM   3286 N  N     . PRO B 2 272 ? -17.069 26.743  20.608  1.00 42.82 ? 275 PRO A N     1 
ATOM   3287 C  CA    . PRO B 2 272 ? -15.897 27.351  21.260  1.00 42.84 ? 275 PRO A CA    1 
ATOM   3288 C  C     . PRO B 2 272 ? -15.377 26.605  22.494  1.00 42.94 ? 275 PRO A C     1 
ATOM   3289 O  O     . PRO B 2 272 ? -14.325 26.967  23.027  1.00 43.07 ? 275 PRO A O     1 
ATOM   3290 C  CB    . PRO B 2 272 ? -16.401 28.741  21.673  1.00 42.89 ? 275 PRO A CB    1 
ATOM   3291 C  CG    . PRO B 2 272 ? -17.587 28.997  20.824  1.00 42.89 ? 275 PRO A CG    1 
ATOM   3292 C  CD    . PRO B 2 272 ? -18.224 27.661  20.635  1.00 42.88 ? 275 PRO A CD    1 
ATOM   3293 N  N     . GLY B 2 273 ? -16.103 25.580  22.937  1.00 42.84 ? 276 GLY A N     1 
ATOM   3294 C  CA    . GLY B 2 273 ? -15.705 24.789  24.097  1.00 42.80 ? 276 GLY A CA    1 
ATOM   3295 C  C     . GLY B 2 273 ? -14.945 23.518  23.762  1.00 42.75 ? 276 GLY A C     1 
ATOM   3296 O  O     . GLY B 2 273 ? -14.400 22.869  24.651  1.00 42.66 ? 276 GLY A O     1 
ATOM   3297 N  N     . ILE B 2 274 ? -14.901 23.169  22.479  1.00 42.78 ? 277 ILE A N     1 
ATOM   3298 C  CA    . ILE B 2 274 ? -14.256 21.937  22.030  1.00 42.75 ? 277 ILE A CA    1 
ATOM   3299 C  C     . ILE B 2 274 ? -12.738 22.094  21.933  1.00 42.55 ? 277 ILE A C     1 
ATOM   3300 O  O     . ILE B 2 274 ? -12.240 23.021  21.299  1.00 42.46 ? 277 ILE A O     1 
ATOM   3301 C  CB    . ILE B 2 274 ? -14.839 21.447  20.678  1.00 42.82 ? 277 ILE A CB    1 
ATOM   3302 C  CG1   . ILE B 2 274 ? -16.345 21.187  20.811  1.00 42.94 ? 277 ILE A CG1   1 
ATOM   3303 C  CG2   . ILE B 2 274 ? -14.111 20.185  20.193  1.00 42.85 ? 277 ILE A CG2   1 
ATOM   3304 C  CD1   . ILE B 2 274 ? -17.052 20.910  19.493  1.00 42.81 ? 277 ILE A CD1   1 
ATOM   3305 N  N     . ALA B 2 275 ? -12.017 21.174  22.570  1.00 42.50 ? 278 ALA A N     1 
ATOM   3306 C  CA    . ALA B 2 275 ? -10.555 21.150  22.523  1.00 42.36 ? 278 ALA A CA    1 
ATOM   3307 C  C     . ALA B 2 275 ? -10.051 20.116  21.514  1.00 42.23 ? 278 ALA A C     1 
ATOM   3308 O  O     . ALA B 2 275 ? -9.175  20.407  20.696  1.00 42.23 ? 278 ALA A O     1 
ATOM   3309 C  CB    . ALA B 2 275 ? -9.991  20.867  23.908  1.00 42.24 ? 278 ALA A CB    1 
ATOM   3310 N  N     . LYS B 2 276 ? -10.614 18.912  21.591  1.00 42.13 ? 279 LYS A N     1 
ATOM   3311 C  CA    . LYS B 2 276 ? -10.263 17.791  20.722  1.00 42.08 ? 279 LYS A CA    1 
ATOM   3312 C  C     . LYS B 2 276 ? -11.530 17.015  20.371  1.00 41.66 ? 279 LYS A C     1 
ATOM   3313 O  O     . LYS B 2 276 ? -12.541 17.134  21.063  1.00 41.63 ? 279 LYS A O     1 
ATOM   3314 C  CB    . LYS B 2 276 ? -9.292  16.854  21.441  1.00 42.31 ? 279 LYS A CB    1 
ATOM   3315 C  CG    . LYS B 2 276 ? -7.841  17.303  21.449  1.00 43.48 ? 279 LYS A CG    1 
ATOM   3316 C  CD    . LYS B 2 276 ? -7.108  16.833  22.709  1.00 44.91 ? 279 LYS A CD    1 
ATOM   3317 C  CE    . LYS B 2 276 ? -7.031  15.315  22.812  1.00 45.93 ? 279 LYS A CE    1 
ATOM   3318 N  NZ    . LYS B 2 276 ? -6.516  14.876  24.145  1.00 46.34 ? 279 LYS A NZ    1 
ATOM   3319 N  N     . LEU B 2 277 ? -11.472 16.218  19.306  1.00 41.23 ? 280 LEU A N     1 
ATOM   3320 C  CA    . LEU B 2 277 ? -12.606 15.382  18.902  1.00 40.70 ? 280 LEU A CA    1 
ATOM   3321 C  C     . LEU B 2 277 ? -12.199 14.260  17.951  1.00 40.52 ? 280 LEU A C     1 
ATOM   3322 O  O     . LEU B 2 277 ? -11.226 14.388  17.205  1.00 40.44 ? 280 LEU A O     1 
ATOM   3323 C  CB    . LEU B 2 277 ? -13.730 16.226  18.279  1.00 40.67 ? 280 LEU A CB    1 
ATOM   3324 C  CG    . LEU B 2 277 ? -13.522 16.926  16.930  1.00 40.59 ? 280 LEU A CG    1 
ATOM   3325 C  CD1   . LEU B 2 277 ? -14.845 17.047  16.198  1.00 40.20 ? 280 LEU A CD1   1 
ATOM   3326 C  CD2   . LEU B 2 277 ? -12.865 18.291  17.084  1.00 40.48 ? 280 LEU A CD2   1 
ATOM   3327 N  N     . HIS B 2 278 ? -12.950 13.160  17.989  1.00 40.23 ? 281 HIS A N     1 
ATOM   3328 C  CA    . HIS B 2 278 ? -12.785 12.078  17.026  1.00 40.07 ? 281 HIS A CA    1 
ATOM   3329 C  C     . HIS B 2 278 ? -13.324 12.491  15.661  1.00 39.94 ? 281 HIS A C     1 
ATOM   3330 O  O     . HIS B 2 278 ? -14.258 13.292  15.568  1.00 39.88 ? 281 HIS A O     1 
ATOM   3331 C  CB    . HIS B 2 278 ? -13.509 10.810  17.491  1.00 40.04 ? 281 HIS A CB    1 
ATOM   3332 C  CG    . HIS B 2 278 ? -12.710 9.958   18.429  1.00 40.08 ? 281 HIS A CG    1 
ATOM   3333 N  ND1   . HIS B 2 278 ? -13.231 9.458   19.603  1.00 40.34 ? 281 HIS A ND1   1 
ATOM   3334 C  CD2   . HIS B 2 278 ? -11.436 9.504   18.360  1.00 40.15 ? 281 HIS A CD2   1 
ATOM   3335 C  CE1   . HIS B 2 278 ? -12.310 8.739   20.220  1.00 40.27 ? 281 HIS A CE1   1 
ATOM   3336 N  NE2   . HIS B 2 278 ? -11.212 8.751   19.487  1.00 40.06 ? 281 HIS A NE2   1 
ATOM   3337 N  N     . ALA B 2 279 ? -12.724 11.940  14.609  1.00 39.72 ? 282 ALA A N     1 
ATOM   3338 C  CA    . ALA B 2 279 ? -13.218 12.112  13.248  1.00 39.61 ? 282 ALA A CA    1 
ATOM   3339 C  C     . ALA B 2 279 ? -14.364 11.135  12.976  1.00 39.52 ? 282 ALA A C     1 
ATOM   3340 O  O     . ALA B 2 279 ? -14.579 10.192  13.740  1.00 39.42 ? 282 ALA A O     1 
ATOM   3341 C  CB    . ALA B 2 279 ? -12.086 11.901  12.246  1.00 39.60 ? 282 ALA A CB    1 
ATOM   3342 N  N     . GLY B 2 280 ? -15.103 11.376  11.895  1.00 39.51 ? 283 GLY A N     1 
ATOM   3343 C  CA    . GLY B 2 280 ? -16.169 10.474  11.464  1.00 39.48 ? 283 GLY A CA    1 
ATOM   3344 C  C     . GLY B 2 280 ? -17.514 10.663  12.146  1.00 39.51 ? 283 GLY A C     1 
ATOM   3345 O  O     . GLY B 2 280 ? -18.440 9.885   11.912  1.00 39.46 ? 283 GLY A O     1 
ATOM   3346 N  N     . ILE B 2 281 ? -17.626 11.689  12.988  1.00 39.56 ? 284 ILE A N     1 
ATOM   3347 C  CA    . ILE B 2 281 ? -18.892 12.008  13.651  1.00 39.70 ? 284 ILE A CA    1 
ATOM   3348 C  C     . ILE B 2 281 ? -19.884 12.593  12.644  1.00 39.83 ? 284 ILE A C     1 
ATOM   3349 O  O     . ILE B 2 281 ? -19.591 13.584  11.971  1.00 39.88 ? 284 ILE A O     1 
ATOM   3350 C  CB    . ILE B 2 281 ? -18.703 12.968  14.864  1.00 39.69 ? 284 ILE A CB    1 
ATOM   3351 C  CG1   . ILE B 2 281 ? -17.852 12.298  15.951  1.00 39.67 ? 284 ILE A CG1   1 
ATOM   3352 C  CG2   . ILE B 2 281 ? -20.051 13.393  15.439  1.00 39.53 ? 284 ILE A CG2   1 
ATOM   3353 C  CD1   . ILE B 2 281 ? -17.374 13.240  17.058  1.00 39.72 ? 284 ILE A CD1   1 
ATOM   3354 N  N     . LYS B 2 282 ? -21.043 11.951  12.534  1.00 40.00 ? 285 LYS A N     1 
ATOM   3355 C  CA    . LYS B 2 282 ? -22.121 12.417  11.666  1.00 40.23 ? 285 LYS A CA    1 
ATOM   3356 C  C     . LYS B 2 282 ? -23.195 13.087  12.516  1.00 40.38 ? 285 LYS A C     1 
ATOM   3357 O  O     . LYS B 2 282 ? -23.271 12.846  13.724  1.00 40.40 ? 285 LYS A O     1 
ATOM   3358 C  CB    . LYS B 2 282 ? -22.726 11.249  10.880  1.00 40.15 ? 285 LYS A CB    1 
ATOM   3359 C  CG    . LYS B 2 282 ? -21.728 10.469  10.027  1.00 40.11 ? 285 LYS A CG    1 
ATOM   3360 C  CD    . LYS B 2 282 ? -22.350 9.205   9.422   1.00 40.31 ? 285 LYS A CD    1 
ATOM   3361 C  CE    . LYS B 2 282 ? -22.662 8.132   10.475  1.00 40.48 ? 285 LYS A CE    1 
ATOM   3362 N  NZ    . LYS B 2 282 ? -21.456 7.667   11.224  1.00 40.35 ? 285 LYS A NZ    1 
ATOM   3363 N  N     . ARG B 2 283 ? -24.014 13.933  11.891  1.00 40.55 ? 286 ARG A N     1 
ATOM   3364 C  CA    . ARG B 2 283 ? -25.136 14.564  12.586  1.00 40.74 ? 286 ARG A CA    1 
ATOM   3365 C  C     . ARG B 2 283 ? -26.118 13.490  13.051  1.00 40.74 ? 286 ARG A C     1 
ATOM   3366 O  O     . ARG B 2 283 ? -26.596 12.683  12.250  1.00 40.77 ? 286 ARG A O     1 
ATOM   3367 C  CB    . ARG B 2 283 ? -25.852 15.584  11.692  1.00 40.81 ? 286 ARG A CB    1 
ATOM   3368 C  CG    . ARG B 2 283 ? -25.005 16.774  11.247  1.00 41.22 ? 286 ARG A CG    1 
ATOM   3369 C  CD    . ARG B 2 283 ? -25.892 17.954  10.872  1.00 42.13 ? 286 ARG A CD    1 
ATOM   3370 N  NE    . ARG B 2 283 ? -25.269 18.848  9.897   1.00 42.90 ? 286 ARG A NE    1 
ATOM   3371 C  CZ    . ARG B 2 283 ? -25.781 20.016  9.507   1.00 43.58 ? 286 ARG A CZ    1 
ATOM   3372 N  NH1   . ARG B 2 283 ? -26.927 20.455  10.016  1.00 43.71 ? 286 ARG A NH1   1 
ATOM   3373 N  NH2   . ARG B 2 283 ? -25.143 20.753  8.606   1.00 43.54 ? 286 ARG A NH2   1 
ATOM   3374 N  N     . GLY B 2 284 ? -26.398 13.478  14.351  1.00 40.76 ? 287 GLY A N     1 
ATOM   3375 C  CA    . GLY B 2 284 ? -27.295 12.491  14.944  1.00 40.88 ? 287 GLY A CA    1 
ATOM   3376 C  C     . GLY B 2 284 ? -26.590 11.373  15.694  1.00 40.97 ? 287 GLY A C     1 
ATOM   3377 O  O     . GLY B 2 284 ? -27.241 10.579  16.374  1.00 41.00 ? 287 GLY A O     1 
ATOM   3378 N  N     . ASP B 2 285 ? -25.264 11.309  15.568  1.00 40.99 ? 288 ASP A N     1 
ATOM   3379 C  CA    . ASP B 2 285 ? -24.461 10.286  16.246  1.00 41.20 ? 288 ASP A CA    1 
ATOM   3380 C  C     . ASP B 2 285 ? -24.461 10.452  17.761  1.00 41.11 ? 288 ASP A C     1 
ATOM   3381 O  O     . ASP B 2 285 ? -24.411 11.573  18.275  1.00 41.10 ? 288 ASP A O     1 
ATOM   3382 C  CB    . ASP B 2 285 ? -23.010 10.298  15.745  1.00 41.25 ? 288 ASP A CB    1 
ATOM   3383 C  CG    . ASP B 2 285 ? -22.815 9.507   14.460  1.00 41.69 ? 288 ASP A CG    1 
ATOM   3384 O  OD1   . ASP B 2 285 ? -23.796 8.940   13.931  1.00 42.09 ? 288 ASP A OD1   1 
ATOM   3385 O  OD2   . ASP B 2 285 ? -21.663 9.453   13.976  1.00 42.18 ? 288 ASP A OD2   1 
ATOM   3386 N  N     . LEU B 2 286 ? -24.519 9.325   18.467  1.00 41.00 ? 289 LEU A N     1 
ATOM   3387 C  CA    . LEU B 2 286 ? -24.312 9.314   19.907  1.00 41.06 ? 289 LEU A CA    1 
ATOM   3388 C  C     . LEU B 2 286 ? -22.830 9.531   20.179  1.00 40.99 ? 289 LEU A C     1 
ATOM   3389 O  O     . LEU B 2 286 ? -21.981 8.803   19.665  1.00 40.98 ? 289 LEU A O     1 
ATOM   3390 C  CB    . LEU B 2 286 ? -24.793 7.994   20.526  1.00 41.05 ? 289 LEU A CB    1 
ATOM   3391 C  CG    . LEU B 2 286 ? -24.545 7.748   22.022  1.00 41.22 ? 289 LEU A CG    1 
ATOM   3392 C  CD1   . LEU B 2 286 ? -25.330 8.722   22.901  1.00 40.99 ? 289 LEU A CD1   1 
ATOM   3393 C  CD2   . LEU B 2 286 ? -24.885 6.305   22.383  1.00 41.09 ? 289 LEU A CD2   1 
ATOM   3394 N  N     . VAL B 2 287 ? -22.531 10.554  20.973  1.00 40.98 ? 290 VAL A N     1 
ATOM   3395 C  CA    . VAL B 2 287 ? -21.156 10.896  21.313  1.00 40.99 ? 290 VAL A CA    1 
ATOM   3396 C  C     . VAL B 2 287 ? -20.975 10.987  22.826  1.00 41.06 ? 290 VAL A C     1 
ATOM   3397 O  O     . VAL B 2 287 ? -21.933 11.236  23.567  1.00 41.20 ? 290 VAL A O     1 
ATOM   3398 C  CB    . VAL B 2 287 ? -20.696 12.233  20.651  1.00 40.98 ? 290 VAL A CB    1 
ATOM   3399 C  CG1   . VAL B 2 287 ? -20.749 12.136  19.126  1.00 40.93 ? 290 VAL A CG1   1 
ATOM   3400 C  CG2   . VAL B 2 287 ? -21.531 13.408  21.145  1.00 40.93 ? 290 VAL A CG2   1 
ATOM   3401 N  N     . ALA B 2 288 ? -19.742 10.779  23.275  1.00 40.91 ? 291 ALA A N     1 
ATOM   3402 C  CA    . ALA B 2 288 ? -19.393 10.996  24.669  1.00 40.91 ? 291 ALA A CA    1 
ATOM   3403 C  C     . ALA B 2 288 ? -18.638 12.314  24.813  1.00 40.88 ? 291 ALA A C     1 
ATOM   3404 O  O     . ALA B 2 288 ? -17.655 12.559  24.109  1.00 40.66 ? 291 ALA A O     1 
ATOM   3405 C  CB    . ALA B 2 288 ? -18.568 9.836   25.202  1.00 40.57 ? 291 ALA A CB    1 
ATOM   3406 N  N     . ILE B 2 289 ? -19.113 13.161  25.720  1.00 41.06 ? 292 ILE A N     1 
ATOM   3407 C  CA    . ILE B 2 289 ? -18.438 14.417  26.035  1.00 41.16 ? 292 ILE A CA    1 
ATOM   3408 C  C     . ILE B 2 289 ? -17.466 14.159  27.182  1.00 41.32 ? 292 ILE A C     1 
ATOM   3409 O  O     . ILE B 2 289 ? -17.869 13.708  28.256  1.00 41.24 ? 292 ILE A O     1 
ATOM   3410 C  CB    . ILE B 2 289 ? -19.447 15.550  26.379  1.00 41.25 ? 292 ILE A CB    1 
ATOM   3411 C  CG1   . ILE B 2 289 ? -20.341 15.854  25.166  1.00 41.33 ? 292 ILE A CG1   1 
ATOM   3412 C  CG2   . ILE B 2 289 ? -18.717 16.810  26.847  1.00 41.10 ? 292 ILE A CG2   1 
ATOM   3413 C  CD1   . ILE B 2 289 ? -21.474 16.839  25.431  1.00 41.05 ? 292 ILE A CD1   1 
ATOM   3414 N  N     . MET B 2 290 ? -16.187 14.437  26.933  1.00 41.52 ? 293 MET A N     1 
ATOM   3415 C  CA    . MET B 2 290 ? -15.110 14.129  27.877  1.00 41.56 ? 293 MET A CA    1 
ATOM   3416 C  C     . MET B 2 290 ? -14.360 15.387  28.307  1.00 41.53 ? 293 MET A C     1 
ATOM   3417 O  O     . MET B 2 290 ? -14.258 16.345  27.541  1.00 41.30 ? 293 MET A O     1 
ATOM   3418 C  CB    . MET B 2 290 ? -14.107 13.145  27.248  1.00 41.59 ? 293 MET A CB    1 
ATOM   3419 C  CG    . MET B 2 290 ? -14.714 11.911  26.561  1.00 41.69 ? 293 MET A CG    1 
ATOM   3420 S  SD    . MET B 2 290 ? -15.519 10.728  27.665  1.00 42.22 ? 293 MET A SD    1 
ATOM   3421 C  CE    . MET B 2 290 ? -14.116 10.019  28.522  1.00 42.01 ? 293 MET A CE    1 
ATOM   3422 N  N     . THR B 2 291 ? -13.829 15.380  29.529  1.00 41.69 ? 294 THR A N     1 
ATOM   3423 C  CA    . THR B 2 291 ? -12.859 16.400  29.938  1.00 41.74 ? 294 THR A CA    1 
ATOM   3424 C  C     . THR B 2 291 ? -11.495 16.023  29.373  1.00 41.78 ? 294 THR A C     1 
ATOM   3425 O  O     . THR B 2 291 ? -11.303 14.904  28.888  1.00 41.83 ? 294 THR A O     1 
ATOM   3426 C  CB    . THR B 2 291 ? -12.725 16.545  31.475  1.00 41.69 ? 294 THR A CB    1 
ATOM   3427 O  OG1   . THR B 2 291 ? -12.136 15.363  32.032  1.00 41.65 ? 294 THR A OG1   1 
ATOM   3428 C  CG2   . THR B 2 291 ? -14.067 16.814  32.128  1.00 41.88 ? 294 THR A CG2   1 
ATOM   3429 N  N     . LEU B 2 292 ? -10.547 16.951  29.457  1.00 41.82 ? 295 LEU A N     1 
ATOM   3430 C  CA    . LEU B 2 292 ? -9.178  16.698  29.022  1.00 41.91 ? 295 LEU A CA    1 
ATOM   3431 C  C     . LEU B 2 292 ? -8.423  15.768  29.979  1.00 41.98 ? 295 LEU A C     1 
ATOM   3432 O  O     . LEU B 2 292 ? -7.295  15.362  29.698  1.00 42.09 ? 295 LEU A O     1 
ATOM   3433 C  CB    . LEU B 2 292 ? -8.427  18.020  28.808  1.00 41.89 ? 295 LEU A CB    1 
ATOM   3434 C  CG    . LEU B 2 292 ? -8.799  18.810  27.546  1.00 41.81 ? 295 LEU A CG    1 
ATOM   3435 C  CD1   . LEU B 2 292 ? -8.350  20.266  27.653  1.00 41.26 ? 295 LEU A CD1   1 
ATOM   3436 C  CD2   . LEU B 2 292 ? -8.231  18.153  26.287  1.00 41.33 ? 295 LEU A CD2   1 
ATOM   3437 N  N     . LYS B 2 293 ? -9.055  15.438  31.104  1.00 42.21 ? 296 LYS A N     1 
ATOM   3438 C  CA    . LYS B 2 293 ? -8.548  14.427  32.034  1.00 42.33 ? 296 LYS A CA    1 
ATOM   3439 C  C     . LYS B 2 293 ? -9.153  13.057  31.731  1.00 42.56 ? 296 LYS A C     1 
ATOM   3440 O  O     . LYS B 2 293 ? -8.949  12.099  32.482  1.00 42.57 ? 296 LYS A O     1 
ATOM   3441 C  CB    . LYS B 2 293 ? -8.864  14.817  33.480  1.00 42.35 ? 296 LYS A CB    1 
ATOM   3442 C  CG    . LYS B 2 293 ? -8.091  16.018  33.992  1.00 42.13 ? 296 LYS A CG    1 
ATOM   3443 C  CD    . LYS B 2 293 ? -8.354  16.248  35.471  1.00 41.52 ? 296 LYS A CD    1 
ATOM   3444 C  CE    . LYS B 2 293 ? -7.794  17.588  35.921  1.00 41.15 ? 296 LYS A CE    1 
ATOM   3445 N  NZ    . LYS B 2 293 ? -8.607  18.728  35.410  1.00 40.08 ? 296 LYS A NZ    1 
ATOM   3446 N  N     . ASP B 2 294 ? -9.902  12.982  30.629  1.00 42.84 ? 297 ASP A N     1 
ATOM   3447 C  CA    . ASP B 2 294 ? -10.607 11.766  30.201  1.00 43.18 ? 297 ASP A CA    1 
ATOM   3448 C  C     . ASP B 2 294 ? -11.690 11.302  31.184  1.00 43.10 ? 297 ASP A C     1 
ATOM   3449 O  O     . ASP B 2 294 ? -11.897 10.101  31.370  1.00 43.09 ? 297 ASP A O     1 
ATOM   3450 C  CB    . ASP B 2 294 ? -9.620  10.634  29.862  1.00 43.25 ? 297 ASP A CB    1 
ATOM   3451 C  CG    . ASP B 2 294 ? -8.872  10.885  28.563  1.00 44.49 ? 297 ASP A CG    1 
ATOM   3452 O  OD1   . ASP B 2 294 ? -9.490  11.403  27.610  1.00 45.54 ? 297 ASP A OD1   1 
ATOM   3453 O  OD2   . ASP B 2 294 ? -7.665  10.562  28.491  1.00 46.00 ? 297 ASP A OD2   1 
ATOM   3454 N  N     . GLU B 2 295 ? -12.373 12.264  31.805  1.00 43.16 ? 298 GLU A N     1 
ATOM   3455 C  CA    . GLU B 2 295 ? -13.548 11.976  32.629  1.00 43.29 ? 298 GLU A CA    1 
ATOM   3456 C  C     . GLU B 2 295 ? -14.791 12.052  31.756  1.00 43.17 ? 298 GLU A C     1 
ATOM   3457 O  O     . GLU B 2 295 ? -14.865 12.887  30.854  1.00 43.15 ? 298 GLU A O     1 
ATOM   3458 C  CB    . GLU B 2 295 ? -13.700 12.986  33.766  1.00 43.21 ? 298 GLU A CB    1 
ATOM   3459 C  CG    . GLU B 2 295 ? -12.463 13.232  34.606  1.00 43.76 ? 298 GLU A CG    1 
ATOM   3460 C  CD    . GLU B 2 295 ? -12.531 14.566  35.327  1.00 43.94 ? 298 GLU A CD    1 
ATOM   3461 O  OE1   . GLU B 2 295 ? -13.158 14.638  36.401  1.00 44.20 ? 298 GLU A OE1   1 
ATOM   3462 O  OE2   . GLU B 2 295 ? -11.957 15.544  34.814  1.00 43.96 ? 298 GLU A OE2   1 
ATOM   3463 N  N     . LEU B 2 296 ? -15.767 11.193  32.030  1.00 43.03 ? 299 LEU A N     1 
ATOM   3464 C  CA    . LEU B 2 296 ? -17.049 11.269  31.341  1.00 42.94 ? 299 LEU A CA    1 
ATOM   3465 C  C     . LEU B 2 296 ? -17.904 12.384  31.939  1.00 42.90 ? 299 LEU A C     1 
ATOM   3466 O  O     . LEU B 2 296 ? -18.229 12.364  33.131  1.00 42.89 ? 299 LEU A O     1 
ATOM   3467 C  CB    . LEU B 2 296 ? -17.789 9.925   31.394  1.00 42.99 ? 299 LEU A CB    1 
ATOM   3468 C  CG    . LEU B 2 296 ? -19.174 9.839   30.735  1.00 42.96 ? 299 LEU A CG    1 
ATOM   3469 C  CD1   . LEU B 2 296 ? -19.115 10.103  29.225  1.00 42.82 ? 299 LEU A CD1   1 
ATOM   3470 C  CD2   . LEU B 2 296 ? -19.820 8.486   31.024  1.00 42.85 ? 299 LEU A CD2   1 
ATOM   3471 N  N     . VAL B 2 297 ? -18.249 13.359  31.104  1.00 42.50 ? 300 VAL A N     1 
ATOM   3472 C  CA    . VAL B 2 297 ? -19.136 14.443  31.508  1.00 42.32 ? 300 VAL A CA    1 
ATOM   3473 C  C     . VAL B 2 297 ? -20.579 14.073  31.189  1.00 42.22 ? 300 VAL A C     1 
ATOM   3474 O  O     . VAL B 2 297 ? -21.449 14.110  32.065  1.00 42.18 ? 300 VAL A O     1 
ATOM   3475 C  CB    . VAL B 2 297 ? -18.791 15.783  30.793  1.00 42.26 ? 300 VAL A CB    1 
ATOM   3476 C  CG1   . VAL B 2 297 ? -19.648 16.921  31.337  1.00 42.55 ? 300 VAL A CG1   1 
ATOM   3477 C  CG2   . VAL B 2 297 ? -17.318 16.118  30.941  1.00 41.72 ? 300 VAL A CG2   1 
ATOM   3478 N  N     . ALA B 2 298 ? -20.820 13.708  29.931  1.00 42.13 ? 301 ALA A N     1 
ATOM   3479 C  CA    . ALA B 2 298 ? -22.171 13.580  29.406  1.00 42.28 ? 301 ALA A CA    1 
ATOM   3480 C  C     . ALA B 2 298 ? -22.239 12.748  28.131  1.00 42.41 ? 301 ALA A C     1 
ATOM   3481 O  O     . ALA B 2 298 ? -21.262 12.636  27.394  1.00 42.46 ? 301 ALA A O     1 
ATOM   3482 C  CB    . ALA B 2 298 ? -22.771 14.974  29.153  1.00 42.10 ? 301 ALA A CB    1 
ATOM   3483 N  N     . LEU B 2 299 ? -23.407 12.160  27.891  1.00 42.64 ? 302 LEU A N     1 
ATOM   3484 C  CA    . LEU B 2 299 ? -23.734 11.565  26.601  1.00 42.83 ? 302 LEU A CA    1 
ATOM   3485 C  C     . LEU B 2 299 ? -24.603 12.540  25.825  1.00 42.85 ? 302 LEU A C     1 
ATOM   3486 O  O     . LEU B 2 299 ? -25.476 13.198  26.396  1.00 43.00 ? 302 LEU A O     1 
ATOM   3487 C  CB    . LEU B 2 299 ? -24.466 10.232  26.775  1.00 42.64 ? 302 LEU A CB    1 
ATOM   3488 C  CG    . LEU B 2 299 ? -23.644 9.028   27.242  1.00 42.94 ? 302 LEU A CG    1 
ATOM   3489 C  CD1   . LEU B 2 299 ? -24.546 7.810   27.479  1.00 42.17 ? 302 LEU A CD1   1 
ATOM   3490 C  CD2   . LEU B 2 299 ? -22.536 8.700   26.246  1.00 42.69 ? 302 LEU A CD2   1 
ATOM   3491 N  N     . GLY B 2 300 ? -24.364 12.635  24.522  1.00 42.93 ? 303 GLY A N     1 
ATOM   3492 C  CA    . GLY B 2 300 ? -25.092 13.581  23.696  1.00 42.94 ? 303 GLY A CA    1 
ATOM   3493 C  C     . GLY B 2 300 ? -25.309 13.155  22.261  1.00 43.05 ? 303 GLY A C     1 
ATOM   3494 O  O     . GLY B 2 300 ? -24.730 12.173  21.791  1.00 43.20 ? 303 GLY A O     1 
ATOM   3495 N  N     . LYS B 2 301 ? -26.161 13.911  21.577  1.00 43.12 ? 304 LYS A N     1 
ATOM   3496 C  CA    . LYS B 2 301 ? -26.458 13.713  20.167  1.00 43.32 ? 304 LYS A CA    1 
ATOM   3497 C  C     . LYS B 2 301 ? -25.780 14.831  19.379  1.00 43.32 ? 304 LYS A C     1 
ATOM   3498 O  O     . LYS B 2 301 ? -26.018 16.016  19.633  1.00 43.07 ? 304 LYS A O     1 
ATOM   3499 C  CB    . LYS B 2 301 ? -27.972 13.740  19.944  1.00 43.27 ? 304 LYS A CB    1 
ATOM   3500 C  CG    . LYS B 2 301 ? -28.427 13.340  18.548  1.00 43.58 ? 304 LYS A CG    1 
ATOM   3501 C  CD    . LYS B 2 301 ? -29.942 13.451  18.422  1.00 43.59 ? 304 LYS A CD    1 
ATOM   3502 C  CE    . LYS B 2 301 ? -30.452 12.719  17.195  1.00 44.35 ? 304 LYS A CE    1 
ATOM   3503 N  NZ    . LYS B 2 301 ? -31.940 12.646  17.173  1.00 44.64 ? 304 LYS A NZ    1 
ATOM   3504 N  N     . ALA B 2 302 ? -24.929 14.441  18.434  1.00 43.33 ? 305 ALA A N     1 
ATOM   3505 C  CA    . ALA B 2 302 ? -24.171 15.394  17.632  1.00 43.40 ? 305 ALA A CA    1 
ATOM   3506 C  C     . ALA B 2 302 ? -25.081 16.206  16.712  1.00 43.43 ? 305 ALA A C     1 
ATOM   3507 O  O     . ALA B 2 302 ? -25.858 15.644  15.937  1.00 43.41 ? 305 ALA A O     1 
ATOM   3508 C  CB    . ALA B 2 302 ? -23.099 14.677  16.830  1.00 43.34 ? 305 ALA A CB    1 
ATOM   3509 N  N     . MET B 2 303 ? -24.985 17.528  16.822  1.00 43.43 ? 306 MET A N     1 
ATOM   3510 C  CA    . MET B 2 303 ? -25.736 18.440  15.962  1.00 43.56 ? 306 MET A CA    1 
ATOM   3511 C  C     . MET B 2 303 ? -24.895 18.840  14.752  1.00 43.46 ? 306 MET A C     1 
ATOM   3512 O  O     . MET B 2 303 ? -25.396 19.455  13.809  1.00 43.48 ? 306 MET A O     1 
ATOM   3513 C  CB    . MET B 2 303 ? -26.174 19.688  16.741  1.00 43.63 ? 306 MET A CB    1 
ATOM   3514 C  CG    . MET B 2 303 ? -26.996 19.400  17.998  1.00 44.01 ? 306 MET A CG    1 
ATOM   3515 S  SD    . MET B 2 303 ? -28.515 18.473  17.686  1.00 45.28 ? 306 MET A SD    1 
ATOM   3516 C  CE    . MET B 2 303 ? -29.586 19.764  17.058  1.00 44.89 ? 306 MET A CE    1 
ATOM   3517 N  N     . MET B 2 304 ? -23.615 18.479  14.796  1.00 43.41 ? 307 MET A N     1 
ATOM   3518 C  CA    . MET B 2 304 ? -22.657 18.811  13.746  1.00 43.37 ? 307 MET A CA    1 
ATOM   3519 C  C     . MET B 2 304 ? -21.797 17.604  13.386  1.00 43.39 ? 307 MET A C     1 
ATOM   3520 O  O     . MET B 2 304 ? -21.749 16.619  14.128  1.00 43.39 ? 307 MET A O     1 
ATOM   3521 C  CB    . MET B 2 304 ? -21.749 19.957  14.199  1.00 43.37 ? 307 MET A CB    1 
ATOM   3522 C  CG    . MET B 2 304 ? -22.422 21.314  14.294  1.00 43.29 ? 307 MET A CG    1 
ATOM   3523 S  SD    . MET B 2 304 ? -21.247 22.592  14.771  1.00 43.28 ? 307 MET A SD    1 
ATOM   3524 C  CE    . MET B 2 304 ? -22.331 24.010  14.929  1.00 43.37 ? 307 MET A CE    1 
ATOM   3525 N  N     . THR B 2 305 ? -21.123 17.688  12.241  1.00 43.40 ? 308 THR A N     1 
ATOM   3526 C  CA    . THR B 2 305 ? -20.122 16.697  11.855  1.00 43.41 ? 308 THR A CA    1 
ATOM   3527 C  C     . THR B 2 305 ? -18.783 17.068  12.491  1.00 43.51 ? 308 THR A C     1 
ATOM   3528 O  O     . THR B 2 305 ? -18.631 18.175  13.013  1.00 43.45 ? 308 THR A O     1 
ATOM   3529 C  CB    . THR B 2 305 ? -19.956 16.601  10.316  1.00 43.38 ? 308 THR A CB    1 
ATOM   3530 O  OG1   . THR B 2 305 ? -19.451 17.840  9.806   1.00 43.12 ? 308 THR A OG1   1 
ATOM   3531 C  CG2   . THR B 2 305 ? -21.283 16.269  9.635   1.00 43.23 ? 308 THR A CG2   1 
ATOM   3532 N  N     . SER B 2 306 ? -17.821 16.147  12.446  1.00 43.71 ? 309 SER A N     1 
ATOM   3533 C  CA    . SER B 2 306 ? -16.474 16.400  12.969  1.00 43.94 ? 309 SER A CA    1 
ATOM   3534 C  C     . SER B 2 306 ? -15.804 17.588  12.282  1.00 44.15 ? 309 SER A C     1 
ATOM   3535 O  O     . SER B 2 306 ? -15.171 18.417  12.939  1.00 44.11 ? 309 SER A O     1 
ATOM   3536 C  CB    . SER B 2 306 ? -15.592 15.155  12.839  1.00 43.88 ? 309 SER A CB    1 
ATOM   3537 O  OG    . SER B 2 306 ? -15.985 14.153  13.758  1.00 43.79 ? 309 SER A OG    1 
ATOM   3538 N  N     . GLN B 2 307 ? -15.954 17.661  10.961  1.00 44.46 ? 310 GLN A N     1 
ATOM   3539 C  CA    . GLN B 2 307 ? -15.416 18.764  10.167  1.00 44.85 ? 310 GLN A CA    1 
ATOM   3540 C  C     . GLN B 2 307 ? -16.082 20.092  10.522  1.00 44.95 ? 310 GLN A C     1 
ATOM   3541 O  O     . GLN B 2 307 ? -15.411 21.120  10.605  1.00 44.99 ? 310 GLN A O     1 
ATOM   3542 C  CB    . GLN B 2 307 ? -15.557 18.474  8.670   1.00 44.85 ? 310 GLN A CB    1 
ATOM   3543 C  CG    . GLN B 2 307 ? -14.581 17.428  8.145   1.00 45.48 ? 310 GLN A CG    1 
ATOM   3544 C  CD    . GLN B 2 307 ? -13.161 17.956  8.015   1.00 46.22 ? 310 GLN A CD    1 
ATOM   3545 O  OE1   . GLN B 2 307 ? -12.892 18.873  7.235   1.00 46.29 ? 310 GLN A OE1   1 
ATOM   3546 N  NE2   . GLN B 2 307 ? -12.241 17.369  8.774   1.00 46.64 ? 310 GLN A NE2   1 
ATOM   3547 N  N     . GLU B 2 308 ? -17.396 20.056  10.737  1.00 45.16 ? 311 GLU A N     1 
ATOM   3548 C  CA    . GLU B 2 308 ? -18.148 21.226  11.190  1.00 45.43 ? 311 GLU A CA    1 
ATOM   3549 C  C     . GLU B 2 308 ? -17.657 21.727  12.549  1.00 45.60 ? 311 GLU A C     1 
ATOM   3550 O  O     . GLU B 2 308 ? -17.411 22.920  12.715  1.00 45.64 ? 311 GLU A O     1 
ATOM   3551 C  CB    . GLU B 2 308 ? -19.647 20.922  11.249  1.00 45.36 ? 311 GLU A CB    1 
ATOM   3552 C  CG    . GLU B 2 308 ? -20.359 20.994  9.906   1.00 45.53 ? 311 GLU A CG    1 
ATOM   3553 C  CD    . GLU B 2 308 ? -21.848 20.717  10.018  1.00 45.57 ? 311 GLU A CD    1 
ATOM   3554 O  OE1   . GLU B 2 308 ? -22.225 19.616  10.472  1.00 45.59 ? 311 GLU A OE1   1 
ATOM   3555 O  OE2   . GLU B 2 308 ? -22.643 21.602  9.642   1.00 46.01 ? 311 GLU A OE2   1 
ATOM   3556 N  N     . MET B 2 309 ? -17.504 20.812  13.507  1.00 45.78 ? 312 MET A N     1 
ATOM   3557 C  CA    . MET B 2 309 ? -17.025 21.156  14.849  1.00 46.06 ? 312 MET A CA    1 
ATOM   3558 C  C     . MET B 2 309 ? -15.614 21.747  14.820  1.00 46.06 ? 312 MET A C     1 
ATOM   3559 O  O     . MET B 2 309 ? -15.314 22.683  15.560  1.00 46.18 ? 312 MET A O     1 
ATOM   3560 C  CB    . MET B 2 309 ? -17.057 19.935  15.777  1.00 45.96 ? 312 MET A CB    1 
ATOM   3561 C  CG    . MET B 2 309 ? -18.445 19.376  16.074  1.00 46.08 ? 312 MET A CG    1 
ATOM   3562 S  SD    . MET B 2 309 ? -18.393 17.969  17.208  1.00 46.51 ? 312 MET A SD    1 
ATOM   3563 C  CE    . MET B 2 309 ? -20.044 17.305  17.016  1.00 46.15 ? 312 MET A CE    1 
ATOM   3564 N  N     . LEU B 2 310 ? -14.763 21.198  13.956  1.00 46.12 ? 313 LEU A N     1 
ATOM   3565 C  CA    . LEU B 2 310 ? -13.368 21.625  13.833  1.00 46.11 ? 313 LEU A CA    1 
ATOM   3566 C  C     . LEU B 2 310 ? -13.214 22.989  13.151  1.00 46.14 ? 313 LEU A C     1 
ATOM   3567 O  O     . LEU B 2 310 ? -12.395 23.809  13.573  1.00 46.23 ? 313 LEU A O     1 
ATOM   3568 C  CB    . LEU B 2 310 ? -12.556 20.560  13.081  1.00 46.07 ? 313 LEU A CB    1 
ATOM   3569 C  CG    . LEU B 2 310 ? -11.035 20.713  12.957  1.00 46.07 ? 313 LEU A CG    1 
ATOM   3570 C  CD1   . LEU B 2 310 ? -10.339 20.494  14.293  1.00 45.80 ? 313 LEU A CD1   1 
ATOM   3571 C  CD2   . LEU B 2 310 ? -10.489 19.754  11.910  1.00 46.08 ? 313 LEU A CD2   1 
ATOM   3572 N  N     . GLU B 2 311 ? -14.001 23.224  12.103  1.00 46.13 ? 314 GLU A N     1 
ATOM   3573 C  CA    . GLU B 2 311 ? -13.871 24.433  11.284  1.00 46.11 ? 314 GLU A CA    1 
ATOM   3574 C  C     . GLU B 2 311 ? -14.623 25.640  11.841  1.00 46.03 ? 314 GLU A C     1 
ATOM   3575 O  O     . GLU B 2 311 ? -14.102 26.759  11.824  1.00 46.05 ? 314 GLU A O     1 
ATOM   3576 C  CB    . GLU B 2 311 ? -14.327 24.163  9.847   1.00 46.10 ? 314 GLU A CB    1 
ATOM   3577 C  CG    . GLU B 2 311 ? -13.377 23.297  9.032   1.00 46.26 ? 314 GLU A CG    1 
ATOM   3578 C  CD    . GLU B 2 311 ? -13.918 22.975  7.650   1.00 46.26 ? 314 GLU A CD    1 
ATOM   3579 O  OE1   . GLU B 2 311 ? -13.159 23.115  6.669   1.00 46.47 ? 314 GLU A OE1   1 
ATOM   3580 O  OE2   . GLU B 2 311 ? -15.102 22.588  7.542   1.00 46.63 ? 314 GLU A OE2   1 
ATOM   3581 N  N     . LYS B 2 312 ? -15.844 25.411  12.325  1.00 45.89 ? 315 LYS A N     1 
ATOM   3582 C  CA    . LYS B 2 312 ? -16.722 26.496  12.774  1.00 45.79 ? 315 LYS A CA    1 
ATOM   3583 C  C     . LYS B 2 312 ? -16.231 27.160  14.059  1.00 45.55 ? 315 LYS A C     1 
ATOM   3584 O  O     . LYS B 2 312 ? -15.368 26.624  14.759  1.00 45.51 ? 315 LYS A O     1 
ATOM   3585 C  CB    . LYS B 2 312 ? -18.168 26.005  12.933  1.00 45.74 ? 315 LYS A CB    1 
ATOM   3586 C  CG    . LYS B 2 312 ? -18.829 25.596  11.618  1.00 45.95 ? 315 LYS A CG    1 
ATOM   3587 C  CD    . LYS B 2 312 ? -20.216 24.998  11.828  1.00 46.12 ? 315 LYS A CD    1 
ATOM   3588 C  CE    . LYS B 2 312 ? -21.308 26.055  11.713  1.00 47.17 ? 315 LYS A CE    1 
ATOM   3589 N  NZ    . LYS B 2 312 ? -22.658 25.446  11.539  1.00 47.46 ? 315 LYS A NZ    1 
ATOM   3590 N  N     . THR B 2 313 ? -16.777 28.338  14.348  1.00 45.32 ? 316 THR A N     1 
ATOM   3591 C  CA    . THR B 2 313 ? -16.414 29.095  15.545  1.00 45.11 ? 316 THR A CA    1 
ATOM   3592 C  C     . THR B 2 313 ? -17.598 29.261  16.497  1.00 44.86 ? 316 THR A C     1 
ATOM   3593 O  O     . THR B 2 313 ? -17.416 29.605  17.665  1.00 44.88 ? 316 THR A O     1 
ATOM   3594 C  CB    . THR B 2 313 ? -15.844 30.490  15.191  1.00 45.11 ? 316 THR A CB    1 
ATOM   3595 O  OG1   . THR B 2 313 ? -16.762 31.182  14.336  1.00 45.26 ? 316 THR A OG1   1 
ATOM   3596 C  CG2   . THR B 2 313 ? -14.495 30.367  14.489  1.00 45.11 ? 316 THR A CG2   1 
ATOM   3597 N  N     . LYS B 2 314 ? -18.805 29.014  15.990  1.00 44.55 ? 317 LYS A N     1 
ATOM   3598 C  CA    . LYS B 2 314 ? -20.037 29.196  16.760  1.00 44.27 ? 317 LYS A CA    1 
ATOM   3599 C  C     . LYS B 2 314 ? -21.066 28.104  16.469  1.00 44.10 ? 317 LYS A C     1 
ATOM   3600 O  O     . LYS B 2 314 ? -20.967 27.392  15.465  1.00 44.04 ? 317 LYS A O     1 
ATOM   3601 C  CB    . LYS B 2 314 ? -20.651 30.574  16.476  1.00 44.28 ? 317 LYS A CB    1 
ATOM   3602 C  CG    . LYS B 2 314 ? -20.000 31.732  17.219  1.00 44.24 ? 317 LYS A CG    1 
ATOM   3603 C  CD    . LYS B 2 314 ? -20.671 33.055  16.868  1.00 44.30 ? 317 LYS A CD    1 
ATOM   3604 C  CE    . LYS B 2 314 ? -20.019 34.224  17.591  1.00 44.17 ? 317 LYS A CE    1 
ATOM   3605 N  NZ    . LYS B 2 314 ? -20.689 35.517  17.273  1.00 44.19 ? 317 LYS A NZ    1 
ATOM   3606 N  N     . GLY B 2 315 ? -22.051 27.984  17.357  1.00 43.88 ? 318 GLY A N     1 
ATOM   3607 C  CA    . GLY B 2 315 ? -23.150 27.036  17.191  1.00 43.62 ? 318 GLY A CA    1 
ATOM   3608 C  C     . GLY B 2 315 ? -23.110 25.897  18.191  1.00 43.49 ? 318 GLY A C     1 
ATOM   3609 O  O     . GLY B 2 315 ? -22.069 25.617  18.788  1.00 43.36 ? 318 GLY A O     1 
ATOM   3610 N  N     . ILE B 2 316 ? -24.256 25.248  18.379  1.00 43.40 ? 319 ILE A N     1 
ATOM   3611 C  CA    . ILE B 2 316 ? -24.346 24.058  19.219  1.00 43.41 ? 319 ILE A CA    1 
ATOM   3612 C  C     . ILE B 2 316 ? -23.784 22.860  18.455  1.00 43.40 ? 319 ILE A C     1 
ATOM   3613 O  O     . ILE B 2 316 ? -24.254 22.529  17.364  1.00 43.39 ? 319 ILE A O     1 
ATOM   3614 C  CB    . ILE B 2 316 ? -25.807 23.779  19.684  1.00 43.38 ? 319 ILE A CB    1 
ATOM   3615 C  CG1   . ILE B 2 316 ? -26.360 24.949  20.517  1.00 43.32 ? 319 ILE A CG1   1 
ATOM   3616 C  CG2   . ILE B 2 316 ? -25.909 22.442  20.439  1.00 43.31 ? 319 ILE A CG2   1 
ATOM   3617 C  CD1   . ILE B 2 316 ? -25.599 25.256  21.815  1.00 43.05 ? 319 ILE A CD1   1 
ATOM   3618 N  N     . ALA B 2 317 ? -22.765 22.232  19.032  1.00 43.40 ? 320 ALA A N     1 
ATOM   3619 C  CA    . ALA B 2 317 ? -22.120 21.072  18.425  1.00 43.50 ? 320 ALA A CA    1 
ATOM   3620 C  C     . ALA B 2 317 ? -22.764 19.763  18.877  1.00 43.49 ? 320 ALA A C     1 
ATOM   3621 O  O     . ALA B 2 317 ? -22.931 18.844  18.078  1.00 43.57 ? 320 ALA A O     1 
ATOM   3622 C  CB    . ALA B 2 317 ? -20.632 21.071  18.736  1.00 43.40 ? 320 ALA A CB    1 
ATOM   3623 N  N     . VAL B 2 318 ? -23.119 19.689  20.159  1.00 43.55 ? 321 VAL A N     1 
ATOM   3624 C  CA    . VAL B 2 318 ? -23.717 18.488  20.739  1.00 43.65 ? 321 VAL A CA    1 
ATOM   3625 C  C     . VAL B 2 318 ? -24.926 18.833  21.612  1.00 43.82 ? 321 VAL A C     1 
ATOM   3626 O  O     . VAL B 2 318 ? -24.824 19.645  22.536  1.00 43.73 ? 321 VAL A O     1 
ATOM   3627 C  CB    . VAL B 2 318 ? -22.694 17.685  21.596  1.00 43.65 ? 321 VAL A CB    1 
ATOM   3628 C  CG1   . VAL B 2 318 ? -23.349 16.452  22.197  1.00 43.29 ? 321 VAL A CG1   1 
ATOM   3629 C  CG2   . VAL B 2 318 ? -21.468 17.284  20.777  1.00 43.76 ? 321 VAL A CG2   1 
ATOM   3630 N  N     . ASP B 2 319 ? -26.065 18.211  21.312  1.00 43.97 ? 322 ASP A N     1 
ATOM   3631 C  CA    . ASP B 2 319 ? -27.234 18.274  22.183  1.00 44.28 ? 322 ASP A CA    1 
ATOM   3632 C  C     . ASP B 2 319 ? -27.032 17.302  23.347  1.00 44.46 ? 322 ASP A C     1 
ATOM   3633 O  O     . ASP B 2 319 ? -27.005 16.083  23.154  1.00 44.45 ? 322 ASP A O     1 
ATOM   3634 C  CB    . ASP B 2 319 ? -28.507 17.929  21.404  1.00 44.40 ? 322 ASP A CB    1 
ATOM   3635 C  CG    . ASP B 2 319 ? -29.775 18.356  22.128  1.00 44.89 ? 322 ASP A CG    1 
ATOM   3636 O  OD1   . ASP B 2 319 ? -30.069 17.807  23.212  1.00 44.92 ? 322 ASP A OD1   1 
ATOM   3637 O  OD2   . ASP B 2 319 ? -30.488 19.238  21.600  1.00 45.76 ? 322 ASP A OD2   1 
ATOM   3638 N  N     . VAL B 2 320 ? -26.879 17.850  24.549  1.00 44.48 ? 323 VAL A N     1 
ATOM   3639 C  CA    . VAL B 2 320 ? -26.619 17.044  25.741  1.00 44.55 ? 323 VAL A CA    1 
ATOM   3640 C  C     . VAL B 2 320 ? -27.884 16.302  26.174  1.00 44.61 ? 323 VAL A C     1 
ATOM   3641 O  O     . VAL B 2 320 ? -28.934 16.910  26.372  1.00 44.63 ? 323 VAL A O     1 
ATOM   3642 C  CB    . VAL B 2 320 ? -26.052 17.900  26.906  1.00 44.52 ? 323 VAL A CB    1 
ATOM   3643 C  CG1   . VAL B 2 320 ? -25.829 17.048  28.149  1.00 44.45 ? 323 VAL A CG1   1 
ATOM   3644 C  CG2   . VAL B 2 320 ? -24.747 18.565  26.491  1.00 44.45 ? 323 VAL A CG2   1 
ATOM   3645 N  N     . GLU B 2 321 ? -27.767 14.984  26.314  1.00 44.73 ? 324 GLU A N     1 
ATOM   3646 C  CA    . GLU B 2 321 ? -28.915 14.136  26.628  1.00 44.77 ? 324 GLU A CA    1 
ATOM   3647 C  C     . GLU B 2 321 ? -28.870 13.562  28.046  1.00 44.35 ? 324 GLU A C     1 
ATOM   3648 O  O     . GLU B 2 321 ? -29.890 13.522  28.732  1.00 44.27 ? 324 GLU A O     1 
ATOM   3649 C  CB    . GLU B 2 321 ? -29.059 13.024  25.583  1.00 44.78 ? 324 GLU A CB    1 
ATOM   3650 C  CG    . GLU B 2 321 ? -29.470 13.537  24.201  1.00 45.35 ? 324 GLU A CG    1 
ATOM   3651 C  CD    . GLU B 2 321 ? -29.571 12.441  23.155  1.00 45.43 ? 324 GLU A CD    1 
ATOM   3652 O  OE1   . GLU B 2 321 ? -30.572 12.428  22.406  1.00 46.93 ? 324 GLU A OE1   1 
ATOM   3653 O  OE2   . GLU B 2 321 ? -28.653 11.597  23.074  1.00 46.91 ? 324 GLU A OE2   1 
ATOM   3654 N  N     . LYS B 2 322 ? -27.691 13.122  28.478  1.00 44.15 ? 325 LYS A N     1 
ATOM   3655 C  CA    . LYS B 2 322 ? -27.518 12.566  29.823  1.00 43.93 ? 325 LYS A CA    1 
ATOM   3656 C  C     . LYS B 2 322 ? -26.222 13.056  30.461  1.00 43.53 ? 325 LYS A C     1 
ATOM   3657 O  O     . LYS B 2 322 ? -25.143 12.833  29.923  1.00 43.65 ? 325 LYS A O     1 
ATOM   3658 C  CB    . LYS B 2 322 ? -27.542 11.031  29.791  1.00 43.92 ? 325 LYS A CB    1 
ATOM   3659 C  CG    . LYS B 2 322 ? -28.905 10.422  29.493  1.00 44.00 ? 325 LYS A CG    1 
ATOM   3660 C  CD    . LYS B 2 322 ? -28.885 8.913   29.654  1.00 44.32 ? 325 LYS A CD    1 
ATOM   3661 C  CE    . LYS B 2 322 ? -30.266 8.315   29.425  1.00 45.39 ? 325 LYS A CE    1 
ATOM   3662 N  NZ    . LYS B 2 322 ? -30.298 6.855   29.726  1.00 46.17 ? 325 LYS A NZ    1 
ATOM   3663 N  N     . VAL B 2 323 ? -26.340 13.722  31.608  1.00 43.07 ? 326 VAL A N     1 
ATOM   3664 C  CA    . VAL B 2 323 ? -25.176 14.225  32.345  1.00 42.60 ? 326 VAL A CA    1 
ATOM   3665 C  C     . VAL B 2 323 ? -24.813 13.272  33.485  1.00 42.37 ? 326 VAL A C     1 
ATOM   3666 O  O     . VAL B 2 323 ? -25.667 12.914  34.299  1.00 42.28 ? 326 VAL A O     1 
ATOM   3667 C  CB    . VAL B 2 323 ? -25.420 15.644  32.911  1.00 42.54 ? 326 VAL A CB    1 
ATOM   3668 C  CG1   . VAL B 2 323 ? -24.174 16.165  33.630  1.00 42.16 ? 326 VAL A CG1   1 
ATOM   3669 C  CG2   . VAL B 2 323 ? -25.834 16.600  31.804  1.00 42.18 ? 326 VAL A CG2   1 
ATOM   3670 N  N     . PHE B 2 324 ? -23.543 12.876  33.538  1.00 42.09 ? 327 PHE A N     1 
ATOM   3671 C  CA    . PHE B 2 324 ? -23.065 11.950  34.562  1.00 42.11 ? 327 PHE A CA    1 
ATOM   3672 C  C     . PHE B 2 324 ? -22.168 12.604  35.608  1.00 42.15 ? 327 PHE A C     1 
ATOM   3673 O  O     . PHE B 2 324 ? -22.158 12.184  36.765  1.00 42.17 ? 327 PHE A O     1 
ATOM   3674 C  CB    . PHE B 2 324 ? -22.364 10.744  33.918  1.00 41.82 ? 327 PHE A CB    1 
ATOM   3675 C  CG    . PHE B 2 324 ? -23.272 9.920   33.058  1.00 41.64 ? 327 PHE A CG    1 
