data_2HW1
# 
_entry.id   2HW1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HW1         
RCSB  RCSB038828   
WWPDB D_1000038828 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2HQQ 
_pdbx_database_related.details        'The same protein complexed with fructose and AMPPNP' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HW1 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Trinh, C.H.'      1 
'Asipu, A.'        2 
'Bonthron, D.T.'   3 
'Phillips, S.E.V.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structures of alternatively spliced isoforms of human ketohexokinase.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            65 
_citation.page_first                201 
_citation.page_last                 211 
_citation.year                      2009 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19237742 
_citation.pdbx_database_id_DOI      10.1107/S0907444908041115 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Trinh, C.H.'    1 ? 
primary 'Asipu, A.'      2 ? 
primary 'Bonthron, D.T.' 3 ? 
primary 'Phillips, S.E.' 4 ? 
# 
_cell.entry_id           2HW1 
_cell.length_a           61.264 
_cell.length_b           107.823 
_cell.length_c           146.679 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HW1 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Ketohexokinase                                32768.277 1   2.7.1.3 ? ? ? 
2 non-polymer man beta-D-fructofuranose                         180.156   1   ?       ? ? ? 
3 non-polymer syn 'SULFATE ION'                                 96.063    1   ?       ? ? ? 
4 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   1   ?       ? ? ? 
5 non-polymer syn GLYCEROL                                      92.094    1   ?       ? ? ? 
6 water       nat water                                         18.015    247 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Hepatic fructokinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYS
VDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQ
PPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYS
VDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQ
PPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   GLU n 
1 4   LYS n 
1 5   GLN n 
1 6   ILE n 
1 7   LEU n 
1 8   CYS n 
1 9   VAL n 
1 10  GLY n 
1 11  LEU n 
1 12  VAL n 
1 13  VAL n 
1 14  LEU n 
1 15  ASP n 
1 16  VAL n 
1 17  ILE n 
1 18  SER n 
1 19  LEU n 
1 20  VAL n 
1 21  ASP n 
1 22  LYS n 
1 23  TYR n 
1 24  PRO n 
1 25  LYS n 
1 26  GLU n 
1 27  ASP n 
1 28  SER n 
1 29  GLU n 
1 30  ILE n 
1 31  ARG n 
1 32  CYS n 
1 33  LEU n 
1 34  SER n 
1 35  GLN n 
1 36  ARG n 
1 37  TRP n 
1 38  GLN n 
1 39  ARG n 
1 40  GLY n 
1 41  GLY n 
1 42  ASN n 
1 43  ALA n 
1 44  SER n 
1 45  ASN n 
1 46  SER n 
1 47  CYS n 
1 48  THR n 
1 49  VAL n 
1 50  LEU n 
1 51  SER n 
1 52  LEU n 
1 53  LEU n 
1 54  GLY n 
1 55  ALA n 
1 56  PRO n 
1 57  CYS n 
1 58  ALA n 
1 59  PHE n 
1 60  MET n 
1 61  GLY n 
1 62  SER n 
1 63  MET n 
1 64  ALA n 
1 65  PRO n 
1 66  GLY n 
1 67  HIS n 
1 68  VAL n 
1 69  ALA n 
1 70  ASP n 
1 71  PHE n 
1 72  VAL n 
1 73  LEU n 
1 74  ASP n 
1 75  ASP n 
1 76  LEU n 
1 77  ARG n 
1 78  ARG n 
1 79  TYR n 
1 80  SER n 
1 81  VAL n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  TYR n 
1 86  THR n 
1 87  VAL n 
1 88  PHE n 
1 89  GLN n 
1 90  THR n 
1 91  THR n 
1 92  GLY n 
1 93  SER n 
1 94  VAL n 
1 95  PRO n 
1 96  ILE n 
1 97  ALA n 
1 98  THR n 
1 99  VAL n 
1 100 ILE n 