ATOM   3676 C  CD1   . PHE B 2 324 ? -23.371 10.169  31.690  1.00 41.18 ? 327 PHE A CD1   1 
ATOM   3677 C  CD2   . PHE B 2 324 ? -24.055 8.915   33.616  1.00 40.77 ? 327 PHE A CD2   1 
ATOM   3678 C  CE1   . PHE B 2 324 ? -24.226 9.419   30.891  1.00 40.72 ? 327 PHE A CE1   1 
ATOM   3679 C  CE2   . PHE B 2 324 ? -24.913 8.164   32.825  1.00 41.06 ? 327 PHE A CE2   1 
ATOM   3680 C  CZ    . PHE B 2 324 ? -24.997 8.414   31.459  1.00 41.06 ? 327 PHE A CZ    1 
ATOM   3681 N  N     . MET B 2 325 ? -21.426 13.630  35.203  1.00 42.47 ? 328 MET A N     1 
ATOM   3682 C  CA    . MET B 2 325 ? -20.516 14.323  36.114  1.00 42.71 ? 328 MET A CA    1 
ATOM   3683 C  C     . MET B 2 325 ? -21.267 15.288  37.034  1.00 42.94 ? 328 MET A C     1 
ATOM   3684 O  O     . MET B 2 325 ? -22.081 16.085  36.560  1.00 43.09 ? 328 MET A O     1 
ATOM   3685 C  CB    . MET B 2 325 ? -19.430 15.069  35.337  1.00 42.63 ? 328 MET A CB    1 
ATOM   3686 C  CG    . MET B 2 325 ? -18.441 15.807  36.234  1.00 42.44 ? 328 MET A CG    1 
ATOM   3687 S  SD    . MET B 2 325 ? -17.149 16.673  35.342  1.00 42.95 ? 328 MET A SD    1 
ATOM   3688 C  CE    . MET B 2 325 ? -16.183 15.297  34.743  1.00 41.71 ? 328 MET A CE    1 
ATOM   3689 N  N     . PRO B 2 326 ? -20.998 15.214  38.354  1.00 43.26 ? 329 PRO A N     1 
ATOM   3690 C  CA    . PRO B 2 326 ? -21.577 16.165  39.316  1.00 43.46 ? 329 PRO A CA    1 
ATOM   3691 C  C     . PRO B 2 326 ? -21.215 17.617  39.001  1.00 43.77 ? 329 PRO A C     1 
ATOM   3692 O  O     . PRO B 2 326 ? -20.161 17.880  38.415  1.00 43.85 ? 329 PRO A O     1 
ATOM   3693 C  CB    . PRO B 2 326 ? -20.954 15.742  40.648  1.00 43.47 ? 329 PRO A CB    1 
ATOM   3694 C  CG    . PRO B 2 326 ? -20.585 14.308  40.454  1.00 43.33 ? 329 PRO A CG    1 
ATOM   3695 C  CD    . PRO B 2 326 ? -20.151 14.209  39.025  1.00 43.00 ? 329 PRO A CD    1 
ATOM   3696 N  N     . ARG B 2 327 ? -22.088 18.538  39.405  1.00 44.09 ? 330 ARG A N     1 
ATOM   3697 C  CA    . ARG B 2 327 ? -21.954 19.970  39.112  1.00 44.56 ? 330 ARG A CA    1 
ATOM   3698 C  C     . ARG B 2 327 ? -20.785 20.670  39.802  1.00 44.67 ? 330 ARG A C     1 
ATOM   3699 O  O     . ARG B 2 327 ? -20.301 21.694  39.312  1.00 44.81 ? 330 ARG A O     1 
ATOM   3700 C  CB    . ARG B 2 327 ? -23.244 20.708  39.484  1.00 44.79 ? 330 ARG A CB    1 
ATOM   3701 C  CG    . ARG B 2 327 ? -24.434 20.353  38.628  1.00 45.18 ? 330 ARG A CG    1 
ATOM   3702 C  CD    . ARG B 2 327 ? -25.726 20.707  39.325  1.00 45.75 ? 330 ARG A CD    1 
ATOM   3703 N  NE    . ARG B 2 327 ? -26.839 19.946  38.767  1.00 46.74 ? 330 ARG A NE    1 
ATOM   3704 C  CZ    . ARG B 2 327 ? -27.761 20.441  37.946  1.00 47.21 ? 330 ARG A CZ    1 
ATOM   3705 N  NH1   . ARG B 2 327 ? -27.730 21.718  37.582  1.00 47.51 ? 330 ARG A NH1   1 
ATOM   3706 N  NH2   . ARG B 2 327 ? -28.725 19.653  37.496  1.00 47.22 ? 330 ARG A NH2   1 
ATOM   3707 N  N     . ASP B 2 328 ? -20.343 20.136  40.937  1.00 44.68 ? 331 ASP A N     1 
ATOM   3708 C  CA    . ASP B 2 328 ? -19.329 20.809  41.753  1.00 44.72 ? 331 ASP A CA    1 
ATOM   3709 C  C     . ASP B 2 328 ? -17.886 20.337  41.517  1.00 44.46 ? 331 ASP A C     1 
ATOM   3710 O  O     . ASP B 2 328 ? -16.961 20.800  42.188  1.00 44.52 ? 331 ASP A O     1 
ATOM   3711 C  CB    . ASP B 2 328 ? -19.702 20.747  43.245  1.00 44.91 ? 331 ASP A CB    1 
ATOM   3712 C  CG    . ASP B 2 328 ? -19.773 19.322  43.787  1.00 45.65 ? 331 ASP A CG    1 
ATOM   3713 O  OD1   . ASP B 2 328 ? -20.057 18.377  43.016  1.00 46.19 ? 331 ASP A OD1   1 
ATOM   3714 O  OD2   . ASP B 2 328 ? -19.553 19.154  45.005  1.00 46.63 ? 331 ASP A OD2   1 
ATOM   3715 N  N     . TRP B 2 329 ? -17.697 19.427  40.564  1.00 44.24 ? 332 TRP A N     1 
ATOM   3716 C  CA    . TRP B 2 329 ? -16.360 18.948  40.193  1.00 44.02 ? 332 TRP A CA    1 
ATOM   3717 C  C     . TRP B 2 329 ? -15.530 20.035  39.501  1.00 43.97 ? 332 TRP A C     1 
ATOM   3718 O  O     . TRP B 2 329 ? -14.325 20.153  39.738  1.00 44.05 ? 332 TRP A O     1 
ATOM   3719 C  CB    . TRP B 2 329 ? -16.464 17.709  39.297  1.00 43.84 ? 332 TRP A CB    1 
ATOM   3720 C  CG    . TRP B 2 329 ? -16.730 16.421  40.035  1.00 43.62 ? 332 TRP A CG    1 
ATOM   3721 C  CD1   . TRP B 2 329 ? -17.282 16.280  41.280  1.00 43.74 ? 332 TRP A CD1   1 
ATOM   3722 C  CD2   . TRP B 2 329 ? -16.478 15.092  39.557  1.00 43.25 ? 332 TRP A CD2   1 
ATOM   3723 N  NE1   . TRP B 2 329 ? -17.375 14.949  41.609  1.00 43.71 ? 332 TRP A NE1   1 
ATOM   3724 C  CE2   . TRP B 2 329 ? -16.891 14.198  40.570  1.00 43.38 ? 332 TRP A CE2   1 
ATOM   3725 C  CE3   . TRP B 2 329 ? -15.934 14.571  38.374  1.00 43.19 ? 332 TRP A CE3   1 
ATOM   3726 C  CZ2   . TRP B 2 329 ? -16.784 12.807  40.435  1.00 43.68 ? 332 TRP A CZ2   1 
ATOM   3727 C  CZ3   . TRP B 2 329 ? -15.831 13.185  38.238  1.00 43.74 ? 332 TRP A CZ3   1 
ATOM   3728 C  CH2   . TRP B 2 329 ? -16.254 12.322  39.266  1.00 43.62 ? 332 TRP A CH2   1 
ATOM   3729 N  N     . TYR B 2 330 ? -16.184 20.813  38.641  1.00 43.81 ? 333 TYR A N     1 
ATOM   3730 C  CA    . TYR B 2 330 ? -15.562 21.960  37.979  1.00 43.85 ? 333 TYR A CA    1 
ATOM   3731 C  C     . TYR B 2 330 ? -16.317 23.241  38.340  1.00 43.82 ? 333 TYR A C     1 
ATOM   3732 O  O     . TYR B 2 330 ? -17.538 23.212  38.499  1.00 43.76 ? 333 TYR A O     1 
ATOM   3733 C  CB    . TYR B 2 330 ? -15.520 21.750  36.458  1.00 43.79 ? 333 TYR A CB    1 
ATOM   3734 C  CG    . TYR B 2 330 ? -14.464 20.756  36.015  1.00 43.71 ? 333 TYR A CG    1 
ATOM   3735 C  CD1   . TYR B 2 330 ? -14.619 19.388  36.252  1.00 43.90 ? 333 TYR A CD1   1 
ATOM   3736 C  CD2   . TYR B 2 330 ? -13.307 21.182  35.365  1.00 43.72 ? 333 TYR A CD2   1 
ATOM   3737 C  CE1   . TYR B 2 330 ? -13.652 18.472  35.854  1.00 43.72 ? 333 TYR A CE1   1 
ATOM   3738 C  CE2   . TYR B 2 330 ? -12.330 20.272  34.963  1.00 43.57 ? 333 TYR A CE2   1 
ATOM   3739 C  CZ    . TYR B 2 330 ? -12.510 18.921  35.215  1.00 43.83 ? 333 TYR A CZ    1 
ATOM   3740 O  OH    . TYR B 2 330 ? -11.553 18.016  34.820  1.00 44.01 ? 333 TYR A OH    1 
ATOM   3741 N  N     . PRO B 2 331 ? -15.596 24.369  38.483  1.00 43.97 ? 334 PRO A N     1 
ATOM   3742 C  CA    . PRO B 2 331 ? -16.265 25.606  38.874  1.00 44.08 ? 334 PRO A CA    1 
ATOM   3743 C  C     . PRO B 2 331 ? -17.014 26.234  37.706  1.00 44.21 ? 334 PRO A C     1 
ATOM   3744 O  O     . PRO B 2 331 ? -16.694 25.959  36.546  1.00 44.04 ? 334 PRO A O     1 
ATOM   3745 C  CB    . PRO B 2 331 ? -15.104 26.506  39.300  1.00 44.14 ? 334 PRO A CB    1 
ATOM   3746 C  CG    . PRO B 2 331 ? -13.972 26.058  38.457  1.00 44.00 ? 334 PRO A CG    1 
ATOM   3747 C  CD    . PRO B 2 331 ? -14.148 24.570  38.286  1.00 43.94 ? 334 PRO A CD    1 
ATOM   3748 N  N     . LYS B 2 332 ? -18.007 27.061  38.023  1.00 44.43 ? 335 LYS A N     1 
ATOM   3749 C  CA    . LYS B 2 332 ? -18.763 27.798  37.016  1.00 44.80 ? 335 LYS A CA    1 
ATOM   3750 C  C     . LYS B 2 332 ? -17.854 28.840  36.378  1.00 44.96 ? 335 LYS A C     1 
ATOM   3751 O  O     . LYS B 2 332 ? -17.445 29.806  37.026  1.00 44.96 ? 335 LYS A O     1 
ATOM   3752 C  CB    . LYS B 2 332 ? -19.990 28.471  37.643  1.00 44.85 ? 335 LYS A CB    1 
ATOM   3753 C  CG    . LYS B 2 332 ? -20.908 27.518  38.392  1.00 45.06 ? 335 LYS A CG    1 
ATOM   3754 C  CD    . LYS B 2 332 ? -21.934 28.272  39.214  1.00 45.33 ? 335 LYS A CD    1 
ATOM   3755 C  CE    . LYS B 2 332 ? -22.707 27.323  40.107  1.00 45.66 ? 335 LYS A CE    1 
ATOM   3756 N  NZ    . LYS B 2 332 ? -23.578 28.055  41.059  1.00 45.85 ? 335 LYS A NZ    1 
ATOM   3757 N  N     . LEU B 2 333 ? -17.529 28.621  35.108  1.00 45.23 ? 336 LEU A N     1 
ATOM   3758 C  CA    . LEU B 2 333 ? -16.578 29.463  34.391  1.00 45.48 ? 336 LEU A CA    1 
ATOM   3759 C  C     . LEU B 2 333 ? -17.196 30.188  33.194  1.00 45.56 ? 336 LEU A C     1 
ATOM   3760 O  O     . LEU B 2 333 ? -16.513 30.951  32.507  1.00 45.66 ? 336 LEU A O     1 
ATOM   3761 C  CB    . LEU B 2 333 ? -15.355 28.638  33.965  1.00 45.54 ? 336 LEU A CB    1 
ATOM   3762 C  CG    . LEU B 2 333 ? -14.044 28.741  34.762  1.00 45.82 ? 336 LEU A CG    1 
ATOM   3763 C  CD1   . LEU B 2 333 ? -14.236 29.128  36.229  1.00 46.37 ? 336 LEU A CD1   1 
ATOM   3764 C  CD2   . LEU B 2 333 ? -13.243 27.450  34.648  1.00 45.46 ? 336 LEU A CD2   1 
ATOM   3765 N  N     . TRP B 2 334 ? -18.485 29.954  32.956  1.00 45.59 ? 337 TRP A N     1 
ATOM   3766 C  CA    . TRP B 2 334 ? -19.210 30.644  31.889  1.00 45.56 ? 337 TRP A CA    1 
ATOM   3767 C  C     . TRP B 2 334 ? -19.513 32.091  32.271  1.00 45.59 ? 337 TRP A C     1 
ATOM   3768 O  O     . TRP B 2 334 ? -19.687 32.409  33.449  1.00 45.66 ? 337 TRP A O     1 
ATOM   3769 C  CB    . TRP B 2 334 ? -20.498 29.897  31.519  1.00 45.51 ? 337 TRP A CB    1 
ATOM   3770 C  CG    . TRP B 2 334 ? -21.590 29.953  32.558  1.00 45.40 ? 337 TRP A CG    1 
ATOM   3771 C  CD1   . TRP B 2 334 ? -22.478 30.973  32.764  1.00 45.28 ? 337 TRP A CD1   1 
ATOM   3772 C  CD2   . TRP B 2 334 ? -21.920 28.937  33.515  1.00 45.28 ? 337 TRP A CD2   1 
ATOM   3773 N  NE1   . TRP B 2 334 ? -23.331 30.660  33.793  1.00 45.28 ? 337 TRP A NE1   1 
ATOM   3774 C  CE2   . TRP B 2 334 ? -23.013 29.416  34.272  1.00 45.12 ? 337 TRP A CE2   1 
ATOM   3775 C  CE3   . TRP B 2 334 ? -21.396 27.671  33.809  1.00 45.26 ? 337 TRP A CE3   1 
ATOM   3776 C  CZ2   . TRP B 2 334 ? -23.592 28.673  35.306  1.00 45.23 ? 337 TRP A CZ2   1 
ATOM   3777 C  CZ3   . TRP B 2 334 ? -21.975 26.931  34.839  1.00 45.26 ? 337 TRP A CZ3   1 
ATOM   3778 C  CH2   . TRP B 2 334 ? -23.063 27.436  35.572  1.00 45.32 ? 337 TRP A CH2   1 
ATOM   3779 N  N     . MET C 3 8   ? -43.710 -14.224 -14.804 1.00 47.95 ? 1   MET B N     1 
ATOM   3780 C  CA    . MET C 3 8   ? -43.073 -14.897 -13.634 1.00 48.14 ? 1   MET B CA    1 
ATOM   3781 C  C     . MET C 3 8   ? -41.604 -14.513 -13.473 1.00 47.87 ? 1   MET B C     1 
ATOM   3782 O  O     . MET C 3 8   ? -40.863 -14.422 -14.456 1.00 47.90 ? 1   MET B O     1 
ATOM   3783 C  CB    . MET C 3 8   ? -43.230 -16.423 -13.716 1.00 48.17 ? 1   MET B CB    1 
ATOM   3784 C  CG    . MET C 3 8   ? -42.904 -17.040 -15.072 1.00 48.39 ? 1   MET B CG    1 
ATOM   3785 S  SD    . MET C 3 8   ? -43.127 -18.831 -15.078 1.00 48.77 ? 1   MET B SD    1 
ATOM   3786 C  CE    . MET C 3 8   ? -43.294 -19.136 -16.837 1.00 48.44 ? 1   MET B CE    1 
ATOM   3787 N  N     . LYS C 3 9   ? -41.201 -14.282 -12.225 1.00 47.54 ? 2   LYS B N     1 
ATOM   3788 C  CA    . LYS C 3 9   ? -39.834 -13.886 -11.903 1.00 47.29 ? 2   LYS B CA    1 
ATOM   3789 C  C     . LYS C 3 9   ? -39.069 -15.060 -11.301 1.00 46.86 ? 2   LYS B C     1 
ATOM   3790 O  O     . LYS C 3 9   ? -39.485 -15.636 -10.291 1.00 46.69 ? 2   LYS B O     1 
ATOM   3791 C  CB    . LYS C 3 9   ? -39.830 -12.688 -10.948 1.00 47.36 ? 2   LYS B CB    1 
ATOM   3792 C  CG    . LYS C 3 9   ? -38.494 -11.962 -10.863 1.00 47.69 ? 2   LYS B CG    1 
ATOM   3793 C  CD    . LYS C 3 9   ? -38.569 -10.750 -9.950  1.00 47.70 ? 2   LYS B CD    1 
ATOM   3794 C  CE    . LYS C 3 9   ? -37.216 -10.066 -9.840  1.00 48.49 ? 2   LYS B CE    1 
ATOM   3795 N  NZ    . LYS C 3 9   ? -37.211 -9.004  -8.794  1.00 49.05 ? 2   LYS B NZ    1 
ATOM   3796 N  N     . ARG C 3 10  ? -37.950 -15.404 -11.932 1.00 46.42 ? 3   ARG B N     1 
ATOM   3797 C  CA    . ARG C 3 10  ? -37.160 -16.570 -11.543 1.00 46.04 ? 3   ARG B CA    1 
ATOM   3798 C  C     . ARG C 3 10  ? -36.553 -16.445 -10.148 1.00 45.95 ? 3   ARG B C     1 
ATOM   3799 O  O     . ARG C 3 10  ? -35.884 -15.460 -9.834  1.00 45.84 ? 3   ARG B O     1 
ATOM   3800 C  CB    . ARG C 3 10  ? -36.065 -16.845 -12.577 1.00 45.90 ? 3   ARG B CB    1 
ATOM   3801 C  CG    . ARG C 3 10  ? -35.399 -18.208 -12.435 1.00 45.44 ? 3   ARG B CG    1 
ATOM   3802 C  CD    . ARG C 3 10  ? -34.407 -18.452 -13.557 1.00 44.98 ? 3   ARG B CD    1 
ATOM   3803 N  NE    . ARG C 3 10  ? -33.223 -17.605 -13.436 1.00 44.34 ? 3   ARG B NE    1 
ATOM   3804 C  CZ    . ARG C 3 10  ? -32.429 -17.267 -14.447 1.00 44.04 ? 3   ARG B CZ    1 
ATOM   3805 N  NH1   . ARG C 3 10  ? -32.684 -17.690 -15.679 1.00 43.25 ? 3   ARG B NH1   1 
ATOM   3806 N  NH2   . ARG C 3 10  ? -31.377 -16.493 -14.224 1.00 44.02 ? 3   ARG B NH2   1 
ATOM   3807 N  N     . LEU C 3 11  ? -36.820 -17.453 -9.320  1.00 45.87 ? 4   LEU B N     1 
ATOM   3808 C  CA    . LEU C 3 11  ? -36.178 -17.611 -8.022  1.00 45.83 ? 4   LEU B CA    1 
ATOM   3809 C  C     . LEU C 3 11  ? -34.837 -18.303 -8.215  1.00 45.73 ? 4   LEU B C     1 
ATOM   3810 O  O     . LEU C 3 11  ? -33.783 -17.679 -8.097  1.00 45.81 ? 4   LEU B O     1 
ATOM   3811 C  CB    . LEU C 3 11  ? -37.068 -18.434 -7.082  1.00 45.85 ? 4   LEU B CB    1 
ATOM   3812 C  CG    . LEU C 3 11  ? -37.661 -17.831 -5.803  1.00 45.88 ? 4   LEU B CG    1 
ATOM   3813 C  CD1   . LEU C 3 11  ? -37.852 -16.327 -5.885  1.00 45.70 ? 4   LEU B CD1   1 
ATOM   3814 C  CD2   . LEU C 3 11  ? -38.973 -18.532 -5.452  1.00 46.05 ? 4   LEU B CD2   1 
ATOM   3815 N  N     . GLY C 3 12  ? -34.889 -19.592 -8.531  1.00 45.53 ? 5   GLY B N     1 
ATOM   3816 C  CA    . GLY C 3 12  ? -33.689 -20.376 -8.758  1.00 45.40 ? 5   GLY B CA    1 
ATOM   3817 C  C     . GLY C 3 12  ? -33.894 -21.851 -8.493  1.00 45.35 ? 5   GLY B C     1 
ATOM   3818 O  O     . GLY C 3 12  ? -35.026 -22.317 -8.328  1.00 45.37 ? 5   GLY B O     1 
ATOM   3819 N  N     . LYS C 3 13  ? -32.779 -22.574 -8.458  1.00 45.24 ? 6   LYS B N     1 
ATOM   3820 C  CA    . LYS C 3 13  ? -32.749 -24.014 -8.246  1.00 45.19 ? 6   LYS B CA    1 
ATOM   3821 C  C     . LYS C 3 13  ? -33.195 -24.350 -6.828  1.00 45.04 ? 6   LYS B C     1 
ATOM   3822 O  O     . LYS C 3 13  ? -32.855 -23.637 -5.881  1.00 45.05 ? 6   LYS B O     1 
ATOM   3823 C  CB    . LYS C 3 13  ? -31.316 -24.513 -8.448  1.00 45.22 ? 6   LYS B CB    1 
ATOM   3824 C  CG    . LYS C 3 13  ? -31.163 -26.000 -8.715  1.00 45.54 ? 6   LYS B CG    1 
ATOM   3825 C  CD    . LYS C 3 13  ? -30.819 -26.252 -10.171 1.00 45.99 ? 6   LYS B CD    1 
ATOM   3826 C  CE    . LYS C 3 13  ? -29.979 -27.507 -10.323 1.00 46.15 ? 6   LYS B CE    1 
ATOM   3827 N  NZ    . LYS C 3 13  ? -29.439 -27.639 -11.702 1.00 46.19 ? 6   LYS B NZ    1 
ATOM   3828 N  N     . VAL C 3 14  ? -33.961 -25.427 -6.683  1.00 44.85 ? 7   VAL B N     1 
ATOM   3829 C  CA    . VAL C 3 14  ? -34.233 -25.975 -5.359  1.00 44.63 ? 7   VAL B CA    1 
ATOM   3830 C  C     . VAL C 3 14  ? -33.002 -26.764 -4.938  1.00 44.53 ? 7   VAL B C     1 
ATOM   3831 O  O     . VAL C 3 14  ? -32.618 -27.736 -5.595  1.00 44.48 ? 7   VAL B O     1 
ATOM   3832 C  CB    . VAL C 3 14  ? -35.490 -26.875 -5.322  1.00 44.66 ? 7   VAL B CB    1 
ATOM   3833 C  CG1   . VAL C 3 14  ? -35.669 -27.495 -3.939  1.00 44.24 ? 7   VAL B CG1   1 
ATOM   3834 C  CG2   . VAL C 3 14  ? -36.728 -26.083 -5.698  1.00 44.52 ? 7   VAL B CG2   1 
ATOM   3835 N  N     . LEU C 3 15  ? -32.379 -26.322 -3.852  1.00 44.44 ? 8   LEU B N     1 
ATOM   3836 C  CA    . LEU C 3 15  ? -31.170 -26.958 -3.343  1.00 44.44 ? 8   LEU B CA    1 
ATOM   3837 C  C     . LEU C 3 15  ? -31.501 -28.269 -2.637  1.00 44.37 ? 8   LEU B C     1 
ATOM   3838 O  O     . LEU C 3 15  ? -30.784 -29.263 -2.786  1.00 44.44 ? 8   LEU B O     1 
ATOM   3839 C  CB    . LEU C 3 15  ? -30.412 -26.009 -2.408  1.00 44.39 ? 8   LEU B CB    1 
ATOM   3840 C  CG    . LEU C 3 15  ? -29.943 -24.666 -2.986  1.00 44.66 ? 8   LEU B CG    1 
ATOM   3841 C  CD1   . LEU C 3 15  ? -29.265 -23.829 -1.908  1.00 44.83 ? 8   LEU B CD1   1 
ATOM   3842 C  CD2   . LEU C 3 15  ? -29.012 -24.853 -4.183  1.00 44.76 ? 8   LEU B CD2   1 
ATOM   3843 N  N     . HIS C 3 16  ? -32.592 -28.258 -1.873  1.00 44.18 ? 9   HIS B N     1 
ATOM   3844 C  CA    . HIS C 3 16  ? -33.072 -29.438 -1.151  1.00 44.12 ? 9   HIS B CA    1 
ATOM   3845 C  C     . HIS C 3 16  ? -34.451 -29.205 -0.545  1.00 43.92 ? 9   HIS B C     1 
ATOM   3846 O  O     . HIS C 3 16  ? -34.946 -28.074 -0.497  1.00 43.79 ? 9   HIS B O     1 
ATOM   3847 C  CB    . HIS C 3 16  ? -32.089 -29.864 -0.046  1.00 44.17 ? 9   HIS B CB    1 
ATOM   3848 C  CG    . HIS C 3 16  ? -31.407 -28.719 0.635   1.00 44.29 ? 9   HIS B CG    1 
ATOM   3849 N  ND1   . HIS C 3 16  ? -30.035 -28.605 0.699   1.00 44.61 ? 9   HIS B ND1   1 
ATOM   3850 C  CD2   . HIS C 3 16  ? -31.906 -27.628 1.262   1.00 44.55 ? 9   HIS B CD2   1 
ATOM   3851 C  CE1   . HIS C 3 16  ? -29.718 -27.497 1.345   1.00 44.65 ? 9   HIS B CE1   1 
ATOM   3852 N  NE2   . HIS C 3 16  ? -30.835 -26.884 1.695   1.00 44.39 ? 9   HIS B NE2   1 
ATOM   3853 N  N     . TYR C 3 17  ? -35.068 -30.293 -0.096  1.00 43.67 ? 10  TYR B N     1 
ATOM   3854 C  CA    . TYR C 3 17  ? -36.280 -30.219 0.695   1.00 43.51 ? 10  TYR B CA    1 
ATOM   3855 C  C     . TYR C 3 17  ? -35.889 -30.405 2.155   1.00 43.41 ? 10  TYR B C     1 
ATOM   3856 O  O     . TYR C 3 17  ? -35.521 -31.505 2.573   1.00 43.33 ? 10  TYR B O     1 
ATOM   3857 C  CB    . TYR C 3 17  ? -37.287 -31.281 0.241   1.00 43.50 ? 10  TYR B CB    1 
ATOM   3858 C  CG    . TYR C 3 17  ? -38.576 -31.308 1.035   1.00 43.55 ? 10  TYR B CG    1 
ATOM   3859 C  CD1   . TYR C 3 17  ? -39.416 -30.193 1.084   1.00 43.40 ? 10  TYR B CD1   1 
ATOM   3860 C  CD2   . TYR C 3 17  ? -38.965 -32.456 1.725   1.00 43.62 ? 10  TYR B CD2   1 
ATOM   3861 C  CE1   . TYR C 3 17  ? -40.602 -30.217 1.810   1.00 43.41 ? 10  TYR B CE1   1 
ATOM   3862 C  CE2   . TYR C 3 17  ? -40.153 -32.492 2.453   1.00 43.66 ? 10  TYR B CE2   1 
ATOM   3863 C  CZ    . TYR C 3 17  ? -40.964 -31.370 2.491   1.00 43.57 ? 10  TYR B CZ    1 
ATOM   3864 O  OH    . TYR C 3 17  ? -42.138 -31.401 3.207   1.00 43.56 ? 10  TYR B OH    1 
ATOM   3865 N  N     . ALA C 3 18  ? -35.936 -29.312 2.915   1.00 43.35 ? 11  ALA B N     1 
ATOM   3866 C  CA    . ALA C 3 18  ? -35.617 -29.346 4.341   1.00 43.30 ? 11  ALA B CA    1 
ATOM   3867 C  C     . ALA C 3 18  ? -36.635 -30.187 5.092   1.00 43.27 ? 11  ALA B C     1 
ATOM   3868 O  O     . ALA C 3 18  ? -37.840 -30.082 4.849   1.00 43.21 ? 11  ALA B O     1 
ATOM   3869 C  CB    . ALA C 3 18  ? -35.557 -27.942 4.917   1.00 43.23 ? 11  ALA B CB    1 
ATOM   3870 N  N     . LYS C 3 19  ? -36.138 -31.020 6.002   1.00 43.40 ? 12  LYS B N     1 
ATOM   3871 C  CA    . LYS C 3 19  ? -36.978 -31.952 6.759   1.00 43.36 ? 12  LYS B CA    1 
ATOM   3872 C  C     . LYS C 3 19  ? -37.976 -31.262 7.693   1.00 43.27 ? 12  LYS B C     1 
ATOM   3873 O  O     . LYS C 3 19  ? -38.989 -31.851 8.066   1.00 43.38 ? 12  LYS B O     1 
ATOM   3874 C  CB    . LYS C 3 19  ? -36.123 -32.982 7.512   1.00 43.47 ? 12  LYS B CB    1 
ATOM   3875 C  CG    . LYS C 3 19  ? -34.821 -32.442 8.091   1.00 43.50 ? 12  LYS B CG    1 
ATOM   3876 C  CD    . LYS C 3 19  ? -33.779 -33.547 8.260   1.00 43.67 ? 12  LYS B CD    1 
ATOM   3877 C  CE    . LYS C 3 19  ? -33.822 -34.180 9.644   1.00 43.89 ? 12  LYS B CE    1 
ATOM   3878 N  NZ    . LYS C 3 19  ? -34.984 -35.093 9.848   1.00 44.32 ? 12  LYS B NZ    1 
ATOM   3879 N  N     . GLN C 3 20  ? -37.693 -30.011 8.049   1.00 43.22 ? 13  GLN B N     1 
ATOM   3880 C  CA    . GLN C 3 20  ? -38.647 -29.179 8.785   1.00 43.13 ? 13  GLN B CA    1 
ATOM   3881 C  C     . GLN C 3 20  ? -39.812 -28.707 7.901   1.00 43.08 ? 13  GLN B C     1 
ATOM   3882 O  O     . GLN C 3 20  ? -40.731 -28.038 8.379   1.00 43.26 ? 13  GLN B O     1 
ATOM   3883 C  CB    . GLN C 3 20  ? -37.938 -28.001 9.467   1.00 43.11 ? 13  GLN B CB    1 
ATOM   3884 C  CG    . GLN C 3 20  ? -37.220 -28.398 10.760  1.00 43.06 ? 13  GLN B CG    1 
ATOM   3885 C  CD    . GLN C 3 20  ? -36.332 -27.300 11.328  1.00 42.97 ? 13  GLN B CD    1 
ATOM   3886 O  OE1   . GLN C 3 20  ? -35.652 -26.584 10.591  1.00 42.23 ? 13  GLN B OE1   1 
ATOM   3887 N  NE2   . GLN C 3 20  ? -36.321 -27.177 12.652  1.00 42.37 ? 13  GLN B NE2   1 
ATOM   3888 N  N     . GLY C 3 21  ? -39.761 -29.060 6.615   1.00 42.81 ? 14  GLY B N     1 
ATOM   3889 C  CA    . GLY C 3 21  ? -40.910 -28.937 5.718   1.00 42.50 ? 14  GLY B CA    1 
ATOM   3890 C  C     . GLY C 3 21  ? -40.888 -27.774 4.746   1.00 42.31 ? 14  GLY B C     1 
ATOM   3891 O  O     . GLY C 3 21  ? -41.930 -27.187 4.460   1.00 42.31 ? 14  GLY B O     1 
ATOM   3892 N  N     . PHE C 3 22  ? -39.706 -27.445 4.231   1.00 42.12 ? 15  PHE B N     1 
ATOM   3893 C  CA    . PHE C 3 22  ? -39.558 -26.334 3.292   1.00 41.99 ? 15  PHE B CA    1 
ATOM   3894 C  C     . PHE C 3 22  ? -38.636 -26.687 2.136   1.00 41.89 ? 15  PHE B C     1 
ATOM   3895 O  O     . PHE C 3 22  ? -37.580 -27.288 2.335   1.00 41.82 ? 15  PHE B O     1 
ATOM   3896 C  CB    . PHE C 3 22  ? -39.021 -25.083 4.001   1.00 41.91 ? 15  PHE B CB    1 
ATOM   3897 C  CG    . PHE C 3 22  ? -39.945 -24.529 5.048   1.00 41.99 ? 15  PHE B CG    1 
ATOM   3898 C  CD1   . PHE C 3 22  ? -39.798 -24.889 6.384   1.00 41.88 ? 15  PHE B CD1   1 
ATOM   3899 C  CD2   . PHE C 3 22  ? -40.960 -23.641 4.700   1.00 41.99 ? 15  PHE B CD2   1 
ATOM   3900 C  CE1   . PHE C 3 22  ? -40.654 -24.381 7.359   1.00 42.02 ? 15  PHE B CE1   1 
ATOM   3901 C  CE2   . PHE C 3 22  ? -41.819 -23.127 5.667   1.00 42.13 ? 15  PHE B CE2   1 
ATOM   3902 C  CZ    . PHE C 3 22  ? -41.666 -23.498 6.999   1.00 41.91 ? 15  PHE B CZ    1 
ATOM   3903 N  N     . LEU C 3 23  ? -39.045 -26.317 0.927   1.00 41.81 ? 16  LEU B N     1 
ATOM   3904 C  CA    . LEU C 3 23  ? -38.138 -26.317 -0.213  1.00 41.94 ? 16  LEU B CA    1 
ATOM   3905 C  C     . LEU C 3 23  ? -37.265 -25.071 -0.098  1.00 41.93 ? 16  LEU B C     1 
ATOM   3906 O  O     . LEU C 3 23  ? -37.779 -23.974 0.123   1.00 41.92 ? 16  LEU B O     1 
ATOM   3907 C  CB    . LEU C 3 23  ? -38.914 -26.311 -1.535  1.00 41.93 ? 16  LEU B CB    1 
ATOM   3908 C  CG    . LEU C 3 23  ? -39.776 -27.527 -1.884  1.00 41.92 ? 16  LEU B CG    1 
ATOM   3909 C  CD1   . LEU C 3 23  ? -40.759 -27.177 -2.992  1.00 42.29 ? 16  LEU B CD1   1 
ATOM   3910 C  CD2   . LEU C 3 23  ? -38.923 -28.725 -2.282  1.00 42.03 ? 16  LEU B CD2   1 
ATOM   3911 N  N     . ILE C 3 24  ? -35.950 -25.244 -0.215  1.00 42.11 ? 17  ILE B N     1 
ATOM   3912 C  CA    . ILE C 3 24  ? -35.020 -24.117 -0.082  1.00 42.21 ? 17  ILE B CA    1 
ATOM   3913 C  C     . ILE C 3 24  ? -34.361 -23.753 -1.411  1.00 42.35 ? 17  ILE B C     1 
ATOM   3914 O  O     . ILE C 3 24  ? -33.799 -24.604 -2.103  1.00 42.20 ? 17  ILE B O     1 
ATOM   3915 C  CB    . ILE C 3 24  ? -33.975 -24.325 1.056   1.00 42.34 ? 17  ILE B CB    1 
ATOM   3916 C  CG1   . ILE C 3 24  ? -34.592 -23.982 2.415   1.00 42.40 ? 17  ILE B CG1   1 
ATOM   3917 C  CG2   . ILE C 3 24  ? -32.759 -23.411 0.877   1.00 41.95 ? 17  ILE B CG2   1 
ATOM   3918 C  CD1   . ILE C 3 24  ? -35.342 -25.094 3.059   1.00 42.32 ? 17  ILE B CD1   1 
ATOM   3919 N  N     . VAL C 3 25  ? -34.461 -22.471 -1.750  1.00 42.56 ? 18  VAL B N     1 
ATOM   3920 C  CA    . VAL C 3 25  ? -33.962 -21.935 -3.007  1.00 42.87 ? 18  VAL B CA    1 
ATOM   3921 C  C     . VAL C 3 25  ? -32.990 -20.789 -2.725  1.00 42.84 ? 18  VAL B C     1 
ATOM   3922 O  O     . VAL C 3 25  ? -33.225 -19.974 -1.831  1.00 42.77 ? 18  VAL B O     1 
ATOM   3923 C  CB    . VAL C 3 25  ? -35.137 -21.430 -3.900  1.00 42.93 ? 18  VAL B CB    1 
ATOM   3924 C  CG1   . VAL C 3 25  ? -34.629 -20.638 -5.100  1.00 43.22 ? 18  VAL B CG1   1 
ATOM   3925 C  CG2   . VAL C 3 25  ? -36.006 -22.594 -4.362  1.00 43.05 ? 18  VAL B CG2   1 
ATOM   3926 N  N     . ARG C 3 26  ? -31.892 -20.759 -3.475  1.00 42.91 ? 19  ARG B N     1 
ATOM   3927 C  CA    . ARG C 3 26  ? -30.986 -19.616 -3.492  1.00 43.07 ? 19  ARG B CA    1 
ATOM   3928 C  C     . ARG C 3 26  ? -31.371 -18.720 -4.663  1.00 43.09 ? 19  ARG B C     1 
ATOM   3929 O  O     . ARG C 3 26  ? -31.582 -19.200 -5.779  1.00 43.15 ? 19  ARG B O     1 
ATOM   3930 C  CB    . ARG C 3 26  ? -29.531 -20.073 -3.630  1.00 43.08 ? 19  ARG B CB    1 
ATOM   3931 C  CG    . ARG C 3 26  ? -28.496 -19.021 -3.228  1.00 43.51 ? 19  ARG B CG    1 
ATOM   3932 C  CD    . ARG C 3 26  ? -28.284 -19.016 -1.725  1.00 43.73 ? 19  ARG B CD    1 
ATOM   3933 N  NE    . ARG C 3 26  ? -27.528 -17.857 -1.255  1.00 44.10 ? 19  ARG B NE    1 
ATOM   3934 C  CZ    . ARG C 3 26  ? -26.203 -17.802 -1.160  1.00 44.03 ? 19  ARG B CZ    1 
ATOM   3935 N  NH1   . ARG C 3 26  ? -25.458 -18.841 -1.517  1.00 44.57 ? 19  ARG B NH1   1 
ATOM   3936 N  NH2   . ARG C 3 26  ? -25.619 -16.700 -0.710  1.00 43.56 ? 19  ARG B NH2   1 
ATOM   3937 N  N     . THR C 3 27  ? -31.467 -17.421 -4.399  1.00 43.07 ? 20  THR B N     1 
ATOM   3938 C  CA    . THR C 3 27  ? -31.905 -16.451 -5.405  1.00 43.04 ? 20  THR B CA    1 
ATOM   3939 C  C     . THR C 3 27  ? -31.083 -15.161 -5.306  1.00 42.88 ? 20  THR B C     1 
ATOM   3940 O  O     . THR C 3 27  ? -30.234 -15.038 -4.425  1.00 42.99 ? 20  THR B O     1 
ATOM   3941 C  CB    . THR C 3 27  ? -33.432 -16.171 -5.290  1.00 43.07 ? 20  THR B CB    1 
ATOM   3942 O  OG1   . THR C 3 27  ? -33.866 -15.367 -6.394  1.00 43.75 ? 20  THR B OG1   1 
ATOM   3943 C  CG2   . THR C 3 27  ? -33.777 -15.476 -3.976  1.00 43.14 ? 20  THR B CG2   1 
ATOM   3944 N  N     . ASN C 3 28  ? -31.326 -14.215 -6.214  1.00 42.67 ? 21  ASN B N     1 
ATOM   3945 C  CA    . ASN C 3 28  ? -30.587 -12.948 -6.234  1.00 42.45 ? 21  ASN B CA    1 
ATOM   3946 C  C     . ASN C 3 28  ? -31.471 -11.705 -6.053  1.00 42.44 ? 21  ASN B C     1 
ATOM   3947 O  O     . ASN C 3 28  ? -31.087 -10.595 -6.437  1.00 42.52 ? 21  ASN B O     1 
ATOM   3948 C  CB    . ASN C 3 28  ? -29.741 -12.835 -7.512  1.00 42.38 ? 21  ASN B CB    1 
ATOM   3949 C  CG    . ASN C 3 28  ? -30.575 -12.911 -8.784  1.00 42.10 ? 21  ASN B CG    1 
ATOM   3950 O  OD1   . ASN C 3 28  ? -31.796 -13.067 -8.742  1.00 42.20 ? 21  ASN B OD1   1 
ATOM   3951 N  ND2   . ASN C 3 28  ? -29.911 -12.803 -9.925  1.00 42.11 ? 21  ASN B ND2   1 
ATOM   3952 N  N     . TRP C 3 29  ? -32.656 -11.910 -5.483  1.00 42.34 ? 22  TRP B N     1 
ATOM   3953 C  CA    . TRP C 3 29  ? -33.574 -10.825 -5.131  1.00 42.28 ? 22  TRP B CA    1 
ATOM   3954 C  C     . TRP C 3 29  ? -34.384 -11.227 -3.898  1.00 42.33 ? 22  TRP B C     1 
ATOM   3955 O  O     . TRP C 3 29  ? -34.304 -12.369 -3.451  1.00 42.39 ? 22  TRP B O     1 
ATOM   3956 C  CB    . TRP C 3 29  ? -34.483 -10.454 -6.313  1.00 42.07 ? 22  TRP B CB    1 
ATOM   3957 C  CG    . TRP C 3 29  ? -35.448 -11.533 -6.733  1.00 42.08 ? 22  TRP B CG    1 
ATOM   3958 C  CD1   . TRP C 3 29  ? -35.154 -12.675 -7.422  1.00 41.97 ? 22  TRP B CD1   1 
ATOM   3959 C  CD2   . TRP C 3 29  ? -36.864 -11.557 -6.506  1.00 41.88 ? 22  TRP B CD2   1 
ATOM   3960 N  NE1   . TRP C 3 29  ? -36.294 -13.412 -7.630  1.00 41.86 ? 22  TRP B NE1   1 
ATOM   3961 C  CE2   . TRP C 3 29  ? -37.359 -12.749 -7.078  1.00 41.92 ? 22  TRP B CE2   1 
ATOM   3962 C  CE3   . TRP C 3 29  ? -37.763 -10.687 -5.873  1.00 41.85 ? 22  TRP B CE3   1 
ATOM   3963 C  CZ2   . TRP C 3 29  ? -38.714 -13.095 -7.037  1.00 41.83 ? 22  TRP B CZ2   1 
ATOM   3964 C  CZ3   . TRP C 3 29  ? -39.110 -11.032 -5.834  1.00 41.77 ? 22  TRP B CZ3   1 
ATOM   3965 C  CH2   . TRP C 3 29  ? -39.570 -12.227 -6.410  1.00 41.86 ? 22  TRP B CH2   1 
ATOM   3966 N  N     . VAL C 3 30  ? -35.153 -10.291 -3.346  1.00 42.45 ? 23  VAL B N     1 
ATOM   3967 C  CA    . VAL C 3 30  ? -35.882 -10.542 -2.101  1.00 42.53 ? 23  VAL B CA    1 
ATOM   3968 C  C     . VAL C 3 30  ? -37.395 -10.654 -2.337  1.00 42.66 ? 23  VAL B C     1 
ATOM   3969 O  O     . VAL C 3 30  ? -38.072 -9.639  -2.523  1.00 42.66 ? 23  VAL B O     1 
ATOM   3970 C  CB    . VAL C 3 30  ? -35.584 -9.459  -1.024  1.00 42.57 ? 23  VAL B CB    1 
ATOM   3971 C  CG1   . VAL C 3 30  ? -36.182 -9.860  0.320   1.00 42.33 ? 23  VAL B CG1   1 
ATOM   3972 C  CG2   . VAL C 3 30  ? -34.079 -9.224  -0.887  1.00 42.31 ? 23  VAL B CG2   1 
ATOM   3973 N  N     . PRO C 3 31  ? -37.928 -11.893 -2.325  1.00 42.80 ? 24  PRO B N     1 
ATOM   3974 C  CA    . PRO C 3 31  ? -39.373 -12.093 -2.459  1.00 42.94 ? 24  PRO B CA    1 
ATOM   3975 C  C     . PRO C 3 31  ? -40.105 -11.664 -1.192  1.00 43.07 ? 24  PRO B C     1 
ATOM   3976 O  O     . PRO C 3 31  ? -39.477 -11.473 -0.150  1.00 43.05 ? 24  PRO B O     1 
ATOM   3977 C  CB    . PRO C 3 31  ? -39.512 -13.611 -2.661  1.00 42.84 ? 24  PRO B CB    1 
ATOM   3978 C  CG    . PRO C 3 31  ? -38.126 -14.133 -2.863  1.00 42.76 ? 24  PRO B CG    1 
ATOM   3979 C  CD    . PRO C 3 31  ? -37.217 -13.175 -2.178  1.00 42.78 ? 24  PRO B CD    1 
ATOM   3980 N  N     . SER C 3 32  ? -41.420 -11.505 -1.288  1.00 43.34 ? 25  SER B N     1 
ATOM   3981 C  CA    . SER C 3 32  ? -42.223 -11.139 -0.129  1.00 43.64 ? 25  SER B CA    1 
ATOM   3982 C  C     . SER C 3 32  ? -42.895 -12.365 0.480   1.00 43.78 ? 25  SER B C     1 
ATOM   3983 O  O     . SER C 3 32  ? -43.023 -13.407 -0.171  1.00 43.76 ? 25  SER B O     1 
ATOM   3984 C  CB    . SER C 3 32  ? -43.257 -10.069 -0.495  1.00 43.69 ? 25  SER B CB    1 
ATOM   3985 O  OG    . SER C 3 32  ? -44.187 -10.549 -1.449  1.00 44.10 ? 25  SER B OG    1 
ATOM   3986 N  N     . LEU C 3 33  ? -43.302 -12.233 1.740   1.00 43.91 ? 26  LEU B N     1 
ATOM   3987 C  CA    . LEU C 3 33  ? -44.022 -13.282 2.446   1.00 43.95 ? 26  LEU B CA    1 
ATOM   3988 C  C     . LEU C 3 33  ? -45.334 -13.579 1.723   1.00 43.84 ? 26  LEU B C     1 
ATOM   3989 O  O     . LEU C 3 33  ? -46.038 -12.660 1.296   1.00 43.82 ? 26  LEU B O     1 
ATOM   3990 C  CB    . LEU C 3 33  ? -44.295 -12.850 3.892   1.00 44.07 ? 26  LEU B CB    1 
ATOM   3991 C  CG    . LEU C 3 33  ? -44.092 -13.828 5.059   1.00 44.47 ? 26  LEU B CG    1 
ATOM   3992 C  CD1   . LEU C 3 33  ? -45.164 -14.919 5.115   1.00 44.98 ? 26  LEU B CD1   1 
ATOM   3993 C  CD2   . LEU C 3 33  ? -42.693 -14.437 5.042   1.00 44.90 ? 26  LEU B CD2   1 
ATOM   3994 N  N     . ASN C 3 34  ? -45.630 -14.868 1.568   1.00 43.70 ? 27  ASN B N     1 
ATOM   3995 C  CA    . ASN C 3 34  ? -46.874 -15.351 0.952   1.00 43.59 ? 27  ASN B CA    1 
ATOM   3996 C  C     . ASN C 3 34  ? -46.941 -15.301 -0.581  1.00 43.51 ? 27  ASN B C     1 
ATOM   3997 O  O     . ASN C 3 34  ? -48.012 -15.493 -1.164  1.00 43.54 ? 27  ASN B O     1 
ATOM   3998 C  CB    . ASN C 3 34  ? -48.113 -14.695 1.588   1.00 43.64 ? 27  ASN B CB    1 
ATOM   3999 C  CG    . ASN C 3 34  ? -48.282 -15.057 3.057   1.00 43.67 ? 27  ASN B CG    1 
ATOM   4000 O  OD1   . ASN C 3 34  ? -47.858 -16.124 3.504   1.00 43.58 ? 27  ASN B OD1   1 
ATOM   4001 N  ND2   . ASN C 3 34  ? -48.915 -14.166 3.813   1.00 43.92 ? 27  ASN B ND2   1 
ATOM   4002 N  N     . ASP C 3 35  ? -45.800 -15.055 -1.224  1.00 43.39 ? 28  ASP B N     1 
ATOM   4003 C  CA    . ASP C 3 35  ? -45.706 -15.071 -2.685  1.00 43.25 ? 28  ASP B CA    1 
ATOM   4004 C  C     . ASP C 3 35  ? -45.901 -16.480 -3.239  1.00 43.14 ? 28  ASP B C     1 
ATOM   4005 O  O     . ASP C 3 35  ? -45.331 -17.445 -2.718  1.00 43.22 ? 28  ASP B O     1 
ATOM   4006 C  CB    . ASP C 3 35  ? -44.358 -14.508 -3.152  1.00 43.30 ? 28  ASP B CB    1 
ATOM   4007 C  CG    . ASP C 3 35  ? -44.360 -12.989 -3.276  1.00 43.52 ? 28  ASP B CG    1 
ATOM   4008 O  OD1   . ASP C 3 35  ? -43.260 -12.398 -3.326  1.00 43.77 ? 28  ASP B OD1   1 
ATOM   4009 O  OD2   . ASP C 3 35  ? -45.451 -12.380 -3.328  1.00 43.77 ? 28  ASP B OD2   1 
ATOM   4010 N  N     . ARG C 3 36  ? -46.715 -16.587 -4.287  1.00 42.88 ? 29  ARG B N     1 
ATOM   4011 C  CA    . ARG C 3 36  ? -47.013 -17.872 -4.921  1.00 42.65 ? 29  ARG B CA    1 
ATOM   4012 C  C     . ARG C 3 36  ? -45.830 -18.358 -5.745  1.00 42.36 ? 29  ARG B C     1 
ATOM   4013 O  O     . ARG C 3 36  ? -45.202 -17.582 -6.465  1.00 42.36 ? 29  ARG B O     1 
ATOM   4014 C  CB    . ARG C 3 36  ? -48.264 -17.774 -5.800  1.00 42.63 ? 29  ARG B CB    1 
ATOM   4015 C  CG    . ARG C 3 36  ? -49.570 -17.726 -5.025  1.00 42.72 ? 29  ARG B CG    1 
ATOM   4016 C  CD    . ARG C 3 36  ? -50.772 -17.548 -5.949  1.00 43.03 ? 29  ARG B CD    1 
ATOM   4017 N  NE    . ARG C 3 36  ? -51.045 -18.734 -6.764  1.00 43.69 ? 29  ARG B NE    1 
ATOM   4018 C  CZ    . ARG C 3 36  ? -51.802 -19.760 -6.379  1.00 44.02 ? 29  ARG B CZ    1 
ATOM   4019 N  NH1   . ARG C 3 36  ? -52.372 -19.769 -5.180  1.00 43.94 ? 29  ARG B NH1   1 
ATOM   4020 N  NH2   . ARG C 3 36  ? -51.990 -20.786 -7.200  1.00 44.33 ? 29  ARG B NH2   1 
ATOM   4021 N  N     . VAL C 3 37  ? -45.537 -19.649 -5.631  1.00 42.02 ? 30  VAL B N     1 
ATOM   4022 C  CA    . VAL C 3 37  ? -44.382 -20.240 -6.295  1.00 41.71 ? 30  VAL B CA    1 
ATOM   4023 C  C     . VAL C 3 37  ? -44.821 -21.313 -7.291  1.00 41.53 ? 30  VAL B C     1 
ATOM   4024 O  O     . VAL C 3 37  ? -45.586 -22.219 -6.949  1.00 41.48 ? 30  VAL B O     1 
ATOM   4025 C  CB    . VAL C 3 37  ? -43.359 -20.804 -5.266  1.00 41.75 ? 30  VAL B CB    1 
ATOM   4026 C  CG1   . VAL C 3 37  ? -42.148 -21.383 -5.963  1.00 41.68 ? 30  VAL B CG1   1 
ATOM   4027 C  CG2   . VAL C 3 37  ? -42.926 -19.713 -4.298  1.00 41.37 ? 30  VAL B CG2   1 
ATOM   4028 N  N     . VAL C 3 38  ? -44.341 -21.184 -8.526  1.00 41.30 ? 31  VAL B N     1 
ATOM   4029 C  CA    . VAL C 3 38  ? -44.659 -22.117 -9.609  1.00 41.09 ? 31  VAL B CA    1 
ATOM   4030 C  C     . VAL C 3 38  ? -43.379 -22.632 -10.272 1.00 41.14 ? 31  VAL B C     1 
ATOM   4031 O  O     . VAL C 3 38  ? -42.286 -22.145 -9.981  1.00 41.07 ? 31  VAL B O     1 
ATOM   4032 C  CB    . VAL C 3 38  ? -45.573 -21.461 -10.691 1.00 41.06 ? 31  VAL B CB    1 
ATOM   4033 C  CG1   . VAL C 3 38  ? -46.933 -21.080 -10.109 1.00 40.81 ? 31  VAL B CG1   1 
ATOM   4034 C  CG2   . VAL C 3 38  ? -44.892 -20.245 -11.337 1.00 40.75 ? 31  VAL B CG2   1 
ATOM   4035 N  N     . ASP C 3 39  ? -43.520 -23.622 -11.152 1.00 41.15 ? 32  ASP B N     1 
ATOM   4036 C  CA    . ASP C 3 39  ? -42.420 -24.052 -12.018 1.00 41.07 ? 32  ASP B CA    1 
ATOM   4037 C  C     . ASP C 3 39  ? -42.511 -23.346 -13.377 1.00 40.93 ? 32  ASP B C     1 
ATOM   4038 O  O     . ASP C 3 39  ? -43.375 -22.486 -13.570 1.00 40.82 ? 32  ASP B O     1 
ATOM   4039 C  CB    . ASP C 3 39  ? -42.400 -25.583 -12.172 1.00 41.18 ? 32  ASP B CB    1 
ATOM   4040 C  CG    . ASP C 3 39  ? -43.669 -26.141 -12.811 1.00 41.35 ? 32  ASP B CG    1 
ATOM   4041 O  OD1   . ASP C 3 39  ? -43.807 -27.382 -12.847 1.00 42.04 ? 32  ASP B OD1   1 
ATOM   4042 O  OD2   . ASP C 3 39  ? -44.525 -25.362 -13.280 1.00 41.90 ? 32  ASP B OD2   1 
ATOM   4043 N  N     . LYS C 3 40  ? -41.636 -23.717 -14.312 1.00 40.80 ? 33  LYS B N     1 
ATOM   4044 C  CA    . LYS C 3 40  ? -41.584 -23.091 -15.643 1.00 40.75 ? 33  LYS B CA    1 
ATOM   4045 C  C     . LYS C 3 40  ? -42.866 -23.274 -16.475 1.00 40.73 ? 33  LYS B C     1 
ATOM   4046 O  O     . LYS C 3 40  ? -43.107 -22.529 -17.426 1.00 40.62 ? 33  LYS B O     1 
ATOM   4047 C  CB    . LYS C 3 40  ? -40.359 -23.580 -16.429 1.00 40.70 ? 33  LYS B CB    1 
ATOM   4048 C  CG    . LYS C 3 40  ? -40.451 -25.023 -16.927 1.00 40.77 ? 33  LYS B CG    1 
ATOM   4049 C  CD    . LYS C 3 40  ? -39.293 -25.387 -17.844 1.00 40.77 ? 33  LYS B CD    1 
ATOM   4050 C  CE    . LYS C 3 40  ? -38.097 -25.886 -17.052 1.00 41.05 ? 33  LYS B CE    1 
ATOM   4051 N  NZ    . LYS C 3 40  ? -37.005 -26.362 -17.939 1.00 41.39 ? 33  LYS B NZ    1 
ATOM   4052 N  N     . ARG C 3 41  ? -43.673 -24.267 -16.106 1.00 40.76 ? 34  ARG B N     1 
ATOM   4053 C  CA    . ARG C 3 41  ? -44.918 -24.574 -16.811 1.00 40.93 ? 34  ARG B CA    1 
ATOM   4054 C  C     . ARG C 3 41  ? -46.139 -24.019 -16.068 1.00 40.72 ? 34  ARG B C     1 
ATOM   4055 O  O     . ARG C 3 41  ? -47.277 -24.413 -16.339 1.00 40.63 ? 34  ARG B O     1 
ATOM   4056 C  CB    . ARG C 3 41  ? -45.042 -26.087 -17.034 1.00 41.05 ? 34  ARG B CB    1 
ATOM   4057 C  CG    . ARG C 3 41  ? -43.847 -26.689 -17.767 1.00 42.01 ? 34  ARG B CG    1 
ATOM   4058 C  CD    . ARG C 3 41  ? -43.837 -28.207 -17.713 1.00 43.60 ? 34  ARG B CD    1 
ATOM   4059 N  NE    . ARG C 3 41  ? -42.489 -28.739 -17.922 1.00 44.61 ? 34  ARG B NE    1 
ATOM   4060 C  CZ    . ARG C 3 41  ? -42.214 -29.979 -18.322 1.00 45.18 ? 34  ARG B CZ    1 
ATOM   4061 N  NH1   . ARG C 3 41  ? -43.191 -30.843 -18.574 1.00 45.06 ? 34  ARG B NH1   1 
ATOM   4062 N  NH2   . ARG C 3 41  ? -40.951 -30.355 -18.477 1.00 45.48 ? 34  ARG B NH2   1 
ATOM   4063 N  N     . LEU C 3 42  ? -45.874 -23.098 -15.138 1.00 40.55 ? 35  LEU B N     1 
ATOM   4064 C  CA    . LEU C 3 42  ? -46.894 -22.405 -14.332 1.00 40.40 ? 35  LEU B CA    1 
ATOM   4065 C  C     . LEU C 3 42  ? -47.713 -23.299 -13.396 1.00 40.33 ? 35  LEU B C     1 