1 101 ILE n 
1 102 ASN n 
1 103 GLU n 
1 104 ALA n 
1 105 SER n 
1 106 GLY n 
1 107 SER n 
1 108 ARG n 
1 109 THR n 
1 110 ILE n 
1 111 LEU n 
1 112 TYR n 
1 113 TYR n 
1 114 ASP n 
1 115 ARG n 
1 116 SER n 
1 117 LEU n 
1 118 PRO n 
1 119 ASP n 
1 120 VAL n 
1 121 SER n 
1 122 ALA n 
1 123 THR n 
1 124 ASP n 
1 125 PHE n 
1 126 GLU n 
1 127 LYS n 
1 128 VAL n 
1 129 ASP n 
1 130 LEU n 
1 131 THR n 
1 132 GLN n 
1 133 PHE n 
1 134 LYS n 
1 135 TRP n 
1 136 ILE n 
1 137 HIS n 
1 138 ILE n 
1 139 GLU n 
1 140 GLY n 
1 141 ARG n 
1 142 ASN n 
1 143 ALA n 
1 144 SER n 
1 145 GLU n 
1 146 GLN n 
1 147 VAL n 
1 148 LYS n 
1 149 MET n 
1 150 LEU n 
1 151 GLN n 
1 152 ARG n 
1 153 ILE n 
1 154 ASP n 
1 155 ALA n 
1 156 HIS n 
1 157 ASN n 
1 158 THR n 
1 159 ARG n 
1 160 GLN n 
1 161 PRO n 
1 162 PRO n 
1 163 GLU n 
1 164 GLN n 
1 165 LYS n 
1 166 ILE n 
1 167 ARG n 
1 168 VAL n 
1 169 SER n 
1 170 VAL n 
1 171 GLU n 
1 172 VAL n 
1 173 GLU n 
1 174 LYS n 
1 175 PRO n 
1 176 ARG n 
1 177 GLU n 
1 178 GLU n 
1 179 LEU n 
1 180 PHE n 
1 181 GLN n 
1 182 LEU n 
1 183 PHE n 
1 184 GLY n 
1 185 TYR n 
1 186 GLY n 
1 187 ASP n 
1 188 VAL n 
1 189 VAL n 
1 190 PHE n 
1 191 VAL n 
1 192 SER n 
1 193 LYS n 
1 194 ASP n 
1 195 VAL n 
1 196 ALA n 
1 197 LYS n 
1 198 HIS n 
1 199 LEU n 
1 200 GLY n 
1 201 PHE n 
1 202 GLN n 
1 203 SER n 
1 204 ALA n 
1 205 GLU n 
1 206 GLU n 
1 207 ALA n 
1 208 LEU n 
1 209 ARG n 
1 210 GLY n 
1 211 LEU n 
1 212 TYR n 
1 213 GLY n 
1 214 ARG n 
1 215 VAL n 
1 216 ARG n 
1 217 LYS n 
1 218 GLY n 
1 219 ALA n 
1 220 VAL n 
1 221 LEU n 
1 222 VAL n 
1 223 CYS n 
1 224 ALA n 
1 225 TRP n 
1 226 ALA n 
1 227 GLU n 
1 228 GLU n 
1 229 GLY n 
1 230 ALA n 
1 231 ASP n 
1 232 ALA n 
1 233 LEU n 
1 234 GLY n 
1 235 PRO n 
1 236 ASP n 
1 237 GLY n 
1 238 LYS n 
1 239 LEU n 
1 240 LEU n 
1 241 HIS n 
1 242 SER n 
1 243 ASP n 
1 244 ALA n 
1 245 PHE n 
1 246 PRO n 
1 247 PRO n 
1 248 PRO n 
1 249 ARG n 
1 250 VAL n 
1 251 VAL n 
1 252 ASP n 
1 253 THR n 
1 254 LEU n 
1 255 GLY n 
1 256 ALA n 
1 257 GLY n 
1 258 ASP n 
1 259 THR n 
1 260 PHE n 
1 261 ASN n 
1 262 ALA n 
1 263 SER n 
1 264 VAL n 
1 265 ILE n 
1 266 PHE n 
1 267 SER n 
1 268 LEU n 
1 269 SER n 
1 270 GLN n 
1 271 GLY n 
1 272 ARG n 
1 273 SER n 
1 274 VAL n 
1 275 GLN n 
1 276 GLU n 
1 277 ALA n 
1 278 LEU n 
1 279 ARG n 
1 280 PHE n 
1 281 GLY n 
1 282 CYS n 
1 283 GLN n 
1 284 VAL n 
1 285 ALA n 
1 286 GLY n 
1 287 LYS n 
1 288 LYS n 
1 289 CYS n 
1 290 GLY n 
1 291 LEU n 
1 292 GLN n 
1 293 GLY n 
1 294 PHE n 
1 295 ASP n 
1 296 GLY n 
1 297 ILE n 
1 298 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 KHK 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'JM109(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KHK_HUMAN 
_struct_ref.pdbx_db_accession          P50053 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYS
VDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQ
PPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2HW1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 298 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P50053 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  298 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       298 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                       ?                               'C3 H7 N O2' 
89.093  
ANP non-polymer                  . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ?                               