ATOM   4066 O  O     . LEU C 3 42  ? -48.780 -22.898 -12.919 1.00 40.24 ? 35  LEU B O     1 
ATOM   4067 C  CB    . LEU C 3 42  ? -47.816 -21.539 -15.209 1.00 40.37 ? 35  LEU B CB    1 
ATOM   4068 C  CG    . LEU C 3 42  ? -47.255 -20.228 -15.772 1.00 40.35 ? 35  LEU B CG    1 
ATOM   4069 C  CD1   . LEU C 3 42  ? -48.250 -19.605 -16.733 1.00 40.09 ? 35  LEU B CD1   1 
ATOM   4070 C  CD2   . LEU C 3 42  ? -46.891 -19.243 -14.659 1.00 40.26 ? 35  LEU B CD2   1 
ATOM   4071 N  N     . GLN C 3 43  ? -47.209 -24.500 -13.126 1.00 40.23 ? 36  GLN B N     1 
ATOM   4072 C  CA    . GLN C 3 43  ? -47.876 -25.412 -12.199 1.00 40.27 ? 36  GLN B CA    1 
ATOM   4073 C  C     . GLN C 3 43  ? -47.549 -25.031 -10.761 1.00 40.14 ? 36  GLN B C     1 
ATOM   4074 O  O     . GLN C 3 43  ? -46.381 -24.868 -10.407 1.00 40.14 ? 36  GLN B O     1 
ATOM   4075 C  CB    . GLN C 3 43  ? -47.506 -26.871 -12.483 1.00 40.30 ? 36  GLN B CB    1 
ATOM   4076 C  CG    . GLN C 3 43  ? -48.154 -27.441 -13.746 1.00 40.46 ? 36  GLN B CG    1 
ATOM   4077 C  CD    . GLN C 3 43  ? -48.463 -28.929 -13.647 1.00 40.95 ? 36  GLN B CD    1 
ATOM   4078 O  OE1   . GLN C 3 43  ? -49.375 -29.426 -14.311 1.00 41.21 ? 36  GLN B OE1   1 
ATOM   4079 N  NE2   . GLN C 3 43  ? -47.710 -29.644 -12.816 1.00 41.07 ? 36  GLN B NE2   1 
ATOM   4080 N  N     . PHE C 3 44  ? -48.589 -24.884 -9.945  1.00 40.06 ? 37  PHE B N     1 
ATOM   4081 C  CA    . PHE C 3 44  ? -48.444 -24.395 -8.575  1.00 40.01 ? 37  PHE B CA    1 
ATOM   4082 C  C     . PHE C 3 44  ? -47.630 -25.342 -7.695  1.00 39.95 ? 37  PHE B C     1 
ATOM   4083 O  O     . PHE C 3 44  ? -47.902 -26.542 -7.635  1.00 39.90 ? 37  PHE B O     1 
ATOM   4084 C  CB    . PHE C 3 44  ? -49.817 -24.107 -7.956  1.00 39.96 ? 37  PHE B CB    1 
ATOM   4085 C  CG    . PHE C 3 44  ? -49.754 -23.540 -6.565  1.00 39.92 ? 37  PHE B CG    1 
ATOM   4086 C  CD1   . PHE C 3 44  ? -50.278 -24.251 -5.490  1.00 40.02 ? 37  PHE B CD1   1 
ATOM   4087 C  CD2   . PHE C 3 44  ? -49.172 -22.298 -6.327  1.00 39.89 ? 37  PHE B CD2   1 
ATOM   4088 C  CE1   . PHE C 3 44  ? -50.227 -23.733 -4.200  1.00 39.97 ? 37  PHE B CE1   1 
ATOM   4089 C  CE2   . PHE C 3 44  ? -49.114 -21.773 -5.040  1.00 39.88 ? 37  PHE B CE2   1 
ATOM   4090 C  CZ    . PHE C 3 44  ? -49.642 -22.492 -3.974  1.00 39.94 ? 37  PHE B CZ    1 
ATOM   4091 N  N     . VAL C 3 45  ? -46.624 -24.787 -7.025  1.00 39.97 ? 38  VAL B N     1 
ATOM   4092 C  CA    . VAL C 3 45  ? -45.716 -25.571 -6.191  1.00 40.04 ? 38  VAL B CA    1 
ATOM   4093 C  C     . VAL C 3 45  ? -45.936 -25.275 -4.707  1.00 40.09 ? 38  VAL B C     1 
ATOM   4094 O  O     . VAL C 3 45  ? -46.193 -26.190 -3.920  1.00 40.12 ? 38  VAL B O     1 
ATOM   4095 C  CB    . VAL C 3 45  ? -44.232 -25.345 -6.590  1.00 40.00 ? 38  VAL B CB    1 
ATOM   4096 C  CG1   . VAL C 3 45  ? -43.285 -26.056 -5.625  1.00 40.13 ? 38  VAL B CG1   1 
ATOM   4097 C  CG2   . VAL C 3 45  ? -43.989 -25.819 -8.013  1.00 39.92 ? 38  VAL B CG2   1 
ATOM   4098 N  N     . GLY C 3 46  ? -45.843 -24.001 -4.333  1.00 40.05 ? 39  GLY B N     1 
ATOM   4099 C  CA    . GLY C 3 46  ? -46.011 -23.607 -2.940  1.00 40.09 ? 39  GLY B CA    1 
ATOM   4100 C  C     . GLY C 3 46  ? -45.989 -22.115 -2.671  1.00 40.21 ? 39  GLY B C     1 
ATOM   4101 O  O     . GLY C 3 46  ? -46.250 -21.302 -3.560  1.00 40.06 ? 39  GLY B O     1 
ATOM   4102 N  N     . ILE C 3 47  ? -45.661 -21.770 -1.429  1.00 40.41 ? 40  ILE B N     1 
ATOM   4103 C  CA    . ILE C 3 47  ? -45.755 -20.400 -0.928  1.00 40.63 ? 40  ILE B CA    1 
ATOM   4104 C  C     . ILE C 3 47  ? -44.494 -20.011 -0.139  1.00 40.76 ? 40  ILE B C     1 
ATOM   4105 O  O     . ILE C 3 47  ? -43.968 -20.815 0.635   1.00 40.79 ? 40  ILE B O     1 
ATOM   4106 C  CB    . ILE C 3 47  ? -47.059 -20.220 -0.082  1.00 40.59 ? 40  ILE B CB    1 
ATOM   4107 C  CG1   . ILE C 3 47  ? -47.137 -18.835 0.560   1.00 40.48 ? 40  ILE B CG1   1 
ATOM   4108 C  CG2   . ILE C 3 47  ? -47.203 -21.334 0.967   1.00 40.97 ? 40  ILE B CG2   1 
ATOM   4109 C  CD1   . ILE C 3 47  ? -48.509 -18.497 1.121   1.00 40.79 ? 40  ILE B CD1   1 
ATOM   4110 N  N     . VAL C 3 48  ? -44.010 -18.787 -0.357  1.00 40.87 ? 41  VAL B N     1 
ATOM   4111 C  CA    . VAL C 3 48  ? -42.833 -18.261 0.347   1.00 40.91 ? 41  VAL B CA    1 
ATOM   4112 C  C     . VAL C 3 48  ? -43.173 -17.972 1.807   1.00 40.99 ? 41  VAL B C     1 
ATOM   4113 O  O     . VAL C 3 48  ? -44.081 -17.189 2.093   1.00 40.97 ? 41  VAL B O     1 
ATOM   4114 C  CB    . VAL C 3 48  ? -42.286 -16.965 -0.316  1.00 40.88 ? 41  VAL B CB    1 
ATOM   4115 C  CG1   . VAL C 3 48  ? -41.144 -16.372 0.502   1.00 40.77 ? 41  VAL B CG1   1 
ATOM   4116 C  CG2   . VAL C 3 48  ? -41.833 -17.231 -1.742  1.00 40.88 ? 41  VAL B CG2   1 
ATOM   4117 N  N     . LYS C 3 49  ? -42.434 -18.599 2.722   1.00 41.17 ? 42  LYS B N     1 
ATOM   4118 C  CA    . LYS C 3 49  ? -42.687 -18.442 4.157   1.00 41.37 ? 42  LYS B CA    1 
ATOM   4119 C  C     . LYS C 3 49  ? -41.524 -17.843 4.948   1.00 41.35 ? 42  LYS B C     1 
ATOM   4120 O  O     . LYS C 3 49  ? -41.698 -17.450 6.105   1.00 41.43 ? 42  LYS B O     1 
ATOM   4121 C  CB    . LYS C 3 49  ? -43.141 -19.768 4.779   1.00 41.35 ? 42  LYS B CB    1 
ATOM   4122 C  CG    . LYS C 3 49  ? -44.604 -20.103 4.519   1.00 41.86 ? 42  LYS B CG    1 
ATOM   4123 C  CD    . LYS C 3 49  ? -45.546 -19.165 5.273   1.00 42.67 ? 42  LYS B CD    1 
ATOM   4124 C  CE    . LYS C 3 49  ? -47.000 -19.401 4.893   1.00 43.09 ? 42  LYS B CE    1 
ATOM   4125 N  NZ    . LYS C 3 49  ? -47.514 -20.700 5.408   1.00 43.94 ? 42  LYS B NZ    1 
ATOM   4126 N  N     . ASP C 3 50  ? -40.349 -17.769 4.328   1.00 41.31 ? 43  ASP B N     1 
ATOM   4127 C  CA    . ASP C 3 50  ? -39.206 -17.088 4.933   1.00 41.34 ? 43  ASP B CA    1 
ATOM   4128 C  C     . ASP C 3 50  ? -38.147 -16.711 3.907   1.00 41.41 ? 43  ASP B C     1 
ATOM   4129 O  O     . ASP C 3 50  ? -37.903 -17.440 2.948   1.00 41.47 ? 43  ASP B O     1 
ATOM   4130 C  CB    . ASP C 3 50  ? -38.575 -17.937 6.045   1.00 41.34 ? 43  ASP B CB    1 
ATOM   4131 C  CG    . ASP C 3 50  ? -37.847 -17.096 7.088   1.00 41.38 ? 43  ASP B CG    1 
ATOM   4132 O  OD1   . ASP C 3 50  ? -37.284 -17.689 8.028   1.00 41.43 ? 43  ASP B OD1   1 
ATOM   4133 O  OD2   . ASP C 3 50  ? -37.837 -15.847 6.979   1.00 41.85 ? 43  ASP B OD2   1 
ATOM   4134 N  N     . VAL C 3 51  ? -37.533 -15.552 4.125   1.00 41.54 ? 44  VAL B N     1 
ATOM   4135 C  CA    . VAL C 3 51  ? -36.412 -15.080 3.318   1.00 41.48 ? 44  VAL B CA    1 
ATOM   4136 C  C     . VAL C 3 51  ? -35.297 -14.705 4.287   1.00 41.44 ? 44  VAL B C     1 
ATOM   4137 O  O     . VAL C 3 51  ? -35.501 -13.912 5.208   1.00 41.60 ? 44  VAL B O     1 
ATOM   4138 C  CB    . VAL C 3 51  ? -36.793 -13.859 2.436   1.00 41.51 ? 44  VAL B CB    1 
ATOM   4139 C  CG1   . VAL C 3 51  ? -35.662 -13.515 1.469   1.00 41.30 ? 44  VAL B CG1   1 
ATOM   4140 C  CG2   . VAL C 3 51  ? -38.079 -14.125 1.662   1.00 41.46 ? 44  VAL B CG2   1 
ATOM   4141 N  N     . PHE C 3 52  ? -34.124 -15.293 4.081   1.00 41.37 ? 45  PHE B N     1 
ATOM   4142 C  CA    . PHE C 3 52  ? -33.013 -15.156 5.018   1.00 41.20 ? 45  PHE B CA    1 
ATOM   4143 C  C     . PHE C 3 52  ? -31.661 -15.244 4.308   1.00 41.20 ? 45  PHE B C     1 
ATOM   4144 O  O     . PHE C 3 52  ? -31.603 -15.444 3.096   1.00 41.10 ? 45  PHE B O     1 
ATOM   4145 C  CB    . PHE C 3 52  ? -33.120 -16.209 6.132   1.00 41.15 ? 45  PHE B CB    1 
ATOM   4146 C  CG    . PHE C 3 52  ? -33.215 -17.632 5.632   1.00 41.16 ? 45  PHE B CG    1 
ATOM   4147 C  CD1   . PHE C 3 52  ? -34.431 -18.156 5.201   1.00 40.89 ? 45  PHE B CD1   1 
ATOM   4148 C  CD2   . PHE C 3 52  ? -32.089 -18.450 5.605   1.00 41.09 ? 45  PHE B CD2   1 
ATOM   4149 C  CE1   . PHE C 3 52  ? -34.521 -19.469 4.738   1.00 41.59 ? 45  PHE B CE1   1 
ATOM   4150 C  CE2   . PHE C 3 52  ? -32.172 -19.768 5.155   1.00 41.36 ? 45  PHE B CE2   1 
ATOM   4151 C  CZ    . PHE C 3 52  ? -33.390 -20.278 4.718   1.00 41.18 ? 45  PHE B CZ    1 
ATOM   4152 N  N     . GLY C 3 53  ? -30.582 -15.086 5.072   1.00 41.25 ? 46  GLY B N     1 
ATOM   4153 C  CA    . GLY C 3 53  ? -29.232 -15.085 4.520   1.00 41.28 ? 46  GLY B CA    1 
ATOM   4154 C  C     . GLY C 3 53  ? -28.843 -13.733 3.946   1.00 41.39 ? 46  GLY B C     1 
ATOM   4155 O  O     . GLY C 3 53  ? -29.481 -12.724 4.256   1.00 41.21 ? 46  GLY B O     1 
ATOM   4156 N  N     . PRO C 3 54  ? -27.809 -13.710 3.078   1.00 41.57 ? 47  PRO B N     1 
ATOM   4157 C  CA    . PRO C 3 54  ? -27.245 -12.462 2.546   1.00 41.67 ? 47  PRO B CA    1 
ATOM   4158 C  C     . PRO C 3 54  ? -28.275 -11.670 1.751   1.00 41.83 ? 47  PRO B C     1 
ATOM   4159 O  O     . PRO C 3 54  ? -29.026 -12.248 0.968   1.00 41.69 ? 47  PRO B O     1 
ATOM   4160 C  CB    . PRO C 3 54  ? -26.127 -12.939 1.611   1.00 41.77 ? 47  PRO B CB    1 
ATOM   4161 C  CG    . PRO C 3 54  ? -25.884 -14.358 1.955   1.00 41.52 ? 47  PRO B CG    1 
ATOM   4162 C  CD    . PRO C 3 54  ? -27.141 -14.902 2.526   1.00 41.46 ? 47  PRO B CD    1 
ATOM   4163 N  N     . VAL C 3 55  ? -28.306 -10.357 1.959   1.00 42.08 ? 48  VAL B N     1 
ATOM   4164 C  CA    . VAL C 3 55  ? -29.258 -9.483  1.270   1.00 42.41 ? 48  VAL B CA    1 
ATOM   4165 C  C     . VAL C 3 55  ? -29.135 -9.575  -0.263  1.00 42.60 ? 48  VAL B C     1 
ATOM   4166 O  O     . VAL C 3 55  ? -30.143 -9.560  -0.970  1.00 42.66 ? 48  VAL B O     1 
ATOM   4167 C  CB    . VAL C 3 55  ? -29.169 -8.008  1.784   1.00 42.36 ? 48  VAL B CB    1 
ATOM   4168 C  CG1   . VAL C 3 55  ? -27.771 -7.424  1.581   1.00 42.53 ? 48  VAL B CG1   1 
ATOM   4169 C  CG2   . VAL C 3 55  ? -30.232 -7.131  1.132   1.00 42.44 ? 48  VAL B CG2   1 
ATOM   4170 N  N     . LYS C 3 56  ? -27.904 -9.698  -0.759  1.00 42.87 ? 49  LYS B N     1 
ATOM   4171 C  CA    . LYS C 3 56  ? -27.646 -9.759  -2.200  1.00 43.24 ? 49  LYS B CA    1 
ATOM   4172 C  C     . LYS C 3 56  ? -27.892 -11.139 -2.817  1.00 43.35 ? 49  LYS B C     1 
ATOM   4173 O  O     . LYS C 3 56  ? -28.191 -11.240 -4.009  1.00 43.30 ? 49  LYS B O     1 
ATOM   4174 C  CB    . LYS C 3 56  ? -26.225 -9.277  -2.523  1.00 43.27 ? 49  LYS B CB    1 
ATOM   4175 C  CG    . LYS C 3 56  ? -25.920 -7.842  -2.085  1.00 43.67 ? 49  LYS B CG    1 
ATOM   4176 C  CD    . LYS C 3 56  ? -26.863 -6.834  -2.731  1.00 44.26 ? 49  LYS B CD    1 
ATOM   4177 C  CE    . LYS C 3 56  ? -26.745 -5.471  -2.075  1.00 44.53 ? 49  LYS B CE    1 
ATOM   4178 N  NZ    . LYS C 3 56  ? -27.830 -4.563  -2.532  1.00 45.14 ? 49  LYS B NZ    1 
ATOM   4179 N  N     . MET C 3 57  ? -27.762 -12.190 -2.006  1.00 43.51 ? 50  MET B N     1 
ATOM   4180 C  CA    . MET C 3 57  ? -27.978 -13.564 -2.465  1.00 43.76 ? 50  MET B CA    1 
ATOM   4181 C  C     . MET C 3 57  ? -28.715 -14.395 -1.399  1.00 43.51 ? 50  MET B C     1 
ATOM   4182 O  O     . MET C 3 57  ? -28.126 -15.289 -0.785  1.00 43.48 ? 50  MET B O     1 
ATOM   4183 C  CB    . MET C 3 57  ? -26.640 -14.213 -2.838  1.00 44.21 ? 50  MET B CB    1 
ATOM   4184 C  CG    . MET C 3 57  ? -26.746 -15.355 -3.835  1.00 45.20 ? 50  MET B CG    1 
ATOM   4185 S  SD    . MET C 3 57  ? -26.847 -14.793 -5.549  1.00 48.63 ? 50  MET B SD    1 
ATOM   4186 C  CE    . MET C 3 57  ? -27.622 -16.221 -6.310  1.00 46.45 ? 50  MET B CE    1 
ATOM   4187 N  N     . PRO C 3 58  ? -30.010 -14.099 -1.172  1.00 43.26 ? 51  PRO B N     1 
ATOM   4188 C  CA    . PRO C 3 58  ? -30.723 -14.736 -0.062  1.00 43.01 ? 51  PRO B CA    1 
ATOM   4189 C  C     . PRO C 3 58  ? -31.223 -16.158 -0.307  1.00 42.82 ? 51  PRO B C     1 
ATOM   4190 O  O     . PRO C 3 58  ? -31.349 -16.600 -1.451  1.00 42.65 ? 51  PRO B O     1 
ATOM   4191 C  CB    . PRO C 3 58  ? -31.910 -13.795 0.174   1.00 43.03 ? 51  PRO B CB    1 
ATOM   4192 C  CG    . PRO C 3 58  ? -32.155 -13.147 -1.132  1.00 43.14 ? 51  PRO B CG    1 
ATOM   4193 C  CD    . PRO C 3 58  ? -30.866 -13.147 -1.907  1.00 43.23 ? 51  PRO B CD    1 
ATOM   4194 N  N     . TYR C 3 59  ? -31.484 -16.861 0.791   1.00 42.64 ? 52  TYR B N     1 
ATOM   4195 C  CA    . TYR C 3 59  ? -32.171 -18.142 0.767   1.00 42.62 ? 52  TYR B CA    1 
ATOM   4196 C  C     . TYR C 3 59  ? -33.666 -17.903 0.945   1.00 42.66 ? 52  TYR B C     1 
ATOM   4197 O  O     . TYR C 3 59  ? -34.077 -16.988 1.663   1.00 42.59 ? 52  TYR B O     1 
ATOM   4198 C  CB    . TYR C 3 59  ? -31.666 -19.046 1.890   1.00 42.45 ? 52  TYR B CB    1 
ATOM   4199 C  CG    . TYR C 3 59  ? -30.287 -19.629 1.682   1.00 42.23 ? 52  TYR B CG    1 
ATOM   4200 C  CD1   . TYR C 3 59  ? -29.147 -18.961 2.133   1.00 42.25 ? 52  TYR B CD1   1 
ATOM   4201 C  CD2   . TYR C 3 59  ? -30.122 -20.858 1.048   1.00 41.67 ? 52  TYR B CD2   1 
ATOM   4202 C  CE1   . TYR C 3 59  ? -27.874 -19.503 1.947   1.00 42.27 ? 52  TYR B CE1   1 
ATOM   4203 C  CE2   . TYR C 3 59  ? -28.859 -21.407 0.856   1.00 41.91 ? 52  TYR B CE2   1 
ATOM   4204 C  CZ    . TYR C 3 59  ? -27.741 -20.729 1.309   1.00 42.34 ? 52  TYR B CZ    1 
ATOM   4205 O  OH    . TYR C 3 59  ? -26.494 -21.280 1.117   1.00 42.65 ? 52  TYR B OH    1 
ATOM   4206 N  N     . VAL C 3 60  ? -34.474 -18.725 0.283   1.00 42.76 ? 53  VAL B N     1 
ATOM   4207 C  CA    . VAL C 3 60  ? -35.928 -18.631 0.385   1.00 42.76 ? 53  VAL B CA    1 
ATOM   4208 C  C     . VAL C 3 60  ? -36.496 -19.978 0.821   1.00 42.89 ? 53  VAL B C     1 
ATOM   4209 O  O     . VAL C 3 60  ? -36.210 -21.009 0.206   1.00 42.69 ? 53  VAL B O     1 
ATOM   4210 C  CB    . VAL C 3 60  ? -36.577 -18.180 -0.958  1.00 42.80 ? 53  VAL B CB    1 
ATOM   4211 C  CG1   . VAL C 3 60  ? -38.073 -18.009 -0.803  1.00 42.73 ? 53  VAL B CG1   1 
ATOM   4212 C  CG2   . VAL C 3 60  ? -35.966 -16.871 -1.445  1.00 42.66 ? 53  VAL B CG2   1 
ATOM   4213 N  N     . ALA C 3 61  ? -37.283 -19.963 1.896   1.00 43.06 ? 54  ALA B N     1 
ATOM   4214 C  CA    . ALA C 3 61  ? -37.976 -21.157 2.365   1.00 43.28 ? 54  ALA B CA    1 
ATOM   4215 C  C     . ALA C 3 61  ? -39.394 -21.191 1.800   1.00 43.47 ? 54  ALA B C     1 
ATOM   4216 O  O     . ALA C 3 61  ? -40.212 -20.309 2.084   1.00 43.45 ? 54  ALA B O     1 
ATOM   4217 C  CB    . ALA C 3 61  ? -37.994 -21.211 3.891   1.00 43.13 ? 54  ALA B CB    1 
ATOM   4218 N  N     . ILE C 3 62  ? -39.667 -22.209 0.988   1.00 43.67 ? 55  ILE B N     1 
ATOM   4219 C  CA    . ILE C 3 62  ? -40.957 -22.356 0.322   1.00 43.99 ? 55  ILE B CA    1 
ATOM   4220 C  C     . ILE C 3 62  ? -41.765 -23.474 0.974   1.00 43.99 ? 55  ILE B C     1 
ATOM   4221 O  O     . ILE C 3 62  ? -41.357 -24.636 0.949   1.00 43.91 ? 55  ILE B O     1 
ATOM   4222 C  CB    . ILE C 3 62  ? -40.804 -22.696 -1.194  1.00 43.98 ? 55  ILE B CB    1 
ATOM   4223 C  CG1   . ILE C 3 62  ? -39.688 -21.875 -1.862  1.00 44.41 ? 55  ILE B CG1   1 
ATOM   4224 C  CG2   . ILE C 3 62  ? -42.156 -22.589 -1.920  1.00 43.87 ? 55  ILE B CG2   1 
ATOM   4225 C  CD1   . ILE C 3 62  ? -40.076 -20.480 -2.289  1.00 45.29 ? 55  ILE B CD1   1 
ATOM   4226 N  N     . LYS C 3 63  ? -42.906 -23.113 1.555   1.00 44.19 ? 56  LYS B N     1 
ATOM   4227 C  CA    . LYS C 3 63  ? -43.852 -24.094 2.076   1.00 44.47 ? 56  LYS B CA    1 
ATOM   4228 C  C     . LYS C 3 63  ? -44.567 -24.762 0.902   1.00 44.62 ? 56  LYS B C     1 
ATOM   4229 O  O     . LYS C 3 63  ? -45.280 -24.092 0.151   1.00 44.54 ? 56  LYS B O     1 
ATOM   4230 C  CB    . LYS C 3 63  ? -44.857 -23.431 3.025   1.00 44.45 ? 56  LYS B CB    1 
ATOM   4231 C  CG    . LYS C 3 63  ? -46.011 -24.321 3.484   1.00 44.72 ? 56  LYS B CG    1 
ATOM   4232 C  CD    . LYS C 3 63  ? -45.591 -25.298 4.571   1.00 45.28 ? 56  LYS B CD    1 
ATOM   4233 C  CE    . LYS C 3 63  ? -46.774 -26.131 5.042   1.00 45.78 ? 56  LYS B CE    1 
ATOM   4234 N  NZ    . LYS C 3 63  ? -46.384 -27.101 6.102   1.00 46.08 ? 56  LYS B NZ    1 
ATOM   4235 N  N     . PRO C 3 64  ? -44.375 -26.085 0.739   1.00 44.86 ? 57  PRO B N     1 
ATOM   4236 C  CA    . PRO C 3 64  ? -44.943 -26.795 -0.402  1.00 45.03 ? 57  PRO B CA    1 
ATOM   4237 C  C     . PRO C 3 64  ? -46.440 -27.016 -0.244  1.00 45.22 ? 57  PRO B C     1 
ATOM   4238 O  O     . PRO C 3 64  ? -46.933 -27.172 0.877   1.00 45.21 ? 57  PRO B O     1 
ATOM   4239 C  CB    . PRO C 3 64  ? -44.215 -28.148 -0.387  1.00 45.04 ? 57  PRO B CB    1 
ATOM   4240 C  CG    . PRO C 3 64  ? -43.191 -28.065 0.705   1.00 45.08 ? 57  PRO B CG    1 
ATOM   4241 C  CD    . PRO C 3 64  ? -43.638 -26.994 1.631   1.00 44.91 ? 57  PRO B CD    1 
ATOM   4242 N  N     . LYS C 3 65  ? -47.150 -27.020 -1.367  1.00 45.45 ? 58  LYS B N     1 
ATOM   4243 C  CA    . LYS C 3 65  ? -48.579 -27.313 -1.373  1.00 45.76 ? 58  LYS B CA    1 
ATOM   4244 C  C     . LYS C 3 65  ? -48.921 -28.404 -2.389  1.00 45.87 ? 58  LYS B C     1 
ATOM   4245 O  O     . LYS C 3 65  ? -50.068 -28.542 -2.820  1.00 45.95 ? 58  LYS B O     1 
ATOM   4246 C  CB    . LYS C 3 65  ? -49.388 -26.032 -1.587  1.00 45.75 ? 58  LYS B CB    1 
ATOM   4247 C  CG    . LYS C 3 65  ? -49.671 -25.297 -0.286  1.00 46.16 ? 58  LYS B CG    1 
ATOM   4248 C  CD    . LYS C 3 65  ? -50.031 -23.837 -0.506  1.00 46.80 ? 58  LYS B CD    1 
ATOM   4249 C  CE    . LYS C 3 65  ? -50.793 -23.267 0.691   1.00 47.15 ? 58  LYS B CE    1 
ATOM   4250 N  NZ    . LYS C 3 65  ? -50.059 -23.404 1.986   1.00 47.20 ? 58  LYS B NZ    1 
ATOM   4251 N  N     . VAL C 3 66  ? -47.901 -29.176 -2.755  1.00 46.06 ? 59  VAL B N     1 
ATOM   4252 C  CA    . VAL C 3 66  ? -48.060 -30.373 -3.577  1.00 46.30 ? 59  VAL B CA    1 
ATOM   4253 C  C     . VAL C 3 66  ? -47.837 -31.619 -2.718  1.00 46.41 ? 59  VAL B C     1 
ATOM   4254 O  O     . VAL C 3 66  ? -47.220 -31.537 -1.651  1.00 46.51 ? 59  VAL B O     1 
ATOM   4255 C  CB    . VAL C 3 66  ? -47.099 -30.378 -4.797  1.00 46.26 ? 59  VAL B CB    1 
ATOM   4256 C  CG1   . VAL C 3 66  ? -47.581 -29.404 -5.859  1.00 46.37 ? 59  VAL B CG1   1 
ATOM   4257 C  CG2   . VAL C 3 66  ? -45.662 -30.059 -4.375  1.00 46.41 ? 59  VAL B CG2   1 
ATOM   4258 N  N     . SER C 3 67  ? -48.341 -32.761 -3.184  1.00 46.52 ? 60  SER B N     1 
ATOM   4259 C  CA    . SER C 3 67  ? -48.273 -34.016 -2.429  1.00 46.65 ? 60  SER B CA    1 
ATOM   4260 C  C     . SER C 3 67  ? -46.840 -34.500 -2.196  1.00 46.69 ? 60  SER B C     1 
ATOM   4261 O  O     . SER C 3 67  ? -46.475 -34.846 -1.070  1.00 46.73 ? 60  SER B O     1 
ATOM   4262 C  CB    . SER C 3 67  ? -49.100 -35.106 -3.118  1.00 46.63 ? 60  SER B CB    1 
ATOM   4263 O  OG    . SER C 3 67  ? -48.616 -35.364 -4.425  1.00 46.78 ? 60  SER B OG    1 
ATOM   4264 N  N     . ASN C 3 68  ? -46.040 -34.520 -3.260  1.00 46.72 ? 61  ASN B N     1 
ATOM   4265 C  CA    . ASN C 3 68  ? -44.647 -34.955 -3.179  1.00 46.78 ? 61  ASN B CA    1 
ATOM   4266 C  C     . ASN C 3 68  ? -43.674 -33.828 -3.545  1.00 46.80 ? 61  ASN B C     1 
ATOM   4267 O  O     . ASN C 3 68  ? -43.315 -33.672 -4.714  1.00 46.88 ? 61  ASN B O     1 
ATOM   4268 C  CB    . ASN C 3 68  ? -44.412 -36.191 -4.060  1.00 46.80 ? 61  ASN B CB    1 
ATOM   4269 C  CG    . ASN C 3 68  ? -45.206 -37.408 -3.598  1.00 46.92 ? 61  ASN B CG    1 
ATOM   4270 O  OD1   . ASN C 3 68  ? -46.021 -37.949 -4.346  1.00 46.95 ? 61  ASN B OD1   1 
ATOM   4271 N  ND2   . ASN C 3 68  ? -44.968 -37.843 -2.363  1.00 47.13 ? 61  ASN B ND2   1 
ATOM   4272 N  N     . PRO C 3 69  ? -43.254 -33.029 -2.543  1.00 46.75 ? 62  PRO B N     1 
ATOM   4273 C  CA    . PRO C 3 69  ? -42.345 -31.900 -2.773  1.00 46.75 ? 62  PRO B CA    1 
ATOM   4274 C  C     . PRO C 3 69  ? -40.908 -32.312 -3.105  1.00 46.74 ? 62  PRO B C     1 
ATOM   4275 O  O     . PRO C 3 69  ? -40.154 -31.510 -3.658  1.00 46.75 ? 62  PRO B O     1 
ATOM   4276 C  CB    . PRO C 3 69  ? -42.381 -31.144 -1.442  1.00 46.68 ? 62  PRO B CB    1 
ATOM   4277 C  CG    . PRO C 3 69  ? -42.741 -32.166 -0.435  1.00 46.79 ? 62  PRO B CG    1 
ATOM   4278 C  CD    . PRO C 3 69  ? -43.637 -33.146 -1.124  1.00 46.76 ? 62  PRO B CD    1 
ATOM   4279 N  N     . GLU C 3 70  ? -40.545 -33.551 -2.773  1.00 46.79 ? 63  GLU B N     1 
ATOM   4280 C  CA    . GLU C 3 70  ? -39.191 -34.069 -2.998  1.00 46.79 ? 63  GLU B CA    1 
ATOM   4281 C  C     . GLU C 3 70  ? -38.780 -34.108 -4.475  1.00 46.64 ? 63  GLU B C     1 
ATOM   4282 O  O     . GLU C 3 70  ? -37.592 -34.058 -4.786  1.00 46.58 ? 63  GLU B O     1 
ATOM   4283 C  CB    . GLU C 3 70  ? -39.033 -35.466 -2.381  1.00 46.87 ? 63  GLU B CB    1 
ATOM   4284 C  CG    . GLU C 3 70  ? -39.082 -35.505 -0.853  1.00 47.30 ? 63  GLU B CG    1 
ATOM   4285 C  CD    . GLU C 3 70  ? -40.480 -35.753 -0.294  1.00 47.83 ? 63  GLU B CD    1 
ATOM   4286 O  OE1   . GLU C 3 70  ? -40.592 -35.980 0.931   1.00 47.80 ? 63  GLU B OE1   1 
ATOM   4287 O  OE2   . GLU C 3 70  ? -41.463 -35.727 -1.068  1.00 47.84 ? 63  GLU B OE2   1 
ATOM   4288 N  N     . ILE C 3 71  ? -39.759 -34.197 -5.374  1.00 46.50 ? 64  ILE B N     1 
ATOM   4289 C  CA    . ILE C 3 71  ? -39.484 -34.295 -6.814  1.00 46.36 ? 64  ILE B CA    1 
ATOM   4290 C  C     . ILE C 3 71  ? -38.988 -32.980 -7.421  1.00 46.21 ? 64  ILE B C     1 
ATOM   4291 O  O     . ILE C 3 71  ? -38.452 -32.964 -8.533  1.00 46.21 ? 64  ILE B O     1 
ATOM   4292 C  CB    . ILE C 3 71  ? -40.705 -34.833 -7.620  1.00 46.36 ? 64  ILE B CB    1 
ATOM   4293 C  CG1   . ILE C 3 71  ? -41.879 -33.845 -7.574  1.00 46.34 ? 64  ILE B CG1   1 
ATOM   4294 C  CG2   . ILE C 3 71  ? -41.110 -36.223 -7.121  1.00 46.34 ? 64  ILE B CG2   1 
ATOM   4295 C  CD1   . ILE C 3 71  ? -42.878 -34.009 -8.705  1.00 46.64 ? 64  ILE B CD1   1 
ATOM   4296 N  N     . TYR C 3 72  ? -39.162 -31.887 -6.681  1.00 46.04 ? 65  TYR B N     1 
ATOM   4297 C  CA    . TYR C 3 72  ? -38.757 -30.562 -7.146  1.00 45.84 ? 65  TYR B CA    1 
ATOM   4298 C  C     . TYR C 3 72  ? -37.313 -30.191 -6.795  1.00 45.66 ? 65  TYR B C     1 
ATOM   4299 O  O     . TYR C 3 72  ? -36.854 -29.104 -7.150  1.00 45.62 ? 65  TYR B O     1 
ATOM   4300 C  CB    . TYR C 3 72  ? -39.736 -29.491 -6.647  1.00 45.88 ? 65  TYR B CB    1 
ATOM   4301 C  CG    . TYR C 3 72  ? -41.094 -29.563 -7.309  1.00 46.02 ? 65  TYR B CG    1 
ATOM   4302 C  CD1   . TYR C 3 72  ? -41.326 -28.944 -8.540  1.00 46.12 ? 65  TYR B CD1   1 
ATOM   4303 C  CD2   . TYR C 3 72  ? -42.146 -30.253 -6.709  1.00 46.00 ? 65  TYR B CD2   1 
ATOM   4304 C  CE1   . TYR C 3 72  ? -42.576 -29.012 -9.156  1.00 46.08 ? 65  TYR B CE1   1 
ATOM   4305 C  CE2   . TYR C 3 72  ? -43.398 -30.326 -7.315  1.00 46.18 ? 65  TYR B CE2   1 
ATOM   4306 C  CZ    . TYR C 3 72  ? -43.605 -29.702 -8.536  1.00 46.08 ? 65  TYR B CZ    1 
ATOM   4307 O  OH    . TYR C 3 72  ? -44.842 -29.775 -9.136  1.00 46.35 ? 65  TYR B OH    1 
ATOM   4308 N  N     . VAL C 3 73  ? -36.598 -31.084 -6.111  1.00 45.42 ? 66  VAL B N     1 
ATOM   4309 C  CA    . VAL C 3 73  ? -35.175 -30.857 -5.828  1.00 45.36 ? 66  VAL B CA    1 
ATOM   4310 C  C     . VAL C 3 73  ? -34.360 -30.876 -7.125  1.00 45.18 ? 66  VAL B C     1 
ATOM   4311 O  O     . VAL C 3 73  ? -34.431 -31.831 -7.906  1.00 45.20 ? 66  VAL B O     1 
ATOM   4312 C  CB    . VAL C 3 73  ? -34.585 -31.843 -4.766  1.00 45.33 ? 66  VAL B CB    1 
ATOM   4313 C  CG1   . VAL C 3 73  ? -35.268 -31.656 -3.414  1.00 45.34 ? 66  VAL B CG1   1 
ATOM   4314 C  CG2   . VAL C 3 73  ? -34.672 -33.297 -5.227  1.00 45.57 ? 66  VAL B CG2   1 
ATOM   4315 N  N     . GLY C 3 74  ? -33.613 -29.800 -7.356  1.00 44.99 ? 67  GLY B N     1 
ATOM   4316 C  CA    . GLY C 3 74  ? -32.857 -29.630 -8.594  1.00 44.81 ? 67  GLY B CA    1 
ATOM   4317 C  C     . GLY C 3 74  ? -33.649 -28.933 -9.688  1.00 44.66 ? 67  GLY B C     1 
ATOM   4318 O  O     . GLY C 3 74  ? -33.112 -28.641 -10.758 1.00 44.73 ? 67  GLY B O     1 
ATOM   4319 N  N     . GLU C 3 75  ? -34.928 -28.675 -9.422  1.00 44.46 ? 68  GLU B N     1 
ATOM   4320 C  CA    . GLU C 3 75  ? -35.794 -27.970 -10.368 1.00 44.26 ? 68  GLU B CA    1 
ATOM   4321 C  C     . GLU C 3 75  ? -35.820 -26.480 -10.056 1.00 43.92 ? 68  GLU B C     1 
ATOM   4322 O  O     . GLU C 3 75  ? -35.690 -26.080 -8.900  1.00 43.99 ? 68  GLU B O     1 
ATOM   4323 C  CB    . GLU C 3 75  ? -37.218 -28.542 -10.344 1.00 44.32 ? 68  GLU B CB    1 
ATOM   4324 C  CG    . GLU C 3 75  ? -37.340 -29.969 -10.868 1.00 44.72 ? 68  GLU B CG    1 
ATOM   4325 C  CD    . GLU C 3 75  ? -37.302 -30.047 -12.384 1.00 45.49 ? 68  GLU B CD    1 
ATOM   4326 O  OE1   . GLU C 3 75  ? -38.319 -29.707 -13.026 1.00 45.94 ? 68  GLU B OE1   1 
ATOM   4327 O  OE2   . GLU C 3 75  ? -36.258 -30.460 -12.933 1.00 45.70 ? 68  GLU B OE2   1 
ATOM   4328 N  N     . VAL C 3 76  ? -35.986 -25.664 -11.094 1.00 43.55 ? 69  VAL B N     1 
ATOM   4329 C  CA    . VAL C 3 76  ? -36.012 -24.212 -10.940 1.00 43.18 ? 69  VAL B CA    1 
ATOM   4330 C  C     . VAL C 3 76  ? -37.440 -23.720 -10.709 1.00 43.00 ? 69  VAL B C     1 
ATOM   4331 O  O     . VAL C 3 76  ? -38.366 -24.119 -11.412 1.00 43.00 ? 69  VAL B O     1 
ATOM   4332 C  CB    . VAL C 3 76  ? -35.368 -23.491 -12.156 1.00 43.12 ? 69  VAL B CB    1 
ATOM   4333 C  CG1   . VAL C 3 76  ? -35.417 -21.977 -11.990 1.00 42.80 ? 69  VAL B CG1   1 
ATOM   4334 C  CG2   . VAL C 3 76  ? -33.930 -23.952 -12.351 1.00 43.00 ? 69  VAL B CG2   1 
ATOM   4335 N  N     . LEU C 3 77  ? -37.601 -22.852 -9.714  1.00 42.97 ? 70  LEU B N     1 
ATOM   4336 C  CA    . LEU C 3 77  ? -38.908 -22.315 -9.351  1.00 42.87 ? 70  LEU B CA    1 
ATOM   4337 C  C     . LEU C 3 77  ? -39.013 -20.815 -9.620  1.00 42.94 ? 70  LEU B C     1 
ATOM   4338 O  O     . LEU C 3 77  ? -38.002 -20.122 -9.750  1.00 43.00 ? 70  LEU B O     1 
ATOM   4339 C  CB    . LEU C 3 77  ? -39.235 -22.634 -7.886  1.00 42.86 ? 70  LEU B CB    1 
ATOM   4340 C  CG    . LEU C 3 77  ? -39.376 -24.112 -7.491  1.00 42.66 ? 70  LEU B CG    1 
ATOM   4341 C  CD1   . LEU C 3 77  ? -39.848 -24.238 -6.050  1.00 42.12 ? 70  LEU B CD1   1 
ATOM   4342 C  CD2   . LEU C 3 77  ? -40.311 -24.869 -8.429  1.00 42.34 ? 70  LEU B CD2   1 
ATOM   4343 N  N     . TYR C 3 78  ? -40.251 -20.334 -9.714  1.00 42.93 ? 71  TYR B N     1 
ATOM   4344 C  CA    . TYR C 3 78  ? -40.548 -18.954 -10.084 1.00 42.99 ? 71  TYR B CA    1 
ATOM   4345 C  C     . TYR C 3 78  ? -41.625 -18.388 -9.174  1.00 43.20 ? 71  TYR B C     1 
ATOM   4346 O  O     . TYR C 3 78  ? -42.465 -19.129 -8.666  1.00 43.17 ? 71  TYR B O     1 
ATOM   4347 C  CB    . TYR C 3 78  ? -41.057 -18.889 -11.530 1.00 42.74 ? 71  TYR B CB    1 
ATOM   4348 C  CG    . TYR C 3 78  ? -40.071 -19.347 -12.581 1.00 42.56 ? 71  TYR B CG    1 
ATOM   4349 C  CD1   . TYR C 3 78  ? -39.802 -20.704 -12.771 1.00 42.32 ? 71  TYR B CD1   1 
ATOM   4350 C  CD2   . TYR C 3 78  ? -39.428 -18.426 -13.407 1.00 42.05 ? 71  TYR B CD2   1 
ATOM   4351 C  CE1   . TYR C 3 78  ? -38.901 -21.128 -13.732 1.00 42.20 ? 71  TYR B CE1   1 
ATOM   4352 C  CE2   . TYR C 3 78  ? -38.526 -18.841 -14.376 1.00 41.85 ? 71  TYR B CE2   1 
ATOM   4353 C  CZ    . TYR C 3 78  ? -38.269 -20.193 -14.530 1.00 42.24 ? 71  TYR B CZ    1 
ATOM   4354 O  OH    . TYR C 3 78  ? -37.383 -20.618 -15.484 1.00 42.49 ? 71  TYR B OH    1 
ATOM   4355 N  N     . VAL C 3 79  ? -41.601 -17.075 -8.973  1.00 43.58 ? 72  VAL B N     1 
ATOM   4356 C  CA    . VAL C 3 79  ? -42.710 -16.395 -8.317  1.00 43.99 ? 72  VAL B CA    1 
ATOM   4357 C  C     . VAL C 3 79  ? -43.695 -15.944 -9.389  1.00 44.20 ? 72  VAL B C     1 
ATOM   4358 O  O     . VAL C 3 79  ? -43.344 -15.163 -10.276 1.00 44.30 ? 72  VAL B O     1 
ATOM   4359 C  CB    . VAL C 3 79  ? -42.247 -15.205 -7.439  1.00 43.97 ? 72  VAL B CB    1 
ATOM   4360 C  CG1   . VAL C 3 79  ? -43.442 -14.382 -6.963  1.00 44.00 ? 72  VAL B CG1   1 
ATOM   4361 C  CG2   . VAL C 3 79  ? -41.458 -15.707 -6.245  1.00 43.90 ? 72  VAL B CG2   1 
ATOM   4362 N  N     . ASP C 3 80  ? -44.918 -16.469 -9.311  1.00 44.48 ? 73  ASP B N     1 
ATOM   4363 C  CA    . ASP C 3 80  ? -45.991 -16.116 -10.236 1.00 44.77 ? 73  ASP B CA    1 
ATOM   4364 C  C     . ASP C 3 80  ? -46.379 -14.655 -10.032 1.00 44.95 ? 73  ASP B C     1 
ATOM   4365 O  O     . ASP C 3 80  ? -46.721 -14.244 -8.920  1.00 44.97 ? 73  ASP B O     1 
ATOM   4366 C  CB    . ASP C 3 80  ? -47.203 -17.034 -10.023 1.00 44.78 ? 73  ASP B CB    1 
ATOM   4367 C  CG    . ASP C 3 80  ? -48.199 -16.991 -11.177 1.00 44.73 ? 73  ASP B CG    1 
ATOM   4368 O  OD1   . ASP C 3 80  ? -49.129 -17.825 -11.173 1.00 44.93 ? 73  ASP B OD1   1 
ATOM   4369 O  OD2   . ASP C 3 80  ? -48.066 -16.140 -12.084 1.00 44.44 ? 73  ASP B OD2   1 
ATOM   4370 N  N     . GLU C 3 81  ? -46.315 -13.880 -11.110 1.00 45.29 ? 74  GLU B N     1 
ATOM   4371 C  CA    . GLU C 3 81  ? -46.551 -12.442 -11.044 1.00 45.55 ? 74  GLU B CA    1 
ATOM   4372 C  C     . GLU C 3 81  ? -47.597 -12.004 -12.061 1.00 45.57 ? 74  GLU B C     1 
ATOM   4373 O  O     . GLU C 3 81  ? -48.089 -10.875 -12.015 1.00 45.71 ? 74  GLU B O     1 
ATOM   4374 C  CB    . GLU C 3 81  ? -45.240 -11.684 -11.271 1.00 45.64 ? 74  GLU B CB    1 
ATOM   4375 C  CG    . GLU C 3 81  ? -45.018 -10.525 -10.308 1.00 46.07 ? 74  GLU B CG    1 
ATOM   4376 C  CD    . GLU C 3 81  ? -44.671 -10.990 -8.904  1.00 46.55 ? 74  GLU B CD    1 
ATOM   4377 O  OE1   . GLU C 3 81  ? -43.549 -11.506 -8.703  1.00 46.87 ? 74  GLU B OE1   1 
ATOM   4378 O  OE2   . GLU C 3 81  ? -45.518 -10.834 -8.000  1.00 46.73 ? 74  GLU B OE2   1 
ATOM   4379 N  N     . PHE D 4 3   ? -24.464 -28.574 29.857  1.00 44.04 ? 3   PHE C N     1 
ATOM   4380 C  CA    . PHE D 4 3   ? -23.490 -27.634 29.228  1.00 44.07 ? 3   PHE C CA    1 
ATOM   4381 C  C     . PHE D 4 3   ? -22.235 -28.377 28.786  1.00 44.12 ? 3   PHE C C     1 
ATOM   4382 O  O     . PHE D 4 3   ? -21.760 -29.276 29.483  1.00 44.22 ? 3   PHE C O     1 
ATOM   4383 C  CB    . PHE D 4 3   ? -23.129 -26.498 30.192  1.00 44.01 ? 3   PHE C CB    1 
ATOM   4384 C  CG    . PHE D 4 3   ? -24.324 -25.781 30.762  1.00 43.95 ? 3   PHE C CG    1 
ATOM   4385 C  CD1   . PHE D 4 3   ? -24.786 -26.081 32.040  1.00 43.91 ? 3   PHE C CD1   1 
ATOM   4386 C  CD2   . PHE D 4 3   ? -24.993 -24.812 30.019  1.00 43.95 ? 3   PHE C CD2   1 
ATOM   4387 C  CE1   . PHE D 4 3   ? -25.893 -25.424 32.573  1.00 44.06 ? 3   PHE C CE1   1 
ATOM   4388 C  CE2   . PHE D 4 3   ? -26.102 -24.149 30.542  1.00 43.88 ? 3   PHE C CE2   1 
ATOM   4389 C  CZ    . PHE D 4 3   ? -26.552 -24.455 31.821  1.00 43.98 ? 3   PHE C CZ    1 
ATOM   4390 N  N     . ARG D 4 4   ? -21.705 -28.004 27.623  1.00 44.10 ? 4   ARG C N     1 
ATOM   4391 C  CA    . ARG D 4 4   ? -20.528 -28.678 27.074  1.00 44.09 ? 4   ARG C CA    1 
ATOM   4392 C  C     . ARG D 4 4   ? -19.526 -27.773 26.342  1.00 44.01 ? 4   ARG C C     1 
ATOM   4393 O  O     . ARG D 4 4   ? -18.522 -28.262 25.818  1.00 44.09 ? 4   ARG C O     1 
ATOM   4394 C  CB    . ARG D 4 4   ? -20.935 -29.884 26.212  1.00 44.32 ? 4   ARG C CB    1 
ATOM   4395 C  CG    . ARG D 4 4   ? -21.937 -29.588 25.109  1.00 44.72 ? 4   ARG C CG    1 
ATOM   4396 C  CD    . ARG D 4 4   ? -22.628 -30.861 24.623  1.00 45.58 ? 4   ARG C CD    1 
ATOM   4397 N  NE    . ARG D 4 4   ? -21.681 -31.879 24.166  1.00 46.55 ? 4   ARG C NE    1 
ATOM   4398 C  CZ    . ARG D 4 4   ? -21.153 -31.932 22.945  1.00 47.06 ? 4   ARG C CZ    1 
ATOM   4399 N  NH1   . ARG D 4 4   ? -21.468 -31.019 22.035  1.00 47.54 ? 4   ARG C NH1   1 
ATOM   4400 N  NH2   . ARG D 4 4   ? -20.302 -32.899 22.632  1.00 47.14 ? 4   ARG C NH2   1 
ATOM   4401 N  N     . ILE D 4 5   ? -19.785 -26.467 26.311  1.00 43.77 ? 5   ILE C N     1 
ATOM   4402 C  CA    . ILE D 4 5   ? -18.776 -25.521 25.833  1.00 43.83 ? 5   ILE C CA    1 
ATOM   4403 C  C     . ILE D 4 5   ? -17.707 -25.386 26.916  1.00 43.81 ? 5   ILE C C     1 
ATOM   4404 O  O     . ILE D 4 5   ? -18.017 -25.124 28.080  1.00 43.70 ? 5   ILE C O     1 
ATOM   4405 C  CB    . ILE D 4 5   ? -19.355 -24.126 25.462  1.00 43.68 ? 5   ILE C CB    1 
ATOM   4406 C  CG1   . ILE D 4 5   ? -20.382 -24.240 24.331  1.00 43.73 ? 5   ILE C CG1   1 
ATOM   4407 C  CG2   . ILE D 4 5   ? -18.231 -23.175 25.041  1.00 43.93 ? 5   ILE C CG2   1 
ATOM   4408 C  CD1   . ILE D 4 5   ? -21.058 -22.920 23.959  1.00 43.64 ? 5   ILE C CD1   1 
ATOM   4409 N  N     . ARG D 4 6   ? -16.454 -25.602 26.525  1.00 43.87 ? 6   ARG C N     1 
ATOM   4410 C  CA    . ARG D 4 6   ? -15.330 -25.510 27.451  1.00 43.90 ? 6   ARG C CA    1 
ATOM   4411 C  C     . ARG D 4 6   ? -14.346 -24.440 26.989  1.00 43.70 ? 6   ARG C C     1 
ATOM   4412 O  O     . ARG D 4 6   ? -14.422 -23.959 25.857  1.00 43.79 ? 6   ARG C O     1 
ATOM   4413 C  CB    . ARG D 4 6   ? -14.626 -26.867 27.604  1.00 44.03 ? 6   ARG C CB    1 
ATOM   4414 C  CG    . ARG D 4 6   ? -15.546 -28.041 27.935  1.00 44.57 ? 6   ARG C CG    1 
ATOM   4415 C  CD    . ARG D 4 6   ? -14.776 -29.189 28.576  1.00 46.13 ? 6   ARG C CD    1 
ATOM   4416 N  NE    . ARG D 4 6   ? -14.805 -29.097 30.035  1.00 47.53 ? 6   ARG C NE    1 
ATOM   4417 C  CZ    . ARG D 4 6   ? -13.912 -29.648 30.851  1.00 48.32 ? 6   ARG C CZ    1 
ATOM   4418 N  NH1   . ARG D 4 6   ? -12.888 -30.339 30.366  1.00 49.36 ? 6   ARG C NH1   1 
ATOM   4419 N  NH2   . ARG D 4 6   ? -14.039 -29.499 32.162  1.00 48.63 ? 6   ARG C NH2   1 
ATOM   4420 N  N     . LYS D 4 7   ? -13.430 -24.065 27.875  1.00 43.57 ? 7   LYS C N     1 
ATOM   4421 C  CA    . LYS D 4 7   ? -12.428 -23.054 27.570  1.00 43.51 ? 7   LYS C CA    1 
ATOM   4422 C  C     . LYS D 4 7   ? -11.089 -23.408 28.207  1.00 43.39 ? 7   LYS C C     1 
ATOM   4423 O  O     . LYS D 4 7   ? -11.038 -23.855 29.353  1.00 43.25 ? 7   LYS C O     1 
ATOM   4424 C  CB    . LYS D 4 7   ? -12.898 -21.672 28.048  1.00 43.45 ? 7   LYS C CB    1 
ATOM   4425 C  CG    . LYS D 4 7   ? -12.055 -20.511 27.545  1.00 43.50 ? 7   LYS C CG    1 
ATOM   4426 C  CD    . LYS D 4 7   ? -12.527 -19.183 28.119  1.00 43.67 ? 7   LYS C CD    1 
ATOM   4427 C  CE    . LYS D 4 7   ? -11.824 -18.026 27.434  1.00 44.12 ? 7   LYS C CE    1 
ATOM   4428 N  NZ    . LYS D 4 7   ? -12.309 -16.704 27.908  1.00 44.93 ? 7   LYS C NZ    1 
ATOM   4429 N  N     . CYS D 4 8   ? -10.011 -23.213 27.450  1.00 43.37 ? 8   CYS C N     1 
ATOM   4430 C  CA    . CYS D 4 8   ? -8.663  -23.328 27.990  1.00 43.30 ? 8   CYS C CA    1 
ATOM   4431 C  C     . CYS D 4 8   ? -8.363  -22.109 28.862  1.00 43.24 ? 8   CYS C C     1 
ATOM   4432 O  O     . CYS D 4 8   ? -8.499  -20.973 28.402  1.00 43.19 ? 8   CYS C O     1 
ATOM   4433 C  CB    . CYS D 4 8   ? -7.635  -23.445 26.867  1.00 43.24 ? 8   CYS C CB    1 
ATOM   4434 S  SG    . CYS D 4 8   ? -5.936  -23.699 27.445  1.00 43.70 ? 8   CYS C SG    1 
ATOM   4435 N  N     . PRO D 4 9   ? -7.964  -22.340 30.127  1.00 43.27 ? 9   PRO C N     1 
ATOM   4436 C  CA    . PRO D 4 9   ? -7.737  -21.247 31.078  1.00 43.24 ? 9   PRO C CA    1 
ATOM   4437 C  C     . PRO D 4 9   ? -6.542  -20.360 30.726  1.00 43.21 ? 9   PRO C C     1 
ATOM   4438 O  O     . PRO D 4 9   ? -6.562  -19.163 31.018  1.00 43.21 ? 9   PRO C O     1 
ATOM   4439 C  CB    . PRO D 4 9   ? -7.474  -21.978 32.405  1.00 43.23 ? 9   PRO C CB    1 
ATOM   4440 C  CG    . PRO D 4 9   ? -7.930  -23.384 32.189  1.00 43.24 ? 9   PRO C CG    1 
ATOM   4441 C  CD    . PRO D 4 9   ? -7.707  -23.654 30.742  1.00 43.27 ? 9   PRO C CD    1 
ATOM   4442 N  N     . LYS D 4 10  ? -5.523  -20.942 30.097  1.00 43.20 ? 10  LYS C N     1 
ATOM   4443 C  CA    . LYS D 4 10  ? -4.265  -20.235 29.845  1.00 43.19 ? 10  LYS C CA    1 
ATOM   4444 C  C     . LYS D 4 10  ? -4.187  -19.506 28.500  1.00 43.08 ? 10  LYS C C     1 
ATOM   4445 O  O     . LYS D 4 10  ? -3.641  -18.403 28.428  1.00 43.08 ? 10  LYS C O     1 
ATOM   4446 C  CB    . LYS D 4 10  ? -3.065  -21.177 30.024  1.00 43.26 ? 10  LYS C CB    1 
ATOM   4447 C  CG    . LYS D 4 10  ? -2.475  -21.194 31.438  1.00 43.61 ? 10  LYS C CG    1 
ATOM   4448 C  CD    . LYS D 4 10  ? -3.404  -21.856 32.454  1.00 44.15 ? 10  LYS C CD    1 
ATOM   4449 C  CE    . LYS D 4 10  ? -2.918  -21.637 33.877  1.00 44.47 ? 10  LYS C CE    1 
ATOM   4450 N  NZ    . LYS D 4 10  ? -3.883  -22.179 34.875  1.00 44.76 ? 10  LYS C NZ    1 
ATOM   4451 N  N     . CYS D 4 11  ? -4.722  -20.116 27.443  1.00 42.93 ? 11  CYS C N     1 
ATOM   4452 C  CA    . CYS D 4 11  ? -4.666  -19.506 26.110  1.00 42.81 ? 11  CYS C CA    1 
ATOM   4453 C  C     . CYS D 4 11  ? -6.010  -18.938 25.635  1.00 42.64 ? 11  CYS C C     1 
ATOM   4454 O  O     . CYS D 4 11  ? -6.067  -18.213 24.640  1.00 42.68 ? 11  CYS C O     1 
ATOM   4455 C  CB    . CYS D 4 11  ? -4.064  -20.470 25.079  1.00 42.84 ? 11  CYS C CB    1 
ATOM   4456 S  SG    . CYS D 4 11  ? -5.223  -21.629 24.329  1.00 43.12 ? 11  CYS C SG    1 
ATOM   4457 N  N     . GLY D 4 12  ? -7.082  -19.279 26.346  1.00 42.48 ? 12  GLY C N     1 
ATOM   4458 C  CA    . GLY D 4 12  ? -8.408  -18.714 26.087  1.00 42.28 ? 12  GLY C CA    1 
ATOM   4459 C  C     . GLY D 4 12  ? -9.157  -19.298 24.903  1.00 42.12 ? 12  GLY C C     1 
ATOM   4460 O  O     . GLY D 4 12  ? -10.081 -18.673 24.383  1.00 42.19 ? 12  GLY C O     1 
ATOM   4461 N  N     . ARG D 4 13  ? -8.762  -20.498 24.483  1.00 41.97 ? 13  ARG C N     1 
ATOM   4462 C  CA    . ARG D 4 13  ? -9.385  -21.178 23.348  1.00 41.80 ? 13  ARG C CA    1 
ATOM   4463 C  C     . ARG D 4 13  ? -10.697 -21.849 23.754  1.00 41.63 ? 13  ARG C C     1 
ATOM   4464 O  O     . ARG D 4 13  ? -10.744 -22.608 24.726  1.00 41.67 ? 13  ARG C O     1 
ATOM   4465 C  CB    . ARG D 4 13  ? -8.414  -22.212 22.755  1.00 41.89 ? 13  ARG C CB    1 
ATOM   4466 C  CG    . ARG D 4 13  ? -8.988  -23.125 21.668  1.00 41.81 ? 13  ARG C CG    1 
ATOM   4467 C  CD    . ARG D 4 13  ? -8.957  -22.469 20.301  1.00 41.98 ? 13  ARG C CD    1 
ATOM   4468 N  NE    . ARG D 4 13  ? -9.530  -23.326 19.264  1.00 41.93 ? 13  ARG C NE    1 
ATOM   4469 C  CZ    . ARG D 4 13  ? -9.513  -23.048 17.962  1.00 42.04 ? 13  ARG C CZ    1 
ATOM   4470 N  NH1   . ARG D 4 13  ? -8.944  -21.933 17.518  1.00 42.01 ? 13  ARG C NH1   1 
ATOM   4471 N  NH2   . ARG D 4 13  ? -10.064 -23.889 17.099  1.00 42.15 ? 13  ARG C NH2   1 
ATOM   4472 N  N     . TYR D 4 14  ? -11.759 -21.560 23.008  1.00 41.35 ? 14  TYR C N     1 
ATOM   4473 C  CA    . TYR D 4 14  ? -13.027 -22.253 23.191  1.00 41.10 ? 14  TYR C CA    1 
ATOM   4474 C  C     . TYR D 4 14  ? -13.033 -23.581 22.443  1.00 41.07 ? 14  TYR C C     1 
ATOM   4475 O  O     . TYR D 4 14  ? -12.616 -23.653 21.285  1.00 40.96 ? 14  TYR C O     1 
ATOM   4476 C  CB    . TYR D 4 14  ? -14.201 -21.370 22.770  1.00 41.06 ? 14  TYR C CB    1 
ATOM   4477 C  CG    . TYR D 4 14  ? -14.620 -20.397 23.846  1.00 40.89 ? 14  TYR C CG    1 
ATOM   4478 C  CD1   . TYR D 4 14  ? -14.209 -19.064 23.811  1.00 40.72 ? 14  TYR C CD1   1 
ATOM   4479 C  CD2   . TYR D 4 14  ? -15.408 -20.817 24.914  1.00 40.77 ? 14  TYR C CD2   1 
ATOM   4480 C  CE1   . TYR D 4 14  ? -14.591 -18.171 24.809  1.00 40.58 ? 14  TYR C CE1   1 
ATOM   4481 C  CE2   . TYR D 4 14  ? -15.791 -19.938 25.914  1.00 40.68 ? 14  TYR C CE2   1 
ATOM   4482 C  CZ    . TYR D 4 14  ? -15.382 -18.621 25.857  1.00 40.67 ? 14  TYR C CZ    1 
ATOM   4483 O  OH    . TYR D 4 14  ? -15.772 -17.767 26.855  1.00 40.54 ? 14  TYR C OH    1 
ATOM   4484 N  N     . THR D 4 15  ? -13.493 -24.627 23.127  1.00 41.02 ? 15  THR C N     1 
ATOM   4485 C  CA    . THR D 4 15  ? -13.472 -25.991 22.597  1.00 41.24 ? 15  THR C CA    1 
ATOM   4486 C  C     . THR D 4 15  ? -14.557 -26.858 23.242  1.00 41.37 ? 15  THR C C     1 
ATOM   4487 O  O     . THR D 4 15  ? -15.171 -26.459 24.233  1.00 41.44 ? 15  THR C O     1 
ATOM   4488 C  CB    . THR D 4 15  ? -12.071 -26.657 22.773  1.00 41.11 ? 15  THR C CB    1 
ATOM   4489 O  OG1   . THR D 4 15  ? -12.091 -27.982 22.235  1.00 41.33 ? 15  THR C OG1   1 
ATOM   4490 C  CG2   . THR D 4 15  ? -11.665 -26.724 24.239  1.00 41.15 ? 15  THR C CG2   1 
ATOM   4491 N  N     . LEU D 4 16  ? -14.794 -28.030 22.658  1.00 41.40 ? 16  LEU C N     1 
ATOM   4492 C  CA    . LEU D 4 16  ? -15.661 -29.043 23.258  1.00 41.63 ? 16  LEU C CA    1 
ATOM   4493 C  C     . LEU D 4 16  ? -14.823 -30.163 23.877  1.00 41.72 ? 16  LEU C C     1 
ATOM   4494 O  O     . LEU D 4 16  ? -15.350 -31.034 24.572  1.00 41.80 ? 16  LEU C O     1 
ATOM   4495 C  CB    . LEU D 4 16  ? -16.628 -29.623 22.217  1.00 41.55 ? 16  LEU C CB    1 
ATOM   4496 C  CG    . LEU D 4 16  ? -17.534 -28.663 21.434  1.00 41.50 ? 16  LEU C CG    1 
ATOM   4497 C  CD1   . LEU D 4 16  ? -18.244 -29.402 20.306  1.00 41.04 ? 16  LEU C CD1   1 
ATOM   4498 C  CD2   . LEU D 4 16  ? -18.540 -27.962 22.344  1.00 41.04 ? 16  LEU C CD2   1 
ATOM   4499 N  N     . LYS D 4 17  ? -13.516 -30.125 23.624  1.00 41.84 ? 17  LYS C N     1 
ATOM   4500 C  CA    . LYS D 4 17  ? -12.599 -31.172 24.069  1.00 42.21 ? 17  LYS C CA    1 
ATOM   4501 C  C     . LYS D 4 17  ? -12.123 -30.955 25.504  1.00 42.24 ? 17  LYS C C     1 
ATOM   4502 O  O     . LYS D 4 17  ? -12.137 -29.831 26.014  1.00 42.28 ? 17  LYS C O     1 
ATOM   4503 C  CB    . LYS D 4 17  ? -11.389 -31.277 23.128  1.00 42.22 ? 17  LYS C CB    1 
ATOM   4504 C  CG    . LYS D 4 17  ? -11.715 -31.454 21.643  1.00 42.53 ? 17  LYS C CG    1 
ATOM   4505 C  CD    . LYS D 4 17  ? -12.493 -32.735 21.369  1.00 43.34 ? 17  LYS C CD    1 
ATOM   4506 C  CE    . LYS D 4 17  ? -12.436 -33.128 19.895  1.00 43.79 ? 17  LYS C CE    1 
ATOM   4507 N  NZ    . LYS D 4 17  ? -13.060 -32.113 19.002  1.00 44.18 ? 17  LYS C NZ    1 
ATOM   4508 N  N     . GLU D 4 18  ? -11.704 -32.047 26.137  1.00 42.32 ? 18  GLU C N     1 
ATOM   4509 C  CA    . GLU D 4 18  ? -11.164 -32.031 27.496  1.00 42.43 ? 18  GLU C CA    1 
ATOM   4510 C  C     . GLU D 4 18  ? -9.746  -31.461 27.512  1.00 42.44 ? 18  GLU C C     1 
ATOM   4511 O  O     . GLU D 4 18  ? -9.323  -30.851 28.497  1.00 42.43 ? 18  GLU C O     1 
ATOM   4512 C  CB    . GLU D 4 18  ? -11.161 -33.446 28.080  1.00 42.39 ? 18  GLU C CB    1 
ATOM   4513 C  CG    . GLU D 4 18  ? -12.510 -34.165 28.028  1.00 42.67 ? 18  GLU C CG    1 
ATOM   4514 C  CD    . GLU D 4 18  ? -13.370 -33.920 29.256  1.00 43.06 ? 18  GLU C CD    1 
ATOM   4515 O  OE1   . GLU D 4 18  ? -13.760 -32.758 29.502  1.00 43.06 ? 18  GLU C OE1   1 
ATOM   4516 O  OE2   . GLU D 4 18  ? -13.668 -34.900 29.972  1.00 43.02 ? 18  GLU C OE2   1 
ATOM   4517 N  N     . VAL D 4 19  ? -9.016  -31.681 26.421  1.00 42.44 ? 19  VAL C N     1 
ATOM   4518 C  CA    . VAL D 4 19  ? -7.686  -31.102 26.232  1.00 42.45 ? 19  VAL C CA    1 
ATOM   4519 C  C     . VAL D 4 19  ? -7.737  -29.974 25.201  1.00 42.36 ? 19  VAL C C     1 
ATOM   4520 O  O     . VAL D 4 19  ? -8.535  -30.012 24.261  1.00 42.37 ? 19  VAL C O     1 
ATOM   4521 C  CB    . VAL D 4 19  ? -6.627  -32.164 25.818  1.00 42.49 ? 19  VAL C CB    1 
ATOM   4522 C  CG1   . VAL D 4 19  ? -6.345  -33.123 26.969  1.00 42.54 ? 19  VAL C CG1   1 
ATOM   4523 C  CG2   . VAL D 4 19  ? -7.062  -32.930 24.567  1.00 42.81 ? 19  VAL C CG2   1 
ATOM   4524 N  N     . CYS D 4 20  ? -6.893  -28.965 25.389  1.00 42.19 ? 20  CYS C N     1 
ATOM   4525 C  CA    . CYS D 4 20  ? -6.836  -27.841 24.464  1.00 42.12 ? 20  CYS C CA    1 
ATOM   4526 C  C     . CYS D 4 20  ? -6.139  -28.242 23.160  1.00 42.00 ? 20  CYS C C     1 
ATOM   4527 O  O     . CYS D 4 20  ? -5.042  -28.801 23.192  1.00 41.89 ? 20  CYS C O     1 
ATOM   4528 C  CB    . CYS D 4 20  ? -6.132  -26.648 25.109  1.00 42.10 ? 20  CYS C CB    1 
ATOM   4529 S  SG    . CYS D 4 20  ? -6.112  -25.163 24.081  1.00 42.21 ? 20  CYS C SG    1 
ATOM   4530 N  N     . PRO D 4 21  ? -6.781  -27.962 22.008  1.00 41.94 ? 21  PRO C N     1 
ATOM   4531 C  CA    . PRO D 4 21  ? -6.217  -28.322 20.705  1.00 41.90 ? 21  PRO C CA    1 
ATOM   4532 C  C     . PRO D 4 21  ? -5.007  -27.472 20.304  1.00 41.89 ? 21  PRO C C     1 
ATOM   4533 O  O     . PRO D 4 21  ? -4.292  -27.828 19.364  1.00 41.84 ? 21  PRO C O     1 
ATOM   4534 C  CB    . PRO D 4 21  ? -7.384  -28.080 19.743  1.00 41.93 ? 21  PRO C CB    1 
ATOM   4535 C  CG    . PRO D 4 21  ? -8.202  -27.032 20.403  1.00 41.93 ? 21  PRO C CG    1 
ATOM   4536 C  CD    . PRO D 4 21  ? -8.092  -27.296 21.874  1.00 41.90 ? 21  PRO C CD    1 
ATOM   4537 N  N     . VAL D 4 22  ? -4.785  -26.368 21.016  1.00 41.84 ? 22  VAL C N     1 
ATOM   4538 C  CA    . VAL D 4 22  ? -3.699  -25.439 20.699  1.00 41.80 ? 22  VAL C CA    1 
ATOM   4539 C  C     . VAL D 4 22  ? -2.434  -25.720 21.519  1.00 41.74 ? 22  VAL C C     1 
ATOM   4540 O  O     . VAL D 4 22  ? -1.373  -25.988 20.950  1.00 41.76 ? 22  VAL C O     1 
ATOM   4541 C  CB    . VAL D 4 22  ? -4.144  -23.954 20.857  1.00 41.77 ? 22  VAL C CB    1 
ATOM   4542 C  CG1   . VAL D 4 22  ? -2.990  -23.002 20.563  1.00 41.73 ? 22  VAL C CG1   1 
ATOM   4543 C  CG2   . VAL D 4 22  ? -5.322  -23.649 19.942  1.00 41.73 ? 22  VAL C CG2   1 
ATOM   4544 N  N     . CYS D 4 23  ? -2.553  -25.665 22.845  1.00 41.71 ? 23  CYS C N     1 
ATOM   4545 C  CA    . CYS D 4 23  ? -1.395  -25.814 23.734  1.00 41.73 ? 23  CYS C CA    1 
ATOM   4546 C  C     . CYS D 4 23  ? -1.322  -27.170 24.439  1.00 41.75 ? 23  CYS C C     1 
ATOM   4547 O  O     . CYS D 4 23  ? -0.248  -27.582 24.884  1.00 41.74 ? 23  CYS C O     1 
ATOM   4548 C  CB    . CYS D 4 23  ? -1.348  -24.674 24.756  1.00 41.68 ? 23  CYS C CB    1 
ATOM   4549 S  SG    . CYS D 4 23  ? -2.759  -24.610 25.872  1.00 41.78 ? 23  CYS C SG    1 
ATOM   4550 N  N     . GLY D 4 24  ? -2.459  -27.853 24.543  1.00 41.78 ? 24  GLY C N     1 
ATOM   4551 C  CA    . GLY D 4 24  ? -2.506  -29.198 25.113  1.00 41.85 ? 24  GLY C CA    1 
ATOM   4552 C  C     . GLY D 4 24  ? -2.544  -29.233 26.628  1.00 41.88 ? 24  GLY C C     1 
ATOM   4553 O  O     . GLY D 4 24  ? -1.624  -29.743 27.267  1.00 41.93 ? 24  GLY C O     1 
ATOM   4554 N  N     . GLU D 4 25  ? -3.612  -28.684 27.199  1.00 41.92 ? 25  GLU C N     1 
ATOM   4555 C  CA    . GLU D 4 25  ? -3.839  -28.731 28.644  1.00 41.94 ? 25  GLU C CA    1 
ATOM   4556 C  C     . GLU D 4 25  ? -5.330  -28.861 28.955  1.00 41.70 ? 25  GLU C C     1 
ATOM   4557 O  O     . GLU D 4 25  ? -6.171  -28.641 28.080  1.00 41.65 ? 25  GLU C O     1 
ATOM   4558 C  CB    . GLU D 4 25  ? -3.235  -27.504 29.341  1.00 41.98 ? 25  GLU C CB    1 
ATOM   4559 C  CG    . GLU D 4 25  ? -3.932  -26.187 29.029  1.00 42.07 ? 25  GLU C CG    1 
ATOM   4560 C  CD    . GLU D 4 25  ? -3.500  -25.056 29.946  1.00 42.21 ? 25  GLU C CD    1 
ATOM   4561 O  OE1   . GLU D 4 25  ? -2.296  -24.963 30.272  1.00 42.48 ? 25  GLU C OE1   1 
ATOM   4562 O  OE2   . GLU D 4 25  ? -4.372  -24.251 30.336  1.00 42.78 ? 25  GLU C OE2   1 
ATOM   4563 N  N     . LYS D 4 26  ? -5.646  -29.218 30.199  1.00 41.54 ? 26  LYS C N     1 
ATOM   4564 C  CA    . LYS D 4 26  ? -7.027  -29.482 30.609  1.00 41.47 ? 26  LYS C CA    1 
ATOM   4565 C  C     . LYS D 4 26  ? -7.893  -28.226 30.566  1.00 41.27 ? 26  LYS C C     1 
ATOM   4566 O  O     . LYS D 4 26  ? -7.529  -27.184 31.113  1.00 41.32 ? 26  LYS C O     1 
ATOM   4567 C  CB    . LYS D 4 26  ? -7.080  -30.123 32.003  1.00 41.48 ? 26  LYS C CB    1 
ATOM   4568 C  CG    . LYS D 4 26  ? -6.231  -31.384 32.171  1.00 41.96 ? 26  LYS C CG    1 
ATOM   4569 C  CD    . LYS D 4 26  ? -6.726  -32.549 31.318  1.00 42.58 ? 26  LYS C CD    1 
ATOM   4570 C  CE    . LYS D 4 26  ? -5.790  -33.744 31.436  1.00 42.96 ? 26  LYS C CE    1 
ATOM   4571 N  NZ    . LYS D 4 26  ? -6.140  -34.833 30.482  1.00 43.36 ? 26  LYS C NZ    1 
ATOM   4572 N  N     . THR D 4 27  ? -9.039  -28.342 29.904  1.00 41.06 ? 27  THR C N     1 
ATOM   4573 C  CA    . THR D 4 27  ? -9.964  -27.226 29.742  1.00 40.86 ? 27  THR C CA    1 
ATOM   4574 C  C     . THR D 4 27  ? -10.970 -27.171 30.885  1.00 40.91 ? 27  THR C C     1 
ATOM   4575 O  O     . THR D 4 27  ? -11.187 -28.163 31.586  1.00 40.92 ? 27  THR C O     1 
ATOM   4576 C  CB    . THR D 4 27  ? -10.724 -27.310 28.402  1.00 40.82 ? 27  THR C CB    1 
ATOM   4577 O  OG1   . THR D 4 27  ? -11.402 -28.569 28.313  1.00 40.50 ? 27  THR C OG1   1 
ATOM   4578 C  CG2   . THR D 4 27  ? -9.764  -27.162 27.228  1.00 40.47 ? 27  THR C CG2   1 
ATOM   4579 N  N     . LYS D 4 28  ? -11.571 -26.000 31.071  1.00 40.93 ? 28  LYS C N     1 
ATOM   4580 C  CA    . LYS D 4 28  ? -12.613 -25.822 32.077  1.00 41.07 ? 28  LYS C CA    1 
ATOM   4581 C  C     . LYS D 4 28  ? -13.930 -25.421 31.423  1.00 41.08 ? 28  LYS C C     1 
ATOM   4582 O  O     . LYS D 4 28  ? -13.935 -24.800 30.361  1.00 41.15 ? 28  LYS C O     1 
ATOM   4583 C  CB    . LYS D 4 28  ? -12.188 -24.791 33.125  1.00 41.07 ? 28  LYS C CB    1 
ATOM   4584 C  CG    . LYS D 4 28  ? -11.165 -25.314 34.122  1.00 41.08 ? 28  LYS C CG    1 
ATOM   4585 C  CD    . LYS D 4 28  ? -11.172 -24.493 35.399  1.00 41.65 ? 28  LYS C CD    1 
ATOM   4586 C  CE    . LYS D 4 28  ? -10.488 -25.235 36.535  1.00 41.77 ? 28  LYS C CE    1 
ATOM   4587 N  NZ    . LYS D 4 28  ? -10.731 -24.578 37.850  1.00 42.13 ? 28  LYS C NZ    1 
ATOM   4588 N  N     . VAL D 4 29  ? -15.041 -25.788 32.057  1.00 41.20 ? 29  VAL C N     1 
ATOM   4589 C  CA    . VAL D 4 29  ? -16.372 -25.453 31.548  1.00 41.35 ? 29  VAL C CA    1 
ATOM   4590 C  C     . VAL D 4 29  ? -16.523 -23.931 31.476  1.00 41.34 ? 29  VAL C C     1 
ATOM   4591 O  O     . VAL D 4 29  ? -16.096 -23.212 32.382  1.00 41.27 ? 29  VAL C O     1 
ATOM   4592 C  CB    . VAL D 4 29  ? -17.504 -26.094 32.399  1.00 41.40 ? 29  VAL C CB    1 
ATOM   4593 C  CG1   . VAL D 4 29  ? -18.855 -25.904 31.727  1.00 41.44 ? 29  VAL C CG1   1 
ATOM   4594 C  CG2   . VAL D 4 29  ? -17.249 -27.582 32.600  1.00 41.61 ? 29  VAL C CG2   1 
ATOM   4595 N  N     . ALA D 4 30  ? -17.122 -23.460 30.387  1.00 41.49 ? 30  ALA C N     1 
ATOM   4596 C  CA    . ALA D 4 30  ? -17.170 -22.035 30.064  1.00 41.66 ? 30  ALA C CA    1 
ATOM   4597 C  C     . ALA D 4 30  ? -18.081 -21.198 30.967  1.00 41.83 ? 30  ALA C C     1 
ATOM   4598 O  O     . ALA D 4 30  ? -17.792 -20.024 31.215  1.00 42.11 ? 30  ALA C O     1 
ATOM   4599 C  CB    . ALA D 4 30  ? -17.543 -21.841 28.597  1.00 41.56 ? 30  ALA C CB    1 
ATOM   4600 N  N     . HIS D 4 31  ? -19.168 -21.792 31.456  1.00 41.92 ? 31  HIS C N     1 
ATOM   4601 C  CA    . HIS D 4 31  ? -20.144 -21.056 32.268  1.00 42.07 ? 31  HIS C CA    1 
ATOM   4602 C  C     . HIS D 4 31  ? -19.740 -20.967 33.746  1.00 42.00 ? 31  HIS C C     1 
ATOM   4603 O  O     . HIS D 4 31  ? -19.179 -21.921 34.292  1.00 41.88 ? 31  HIS C O     1 
ATOM   4604 C  CB    . HIS D 4 31  ? -21.552 -21.658 32.122  1.00 42.14 ? 31  HIS C CB    1 
ATOM   4605 C  CG    . HIS D 4 31  ? -21.777 -22.888 32.944  1.00 42.89 ? 31  HIS C CG    1 
ATOM   4606 N  ND1   . HIS D 4 31  ? -21.520 -24.157 32.473  1.00 43.76 ? 31  HIS C ND1   1 
ATOM   4607 C  CD2   . HIS D 4 31  ? -22.238 -23.043 34.208  1.00 43.63 ? 31  HIS C CD2   1 
ATOM   4608 C  CE1   . HIS D 4 31  ? -21.808 -25.040 33.412  1.00 43.90 ? 31  HIS C CE1   1 
ATOM   4609 N  NE2   . HIS D 4 31  ? -22.244 -24.390 34.476  1.00 44.02 ? 31  HIS C NE2   1 
ATOM   4610 N  N     . PRO D 4 32  ? -20.012 -19.814 34.391  1.00 42.04 ? 32  PRO C N     1 
ATOM   4611 C  CA    . PRO D 4 32  ? -19.789 -19.682 35.833  1.00 42.04 ? 32  PRO C CA    1 
ATOM   4612 C  C     . PRO D 4 32  ? -20.804 -20.496 36.648  1.00 42.22 ? 32  PRO C C     1 
ATOM   4613 O  O     . PRO D 4 32  ? -21.893 -20.788 36.149  1.00 42.24 ? 32  PRO C O     1 
ATOM   4614 C  CB    . PRO D 4 32  ? -19.966 -18.180 36.080  1.00 42.04 ? 32  PRO C CB    1 
ATOM   4615 C  CG    . PRO D 4 32  ? -20.836 -17.710 34.979  1.00 41.96 ? 32  PRO C CG    1 
ATOM   4616 C  CD    . PRO D 4 32  ? -20.514 -18.561 33.792  1.00 41.93 ? 32  PRO C CD    1 
ATOM   4617 N  N     . PRO D 4 33  ? -20.448 -20.874 37.894  1.00 42.31 ? 33  PRO C N     1 
ATOM   4618 C  CA    . PRO D 4 33  ? -21.364 -21.675 38.710  1.00 42.35 ? 33  PRO C CA    1 
ATOM   4619 C  C     . PRO D 4 33  ? -22.614 -20.900 39.135  1.00 42.39 ? 33  PRO C C     1 
ATOM   4620 O  O     . PRO D 4 33  ? -22.618 -19.664 39.118  1.00 42.43 ? 33  PRO C O     1 
ATOM   4621 C  CB    . PRO D 4 33  ? -20.518 -22.029 39.937  1.00 42.32 ? 33  PRO C CB    1 
ATOM   4622 C  CG    . PRO D 4 33  ? -19.521 -20.938 40.030  1.00 42.28 ? 33  PRO C CG    1 
ATOM   4623 C  CD    . PRO D 4 33  ? -19.190 -20.588 38.610  1.00 42.25 ? 33  PRO C CD    1 
ATOM   4624 N  N     . ARG D 4 34  ? -23.660 -21.638 39.499  1.00 42.41 ? 34  ARG C N     1 
ATOM   4625 C  CA    . ARG D 4 34  ? -24.897 -21.058 40.010  1.00 42.39 ? 34  ARG C CA    1 
ATOM   4626 C  C     . ARG D 4 34  ? -24.633 -20.192 41.238  1.00 42.41 ? 34  ARG C C     1 
ATOM   4627 O  O     . ARG D 4 34  ? -23.957 -20.616 42.180  1.00 42.71 ? 34  ARG C O     1 
ATOM   4628 C  CB    . ARG D 4 34  ? -25.904 -22.160 40.360  1.00 42.26 ? 34  ARG C CB    1 
ATOM   4629 C  CG    . ARG D 4 34  ? -27.192 -21.646 41.016  1.00 42.42 ? 34  ARG C CG    1 
ATOM   4630 C  CD    . ARG D 4 34  ? -28.068 -22.773 41.544  1.00 42.30 ? 34  ARG C CD    1 
ATOM   4631 N  NE    . ARG D 4 34  ? -28.658 -23.563 40.466  1.00 42.83 ? 34  ARG C NE    1 
ATOM   4632 C  CZ    . ARG D 4 34  ? -28.404 -24.850 40.241  1.00 43.13 ? 34  ARG C CZ    1 
ATOM   4633 N  NH1   . ARG D 4 34  ? -27.574 -25.524 41.028  1.00 43.19 ? 34  ARG C NH1   1 
ATOM   4634 N  NH2   . ARG D 4 34  ? -28.995 -25.471 39.228  1.00 43.24 ? 34  ARG C NH2   1 
ATOM   4635 N  N     . PHE D 4 35  ? -25.163 -18.977 41.214  1.00 42.21 ? 35  PHE C N     1 
ATOM   4636 C  CA    . PHE D 4 35  ? -25.127 -18.113 42.379  1.00 42.23 ? 35  PHE C CA    1 
ATOM   4637 C  C     . PHE D 4 35  ? -26.496 -18.057 43.052  1.00 42.29 ? 35  PHE C C     1 
ATOM   4638 O  O     . PHE D 4 35  ? -27.535 -18.042 42.386  1.00 42.12 ? 35  PHE C O     1 
ATOM   4639 C  CB    . PHE D 4 35  ? -24.655 -16.704 42.004  1.00 42.16 ? 35  PHE C CB    1 
ATOM   4640 C  CG    . PHE D 4 35  ? -24.534 -15.775 43.177  1.00 42.12 ? 35  PHE C CG    1 
ATOM   4641 C  CD1   . PHE D 4 35  ? -23.444 -15.858 44.040  1.00 42.10 ? 35  PHE C CD1   1 
ATOM   4642 C  CD2   . PHE D 4 35  ? -25.513 -14.818 43.424  1.00 42.13 ? 35  PHE C CD2   1 
ATOM   4643 C  CE1   . PHE D 4 35  ? -23.333 -14.999 45.131  1.00 42.00 ? 35  PHE C CE1   1 
ATOM   4644 C  CE2   . PHE D 4 35  ? -25.408 -13.953 44.509  1.00 42.06 ? 35  PHE C CE2   1 
ATOM   4645 C  CZ    . PHE D 4 35  ? -24.317 -14.047 45.365  1.00 42.06 ? 35  PHE C CZ    1 
ATOM   4646 N  N     . SER D 4 36  ? -26.475 -18.035 44.380  1.00 42.41 ? 36  SER C N     1 
ATOM   4647 C  CA    . SER D 4 36  ? -27.676 -17.843 45.178  1.00 42.63 ? 36  SER C CA    1 
ATOM   4648 C  C     . SER D 4 36  ? -27.543 -16.554 45.985  1.00 42.84 ? 36  SER C C     1 
ATOM   4649 O  O     . SER D 4 36  ? -26.540 -16.364 46.673  1.00 42.86 ? 36  SER C O     1 
ATOM   4650 C  CB    . SER D 4 36  ? -27.890 -19.031 46.116  1.00 42.46 ? 36  SER C CB    1 
ATOM   4651 O  OG    . SER D 4 36  ? -28.977 -18.796 46.992  1.00 42.60 ? 36  SER C OG    1 
ATOM   4652 N  N     . PRO D 4 37  ? -28.549 -15.660 45.895  1.00 43.11 ? 37  PRO C N     1 
ATOM   4653 C  CA    . PRO D 4 37  ? -28.580 -14.457 46.732  1.00 43.32 ? 37  PRO C CA    1 
ATOM   4654 C  C     . PRO D 4 37  ? -28.615 -14.793 48.227  1.00 43.61 ? 37  PRO C C     1 
ATOM   4655 O  O     . PRO D 4 37  ? -28.201 -13.980 49.053  1.00 43.62 ? 37  PRO C O     1 
ATOM   4656 C  CB    . PRO D 4 37  ? -29.876 -13.756 46.305  1.00 43.26 ? 37  PRO C CB    1 
ATOM   4657 C  CG    . PRO D 4 37  ? -30.688 -14.807 45.627  1.00 43.21 ? 37  PRO C CG    1 
ATOM   4658 C  CD    . PRO D 4 37  ? -29.706 -15.723 44.984  1.00 43.12 ? 37  PRO C CD    1 
ATOM   4659 N  N     . GLU D 4 38  ? -29.105 -15.987 48.555  1.00 43.99 ? 38  GLU C N     1 
ATOM   4660 C  CA    . GLU D 4 38  ? -29.084 -16.500 49.923  1.00 44.48 ? 38  GLU C CA    1 
ATOM   4661 C  C     . GLU D 4 38  ? -27.677 -16.939 50.334  1.00 44.50 ? 38  GLU C C     1 
ATOM   4662 O  O     . GLU D 4 38  ? -27.323 -16.864 51.511  1.00 44.59 ? 38  GLU C O     1 
ATOM   4663 C  CB    . GLU D 4 38  ? -30.072 -17.662 50.078  1.00 44.57 ? 38  GLU C CB    1 
ATOM   4664 C  CG    . GLU D 4 38  ? -31.516 -17.238 50.353  1.00 45.72 ? 38  GLU C CG    1 
ATOM   4665 C  CD    . GLU D 4 38  ? -32.185 -16.580 49.156  1.00 47.29 ? 38  GLU C CD    1 
ATOM   4666 O  OE1   . GLU D 4 38  ? -32.228 -15.330 49.118  1.00 47.54 ? 38  GLU C OE1   1 
ATOM   4667 O  OE2   . GLU D 4 38  ? -32.657 -17.308 48.253  1.00 48.07 ? 38  GLU C OE2   1 
ATOM   4668 N  N     . ASP D 4 39  ? -26.895 -17.395 49.352  1.00 44.55 ? 39  ASP C N     1 
ATOM   4669 C  CA    . ASP D 4 39  ? -25.497 -17.822 49.533  1.00 44.60 ? 39  ASP C CA    1 
ATOM   4670 C  C     . ASP D 4 39  ? -25.238 -18.512 50.886  1.00 44.57 ? 39  ASP C C     1 
ATOM   4671 O  O     . ASP D 4 39  ? -24.483 -17.992 51.715  1.00 44.61 ? 39  ASP C O     1 
ATOM   4672 C  CB    . ASP D 4 39  ? -24.548 -16.627 49.326  1.00 44.63 ? 39  ASP C CB    1 
ATOM   4673 C  CG    . ASP D 4 39  ? -23.144 -17.047 48.909  1.00 44.70 ? 39  ASP C CG    1 
ATOM   4674 O  OD1   . ASP D 4 39  ? -22.988 -18.099 48.257  1.00 45.51 ? 39  ASP C OD1   1 
ATOM   4675 O  OD2   . ASP D 4 39  ? -22.189 -16.307 49.222  1.00 45.40 ? 39  ASP C OD2   1 
ATOM   4676 N  N     . PRO D 4 40  ? -25.853 -19.695 51.104  1.00 44.54 ? 40  PRO C N     1 
ATOM   4677 C  CA    . PRO D 4 40  ? -25.870 -20.334 52.428  1.00 44.48 ? 40  PRO C CA    1 
ATOM   4678 C  C     . PRO D 4 40  ? -24.492 -20.751 52.945  1.00 44.45 ? 40  PRO C C     1 
ATOM   4679 O  O     . PRO D 4 40  ? -24.286 -20.811 54.157  1.00 44.50 ? 40  PRO C O     1 
ATOM   4680 C  CB    . PRO D 4 40  ? -26.745 -21.580 52.213  1.00 44.45 ? 40  PRO C CB    1 
ATOM   4681 C  CG    . PRO D 4 40  ? -27.467 -21.351 50.932  1.00 44.49 ? 40  PRO C CG    1 
ATOM   4682 C  CD    . PRO D 4 40  ? -26.553 -20.517 50.100  1.00 44.53 ? 40  PRO C CD    1 
ATOM   4683 N  N     . TYR D 4 41  ? -23.562 -21.024 52.034  1.00 44.48 ? 41  TYR C N     1 
ATOM   4684 C  CA    . TYR D 4 41  ? -22.235 -21.515 52.402  1.00 44.41 ? 41  TYR C CA    1 
ATOM   4685 C  C     . TYR D 4 41  ? -21.109 -20.565 51.989  1.00 44.38 ? 41  TYR C C     1 
ATOM   4686 O  O     . TYR D 4 41  ? -19.962 -20.986 51.806  1.00 44.43 ? 41  TYR C O     1 
ATOM   4687 C  CB    . TYR D 4 41  ? -22.027 -22.921 51.826  1.00 44.57 ? 41  TYR C CB    1 
ATOM   4688 C  CG    . TYR D 4 41  ? -23.151 -23.866 52.192  1.00 44.53 ? 41  TYR C CG    1 
ATOM   4689 C  CD1   . TYR D 4 41  ? -24.149 -24.186 51.271  1.00 44.51 ? 41  TYR C CD1   1 
ATOM   4690 C  CD2   . TYR D 4 41  ? -23.236 -24.409 53.473  1.00 44.32 ? 41  TYR C CD2   1 
ATOM   4691 C  CE1   . TYR D 4 41  ? -25.194 -25.042 51.614  1.00 44.72 ? 41  TYR C CE1   1 
ATOM   4692 C  CE2   . TYR D 4 41  ? -24.273 -25.260 53.824  1.00 44.68 ? 41  TYR C CE2   1 
ATOM   4693 C  CZ    . TYR D 4 41  ? -25.249 -25.572 52.893  1.00 44.73 ? 41  TYR C CZ    1 
ATOM   4694 O  OH    . TYR D 4 41  ? -26.274 -26.425 53.246  1.00 45.01 ? 41  TYR C OH    1 
ATOM   4695 N  N     . GLY D 4 42  ? -21.447 -19.281 51.866  1.00 44.18 ? 42  GLY C N     1 
ATOM   4696 C  CA    . GLY D 4 42  ? -20.496 -18.239 51.474  1.00 44.05 ? 42  GLY C CA    1 
ATOM   4697 C  C     . GLY D 4 42  ? -19.359 -18.023 52.457  1.00 43.96 ? 42  GLY C C     1 
ATOM   4698 O  O     . GLY D 4 42  ? -18.241 -17.697 52.053  1.00 43.95 ? 42  GLY C O     1 
ATOM   4699 N  N     . GLU D 4 43  ? -19.646 -18.205 53.746  1.00 43.81 ? 43  GLU C N     1 
ATOM   4700 C  CA    . GLU D 4 43  ? -18.638 -18.076 54.801  1.00 43.69 ? 43  GLU C CA    1 
ATOM   4701 C  C     . GLU D 4 43  ? -17.559 -19.152 54.696  1.00 43.57 ? 43  GLU C C     1 
ATOM   4702 O  O     . GLU D 4 43  ? -16.383 -18.888 54.953  1.00 43.50 ? 43  GLU C O     1 
ATOM   4703 C  CB    . GLU D 4 43  ? -19.291 -18.122 56.187  1.00 43.78 ? 43  GLU C CB    1 
ATOM   4704 C  CG    . GLU D 4 43  ? -20.004 -16.833 56.592  1.00 43.97 ? 43  GLU C CG    1 
ATOM   4705 C  CD    . GLU D 4 43  ? -19.055 -15.656 56.779  1.00 44.00 ? 43  GLU C CD    1 
ATOM   4706 O  OE1   . GLU D 4 43  ? -17.957 -15.849 57.348  1.00 44.07 ? 43  GLU C OE1   1 
ATOM   4707 O  OE2   . GLU D 4 43  ? -19.416 -14.535 56.362  1.00 43.58 ? 43  GLU C OE2   1 
ATOM   4708 N  N     . TYR D 4 44  ? -17.972 -20.359 54.315  1.00 43.38 ? 44  TYR C N     1 
ATOM   4709 C  CA    . TYR D 4 44  ? -17.059 -21.488 54.156  1.00 43.24 ? 44  TYR C CA    1 
ATOM   4710 C  C     . TYR D 4 44  ? -16.258 -21.388 52.861  1.00 43.19 ? 44  TYR C C     1 
ATOM   4711 O  O     . TYR D 4 44  ? -15.094 -21.787 52.817  1.00 43.18 ? 44  TYR C O     1 
ATOM   4712 C  CB    . TYR D 4 44  ? -17.824 -22.812 54.234  1.00 43.25 ? 44  TYR C CB    1 
ATOM   4713 C  CG    . TYR D 4 44  ? -18.535 -23.005 55.555  1.00 43.17 ? 44  TYR C CG    1 
ATOM   4714 C  CD1   . TYR D 4 44  ? -19.896 -22.724 55.683  1.00 43.07 ? 44  TYR C CD1   1 
ATOM   4715 C  CD2   . TYR D 4 44  ? -17.843 -23.446 56.684  1.00 42.90 ? 44  TYR C CD2   1 
ATOM   4716 C  CE1   . TYR D 4 44  ? -20.553 -22.890 56.902  1.00 43.32 ? 44  TYR C CE1   1 
ATOM   4717 C  CE2   . TYR D 4 44  ? -18.489 -23.616 57.903  1.00 43.08 ? 44  TYR C CE2   1 
ATOM   4718 C  CZ    . TYR D 4 44  ? -19.843 -23.336 58.006  1.00 43.22 ? 44  TYR C CZ    1 
ATOM   4719 O  OH    . TYR D 4 44  ? -20.482 -23.504 59.215  1.00 43.41 ? 44  TYR C OH    1 
ATOM   4720 N  N     . ARG D 4 45  ? -16.887 -20.850 51.817  1.00 43.10 ? 45  ARG C N     1 
ATOM   4721 C  CA    . ARG D 4 45  ? -16.205 -20.542 50.560  1.00 43.06 ? 45  ARG C CA    1 
ATOM   4722 C  C     . ARG D 4 45  ? -15.116 -19.481 50.774  1.00 43.00 ? 45  ARG C C     1 
ATOM   4723 O  O     . ARG D 4 45  ? -14.029 -19.576 50.199  1.00 42.96 ? 45  ARG C O     1 
ATOM   4724 C  CB    . ARG D 4 45  ? -17.212 -20.074 49.501  1.00 43.03 ? 45  ARG C CB    1 
ATOM   4725 C  CG    . ARG D 4 45  ? -16.642 -19.967 48.090  1.00 43.03 ? 45  ARG C CG    1 
ATOM   4726 C  CD    . ARG D 4 45  ? -17.670 -19.463 47.080  1.00 42.99 ? 45  ARG C CD    1 
ATOM   4727 N  NE    . ARG D 4 45  ? -18.080 -18.078 47.326  1.00 42.63 ? 45  ARG C NE    1 
ATOM   4728 C  CZ    . ARG D 4 45  ? -19.309 -17.704 47.676  1.00 42.26 ? 45  ARG C CZ    1 
ATOM   4729 N  NH1   . ARG D 4 45  ? -20.271 -18.603 47.812  1.00 41.95 ? 45  ARG C NH1   1 
ATOM   4730 N  NH2   . ARG D 4 45  ? -19.583 -16.421 47.877  1.00 42.76 ? 45  ARG C NH2   1 
ATOM   4731 N  N     . ARG D 4 46  ? -15.414 -18.486 51.610  1.00 42.92 ? 46  ARG C N     1 
ATOM   4732 C  CA    . ARG D 4 46  ? -14.465 -17.414 51.930  1.00 43.02 ? 46  ARG C CA    1 
ATOM   4733 C  C     . ARG D 4 46  ? -13.235 -17.882 52.705  1.00 43.06 ? 46  ARG C C     1 
ATOM   4734 O  O     . ARG D 4 46  ? -12.149 -17.334 52.523  1.00 42.99 ? 46  ARG C O     1 
ATOM   4735 C  CB    . ARG D 4 46  ? -15.156 -16.280 52.687  1.00 42.93 ? 46  ARG C CB    1 
ATOM   4736 C  CG    . ARG D 4 46  ? -15.837 -15.289 51.777  1.00 43.13 ? 46  ARG C CG    1 
ATOM   4737 C  CD    . ARG D 4 46  ? -16.684 -14.299 52.543  1.00 43.02 ? 46  ARG C CD    1 
ATOM   4738 N  NE    . ARG D 4 46  ? -17.918 -14.057 51.808  1.00 44.21 ? 46  ARG C NE    1 
ATOM   4739 C  CZ    . ARG D 4 46  ? -19.135 -14.365 52.243  1.00 43.70 ? 46  ARG C CZ    1 
ATOM   4740 N  NH1   . ARG D 4 46  ? -19.310 -14.895 53.446  1.00 42.29 ? 46  ARG C NH1   1 
ATOM   4741 N  NH2   . ARG D 4 46  ? -20.185 -14.113 51.474  1.00 43.79 ? 46  ARG C NH2   1 
ATOM   4742 N  N     . ARG D 4 47  ? -13.412 -18.880 53.570  1.00 43.14 ? 47  ARG C N     1 
ATOM   4743 C  CA    . ARG D 4 47  ? -12.297 -19.471 54.313  1.00 43.40 ? 47  ARG C CA    1 
ATOM   4744 C  C     . ARG D 4 47  ? -11.305 -20.122 53.353  1.00 43.42 ? 47  ARG C C     1 
ATOM   4745 O  O     . ARG D 4 47  ? -10.092 -19.954 53.488  1.00 43.43 ? 47  ARG C O     1 
ATOM   4746 C  CB    . ARG D 4 47  ? -12.803 -20.491 55.338  1.00 43.35 ? 47  ARG C CB    1 
ATOM   4747 C  CG    . ARG D 4 47  ? -13.548 -19.872 56.508  1.00 43.74 ? 47  ARG C CG    1 
ATOM   4748 C  CD    . ARG D 4 47  ? -13.901 -20.905 57.568  1.00 43.74 ? 47  ARG C CD    1 
ATOM   4749 N  NE    . ARG D 4 47  ? -14.794 -20.346 58.581  1.00 44.51 ? 47  ARG C NE    1 
ATOM   4750 C  CZ    . ARG D 4 47  ? -15.329 -21.036 59.584  1.00 45.07 ? 47  ARG C CZ    1 
ATOM   4751 N  NH1   . ARG D 4 47  ? -15.067 -22.330 59.728  1.00 45.37 ? 47  ARG C NH1   1 
ATOM   4752 N  NH2   . ARG D 4 47  ? -16.128 -20.427 60.450  1.00 45.47 ? 47  ARG C NH2   1 
ATOM   4753 N  N     . TRP D 4 48  ? -11.843 -20.856 52.382  1.00 43.51 ? 48  TRP C N     1 
ATOM   4754 C  CA    . TRP D 4 48  ? -11.067 -21.426 51.285  1.00 43.63 ? 48  TRP C CA    1 
ATOM   4755 C  C     . TRP D 4 48  ? -10.407 -20.335 50.437  1.00 43.69 ? 48  TRP C C     1 
ATOM   4756 O  O     . TRP D 4 48  ? -9.228  -20.440 50.097  1.00 43.69 ? 48  TRP C O     1 
ATOM   4757 C  CB    . TRP D 4 48  ? -11.972 -22.316 50.424  1.00 43.67 ? 48  TRP C CB    1 
ATOM   4758 C  CG    . TRP D 4 48  ? -11.486 -22.575 49.024  1.00 43.63 ? 48  TRP C CG    1 
ATOM   4759 C  CD1   . TRP D 4 48  ? -10.403 -23.323 48.654  1.00 43.76 ? 48  TRP C CD1   1 
ATOM   4760 C  CD2   . TRP D 4 48  ? -12.085 -22.107 47.808  1.00 43.71 ? 48  TRP C CD2   1 
ATOM   4761 N  NE1   . TRP D 4 48  ? -10.285 -23.339 47.284  1.00 43.81 ? 48  TRP C NE1   1 
ATOM   4762 C  CE2   . TRP D 4 48  ? -11.304 -22.601 46.740  1.00 43.66 ? 48  TRP C CE2   1 
ATOM   4763 C  CE3   . TRP D 4 48  ? -13.202 -21.309 47.518  1.00 43.81 ? 48  TRP C CE3   1 
ATOM   4764 C  CZ2   . TRP D 4 48  ? -11.605 -22.328 45.400  1.00 43.66 ? 48  TRP C CZ2   1 
ATOM   4765 C  CZ3   . TRP D 4 48  ? -13.501 -21.038 46.184  1.00 43.80 ? 48  TRP C CZ3   1 
ATOM   4766 C  CH2   . TRP D 4 48  ? -12.703 -21.547 45.143  1.00 43.80 ? 48  TRP C CH2   1 
ATOM   4767 N  N     . LYS D 4 49  ? -11.171 -19.290 50.117  1.00 43.75 ? 49  LYS C N     1 
ATOM   4768 C  CA    . LYS D 4 49  ? -10.697 -18.200 49.262  1.00 43.85 ? 49  LYS C CA    1 
ATOM   4769 C  C     . LYS D 4 49  ? -9.623  -17.344 49.942  1.00 43.91 ? 49  LYS C C     1 
ATOM   4770 O  O     . LYS D 4 49  ? -8.667  -16.922 49.292  1.00 43.93 ? 49  LYS C O     1 
ATOM   4771 C  CB    . LYS D 4 49  ? -11.872 -17.336 48.786  1.00 43.82 ? 49  LYS C CB    1 
ATOM   4772 C  CG    . LYS D 4 49  ? -11.564 -16.475 47.559  1.00 43.88 ? 49  LYS C CG    1 
ATOM   4773 C  CD    . LYS D 4 49  ? -12.833 -15.957 46.882  1.00 43.83 ? 49  LYS C CD    1 
ATOM   4774 C  CE    . LYS D 4 49  ? -13.535 -17.049 46.074  1.00 43.73 ? 49  LYS C CE    1 
ATOM   4775 N  NZ    . LYS D 4 49  ? -14.784 -16.548 45.422  1.00 42.95 ? 49  LYS C NZ    1 
ATOM   4776 N  N     . ARG D 4 50  ? -9.784  -17.095 51.241  1.00 44.07 ? 50  ARG C N     1 
ATOM   4777 C  CA    . ARG D 4 50  ? -8.779  -16.372 52.028  1.00 44.28 ? 50  ARG C CA    1 
ATOM   4778 C  C     . ARG D 4 50  ? -7.474  -17.157 52.136  1.00 44.50 ? 50  ARG C C     1 
ATOM   4779 O  O     . ARG D 4 50  ? -6.392  -16.569 52.162  1.00 44.56 ? 50  ARG C O     1 
ATOM   4780 C  CB    . ARG D 4 50  ? -9.306  -16.037 53.427  1.00 44.24 ? 50  ARG C CB    1 
ATOM   4781 C  CG    . ARG D 4 50  ? -10.235 -14.833 53.474  1.00 44.09 ? 50  ARG C CG    1 
ATOM   4782 C  CD    . ARG D 4 50  ? -10.652 -14.513 54.899  1.00 44.00 ? 50  ARG C CD    1 
ATOM   4783 N  NE    . ARG D 4 50  ? -11.506 -13.330 54.970  1.00 43.87 ? 50  ARG C NE    1 
ATOM   4784 C  CZ    . ARG D 4 50  ? -12.831 -13.355 55.094  1.00 44.14 ? 50  ARG C CZ    1 
ATOM   4785 N  NH1   . ARG D 4 50  ? -13.482 -14.510 55.168  1.00 44.16 ? 50  ARG C NH1   1 
ATOM   4786 N  NH2   . ARG D 4 50  ? -13.511 -12.217 55.147  1.00 44.24 ? 50  ARG C NH2   1 
ATOM   4787 N  N     . GLU D 4 51  ? -7.590  -18.483 52.202  1.00 44.73 ? 51  GLU C N     1 
ATOM   4788 C  CA    . GLU D 4 51  ? -6.438  -19.383 52.213  1.00 44.96 ? 51  GLU C CA    1 
ATOM   4789 C  C     . GLU D 4 51  ? -5.668  -19.302 50.891  1.00 45.05 ? 51  GLU C C     1 
ATOM   4790 O  O     . GLU D 4 51  ? -4.438  -19.211 50.887  1.00 45.03 ? 51  GLU C O     1 
ATOM   4791 C  CB    . GLU D 4 51  ? -6.895  -20.822 52.485  1.00 44.99 ? 51  GLU C CB    1 
ATOM   4792 C  CG    . GLU D 4 51  ? -5.782  -21.868 52.487  1.00 45.31 ? 51  GLU C CG    1 
ATOM   4793 C  CD    . GLU D 4 51  ? -6.287  -23.272 52.184  1.00 45.73 ? 51  GLU C CD    1 
ATOM   4794 O  OE1   . GLU D 4 51  ? -7.224  -23.416 51.367  1.00 45.86 ? 51  GLU C OE1   1 
ATOM   4795 O  OE2   . GLU D 4 51  ? -5.737  -24.237 52.757  1.00 45.91 ? 51  GLU C OE2   1 
ATOM   4796 N  N     . VAL D 4 52  ? -6.405  -19.328 49.780  1.00 45.22 ? 52  VAL C N     1 
ATOM   4797 C  CA    . VAL D 4 52  ? -5.819  -19.280 48.437  1.00 45.37 ? 52  VAL C CA    1 
ATOM   4798 C  C     . VAL D 4 52  ? -5.140  -17.932 48.167  1.00 45.47 ? 52  VAL C C     1 
ATOM   4799 O  O     . VAL D 4 52  ? -3.983  -17.891 47.736  1.00 45.52 ? 52  VAL C O     1 
ATOM   4800 C  CB    . VAL D 4 52  ? -6.877  -19.603 47.335  1.00 45.38 ? 52  VAL C CB    1 
ATOM   4801 C  CG1   . VAL D 4 52  ? -6.320  -19.355 45.935  1.00 45.39 ? 52  VAL C CG1   1 
ATOM   4802 C  CG2   . VAL D 4 52  ? -7.361  -21.044 47.460  1.00 45.34 ? 52  VAL C CG2   1 
ATOM   4803 N  N     . LEU D 4 53  ? -5.856  -16.843 48.443  1.00 45.52 ? 53  LEU C N     1 
ATOM   4804 C  CA    . LEU D 4 53  ? -5.351  -15.488 48.194  1.00 45.66 ? 53  LEU C CA    1 
ATOM   4805 C  C     . LEU D 4 53  ? -4.310  -15.025 49.219  1.00 45.67 ? 53  LEU C C     1 
ATOM   4806 O  O     . LEU D 4 53  ? -3.597  -14.047 48.986  1.00 45.68 ? 53  LEU C O     1 
ATOM   4807 C  CB    . LEU D 4 53  ? -6.509  -14.481 48.121  1.00 45.65 ? 53  LEU C CB    1 
ATOM   4808 C  CG    . LEU D 4 53  ? -7.603  -14.687 47.064  1.00 45.77 ? 53  LEU C CG    1 
ATOM   4809 C  CD1   . LEU D 4 53  ? -8.708  -13.654 47.234  1.00 46.02 ? 53  LEU C CD1   1 
ATOM   4810 C  CD2   . LEU D 4 53  ? -7.046  -14.654 45.642  1.00 46.09 ? 53  LEU C CD2   1 
ATOM   4811 N  N     . GLY D 4 54  ? -4.227  -15.731 50.346  1.00 45.70 ? 54  GLY C N     1 
ATOM   4812 C  CA    . GLY D 4 54  ? -3.283  -15.396 51.409  1.00 45.78 ? 54  GLY C CA    1 
ATOM   4813 C  C     . GLY D 4 54  ? -3.753  -14.239 52.270  1.00 45.83 ? 54  GLY C C     1 
ATOM   4814 O  O     . GLY D 4 54  ? -3.006  -13.286 52.503  1.00 45.83 ? 54  GLY C O     1 
ATOM   4815 N  N     . ILE D 4 55  ? -4.994  -14.329 52.741  1.00 45.85 ? 55  ILE C N     1 
ATOM   4816 C  CA    . ILE D 4 55  ? -5.598  -13.298 53.583  1.00 45.90 ? 55  ILE C CA    1 
ATOM   4817 C  C     . ILE D 4 55  ? -5.853  -13.848 54.985  1.00 45.90 ? 55  ILE C C     1 
ATOM   4818 O  O     . ILE D 4 55  ? -5.115  -13.546 55.924  1.00 45.91 ? 55  ILE C O     1 
ATOM   4819 C  CB    . ILE D 4 55  ? -6.919  -12.759 52.970  1.00 45.89 ? 55  ILE C CB    1 
ATOM   4820 C  CG1   . ILE D 4 55  ? -6.657  -12.135 51.593  1.00 45.96 ? 55  ILE C CG1   1 
ATOM   4821 C  CG2   . ILE D 4 55  ? -7.578  -11.742 53.908  1.00 45.97 ? 55  ILE C CG2   1 
ATOM   4822 C  CD1   . ILE D 4 55  ? -7.896  -11.975 50.722  1.00 45.92 ? 55  ILE C CD1   1 
ATOM   4823 N  N     . LYS E 5 4   ? -3.263  -29.935 40.491  1.00 42.41 ? 4   LYS D N     1 
ATOM   4824 C  CA    . LYS E 5 4   ? -4.696  -30.226 40.806  1.00 42.44 ? 4   LYS D CA    1 
ATOM   4825 C  C     . LYS E 5 4   ? -5.348  -29.106 41.638  1.00 42.34 ? 4   LYS D C     1 
ATOM   4826 O  O     . LYS E 5 4   ? -4.641  -28.355 42.316  1.00 42.39 ? 4   LYS D O     1 
ATOM   4827 C  CB    . LYS E 5 4   ? -4.844  -31.603 41.473  1.00 42.46 ? 4   LYS D CB    1 
ATOM   4828 C  CG    . LYS E 5 4   ? -3.981  -31.845 42.698  1.00 42.53 ? 4   LYS D CG    1 
ATOM   4829 C  CD    . LYS E 5 4   ? -4.082  -33.299 43.129  1.00 42.58 ? 4   LYS D CD    1 
ATOM   4830 C  CE    . LYS E 5 4   ? -3.220  -33.585 44.343  1.00 42.87 ? 4   LYS D CE    1 
ATOM   4831 N  NZ    . LYS E 5 4   ? -3.287  -35.020 44.740  1.00 42.93 ? 4   LYS D NZ    1 
ATOM   4832 N  N     . PRO E 5 5   ? -6.695  -28.994 41.585  1.00 42.19 ? 5   PRO D N     1 
ATOM   4833 C  CA    . PRO E 5 5   ? -7.436  -27.838 42.115  1.00 42.07 ? 5   PRO D CA    1 
ATOM   4834 C  C     . PRO E 5 5   ? -7.163  -27.480 43.579  1.00 41.90 ? 5   PRO D C     1 
ATOM   4835 O  O     . PRO E 5 5   ? -6.798  -28.343 44.382  1.00 41.93 ? 5   PRO D O     1 
ATOM   4836 C  CB    . PRO E 5 5   ? -8.906  -28.238 41.925  1.00 42.02 ? 5   PRO D CB    1 
ATOM   4837 C  CG    . PRO E 5 5   ? -8.892  -29.698 41.716  1.00 42.16 ? 5   PRO D CG    1 
ATOM   4838 C  CD    . PRO E 5 5   ? -7.617  -29.987 41.007  1.00 42.23 ? 5   PRO D CD    1 
ATOM   4839 N  N     . SER E 5 6   ? -7.373  -26.205 43.900  1.00 41.63 ? 6   SER D N     1 
ATOM   4840 C  CA    . SER E 5 6   ? -7.002  -25.621 45.189  1.00 41.42 ? 6   SER D CA    1 
ATOM   4841 C  C     . SER E 5 6   ? -7.857  -26.067 46.378  1.00 41.26 ? 6   SER D C     1 
ATOM   4842 O  O     . SER E 5 6   ? -7.478  -25.838 47.529  1.00 41.27 ? 6   SER D O     1 
ATOM   4843 C  CB    . SER E 5 6   ? -7.020  -24.091 45.089  1.00 41.39 ? 6   SER D CB    1 
ATOM   4844 O  OG    . SER E 5 6   ? -8.323  -23.620 44.787  1.00 41.22 ? 6   SER D OG    1 
ATOM   4845 N  N     . TYR E 5 7   ? -9.001  -26.692 46.108  1.00 41.03 ? 7   TYR D N     1 