'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking'          y ARGININE                                      ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                    ?                               'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                               ?                               'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking'          y CYSTEINE                                      ?                               'C3 H7 N O2 S' 
121.158 
FRU 'D-saccharide, beta linking' . beta-D-fructofuranose                         ?                               'C6 H12 O6' 
180.156 
GLN 'L-peptide linking'          y GLUTAMINE                                     ?                               'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                               ?                               'C5 H9 N O4' 
147.129 
GLY 'peptide linking'            y GLYCINE                                       ?                               'C2 H5 N O2' 
75.067  
GOL non-polymer                  . GLYCEROL                                      'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 
HIS 'L-peptide linking'          y HISTIDINE                                     ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer                  . WATER                                         ?                               'H2 O' 18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                    ?                               'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking'          y LEUCINE                                       ?                               'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking'          y LYSINE                                        ?                               'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking'          y METHIONINE                                    ?                               'C5 H11 N O2 S' 
149.211 
PHE 'L-peptide linking'          y PHENYLALANINE                                 ?                               'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking'          y PROLINE                                       ?                               'C5 H9 N O2' 
115.130 
SER 'L-peptide linking'          y SERINE                                        ?                               'C3 H7 N O3' 
105.093 
SO4 non-polymer                  . 'SULFATE ION'                                 ?                               'O4 S -2' 96.063  
THR 'L-peptide linking'          y THREONINE                                     ?                               'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                    ?                               'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking'          y TYROSINE                                      ?                               'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking'          y VALINE                                        ?                               'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          2HW1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.69 
_exptl_crystal.density_percent_sol   66.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.7 
_exptl_crystal_grow.pdbx_details    
'0.7M ammonium sulphate, 0.5M lithium sulphate, 0.1M sodium citrate, pH 5.7, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-10-18 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 optimized for 0.977' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.977 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX14.1' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX14.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.977 
# 
_reflns.entry_id                     2HW1 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.10 
_reflns.d_resolution_low             87.71 
_reflns.number_all                   27885 
_reflns.number_obs                   27885 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            0.066 
_reflns.pdbx_Rsym_value              0.066 
_reflns.pdbx_netI_over_sigmaI        8.4 
_reflns.B_iso_Wilson_estimate        29.8 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   91.2 