ATOM   4846 C  CA    . TYR E 5 7   ? -9.873  -27.169 47.183  1.00 40.89 ? 7   TYR D CA    1 
ATOM   4847 C  C     . TYR E 5 7   ? -9.395  -28.500 47.765  1.00 40.92 ? 7   TYR D C     1 
ATOM   4848 O  O     . TYR E 5 7   ? -9.884  -28.939 48.808  1.00 40.87 ? 7   TYR D O     1 
ATOM   4849 C  CB    . TYR E 5 7   ? -11.343 -27.240 46.737  1.00 40.81 ? 7   TYR D CB    1 
ATOM   4850 C  CG    . TYR E 5 7   ? -11.673 -28.328 45.736  1.00 40.59 ? 7   TYR D CG    1 
ATOM   4851 C  CD1   . TYR E 5 7   ? -11.916 -29.640 46.150  1.00 40.32 ? 7   TYR D CD1   1 
ATOM   4852 C  CD2   . TYR E 5 7   ? -11.773 -28.039 44.376  1.00 40.50 ? 7   TYR D CD2   1 
ATOM   4853 C  CE1   . TYR E 5 7   ? -12.225 -30.638 45.233  1.00 40.43 ? 7   TYR D CE1   1 
ATOM   4854 C  CE2   . TYR E 5 7   ? -12.087 -29.026 43.452  1.00 40.24 ? 7   TYR D CE2   1 
ATOM   4855 C  CZ    . TYR E 5 7   ? -12.310 -30.321 43.885  1.00 40.54 ? 7   TYR D CZ    1 
ATOM   4856 O  OH    . TYR E 5 7   ? -12.617 -31.296 42.968  1.00 40.61 ? 7   TYR D OH    1 
ATOM   4857 N  N     . VAL E 5 8   ? -8.444  -29.134 47.079  1.00 40.95 ? 8   VAL D N     1 
ATOM   4858 C  CA    . VAL E 5 8   ? -7.812  -30.362 47.558  1.00 41.04 ? 8   VAL D CA    1 
ATOM   4859 C  C     . VAL E 5 8   ? -6.717  -29.991 48.563  1.00 41.12 ? 8   VAL D C     1 
ATOM   4860 O  O     . VAL E 5 8   ? -5.625  -29.560 48.182  1.00 41.11 ? 8   VAL D O     1 
ATOM   4861 C  CB    . VAL E 5 8   ? -7.239  -31.214 46.392  1.00 41.03 ? 8   VAL D CB    1 
ATOM   4862 C  CG1   . VAL E 5 8   ? -6.681  -32.533 46.906  1.00 40.84 ? 8   VAL D CG1   1 
ATOM   4863 C  CG2   . VAL E 5 8   ? -8.312  -31.475 45.333  1.00 41.06 ? 8   VAL D CG2   1 
ATOM   4864 N  N     . LYS E 5 9   ? -7.034  -30.154 49.845  1.00 41.27 ? 9   LYS D N     1 
ATOM   4865 C  CA    . LYS E 5 9   ? -6.158  -29.735 50.942  1.00 41.44 ? 9   LYS D CA    1 
ATOM   4866 C  C     . LYS E 5 9   ? -4.890  -30.574 51.112  1.00 41.43 ? 9   LYS D C     1 
ATOM   4867 O  O     . LYS E 5 9   ? -3.849  -30.049 51.512  1.00 41.39 ? 9   LYS D O     1 
ATOM   4868 C  CB    . LYS E 5 9   ? -6.938  -29.693 52.262  1.00 41.53 ? 9   LYS D CB    1 
ATOM   4869 C  CG    . LYS E 5 9   ? -7.348  -28.292 52.718  1.00 41.98 ? 9   LYS D CG    1 
ATOM   4870 C  CD    . LYS E 5 9   ? -8.495  -27.714 51.901  1.00 42.37 ? 9   LYS D CD    1 
ATOM   4871 C  CE    . LYS E 5 9   ? -8.823  -26.297 52.356  1.00 42.91 ? 9   LYS D CE    1 
ATOM   4872 N  NZ    . LYS E 5 9   ? -9.836  -25.641 51.478  1.00 42.77 ? 9   LYS D NZ    1 
ATOM   4873 N  N     . PHE E 5 10  ? -4.982  -31.869 50.814  1.00 41.45 ? 10  PHE D N     1 
ATOM   4874 C  CA    . PHE E 5 10  ? -3.854  -32.785 50.999  1.00 41.49 ? 10  PHE D CA    1 
ATOM   4875 C  C     . PHE E 5 10  ? -3.741  -33.839 49.894  1.00 41.65 ? 10  PHE D C     1 
ATOM   4876 O  O     . PHE E 5 10  ? -4.706  -34.110 49.175  1.00 41.63 ? 10  PHE D O     1 
ATOM   4877 C  CB    . PHE E 5 10  ? -3.905  -33.451 52.386  1.00 41.34 ? 10  PHE D CB    1 
ATOM   4878 C  CG    . PHE E 5 10  ? -5.241  -34.055 52.730  1.00 41.06 ? 10  PHE D CG    1 
ATOM   4879 C  CD1   . PHE E 5 10  ? -5.552  -35.359 52.350  1.00 40.86 ? 10  PHE D CD1   1 
ATOM   4880 C  CD2   . PHE E 5 10  ? -6.184  -33.325 53.449  1.00 40.82 ? 10  PHE D CD2   1 
ATOM   4881 C  CE1   . PHE E 5 10  ? -6.787  -35.922 52.670  1.00 40.88 ? 10  PHE D CE1   1 
ATOM   4882 C  CE2   . PHE E 5 10  ? -7.422  -33.878 53.772  1.00 40.79 ? 10  PHE D CE2   1 
ATOM   4883 C  CZ    . PHE E 5 10  ? -7.724  -35.179 53.382  1.00 41.01 ? 10  PHE D CZ    1 
ATOM   4884 N  N     . GLU E 5 11  ? -2.547  -34.419 49.773  1.00 41.83 ? 11  GLU D N     1 
ATOM   4885 C  CA    . GLU E 5 11  ? -2.255  -35.452 48.784  1.00 42.03 ? 11  GLU D CA    1 
ATOM   4886 C  C     . GLU E 5 11  ? -2.753  -36.813 49.269  1.00 42.10 ? 11  GLU D C     1 
ATOM   4887 O  O     . GLU E 5 11  ? -2.395  -37.264 50.362  1.00 42.11 ? 11  GLU D O     1 
ATOM   4888 C  CB    . GLU E 5 11  ? -0.747  -35.507 48.510  1.00 42.06 ? 11  GLU D CB    1 
ATOM   4889 C  CG    . GLU E 5 11  ? -0.340  -36.328 47.286  1.00 42.42 ? 11  GLU D CG    1 
ATOM   4890 C  CD    . GLU E 5 11  ? -0.284  -35.515 45.999  1.00 42.86 ? 11  GLU D CD    1 
ATOM   4891 O  OE1   . GLU E 5 11  ? -0.541  -34.291 46.038  1.00 42.97 ? 11  GLU D OE1   1 
ATOM   4892 O  OE2   . GLU E 5 11  ? 0.028   -36.106 44.942  1.00 42.93 ? 11  GLU D OE2   1 
ATOM   4893 N  N     . VAL E 5 12  ? -3.576  -37.460 48.448  1.00 42.18 ? 12  VAL D N     1 
ATOM   4894 C  CA    . VAL E 5 12  ? -4.153  -38.762 48.782  1.00 42.29 ? 12  VAL D CA    1 
ATOM   4895 C  C     . VAL E 5 12  ? -3.458  -39.883 48.000  1.00 42.40 ? 12  VAL D C     1 
ATOM   4896 O  O     . VAL E 5 12  ? -3.404  -39.837 46.768  1.00 42.44 ? 12  VAL D O     1 
ATOM   4897 C  CB    . VAL E 5 12  ? -5.686  -38.784 48.531  1.00 42.30 ? 12  VAL D CB    1 
ATOM   4898 C  CG1   . VAL E 5 12  ? -6.253  -40.195 48.677  1.00 42.22 ? 12  VAL D CG1   1 
ATOM   4899 C  CG2   . VAL E 5 12  ? -6.395  -37.822 49.475  1.00 42.18 ? 12  VAL D CG2   1 
ATOM   4900 N  N     . PRO E 5 13  ? -2.910  -40.886 48.719  1.00 42.50 ? 13  PRO D N     1 
ATOM   4901 C  CA    . PRO E 5 13  ? -2.283  -42.054 48.090  1.00 42.58 ? 13  PRO D CA    1 
ATOM   4902 C  C     . PRO E 5 13  ? -3.274  -42.877 47.269  1.00 42.66 ? 13  PRO D C     1 
ATOM   4903 O  O     . PRO E 5 13  ? -4.462  -42.924 47.595  1.00 42.63 ? 13  PRO D O     1 
ATOM   4904 C  CB    . PRO E 5 13  ? -1.784  -42.873 49.287  1.00 42.56 ? 13  PRO D CB    1 
ATOM   4905 C  CG    . PRO E 5 13  ? -1.706  -41.905 50.416  1.00 42.55 ? 13  PRO D CG    1 
ATOM   4906 C  CD    . PRO E 5 13  ? -2.837  -40.960 50.189  1.00 42.50 ? 13  PRO D CD    1 
ATOM   4907 N  N     . LYS E 5 14  ? -2.770  -43.520 46.216  1.00 42.82 ? 14  LYS D N     1 
ATOM   4908 C  CA    . LYS E 5 14  ? -3.580  -44.332 45.300  1.00 42.96 ? 14  LYS D CA    1 
ATOM   4909 C  C     . LYS E 5 14  ? -4.363  -45.437 46.018  1.00 43.02 ? 14  LYS D C     1 
ATOM   4910 O  O     . LYS E 5 14  ? -5.505  -45.732 45.655  1.00 43.00 ? 14  LYS D O     1 
ATOM   4911 C  CB    . LYS E 5 14  ? -2.685  -44.939 44.212  1.00 42.99 ? 14  LYS D CB    1 
ATOM   4912 C  CG    . LYS E 5 14  ? -3.429  -45.618 43.069  1.00 43.10 ? 14  LYS D CG    1 
ATOM   4913 C  CD    . LYS E 5 14  ? -2.489  -46.479 42.240  1.00 43.07 ? 14  LYS D CD    1 
ATOM   4914 C  CE    . LYS E 5 14  ? -3.248  -47.299 41.209  1.00 43.13 ? 14  LYS D CE    1 
ATOM   4915 N  NZ    . LYS E 5 14  ? -2.369  -48.296 40.536  1.00 42.92 ? 14  LYS D NZ    1 
ATOM   4916 N  N     . GLU E 5 15  ? -3.742  -46.033 47.035  1.00 43.11 ? 15  GLU D N     1 
ATOM   4917 C  CA    . GLU E 5 15  ? -4.344  -47.122 47.807  1.00 43.20 ? 15  GLU D CA    1 
ATOM   4918 C  C     . GLU E 5 15  ? -5.501  -46.648 48.685  1.00 43.23 ? 15  GLU D C     1 
ATOM   4919 O  O     . GLU E 5 15  ? -6.521  -47.332 48.798  1.00 43.22 ? 15  GLU D O     1 
ATOM   4920 C  CB    . GLU E 5 15  ? -3.288  -47.819 48.674  1.00 43.20 ? 15  GLU D CB    1 
ATOM   4921 C  CG    . GLU E 5 15  ? -2.249  -48.632 47.900  1.00 43.38 ? 15  GLU D CG    1 
ATOM   4922 C  CD    . GLU E 5 15  ? -1.148  -47.781 47.276  1.00 43.54 ? 15  GLU D CD    1 
ATOM   4923 O  OE1   . GLU E 5 15  ? -0.988  -46.603 47.669  1.00 43.36 ? 15  GLU D OE1   1 
ATOM   4924 O  OE2   . GLU E 5 15  ? -0.436  -48.299 46.390  1.00 43.68 ? 15  GLU D OE2   1 
ATOM   4925 N  N     . LEU E 5 16  ? -5.334  -45.478 49.300  1.00 43.26 ? 16  LEU D N     1 
ATOM   4926 C  CA    . LEU E 5 16  ? -6.335  -44.920 50.211  1.00 43.37 ? 16  LEU D CA    1 
ATOM   4927 C  C     . LEU E 5 16  ? -7.584  -44.434 49.474  1.00 43.40 ? 16  LEU D C     1 
ATOM   4928 O  O     . LEU E 5 16  ? -8.691  -44.487 50.017  1.00 43.41 ? 16  LEU D O     1 
ATOM   4929 C  CB    . LEU E 5 16  ? -5.727  -43.786 51.047  1.00 43.39 ? 16  LEU D CB    1 
ATOM   4930 C  CG    . LEU E 5 16  ? -6.462  -43.334 52.315  1.00 43.42 ? 16  LEU D CG    1 
ATOM   4931 C  CD1   . LEU E 5 16  ? -6.443  -44.416 53.390  1.00 43.55 ? 16  LEU D CD1   1 
ATOM   4932 C  CD2   . LEU E 5 16  ? -5.853  -42.049 52.847  1.00 43.40 ? 16  LEU D CD2   1 
ATOM   4933 N  N     . ALA E 5 17  ? -7.397  -43.962 48.243  1.00 43.47 ? 17  ALA D N     1 
ATOM   4934 C  CA    . ALA E 5 17  ? -8.505  -43.528 47.392  1.00 43.49 ? 17  ALA D CA    1 
ATOM   4935 C  C     . ALA E 5 17  ? -9.381  -44.711 46.979  1.00 43.49 ? 17  ALA D C     1 
ATOM   4936 O  O     . ALA E 5 17  ? -10.605 -44.584 46.890  1.00 43.48 ? 17  ALA D O     1 
ATOM   4937 C  CB    . ALA E 5 17  ? -7.979  -42.792 46.167  1.00 43.52 ? 17  ALA D CB    1 
ATOM   4938 N  N     . GLU E 5 18  ? -8.744  -45.855 46.731  1.00 43.46 ? 18  GLU D N     1 
ATOM   4939 C  CA    . GLU E 5 18  ? -9.451  -47.102 46.437  1.00 43.51 ? 18  GLU D CA    1 
ATOM   4940 C  C     . GLU E 5 18  ? -10.253 -47.598 47.637  1.00 43.44 ? 18  GLU D C     1 
ATOM   4941 O  O     . GLU E 5 18  ? -11.389 -48.048 47.483  1.00 43.42 ? 18  GLU D O     1 
ATOM   4942 C  CB    . GLU E 5 18  ? -8.473  -48.185 45.969  1.00 43.53 ? 18  GLU D CB    1 
ATOM   4943 C  CG    . GLU E 5 18  ? -8.313  -48.284 44.456  1.00 43.79 ? 18  GLU D CG    1 
ATOM   4944 C  CD    . GLU E 5 18  ? -9.431  -49.075 43.792  1.00 44.05 ? 18  GLU D CD    1 
ATOM   4945 O  OE1   . GLU E 5 18  ? -9.151  -50.178 43.275  1.00 44.22 ? 18  GLU D OE1   1 
ATOM   4946 O  OE2   . GLU E 5 18  ? -10.588 -48.602 43.788  1.00 44.28 ? 18  GLU D OE2   1 
ATOM   4947 N  N     . LYS E 5 19  ? -9.655  -47.505 48.825  1.00 43.40 ? 19  LYS D N     1 
ATOM   4948 C  CA    . LYS E 5 19  ? -10.315 -47.888 50.076  1.00 43.40 ? 19  LYS D CA    1 
ATOM   4949 C  C     . LYS E 5 19  ? -11.547 -47.031 50.371  1.00 43.44 ? 19  LYS D C     1 
ATOM   4950 O  O     . LYS E 5 19  ? -12.526 -47.521 50.939  1.00 43.48 ? 19  LYS D O     1 
ATOM   4951 C  CB    . LYS E 5 19  ? -9.332  -47.825 51.249  1.00 43.40 ? 19  LYS D CB    1 
ATOM   4952 C  CG    . LYS E 5 19  ? -8.301  -48.947 51.259  1.00 43.38 ? 19  LYS D CG    1 
ATOM   4953 C  CD    . LYS E 5 19  ? -7.433  -48.895 52.508  1.00 43.34 ? 19  LYS D CD    1 
ATOM   4954 C  CE    . LYS E 5 19  ? -6.448  -50.056 52.556  1.00 43.23 ? 19  LYS D CE    1 
ATOM   4955 N  NZ    . LYS E 5 19  ? -7.123  -51.375 52.733  1.00 43.03 ? 19  LYS D NZ    1 
ATOM   4956 N  N     . ALA E 5 20  ? -11.487 -45.758 49.981  1.00 43.43 ? 20  ALA D N     1 
ATOM   4957 C  CA    . ALA E 5 20  ? -12.612 -44.835 50.123  1.00 43.45 ? 20  ALA D CA    1 
ATOM   4958 C  C     . ALA E 5 20  ? -13.748 -45.188 49.167  1.00 43.43 ? 20  ALA D C     1 
ATOM   4959 O  O     . ALA E 5 20  ? -14.920 -45.149 49.547  1.00 43.40 ? 20  ALA D O     1 
ATOM   4960 C  CB    . ALA E 5 20  ? -12.157 -43.395 49.909  1.00 43.40 ? 20  ALA D CB    1 
ATOM   4961 N  N     . LEU E 5 21  ? -13.390 -45.533 47.931  1.00 43.44 ? 21  LEU D N     1 
ATOM   4962 C  CA    . LEU E 5 21  ? -14.361 -45.949 46.918  1.00 43.45 ? 21  LEU D CA    1 
ATOM   4963 C  C     . LEU E 5 21  ? -14.996 -47.294 47.267  1.00 43.43 ? 21  LEU D C     1 
ATOM   4964 O  O     . LEU E 5 21  ? -16.181 -47.510 47.005  1.00 43.42 ? 21  LEU D O     1 
ATOM   4965 C  CB    . LEU E 5 21  ? -13.714 -46.001 45.528  1.00 43.46 ? 21  LEU D CB    1 
ATOM   4966 C  CG    . LEU E 5 21  ? -13.363 -44.664 44.861  1.00 43.35 ? 21  LEU D CG    1 
ATOM   4967 C  CD1   . LEU E 5 21  ? -12.392 -44.875 43.707  1.00 43.36 ? 21  LEU D CD1   1 
ATOM   4968 C  CD2   . LEU E 5 21  ? -14.611 -43.929 44.386  1.00 43.05 ? 21  LEU D CD2   1 
ATOM   4969 N  N     . GLN E 5 22  ? -14.200 -48.185 47.860  1.00 43.44 ? 22  GLN D N     1 
ATOM   4970 C  CA    . GLN E 5 22  ? -14.691 -49.460 48.389  1.00 43.43 ? 22  GLN D CA    1 
ATOM   4971 C  C     . GLN E 5 22  ? -15.682 -49.231 49.528  1.00 43.35 ? 22  GLN D C     1 
ATOM   4972 O  O     . GLN E 5 22  ? -16.698 -49.922 49.621  1.00 43.32 ? 22  GLN D O     1 
ATOM   4973 C  CB    . GLN E 5 22  ? -13.530 -50.329 48.884  1.00 43.45 ? 22  GLN D CB    1 
ATOM   4974 C  CG    . GLN E 5 22  ? -12.729 -51.022 47.786  1.00 43.52 ? 22  GLN D CG    1 
ATOM   4975 C  CD    . GLN E 5 22  ? -11.525 -51.795 48.316  1.00 43.61 ? 22  GLN D CD    1 
ATOM   4976 O  OE1   . GLN E 5 22  ? -10.887 -52.546 47.578  1.00 43.91 ? 22  GLN D OE1   1 
ATOM   4977 N  NE2   . GLN E 5 22  ? -11.211 -51.613 49.597  1.00 43.85 ? 22  GLN D NE2   1 
ATOM   4978 N  N     . ALA E 5 23  ? -15.377 -48.254 50.383  1.00 43.31 ? 23  ALA D N     1 
ATOM   4979 C  CA    . ALA E 5 23  ? -16.228 -47.901 51.521  1.00 43.28 ? 23  ALA D CA    1 
ATOM   4980 C  C     . ALA E 5 23  ? -17.586 -47.342 51.096  1.00 43.29 ? 23  ALA D C     1 
ATOM   4981 O  O     . ALA E 5 23  ? -18.583 -47.541 51.791  1.00 43.27 ? 23  ALA D O     1 
ATOM   4982 C  CB    . ALA E 5 23  ? -15.510 -46.923 52.442  1.00 43.27 ? 23  ALA D CB    1 
ATOM   4983 N  N     . VAL E 5 24  ? -17.618 -46.644 49.960  1.00 43.28 ? 24  VAL D N     1 
ATOM   4984 C  CA    . VAL E 5 24  ? -18.873 -46.149 49.388  1.00 43.36 ? 24  VAL D CA    1 
ATOM   4985 C  C     . VAL E 5 24  ? -19.676 -47.318 48.809  1.00 43.38 ? 24  VAL D C     1 
ATOM   4986 O  O     . VAL E 5 24  ? -20.877 -47.436 49.058  1.00 43.36 ? 24  VAL D O     1 
ATOM   4987 C  CB    . VAL E 5 24  ? -18.638 -45.056 48.303  1.00 43.34 ? 24  VAL D CB    1 
ATOM   4988 C  CG1   . VAL E 5 24  ? -19.958 -44.590 47.695  1.00 43.32 ? 24  VAL D CG1   1 
ATOM   4989 C  CG2   . VAL E 5 24  ? -17.891 -43.867 48.884  1.00 43.35 ? 24  VAL D CG2   1 
ATOM   4990 N  N     . GLU E 5 25  ? -18.992 -48.178 48.053  1.00 43.45 ? 25  GLU D N     1 
ATOM   4991 C  CA    . GLU E 5 25  ? -19.597 -49.350 47.415  1.00 43.60 ? 25  GLU D CA    1 
ATOM   4992 C  C     . GLU E 5 25  ? -20.307 -50.270 48.416  1.00 43.64 ? 25  GLU D C     1 
ATOM   4993 O  O     . GLU E 5 25  ? -21.449 -50.671 48.188  1.00 43.63 ? 25  GLU D O     1 
ATOM   4994 C  CB    . GLU E 5 25  ? -18.530 -50.121 46.619  1.00 43.63 ? 25  GLU D CB    1 
ATOM   4995 C  CG    . GLU E 5 25  ? -18.961 -51.488 46.075  1.00 43.80 ? 25  GLU D CG    1 
ATOM   4996 C  CD    . GLU E 5 25  ? -19.716 -51.422 44.750  1.00 44.03 ? 25  GLU D CD    1 
ATOM   4997 O  OE1   . GLU E 5 25  ? -19.978 -52.502 44.174  1.00 44.19 ? 25  GLU D OE1   1 
ATOM   4998 O  OE2   . GLU E 5 25  ? -20.045 -50.311 44.280  1.00 43.87 ? 25  GLU D OE2   1 
ATOM   4999 N  N     . ILE E 5 26  ? -19.631 -50.583 49.520  1.00 43.72 ? 26  ILE D N     1 
ATOM   5000 C  CA    . ILE E 5 26  ? -20.162 -51.498 50.536  1.00 43.85 ? 26  ILE D CA    1 
ATOM   5001 C  C     . ILE E 5 26  ? -21.301 -50.874 51.355  1.00 43.91 ? 26  ILE D C     1 
ATOM   5002 O  O     . ILE E 5 26  ? -22.352 -51.494 51.530  1.00 43.88 ? 26  ILE D O     1 
ATOM   5003 C  CB    . ILE E 5 26  ? -19.040 -52.037 51.472  1.00 43.86 ? 26  ILE D CB    1 
ATOM   5004 C  CG1   . ILE E 5 26  ? -17.976 -52.784 50.659  1.00 43.94 ? 26  ILE D CG1   1 
ATOM   5005 C  CG2   . ILE E 5 26  ? -19.618 -52.956 52.549  1.00 43.83 ? 26  ILE D CG2   1 
ATOM   5006 C  CD1   . ILE E 5 26  ? -16.626 -52.906 51.350  1.00 44.23 ? 26  ILE D CD1   1 
ATOM   5007 N  N     . ALA E 5 27  ? -21.089 -49.649 51.836  1.00 44.03 ? 27  ALA D N     1 
ATOM   5008 C  CA    . ALA E 5 27  ? -22.078 -48.940 52.658  1.00 44.15 ? 27  ALA D CA    1 
ATOM   5009 C  C     . ALA E 5 27  ? -23.368 -48.599 51.904  1.00 44.22 ? 27  ALA D C     1 
ATOM   5010 O  O     . ALA E 5 27  ? -24.409 -48.371 52.521  1.00 44.24 ? 27  ALA D O     1 
ATOM   5011 C  CB    . ALA E 5 27  ? -21.467 -47.680 53.256  1.00 44.12 ? 27  ALA D CB    1 
ATOM   5012 N  N     . ARG E 5 28  ? -23.286 -48.570 50.576  1.00 44.32 ? 28  ARG D N     1 
ATOM   5013 C  CA    . ARG E 5 28  ? -24.428 -48.269 49.711  1.00 44.41 ? 28  ARG D CA    1 
ATOM   5014 C  C     . ARG E 5 28  ? -25.543 -49.313 49.835  1.00 44.44 ? 28  ARG D C     1 
ATOM   5015 O  O     . ARG E 5 28  ? -26.725 -48.966 49.892  1.00 44.43 ? 28  ARG D O     1 
ATOM   5016 C  CB    . ARG E 5 28  ? -23.958 -48.155 48.257  1.00 44.36 ? 28  ARG D CB    1 
ATOM   5017 C  CG    . ARG E 5 28  ? -25.061 -47.993 47.221  1.00 44.36 ? 28  ARG D CG    1 
ATOM   5018 C  CD    . ARG E 5 28  ? -24.555 -48.373 45.839  1.00 44.13 ? 28  ARG D CD    1 
ATOM   5019 N  NE    . ARG E 5 28  ? -24.198 -49.788 45.751  1.00 43.71 ? 28  ARG D NE    1 
ATOM   5020 C  CZ    . ARG E 5 28  ? -23.405 -50.314 44.821  1.00 43.71 ? 28  ARG D CZ    1 
ATOM   5021 N  NH1   . ARG E 5 28  ? -22.862 -49.548 43.882  1.00 43.35 ? 28  ARG D NH1   1 
ATOM   5022 N  NH2   . ARG E 5 28  ? -23.147 -51.615 44.834  1.00 43.63 ? 28  ARG D NH2   1 
ATOM   5023 N  N     . ASP E 5 29  ? -25.157 -50.585 49.885  1.00 44.55 ? 29  ASP D N     1 
ATOM   5024 C  CA    . ASP E 5 29  ? -26.120 -51.687 49.909  1.00 44.65 ? 29  ASP D CA    1 
ATOM   5025 C  C     . ASP E 5 29  ? -26.248 -52.384 51.268  1.00 44.63 ? 29  ASP D C     1 
ATOM   5026 O  O     . ASP E 5 29  ? -27.149 -53.205 51.461  1.00 44.64 ? 29  ASP D O     1 
ATOM   5027 C  CB    . ASP E 5 29  ? -25.809 -52.700 48.797  1.00 44.72 ? 29  ASP D CB    1 
ATOM   5028 C  CG    . ASP E 5 29  ? -24.340 -53.081 48.742  1.00 44.89 ? 29  ASP D CG    1 
ATOM   5029 O  OD1   . ASP E 5 29  ? -23.641 -52.604 47.823  1.00 44.93 ? 29  ASP D OD1   1 
ATOM   5030 O  OD2   . ASP E 5 29  ? -23.884 -53.850 49.614  1.00 45.17 ? 29  ASP D OD2   1 
ATOM   5031 N  N     . THR E 5 30  ? -25.360 -52.051 52.203  1.00 44.65 ? 30  THR D N     1 
ATOM   5032 C  CA    . THR E 5 30  ? -25.405 -52.628 53.552  1.00 44.69 ? 30  THR D CA    1 
ATOM   5033 C  C     . THR E 5 30  ? -25.832 -51.617 54.619  1.00 44.73 ? 30  THR D C     1 
ATOM   5034 O  O     . THR E 5 30  ? -26.350 -51.998 55.670  1.00 44.78 ? 30  THR D O     1 
ATOM   5035 C  CB    . THR E 5 30  ? -24.057 -53.279 53.962  1.00 44.67 ? 30  THR D CB    1 
ATOM   5036 O  OG1   . THR E 5 30  ? -23.022 -52.289 53.979  1.00 44.65 ? 30  THR D OG1   1 
ATOM   5037 C  CG2   . THR E 5 30  ? -23.676 -54.404 53.003  1.00 44.58 ? 30  THR D CG2   1 
ATOM   5038 N  N     . GLY E 5 31  ? -25.611 -50.333 54.343  1.00 44.82 ? 31  GLY D N     1 
ATOM   5039 C  CA    . GLY E 5 31  ? -25.973 -49.263 55.271  1.00 44.86 ? 31  GLY D CA    1 
ATOM   5040 C  C     . GLY E 5 31  ? -26.761 -48.152 54.604  1.00 44.87 ? 31  GLY D C     1 
ATOM   5041 O  O     . GLY E 5 31  ? -27.772 -48.406 53.948  1.00 44.84 ? 31  GLY D O     1 
ATOM   5042 N  N     . LYS E 5 32  ? -26.292 -46.918 54.774  1.00 44.97 ? 32  LYS D N     1 
ATOM   5043 C  CA    . LYS E 5 32  ? -26.942 -45.750 54.184  1.00 45.03 ? 32  LYS D CA    1 
ATOM   5044 C  C     . LYS E 5 32  ? -25.920 -44.682 53.798  1.00 45.02 ? 32  LYS D C     1 
ATOM   5045 O  O     . LYS E 5 32  ? -25.053 -44.320 54.598  1.00 45.00 ? 32  LYS D O     1 
ATOM   5046 C  CB    . LYS E 5 32  ? -27.987 -45.172 55.146  1.00 45.00 ? 32  LYS D CB    1 
ATOM   5047 C  CG    . LYS E 5 32  ? -28.921 -44.147 54.517  1.00 45.17 ? 32  LYS D CG    1 
ATOM   5048 C  CD    . LYS E 5 32  ? -29.856 -43.539 55.550  1.00 45.29 ? 32  LYS D CD    1 
ATOM   5049 C  CE    . LYS E 5 32  ? -30.495 -42.259 55.025  1.00 45.78 ? 32  LYS D CE    1 
ATOM   5050 N  NZ    . LYS E 5 32  ? -31.442 -41.665 56.011  1.00 45.93 ? 32  LYS D NZ    1 
ATOM   5051 N  N     . ILE E 5 33  ? -26.030 -44.191 52.564  1.00 45.04 ? 33  ILE D N     1 
ATOM   5052 C  CA    . ILE E 5 33  ? -25.159 -43.124 52.059  1.00 44.95 ? 33  ILE D CA    1 
ATOM   5053 C  C     . ILE E 5 33  ? -25.945 -41.991 51.397  1.00 45.01 ? 33  ILE D C     1 
ATOM   5054 O  O     . ILE E 5 33  ? -27.029 -42.209 50.847  1.00 44.97 ? 33  ILE D O     1 
ATOM   5055 C  CB    . ILE E 5 33  ? -24.056 -43.656 51.082  1.00 44.94 ? 33  ILE D CB    1 
ATOM   5056 C  CG1   . ILE E 5 33  ? -24.659 -44.443 49.912  1.00 44.93 ? 33  ILE D CG1   1 
ATOM   5057 C  CG2   . ILE E 5 33  ? -23.028 -44.505 51.826  1.00 44.92 ? 33  ILE D CG2   1 
ATOM   5058 C  CD1   . ILE E 5 33  ? -24.772 -43.664 48.625  1.00 44.76 ? 33  ILE D CD1   1 
ATOM   5059 N  N     . ARG E 5 34  ? -25.387 -40.784 51.470  1.00 44.96 ? 34  ARG D N     1 
ATOM   5060 C  CA    . ARG E 5 34  ? -25.924 -39.616 50.778  1.00 45.00 ? 34  ARG D CA    1 
ATOM   5061 C  C     . ARG E 5 34  ? -25.012 -39.257 49.609  1.00 44.88 ? 34  ARG D C     1 
ATOM   5062 O  O     . ARG E 5 34  ? -23.802 -39.116 49.783  1.00 44.93 ? 34  ARG D O     1 
ATOM   5063 C  CB    . ARG E 5 34  ? -26.057 -38.430 51.742  1.00 45.07 ? 34  ARG D CB    1 
ATOM   5064 C  CG    . ARG E 5 34  ? -27.202 -38.562 52.742  1.00 45.41 ? 34  ARG D CG    1 
ATOM   5065 C  CD    . ARG E 5 34  ? -28.524 -38.120 52.129  1.00 45.82 ? 34  ARG D CD    1 
ATOM   5066 N  NE    . ARG E 5 34  ? -29.676 -38.684 52.826  1.00 45.91 ? 34  ARG D NE    1 
ATOM   5067 C  CZ    . ARG E 5 34  ? -30.944 -38.426 52.516  1.00 46.01 ? 34  ARG D CZ    1 
ATOM   5068 N  NH1   . ARG E 5 34  ? -31.240 -37.600 51.519  1.00 45.53 ? 34  ARG D NH1   1 
ATOM   5069 N  NH2   . ARG E 5 34  ? -31.923 -38.993 53.211  1.00 45.75 ? 34  ARG D NH2   1 
ATOM   5070 N  N     . LYS E 5 35  ? -25.598 -39.119 48.421  1.00 44.62 ? 35  LYS D N     1 
ATOM   5071 C  CA    . LYS E 5 35  ? -24.829 -38.907 47.194  1.00 44.40 ? 35  LYS D CA    1 
ATOM   5072 C  C     . LYS E 5 35  ? -25.227 -37.611 46.488  1.00 44.17 ? 35  LYS D C     1 
ATOM   5073 O  O     . LYS E 5 35  ? -26.413 -37.295 46.367  1.00 44.16 ? 35  LYS D O     1 
ATOM   5074 C  CB    . LYS E 5 35  ? -24.958 -40.117 46.257  1.00 44.52 ? 35  LYS D CB    1 
ATOM   5075 C  CG    . LYS E 5 35  ? -26.364 -40.358 45.718  1.00 44.88 ? 35  LYS D CG    1 
ATOM   5076 C  CD    . LYS E 5 35  ? -26.721 -41.831 45.697  1.00 45.51 ? 35  LYS D CD    1 
ATOM   5077 C  CE    . LYS E 5 35  ? -28.178 -42.032 45.297  1.00 46.05 ? 35  LYS D CE    1 
ATOM   5078 N  NZ    . LYS E 5 35  ? -29.121 -41.222 46.130  1.00 46.29 ? 35  LYS D NZ    1 
ATOM   5079 N  N     . GLY E 5 36  ? -24.224 -36.873 46.021  1.00 43.80 ? 36  GLY D N     1 
ATOM   5080 C  CA    . GLY E 5 36  ? -24.438 -35.547 45.453  1.00 43.52 ? 36  GLY D CA    1 
ATOM   5081 C  C     . GLY E 5 36  ? -24.097 -34.480 46.474  1.00 43.24 ? 36  GLY D C     1 
ATOM   5082 O  O     . GLY E 5 36  ? -24.192 -34.715 47.679  1.00 43.35 ? 36  GLY D O     1 
ATOM   5083 N  N     . THR E 5 37  ? -23.719 -33.302 45.990  1.00 42.98 ? 37  THR D N     1 
ATOM   5084 C  CA    . THR E 5 37  ? -23.188 -32.242 46.851  1.00 42.63 ? 37  THR D CA    1 
ATOM   5085 C  C     . THR E 5 37  ? -24.206 -31.658 47.836  1.00 42.32 ? 37  THR D C     1 
ATOM   5086 O  O     . THR E 5 37  ? -23.854 -31.361 48.976  1.00 42.35 ? 37  THR D O     1 
ATOM   5087 C  CB    . THR E 5 37  ? -22.494 -31.134 46.022  1.00 42.67 ? 37  THR D CB    1 
ATOM   5088 O  OG1   . THR E 5 37  ? -21.433 -31.722 45.260  1.00 42.73 ? 37  THR D OG1   1 
ATOM   5089 C  CG2   . THR E 5 37  ? -21.913 -30.044 46.922  1.00 42.46 ? 37  THR D CG2   1 
ATOM   5090 N  N     . ASN E 5 38  ? -25.457 -31.508 47.411  1.00 41.96 ? 38  ASN D N     1 
ATOM   5091 C  CA    . ASN E 5 38  ? -26.494 -30.998 48.308  1.00 41.76 ? 38  ASN D CA    1 
ATOM   5092 C  C     . ASN E 5 38  ? -26.800 -31.976 49.449  1.00 41.67 ? 38  ASN D C     1 
ATOM   5093 O  O     . ASN E 5 38  ? -26.872 -31.572 50.609  1.00 41.59 ? 38  ASN D O     1 
ATOM   5094 C  CB    . ASN E 5 38  ? -27.768 -30.630 47.539  1.00 41.63 ? 38  ASN D CB    1 
ATOM   5095 C  CG    . ASN E 5 38  ? -28.649 -29.641 48.299  1.00 41.56 ? 38  ASN D CG    1 
ATOM   5096 O  OD1   . ASN E 5 38  ? -28.162 -28.666 48.878  1.00 41.08 ? 38  ASN D OD1   1 
ATOM   5097 N  ND2   . ASN E 5 38  ? -29.955 -29.882 48.284  1.00 41.05 ? 38  ASN D ND2   1 
ATOM   5098 N  N     . GLU E 5 39  ? -26.947 -33.256 49.110  1.00 41.53 ? 39  GLU D N     1 
ATOM   5099 C  CA    . GLU E 5 39  ? -27.215 -34.319 50.087  1.00 41.46 ? 39  GLU D CA    1 
ATOM   5100 C  C     . GLU E 5 39  ? -26.066 -34.515 51.071  1.00 41.41 ? 39  GLU D C     1 
ATOM   5101 O  O     . GLU E 5 39  ? -26.292 -34.689 52.272  1.00 41.42 ? 39  GLU D O     1 
ATOM   5102 C  CB    . GLU E 5 39  ? -27.502 -35.643 49.379  1.00 41.41 ? 39  GLU D CB    1 
ATOM   5103 C  CG    . GLU E 5 39  ? -28.815 -35.679 48.626  1.00 41.49 ? 39  GLU D CG    1 
ATOM   5104 C  CD    . GLU E 5 39  ? -29.141 -37.053 48.074  1.00 41.53 ? 39  GLU D CD    1 
ATOM   5105 O  OE1   . GLU E 5 39  ? -29.634 -37.127 46.932  1.00 41.71 ? 39  GLU D OE1   1 
ATOM   5106 O  OE2   . GLU E 5 39  ? -28.907 -38.059 48.777  1.00 41.87 ? 39  GLU D OE2   1 
ATOM   5107 N  N     . THR E 5 40  ? -24.842 -34.496 50.545  1.00 41.36 ? 40  THR D N     1 
ATOM   5108 C  CA    . THR E 5 40  ? -23.624 -34.619 51.346  1.00 41.27 ? 40  THR D CA    1 
ATOM   5109 C  C     . THR E 5 40  ? -23.491 -33.450 52.325  1.00 41.18 ? 40  THR D C     1 
ATOM   5110 O  O     . THR E 5 40  ? -23.197 -33.654 53.504  1.00 41.18 ? 40  THR D O     1 
ATOM   5111 C  CB    . THR E 5 40  ? -22.367 -34.703 50.439  1.00 41.32 ? 40  THR D CB    1 
ATOM   5112 O  OG1   . THR E 5 40  ? -22.485 -35.828 49.558  1.00 41.10 ? 40  THR D OG1   1 
ATOM   5113 C  CG2   . THR E 5 40  ? -21.092 -34.842 51.266  1.00 41.34 ? 40  THR D CG2   1 
ATOM   5114 N  N     . THR E 5 41  ? -23.722 -32.237 51.827  1.00 41.02 ? 41  THR D N     1 
ATOM   5115 C  CA    . THR E 5 41  ? -23.627 -31.017 52.630  1.00 40.85 ? 41  THR D CA    1 
ATOM   5116 C  C     . THR E 5 41  ? -24.654 -30.988 53.765  1.00 40.85 ? 41  THR D C     1 
ATOM   5117 O  O     . THR E 5 41  ? -24.330 -30.590 54.884  1.00 40.84 ? 41  THR D O     1 
ATOM   5118 C  CB    . THR E 5 41  ? -23.771 -29.751 51.747  1.00 40.81 ? 41  THR D CB    1 
ATOM   5119 O  OG1   . THR E 5 41  ? -22.794 -29.787 50.703  1.00 40.44 ? 41  THR D OG1   1 
ATOM   5120 C  CG2   . THR E 5 41  ? -23.565 -28.490 52.562  1.00 40.66 ? 41  THR D CG2   1 
ATOM   5121 N  N     . LYS E 5 42  ? -25.884 -31.411 53.469  1.00 40.92 ? 42  LYS D N     1 
ATOM   5122 C  CA    . LYS E 5 42  ? -26.946 -31.486 54.476  1.00 40.91 ? 42  LYS D CA    1 
ATOM   5123 C  C     . LYS E 5 42  ? -26.580 -32.479 55.570  1.00 40.84 ? 42  LYS D C     1 
ATOM   5124 O  O     . LYS E 5 42  ? -26.794 -32.212 56.750  1.00 40.80 ? 42  LYS D O     1 
ATOM   5125 C  CB    . LYS E 5 42  ? -28.292 -31.875 53.849  1.00 40.92 ? 42  LYS D CB    1 
ATOM   5126 C  CG    . LYS E 5 42  ? -28.813 -30.923 52.784  1.00 41.15 ? 42  LYS D CG    1 
ATOM   5127 C  CD    . LYS E 5 42  ? -28.983 -29.509 53.306  1.00 41.75 ? 42  LYS D CD    1 
ATOM   5128 C  CE    . LYS E 5 42  ? -28.909 -28.503 52.171  1.00 41.79 ? 42  LYS D CE    1 
ATOM   5129 N  NZ    . LYS E 5 42  ? -29.085 -27.122 52.675  1.00 41.83 ? 42  LYS D NZ    1 
ATOM   5130 N  N     . ALA E 5 43  ? -26.016 -33.615 55.158  1.00 40.87 ? 43  ALA D N     1 
ATOM   5131 C  CA    . ALA E 5 43  ? -25.566 -34.664 56.071  1.00 40.90 ? 43  ALA D CA    1 
ATOM   5132 C  C     . ALA E 5 43  ? -24.492 -34.169 57.038  1.00 40.90 ? 43  ALA D C     1 
ATOM   5133 O  O     . ALA E 5 43  ? -24.492 -34.540 58.211  1.00 40.92 ? 43  ALA D O     1 
ATOM   5134 C  CB    . ALA E 5 43  ? -25.059 -35.860 55.285  1.00 40.86 ? 43  ALA D CB    1 
ATOM   5135 N  N     . VAL E 5 44  ? -23.581 -33.336 56.536  1.00 40.95 ? 44  VAL D N     1 
ATOM   5136 C  CA    . VAL E 5 44  ? -22.541 -32.718 57.360  1.00 41.02 ? 44  VAL D CA    1 
ATOM   5137 C  C     . VAL E 5 44  ? -23.165 -31.693 58.309  1.00 41.12 ? 44  VAL D C     1 
ATOM   5138 O  O     . VAL E 5 44  ? -22.824 -31.639 59.494  1.00 41.10 ? 44  VAL D O     1 
ATOM   5139 C  CB    . VAL E 5 44  ? -21.443 -32.050 56.488  1.00 41.01 ? 44  VAL D CB    1 
ATOM   5140 C  CG1   . VAL E 5 44  ? -20.417 -31.316 57.352  1.00 40.86 ? 44  VAL D CG1   1 
ATOM   5141 C  CG2   . VAL E 5 44  ? -20.751 -33.088 55.620  1.00 40.88 ? 44  VAL D CG2   1 
ATOM   5142 N  N     . GLU E 5 45  ? -24.093 -30.904 57.771  1.00 41.18 ? 45  GLU D N     1 
ATOM   5143 C  CA    . GLU E 5 45  ? -24.793 -29.856 58.511  1.00 41.33 ? 45  GLU D CA    1 
ATOM   5144 C  C     . GLU E 5 45  ? -25.646 -30.431 59.645  1.00 41.16 ? 45  GLU D C     1 
ATOM   5145 O  O     . GLU E 5 45  ? -25.809 -29.799 60.692  1.00 41.13 ? 45  GLU D O     1 
ATOM   5146 C  CB    . GLU E 5 45  ? -25.674 -29.063 57.546  1.00 41.31 ? 45  GLU D CB    1 
ATOM   5147 C  CG    . GLU E 5 45  ? -25.760 -27.573 57.821  1.00 41.77 ? 45  GLU D CG    1 
ATOM   5148 C  CD    . GLU E 5 45  ? -26.343 -26.795 56.648  1.00 41.96 ? 45  GLU D CD    1 
ATOM   5149 O  OE1   . GLU E 5 45  ? -26.056 -25.582 56.537  1.00 43.08 ? 45  GLU D OE1   1 
ATOM   5150 O  OE2   . GLU E 5 45  ? -27.083 -27.394 55.833  1.00 42.42 ? 45  GLU D OE2   1 
ATOM   5151 N  N     . ARG E 5 46  ? -26.183 -31.630 59.423  1.00 40.97 ? 46  ARG D N     1 
ATOM   5152 C  CA    . ARG E 5 46  ? -27.033 -32.309 60.401  1.00 40.85 ? 46  ARG D CA    1 
ATOM   5153 C  C     . ARG E 5 46  ? -26.226 -33.195 61.355  1.00 40.82 ? 46  ARG D C     1 
ATOM   5154 O  O     . ARG E 5 46  ? -26.754 -33.679 62.361  1.00 40.77 ? 46  ARG D O     1 
ATOM   5155 C  CB    . ARG E 5 46  ? -28.111 -33.134 59.686  1.00 40.83 ? 46  ARG D CB    1 
ATOM   5156 C  CG    . ARG E 5 46  ? -29.139 -32.298 58.930  1.00 40.51 ? 46  ARG D CG    1 
ATOM   5157 C  CD    . ARG E 5 46  ? -29.880 -33.129 57.894  1.00 40.21 ? 46  ARG D CD    1 
ATOM   5158 N  NE    . ARG E 5 46  ? -30.632 -32.293 56.958  1.00 40.09 ? 46  ARG D NE    1 
ATOM   5159 C  CZ    . ARG E 5 46  ? -31.402 -32.756 55.976  1.00 39.95 ? 46  ARG D CZ    1 
ATOM   5160 N  NH1   . ARG E 5 46  ? -31.540 -34.062 55.781  1.00 39.88 ? 46  ARG D NH1   1 
ATOM   5161 N  NH2   . ARG E 5 46  ? -32.042 -31.907 55.184  1.00 39.86 ? 46  ARG D NH2   1 
ATOM   5162 N  N     . GLY E 5 47  ? -24.948 -33.395 61.035  1.00 40.74 ? 47  GLY D N     1 
ATOM   5163 C  CA    . GLY E 5 47  ? -24.053 -34.222 61.844  1.00 40.72 ? 47  GLY D CA    1 
ATOM   5164 C  C     . GLY E 5 47  ? -24.323 -35.706 61.686  1.00 40.74 ? 47  GLY D C     1 
ATOM   5165 O  O     . GLY E 5 47  ? -24.135 -36.483 62.625  1.00 40.68 ? 47  GLY D O     1 
ATOM   5166 N  N     . GLN E 5 48  ? -24.762 -36.096 60.491  1.00 40.71 ? 48  GLN D N     1 
ATOM   5167 C  CA    . GLN E 5 48  ? -25.118 -37.484 60.197  1.00 40.69 ? 48  GLN D CA    1 
ATOM   5168 C  C     . GLN E 5 48  ? -23.983 -38.223 59.496  1.00 40.57 ? 48  GLN D C     1 
ATOM   5169 O  O     . GLN E 5 48  ? -23.842 -39.439 59.642  1.00 40.60 ? 48  GLN D O     1 
ATOM   5170 C  CB    . GLN E 5 48  ? -26.388 -37.538 59.343  1.00 40.73 ? 48  GLN D CB    1 
ATOM   5171 C  CG    . GLN E 5 48  ? -27.644 -37.056 60.059  1.00 40.91 ? 48  GLN D CG    1 
ATOM   5172 C  CD    . GLN E 5 48  ? -28.789 -36.749 59.111  1.00 40.98 ? 48  GLN D CD    1 
ATOM   5173 O  OE1   . GLN E 5 48  ? -28.578 -36.295 57.986  1.00 41.37 ? 48  GLN D OE1   1 
ATOM   5174 N  NE2   . GLN E 5 48  ? -30.012 -36.985 59.568  1.00 41.18 ? 48  GLN D NE2   1 
ATOM   5175 N  N     . ALA E 5 49  ? -23.180 -37.478 58.740  1.00 40.43 ? 49  ALA D N     1 
ATOM   5176 C  CA    . ALA E 5 49  ? -22.065 -38.036 57.979  1.00 40.29 ? 49  ALA D CA    1 
ATOM   5177 C  C     . ALA E 5 49  ? -20.918 -38.477 58.884  1.00 40.19 ? 49  ALA D C     1 
ATOM   5178 O  O     . ALA E 5 49  ? -20.517 -37.747 59.792  1.00 40.10 ? 49  ALA D O     1 
ATOM   5179 C  CB    . ALA E 5 49  ? -21.570 -37.027 56.947  1.00 40.26 ? 49  ALA D CB    1 
ATOM   5180 N  N     . LYS E 5 50  ? -20.406 -39.677 58.625  1.00 40.16 ? 50  LYS D N     1 
ATOM   5181 C  CA    . LYS E 5 50  ? -19.259 -40.222 59.351  1.00 40.21 ? 50  LYS D CA    1 
ATOM   5182 C  C     . LYS E 5 50  ? -17.990 -40.043 58.525  1.00 40.20 ? 50  LYS D C     1 
ATOM   5183 O  O     . LYS E 5 50  ? -16.889 -39.950 59.072  1.00 40.15 ? 50  LYS D O     1 
ATOM   5184 C  CB    . LYS E 5 50  ? -19.468 -41.709 59.673  1.00 40.18 ? 50  LYS D CB    1 
ATOM   5185 C  CG    . LYS E 5 50  ? -20.830 -42.061 60.271  1.00 40.31 ? 50  LYS D CG    1 
ATOM   5186 C  CD    . LYS E 5 50  ? -20.966 -41.614 61.721  1.00 40.46 ? 50  LYS D CD    1 
ATOM   5187 C  CE    . LYS E 5 50  ? -22.394 -41.790 62.211  1.00 40.70 ? 50  LYS D CE    1 
ATOM   5188 N  NZ    . LYS E 5 50  ? -22.525 -41.520 63.671  1.00 41.12 ? 50  LYS D NZ    1 
ATOM   5189 N  N     . LEU E 5 51  ? -18.160 -40.009 57.204  1.00 40.16 ? 51  LEU D N     1 
ATOM   5190 C  CA    . LEU E 5 51  ? -17.063 -39.790 56.265  1.00 40.19 ? 51  LEU D CA    1 
ATOM   5191 C  C     . LEU E 5 51  ? -17.571 -39.104 55.002  1.00 40.25 ? 51  LEU D C     1 
ATOM   5192 O  O     . LEU E 5 51  ? -18.604 -39.489 54.446  1.00 40.24 ? 51  LEU D O     1 
ATOM   5193 C  CB    . LEU E 5 51  ? -16.374 -41.114 55.908  1.00 40.16 ? 51  LEU D CB    1 
ATOM   5194 C  CG    . LEU E 5 51  ? -15.219 -41.111 54.896  1.00 40.05 ? 51  LEU D CG    1 
ATOM   5195 C  CD1   . LEU E 5 51  ? -14.005 -40.344 55.415  1.00 39.96 ? 51  LEU D CD1   1 
ATOM   5196 C  CD2   . LEU E 5 51  ? -14.834 -42.538 54.532  1.00 40.28 ? 51  LEU D CD2   1 
ATOM   5197 N  N     . VAL E 5 52  ? -16.835 -38.086 54.564  1.00 40.28 ? 52  VAL D N     1 
ATOM   5198 C  CA    . VAL E 5 52  ? -17.151 -37.354 53.341  1.00 40.34 ? 52  VAL D CA    1 
ATOM   5199 C  C     . VAL E 5 52  ? -16.114 -37.677 52.268  1.00 40.42 ? 52  VAL D C     1 
ATOM   5200 O  O     . VAL E 5 52  ? -14.910 -37.682 52.532  1.00 40.47 ? 52  VAL D O     1 
ATOM   5201 C  CB    . VAL E 5 52  ? -17.228 -35.829 53.594  1.00 40.26 ? 52  VAL D CB    1 
ATOM   5202 C  CG1   . VAL E 5 52  ? -17.483 -35.061 52.295  1.00 40.37 ? 52  VAL D CG1   1 
ATOM   5203 C  CG2   . VAL E 5 52  ? -18.318 -35.524 54.600  1.00 40.34 ? 52  VAL D CG2   1 
ATOM   5204 N  N     . ILE E 5 53  ? -16.597 -37.966 51.062  1.00 40.43 ? 53  ILE D N     1 
ATOM   5205 C  CA    . ILE E 5 53  ? -15.733 -38.320 49.944  1.00 40.40 ? 53  ILE D CA    1 
ATOM   5206 C  C     . ILE E 5 53  ? -15.944 -37.312 48.818  1.00 40.45 ? 53  ILE D C     1 
ATOM   5207 O  O     . ILE E 5 53  ? -17.042 -37.200 48.271  1.00 40.36 ? 53  ILE D O     1 
ATOM   5208 C  CB    . ILE E 5 53  ? -15.985 -39.772 49.438  1.00 40.31 ? 53  ILE D CB    1 
ATOM   5209 C  CG1   . ILE E 5 53  ? -15.962 -40.785 50.593  1.00 40.40 ? 53  ILE D CG1   1 
ATOM   5210 C  CG2   . ILE E 5 53  ? -14.943 -40.161 48.410  1.00 40.11 ? 53  ILE D CG2   1 
ATOM   5211 C  CD1   . ILE E 5 53  ? -17.310 -41.037 51.253  1.00 40.39 ? 53  ILE D CD1   1 
ATOM   5212 N  N     . ILE E 5 54  ? -14.886 -36.575 48.490  1.00 40.55 ? 54  ILE D N     1 
ATOM   5213 C  CA    . ILE E 5 54  ? -14.962 -35.489 47.514  1.00 40.58 ? 54  ILE D CA    1 
ATOM   5214 C  C     . ILE E 5 54  ? -14.092 -35.796 46.297  1.00 40.72 ? 54  ILE D C     1 
ATOM   5215 O  O     . ILE E 5 54  ? -12.934 -36.194 46.436  1.00 40.76 ? 54  ILE D O     1 
ATOM   5216 C  CB    . ILE E 5 54  ? -14.537 -34.129 48.136  1.00 40.68 ? 54  ILE D CB    1 
ATOM   5217 C  CG1   . ILE E 5 54  ? -15.208 -33.920 49.501  1.00 40.56 ? 54  ILE D CG1   1 
ATOM   5218 C  CG2   . ILE E 5 54  ? -14.855 -32.969 47.183  1.00 40.45 ? 54  ILE D CG2   1 
ATOM   5219 C  CD1   . ILE E 5 54  ? -14.540 -32.875 50.384  1.00 40.54 ? 54  ILE D CD1   1 
ATOM   5220 N  N     . ALA E 5 55  ? -14.662 -35.615 45.108  1.00 40.82 ? 55  ALA D N     1 
ATOM   5221 C  CA    . ALA E 5 55  ? -13.935 -35.814 43.855  1.00 40.95 ? 55  ALA D CA    1 
ATOM   5222 C  C     . ALA E 5 55  ? -12.918 -34.699 43.616  1.00 41.04 ? 55  ALA D C     1 
ATOM   5223 O  O     . ALA E 5 55  ? -13.115 -33.566 44.057  1.00 40.94 ? 55  ALA D O     1 
ATOM   5224 C  CB    . ALA E 5 55  ? -14.904 -35.906 42.693  1.00 40.88 ? 55  ALA D CB    1 
ATOM   5225 N  N     . GLU E 5 56  ? -11.839 -35.034 42.913  1.00 41.16 ? 56  GLU D N     1 
ATOM   5226 C  CA    . GLU E 5 56  ? -10.758 -34.087 42.630  1.00 41.33 ? 56  GLU D CA    1 
ATOM   5227 C  C     . GLU E 5 56  ? -10.909 -33.406 41.268  1.00 41.37 ? 56  GLU D C     1 
ATOM   5228 O  O     . GLU E 5 56  ? -10.176 -32.465 40.957  1.00 41.35 ? 56  GLU D O     1 
ATOM   5229 C  CB    . GLU E 5 56  ? -9.400  -34.789 42.706  1.00 41.33 ? 56  GLU D CB    1 
ATOM   5230 C  CG    . GLU E 5 56  ? -8.987  -35.233 44.104  1.00 41.56 ? 56  GLU D CG    1 
ATOM   5231 C  CD    . GLU E 5 56  ? -7.772  -36.145 44.097  1.00 41.55 ? 56  GLU D CD    1 
ATOM   5232 O  OE1   . GLU E 5 56  ? -6.896  -35.977 43.221  1.00 41.75 ? 56  GLU D OE1   1 
ATOM   5233 O  OE2   . GLU E 5 56  ? -7.689  -37.033 44.972  1.00 42.30 ? 56  GLU D OE2   1 
ATOM   5234 N  N     . ASP E 5 57  ? -11.856 -33.883 40.463  1.00 41.45 ? 57  ASP D N     1 
ATOM   5235 C  CA    . ASP E 5 57  ? -12.058 -33.358 39.111  1.00 41.56 ? 57  ASP D CA    1 
ATOM   5236 C  C     . ASP E 5 57  ? -13.346 -32.534 38.968  1.00 41.65 ? 57  ASP D C     1 
ATOM   5237 O  O     . ASP E 5 57  ? -13.982 -32.537 37.912  1.00 41.75 ? 57  ASP D O     1 
ATOM   5238 C  CB    . ASP E 5 57  ? -11.991 -34.493 38.071  1.00 41.49 ? 57  ASP D CB    1 
ATOM   5239 C  CG    . ASP E 5 57  ? -13.017 -35.598 38.320  1.00 41.52 ? 57  ASP D CG    1 
ATOM   5240 O  OD1   . ASP E 5 57  ? -13.507 -35.742 39.463  1.00 41.41 ? 57  ASP D OD1   1 
ATOM   5241 O  OD2   . ASP E 5 57  ? -13.327 -36.335 37.359  1.00 41.43 ? 57  ASP D OD2   1 
ATOM   5242 N  N     . VAL E 5 58  ? -13.709 -31.820 40.033  1.00 41.86 ? 58  VAL D N     1 
ATOM   5243 C  CA    . VAL E 5 58  ? -14.921 -30.992 40.051  1.00 42.02 ? 58  VAL D CA    1 
ATOM   5244 C  C     . VAL E 5 58  ? -14.662 -29.612 39.442  1.00 42.17 ? 58  VAL D C     1 
ATOM   5245 O  O     . VAL E 5 58  ? -13.729 -28.907 39.839  1.00 42.26 ? 58  VAL D O     1 
ATOM   5246 C  CB    . VAL E 5 58  ? -15.500 -30.844 41.485  1.00 42.10 ? 58  VAL D CB    1 
ATOM   5247 C  CG1   . VAL E 5 58  ? -16.724 -29.923 41.498  1.00 41.92 ? 58  VAL D CG1   1 
ATOM   5248 C  CG2   . VAL E 5 58  ? -15.850 -32.212 42.069  1.00 41.99 ? 58  VAL D CG2   1 
ATOM   5249 N  N     . ASP E 5 59  ? -15.503 -29.241 38.481  1.00 42.26 ? 59  ASP D N     1 
ATOM   5250 C  CA    . ASP E 5 59  ? -15.381 -27.978 37.766  1.00 42.33 ? 59  ASP D CA    1 
ATOM   5251 C  C     . ASP E 5 59  ? -16.774 -27.479 37.371  1.00 42.33 ? 59  ASP D C     1 
ATOM   5252 O  O     . ASP E 5 59  ? -17.484 -28.166 36.631  1.00 42.33 ? 59  ASP D O     1 
ATOM   5253 C  CB    . ASP E 5 59  ? -14.491 -28.167 36.532  1.00 42.34 ? 59  ASP D CB    1 
ATOM   5254 C  CG    . ASP E 5 59  ? -14.442 -26.938 35.643  1.00 42.58 ? 59  ASP D CG    1 
ATOM   5255 O  OD1   . ASP E 5 59  ? -14.245 -25.818 36.161  1.00 42.89 ? 59  ASP D OD1   1 
ATOM   5256 O  OD2   . ASP E 5 59  ? -14.588 -27.103 34.416  1.00 42.52 ? 59  ASP D OD2   1 
ATOM   5257 N  N     . PRO E 5 60  ? -17.179 -26.286 37.858  1.00 42.37 ? 60  PRO D N     1 
ATOM   5258 C  CA    . PRO E 5 60  ? -16.480 -25.322 38.722  1.00 42.46 ? 60  PRO D CA    1 
ATOM   5259 C  C     . PRO E 5 60  ? -16.129 -25.851 40.112  1.00 42.58 ? 60  PRO D C     1 
ATOM   5260 O  O     . PRO E 5 60  ? -16.890 -26.626 40.695  1.00 42.41 ? 60  PRO D O     1 
ATOM   5261 C  CB    . PRO E 5 60  ? -17.489 -24.174 38.855  1.00 42.35 ? 60  PRO D CB    1 
ATOM   5262 C  CG    . PRO E 5 60  ? -18.413 -24.332 37.707  1.00 42.38 ? 60  PRO D CG    1 
ATOM   5263 C  CD    . PRO E 5 60  ? -18.520 -25.795 37.491  1.00 42.41 ? 60  PRO D CD    1 
ATOM   5264 N  N     . GLU E 5 61  ? -14.983 -25.413 40.628  1.00 42.88 ? 61  GLU D N     1 
ATOM   5265 C  CA    . GLU E 5 61  ? -14.502 -25.804 41.956  1.00 43.39 ? 61  GLU D CA    1 
ATOM   5266 C  C     . GLU E 5 61  ? -15.452 -25.385 43.079  1.00 43.42 ? 61  GLU D C     1 
ATOM   5267 O  O     . GLU E 5 61  ? -15.571 -26.084 44.086  1.00 43.51 ? 61  GLU D O     1 
ATOM   5268 C  CB    . GLU E 5 61  ? -13.119 -25.204 42.219  1.00 43.39 ? 61  GLU D CB    1 
ATOM   5269 C  CG    . GLU E 5 61  ? -12.003 -25.750 41.341  1.00 43.68 ? 61  GLU D CG    1 
ATOM   5270 C  CD    . GLU E 5 61  ? -10.641 -25.188 41.710  1.00 43.88 ? 61  GLU D CD    1 
ATOM   5271 O  OE1   . GLU E 5 61  ? -9.836  -24.929 40.790  1.00 44.75 ? 61  GLU D OE1   1 
ATOM   5272 O  OE2   . GLU E 5 61  ? -10.372 -25.006 42.919  1.00 44.67 ? 61  GLU D OE2   1 
ATOM   5273 N  N     . GLU E 5 62  ? -16.125 -24.248 42.886  1.00 43.52 ? 62  GLU D N     1 
ATOM   5274 C  CA    . GLU E 5 62  ? -17.039 -23.667 43.876  1.00 43.68 ? 62  GLU D CA    1 
ATOM   5275 C  C     . GLU E 5 62  ? -18.129 -24.629 44.348  1.00 43.56 ? 62  GLU D C     1 
ATOM   5276 O  O     . GLU E 5 62  ? -18.631 -24.503 45.467  1.00 43.65 ? 62  GLU D O     1 
ATOM   5277 C  CB    . GLU E 5 62  ? -17.684 -22.384 43.332  1.00 43.78 ? 62  GLU D CB    1 
ATOM   5278 C  CG    . GLU E 5 62  ? -16.711 -21.249 43.025  1.00 44.58 ? 62  GLU D CG    1 
ATOM   5279 C  CD    . GLU E 5 62  ? -16.178 -21.279 41.598  1.00 45.65 ? 62  GLU D CD    1 
ATOM   5280 O  OE1   . GLU E 5 62  ? -15.650 -22.327 41.166  1.00 45.98 ? 62  GLU D OE1   1 
ATOM   5281 O  OE2   . GLU E 5 62  ? -16.282 -20.243 40.906  1.00 45.95 ? 62  GLU D OE2   1 
ATOM   5282 N  N     . ILE E 5 63  ? -18.485 -25.588 43.495  1.00 43.41 ? 63  ILE D N     1 
ATOM   5283 C  CA    . ILE E 5 63  ? -19.491 -26.604 43.821  1.00 43.24 ? 63  ILE D CA    1 
ATOM   5284 C  C     . ILE E 5 63  ? -19.189 -27.339 45.133  1.00 43.09 ? 63  ILE D C     1 
ATOM   5285 O  O     . ILE E 5 63  ? -20.067 -27.460 45.988  1.00 43.02 ? 63  ILE D O     1 
ATOM   5286 C  CB    . ILE E 5 63  ? -19.681 -27.603 42.650  1.00 43.23 ? 63  ILE D CB    1 
ATOM   5287 C  CG1   . ILE E 5 63  ? -20.314 -26.885 41.454  1.00 43.49 ? 63  ILE D CG1   1 
ATOM   5288 C  CG2   . ILE E 5 63  ? -20.544 -28.800 43.066  1.00 43.28 ? 63  ILE D CG2   1 
ATOM   5289 C  CD1   . ILE E 5 63  ? -20.047 -27.550 40.139  1.00 43.25 ? 63  ILE D CD1   1 
ATOM   5290 N  N     . VAL E 5 64  ? -17.949 -27.802 45.291  1.00 42.98 ? 64  VAL D N     1 
ATOM   5291 C  CA    . VAL E 5 64  ? -17.534 -28.555 46.484  1.00 42.97 ? 64  VAL D CA    1 
ATOM   5292 C  C     . VAL E 5 64  ? -16.509 -27.825 47.366  1.00 43.09 ? 64  VAL D C     1 
ATOM   5293 O  O     . VAL E 5 64  ? -16.031 -28.383 48.358  1.00 43.18 ? 64  VAL D O     1 
ATOM   5294 C  CB    . VAL E 5 64  ? -16.967 -29.956 46.116  1.00 42.97 ? 64  VAL D CB    1 
ATOM   5295 C  CG1   . VAL E 5 64  ? -18.047 -30.840 45.506  1.00 42.82 ? 64  VAL D CG1   1 
ATOM   5296 C  CG2   . VAL E 5 64  ? -15.764 -29.832 45.181  1.00 42.89 ? 64  VAL D CG2   1 
ATOM   5297 N  N     . ALA E 5 65  ? -16.177 -26.587 47.003  1.00 43.15 ? 65  ALA D N     1 
ATOM   5298 C  CA    . ALA E 5 65  ? -15.153 -25.804 47.706  1.00 43.24 ? 65  ALA D CA    1 
ATOM   5299 C  C     . ALA E 5 65  ? -15.489 -25.527 49.174  1.00 43.27 ? 65  ALA D C     1 
ATOM   5300 O  O     . ALA E 5 65  ? -14.590 -25.430 50.012  1.00 43.39 ? 65  ALA D O     1 
ATOM   5301 C  CB    . ALA E 5 65  ? -14.882 -24.496 46.968  1.00 43.30 ? 65  ALA D CB    1 
ATOM   5302 N  N     . HIS E 5 66  ? -16.782 -25.407 49.472  1.00 43.28 ? 66  HIS D N     1 
ATOM   5303 C  CA    . HIS E 5 66  ? -17.270 -25.149 50.831  1.00 43.18 ? 66  HIS D CA    1 
ATOM   5304 C  C     . HIS E 5 66  ? -17.117 -26.348 51.776  1.00 43.14 ? 66  HIS D C     1 
ATOM   5305 O  O     . HIS E 5 66  ? -17.144 -26.181 52.996  1.00 43.11 ? 66  HIS D O     1 
ATOM   5306 C  CB    . HIS E 5 66  ? -18.744 -24.742 50.787  1.00 43.11 ? 66  HIS D CB    1 
ATOM   5307 C  CG    . HIS E 5 66  ? -19.663 -25.859 50.398  1.00 43.06 ? 66  HIS D CG    1 
ATOM   5308 N  ND1   . HIS E 5 66  ? -19.836 -26.261 49.091  1.00 43.15 ? 66  HIS D ND1   1 
ATOM   5309 C  CD2   . HIS E 5 66  ? -20.447 -26.671 51.147  1.00 43.17 ? 66  HIS D CD2   1 
ATOM   5310 C  CE1   . HIS E 5 66  ? -20.693 -27.265 49.050  1.00 43.04 ? 66  HIS D CE1   1 
ATOM   5311 N  NE2   . HIS E 5 66  ? -21.078 -27.535 50.285  1.00 43.12 ? 66  HIS D NE2   1 
ATOM   5312 N  N     . LEU E 5 67  ? -16.976 -27.547 51.214  1.00 43.09 ? 67  LEU D N     1 
ATOM   5313 C  CA    . LEU E 5 67  ? -16.996 -28.781 52.010  1.00 43.10 ? 67  LEU D CA    1 
ATOM   5314 C  C     . LEU E 5 67  ? -15.812 -28.997 52.969  1.00 42.96 ? 67  LEU D C     1 
ATOM   5315 O  O     . LEU E 5 67  ? -16.040 -29.240 54.154  1.00 43.04 ? 67  LEU D O     1 
ATOM   5316 C  CB    . LEU E 5 67  ? -17.228 -30.019 51.129  1.00 43.17 ? 67  LEU D CB    1 
ATOM   5317 C  CG    . LEU E 5 67  ? -18.676 -30.390 50.795  1.00 43.44 ? 67  LEU D CG    1 
ATOM   5318 C  CD1   . LEU E 5 67  ? -18.704 -31.508 49.765  1.00 43.38 ? 67  LEU D CD1   1 
ATOM   5319 C  CD2   . LEU E 5 67  ? -19.464 -30.792 52.044  1.00 43.21 ? 67  LEU D CD2   1 
ATOM   5320 N  N     . PRO E 5 68  ? -14.555 -28.919 52.473  1.00 42.83 ? 68  PRO D N     1 
ATOM   5321 C  CA    . PRO E 5 68  ? -13.434 -29.089 53.411  1.00 42.75 ? 68  PRO D CA    1 
ATOM   5322 C  C     . PRO E 5 68  ? -13.504 -28.227 54.692  1.00 42.68 ? 68  PRO D C     1 
ATOM   5323 O  O     . PRO E 5 68  ? -13.373 -28.784 55.783  1.00 42.73 ? 68  PRO D O     1 
ATOM   5324 C  CB    . PRO E 5 68  ? -12.201 -28.755 52.561  1.00 42.68 ? 68  PRO D CB    1 
ATOM   5325 C  CG    . PRO E 5 68  ? -12.618 -29.070 51.169  1.00 42.76 ? 68  PRO D CG    1 
ATOM   5326 C  CD    . PRO E 5 68  ? -14.077 -28.712 51.090  1.00 42.78 ? 68  PRO D CD    1 
ATOM   5327 N  N     . PRO E 5 69  ? -13.713 -26.892 54.576  1.00 42.66 ? 69  PRO D N     1 
ATOM   5328 C  CA    . PRO E 5 69  ? -13.840 -26.104 55.810  1.00 42.64 ? 69  PRO D CA    1 
ATOM   5329 C  C     . PRO E 5 69  ? -15.134 -26.338 56.603  1.00 42.68 ? 69  PRO D C     1 
ATOM   5330 O  O     . PRO E 5 69  ? -15.173 -26.044 57.799  1.00 42.73 ? 69  PRO D O     1 
ATOM   5331 C  CB    . PRO E 5 69  ? -13.776 -24.656 55.312  1.00 42.62 ? 69  PRO D CB    1 
ATOM   5332 C  CG    . PRO E 5 69  ? -14.258 -24.718 53.922  1.00 42.54 ? 69  PRO D CG    1 
ATOM   5333 C  CD    . PRO E 5 69  ? -13.802 -26.032 53.378  1.00 42.53 ? 69  PRO D CD    1 
ATOM   5334 N  N     . LEU E 5 70  ? -16.176 -26.849 55.948  1.00 42.76 ? 70  LEU D N     1 
ATOM   5335 C  CA    . LEU E 5 70  ? -17.413 -27.223 56.639  1.00 42.88 ? 70  LEU D CA    1 
ATOM   5336 C  C     . LEU E 5 70  ? -17.171 -28.477 57.480  1.00 43.00 ? 70  LEU D C     1 
ATOM   5337 O  O     . LEU E 5 70  ? -17.568 -28.539 58.648  1.00 42.95 ? 70  LEU D O     1 
ATOM   5338 C  CB    . LEU E 5 70  ? -18.546 -27.483 55.641  1.00 42.80 ? 70  LEU D CB    1 
ATOM   5339 C  CG    . LEU E 5 70  ? -20.020 -27.196 55.978  1.00 42.83 ? 70  LEU D CG    1 
ATOM   5340 C  CD1   . LEU E 5 70  ? -20.902 -28.120 55.156  1.00 42.89 ? 70  LEU D CD1   1 
ATOM   5341 C  CD2   . LEU E 5 70  ? -20.379 -27.326 57.457  1.00 42.88 ? 70  LEU D CD2   1 
ATOM   5342 N  N     . CYS E 5 71  ? -16.513 -29.465 56.871  1.00 43.14 ? 71  CYS D N     1 
ATOM   5343 C  CA    . CYS E 5 71  ? -16.163 -30.720 57.535  1.00 43.32 ? 71  CYS D CA    1 
ATOM   5344 C  C     . CYS E 5 71  ? -15.279 -30.502 58.763  1.00 43.48 ? 71  CYS D C     1 
ATOM   5345 O  O     . CYS E 5 71  ? -15.474 -31.147 59.792  1.00 43.52 ? 71  CYS D O     1 
ATOM   5346 C  CB    . CYS E 5 71  ? -15.467 -31.664 56.554  1.00 43.21 ? 71  CYS D CB    1 
ATOM   5347 S  SG    . CYS E 5 71  ? -16.544 -32.371 55.292  1.00 43.10 ? 71  CYS D SG    1 
ATOM   5348 N  N     . GLU E 5 72  ? -14.318 -29.587 58.643  1.00 43.76 ? 72  GLU D N     1 
ATOM   5349 C  CA    . GLU E 5 72  ? -13.397 -29.259 59.735  1.00 44.02 ? 72  GLU D CA    1 
ATOM   5350 C  C     . GLU E 5 72  ? -14.087 -28.524 60.885  1.00 44.10 ? 72  GLU D C     1 
ATOM   5351 O  O     . GLU E 5 72  ? -13.684 -28.657 62.042  1.00 44.22 ? 72  GLU D O     1 
ATOM   5352 C  CB    . GLU E 5 72  ? -12.214 -28.438 59.216  1.00 43.99 ? 72  GLU D CB    1 
ATOM   5353 C  CG    . GLU E 5 72  ? -11.255 -29.225 58.328  1.00 44.19 ? 72  GLU D CG    1 
ATOM   5354 C  CD    . GLU E 5 72  ? -10.140 -28.372 57.744  1.00 44.25 ? 72  GLU D CD    1 
ATOM   5355 O  OE1   . GLU E 5 72  ? -9.560  -27.544 58.478  1.00 44.59 ? 72  GLU D OE1   1 
ATOM   5356 O  OE2   . GLU E 5 72  ? -9.836  -28.541 56.544  1.00 44.68 ? 72  GLU D OE2   1 
ATOM   5357 N  N     . GLU E 5 73  ? -15.120 -27.750 60.558  1.00 44.25 ? 73  GLU D N     1 
ATOM   5358 C  CA    . GLU E 5 73  ? -15.907 -27.036 61.563  1.00 44.43 ? 73  GLU D CA    1 
ATOM   5359 C  C     . GLU E 5 73  ? -16.828 -27.990 62.325  1.00 44.46 ? 73  GLU D C     1 
ATOM   5360 O  O     . GLU E 5 73  ? -16.983 -27.871 63.542  1.00 44.46 ? 73  GLU D O     1 
ATOM   5361 C  CB    . GLU E 5 73  ? -16.721 -25.909 60.912  1.00 44.45 ? 73  GLU D CB    1 
ATOM   5362 C  CG    . GLU E 5 73  ? -17.346 -24.918 61.897  1.00 44.71 ? 73  GLU D CG    1 
ATOM   5363 C  CD    . GLU E 5 73  ? -16.316 -24.059 62.620  1.00 45.31 ? 73  GLU D CD    1 
ATOM   5364 O  OE1   . GLU E 5 73  ? -15.313 -23.662 61.989  1.00 45.70 ? 73  GLU D OE1   1 
ATOM   5365 O  OE2   . GLU E 5 73  ? -16.513 -23.776 63.821  1.00 45.46 ? 73  GLU D OE2   1 
ATOM   5366 N  N     . LYS E 5 74  ? -17.426 -28.934 61.601  1.00 44.53 ? 74  LYS D N     1 
ATOM   5367 C  CA    . LYS E 5 74  ? -18.360 -29.899 62.182  1.00 44.60 ? 74  LYS D CA    1 
ATOM   5368 C  C     . LYS E 5 74  ? -17.669 -31.181 62.666  1.00 44.65 ? 74  LYS D C     1 
ATOM   5369 O  O     . LYS E 5 74  ? -18.335 -32.132 63.090  1.00 44.69 ? 74  LYS D O     1 
ATOM   5370 C  CB    . LYS E 5 74  ? -19.490 -30.219 61.191  1.00 44.65 ? 74  LYS D CB    1 
ATOM   5371 C  CG    . LYS E 5 74  ? -20.505 -29.089 61.008  1.00 44.75 ? 74  LYS D CG    1 
ATOM   5372 C  CD    . LYS E 5 74  ? -21.479 -29.008 62.182  1.00 45.42 ? 74  LYS D CD    1 
ATOM   5373 C  CE    . LYS E 5 74  ? -22.150 -27.642 62.280  1.00 45.71 ? 74  LYS D CE    1 
ATOM   5374 N  NZ    . LYS E 5 74  ? -23.112 -27.381 61.171  1.00 46.28 ? 74  LYS D NZ    1 
ATOM   5375 N  N     . GLU E 5 75  ? -16.336 -31.183 62.606  1.00 44.64 ? 75  GLU D N     1 
ATOM   5376 C  CA    . GLU E 5 75  ? -15.489 -32.276 63.112  1.00 44.65 ? 75  GLU D CA    1 
ATOM   5377 C  C     . GLU E 5 75  ? -15.722 -33.610 62.391  1.00 44.53 ? 75  GLU D C     1 
ATOM   5378 O  O     . GLU E 5 75  ? -15.734 -34.674 63.016  1.00 44.60 ? 75  GLU D O     1 
ATOM   5379 C  CB    . GLU E 5 75  ? -15.641 -32.443 64.636  1.00 44.72 ? 75  GLU D CB    1 
ATOM   5380 C  CG    . GLU E 5 75  ? -15.380 -31.181 65.464  1.00 44.94 ? 75  GLU D CG    1 
ATOM   5381 C  CD    . GLU E 5 75  ? -13.902 -30.889 65.664  1.00 45.22 ? 75  GLU D CD    1 
ATOM   5382 O  OE1   . GLU E 5 75  ? -13.205 -30.589 64.670  1.00 45.46 ? 75  GLU D OE1   1 
ATOM   5383 O  OE2   . GLU E 5 75  ? -13.442 -30.947 66.823  1.00 45.23 ? 75  GLU D OE2   1 
ATOM   5384 N  N     . ILE E 5 76  ? -15.895 -33.539 61.074  1.00 44.40 ? 76  ILE D N     1 
ATOM   5385 C  CA    . ILE E 5 76  ? -16.138 -34.720 60.248  1.00 44.27 ? 76  ILE D CA    1 
ATOM   5386 C  C     . ILE E 5 76  ? -14.973 -34.933 59.275  1.00 44.08 ? 76  ILE D C     1 
ATOM   5387 O  O     . ILE E 5 76  ? -14.607 -34.012 58.543  1.00 44.07 ? 76  ILE D O     1 
ATOM   5388 C  CB    . ILE E 5 76  ? -17.491 -34.610 59.485  1.00 44.24 ? 76  ILE D CB    1 
ATOM   5389 C  CG1   . ILE E 5 76  ? -18.662 -34.638 60.477  1.00 44.35 ? 76  ILE D CG1   1 
ATOM   5390 C  CG2   . ILE E 5 76  ? -17.636 -35.728 58.445  1.00 44.29 ? 76  ILE D CG2   1 
ATOM   5391 C  CD1   . ILE E 5 76  ? -19.993 -34.180 59.899  1.00 44.39 ? 76  ILE D CD1   1 
ATOM   5392 N  N     . PRO E 5 77  ? -14.375 -36.142 59.280  1.00 43.92 ? 77  PRO D N     1 
ATOM   5393 C  CA    . PRO E 5 77  ? -13.275 -36.448 58.359  1.00 43.77 ? 77  PRO D CA    1 
ATOM   5394 C  C     . PRO E 5 77  ? -13.710 -36.476 56.893  1.00 43.63 ? 77  PRO D C     1 
ATOM   5395 O  O     . PRO E 5 77  ? -14.836 -36.874 56.583  1.00 43.64 ? 77  PRO D O     1 
ATOM   5396 C  CB    . PRO E 5 77  ? -12.815 -37.841 58.804  1.00 43.80 ? 77  PRO D CB    1 
ATOM   5397 C  CG    . PRO E 5 77  ? -13.980 -38.428 59.512  1.00 43.84 ? 77  PRO D CG    1 
ATOM   5398 C  CD    . PRO E 5 77  ? -14.685 -37.281 60.165  1.00 43.96 ? 77  PRO D CD    1 
ATOM   5399 N  N     . TYR E 5 78  ? -12.816 -36.044 56.009  1.00 43.43 ? 78  TYR D N     1 
ATOM   5400 C  CA    . TYR E 5 78  ? -13.062 -36.083 54.571  1.00 43.20 ? 78  TYR D CA    1 
ATOM   5401 C  C     . TYR E 5 78  ? -11.881 -36.682 53.804  1.00 43.11 ? 78  TYR D C     1 
ATOM   5402 O  O     . TYR E 5 78  ? -10.740 -36.647 54.272  1.00 43.08 ? 78  TYR D O     1 
ATOM   5403 C  CB    . TYR E 5 78  ? -13.445 -34.697 54.027  1.00 43.18 ? 78  TYR D CB    1 
ATOM   5404 C  CG    . TYR E 5 78  ? -12.410 -33.609 54.234  1.00 43.04 ? 78  TYR D CG    1 
ATOM   5405 C  CD1   . TYR E 5 78  ? -11.529 -33.257 53.214  1.00 42.79 ? 78  TYR D CD1   1 
ATOM   5406 C  CD2   . TYR E 5 78  ? -12.323 -32.920 55.445  1.00 42.95 ? 78  TYR D CD2   1 
ATOM   5407 C  CE1   . TYR E 5 78  ? -10.580 -32.255 53.396  1.00 42.71 ? 78  TYR D CE1   1 
ATOM   5408 C  CE2   . TYR E 5 78  ? -11.377 -31.917 55.637  1.00 43.01 ? 78  TYR D CE2   1 
ATOM   5409 C  CZ    . TYR E 5 78  ? -10.510 -31.590 54.608  1.00 42.96 ? 78  TYR D CZ    1 
ATOM   5410 O  OH    . TYR E 5 78  ? -9.573  -30.597 54.790  1.00 43.05 ? 78  TYR D OH    1 
ATOM   5411 N  N     . ILE E 5 79  ? -12.174 -37.233 52.629  1.00 43.02 ? 79  ILE D N     1 
ATOM   5412 C  CA    . ILE E 5 79  ? -11.169 -37.876 51.781  1.00 42.94 ? 79  ILE D CA    1 
ATOM   5413 C  C     . ILE E 5 79  ? -11.382 -37.490 50.312  1.00 42.91 ? 79  ILE D C     1 
ATOM   5414 O  O     . ILE E 5 79  ? -12.513 -37.241 49.887  1.00 42.91 ? 79  ILE D O     1 
ATOM   5415 C  CB    . ILE E 5 79  ? -11.155 -39.433 51.984  1.00 42.88 ? 79  ILE D CB    1 
ATOM   5416 C  CG1   . ILE E 5 79  ? -10.151 -40.127 51.055  1.00 42.91 ? 79  ILE D CG1   1 
ATOM   5417 C  CG2   . ILE E 5 79  ? -12.543 -40.036 51.800  1.00 42.87 ? 79  ILE D CG2   1 
ATOM   5418 C  CD1   . ILE E 5 79  ? -8.708  -39.971 51.466  1.00 42.94 ? 79  ILE D CD1   1 
ATOM   5419 N  N     . TYR E 5 80  ? -10.290 -37.425 49.553  1.00 42.84 ? 80  TYR D N     1 
ATOM   5420 C  CA    . TYR E 5 80  ? -10.354 -37.098 48.131  1.00 42.86 ? 80  TYR D CA    1 
ATOM   5421 C  C     . TYR E 5 80  ? -10.194 -38.330 47.238  1.00 42.84 ? 80  TYR D C     1 
ATOM   5422 O  O     . TYR E 5 80  ? -9.368  -39.206 47.509  1.00 42.78 ? 80  TYR D O     1 
ATOM   5423 C  CB    . TYR E 5 80  ? -9.306  -36.042 47.766  1.00 42.84 ? 80  TYR D CB    1 
ATOM   5424 C  CG    . TYR E 5 80  ? -9.474  -34.717 48.482  1.00 42.88 ? 80  TYR D CG    1 
ATOM   5425 C  CD1   . TYR E 5 80  ? -8.644  -34.369 49.547  1.00 43.04 ? 80  TYR D CD1   1 
ATOM   5426 C  CD2   . TYR E 5 80  ? -10.464 -33.812 48.095  1.00 42.80 ? 80  TYR D CD2   1 
ATOM   5427 C  CE1   . TYR E 5 80  ? -8.793  -33.153 50.210  1.00 42.96 ? 80  TYR D CE1   1 
ATOM   5428 C  CE2   . TYR E 5 80  ? -10.624 -32.595 48.753  1.00 42.90 ? 80  TYR D CE2   1 
ATOM   5429 C  CZ    . TYR E 5 80  ? -9.785  -32.273 49.809  1.00 42.90 ? 80  TYR D CZ    1 
ATOM   5430 O  OH    . TYR E 5 80  ? -9.934  -31.069 50.458  1.00 42.71 ? 80  TYR D OH    1 
ATOM   5431 N  N     . VAL E 5 81  ? -11.005 -38.387 46.182  1.00 42.82 ? 81  VAL D N     1 
ATOM   5432 C  CA    . VAL E 5 81  ? -10.881 -39.409 45.136  1.00 42.80 ? 81  VAL D CA    1 
ATOM   5433 C  C     . VAL E 5 81  ? -10.675 -38.739 43.770  1.00 42.79 ? 81  VAL D C     1 
ATOM   5434 O  O     . VAL E 5 81  ? -11.207 -37.653 43.535  1.00 42.75 ? 81  VAL D O     1 
ATOM   5435 C  CB    . VAL E 5 81  ? -12.097 -40.380 45.096  1.00 42.78 ? 81  VAL D CB    1 
ATOM   5436 C  CG1   . VAL E 5 81  ? -12.079 -41.317 46.299  1.00 42.81 ? 81  VAL D CG1   1 
ATOM   5437 C  CG2   . VAL E 5 81  ? -13.421 -39.620 45.003  1.00 42.79 ? 81  VAL D CG2   1 
ATOM   5438 N  N     . PRO E 5 82  ? -9.897  -39.378 42.871  1.00 42.79 ? 82  PRO D N     1 
ATOM   5439 C  CA    . PRO E 5 82  ? -9.536  -38.762 41.586  1.00 42.77 ? 82  PRO D CA    1 
ATOM   5440 C  C     . PRO E 5 82  ? -10.709 -38.407 40.659  1.00 42.77 ? 82  PRO D C     1 
ATOM   5441 O  O     . PRO E 5 82  ? -10.710 -37.327 40.063  1.00 42.74 ? 82  PRO D O     1 
ATOM   5442 C  CB    . PRO E 5 82  ? -8.634  -39.816 40.927  1.00 42.84 ? 82  PRO D CB    1 
ATOM   5443 C  CG    . PRO E 5 82  ? -8.962  -41.097 41.614  1.00 42.81 ? 82  PRO D CG    1 
ATOM   5444 C  CD    . PRO E 5 82  ? -9.293  -40.716 43.020  1.00 42.79 ? 82  PRO D CD    1 
ATOM   5445 N  N     . SER E 5 83  ? -11.693 -39.300 40.554  1.00 42.74 ? 83  SER D N     1 
ATOM   5446 C  CA    . SER E 5 83  ? -12.733 -39.197 39.527  1.00 42.71 ? 83  SER D CA    1 
ATOM   5447 C  C     . SER E 5 83  ? -14.159 -39.120 40.077  1.00 42.69 ? 83  SER D C     1 
ATOM   5448 O  O     . SER E 5 83  ? -14.562 -39.948 40.897  1.00 42.70 ? 83  SER D O     1 
ATOM   5449 C  CB    . SER E 5 83  ? -12.606 -40.367 38.545  1.00 42.68 ? 83  SER D CB    1 
ATOM   5450 O  OG    . SER E 5 83  ? -13.763 -40.498 37.738  1.00 42.85 ? 83  SER D OG    1 
ATOM   5451 N  N     . LYS E 5 84  ? -14.915 -38.128 39.604  1.00 42.69 ? 84  LYS D N     1 
ATOM   5452 C  CA    . LYS E 5 84  ? -16.328 -37.970 39.966  1.00 42.73 ? 84  LYS D CA    1 
ATOM   5453 C  C     . LYS E 5 84  ? -17.225 -39.013 39.294  1.00 42.69 ? 84  LYS D C     1 
ATOM   5454 O  O     . LYS E 5 84  ? -18.257 -39.397 39.847  1.00 42.67 ? 84  LYS D O     1 
ATOM   5455 C  CB    . LYS E 5 84  ? -16.830 -36.544 39.678  1.00 42.63 ? 84  LYS D CB    1 
ATOM   5456 C  CG    . LYS E 5 84  ? -16.717 -36.074 38.226  1.00 42.92 ? 84  LYS D CG    1 
ATOM   5457 C  CD    . LYS E 5 84  ? -17.376 -34.710 38.041  1.00 42.95 ? 84  LYS D CD    1 
ATOM   5458 C  CE    . LYS E 5 84  ? -17.306 -34.233 36.596  1.00 43.65 ? 84  LYS D CE    1 
ATOM   5459 N  NZ    . LYS E 5 84  ? -15.947 -33.749 36.219  1.00 43.97 ? 84  LYS D NZ    1 
ATOM   5460 N  N     . LYS E 5 85  ? -16.821 -39.461 38.106  1.00 42.69 ? 85  LYS D N     1 
ATOM   5461 C  CA    . LYS E 5 85  ? -17.508 -40.532 37.384  1.00 42.78 ? 85  LYS D CA    1 
ATOM   5462 C  C     . LYS E 5 85  ? -17.389 -41.856 38.143  1.00 42.73 ? 85  LYS D C     1 
ATOM   5463 O  O     . LYS E 5 85  ? -18.370 -42.589 38.289  1.00 42.76 ? 85  LYS D O     1 
ATOM   5464 C  CB    . LYS E 5 85  ? -16.929 -40.667 35.968  1.00 42.80 ? 85  LYS D CB    1 
ATOM   5465 C  CG    . LYS E 5 85  ? -17.588 -41.721 35.074  1.00 43.15 ? 85  LYS D CG    1 
ATOM   5466 C  CD    . LYS E 5 85  ? -18.753 -41.152 34.267  1.00 43.74 ? 85  LYS D CD    1 
ATOM   5467 C  CE    . LYS E 5 85  ? -20.103 -41.493 34.884  1.00 43.95 ? 85  LYS D CE    1 
ATOM   5468 N  NZ    . LYS E 5 85  ? -20.507 -42.896 34.590  1.00 43.99 ? 85  LYS D NZ    1 
ATOM   5469 N  N     . GLU E 5 86  ? -16.181 -42.143 38.628  1.00 42.65 ? 86  GLU D N     1 
ATOM   5470 C  CA    . GLU E 5 86  ? -15.894 -43.354 39.396  1.00 42.60 ? 86  GLU D CA    1 
ATOM   5471 C  C     . GLU E 5 86  ? -16.604 -43.328 40.751  1.00 42.49 ? 86  GLU D C     1 
ATOM   5472 O  O     . GLU E 5 86  ? -17.092 -44.357 41.221  1.00 42.50 ? 86  GLU D O     1 
ATOM   5473 C  CB    . GLU E 5 86  ? -14.382 -43.506 39.586  1.00 42.53 ? 86  GLU D CB    1 
ATOM   5474 C  CG    . GLU E 5 86  ? -13.910 -44.925 39.869  1.00 42.80 ? 86  GLU D CG    1 
ATOM   5475 C  CD    . GLU E 5 86  ? -12.394 -45.073 39.802  1.00 42.78 ? 86  GLU D CD    1 
ATOM   5476 O  OE1   . GLU E 5 86  ? -11.912 -46.228 39.802  1.00 42.83 ? 86  GLU D OE1   1 
ATOM   5477 O  OE2   . GLU E 5 86  ? -11.685 -44.042 39.748  1.00 42.75 ? 86  GLU D OE2   1 
ATOM   5478 N  N     . LEU E 5 87  ? -16.661 -42.144 41.361  1.00 42.37 ? 87  LEU D N     1 
ATOM   5479 C  CA    . LEU E 5 87  ? -17.353 -41.942 42.635  1.00 42.24 ? 87  LEU D CA    1 
ATOM   5480 C  C     . LEU E 5 87  ? -18.868 -42.111 42.491  1.00 42.18 ? 87  LEU D C     1 
ATOM   5481 O  O     . LEU E 5 87  ? -19.530 -42.630 43.395  1.00 42.08 ? 87  LEU D O     1 
ATOM   5482 C  CB    . LEU E 5 87  ? -17.013 -40.561 43.218  1.00 42.22 ? 87  LEU D CB    1 
ATOM   5483 C  CG    . LEU E 5 87  ? -17.582 -40.160 44.586  1.00 42.17 ? 87  LEU D CG    1 
ATOM   5484 C  CD1   . LEU E 5 87  ? -17.189 -41.151 45.674  1.00 42.30 ? 87  LEU D CD1   1 
ATOM   5485 C  CD2   . LEU E 5 87  ? -17.141 -38.755 44.963  1.00 42.23 ? 87  LEU D CD2   1 
ATOM   5486 N  N     . GLY E 5 88  ? -19.402 -41.670 41.352  1.00 42.08 ? 88  GLY D N     1 
ATOM   5487 C  CA    . GLY E 5 88  ? -20.816 -41.842 41.025  1.00 41.98 ? 88  GLY D CA    1 
ATOM   5488 C  C     . GLY E 5 88  ? -21.223 -43.301 40.932  1.00 41.94 ? 88  GLY D C     1 
ATOM   5489 O  O     . GLY E 5 88  ? -22.221 -43.710 41.529  1.00 41.96 ? 88  GLY D O     1 
ATOM   5490 N  N     . ALA E 5 89  ? -20.443 -44.085 40.188  1.00 41.84 ? 89  ALA D N     1 
ATOM   5491 C  CA    . ALA E 5 89  ? -20.683 -45.522 40.036  1.00 41.79 ? 89  ALA D CA    1 
ATOM   5492 C  C     . ALA E 5 89  ? -20.638 -46.256 41.378  1.00 41.70 ? 89  ALA D C     1 
ATOM   5493 O  O     . ALA E 5 89  ? -21.438 -47.161 41.620  1.00 41.64 ? 89  ALA D O     1 
ATOM   5494 C  CB    . ALA E 5 89  ? -19.687 -46.132 39.054  1.00 41.78 ? 89  ALA D CB    1 
ATOM   5495 N  N     . ALA E 5 90  ? -19.709 -45.849 42.242  1.00 41.66 ? 90  ALA D N     1 
ATOM   5496 C  CA    . ALA E 5 90  ? -19.578 -46.408 43.590  1.00 41.61 ? 90  ALA D CA    1 
ATOM   5497 C  C     . ALA E 5 90  ? -20.791 -46.091 44.469  1.00 41.59 ? 90  ALA D C     1 
ATOM   5498 O  O     . ALA E 5 90  ? -21.131 -46.861 45.370  1.00 41.54 ? 90  ALA D O     1 
ATOM   5499 C  CB    . ALA E 5 90  ? -18.299 -45.912 44.246  1.00 41.55 ? 90  ALA D CB    1 
ATOM   5500 N  N     . ALA E 5 91  ? -21.432 -44.955 44.198  1.00 41.63 ? 91  ALA D N     1 
ATOM   5501 C  CA    . ALA E 5 91  ? -22.654 -44.551 44.894  1.00 41.65 ? 91  ALA D CA    1 
ATOM   5502 C  C     . ALA E 5 91  ? -23.900 -45.240 44.324  1.00 41.67 ? 91  ALA D C     1 
ATOM   5503 O  O     . ALA E 5 91  ? -24.999 -45.104 44.868  1.00 41.68 ? 91  ALA D O     1 
ATOM   5504 C  CB    . ALA E 5 91  ? -22.810 -43.031 44.855  1.00 41.58 ? 91  ALA D CB    1 
ATOM   5505 N  N     . GLY E 5 92  ? -23.719 -45.978 43.229  1.00 41.66 ? 92  GLY D N     1 
ATOM   5506 C  CA    . GLY E 5 92  ? -24.799 -46.748 42.615  1.00 41.70 ? 92  GLY D CA    1 
ATOM   5507 C  C     . GLY E 5 92  ? -25.680 -45.961 41.663  1.00 41.74 ? 92  GLY D C     1 
ATOM   5508 O  O     . GLY E 5 92  ? -26.837 -46.324 41.440  1.00 41.74 ? 92  GLY D O     1 
ATOM   5509 N  N     . ILE E 5 93  ? -25.135 -44.883 41.105  1.00 41.73 ? 93  ILE D N     1 
ATOM   5510 C  CA    . ILE E 5 93  ? -25.842 -44.089 40.098  1.00 41.77 ? 93  ILE D CA    1 
ATOM   5511 C  C     . ILE E 5 93  ? -25.090 -44.083 38.765  1.00 41.85 ? 93  ILE D C     1 
ATOM   5512 O  O     . ILE E 5 93  ? -23.864 -44.215 38.731  1.00 41.83 ? 93  ILE D O     1 
ATOM   5513 C  CB    . ILE E 5 93  ? -26.151 -42.641 40.581  1.00 41.76 ? 93  ILE D CB    1 
ATOM   5514 C  CG1   . ILE E 5 93  ? -24.879 -41.927 41.062  1.00 41.79 ? 93  ILE D CG1   1 
ATOM   5515 C  CG2   . ILE E 5 93  ? -27.228 -42.665 41.669  1.00 41.68 ? 93  ILE D CG2   1 
ATOM   5516 C  CD1   . ILE E 5 93  ? -25.005 -40.411 41.164  1.00 41.60 ? 93  ILE D CD1   1 
ATOM   5517 N  N     . GLU E 5 94  ? -25.838 -43.926 37.675  1.00 41.98 ? 94  GLU D N     1 
ATOM   5518 C  CA    . GLU E 5 94  ? -25.284 -44.007 36.322  1.00 42.14 ? 94  GLU D CA    1 
ATOM   5519 C  C     . GLU E 5 94  ? -24.514 -42.747 35.910  1.00 42.11 ? 94  GLU D C     1 
ATOM   5520 O  O     . GLU E 5 94  ? -23.771 -42.758 34.924  1.00 42.14 ? 94  GLU D O     1 
ATOM   5521 C  CB    . GLU E 5 94  ? -26.396 -44.319 35.313  1.00 42.15 ? 94  GLU D CB    1 
ATOM   5522 C  CG    . GLU E 5 94  ? -25.933 -45.053 34.052  1.00 42.46 ? 94  GLU D CG    1 
ATOM   5523 C  CD    . GLU E 5 94  ? -25.722 -46.552 34.256  1.00 42.83 ? 94  GLU D CD    1 
ATOM   5524 O  OE1   . GLU E 5 94  ? -25.675 -47.282 33.243  1.00 42.48 ? 94  GLU D OE1   1 
ATOM   5525 O  OE2   . GLU E 5 94  ? -25.604 -47.006 35.416  1.00 43.22 ? 94  GLU D OE2   1 
ATOM   5526 N  N     . VAL E 5 95  ? -24.695 -41.667 36.668  1.00 42.06 ? 95  VAL D N     1 
ATOM   5527 C  CA    . VAL E 5 95  ? -24.002 -40.406 36.405  1.00 42.06 ? 95  VAL D CA    1 
ATOM   5528 C  C     . VAL E 5 95  ? -22.943 -40.145 37.483  1.00 42.01 ? 95  VAL D C     1 
ATOM   5529 O  O     . VAL E 5 95  ? -22.871 -40.864 38.484  1.00 41.94 ? 95  VAL D O     1 
ATOM   5530 C  CB    . VAL E 5 95  ? -24.992 -39.207 36.296  1.00 42.04 ? 95  VAL D CB    1 
ATOM   5531 C  CG1   . VAL E 5 95  ? -24.346 -38.040 35.560  1.00 42.20 ? 95  VAL D CG1   1 
ATOM   5532 C  CG2   . VAL E 5 95  ? -26.272 -39.618 35.570  1.00 42.14 ? 95  VAL D CG2   1 
ATOM   5533 N  N     . ALA E 5 96  ? -22.119 -39.122 37.260  1.00 41.98 ? 96  ALA D N     1 
ATOM   5534 C  CA    . ALA E 5 96  ? -21.060 -38.730 38.188  1.00 42.00 ? 96  ALA D CA    1 
ATOM   5535 C  C     . ALA E 5 96  ? -21.596 -38.169 39.505  1.00 42.01 ? 96  ALA D C     1 
ATOM   5536 O  O     . ALA E 5 96  ? -22.740 -37.717 39.584  1.00 41.87 ? 96  ALA D O     1 
ATOM   5537 C  CB    . ALA E 5 96  ? -20.130 -37.716 37.523  1.00 41.91 ? 96  ALA D CB    1 
ATOM   5538 N  N     . ALA E 5 97  ? -20.757 -38.218 40.537  1.00 42.17 ? 97  ALA D N     1 
ATOM   5539 C  CA    . ALA E 5 97  ? -21.051 -37.590 41.821  1.00 42.36 ? 97  ALA D CA    1 
ATOM   5540 C  C     . ALA E 5 97  ? -19.840 -36.795 42.292  1.00 42.53 ? 97  ALA D C     1 
ATOM   5541 O  O     . ALA E 5 97  ? -18.731 -37.330 42.378  1.00 42.47 ? 97  ALA D O     1 
ATOM   5542 C  CB    . ALA E 5 97  ? -21.448 -38.630 42.855  1.00 42.35 ? 97  ALA D CB    1 
ATOM   5543 N  N     . ALA E 5 98  ? -20.060 -35.515 42.583  1.00 42.74 ? 98  ALA D N     1 
ATOM   5544 C  CA    . ALA E 5 98  ? -18.995 -34.618 43.032  1.00 42.99 ? 98  ALA D CA    1 
ATOM   5545 C  C     . ALA E 5 98  ? -18.569 -34.919 44.467  1.00 43.21 ? 98  ALA D C     1 
ATOM   5546 O  O     . ALA E 5 98  ? -17.389 -34.795 44.809  1.00 43.23 ? 98  ALA D O     1 
ATOM   5547 C  CB    . ALA E 5 98  ? -19.431 -33.168 42.897  1.00 42.91 ? 98  ALA D CB    1 
ATOM   5548 N  N     . SER E 5 99  ? -19.534 -35.309 45.299  1.00 43.44 ? 99  SER D N     1 
ATOM   5549 C  CA    . SER E 5 99  ? -19.262 -35.680 46.685  1.00 43.65 ? 99  SER D CA    1 
ATOM   5550 C  C     . SER E 5 99  ? -20.291 -36.660 47.237  1.00 43.84 ? 99  SER D C     1 
ATOM   5551 O  O     . SER E 5 99  ? -21.470 -36.617 46.874  1.00 43.96 ? 99  SER D O     1 
ATOM   5552 C  CB    . SER E 5 99  ? -19.180 -34.442 47.583  1.00 43.66 ? 99  SER D CB    1 
ATOM   5553 O  OG    . SER E 5 99  ? -20.438 -33.803 47.699  1.00 43.79 ? 99  SER D OG    1 
ATOM   5554 N  N     . VAL E 5 100 ? -19.819 -37.544 48.113  1.00 43.96 ? 100 VAL D N     1 
ATOM   5555 C  CA    . VAL E 5 100 ? -20.654 -38.541 48.776  1.00 44.03 ? 100 VAL D CA    1 
ATOM   5556 C  C     . VAL E 5 100 ? -20.424 -38.459 50.288  1.00 44.16 ? 100 VAL D C     1 
ATOM   5557 O  O     . VAL E 5 100 ? -19.327 -38.118 50.741  1.00 44.20 ? 100 VAL D O     1 
ATOM   5558 C  CB    . VAL E 5 100 ? -20.354 -39.979 48.249  1.00 44.02 ? 100 VAL D CB    1 
ATOM   5559 C  CG1   . VAL E 5 100 ? -21.123 -41.039 49.035  1.00 43.89 ? 100 VAL D CG1   1 
ATOM   5560 C  CG2   . VAL E 5 100 ? -20.687 -40.091 46.767  1.00 44.02 ? 100 VAL D CG2   1 
ATOM   5561 N  N     . ALA E 5 101 ? -21.469 -38.753 51.058  1.00 44.21 ? 101 ALA D N     1 
ATOM   5562 C  CA    . ALA E 5 101 ? -21.369 -38.859 52.511  1.00 44.17 ? 101 ALA D CA    1 
ATOM   5563 C  C     . ALA E 5 101 ? -21.842 -40.231 52.972  1.00 44.12 ? 101 ALA D C     1 
ATOM   5564 O  O     . ALA E 5 101 ? -22.824 -40.764 52.453  1.00 44.15 ? 101 ALA D O     1 
ATOM   5565 C  CB    . ALA E 5 101 ? -22.179 -37.765 53.189  1.00 44.15 ? 101 ALA D CB    1 
ATOM   5566 N  N     . ILE E 5 102 ? -21.133 -40.800 53.941  1.00 44.11 ? 102 ILE D N     1 
ATOM   5567 C  CA    . ILE E 5 102 ? -21.534 -42.061 54.556  1.00 44.07 ? 102 ILE D CA    1 
ATOM   5568 C  C     . ILE E 5 102 ? -22.237 -41.767 55.880  1.00 44.08 ? 102 ILE D C     1 
ATOM   5569 O  O     . ILE E 5 102 ? -21.651 -41.163 56.778  1.00 44.10 ? 102 ILE D O     1 
ATOM   5570 C  CB    . ILE E 5 102 ? -20.323 -43.011 54.766  1.00 44.05 ? 102 ILE D CB    1 
ATOM   5571 C  CG1   . ILE E 5 102 ? -19.703 -43.395 53.417  1.00 43.95 ? 102 ILE D CG1   1 
ATOM   5572 C  CG2   . ILE E 5 102 ? -20.742 -44.265 55.538  1.00 44.07 ? 102 ILE D CG2   1 
ATOM   5573 C  CD1   . ILE E 5 102 ? -18.279 -43.919 53.504  1.00 43.84 ? 102 ILE D CD1   1 
ATOM   5574 N  N     . ILE E 5 103 ? -23.498 -42.183 55.981  1.00 44.10 ? 103 ILE D N     1 
ATOM   5575 C  CA    . ILE E 5 103 ? -24.296 -41.998 57.195  1.00 44.11 ? 103 ILE D CA    1 
ATOM   5576 C  C     . ILE E 5 103 ? -24.137 -43.211 58.113  1.00 44.21 ? 103 ILE D C     1 
ATOM   5577 O  O     . ILE E 5 103 ? -23.884 -43.067 59.312  1.00 44.14 ? 103 ILE D O     1 
ATOM   5578 C  CB    . ILE E 5 103 ? -25.807 -41.776 56.872  1.00 44.06 ? 103 ILE D CB    1 
ATOM   5579 C  CG1   . ILE E 5 103 ? -26.001 -40.710 55.781  1.00 44.11 ? 103 ILE D CG1   1 
ATOM   5580 C  CG2   . ILE E 5 103 ? -26.604 -41.440 58.140  1.00 44.11 ? 103 ILE D CG2   1 
ATOM   5581 C  CD1   . ILE E 5 103 ? -25.464 -39.325 56.119  1.00 44.04 ? 103 ILE D CD1   1 
ATOM   5582 N  N     . GLU E 5 104 ? -24.296 -44.399 57.535  1.00 44.32 ? 104 GLU D N     1 
ATOM   5583 C  CA    . GLU E 5 104 ? -24.122 -45.659 58.248  1.00 44.47 ? 104 GLU D CA    1 
ATOM   5584 C  C     . GLU E 5 104 ? -23.255 -46.590 57.402  1.00 44.53 ? 104 GLU D C     1 
ATOM   5585 O  O     . GLU E 5 104 ? -23.670 -47.008 56.318  1.00 44.59 ? 104 GLU D O     1 
ATOM   5586 C  CB    . GLU E 5 104 ? -25.480 -46.294 58.559  1.00 44.47 ? 104 GLU D CB    1 
ATOM   5587 C  CG    . GLU E 5 104 ? -26.248 -45.594 59.677  1.00 44.62 ? 104 GLU D CG    1 
ATOM   5588 C  CD    . GLU E 5 104 ? -27.753 -45.635 59.481  1.00 44.76 ? 104 GLU D CD    1 
ATOM   5589 O  OE1   . GLU E 5 104 ? -28.319 -46.744 59.366  1.00 44.80 ? 104 GLU D OE1   1 
ATOM   5590 O  OE2   . GLU E 5 104 ? -28.372 -44.551 59.450  1.00 44.90 ? 104 GLU D OE2   1 
ATOM   5591 N  N     . PRO E 5 105 ? -22.037 -46.900 57.888  1.00 44.58 ? 105 PRO D N     1 
ATOM   5592 C  CA    . PRO E 5 105 ? -21.045 -47.656 57.118  1.00 44.61 ? 105 PRO D CA    1 
ATOM   5593 C  C     . PRO E 5 105 ? -21.415 -49.119 56.885  1.00 44.67 ? 105 PRO D C     1 
ATOM   5594 O  O     . PRO E 5 105 ? -21.006 -49.699 55.877  1.00 44.65 ? 105 PRO D O     1 
ATOM   5595 C  CB    . PRO E 5 105 ? -19.778 -47.557 57.981  1.00 44.61 ? 105 PRO D CB    1 
ATOM   5596 C  CG    . PRO E 5 105 ? -20.052 -46.472 58.980  1.00 44.58 ? 105 PRO D CG    1 
ATOM   5597 C  CD    . PRO E 5 105 ? -21.519 -46.532 59.215  1.00 44.58 ? 105 PRO D CD    1 
ATOM   5598 N  N     . GLY E 5 106 ? -22.178 -49.704 57.807  1.00 44.74 ? 106 GLY D N     1 
ATOM   5599 C  CA    . GLY E 5 106 ? -22.580 -51.105 57.707  1.00 44.85 ? 106 GLY D CA    1 
ATOM   5600 C  C     . GLY E 5 106 ? -21.400 -52.045 57.863  1.00 44.93 ? 106 GLY D C     1 
ATOM   5601 O  O     . GLY E 5 106 ? -20.745 -52.057 58.907  1.00 44.92 ? 106 GLY D O     1 
ATOM   5602 N  N     . LYS E 5 107 ? -21.126 -52.821 56.817  1.00 45.05 ? 107 LYS D N     1 
ATOM   5603 C  CA    . LYS E 5 107 ? -20.021 -53.784 56.823  1.00 45.23 ? 107 LYS D CA    1 
ATOM   5604 C  C     . LYS E 5 107 ? -18.658 -53.114 56.631  1.00 45.31 ? 107 LYS D C     1 
ATOM   5605 O  O     . LYS E 5 107 ? -17.625 -53.683 56.996  1.00 45.33 ? 107 LYS D O     1 
ATOM   5606 C  CB    . LYS E 5 107 ? -20.232 -54.868 55.759  1.00 45.22 ? 107 LYS D CB    1 
ATOM   5607 C  CG    . LYS E 5 107 ? -21.404 -55.804 56.029  1.00 45.25 ? 107 LYS D CG    1 
ATOM   5608 C  CD    . LYS E 5 107 ? -21.392 -56.994 55.076  1.00 45.23 ? 107 LYS D CD    1 
ATOM   5609 C  CE    . LYS E 5 107 ? -22.699 -57.777 55.125  1.00 45.15 ? 107 LYS D CE    1 
ATOM   5610 N  NZ    . LYS E 5 107 ? -22.926 -58.448 56.434  1.00 45.23 ? 107 LYS D NZ    1 
ATOM   5611 N  N     . ALA E 5 108 ? -18.666 -51.910 56.063  1.00 45.42 ? 108 ALA D N     1 
ATOM   5612 C  CA    . ALA E 5 108 ? -17.442 -51.138 55.835  1.00 45.55 ? 108 ALA D CA    1 
ATOM   5613 C  C     . ALA E 5 108 ? -17.099 -50.234 57.025  1.00 45.64 ? 108 ALA D C     1 
ATOM   5614 O  O     . ALA E 5 108 ? -16.402 -49.227 56.873  1.00 45.61 ? 108 ALA D O     1 
ATOM   5615 C  CB    . ALA E 5 108 ? -17.562 -50.322 54.551  1.00 45.52 ? 108 ALA D CB    1 
ATOM   5616 N  N     . ARG E 5 109 ? -17.588 -50.616 58.204  1.00 45.74 ? 109 ARG D N     1 
ATOM   5617 C  CA    . ARG E 5 109 ? -17.365 -49.884 59.453  1.00 45.87 ? 109 ARG D CA    1 
ATOM   5618 C  C     . ARG E 5 109 ? -15.881 -49.801 59.823  1.00 45.95 ? 109 ARG D C     1 
ATOM   5619 O  O     . ARG E 5 109 ? -15.392 -48.736 60.208  1.00 45.93 ? 109 ARG D O     1 
ATOM   5620 C  CB    . ARG E 5 109 ? -18.195 -50.526 60.574  1.00 45.86 ? 109 ARG D CB    1 
ATOM   5621 C  CG    . ARG E 5 109 ? -17.742 -50.246 62.003  1.00 45.97 ? 109 ARG D CG    1 
ATOM   5622 C  CD    . ARG E 5 109 ? -18.363 -51.255 62.965  1.00 46.28 ? 109 ARG D CD    1 
ATOM   5623 N  NE    . ARG E 5 109 ? -18.199 -52.629 62.488  1.00 46.44 ? 109 ARG D NE    1 
ATOM   5624 C  CZ    . ARG E 5 109 ? -18.864 -53.683 62.954  1.00 46.76 ? 109 ARG D CZ    1 