_reflns_shell.Rmerge_I_obs           0.34 
_reflns_shell.pdbx_Rsym_value        0.34 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3744 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HW1 
_refine.ls_number_reflns_obs                     26466 
_refine.ls_number_reflns_all                     27885 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             87.71 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    96.78 
_refine.ls_R_factor_obs                          0.19441 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19263 
_refine.ls_R_factor_R_free                       0.22777 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1416 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.949 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               29.841 
_refine.aniso_B[1][1]                            0.22 
_refine.aniso_B[2][2]                            1.35 
_refine.aniso_B[3][3]                            -1.57 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2HQQ' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.167 
_refine.pdbx_overall_ESU_R_Free                  0.154 
_refine.overall_SU_ML                            0.106 
_refine.overall_SU_B                             3.939 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2277 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             247 
_refine_hist.number_atoms_total               2578 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        87.71 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.012  0.022  ? 2374 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.292  1.988  ? 3222 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.365  5.000  ? 295  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   33.728 23.558 ? 104  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   13.967 15.000 ? 390  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   14.652 15.000 ? 19   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.077  0.200  ? 366  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 1776 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.224  0.300  ? 1097 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.319  0.500  ? 1607 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.247  0.500  ? 373  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.253  0.300  ? 37   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.287  0.500  ? 22   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.258  2.000  ? 1505 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.092  3.000  ? 2355 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.326  2.000  ? 977  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.132  3.000  ? 867  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.155 
_refine_ls_shell.number_reflns_R_work             1702 
_refine_ls_shell.R_factor_R_work                  0.252 
_refine_ls_shell.percent_reflns_obs               85.57 
_refine_ls_shell.R_factor_R_free                  0.245 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             89 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                1702 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HW1 
_struct.title                     'Crystal structure of human ketohexokinase complexed to different sugar molecules' 
_struct.pdbx_descriptor           'Ketohexokinase (E.C.2.7.1.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HW1 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'Fructose kinase, transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
'The biological assembly is a dimer generated from the monomer in the asymmetric unit by the operations: 1-x,-y,z' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 41  ? GLY A 54  ? GLY A 41  GLY A 54  1 ? 14 
HELX_P HELX_P2  2  GLY A 66  ? TYR A 79  ? GLY A 66  TYR A 79  1 ? 14 
HELX_P HELX_P3  3  SER A 121 ? LYS A 127 ? SER A 121 LYS A 127 1 ? 7  
HELX_P HELX_P4  4  VAL A 128 ? THR A 131 ? VAL A 128 THR A 131 5 ? 4  
HELX_P HELX_P5  5  ASN A 142 ? ARG A 159 ? ASN A 142 ARG A 159 1 ? 18 
HELX_P HELX_P6  6  ARG A 176 ? TYR A 185 ? ARG A 176 TYR A 185 5 ? 10 