ATOM   5625 N  NH1   . ARG E 5 109 ? -19.756 -53.548 63.928  1.00 46.96 ? 109 ARG D NH1   1 
ATOM   5626 N  NH2   . ARG E 5 109 ? -18.633 -54.883 62.441  1.00 46.78 ? 109 ARG D NH2   1 
ATOM   5627 N  N     . ASP E 5 110 ? -15.176 -50.924 59.695  1.00 46.09 ? 110 ASP D N     1 
ATOM   5628 C  CA    . ASP E 5 110 ? -13.738 -50.978 59.957  1.00 46.20 ? 110 ASP D CA    1 
ATOM   5629 C  C     . ASP E 5 110 ? -12.942 -50.238 58.883  1.00 46.25 ? 110 ASP D C     1 
ATOM   5630 O  O     . ASP E 5 110 ? -11.875 -49.685 59.161  1.00 46.27 ? 110 ASP D O     1 
ATOM   5631 C  CB    . ASP E 5 110 ? -13.262 -52.430 60.061  1.00 46.21 ? 110 ASP D CB    1 
ATOM   5632 C  CG    . ASP E 5 110 ? -13.830 -53.151 61.275  1.00 46.27 ? 110 ASP D CG    1 
ATOM   5633 O  OD1   . ASP E 5 110 ? -14.055 -52.498 62.318  1.00 46.36 ? 110 ASP D OD1   1 
ATOM   5634 O  OD2   . ASP E 5 110 ? -14.044 -54.378 61.185  1.00 46.33 ? 110 ASP D OD2   1 
ATOM   5635 N  N     . LEU E 5 111 ? -13.472 -50.233 57.661  1.00 46.29 ? 111 LEU D N     1 
ATOM   5636 C  CA    . LEU E 5 111 ? -12.844 -49.549 56.534  1.00 46.35 ? 111 LEU D CA    1 
ATOM   5637 C  C     . LEU E 5 111 ? -12.904 -48.029 56.699  1.00 46.39 ? 111 LEU D C     1 
ATOM   5638 O  O     . LEU E 5 111 ? -11.937 -47.334 56.389  1.00 46.40 ? 111 LEU D O     1 
ATOM   5639 C  CB    . LEU E 5 111 ? -13.491 -49.986 55.213  1.00 46.34 ? 111 LEU D CB    1 
ATOM   5640 C  CG    . LEU E 5 111 ? -12.736 -49.787 53.892  1.00 46.37 ? 111 LEU D CG    1 
ATOM   5641 C  CD1   . LEU E 5 111 ? -11.367 -50.462 53.899  1.00 46.29 ? 111 LEU D CD1   1 
ATOM   5642 C  CD2   . LEU E 5 111 ? -13.572 -50.307 52.733  1.00 46.35 ? 111 LEU D CD2   1 
ATOM   5643 N  N     . VAL E 5 112 ? -14.035 -47.528 57.199  1.00 46.43 ? 112 VAL D N     1 
ATOM   5644 C  CA    . VAL E 5 112 ? -14.205 -46.102 57.501  1.00 46.50 ? 112 VAL D CA    1 
ATOM   5645 C  C     . VAL E 5 112 ? -13.290 -45.675 58.657  1.00 46.59 ? 112 VAL D C     1 
ATOM   5646 O  O     . VAL E 5 112 ? -12.720 -44.580 58.631  1.00 46.59 ? 112 VAL D O     1 
ATOM   5647 C  CB    . VAL E 5 112 ? -15.691 -45.746 57.805  1.00 46.49 ? 112 VAL D CB    1 
ATOM   5648 C  CG1   . VAL E 5 112 ? -15.833 -44.305 58.294  1.00 46.44 ? 112 VAL D CG1   1 
ATOM   5649 C  CG2   . VAL E 5 112 ? -16.558 -45.966 56.571  1.00 46.39 ? 112 VAL D CG2   1 
ATOM   5650 N  N     . GLU E 5 113 ? -13.153 -46.550 59.656  1.00 46.65 ? 113 GLU D N     1 
ATOM   5651 C  CA    . GLU E 5 113 ? -12.241 -46.340 60.784  1.00 46.76 ? 113 GLU D CA    1 
ATOM   5652 C  C     . GLU E 5 113 ? -10.793 -46.178 60.320  1.00 46.73 ? 113 GLU D C     1 
ATOM   5653 O  O     . GLU E 5 113 ? -10.080 -45.289 60.790  1.00 46.72 ? 113 GLU D O     1 
ATOM   5654 C  CB    . GLU E 5 113 ? -12.332 -47.502 61.779  1.00 46.76 ? 113 GLU D CB    1 
ATOM   5655 C  CG    . GLU E 5 113 ? -13.535 -47.458 62.713  1.00 46.91 ? 113 GLU D CG    1 
ATOM   5656 C  CD    . GLU E 5 113 ? -13.604 -48.657 63.652  1.00 46.94 ? 113 GLU D CD    1 
ATOM   5657 O  OE1   . GLU E 5 113 ? -14.723 -49.157 63.890  1.00 47.29 ? 113 GLU D OE1   1 
ATOM   5658 O  OE2   . GLU E 5 113 ? -12.546 -49.104 64.151  1.00 47.17 ? 113 GLU D OE2   1 
ATOM   5659 N  N     . GLU E 5 114 ? -10.376 -47.047 59.399  1.00 46.73 ? 114 GLU D N     1 
ATOM   5660 C  CA    . GLU E 5 114 ? -9.028  -47.026 58.829  1.00 46.71 ? 114 GLU D CA    1 
ATOM   5661 C  C     . GLU E 5 114 ? -8.773  -45.748 58.028  1.00 46.62 ? 114 GLU D C     1 
ATOM   5662 O  O     . GLU E 5 114 ? -7.680  -45.181 58.089  1.00 46.63 ? 114 GLU D O     1 
ATOM   5663 C  CB    . GLU E 5 114 ? -8.810  -48.262 57.948  1.00 46.72 ? 114 GLU D CB    1 
ATOM   5664 C  CG    . GLU E 5 114 ? -7.381  -48.443 57.439  1.00 46.83 ? 114 GLU D CG    1 
ATOM   5665 C  CD    . GLU E 5 114 ? -7.240  -49.586 56.443  1.00 46.85 ? 114 GLU D CD    1 
ATOM   5666 O  OE1   . GLU E 5 114 ? -8.271  -50.124 55.982  1.00 47.02 ? 114 GLU D OE1   1 
ATOM   5667 O  OE2   . GLU E 5 114 ? -6.089  -49.944 56.117  1.00 47.01 ? 114 GLU D OE2   1 
ATOM   5668 N  N     . ILE E 5 115 ? -9.786  -45.306 57.284  1.00 46.51 ? 115 ILE D N     1 
ATOM   5669 C  CA    . ILE E 5 115 ? -9.705  -44.077 56.492  1.00 46.40 ? 115 ILE D CA    1 
ATOM   5670 C  C     . ILE E 5 115 ? -9.626  -42.844 57.399  1.00 46.33 ? 115 ILE D C     1 
ATOM   5671 O  O     . ILE E 5 115 ? -8.730  -42.013 57.238  1.00 46.27 ? 115 ILE D O     1 
ATOM   5672 C  CB    . ILE E 5 115 ? -10.887 -43.958 55.486  1.00 46.42 ? 115 ILE D CB    1 
ATOM   5673 C  CG1   . ILE E 5 115 ? -10.802 -45.066 54.430  1.00 46.44 ? 115 ILE D CG1   1 
ATOM   5674 C  CG2   . ILE E 5 115 ? -10.900 -42.582 54.809  1.00 46.28 ? 115 ILE D CG2   1 
ATOM   5675 C  CD1   . ILE E 5 115 ? -12.123 -45.382 53.745  1.00 46.40 ? 115 ILE D CD1   1 
ATOM   5676 N  N     . ALA E 5 116 ? -10.549 -42.748 58.356  1.00 46.27 ? 116 ALA D N     1 
ATOM   5677 C  CA    . ALA E 5 116 ? -10.609 -41.622 59.294  1.00 46.25 ? 116 ALA D CA    1 
ATOM   5678 C  C     . ALA E 5 116 ? -9.320  -41.431 60.101  1.00 46.26 ? 116 ALA D C     1 
ATOM   5679 O  O     . ALA E 5 116 ? -8.937  -40.299 60.406  1.00 46.33 ? 116 ALA D O     1 
ATOM   5680 C  CB    . ALA E 5 116 ? -11.806 -41.765 60.225  1.00 46.21 ? 116 ALA D CB    1 
ATOM   5681 N  N     . MET E 5 117 ? -8.661  -42.537 60.441  1.00 46.25 ? 117 MET D N     1 
ATOM   5682 C  CA    . MET E 5 117 ? -7.383  -42.496 61.153  1.00 46.25 ? 117 MET D CA    1 
ATOM   5683 C  C     . MET E 5 117 ? -6.237  -42.040 60.248  1.00 46.12 ? 117 MET D C     1 
ATOM   5684 O  O     . MET E 5 117 ? -5.372  -41.273 60.674  1.00 46.08 ? 117 MET D O     1 
ATOM   5685 C  CB    . MET E 5 117 ? -7.059  -43.862 61.769  1.00 46.27 ? 117 MET D CB    1 
ATOM   5686 C  CG    . MET E 5 117 ? -7.833  -44.182 63.041  1.00 46.33 ? 117 MET D CG    1 
ATOM   5687 S  SD    . MET E 5 117 ? -7.450  -45.823 63.685  1.00 46.55 ? 117 MET D SD    1 
ATOM   5688 C  CE    . MET E 5 117 ? -8.347  -45.804 65.236  1.00 46.52 ? 117 MET D CE    1 
ATOM   5689 N  N     . LYS E 5 118 ? -6.245  -42.508 59.001  1.00 46.04 ? 118 LYS D N     1 
ATOM   5690 C  CA    . LYS E 5 118 ? -5.174  -42.209 58.047  1.00 45.97 ? 118 LYS D CA    1 
ATOM   5691 C  C     . LYS E 5 118 ? -5.261  -40.813 57.418  1.00 45.96 ? 118 LYS D C     1 
ATOM   5692 O  O     . LYS E 5 118 ? -4.232  -40.231 57.065  1.00 45.95 ? 118 LYS D O     1 
ATOM   5693 C  CB    . LYS E 5 118 ? -5.088  -43.289 56.964  1.00 45.96 ? 118 LYS D CB    1 
ATOM   5694 C  CG    . LYS E 5 118 ? -4.415  -44.571 57.434  1.00 45.88 ? 118 LYS D CG    1 
ATOM   5695 C  CD    . LYS E 5 118 ? -4.304  -45.597 56.318  1.00 45.87 ? 118 LYS D CD    1 
ATOM   5696 C  CE    . LYS E 5 118 ? -3.554  -46.837 56.790  1.00 45.73 ? 118 LYS D CE    1 
ATOM   5697 N  NZ    . LYS E 5 118 ? -3.415  -47.854 55.712  1.00 45.45 ? 118 LYS D NZ    1 
ATOM   5698 N  N     . VAL E 5 119 ? -6.476  -40.282 57.273  1.00 45.93 ? 119 VAL D N     1 
ATOM   5699 C  CA    . VAL E 5 119 ? -6.656  -38.922 56.747  1.00 45.93 ? 119 VAL D CA    1 
ATOM   5700 C  C     . VAL E 5 119 ? -6.264  -37.861 57.776  1.00 45.96 ? 119 VAL D C     1 
ATOM   5701 O  O     . VAL E 5 119 ? -5.824  -36.770 57.410  1.00 45.97 ? 119 VAL D O     1 
ATOM   5702 C  CB    . VAL E 5 119 ? -8.095  -38.646 56.209  1.00 45.91 ? 119 VAL D CB    1 
ATOM   5703 C  CG1   . VAL E 5 119 ? -8.412  -39.545 55.025  1.00 45.89 ? 119 VAL D CG1   1 
ATOM   5704 C  CG2   . VAL E 5 119 ? -9.151  -38.785 57.305  1.00 45.87 ? 119 VAL D CG2   1 
ATOM   5705 N  N     . LYS E 5 120 ? -6.417  -38.196 59.057  1.00 45.99 ? 120 LYS D N     1 
ATOM   5706 C  CA    . LYS E 5 120 ? -6.065  -37.298 60.155  1.00 46.08 ? 120 LYS D CA    1 
ATOM   5707 C  C     . LYS E 5 120 ? -4.556  -37.047 60.210  1.00 46.08 ? 120 LYS D C     1 
ATOM   5708 O  O     . LYS E 5 120 ? -4.115  -35.997 60.675  1.00 46.06 ? 120 LYS D O     1 
ATOM   5709 C  CB    . LYS E 5 120 ? -6.562  -37.864 61.487  1.00 46.08 ? 120 LYS D CB    1 
ATOM   5710 C  CG    . LYS E 5 120 ? -6.787  -36.818 62.569  1.00 46.21 ? 120 LYS D CG    1 
ATOM   5711 C  CD    . LYS E 5 120 ? -7.310  -37.454 63.844  1.00 46.44 ? 120 LYS D CD    1 
ATOM   5712 C  CE    . LYS E 5 120 ? -7.587  -36.412 64.914  1.00 46.57 ? 120 LYS D CE    1 
ATOM   5713 N  NZ    . LYS E 5 120 ? -7.935  -37.048 66.217  1.00 46.66 ? 120 LYS D NZ    1 
ATOM   5714 N  N     . GLU E 5 121 ? -3.780  -38.016 59.727  1.00 46.11 ? 121 GLU D N     1 
ATOM   5715 C  CA    . GLU E 5 121 ? -2.324  -37.891 59.645  1.00 46.16 ? 121 GLU D CA    1 
ATOM   5716 C  C     . GLU E 5 121 ? -1.897  -37.082 58.421  1.00 46.22 ? 121 GLU D C     1 
ATOM   5717 O  O     . GLU E 5 121 ? -0.877  -36.390 58.455  1.00 46.23 ? 121 GLU D O     1 
ATOM   5718 C  CB    . GLU E 5 121 ? -1.656  -39.272 59.631  1.00 46.17 ? 121 GLU D CB    1 
ATOM   5719 C  CG    . GLU E 5 121 ? -1.992  -40.158 60.833  1.00 46.14 ? 121 GLU D CG    1 
ATOM   5720 C  CD    . GLU E 5 121 ? -1.657  -39.510 62.167  1.00 46.28 ? 121 GLU D CD    1 
ATOM   5721 O  OE1   . GLU E 5 121 ? -0.465  -39.227 62.419  1.00 46.11 ? 121 GLU D OE1   1 
ATOM   5722 O  OE2   . GLU E 5 121 ? -2.592  -39.290 62.967  1.00 46.34 ? 121 GLU D OE2   1 
ATOM   5723 N  N     . LEU E 5 122 ? -2.679  -37.178 57.346  1.00 46.28 ? 122 LEU D N     1 
ATOM   5724 C  CA    . LEU E 5 122 ? -2.453  -36.388 56.133  1.00 46.37 ? 122 LEU D CA    1 
ATOM   5725 C  C     . LEU E 5 122 ? -2.838  -34.925 56.339  1.00 46.44 ? 122 LEU D C     1 
ATOM   5726 O  O     . LEU E 5 122 ? -2.237  -34.028 55.743  1.00 46.45 ? 122 LEU D O     1 
ATOM   5727 C  CB    . LEU E 5 122 ? -3.238  -36.966 54.949  1.00 46.34 ? 122 LEU D CB    1 
ATOM   5728 C  CG    . LEU E 5 122 ? -2.800  -38.298 54.331  1.00 46.34 ? 122 LEU D CG    1 
ATOM   5729 C  CD1   . LEU E 5 122 ? -3.898  -38.839 53.430  1.00 46.20 ? 122 LEU D CD1   1 
ATOM   5730 C  CD2   . LEU E 5 122 ? -1.491  -38.160 53.558  1.00 46.37 ? 122 LEU D CD2   1 
ATOM   5731 N  N     . MET E 5 123 ? -3.847  -34.702 57.180  1.00 46.51 ? 123 MET D N     1 
ATOM   5732 C  CA    . MET E 5 123 ? -4.326  -33.362 57.526  1.00 46.57 ? 123 MET D CA    1 
ATOM   5733 C  C     . MET E 5 123 ? -3.280  -32.559 58.300  1.00 46.53 ? 123 MET D C     1 
ATOM   5734 O  O     . MET E 5 123 ? -3.264  -31.327 58.242  1.00 46.52 ? 123 MET D O     1 
ATOM   5735 C  CB    . MET E 5 123 ? -5.612  -33.459 58.351  1.00 46.63 ? 123 MET D CB    1 
ATOM   5736 C  CG    . MET E 5 123 ? -6.872  -33.721 57.538  1.00 47.01 ? 123 MET D CG    1 
ATOM   5737 S  SD    . MET E 5 123 ? -7.717  -32.211 57.035  1.00 48.07 ? 123 MET D SD    1 
ATOM   5738 C  CE    . MET E 5 123 ? -8.484  -31.726 58.582  1.00 48.09 ? 123 MET D CE    1 
ATOM   5739 N  N     . LYS E 5 124 ? -2.413  -33.268 59.020  1.00 46.47 ? 124 LYS D N     1 
ATOM   5740 C  CA    . LYS E 5 124 ? -1.379  -32.641 59.837  1.00 46.46 ? 124 LYS D CA    1 
ATOM   5741 C  C     . LYS E 5 124 ? 0.017   -33.131 59.462  1.00 46.44 ? 124 LYS D C     1 
ATOM   5742 O  O     . LYS E 5 124 ? 0.977   -32.360 59.462  1.00 46.41 ? 124 LYS D O     1 
ATOM   5743 C  CB    . LYS E 5 124 ? -1.657  -32.875 61.327  1.00 46.42 ? 124 LYS D CB    1 
ATOM   5744 C  CG    . LYS E 5 124 ? -1.590  -34.324 61.788  1.00 46.43 ? 124 LYS D CG    1 
ATOM   5745 C  CD    . LYS E 5 124 ? -2.040  -34.459 63.234  1.00 46.48 ? 124 LYS D CD    1 
ATOM   5746 C  CE    . LYS E 5 124 ? -2.009  -35.908 63.691  1.00 46.52 ? 124 LYS D CE    1 
ATOM   5747 N  NZ    . LYS E 5 124 ? -2.438  -36.054 65.110  1.00 46.48 ? 124 LYS D NZ    1 
HETATM 5748 P  PG    . ATP F 6 .   ? -25.874 -37.227 17.588  1.00 75.17 ? 501 ATP A PG    1 
HETATM 5749 O  O1G   . ATP F 6 .   ? -26.192 -37.989 16.320  1.00 74.98 ? 501 ATP A O1G   1 
HETATM 5750 O  O2G   . ATP F 6 .   ? -25.947 -38.053 18.852  1.00 74.92 ? 501 ATP A O2G   1 
HETATM 5751 O  O3G   . ATP F 6 .   ? -24.648 -36.346 17.494  1.00 74.92 ? 501 ATP A O3G   1 
HETATM 5752 P  PB    . ATP F 6 .   ? -28.616 -36.537 17.437  1.00 73.48 ? 501 ATP A PB    1 
HETATM 5753 O  O1B   . ATP F 6 .   ? -29.000 -35.881 16.133  1.00 73.63 ? 501 ATP A O1B   1 
HETATM 5754 O  O2B   . ATP F 6 .   ? -28.823 -38.021 17.626  1.00 73.79 ? 501 ATP A O2B   1 
HETATM 5755 O  O3B   . ATP F 6 .   ? -27.077 -36.165 17.738  1.00 74.21 ? 501 ATP A O3B   1 
HETATM 5756 P  PA    . ATP F 6 .   ? -29.146 -36.121 20.165  1.00 71.55 ? 501 ATP A PA    1 
HETATM 5757 O  O1A   . ATP F 6 .   ? -30.032 -37.293 20.522  1.00 71.67 ? 501 ATP A O1A   1 
HETATM 5758 O  O2A   . ATP F 6 .   ? -27.661 -36.186 20.433  1.00 71.64 ? 501 ATP A O2A   1 
HETATM 5759 O  O3A   . ATP F 6 .   ? -29.398 -35.768 18.613  1.00 72.44 ? 501 ATP A O3A   1 
HETATM 5760 O  "O5'" . ATP F 6 .   ? -29.712 -34.819 20.929  1.00 69.93 ? 501 ATP A "O5'" 1 
HETATM 5761 C  "C5'" . ATP F 6 .   ? -29.590 -33.516 20.358  1.00 67.21 ? 501 ATP A "C5'" 1 
HETATM 5762 C  "C4'" . ATP F 6 .   ? -30.957 -32.867 20.152  1.00 65.17 ? 501 ATP A "C4'" 1 
HETATM 5763 O  "O4'" . ATP F 6 .   ? -31.113 -32.457 18.790  1.00 64.02 ? 501 ATP A "O4'" 1 
HETATM 5764 C  "C3'" . ATP F 6 .   ? -32.133 -33.788 20.450  1.00 64.41 ? 501 ATP A "C3'" 1 
HETATM 5765 O  "O3'" . ATP F 6 .   ? -32.586 -33.617 21.798  1.00 64.46 ? 501 ATP A "O3'" 1 
HETATM 5766 C  "C2'" . ATP F 6 .   ? -33.198 -33.391 19.447  1.00 63.56 ? 501 ATP A "C2'" 1 
HETATM 5767 O  "O2'" . ATP F 6 .   ? -34.208 -32.603 20.078  1.00 63.37 ? 501 ATP A "O2'" 1 
HETATM 5768 C  "C1'" . ATP F 6 .   ? -32.490 -32.539 18.403  1.00 62.56 ? 501 ATP A "C1'" 1 
HETATM 5769 N  N9    . ATP F 6 .   ? -32.638 -33.164 17.062  1.00 61.99 ? 501 ATP A N9    1 
HETATM 5770 C  C8    . ATP F 6 .   ? -31.707 -33.899 16.424  1.00 61.74 ? 501 ATP A C8    1 
HETATM 5771 N  N7    . ATP F 6 .   ? -32.156 -34.326 15.217  1.00 61.64 ? 501 ATP A N7    1 
HETATM 5772 C  C5    . ATP F 6 .   ? -33.409 -33.861 15.066  1.00 61.67 ? 501 ATP A C5    1 
HETATM 5773 C  C6    . ATP F 6 .   ? -34.462 -33.936 14.022  1.00 61.81 ? 501 ATP A C6    1 
HETATM 5774 N  N6    . ATP F 6 .   ? -34.253 -34.622 12.874  1.00 61.85 ? 501 ATP A N6    1 
HETATM 5775 N  N1    . ATP F 6 .   ? -35.637 -33.305 14.256  1.00 61.81 ? 501 ATP A N1    1 
HETATM 5776 C  C2    . ATP F 6 .   ? -35.857 -32.620 15.397  1.00 61.84 ? 501 ATP A C2    1 
HETATM 5777 N  N3    . ATP F 6 .   ? -34.946 -32.508 16.386  1.00 61.70 ? 501 ATP A N3    1 
HETATM 5778 C  C4    . ATP F 6 .   ? -33.723 -33.093 16.284  1.00 61.71 ? 501 ATP A C4    1 
HETATM 5779 ZN ZN    . ZN  G 7 .   ? -4.893  -23.817 25.212  1.00 64.79 ? 201 ZN  C ZN    1 
HETATM 5780 O  O     . HOH H 8 .   ? -28.119 -20.111 38.145  1.00 34.68 ? 66  HOH E O     1 
HETATM 5781 O  O     . HOH H 8 .   ? -31.375 -3.929  35.281  1.00 45.58 ? 67  HOH E O     1 
HETATM 5782 O  O     . HOH H 8 .   ? -39.589 -3.469  34.654  1.00 47.12 ? 68  HOH E O     1 
HETATM 5783 O  O     . HOH H 8 .   ? -45.768 16.201  42.732  1.00 41.97 ? 69  HOH E O     1 
HETATM 5784 O  O     . HOH H 8 .   ? -35.981 -20.769 51.116  1.00 46.29 ? 70  HOH E O     1 
HETATM 5785 O  O     . HOH H 8 .   ? -43.248 -8.865  27.192  1.00 53.03 ? 71  HOH E O     1 
HETATM 5786 O  O     . HOH H 8 .   ? -44.296 -7.415  37.074  1.00 52.22 ? 72  HOH E O     1 
HETATM 5787 O  O     . HOH H 8 .   ? -33.870 -28.605 47.790  1.00 36.40 ? 73  HOH E O     1 
HETATM 5788 O  O     . HOH H 8 .   ? -40.594 10.724  33.691  1.00 50.33 ? 74  HOH E O     1 
HETATM 5789 O  O     . HOH H 8 .   ? -32.599 -31.161 51.281  1.00 39.22 ? 75  HOH E O     1 
HETATM 5790 O  O     . HOH H 8 .   ? -43.925 -10.066 30.767  1.00 56.62 ? 76  HOH E O     1 
HETATM 5791 O  O     . HOH H 8 .   ? -32.414 -24.137 41.887  1.00 34.70 ? 77  HOH E O     1 
HETATM 5792 O  O     . HOH H 8 .   ? -46.913 -8.039  37.530  1.00 48.53 ? 78  HOH E O     1 
HETATM 5793 O  O     . HOH H 8 .   ? -34.663 32.146  29.519  1.00 62.22 ? 79  HOH E O     1 
HETATM 5794 O  O     . HOH H 8 .   ? -35.799 -27.683 45.723  1.00 40.62 ? 80  HOH E O     1 
HETATM 5795 O  O     . HOH H 8 .   ? -36.520 32.966  31.826  1.00 53.90 ? 81  HOH E O     1 
HETATM 5796 O  O     . HOH H 8 .   ? -37.537 23.909  35.348  1.00 42.94 ? 82  HOH E O     1 
HETATM 5797 O  O     . HOH H 8 .   ? -39.322 33.572  30.729  1.00 51.48 ? 83  HOH E O     1 
HETATM 5798 O  O     . HOH H 8 .   ? -35.712 -19.364 53.516  1.00 60.58 ? 84  HOH E O     1 
HETATM 5799 O  O     . HOH H 8 .   ? -25.412 -22.119 44.804  1.00 55.90 ? 85  HOH E O     1 
HETATM 5800 O  O     . HOH H 8 .   ? -40.306 27.077  34.414  1.00 54.86 ? 86  HOH E O     1 
HETATM 5801 O  O     . HOH H 8 .   ? -42.465 16.413  44.805  1.00 51.12 ? 87  HOH E O     1 
HETATM 5802 O  O     . HOH H 8 .   ? -36.952 -15.366 35.947  1.00 44.67 ? 88  HOH E O     1 
HETATM 5803 O  O     . HOH H 8 .   ? -38.749 16.596  45.620  1.00 45.57 ? 89  HOH E O     1 
HETATM 5804 O  O     . HOH H 8 .   ? -44.013 32.070  32.082  1.00 59.87 ? 90  HOH E O     1 
HETATM 5805 O  O     . HOH I 8 .   ? -31.082 -14.949 10.876  1.00 36.43 ? 502 HOH A O     1 
HETATM 5806 O  O     . HOH I 8 .   ? -15.455 -5.771  36.504  1.00 23.83 ? 503 HOH A O     1 
HETATM 5807 O  O     . HOH I 8 .   ? -18.990 20.241  37.168  1.00 38.84 ? 504 HOH A O     1 
HETATM 5808 O  O     . HOH I 8 .   ? -15.335 5.186   38.698  1.00 28.78 ? 505 HOH A O     1 
HETATM 5809 O  O     . HOH I 8 .   ? -11.464 19.676  30.423  1.00 32.59 ? 506 HOH A O     1 
HETATM 5810 O  O     . HOH I 8 .   ? -19.207 -19.437 1.120   1.00 50.51 ? 507 HOH A O     1 
HETATM 5811 O  O     . HOH I 8 .   ? -13.654 -4.107  31.530  1.00 34.35 ? 508 HOH A O     1 
HETATM 5812 O  O     . HOH I 8 .   ? -14.324 -14.075 38.947  1.00 36.01 ? 509 HOH A O     1 
HETATM 5813 O  O     . HOH I 8 .   ? -32.731 -12.065 30.823  1.00 32.96 ? 510 HOH A O     1 
HETATM 5814 O  O     . HOH I 8 .   ? -30.621 -14.313 7.943   1.00 33.90 ? 511 HOH A O     1 
HETATM 5815 O  O     . HOH I 8 .   ? -13.284 -5.627  29.077  1.00 31.10 ? 512 HOH A O     1 
HETATM 5816 O  O     . HOH I 8 .   ? -27.875 -7.058  21.182  1.00 44.09 ? 513 HOH A O     1 
HETATM 5817 O  O     . HOH I 8 .   ? -21.642 -14.994 38.094  1.00 33.35 ? 514 HOH A O     1 
HETATM 5818 O  O     . HOH I 8 .   ? -24.823 15.867  37.396  1.00 41.36 ? 515 HOH A O     1 
HETATM 5819 O  O     . HOH I 8 .   ? -35.108 -18.067 12.513  1.00 48.28 ? 516 HOH A O     1 
HETATM 5820 O  O     . HOH I 8 .   ? -26.255 17.824  36.145  1.00 36.30 ? 517 HOH A O     1 
HETATM 5821 O  O     . HOH I 8 .   ? -11.720 -6.321  48.476  1.00 36.87 ? 518 HOH A O     1 
HETATM 5822 O  O     . HOH I 8 .   ? -27.089 7.204   35.904  1.00 30.36 ? 519 HOH A O     1 
HETATM 5823 O  O     . HOH I 8 .   ? -26.170 10.064  36.775  1.00 39.74 ? 520 HOH A O     1 
HETATM 5824 O  O     . HOH I 8 .   ? -16.341 24.598  34.143  1.00 31.77 ? 521 HOH A O     1 
HETATM 5825 O  O     . HOH I 8 .   ? -25.572 13.442  37.184  1.00 44.32 ? 522 HOH A O     1 
HETATM 5826 O  O     . HOH I 8 .   ? -30.141 -15.989 20.738  1.00 37.67 ? 523 HOH A O     1 
HETATM 5827 O  O     . HOH I 8 .   ? -24.950 6.992   17.046  1.00 48.42 ? 524 HOH A O     1 
HETATM 5828 O  O     . HOH I 8 .   ? -11.796 -19.315 20.899  1.00 36.30 ? 525 HOH A O     1 
HETATM 5829 O  O     . HOH I 8 .   ? -24.326 -2.802  16.721  1.00 41.45 ? 526 HOH A O     1 
HETATM 5830 O  O     . HOH I 8 .   ? -13.597 5.819   27.500  1.00 35.10 ? 527 HOH A O     1 
HETATM 5831 O  O     . HOH I 8 .   ? -10.266 4.600   48.757  1.00 43.14 ? 528 HOH A O     1 
HETATM 5832 O  O     . HOH I 8 .   ? -13.373 -14.506 24.753  1.00 41.09 ? 529 HOH A O     1 
HETATM 5833 O  O     . HOH I 8 .   ? -9.983  26.598  31.651  1.00 51.85 ? 530 HOH A O     1 
HETATM 5834 O  O     . HOH I 8 .   ? -24.066 14.162  8.895   1.00 51.35 ? 531 HOH A O     1 
HETATM 5835 O  O     . HOH I 8 .   ? -26.371 23.443  15.981  1.00 47.10 ? 532 HOH A O     1 
HETATM 5836 O  O     . HOH I 8 .   ? -16.525 14.856  9.340   1.00 45.60 ? 533 HOH A O     1 
HETATM 5837 O  O     . HOH I 8 .   ? -32.166 0.333   39.852  1.00 44.60 ? 534 HOH A O     1 
HETATM 5838 O  O     . HOH I 8 .   ? -19.790 -33.204 10.086  1.00 55.58 ? 535 HOH A O     1 
HETATM 5839 O  O     . HOH I 8 .   ? -8.435  14.357  41.143  1.00 44.68 ? 536 HOH A O     1 
HETATM 5840 O  O     . HOH I 8 .   ? -9.884  30.398  35.400  1.00 50.43 ? 537 HOH A O     1 
HETATM 5841 O  O     . HOH I 8 .   ? -34.443 -25.358 14.643  1.00 46.63 ? 538 HOH A O     1 
HETATM 5842 O  O     . HOH I 8 .   ? -13.566 5.727   21.553  1.00 49.00 ? 539 HOH A O     1 
HETATM 5843 O  O     . HOH I 8 .   ? -28.911 -13.557 24.785  1.00 43.47 ? 540 HOH A O     1 
HETATM 5844 O  O     . HOH I 8 .   ? -28.952 -13.380 20.536  1.00 42.45 ? 541 HOH A O     1 
HETATM 5845 O  O     . HOH I 8 .   ? -15.716 9.446   47.801  1.00 41.06 ? 542 HOH A O     1 
HETATM 5846 O  O     . HOH I 8 .   ? -7.005  -1.517  51.799  1.00 56.71 ? 543 HOH A O     1 
HETATM 5847 O  O     . HOH I 8 .   ? -15.036 8.241   50.073  1.00 47.72 ? 544 HOH A O     1 
HETATM 5848 O  O     . HOH I 8 .   ? -33.124 -25.123 11.144  1.00 33.29 ? 545 HOH A O     1 
HETATM 5849 O  O     . HOH I 8 .   ? -32.621 -18.168 27.488  1.00 42.99 ? 546 HOH A O     1 
HETATM 5850 O  O     . HOH I 8 .   ? -14.097 13.658  9.845   1.00 47.37 ? 547 HOH A O     1 
HETATM 5851 O  O     . HOH I 8 .   ? -16.204 -33.903 6.826   1.00 49.74 ? 548 HOH A O     1 
HETATM 5852 O  O     . HOH I 8 .   ? -24.209 -12.331 50.961  1.00 57.27 ? 549 HOH A O     1 
HETATM 5853 O  O     . HOH I 8 .   ? -26.931 -21.536 26.896  1.00 33.29 ? 550 HOH A O     1 
HETATM 5854 O  O     . HOH I 8 .   ? -29.479 -4.059  50.744  1.00 44.54 ? 551 HOH A O     1 
HETATM 5855 O  O     . HOH I 8 .   ? -20.060 7.556   15.083  1.00 62.59 ? 552 HOH A O     1 
HETATM 5856 O  O     . HOH I 8 .   ? -12.578 -31.511 4.052   1.00 63.00 ? 553 HOH A O     1 
HETATM 5857 O  O     . HOH I 8 .   ? -10.165 -1.509  36.707  1.00 58.17 ? 554 HOH A O     1 
HETATM 5858 O  O     . HOH I 8 .   ? -18.170 27.895  41.073  1.00 58.82 ? 555 HOH A O     1 
HETATM 5859 O  O     . HOH I 8 .   ? -12.385 -13.060 17.665  1.00 51.95 ? 556 HOH A O     1 
HETATM 5860 O  O     . HOH I 8 .   ? -21.911 -2.443  15.707  1.00 49.14 ? 557 HOH A O     1 
HETATM 5861 O  O     . HOH I 8 .   ? -32.759 -20.186 32.515  1.00 42.96 ? 558 HOH A O     1 
HETATM 5862 O  O     . HOH I 8 .   ? -14.095 -0.866  22.496  1.00 49.18 ? 559 HOH A O     1 
HETATM 5863 O  O     . HOH I 8 .   ? -23.465 -33.112 10.563  1.00 51.06 ? 560 HOH A O     1 
HETATM 5864 O  O     . HOH I 8 .   ? -36.203 -20.223 15.240  1.00 54.45 ? 561 HOH A O     1 
HETATM 5865 O  O     . HOH I 8 .   ? -31.735 -22.264 16.863  1.00 39.98 ? 562 HOH A O     1 
HETATM 5866 O  O     . HOH J 8 .   ? -50.763 -12.187 -11.398 1.00 46.17 ? 98  HOH B O     1 
HETATM 5867 O  O     . HOH J 8 .   ? -34.905 -28.370 8.338   1.00 38.89 ? 99  HOH B O     1 
HETATM 5868 O  O     . HOH J 8 .   ? -38.999 -25.441 -13.656 1.00 46.02 ? 100 HOH B O     1 
HETATM 5869 O  O     . HOH J 8 .   ? -33.730 -32.902 -0.082  1.00 50.17 ? 101 HOH B O     1 
HETATM 5870 O  O     . HOH J 8 .   ? -30.108 -28.807 -6.710  1.00 54.74 ? 102 HOH B O     1 
HETATM 5871 O  O     . HOH J 8 .   ? -32.103 -16.424 -10.905 1.00 49.62 ? 103 HOH B O     1 
HETATM 5872 O  O     . HOH J 8 .   ? -35.075 -13.510 7.828   1.00 47.12 ? 104 HOH B O     1 
HETATM 5873 O  O     . HOH J 8 .   ? -33.626 -10.279 -10.065 1.00 45.72 ? 105 HOH B O     1 
HETATM 5874 O  O     . HOH J 8 .   ? -50.653 -21.519 -11.306 1.00 52.14 ? 106 HOH B O     1 
HETATM 5875 O  O     . HOH J 8 .   ? -47.252 -14.305 -6.101  1.00 44.88 ? 107 HOH B O     1 
HETATM 5876 O  O     . HOH J 8 .   ? -49.807 -15.649 -14.858 1.00 52.29 ? 108 HOH B O     1 
HETATM 5877 O  O     . HOH J 8 .   ? -50.692 -18.069 -13.991 1.00 51.28 ? 109 HOH B O     1 
HETATM 5878 O  O     . HOH J 8 .   ? -34.609 -7.974  -10.982 1.00 67.95 ? 110 HOH B O     1 
HETATM 5879 O  O     . HOH J 8 .   ? -53.676 -24.593 -6.894  1.00 47.40 ? 111 HOH B O     1 
HETATM 5880 O  O     . HOH J 8 .   ? -34.633 -7.582  -4.211  1.00 49.26 ? 112 HOH B O     1 
HETATM 5881 O  O     . HOH J 8 .   ? -48.480 -25.398 -18.916 1.00 40.17 ? 113 HOH B O     1 
HETATM 5882 O  O     . HOH K 8 .   ? -20.993 -17.396 39.157  1.00 37.40 ? 202 HOH C O     1 
HETATM 5883 O  O     . HOH K 8 .   ? -27.244 -17.967 39.583  1.00 21.75 ? 203 HOH C O     1 
HETATM 5884 O  O     . HOH K 8 .   ? -17.748 -30.852 25.816  1.00 44.86 ? 204 HOH C O     1 
HETATM 5885 O  O     . HOH K 8 .   ? -11.521 -25.190 19.408  1.00 42.91 ? 205 HOH C O     1 
HETATM 5886 O  O     . HOH K 8 .   ? -24.194 -18.876 45.929  1.00 30.76 ? 206 HOH C O     1 
HETATM 5887 O  O     . HOH K 8 .   ? -23.286 -20.672 49.055  1.00 33.22 ? 207 HOH C O     1 
HETATM 5888 O  O     . HOH K 8 .   ? -24.887 -22.057 47.560  1.00 46.73 ? 208 HOH C O     1 
HETATM 5889 O  O     . HOH K 8 .   ? -16.903 -21.690 36.130  1.00 48.60 ? 209 HOH C O     1 
HETATM 5890 O  O     . HOH K 8 .   ? -22.671 -14.515 51.141  1.00 47.87 ? 210 HOH C O     1 
HETATM 5891 O  O     . HOH K 8 .   ? -23.134 -15.718 53.541  1.00 56.05 ? 211 HOH C O     1 
HETATM 5892 O  O     . HOH L 8 .   ? -28.524 -45.159 51.126  1.00 52.43 ? 131 HOH D O     1 
HETATM 5893 O  O     . HOH L 8 .   ? 4.853   -29.428 58.397  1.00 44.41 ? 132 HOH D O     1 
HETATM 5894 O  O     . HOH L 8 .   ? 5.653   -31.800 59.516  1.00 50.69 ? 133 HOH D O     1 
HETATM 5895 O  O     . HOH L 8 .   ? -18.623 -23.579 47.756  1.00 41.28 ? 134 HOH D O     1 
HETATM 5896 O  O     . HOH L 8 .   ? -15.135 -23.820 34.866  1.00 41.14 ? 135 HOH D O     1 
HETATM 5897 O  O     . HOH L 8 .   ? 1.755   -32.808 56.733  1.00 55.18 ? 136 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   G   E . n 
A 1 2   G   2   2   2   G   G   E . n 
A 1 3   G   3   3   3   G   G   E . n 
A 1 4   U   4   4   4   U   U   E . n 
A 1 5   C   5   5   5   C   C   E . n 
A 1 6   C   6   6   6   C   C   E . n 
A 1 7   G   7   7   7   G   G   E . n 
A 1 8   C   8   8   8   C   C   E . n 
A 1 9   C   9   9   9   C   C   E . n 
A 1 10  U   10  10  10  U   U   E . n 
A 1 11  U   11  11  11  U   U   E . n 
A 1 12  G   12  12  12  G   G   E . n 
A 1 13  A   13  13  13  A   A   E . n 
A 1 14  G   14  14  14  G   G   E . n 
A 1 15  U   15  15  15  U   U   E . n 
A 1 16  G   16  16  16  G   G   E . n 
A 1 17  C   17  17  17  C   C   E . n 
A 1 18  C   18  18  18  C   C   E . n 
A 1 19  C   19  19  19  C   C   E . n 
A 1 20  G   20  20  20  G   G   E . n 
A 1 21  G   21  21  21  G   G   E . n 
A 1 22  G   22  22  22  G   G   E . n 
A 1 23  U   23  23  23  U   U   E . n 
A 1 24  G   24  24  24  G   G   E . n 
A 1 25  A   25  25  25  A   A   E . n 
A 1 26  G   26  26  26  G   G   E . n 
A 1 27  A   27  27  27  A   A   E . n 
A 1 28  A   28  28  28  A   A   E . n 
A 1 29  G   29  29  29  G   G   E . n 
A 1 30  C   30  30  30  C   C   E . n 
A 1 31  A   31  31  31  A   A   E . n 
A 1 32  U   32  32  32  U   U   E . n 
A 1 33  G   33  33  33  G   G   E . n 
A 1 34  A   34  34  34  A   A   E . n 
A 1 35  U   35  35  35  U   U   E . n 
A 1 36  C   36  36  36  C   C   E . n 
A 1 37  C   37  37  37  C   C   E . n 
A 1 38  C   38  38  38  C   C   E . n 
A 1 39  G   39  39  39  G   G   E . n 
A 1 40  G   40  40  40  G   G   E . n 
A 1 41  G   41  41  41  G   G   E . n 
A 1 42  U   42  42  42  U   U   E . n 
A 1 43  A   43  43  43  A   A   E . n 
A 1 44  A   44  44  44  A   A   E . n 
A 1 45  U   45  45  45  U   U   E . n 
A 1 46  U   46  46  46  U   U   E . n 
A 1 47  A   47  47  47  A   A   E . n 
A 1 48  U   48  48  48  U   U   E . n 
A 1 49  G   49  49  49  G   G   E . n 
A 1 50  G   50  50  50  G   G   E . n 
A 1 51  C   51  51  51  C   C   E . n 
A 1 52  G   52  52  52  G   G   E . n 
A 1 53  G   53  53  53  G   G   E . n 
A 1 54  A   54  54  54  A   A   E . n 
A 1 55  C   55  55  55  C   C   E . n 
A 1 56  C   56  56  56  C   C   E . n 
A 1 57  C   57  57  57  C   C   E . n 
A 1 58  A   58  58  58  A   A   E . n 
A 1 59  C   59  59  59  C   C   E . n 
A 1 60  A   60  60  60  A   A   E . n 
A 1 61  G   61  61  61  G   G   E . n 
A 1 62  A   62  62  ?   ?   ?   E . n 
A 1 63  A   63  63  ?   ?   ?   E . n 
A 1 64  U   64  64  ?   ?   ?   E . n 
A 1 65  U   65  65  ?   ?   ?   E . n 
B 2 1   MET 1   4   ?   ?   ?   A . n 
B 2 2   ALA 2   5   ?   ?   ?   A . n 
B 2 3   ARG 3   6   ?   ?   ?   A . n 
B 2 4   ASP 4   7   ?   ?   ?   A . n 
B 2 5   GLU 5   8   ?   ?   ?   A . n 
B 2 6   VAL 6   9   ?   ?   ?   A . n 
B 2 7   ARG 7   10  ?   ?   ?   A . n 
B 2 8   ARG 8   11  11  ARG ARG A . n 
B 2 9   ILE 9   12  12  ILE ILE A . n 
B 2 10  LEU 10  13  13  LEU LEU A . n 
B 2 11  PRO 11  14  14  PRO PRO A . n 
B 2 12  ALA 12  15  15  ALA ALA A . n 
B 2 13  ASP 13  16  16  ASP ASP A . n 
B 2 14  ILE 14  17  17  ILE ILE A . n 
B 2 15  LYS 15  18  18  LYS LYS A . n 
B 2 16  ARG 16  19  19  ARG ARG A . n 
B 2 17  GLU 17  20  20  GLU GLU A . n 
B 2 18  VAL 18  21  21  VAL VAL A . n 
B 2 19  LEU 19  22  22  LEU LEU A . n 
B 2 20  ILE 20  23  23  ILE ILE A . n 
B 2 21  LYS 21  24  24  LYS LYS A . n 
B 2 22  ASP 22  25  25  ASP ASP A . n 
B 2 23  GLU 23  26  26  GLU GLU A . n 
B 2 24  ASN 24  27  27  ASN ASN A . n 
B 2 25  ALA 25  28  28  ALA ALA A . n 
B 2 26  GLU 26  29  29  GLU GLU A . n 
B 2 27  THR 27  30  30  THR THR A . n 
B 2 28  ASN 28  31  31  ASN ASN A . n 
B 2 29  PRO 29  32  32  PRO PRO A . n 
B 2 30  ASP 30  33  33  ASP ASP A . n 
B 2 31  TRP 31  34  34  TRP TRP A . n 
B 2 32  GLY 32  35  35  GLY GLY A . n 
B 2 33  PHE 33  36  36  PHE PHE A . n 
B 2 34  PRO 34  37  37  PRO PRO A . n 
B 2 35  PRO 35  38  38  PRO PRO A . n 
B 2 36  GLU 36  39  39  GLU GLU A . n 
B 2 37  LYS 37  40  40  LYS LYS A . n 
B 2 38  ARG 38  41  41  ARG ARG A . n 
B 2 39  PRO 39  42  42  PRO PRO A . n 
B 2 40  ILE 40  43  43  ILE ILE A . n 
B 2 41  GLU 41  44  44  GLU GLU A . n 
B 2 42  MET 42  45  45  MET MET A . n 
B 2 43  HIS 43  46  46  HIS HIS A . n 
B 2 44  ILE 44  47  47  ILE ILE A . n 
B 2 45  GLN 45  48  48  GLN GLN A . n 
B 2 46  PHE 46  49  49  PHE PHE A . n 
B 2 47  GLY 47  50  50  GLY GLY A . n 
B 2 48  VAL 48  51  51  VAL VAL A . n 
B 2 49  ILE 49  52  52  ILE ILE A . n 
B 2 50  ASN 50  53  53  ASN ASN A . n 
B 2 51  LEU 51  54  54  LEU LEU A . n 
B 2 52  ASP 52  55  55  ASP ASP A . n 
B 2 53  LYS 53  56  56  LYS LYS A . n 
B 2 54  PRO 54  57  57  PRO PRO A . n 
B 2 55  PRO 55  58  58  PRO PRO A . n 
B 2 56  GLY 56  59  59  GLY GLY A . n 
B 2 57  PRO 57  60  60  PRO PRO A . n 
B 2 58  THR 58  61  61  THR THR A . n 
B 2 59  SER 59  62  62  SER SER A . n 
B 2 60  HIS 60  63  63  HIS HIS A . n 
B 2 61  GLU 61  64  64  GLU GLU A . n 
B 2 62  VAL 62  65  65  VAL VAL A . n 
B 2 63  VAL 63  66  66  VAL VAL A . n 
B 2 64  ALA 64  67  67  ALA ALA A . n 
B 2 65  TRP 65  68  68  TRP TRP A . n 
B 2 66  ILE 66  69  69  ILE ILE A . n 
B 2 67  LYS 67  70  70  LYS LYS A . n 
B 2 68  LYS 68  71  71  LYS LYS A . n 
B 2 69  ILE 69  72  72  ILE ILE A . n 
B 2 70  LEU 70  73  73  LEU LEU A . n 
B 2 71  ASN 71  74  74  ASN ASN A . n 
B 2 72  LEU 72  75  75  LEU LEU A . n 
B 2 73  GLU 73  76  76  GLU GLU A . n 
B 2 74  LYS 74  77  77  LYS LYS A . n 
B 2 75  ALA 75  78  78  ALA ALA A . n 
B 2 76  GLY 76  79  79  GLY GLY A . n 
B 2 77  HIS 77  80  80  HIS HIS A . n 
B 2 78  GLY 78  81  81  GLY GLY A . n 
B 2 79  GLY 79  82  82  GLY GLY A . n 
B 2 80  THR 80  83  83  THR THR A . n 
B 2 81  LEU 81  84  84  LEU LEU A . n 
B 2 82  ASP 82  85  85  ASP ASP A . n 
B 2 83  PRO 83  86  86  PRO PRO A . n 
B 2 84  LYS 84  87  87  LYS LYS A . n 
B 2 85  VAL 85  88  88  VAL VAL A . n 
B 2 86  SER 86  89  89  SER SER A . n 
B 2 87  GLY 87  90  90  GLY GLY A . n 
B 2 88  VAL 88  91  91  VAL VAL A . n 
B 2 89  LEU 89  92  92  LEU LEU A . n 
B 2 90  PRO 90  93  93  PRO PRO A . n 
B 2 91  VAL 91  94  94  VAL VAL A . n 
B 2 92  ALA 92  95  95  ALA ALA A . n 
B 2 93  LEU 93  96  96  LEU LEU A . n 
B 2 94  GLU 94  97  97  GLU GLU A . n 
B 2 95  LYS 95  98  98  LYS LYS A . n 
B 2 96  ALA 96  99  99  ALA ALA A . n 
B 2 97  THR 97  100 100 THR THR A . n 
B 2 98  ARG 98  101 101 ARG ARG A . n 
B 2 99  VAL 99  102 102 VAL VAL A . n 
B 2 100 VAL 100 103 103 VAL VAL A . n 
B 2 101 GLN 101 104 104 GLN GLN A . n 
B 2 102 ALA 102 105 105 ALA ALA A . n 
B 2 103 LEU 103 106 106 LEU LEU A . n 
B 2 104 LEU 104 107 107 LEU LEU A . n 
B 2 105 PRO 105 108 108 PRO PRO A . n 
B 2 106 ALA 106 109 109 ALA ALA A . n 
B 2 107 GLY 107 110 110 GLY GLY A . n 
B 2 108 LYS 108 111 111 LYS LYS A . n 
B 2 109 GLU 109 112 112 GLU GLU A . n 
B 2 110 TYR 110 113 113 TYR TYR A . n 
B 2 111 VAL 111 114 114 VAL VAL A . n 
B 2 112 ALA 112 115 115 ALA ALA A . n 
B 2 113 LEU 113 116 116 LEU LEU A . n 
B 2 114 MET 114 117 117 MET MET A . n 
B 2 115 HIS 115 118 118 HIS HIS A . n 
B 2 116 LEU 116 119 119 LEU LEU A . n 
B 2 117 HIS 117 120 120 HIS HIS A . n 
B 2 118 GLY 118 121 121 GLY GLY A . n 
B 2 119 ASP 119 122 122 ASP ASP A . n 
B 2 120 VAL 120 123 123 VAL VAL A . n 
B 2 121 PRO 121 124 124 PRO PRO A . n 
B 2 122 GLU 122 125 125 GLU GLU A . n 
B 2 123 ASP 123 126 126 ASP ASP A . n 
B 2 124 LYS 124 127 127 LYS LYS A . n 
B 2 125 ILE 125 128 128 ILE ILE A . n 
B 2 126 ILE 126 129 129 ILE ILE A . n 
B 2 127 GLN 127 130 130 GLN GLN A . n 
B 2 128 VAL 128 131 131 VAL VAL A . n 
B 2 129 MET 129 132 132 MET MET A . n 
B 2 130 LYS 130 133 133 LYS LYS A . n 
B 2 131 GLU 131 134 134 GLU GLU A . n 
B 2 132 PHE 132 135 135 PHE PHE A . n 
B 2 133 GLU 133 136 136 GLU GLU A . n 
B 2 134 GLY 134 137 137 GLY GLY A . n 
B 2 135 GLU 135 138 138 GLU GLU A . n 
B 2 136 ILE 136 139 139 ILE ILE A . n 
B 2 137 ILE 137 140 140 ILE ILE A . n 
B 2 138 GLN 138 141 141 GLN GLN A . n 
B 2 139 ARG 139 142 142 ARG ARG A . n 
B 2 140 PRO 140 143 143 PRO PRO A . n 
B 2 141 PRO 141 144 144 PRO PRO A . n 
B 2 142 LEU 142 145 145 LEU LEU A . n 
B 2 143 ARG 143 146 ?   ?   ?   A . n 
B 2 144 SER 144 147 ?   ?   ?   A . n 
B 2 145 ALA 145 148 ?   ?   ?   A . n 
B 2 146 VAL 146 149 ?   ?   ?   A . n 
B 2 147 LYS 147 150 ?   ?   ?   A . n 
B 2 148 ARG 148 151 ?   ?   ?   A . n 
B 2 149 ARG 149 152 ?   ?   ?   A . n 
B 2 150 LEU 150 153 153 LEU LEU A . n 
B 2 151 ARG 151 154 154 ARG ARG A . n 
B 2 152 THR 152 155 155 THR THR A . n 
B 2 153 ARG 153 156 156 ARG ARG A . n 
B 2 154 LYS 154 157 157 LYS LYS A . n 
B 2 155 VAL 155 158 158 VAL VAL A . n 
B 2 156 TYR 156 159 159 TYR TYR A . n 
B 2 157 TYR 157 160 160 TYR TYR A . n 
B 2 158 ILE 158 161 161 ILE ILE A . n 
B 2 159 GLU 159 162 162 GLU GLU A . n 
B 2 160 VAL 160 163 163 VAL VAL A . n 
B 2 161 LEU 161 164 164 LEU LEU A . n 
B 2 162 GLU 162 165 165 GLU GLU A . n 
B 2 163 ILE 163 166 166 ILE ILE A . n 
B 2 164 GLU 164 167 167 GLU GLU A . n 
B 2 165 GLY 165 168 168 GLY GLY A . n 
B 2 166 ARG 166 169 169 ARG ARG A . n 
B 2 167 ASP 167 170 170 ASP ASP A . n 
B 2 168 VAL 168 171 171 VAL VAL A . n 
B 2 169 LEU 169 172 172 LEU LEU A . n 
B 2 170 PHE 170 173 173 PHE PHE A . n 
B 2 171 ARG 171 174 174 ARG ARG A . n 
B 2 172 VAL 172 175 175 VAL VAL A . n 
B 2 173 GLY 173 176 176 GLY GLY A . n 
B 2 174 VAL 174 177 177 VAL VAL A . n 
B 2 175 GLU 175 178 178 GLU GLU A . n 
B 2 176 ALA 176 179 179 ALA ALA A . n 
B 2 177 GLY 177 180 180 GLY GLY A . n 
B 2 178 THR 178 181 181 THR THR A . n 
B 2 179 TYR 179 182 182 TYR TYR A . n 
B 2 180 ILE 180 183 183 ILE ILE A . n 
B 2 181 ARG 181 184 184 ARG ARG A . n 
B 2 182 SER 182 185 185 SER SER A . n 
B 2 183 LEU 183 186 186 LEU LEU A . n 
B 2 184 ILE 184 187 187 ILE ILE A . n 
B 2 185 HIS 185 188 188 HIS HIS A . n 
B 2 186 HIS 186 189 189 HIS HIS A . n 
B 2 187 ILE 187 190 190 ILE ILE A . n 
B 2 188 GLY 188 191 191 GLY GLY A . n 
B 2 189 LEU 189 192 192 LEU LEU A . n 
B 2 190 ALA 190 193 193 ALA ALA A . n 
B 2 191 LEU 191 194 194 LEU LEU A . n 
B 2 192 GLY 192 195 195 GLY GLY A . n 
B 2 193 VAL 193 196 196 VAL VAL A . n 
B 2 194 GLY 194 197 197 GLY GLY A . n 
B 2 195 ALA 195 198 198 ALA ALA A . n 
B 2 196 HIS 196 199 199 HIS HIS A . n 
B 2 197 MET 197 200 200 MET MET A . n 
B 2 198 SER 198 201 201 SER SER A . n 
B 2 199 GLU 199 202 202 GLU GLU A . n 
B 2 200 LEU 200 203 203 LEU LEU A . n 
B 2 201 ARG 201 204 204 ARG ARG A . n 
B 2 202 ARG 202 205 205 ARG ARG A . n 
B 2 203 THR 203 206 206 THR THR A . n 
B 2 204 ARG 204 207 207 ARG ARG A . n 
B 2 205 SER 205 208 208 SER SER A . n 
B 2 206 GLY 206 209 209 GLY GLY A . n 
B 2 207 PRO 207 210 210 PRO PRO A . n 
B 2 208 PHE 208 211 211 PHE PHE A . n 
B 2 209 LYS 209 212 212 LYS LYS A . n 
B 2 210 GLU 210 213 213 GLU GLU A . n 
B 2 211 ASP 211 214 214 ASP ASP A . n 
B 2 212 GLU 212 215 215 GLU GLU A . n 
B 2 213 THR 213 216 216 THR THR A . n 
B 2 214 LEU 214 217 217 LEU LEU A . n 
B 2 215 ILE 215 218 218 ILE ILE A . n 
B 2 216 THR 216 219 219 THR THR A . n 
B 2 217 LEU 217 220 220 LEU LEU A . n 
B 2 218 HIS 218 221 221 HIS HIS A . n 
B 2 219 ASP 219 222 222 ASP ASP A . n 
B 2 220 LEU 220 223 223 LEU LEU A . n 
B 2 221 VAL 221 224 224 VAL VAL A . n 
B 2 222 ASP 222 225 225 ASP ASP A . n 
B 2 223 TYR 223 226 226 TYR TYR A . n 
B 2 224 TYR 224 227 227 TYR TYR A . n 
B 2 225 TYR 225 228 228 TYR TYR A . n 
B 2 226 PHE 226 229 229 PHE PHE A . n 
B 2 227 TRP 227 230 230 TRP TRP A . n 
B 2 228 LYS 228 231 231 LYS LYS A . n 
B 2 229 GLU 229 232 232 GLU GLU A . n 
B 2 230 ASP 230 233 233 ASP ASP A . n 
B 2 231 GLY 231 234 234 GLY GLY A . n 
B 2 232 ILE 232 235 235 ILE ILE A . n 
B 2 233 GLU 233 236 236 GLU GLU A . n 
B 2 234 GLU 234 237 237 GLU GLU A . n 
B 2 235 TYR 235 238 238 TYR TYR A . n 
B 2 236 PHE 236 239 239 PHE PHE A . n 
B 2 237 ARG 237 240 240 ARG ARG A . n 
B 2 238 LYS 238 241 241 LYS LYS A . n 
B 2 239 ALA 239 242 242 ALA ALA A . n 
B 2 240 ILE 240 243 243 ILE ILE A . n 
B 2 241 GLN 241 244 244 GLN GLN A . n 
B 2 242 PRO 242 245 245 PRO PRO A . n 
B 2 243 MET 243 246 246 MET MET A . n 
B 2 244 GLU 244 247 247 GLU GLU A . n 
B 2 245 LYS 245 248 248 LYS LYS A . n 
B 2 246 ALA 246 249 249 ALA ALA A . n 
B 2 247 VAL 247 250 250 VAL VAL A . n 
B 2 248 GLU 248 251 251 GLU GLU A . n 
B 2 249 HIS 249 252 252 HIS HIS A . n 
B 2 250 LEU 250 253 253 LEU LEU A . n 
B 2 251 PRO 251 254 254 PRO PRO A . n 
B 2 252 LYS 252 255 255 LYS LYS A . n 
B 2 253 VAL 253 256 256 VAL VAL A . n 
B 2 254 TRP 254 257 257 TRP TRP A . n 
B 2 255 ILE 255 258 258 ILE ILE A . n 
B 2 256 LYS 256 259 259 LYS LYS A . n 
B 2 257 ASP 257 260 260 ASP ASP A . n 
B 2 258 SER 258 261 261 SER SER A . n 
B 2 259 ALA 259 262 262 ALA ALA A . n 
B 2 260 VAL 260 263 263 VAL VAL A . n 
B 2 261 ALA 261 264 264 ALA ALA A . n 
B 2 262 ALA 262 265 265 ALA ALA A . n 
B 2 263 VAL 263 266 266 VAL VAL A . n 
B 2 264 THR 264 267 267 THR THR A . n 
B 2 265 HIS 265 268 268 HIS HIS A . n 
B 2 266 GLY 266 269 269 GLY GLY A . n 
B 2 267 ALA 267 270 270 ALA ALA A . n 
B 2 268 ASP 268 271 271 ASP ASP A . n 
B 2 269 LEU 269 272 272 LEU LEU A . n 
B 2 270 ALA 270 273 273 ALA ALA A . n 
B 2 271 VAL 271 274 274 VAL VAL A . n 
B 2 272 PRO 272 275 275 PRO PRO A . n 
B 2 273 GLY 273 276 276 GLY GLY A . n 
B 2 274 ILE 274 277 277 ILE ILE A . n 
B 2 275 ALA 275 278 278 ALA ALA A . n 
B 2 276 LYS 276 279 279 LYS LYS A . n 
B 2 277 LEU 277 280 280 LEU LEU A . n 
B 2 278 HIS 278 281 281 HIS HIS A . n 
B 2 279 ALA 279 282 282 ALA ALA A . n 
B 2 280 GLY 280 283 283 GLY GLY A . n 
B 2 281 ILE 281 284 284 ILE ILE A . n 
B 2 282 LYS 282 285 285 LYS LYS A . n 
B 2 283 ARG 283 286 286 ARG ARG A . n 
B 2 284 GLY 284 287 287 GLY GLY A . n 
B 2 285 ASP 285 288 288 ASP ASP A . n 
B 2 286 LEU 286 289 289 LEU LEU A . n 
B 2 287 VAL 287 290 290 VAL VAL A . n 
B 2 288 ALA 288 291 291 ALA ALA A . n 
B 2 289 ILE 289 292 292 ILE ILE A . n 
B 2 290 MET 290 293 293 MET MET A . n 
B 2 291 THR 291 294 294 THR THR A . n 
B 2 292 LEU 292 295 295 LEU LEU A . n 
B 2 293 LYS 293 296 296 LYS LYS A . n 
B 2 294 ASP 294 297 297 ASP ASP A . n 
B 2 295 GLU 295 298 298 GLU GLU A . n 
B 2 296 LEU 296 299 299 LEU LEU A . n 
B 2 297 VAL 297 300 300 VAL VAL A . n 
B 2 298 ALA 298 301 301 ALA ALA A . n 
B 2 299 LEU 299 302 302 LEU LEU A . n 
B 2 300 GLY 300 303 303 GLY GLY A . n 
B 2 301 LYS 301 304 304 LYS LYS A . n 
B 2 302 ALA 302 305 305 ALA ALA A . n 
B 2 303 MET 303 306 306 MET MET A . n 
B 2 304 MET 304 307 307 MET MET A . n 
B 2 305 THR 305 308 308 THR THR A . n 
B 2 306 SER 306 309 309 SER SER A . n 
B 2 307 GLN 307 310 310 GLN GLN A . n 
B 2 308 GLU 308 311 311 GLU GLU A . n 
B 2 309 MET 309 312 312 MET MET A . n 
B 2 310 LEU 310 313 313 LEU LEU A . n 
B 2 311 GLU 311 314 314 GLU GLU A . n 
B 2 312 LYS 312 315 315 LYS LYS A . n 
B 2 313 THR 313 316 316 THR THR A . n 
B 2 314 LYS 314 317 317 LYS LYS A . n 
B 2 315 GLY 315 318 318 GLY GLY A . n 
B 2 316 ILE 316 319 319 ILE ILE A . n 
B 2 317 ALA 317 320 320 ALA ALA A . n 
B 2 318 VAL 318 321 321 VAL VAL A . n 
B 2 319 ASP 319 322 322 ASP ASP A . n 
B 2 320 VAL 320 323 323 VAL VAL A . n 
B 2 321 GLU 321 324 324 GLU GLU A . n 
B 2 322 LYS 322 325 325 LYS LYS A . n 
B 2 323 VAL 323 326 326 VAL VAL A . n 
B 2 324 PHE 324 327 327 PHE PHE A . n 
B 2 325 MET 325 328 328 MET MET A . n 
B 2 326 PRO 326 329 329 PRO PRO A . n 
B 2 327 ARG 327 330 330 ARG ARG A . n 
B 2 328 ASP 328 331 331 ASP ASP A . n 
B 2 329 TRP 329 332 332 TRP TRP A . n 
B 2 330 TYR 330 333 333 TYR TYR A . n 
B 2 331 PRO 331 334 334 PRO PRO A . n 
B 2 332 LYS 332 335 335 LYS LYS A . n 
B 2 333 LEU 333 336 336 LEU LEU A . n 
B 2 334 TRP 334 337 337 TRP TRP A . n 
B 2 335 GLU 335 338 ?   ?   ?   A . n 
B 2 336 LYS 336 339 ?   ?   ?   A . n 
B 2 337 ARG 337 340 ?   ?   ?   A . n 
B 2 338 ASP 338 341 ?   ?   ?   A . n 
B 2 339 ARG 339 342 ?   ?   ?   A . n 
B 2 340 SER 340 343 ?   ?   ?   A . n 
B 2 341 HIS 341 344 ?   ?   ?   A . n 
B 2 342 HIS 342 345 ?   ?   ?   A . n 
B 2 343 HIS 343 346 ?   ?   ?   A . n 
B 2 344 HIS 344 347 ?   ?   ?   A . n 
B 2 345 HIS 345 348 ?   ?   ?   A . n 
B 2 346 HIS 346 349 ?   ?   ?   A . n 
C 3 1   MET 1   -6  ?   ?   ?   B . n 
C 3 2   GLU 2   -5  ?   ?   ?   B . n 
C 3 3   LYS 3   -4  ?   ?   ?   B . n 
C 3 4   GLN 4   -3  ?   ?   ?   B . n 
C 3 5   GLY 5   -2  ?   ?   ?   B . n 
C 3 6   GLU 6   -1  ?   ?   ?   B . n 
C 3 7   LYS 7   0   ?   ?   ?   B . n 
C 3 8   MET 8   1   1   MET MET B . n 
C 3 9   LYS 9   2   2   LYS LYS B . n 
C 3 10  ARG 10  3   3   ARG ARG B . n 
C 3 11  LEU 11  4   4   LEU LEU B . n 
C 3 12  GLY 12  5   5   GLY GLY B . n 
C 3 13  LYS 13  6   6   LYS LYS B . n 
C 3 14  VAL 14  7   7   VAL VAL B . n 
C 3 15  LEU 15  8   8   LEU LEU B . n 
C 3 16  HIS 16  9   9   HIS HIS B . n 
C 3 17  TYR 17  10  10  TYR TYR B . n 
C 3 18  ALA 18  11  11  ALA ALA B . n 
C 3 19  LYS 19  12  12  LYS LYS B . n 
C 3 20  GLN 20  13  13  GLN GLN B . n 
C 3 21  GLY 21  14  14  GLY GLY B . n 
C 3 22  PHE 22  15  15  PHE PHE B . n 
C 3 23  LEU 23  16  16  LEU LEU B . n 
C 3 24  ILE 24  17  17  ILE ILE B . n 
C 3 25  VAL 25  18  18  VAL VAL B . n 
C 3 26  ARG 26  19  19  ARG ARG B . n 
C 3 27  THR 27  20  20  THR THR B . n 
C 3 28  ASN 28  21  21  ASN ASN B . n 
C 3 29  TRP 29  22  22  TRP TRP B . n 
C 3 30  VAL 30  23  23  VAL VAL B . n 
C 3 31  PRO 31  24  24  PRO PRO B . n 
C 3 32  SER 32  25  25  SER SER B . n 
C 3 33  LEU 33  26  26  LEU LEU B . n 
C 3 34  ASN 34  27  27  ASN ASN B . n 
C 3 35  ASP 35  28  28  ASP ASP B . n 
C 3 36  ARG 36  29  29  ARG ARG B . n 
C 3 37  VAL 37  30  30  VAL VAL B . n 
C 3 38  VAL 38  31  31  VAL VAL B . n 
C 3 39  ASP 39  32  32  ASP ASP B . n 
C 3 40  LYS 40  33  33  LYS LYS B . n 
C 3 41  ARG 41  34  34  ARG ARG B . n 
C 3 42  LEU 42  35  35  LEU LEU B . n 
C 3 43  GLN 43  36  36  GLN GLN B . n 
C 3 44  PHE 44  37  37  PHE PHE B . n 
C 3 45  VAL 45  38  38  VAL VAL B . n 
C 3 46  GLY 46  39  39  GLY GLY B . n 
C 3 47  ILE 47  40  40  ILE ILE B . n 
C 3 48  VAL 48  41  41  VAL VAL B . n 
C 3 49  LYS 49  42  42  LYS LYS B . n 
C 3 50  ASP 50  43  43  ASP ASP B . n 
C 3 51  VAL 51  44  44  VAL VAL B . n 
C 3 52  PHE 52  45  45  PHE PHE B . n 
C 3 53  GLY 53  46  46  GLY GLY B . n 
C 3 54  PRO 54  47  47  PRO PRO B . n 
C 3 55  VAL 55  48  48  VAL VAL B . n 
C 3 56  LYS 56  49  49  LYS LYS B . n 
C 3 57  MET 57  50  50  MET MET B . n 
C 3 58  PRO 58  51  51  PRO PRO B . n 
C 3 59  TYR 59  52  52  TYR TYR B . n 
C 3 60  VAL 60  53  53  VAL VAL B . n 
C 3 61  ALA 61  54  54  ALA ALA B . n 
C 3 62  ILE 62  55  55  ILE ILE B . n 
C 3 63  LYS 63  56  56  LYS LYS B . n 
C 3 64  PRO 64  57  57  PRO PRO B . n 
C 3 65  LYS 65  58  58  LYS LYS B . n 
C 3 66  VAL 66  59  59  VAL VAL B . n 
C 3 67  SER 67  60  60  SER SER B . n 
C 3 68  ASN 68  61  61  ASN ASN B . n 
C 3 69  PRO 69  62  62  PRO PRO B . n 
C 3 70  GLU 70  63  63  GLU GLU B . n 
C 3 71  ILE 71  64  64  ILE ILE B . n 
C 3 72  TYR 72  65  65  TYR TYR B . n 
C 3 73  VAL 73  66  66  VAL VAL B . n 
C 3 74  GLY 74  67  67  GLY GLY B . n 
C 3 75  GLU 75  68  68  GLU GLU B . n 
C 3 76  VAL 76  69  69  VAL VAL B . n 
C 3 77  LEU 77  70  70  LEU LEU B . n 
C 3 78  TYR 78  71  71  TYR TYR B . n 
C 3 79  VAL 79  72  72  VAL VAL B . n 
C 3 80  ASP 80  73  73  ASP ASP B . n 
C 3 81  GLU 81  74  74  GLU GLU B . n 
C 3 82  ARG 82  75  ?   ?   ?   B . n 
C 3 83  LYS 83  76  ?   ?   ?   B . n 
C 3 84  ARG 84  77  ?   ?   ?   B . n 
C 3 85  LYS 85  78  ?   ?   ?   B . n 
C 3 86  GLU 86  79  ?   ?   ?   B . n 
C 3 87  SER 87  80  ?   ?   ?   B . n 
C 3 88  PRO 88  81  ?   ?   ?   B . n 
C 3 89  LYS 89  82  ?   ?   ?   B . n 
C 3 90  LYS 90  83  ?   ?   ?   B . n 
C 3 91  ASN 91  84  ?   ?   ?   B . n 
C 3 92  LYS 92  85  ?   ?   ?   B . n 
C 3 93  GLU 93  86  ?   ?   ?   B . n 
C 3 94  LYS 94  87  ?   ?   ?   B . n 
C 3 95  ARG 95  88  ?   ?   ?   B . n 
C 3 96  MET 96  89  ?   ?   ?   B . n 
C 3 97  LYS 97  90  ?   ?   ?   B . n 
C 3 98  LYS 98  91  ?   ?   ?   B . n 
C 3 99  LYS 99  92  ?   ?   ?   B . n 
C 3 100 LYS 100 93  ?   ?   ?   B . n 
C 3 101 ARG 101 94  ?   ?   ?   B . n 
C 3 102 LEU 102 95  ?   ?   ?   B . n 
C 3 103 ASN 103 96  ?   ?   ?   B . n 
C 3 104 ARG 104 97  ?   ?   ?   B . n 
D 4 1   MET 1   1   ?   ?   ?   C . n 
D 4 2   LYS 2   2   ?   ?   ?   C . n 
D 4 3   PHE 3   3   3   PHE PHE C . n 
D 4 4   ARG 4   4   4   ARG ARG C . n 
D 4 5   ILE 5   5   5   ILE ILE C . n 
D 4 6   ARG 6   6   6   ARG ARG C . n 
D 4 7   LYS 7   7   7   LYS LYS C . n 
D 4 8   CYS 8   8   8   CYS CYS C . n 
D 4 9   PRO 9   9   9   PRO PRO C . n 
D 4 10  LYS 10  10  10  LYS LYS C . n 
D 4 11  CYS 11  11  11  CYS CYS C . n 
D 4 12  GLY 12  12  12  GLY GLY C . n 
D 4 13  ARG 13  13  13  ARG ARG C . n 
D 4 14  TYR 14  14  14  TYR TYR C . n 
D 4 15  THR 15  15  15  THR THR C . n 
D 4 16  LEU 16  16  16  LEU LEU C . n 
D 4 17  LYS 17  17  17  LYS LYS C . n 
D 4 18  GLU 18  18  18  GLU GLU C . n 
D 4 19  VAL 19  19  19  VAL VAL C . n 
D 4 20  CYS 20  20  20  CYS CYS C . n 
D 4 21  PRO 21  21  21  PRO PRO C . n 
D 4 22  VAL 22  22  22  VAL VAL C . n 
D 4 23  CYS 23  23  23  CYS CYS C . n 
D 4 24  GLY 24  24  24  GLY GLY C . n 
D 4 25  GLU 25  25  25  GLU GLU C . n 
D 4 26  LYS 26  26  26  LYS LYS C . n 
D 4 27  THR 27  27  27  THR THR C . n 
D 4 28  LYS 28  28  28  LYS LYS C . n 
D 4 29  VAL 29  29  29  VAL VAL C . n 
D 4 30  ALA 30  30  30  ALA ALA C . n 
D 4 31  HIS 31  31  31  HIS HIS C . n 
D 4 32  PRO 32  32  32  PRO PRO C . n 
D 4 33  PRO 33  33  33  PRO PRO C . n 
D 4 34  ARG 34  34  34  ARG ARG C . n 
D 4 35  PHE 35  35  35  PHE PHE C . n 
D 4 36  SER 36  36  36  SER SER C . n 
D 4 37  PRO 37  37  37  PRO PRO C . n 
D 4 38  GLU 38  38  38  GLU GLU C . n 
D 4 39  ASP 39  39  39  ASP ASP C . n 
D 4 40  PRO 40  40  40  PRO PRO C . n 
D 4 41  TYR 41  41  41  TYR TYR C . n 
D 4 42  GLY 42  42  42  GLY GLY C . n 
D 4 43  GLU 43  43  43  GLU GLU C . n 
D 4 44  TYR 44  44  44  TYR TYR C . n 
D 4 45  ARG 45  45  45  ARG ARG C . n 
D 4 46  ARG 46  46  46  ARG ARG C . n 
D 4 47  ARG 47  47  47  ARG ARG C . n 
D 4 48  TRP 48  48  48  TRP TRP C . n 
D 4 49  LYS 49  49  49  LYS LYS C . n 
D 4 50  ARG 50  50  50  ARG ARG C . n 
D 4 51  GLU 51  51  51  GLU GLU C . n 
D 4 52  VAL 52  52  52  VAL VAL C . n 
D 4 53  LEU 53  53  53  LEU LEU C . n 
D 4 54  GLY 54  54  54  GLY GLY C . n 
D 4 55  ILE 55  55  55  ILE ILE C . n 
D 4 56  GLY 56  56  ?   ?   ?   C . n 
D 4 57  ARG 57  57  ?   ?   ?   C . n 
D 4 58  LYS 58  58  ?   ?   ?   C . n 
D 4 59  GLU 59  59  ?   ?   ?   C . n 
D 4 60  LYS 60  60  ?   ?   ?   C . n 
E 5 1   MET 1   1   ?   ?   ?   D . n 
E 5 2   ALA 2   2   ?   ?   ?   D . n 
E 5 3   ALA 3   3   ?   ?   ?   D . n 
E 5 4   LYS 4   4   4   LYS LYS D . n 
E 5 5   PRO 5   5   5   PRO PRO D . n 
E 5 6   SER 6   6   6   SER SER D . n 
E 5 7   TYR 7   7   7   TYR TYR D . n 
E 5 8   VAL 8   8   8   VAL VAL D . n 
E 5 9   LYS 9   9   9   LYS LYS D . n 
E 5 10  PHE 10  10  10  PHE PHE D . n 
E 5 11  GLU 11  11  11  GLU GLU D . n 
E 5 12  VAL 12  12  12  VAL VAL D . n 
E 5 13  PRO 13  13  13  PRO PRO D . n 
E 5 14  LYS 14  14  14  LYS LYS D . n 
E 5 15  GLU 15  15  15  GLU GLU D . n 
E 5 16  LEU 16  16  16  LEU LEU D . n 
E 5 17  ALA 17  17  17  ALA ALA D . n 
E 5 18  GLU 18  18  18  GLU GLU D . n 
E 5 19  LYS 19  19  19  LYS LYS D . n 
E 5 20  ALA 20  20  20  ALA ALA D . n 
E 5 21  LEU 21  21  21  LEU LEU D . n 
E 5 22  GLN 22  22  22  GLN GLN D . n 
E 5 23  ALA 23  23  23  ALA ALA D . n 
E 5 24  VAL 24  24  24  VAL VAL D . n 
E 5 25  GLU 25  25  25  GLU GLU D . n 
E 5 26  ILE 26  26  26  ILE ILE D . n 
E 5 27  ALA 27  27  27  ALA ALA D . n 
E 5 28  ARG 28  28  28  ARG ARG D . n 
E 5 29  ASP 29  29  29  ASP ASP D . n 
E 5 30  THR 30  30  30  THR THR D . n 
E 5 31  GLY 31  31  31  GLY GLY D . n 
E 5 32  LYS 32  32  32  LYS LYS D . n 
E 5 33  ILE 33  33  33  ILE ILE D . n 
E 5 34  ARG 34  34  34  ARG ARG D . n 
E 5 35  LYS 35  35  35  LYS LYS D . n 
E 5 36  GLY 36  36  36  GLY GLY D . n 
E 5 37  THR 37  37  37  THR THR D . n 
E 5 38  ASN 38  38  38  ASN ASN D . n 
E 5 39  GLU 39  39  39  GLU GLU D . n 
E 5 40  THR 40  40  40  THR THR D . n 
E 5 41  THR 41  41  41  THR THR D . n 
E 5 42  LYS 42  42  42  LYS LYS D . n 
E 5 43  ALA 43  43  43  ALA ALA D . n 
E 5 44  VAL 44  44  44  VAL VAL D . n 
E 5 45  GLU 45  45  45  GLU GLU D . n 
E 5 46  ARG 46  46  46  ARG ARG D . n 
E 5 47  GLY 47  47  47  GLY GLY D . n 
E 5 48  GLN 48  48  48  GLN GLN D . n 
E 5 49  ALA 49  49  49  ALA ALA D . n 
E 5 50  LYS 50  50  50  LYS LYS D . n 
E 5 51  LEU 51  51  51  LEU LEU D . n 
E 5 52  VAL 52  52  52  VAL VAL D . n 
E 5 53  ILE 53  53  53  ILE ILE D . n 
E 5 54  ILE 54  54  54  ILE ILE D . n 
E 5 55  ALA 55  55  55  ALA ALA D . n 
E 5 56  GLU 56  56  56  GLU GLU D . n 
E 5 57  ASP 57  57  57  ASP ASP D . n 
E 5 58  VAL 58  58  58  VAL VAL D . n 
E 5 59  ASP 59  59  59  ASP ASP D . n 
E 5 60  PRO 60  60  60  PRO PRO D . n 
E 5 61  GLU 61  61  61  GLU GLU D . n 
E 5 62  GLU 62  62  62  GLU GLU D . n 
E 5 63  ILE 63  63  63  ILE ILE D . n 
E 5 64  VAL 64  64  64  VAL VAL D . n 
E 5 65  ALA 65  65  65  ALA ALA D . n 
E 5 66  HIS 66  66  66  HIS HIS D . n 
E 5 67  LEU 67  67  67  LEU LEU D . n 
E 5 68  PRO 68  68  68  PRO PRO D . n 
E 5 69  PRO 69  69  69  PRO PRO D . n 
E 5 70  LEU 70  70  70  LEU LEU D . n 
E 5 71  CYS 71  71  71  CYS CYS D . n 
E 5 72  GLU 72  72  72  GLU GLU D . n 
E 5 73  GLU 73  73  73  GLU GLU D . n 
E 5 74  LYS 74  74  74  LYS LYS D . n 
E 5 75  GLU 75  75  75  GLU GLU D . n 
E 5 76  ILE 76  76  76  ILE ILE D . n 
E 5 77  PRO 77  77  77  PRO PRO D . n 
E 5 78  TYR 78  78  78  TYR TYR D . n 
E 5 79  ILE 79  79  79  ILE ILE D . n 
E 5 80  TYR 80  80  80  TYR TYR D . n 
E 5 81  VAL 81  81  81  VAL VAL D . n 
E 5 82  PRO 82  82  82  PRO PRO D . n 
E 5 83  SER 83  83  83  SER SER D . n 
E 5 84  LYS 84  84  84  LYS LYS D . n 
E 5 85  LYS 85  85  85  LYS LYS D . n 
E 5 86  GLU 86  86  86  GLU GLU D . n 
E 5 87  LEU 87  87  87  LEU LEU D . n 
E 5 88  GLY 88  88  88  GLY GLY D . n 
E 5 89  ALA 89  89  89  ALA ALA D . n 
E 5 90  ALA 90  90  90  ALA ALA D . n 
E 5 91  ALA 91  91  91  ALA ALA D . n 
E 5 92  GLY 92  92  92  GLY GLY D . n 
E 5 93  ILE 93  93  93  ILE ILE D . n 
E 5 94  GLU 94  94  94  GLU GLU D . n 
E 5 95  VAL 95  95  95  VAL VAL D . n 
E 5 96  ALA 96  96  96  ALA ALA D . n 
E 5 97  ALA 97  97  97  ALA ALA D . n 
E 5 98  ALA 98  98  98  ALA ALA D . n 
E 5 99  SER 99  99  99  SER SER D . n 
E 5 100 VAL 100 100 100 VAL VAL D . n 
E 5 101 ALA 101 101 101 ALA ALA D . n 
E 5 102 ILE 102 102 102 ILE ILE D . n 
E 5 103 ILE 103 103 103 ILE ILE D . n 
E 5 104 GLU 104 104 104 GLU GLU D . n 
E 5 105 PRO 105 105 105 PRO PRO D . n 
E 5 106 GLY 106 106 106 GLY GLY D . n 
E 5 107 LYS 107 107 107 LYS LYS D . n 
E 5 108 ALA 108 108 108 ALA ALA D . n 
E 5 109 ARG 109 109 109 ARG ARG D . n 
E 5 110 ASP 110 110 110 ASP ASP D . n 
E 5 111 LEU 111 111 111 LEU LEU D . n 
E 5 112 VAL 112 112 112 VAL VAL D . n 
E 5 113 GLU 113 113 113 GLU GLU D . n 
E 5 114 GLU 114 114 114 GLU GLU D . n 
E 5 115 ILE 115 115 115 ILE ILE D . n 
E 5 116 ALA 116 116 116 ALA ALA D . n 
E 5 117 MET 117 117 117 MET MET D . n 
E 5 118 LYS 118 118 118 LYS LYS D . n 
E 5 119 VAL 119 119 119 VAL VAL D . n 
E 5 120 LYS 120 120 120 LYS LYS D . n 
E 5 121 GLU 121 121 121 GLU GLU D . n 
E 5 122 LEU 122 122 122 LEU LEU D . n 
E 5 123 MET 123 123 123 MET MET D . n 
E 5 124 LYS 124 124 124 LYS LYS D . n 
E 5 125 HIS 125 125 ?   ?   ?   D . n 
E 5 126 HIS 126 126 ?   ?   ?   D . n 
E 5 127 HIS 127 127 ?   ?   ?   D . n 
E 5 128 HIS 128 128 ?   ?   ?   D . n 
E 5 129 HIS 129 129 ?   ?   ?   D . n 
E 5 130 HIS 130 130 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 6 ATP 1  501 1   ATP ATP A . 
G 7 ZN  1  201 201 ZN  ZN  C . 
H 8 HOH 1  66  9   HOH HOH E . 
H 8 HOH 2  67  19  HOH HOH E . 
H 8 HOH 3  68  27  HOH HOH E . 
H 8 HOH 4  69  34  HOH HOH E . 
H 8 HOH 5  70  42  HOH HOH E . 
H 8 HOH 6  71  44  HOH HOH E . 
H 8 HOH 7  72  48  HOH HOH E . 
H 8 HOH 8  73  50  HOH HOH E . 
H 8 HOH 9  74  52  HOH HOH E . 
H 8 HOH 10 75  53  HOH HOH E . 
H 8 HOH 11 76  54  HOH HOH E . 
H 8 HOH 12 77  64  HOH HOH E . 
H 8 HOH 13 78  73  HOH HOH E . 
H 8 HOH 14 79  74  HOH HOH E . 
H 8 HOH 15 80  79  HOH HOH E . 
H 8 HOH 16 81  80  HOH HOH E . 
H 8 HOH 17 82  81  HOH HOH E . 
H 8 HOH 18 83  82  HOH HOH E . 
H 8 HOH 19 84  85  HOH HOH E . 
H 8 HOH 20 85  90  HOH HOH E . 
H 8 HOH 21 86  98  HOH HOH E . 
H 8 HOH 22 87  113 HOH HOH E . 
H 8 HOH 23 88  114 HOH HOH E . 
H 8 HOH 24 89  117 HOH HOH E . 
H 8 HOH 25 90  118 HOH HOH E . 
I 8 HOH 1  502 1   HOH HOH A . 
I 8 HOH 2  503 3   HOH HOH A . 
I 8 HOH 3  504 6   HOH HOH A . 
I 8 HOH 4  505 7   HOH HOH A . 
I 8 HOH 5  506 8   HOH HOH A . 
I 8 HOH 6  507 10  HOH HOH A . 
I 8 HOH 7  508 11  HOH HOH A . 
I 8 HOH 8  509 12  HOH HOH A . 
I 8 HOH 9  510 15  HOH HOH A . 
I 8 HOH 10 511 16  HOH HOH A . 
I 8 HOH 11 512 17  HOH HOH A . 
I 8 HOH 12 513 18  HOH HOH A . 
I 8 HOH 13 514 20  HOH HOH A . 
I 8 HOH 14 515 21  HOH HOH A . 
I 8 HOH 15 516 22  HOH HOH A . 
I 8 HOH 16 517 23  HOH HOH A . 
I 8 HOH 17 518 24  HOH HOH A . 
I 8 HOH 18 519 25  HOH HOH A . 
I 8 HOH 19 520 26  HOH HOH A . 
I 8 HOH 20 521 28  HOH HOH A . 
I 8 HOH 21 522 29  HOH HOH A . 
I 8 HOH 22 523 31  HOH HOH A . 
I 8 HOH 23 524 32  HOH HOH A . 
I 8 HOH 24 525 36  HOH HOH A . 
I 8 HOH 25 526 37  HOH HOH A . 
I 8 HOH 26 527 38  HOH HOH A . 
I 8 HOH 27 528 39  HOH HOH A . 
I 8 HOH 28 529 40  HOH HOH A . 
I 8 HOH 29 530 43  HOH HOH A . 
I 8 HOH 30 531 45  HOH HOH A . 
I 8 HOH 31 532 46  HOH HOH A . 
I 8 HOH 32 533 47  HOH HOH A . 
I 8 HOH 33 534 55  HOH HOH A . 
I 8 HOH 34 535 57  HOH HOH A . 
I 8 HOH 35 536 58  HOH HOH A . 
I 8 HOH 36 537 60  HOH HOH A . 
I 8 HOH 37 538 62  HOH HOH A . 
I 8 HOH 38 539 63  HOH HOH A . 
I 8 HOH 39 540 65  HOH HOH A . 
I 8 HOH 40 541 66  HOH HOH A . 
I 8 HOH 41 542 67  HOH HOH A . 
I 8 HOH 42 543 71  HOH HOH A . 
I 8 HOH 43 544 75  HOH HOH A . 
I 8 HOH 44 545 76  HOH HOH A . 
I 8 HOH 45 546 83  HOH HOH A . 
I 8 HOH 46 547 84  HOH HOH A . 
I 8 HOH 47 548 86  HOH HOH A . 
I 8 HOH 48 549 87  HOH HOH A . 
I 8 HOH 49 550 88  HOH HOH A . 
I 8 HOH 50 551 93  HOH HOH A . 
I 8 HOH 51 552 94  HOH HOH A . 
I 8 HOH 52 553 97  HOH HOH A . 
I 8 HOH 53 554 99  HOH HOH A . 
I 8 HOH 54 555 100 HOH HOH A . 
I 8 HOH 55 556 101 HOH HOH A . 
I 8 HOH 56 557 104 HOH HOH A . 
I 8 HOH 57 558 105 HOH HOH A . 
I 8 HOH 58 559 110 HOH HOH A . 
I 8 HOH 59 560 111 HOH HOH A . 
I 8 HOH 60 561 112 HOH HOH A . 
I 8 HOH 61 562 115 HOH HOH A . 
J 8 HOH 1  98  30  HOH HOH B . 
J 8 HOH 2  99  33  HOH HOH B . 
J 8 HOH 3  100 35  HOH HOH B . 
J 8 HOH 4  101 51  HOH HOH B . 
J 8 HOH 5  102 56  HOH HOH B . 
J 8 HOH 6  103 61  HOH HOH B . 
J 8 HOH 7  104 68  HOH HOH B . 
J 8 HOH 8  105 70  HOH HOH B . 
J 8 HOH 9  106 72  HOH HOH B . 
J 8 HOH 10 107 78  HOH HOH B . 
J 8 HOH 11 108 92  HOH HOH B . 
J 8 HOH 12 109 95  HOH HOH B . 
J 8 HOH 13 110 103 HOH HOH B . 
J 8 HOH 14 111 106 HOH HOH B . 
J 8 HOH 15 112 107 HOH HOH B . 
J 8 HOH 16 113 116 HOH HOH B . 
K 8 HOH 1  202 2   HOH HOH C . 
K 8 HOH 2  203 4   HOH HOH C . 
K 8 HOH 3  204 5   HOH HOH C . 
K 8 HOH 4  205 13  HOH HOH C . 
K 8 HOH 5  206 14  HOH HOH C . 
K 8 HOH 6  207 41  HOH HOH C . 
K 8 HOH 7  208 49  HOH HOH C . 
K 8 HOH 8  209 59  HOH HOH C . 
K 8 HOH 9  210 77  HOH HOH C . 
K 8 HOH 10 211 89  HOH HOH C . 
L 8 HOH 1  131 69  HOH HOH D . 
L 8 HOH 2  132 91  HOH HOH D . 
L 8 HOH 3  133 96  HOH HOH D . 
L 8 HOH 4  134 102 HOH HOH D . 
L 8 HOH 5  135 108 HOH HOH D . 
L 8 HOH 6  136 109 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? D CYS 11 ? C CYS 11 ? 1_555 ZN ? G ZN . ? C ZN 201 ? 1_555 SG ? D CYS 20 ? C CYS 20 ? 1_555 107.6 ? 
2 SG ? D CYS 11 ? C CYS 11 ? 1_555 ZN ? G ZN . ? C ZN 201 ? 1_555 SG ? D CYS 23 ? C CYS 23 ? 1_555 122.4 ? 
3 SG ? D CYS 20 ? C CYS 20 ? 1_555 ZN ? G ZN . ? C ZN 201 ? 1_555 SG ? D CYS 23 ? C CYS 23 ? 1_555 116.7 ? 
4 SG ? D CYS 11 ? C CYS 11 ? 1_555 ZN ? G ZN . ? C ZN 201 ? 1_555 SG ? D CYS 8  ? C CYS 8  ? 1_555 103.5 ? 
5 SG ? D CYS 20 ? C CYS 20 ? 1_555 ZN ? G ZN . ? C ZN 201 ? 1_555 SG ? D CYS 8  ? C CYS 8  ? 1_555 105.5 ? 
6 SG ? D CYS 23 ? C CYS 23 ? 1_555 ZN ? G ZN . ? C ZN 201 ? 1_555 SG ? D CYS 8  ? C CYS 8  ? 1_555 98.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-09-12 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -16.5300 16.9060  24.5540 0.0174  -0.2395 -0.1293 -0.0025 0.0083  0.0453  3.7650  4.2549  5.9757  1.3158  0.3363  
0.4972  -0.0430 0.3511  0.1627  -0.7208 0.0274  0.0321  -0.6112 0.0744  0.0156  'X-RAY DIFFRACTION' 
2 ? refined -22.2840 -10.8080 26.8010 -0.1520 -0.2258 -0.1433 0.0012  0.0237  0.0590  1.1017  3.1152  3.9499  1.0794  0.8858  
2.6473  0.0450  0.0341  -0.0111 -0.0448 -0.0025 -0.0317 -0.0468 0.0772  -0.0425 'X-RAY DIFFRACTION' 
3 ? refined -39.0970 -21.7530 -3.8930 -0.1394 0.0268  -0.0894 -0.0602 0.0011  0.1048  5.3201  6.6385  8.3969  1.5120  3.4713  
0.2455  -0.0541 0.3976  -0.3463 -0.0175 0.4359  0.4556  0.1475  -0.5827 -0.3818 'X-RAY DIFFRACTION' 
4 ? refined -11.3160 -25.8980 26.7560 0.0072  -0.0618 -0.0055 0.0893  0.0128  0.0709  11.9114 12.4026 14.6603 -4.7286 -3.1420 
1.9645  0.0945  -0.5166 0.0350  0.4836  -0.1282 -0.8276 0.3813  1.3388  0.0337  'X-RAY DIFFRACTION' 
5 ? refined -17.6900 -18.8690 48.6470 0.1445  -0.2496 -0.0398 -0.0672 -0.0608 0.1190  3.8311  7.8307  6.7370  -1.4177 1.6380  
1.3745  -0.1637 -0.3116 0.0734  1.0103  0.0134  -0.6288 0.3729  0.2298  0.1503  'X-RAY DIFFRACTION' 
6 ? refined -16.0010 -38.5680 50.6940 0.4193  -0.1453 0.0946  0.0479  -0.1987 0.1288  6.0688  7.2712  5.7159  -0.4898 1.0850  
-1.3835 0.3528  -0.4769 -1.0090 0.3542  -0.0706 -0.3647 1.0825  0.3774  -0.2822 'X-RAY DIFFRACTION' 
7 ? refined -37.1430 17.1630  35.0560 0.1847  -0.0736 0.0928  0.1270  -0.0765 -0.0725 10.6191 0.5049  3.2912  2.2352  -5.1450 
-0.9173 -0.0754 0.1351  0.4611  -0.2381 0.0154  0.4421  0.0940  -0.2650 0.0600  'X-RAY DIFFRACTION' 
8 ? refined -43.6980 -5.6030  33.8450 0.8903  0.7578  1.0112  -0.2004 -0.1887 0.4706  0.0000  0.0000  0.0000  0.0000  0.0000  
0.0000  -0.9841 -1.1426 -0.3215 -0.2844 1.5379  2.2616  -0.4858 0.3318  -0.5538 'X-RAY DIFFRACTION' 
9 ? refined -36.7350 -24.6380 39.8430 0.1050  0.0569  0.1369  -0.1905 -0.0652 0.1203  4.5124  4.8918  3.3941  -1.0598 0.4588  
-2.7643 0.1463  0.4216  -0.3137 -0.3066 0.4141  1.0679  0.7190  -0.8938 -0.5604 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1 A 11  B 8   A 38  B 35  ? 'X-RAY DIFFRACTION' ? 
2  1 A 253 B 250 A 337 B 334 ? 'X-RAY DIFFRACTION' ? 
3  2 A 39  B 36  A 252 B 249 ? 'X-RAY DIFFRACTION' ? 
4  3 B 1   C 8   B 74  C 81  ? 'X-RAY DIFFRACTION' ? 
5  4 C 3   D 3   C 30  D 30  ? 'X-RAY DIFFRACTION' ? 
6  4 C 201 F 1   C 201 F 1   ? 'X-RAY DIFFRACTION' ? 
7  5 C 31  D 31  C 55  D 55  ? 'X-RAY DIFFRACTION' ? 
8  6 D 4   E 4   D 124 E 124 ? 'X-RAY DIFFRACTION' ? 
9  7 E 1   A 1   E 9   A 9   ? 'X-RAY DIFFRACTION' ? 
10 7 E 49  A 49  E 61  A 61  ? 'X-RAY DIFFRACTION' ? 
11 8 E 10  A 10  E 16  A 16  ? 'X-RAY DIFFRACTION' ? 
12 8 E 42  A 42  E 48  A 48  ? 'X-RAY DIFFRACTION' ? 
13 9 E 17  A 17  E 41  A 41  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.2.0019 ? 1 
HKL-2000 'data reduction' .        ? 2 
HKL-2000 'data scaling'   .        ? 3 
MOLREP   phasing          .        ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "C3'" E A 43 ? ? "O3'" E A 43 ? ? P     E A 44 ? ? 129.46 119.70 9.76   1.20 Y 
2 1 "O3'" E A 43 ? ? P     E A 44 ? ? "O5'" E A 44 ? ? 84.13  104.00 -19.87 1.90 Y 
3 1 "O3'" E A 43 ? ? P     E A 44 ? ? OP2   E A 44 ? ? 91.68  105.20 -13.52 2.20 Y 
4 1 "O3'" E A 43 ? ? P     E A 44 ? ? OP1   E A 44 ? ? 85.21  105.20 -19.99 2.20 Y 
5 1 OP1   E A 44 ? ? P     E A 44 ? ? OP2   E A 44 ? ? 129.23 119.60 9.63   1.50 N 
6 1 "C3'" E C 57 ? ? "O3'" E C 57 ? ? P     E A 58 ? ? 129.33 119.70 9.63   1.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 97 ? ? 48.61  -115.20 
2 1 LEU B 4  ? ? -83.53 -71.78  
3 1 ASP C 39 ? ? 35.26  65.37   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 E G 14 ? "O5'" ? A G 14 "O5'" 
2  1 Y 1 E G 14 ? "C5'" ? A G 14 "C5'" 
3  1 Y 1 E G 14 ? "C4'" ? A G 14 "C4'" 
4  1 Y 1 E G 14 ? "O4'" ? A G 14 "O4'" 
5  1 Y 1 E G 14 ? "C3'" ? A G 14 "C3'" 
6  1 Y 1 E G 14 ? "O3'" ? A G 14 "O3'" 
7  1 Y 1 E G 14 ? "C2'" ? A G 14 "C2'" 
8  1 Y 1 E G 14 ? "O2'" ? A G 14 "O2'" 
9  1 Y 1 E G 14 ? "C1'" ? A G 14 "C1'" 
10 1 Y 1 E G 14 ? N9    ? A G 14 N9    
11 1 Y 1 E G 14 ? C8    ? A G 14 C8    
12 1 Y 1 E G 14 ? N7    ? A G 14 N7    
13 1 Y 1 E G 14 ? C5    ? A G 14 C5    
14 1 Y 1 E G 14 ? C6    ? A G 14 C6    
15 1 Y 1 E G 14 ? O6    ? A G 14 O6    
16 1 Y 1 E G 14 ? N1    ? A G 14 N1    
17 1 Y 1 E G 14 ? C2    ? A G 14 C2    
18 1 Y 1 E G 14 ? N2    ? A G 14 N2    
19 1 Y 1 E G 14 ? N3    ? A G 14 N3    
20 1 Y 1 E G 14 ? C4    ? A G 14 C4    
21 1 Y 1 E G 26 ? "O5'" ? A G 26 "O5'" 
22 1 Y 1 E G 26 ? "C5'" ? A G 26 "C5'" 
23 1 Y 1 E G 26 ? "C4'" ? A G 26 "C4'" 
24 1 Y 1 E G 26 ? "O4'" ? A G 26 "O4'" 
25 1 Y 1 E G 26 ? "C3'" ? A G 26 "C3'" 
26 1 Y 1 E G 26 ? "O3'" ? A G 26 "O3'" 
27 1 Y 1 E G 26 ? "C2'" ? A G 26 "C2'" 
28 1 Y 1 E G 26 ? "O2'" ? A G 26 "O2'" 
29 1 Y 1 E G 26 ? "C1'" ? A G 26 "C1'" 
30 1 Y 1 E G 26 ? N9    ? A G 26 N9    
31 1 Y 1 E G 26 ? C8    ? A G 26 C8    
32 1 Y 1 E G 26 ? N7    ? A G 26 N7    
33 1 Y 1 E G 26 ? C5    ? A G 26 C5    
34 1 Y 1 E G 26 ? C6    ? A G 26 C6    
35 1 Y 1 E G 26 ? O6    ? A G 26 O6    
36 1 Y 1 E G 26 ? N1    ? A G 26 N1    
37 1 Y 1 E G 26 ? C2    ? A G 26 C2    
38 1 Y 1 E G 26 ? N2    ? A G 26 N2    
39 1 Y 1 E G 26 ? N3    ? A G 26 N3    
40 1 Y 1 E G 26 ? C4    ? A G 26 C4    
41 1 Y 1 E U 46 ? "C5'" ? A U 46 "C5'" 
42 1 Y 1 E U 46 ? "C4'" ? A U 46 "C4'" 
43 1 Y 1 E U 46 ? "O4'" ? A U 46 "O4'" 
44 1 Y 1 E U 46 ? "C3'" ? A U 46 "C3'" 
45 1 Y 1 E U 46 ? "O3'" ? A U 46 "O3'" 
46 1 Y 1 E U 46 ? "C2'" ? A U 46 "C2'" 
47 1 Y 1 E U 46 ? "O2'" ? A U 46 "O2'" 
48 1 Y 1 E U 46 ? "C1'" ? A U 46 "C1'" 
49 1 Y 1 E U 46 ? N1    ? A U 46 N1    
50 1 Y 1 E U 46 ? C2    ? A U 46 C2    
51 1 Y 1 E U 46 ? O2    ? A U 46 O2    
52 1 Y 1 E U 46 ? N3    ? A U 46 N3    
53 1 Y 1 E U 46 ? C4    ? A U 46 C4    
54 1 Y 1 E U 46 ? O4    ? A U 46 O4    
55 1 Y 1 E U 46 ? C5    ? A U 46 C5    
56 1 Y 1 E U 46 ? C6    ? A U 46 C6    
57 1 Y 1 E G 61 ? "C5'" ? A G 61 "C5'" 
58 1 Y 1 E G 61 ? "C4'" ? A G 61 "C4'" 
59 1 Y 1 E G 61 ? "O4'" ? A G 61 "O4'" 
60 1 Y 1 E G 61 ? "C3'" ? A G 61 "C3'" 
61 1 Y 1 E G 61 ? "O3'" ? A G 61 "O3'" 
62 1 Y 1 E G 61 ? "C2'" ? A G 61 "C2'" 
63 1 Y 1 E G 61 ? "O2'" ? A G 61 "O2'" 
64 1 Y 1 E G 61 ? "C1'" ? A G 61 "C1'" 
65 1 Y 1 E G 61 ? N9    ? A G 61 N9    
66 1 Y 1 E G 61 ? C8    ? A G 61 C8    
67 1 Y 1 E G 61 ? N7    ? A G 61 N7    
68 1 Y 1 E G 61 ? C5    ? A G 61 C5    
69 1 Y 1 E G 61 ? C6    ? A G 61 C6    
70 1 Y 1 E G 61 ? O6    ? A G 61 O6    
71 1 Y 1 E G 61 ? N1    ? A G 61 N1    
72 1 Y 1 E G 61 ? C2    ? A G 61 C2    
73 1 Y 1 E G 61 ? N2    ? A G 61 N2    
74 1 Y 1 E G 61 ? N3    ? A G 61 N3    
75 1 Y 1 E G 61 ? C4    ? A G 61 C4    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 E A   62  ? A A   62  
2  1 Y 1 E A   63  ? A A   63  
3  1 Y 1 E U   64  ? A U   64  
4  1 Y 1 E U   65  ? A U   65  
5  1 Y 1 A MET 4   ? B MET 1   
6  1 Y 1 A ALA 5   ? B ALA 2   
7  1 Y 1 A ARG 6   ? B ARG 3   
8  1 Y 1 A ASP 7   ? B ASP 4   
9  1 Y 1 A GLU 8   ? B GLU 5   
10 1 Y 1 A VAL 9   ? B VAL 6   
11 1 Y 1 A ARG 10  ? B ARG 7   
12 1 Y 1 A ARG 146 ? B ARG 143 
13 1 Y 1 A SER 147 ? B SER 144 
14 1 Y 1 A ALA 148 ? B ALA 145 
15 1 Y 1 A VAL 149 ? B VAL 146 
16 1 Y 1 A LYS 150 ? B LYS 147 
17 1 Y 1 A ARG 151 ? B ARG 148 
18 1 Y 1 A ARG 152 ? B ARG 149 
19 1 Y 1 A GLU 338 ? B GLU 335 
20 1 Y 1 A LYS 339 ? B LYS 336 
21 1 Y 1 A ARG 340 ? B ARG 337 
22 1 Y 1 A ASP 341 ? B ASP 338 
23 1 Y 1 A ARG 342 ? B ARG 339 
24 1 Y 1 A SER 343 ? B SER 340 
25 1 Y 1 A HIS 344 ? B HIS 341 
26 1 Y 1 A HIS 345 ? B HIS 342 
27 1 Y 1 A HIS 346 ? B HIS 343 
28 1 Y 1 A HIS 347 ? B HIS 344 
29 1 Y 1 A HIS 348 ? B HIS 345 
30 1 Y 1 A HIS 349 ? B HIS 346 
31 1 Y 1 B MET -6  ? C MET 1   
32 1 Y 1 B GLU -5  ? C GLU 2   
33 1 Y 1 B LYS -4  ? C LYS 3   
34 1 Y 1 B GLN -3  ? C GLN 4   
35 1 Y 1 B GLY -2  ? C GLY 5   
36 1 Y 1 B GLU -1  ? C GLU 6   
37 1 Y 1 B LYS 0   ? C LYS 7   
38 1 Y 1 B ARG 75  ? C ARG 82  
39 1 Y 1 B LYS 76  ? C LYS 83  
40 1 Y 1 B ARG 77  ? C ARG 84  
41 1 Y 1 B LYS 78  ? C LYS 85  
42 1 Y 1 B GLU 79  ? C GLU 86  
43 1 Y 1 B SER 80  ? C SER 87  
44 1 Y 1 B PRO 81  ? C PRO 88  
45 1 Y 1 B LYS 82  ? C LYS 89  
46 1 Y 1 B LYS 83  ? C LYS 90  
47 1 Y 1 B ASN 84  ? C ASN 91  
48 1 Y 1 B LYS 85  ? C LYS 92  
49 1 Y 1 B GLU 86  ? C GLU 93  
50 1 Y 1 B LYS 87  ? C LYS 94  
51 1 Y 1 B ARG 88  ? C ARG 95  
52 1 Y 1 B MET 89  ? C MET 96  
53 1 Y 1 B LYS 90  ? C LYS 97  
54 1 Y 1 B LYS 91  ? C LYS 98  
55 1 Y 1 B LYS 92  ? C LYS 99  
56 1 Y 1 B LYS 93  ? C LYS 100 
57 1 Y 1 B ARG 94  ? C ARG 101 
58 1 Y 1 B LEU 95  ? C LEU 102 
59 1 Y 1 B ASN 96  ? C ASN 103 
60 1 Y 1 B ARG 97  ? C ARG 104 
61 1 Y 1 C MET 1   ? D MET 1   
62 1 Y 1 C LYS 2   ? D LYS 2   
63 1 Y 1 C GLY 56  ? D GLY 56  
64 1 Y 1 C ARG 57  ? D ARG 57  
65 1 Y 1 C LYS 58  ? D LYS 58  
66 1 Y 1 C GLU 59  ? D GLU 59  
67 1 Y 1 C LYS 60  ? D LYS 60  
68 1 Y 1 D MET 1   ? E MET 1   
69 1 Y 1 D ALA 2   ? E ALA 2   
70 1 Y 1 D ALA 3   ? E ALA 3   
71 1 Y 1 D HIS 125 ? E HIS 125 
72 1 Y 1 D HIS 126 ? E HIS 126 
73 1 Y 1 D HIS 127 ? E HIS 127 
74 1 Y 1 D HIS 128 ? E HIS 128 
75 1 Y 1 D HIS 129 ? E HIS 129 
76 1 Y 1 D HIS 130 ? E HIS 130 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2HVY 'double helix'         
2HVY 'a-form double helix'  
2HVY 'hairpin loop'         
2HVY 'mismatched base pair' 
2HVY 'internal loop'        
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1  1_555 A C 57 1_555 -0.479 0.025  0.098  -4.610  -1.959  -2.396  1  E_G1:C57_E  E 1  ? E 57 ? 19 1 
1 A G 2  1_555 A C 56 1_555 -0.616 -0.335 0.086  -2.053  -18.257 -2.463  2  E_G2:C56_E  E 2  ? E 56 ? 19 1 
1 A G 3  1_555 A C 55 1_555 -0.318 -0.093 0.208  2.073   -17.290 -1.093  3  E_G3:C55_E  E 3  ? E 55 ? 19 1 
1 A U 4  1_555 A A 54 1_555 0.244  -0.112 0.214  4.276   -20.998 -1.178  4  E_U4:A54_E  E 4  ? E 54 ? 20 1 
1 A C 5  1_555 A G 53 1_555 0.119  -0.172 -0.019 7.839   -17.237 -0.326  5  E_C5:G53_E  E 5  ? E 53 ? 19 1 
1 A C 6  1_555 A G 52 1_555 0.472  -0.063 -0.132 8.233   -14.771 -5.082  6  E_C6:G52_E  E 6  ? E 52 ? 19 1 
1 A G 7  1_555 A C 51 1_555 -0.117 -0.202 0.180  3.951   -5.772  -1.528  7  E_G7:C51_E  E 7  ? E 51 ? 19 1 
1 A C 8  1_555 A G 50 1_555 0.126  -0.055 0.051  4.401   -10.867 5.270   8  E_C8:G50_E  E 8  ? E 50 ? 19 1 
1 A C 9  1_555 A G 49 1_555 0.508  -0.175 -0.405 4.004   -5.936  -0.747  9  E_C9:G49_E  E 9  ? E 49 ? 19 1 
1 A U 11 1_555 A A 44 1_555 4.636  -2.158 -0.620 -9.749  -28.292 -85.269 10 E_U11:A44_E E 11 ? E 44 ? ?  ? 
1 A G 16 1_555 A U 42 1_555 -2.343 -0.387 0.143  11.257  -5.576  -20.134 11 E_G16:U42_E E 16 ? E 42 ? 28 ? 
1 A C 17 1_555 A G 41 1_555 0.043  -0.043 0.097  19.825  -22.370 -3.013  12 E_C17:G41_E E 17 ? E 41 ? 19 1 
1 A C 18 1_555 A G 40 1_555 0.180  -0.216 0.322  3.161   -19.365 -0.724  13 E_C18:G40_E E 18 ? E 40 ? 19 1 
1 A C 19 1_555 A G 39 1_555 0.345  -0.233 0.094  4.341   -10.817 -1.950  14 E_C19:G39_E E 19 ? E 39 ? 19 1 
1 A G 20 1_555 A C 38 1_555 -0.253 0.056  0.287  1.347   -12.872 6.094   15 E_G20:C38_E E 20 ? E 38 ? 19 1 
1 A G 21 1_555 A C 37 1_555 -0.314 -0.221 -0.353 -6.720  -10.799 0.018   16 E_G21:C37_E E 21 ? E 37 ? 19 1 
1 A G 22 1_555 A C 36 1_555 -0.208 -0.201 -0.840 -20.714 -15.836 2.079   17 E_G22:C36_E E 22 ? E 36 ? 19 1 
1 A U 23 1_555 A U 35 1_555 2.492  -1.565 0.106  4.640   -3.387  14.271  18 E_U23:U35_E E 23 ? E 35 ? 16 1 
1 A G 24 1_555 A A 34 1_555 6.346  -4.553 1.208  26.677  3.459   5.656   19 E_G24:A34_E E 24 ? E 34 ? 11 9 
1 A A 25 1_555 A G 33 1_555 -6.417 -4.105 0.692  -28.066 14.450  7.862   20 E_A25:G33_E E 25 ? E 33 ? 11 9 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1  1_555 A C 57 1_555 A G 2  1_555 A C 56 1_555 -0.124 -1.961 3.280 -0.205 3.244   30.813 -4.281 0.193  3.063 6.085  0.385  
30.980  1  EE_G1G2:C56C57_EE   E 1  ? E 57 ? E 2  ? E 56 ? 
1 A G 2  1_555 A C 56 1_555 A G 3  1_555 A C 55 1_555 -0.766 -1.483 3.055 -6.350 6.740   31.762 -3.646 0.367  2.788 11.999 11.305 
33.051  2  EE_G2G3:C55C56_EE   E 2  ? E 56 ? E 3  ? E 55 ? 
1 A G 3  1_555 A C 55 1_555 A U 4  1_555 A A 54 1_555 -0.276 -1.196 3.144 -1.800 4.082   35.148 -2.532 0.205  3.001 6.726  2.966  
35.421  3  EE_G3U4:A54C55_EE   E 3  ? E 55 ? E 4  ? E 54 ? 
1 A U 4  1_555 A A 54 1_555 A C 5  1_555 A G 53 1_555 0.069  -1.302 3.007 1.080  7.190   33.148 -3.247 0.035  2.675 12.417 -1.865 
33.914  4  EE_U4C5:G53A54_EE   E 4  ? E 54 ? E 5  ? E 53 ? 
1 A C 5  1_555 A G 53 1_555 A C 6  1_555 A G 52 1_555 0.315  -1.570 3.148 2.947  5.858   34.366 -3.432 -0.112 2.867 9.804  -4.932 
34.968  5  EE_C5C6:G52G53_EE   E 5  ? E 53 ? E 6  ? E 52 ? 
1 A C 6  1_555 A G 52 1_555 A G 7  1_555 A C 51 1_555 -0.136 -1.890 3.188 -4.523 9.733   27.144 -5.629 -0.600 2.374 19.784 9.194  
29.152  6  EE_C6G7:C51G52_EE   E 6  ? E 52 ? E 7  ? E 51 ? 
1 A G 7  1_555 A C 51 1_555 A C 8  1_555 A G 50 1_555 0.717  -1.902 3.268 1.961  1.799   32.992 -3.639 -0.931 3.199 3.162  -3.446 
33.096  7  EE_G7C8:G50C51_EE   E 7  ? E 51 ? E 8  ? E 50 ? 
1 A C 8  1_555 A G 50 1_555 A C 9  1_555 A G 49 1_555 -0.498 -1.816 3.233 3.955  8.598   32.235 -4.429 1.453  2.599 15.084 -6.938 
33.560  8  EE_C8C9:G49G50_EE   E 8  ? E 50 ? E 9  ? E 49 ? 
1 A G 16 1_555 A U 42 1_555 A C 17 1_555 A G 41 1_555 0.820  -0.903 3.093 -0.659 0.972   45.001 -1.262 -1.127 3.062 1.269  0.861  
45.015  9  EE_G16C17:G41U42_EE E 16 ? E 42 ? E 17 ? E 41 ? 
1 A C 17 1_555 A G 41 1_555 A C 18 1_555 A G 40 1_555 0.304  -1.462 3.576 -1.281 6.892   36.734 -3.237 -0.652 3.246 10.815 2.010  
37.375  10 EE_C17C18:G40G41_EE E 17 ? E 41 ? E 18 ? E 40 ? 
1 A C 18 1_555 A G 40 1_555 A C 19 1_555 A G 39 1_555 -0.429 -1.483 3.234 -0.761 3.908   31.502 -3.403 0.649  3.042 7.161  1.395  
31.747  11 EE_C18C19:G39G40_EE E 18 ? E 40 ? E 19 ? E 39 ? 
1 A C 19 1_555 A G 39 1_555 A G 20 1_555 A C 38 1_555 0.738  -1.705 3.097 -0.502 9.359   28.777 -4.911 -1.503 2.423 18.231 0.978  
30.234  12 EE_C19G20:C38G39_EE E 19 ? E 39 ? E 20 ? E 38 ? 
1 A G 20 1_555 A C 38 1_555 A G 21 1_555 A C 37 1_555 -1.008 -1.662 3.258 -0.401 11.163  34.666 -4.098 1.563  2.627 18.160 0.653  
36.368  13 EE_G20G21:C37C38_EE E 20 ? E 38 ? E 21 ? E 37 ? 
1 A G 21 1_555 A C 37 1_555 A G 22 1_555 A C 36 1_555 0.551  -1.790 3.589 4.622  19.071  30.623 -5.460 -0.259 2.196 32.286 -7.824 
36.244  14 EE_G21G22:C36C37_EE E 21 ? E 37 ? E 22 ? E 36 ? 
1 A G 22 1_555 A C 36 1_555 A U 23 1_555 A U 35 1_555 0.714  -0.589 2.720 -8.060 8.861   36.778 -1.755 -1.866 2.321 13.607 12.378 
38.615  15 EE_G22U23:U35C36_EE E 22 ? E 36 ? E 23 ? E 35 ? 
1 A U 23 1_555 A U 35 1_555 A G 24 1_555 A A 34 1_555 -0.115 -0.007 2.942 5.989  14.331  47.356 -0.957 0.533  2.797 17.307 -7.233 
49.698  16 EE_U23G24:A34U35_EE E 23 ? E 35 ? E 24 ? E 34 ? 
1 A G 24 1_555 A A 34 1_555 A A 25 1_555 A G 33 1_555 0.437  -2.034 4.814 2.365  -12.377 -8.827 18.815 3.777  1.068 54.145 10.346 
-15.375 17 EE_G24A25:G33A34_EE E 24 ? E 34 ? E 25 ? E 33 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
6 "ADENOSINE-5'-TRIPHOSPHATE" ATP 
7 'ZINC ION'                  ZN  
8 water                       HOH 
#