HELX_P HELX_P7  7  SER A 192 ? LEU A 199 ? SER A 192 LEU A 199 1 ? 8  
HELX_P HELX_P8  8  SER A 203 ? TYR A 212 ? SER A 203 TYR A 212 1 ? 10 
HELX_P HELX_P9  9  GLY A 213 ? VAL A 215 ? GLY A 213 VAL A 215 5 ? 3  
HELX_P HELX_P10 10 ALA A 226 ? GLU A 228 ? ALA A 226 GLU A 228 5 ? 3  
HELX_P HELX_P11 11 GLY A 255 ? GLN A 270 ? GLY A 255 GLN A 270 1 ? 16 
HELX_P HELX_P12 12 SER A 273 ? GLY A 290 ? SER A 273 GLY A 290 1 ? 18 
HELX_P HELX_P13 13 PHE A 294 ? VAL A 298 ? PHE A 294 VAL A 298 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 4 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 57  ? MET A 60  ? CYS A 57  MET A 60  
A 2 GLN A 5   ? VAL A 9   ? GLN A 5   VAL A 9   
A 3 PHE A 133 ? GLU A 139 ? PHE A 133 GLU A 139 
A 4 ARG A 167 ? VAL A 172 ? ARG A 167 VAL A 172 
A 5 VAL A 188 ? VAL A 191 ? VAL A 188 VAL A 191 
A 6 VAL A 220 ? ALA A 224 ? VAL A 220 ALA A 224 
A 7 ALA A 230 ? LEU A 233 ? ALA A 230 LEU A 233 
A 8 LEU A 239 ? SER A 242 ? LEU A 239 SER A 242 
B 1 SER A 34  ? GLY A 40  ? SER A 34  GLY A 40  
B 2 VAL A 13  ? VAL A 20  ? VAL A 13  VAL A 20  
B 3 ILE A 96  ? ASN A 102 ? ILE A 96  ASN A 102 
B 4 ARG A 108 ? TYR A 113 ? ARG A 108 TYR A 113 
C 1 SER A 62  ? MET A 63  ? SER A 62  MET A 63  
C 2 VAL A 87  ? PHE A 88  ? VAL A 87  PHE A 88  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 60  ? O MET A 60  N CYS A 8   ? N CYS A 8   
A 2 3 N LEU A 7   ? N LEU A 7   O HIS A 137 ? O HIS A 137 
A 3 4 N ILE A 138 ? N ILE A 138 O SER A 169 ? O SER A 169 
A 4 5 N VAL A 170 ? N VAL A 170 O PHE A 190 ? O PHE A 190 
A 5 6 N VAL A 189 ? N VAL A 189 O VAL A 222 ? O VAL A 222 
A 6 7 N CYS A 223 ? N CYS A 223 O ASP A 231 ? O ASP A 231 
A 7 8 N ALA A 232 ? N ALA A 232 O LEU A 240 ? O LEU A 240 
B 1 2 O ARG A 36  ? O ARG A 36  N ILE A 17  ? N ILE A 17  
B 2 3 N VAL A 16  ? N VAL A 16  O ALA A 97  ? O ALA A 97  
B 3 4 N THR A 98  ? N THR A 98  O LEU A 111 ? O LEU A 111 
C 1 2 N MET A 63  ? N MET A 63  O VAL A 87  ? O VAL A 87  
# 
_database_PDB_matrix.entry_id          2HW1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HW1 
_atom_sites.fract_transf_matrix[1][1]   0.016323 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009274 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006818 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLU A 1 3   ? 19.906 37.747  -65.550 1.00 46.15  ? 3   GLU A N     1 
ATOM   2    C CA    . GLU A 1 3   ? 20.698 37.665  -64.281 1.00 45.92  ? 3   GLU A CA    1 
ATOM   3    C C     . GLU A 1 3   ? 22.051 36.981  -64.493 1.00 44.51  ? 3   GLU A C     1 
ATOM   4    O O     . GLU A 1 3   ? 22.151 35.975  -65.207 1.00 44.83  ? 3   GLU A O     1 
ATOM   5    C CB    . GLU A 1 3   ? 19.898 36.943  -63.188 1.00 46.31  ? 3   GLU A CB    1 
ATOM   6    N N     . LYS A 1 4   ? 23.095 37.524  -63.869 1.00 42.25  ? 4   LYS A N     1 
ATOM   7    C CA    . LYS A 1 4   ? 24.412 36.898  -63.946 1.00 39.29  ? 4   LYS A CA    1 
ATOM   8    C C     . LYS A 1 4   ? 24.390 35.572  -63.189 1.00 36.42  ? 4   LYS A C     1 
ATOM   9    O O     . LYS A 1 4   ? 23.577 35.364  -62.297 1.00 35.29  ? 4   LYS A O     1 
ATOM   10   C CB    . LYS A 1 4   ? 25.503 37.833  -63.416 1.00 40.41  ? 4   LYS A CB    1 
ATOM   11   C CG    . LYS A 1 4   ? 25.688 39.099  -64.247 1.00 40.61  ? 4   LYS A CG    1 
ATOM   12   C CD    . LYS A 1 4   ? 26.866 39.902  -63.751 1.00 41.42  ? 4   LYS A CD    1 
ATOM   13   C CE    . LYS A 1 4   ? 27.226 41.007  -64.728 1.00 42.06  ? 4   LYS A CE    1 
ATOM   14   N NZ    . LYS A 1 4   ? 28.605 41.528  -64.482 1.00 42.37  ? 4   LYS A NZ    1 
ATOM   15   N N     . GLN A 1 5   ? 25.268 34.664  -63.570 1.00 33.33  ? 5   GLN A N     1 
ATOM   16   C CA    . GLN A 1 5   ? 25.245 33.333  -63.001 1.00 31.87  ? 5   GLN A CA    1 
ATOM   17   C C     . GLN A 1 5   ? 26.051 33.262  -61.712 1.00 29.87  ? 5   GLN A C     1 
ATOM   18   O O     . GLN A 1 5   ? 26.823 34.166  -61.388 1.00 28.84  ? 5   GLN A O     1 
ATOM   19   C CB    . GLN A 1 5   ? 25.818 32.333  -64.002 1.00 32.85  ? 5   GLN A CB    1 
ATOM   20   C CG    . GLN A 1 5   ? 25.019 32.259  -65.284 1.00 34.84  ? 5   GLN A CG    1 
ATOM   21   C CD    . GLN A 1 5   ? 25.585 31.263  -66.259 1.00 36.20  ? 5   GLN A CD    1 
ATOM   22   O OE1   . GLN A 1 5   ? 26.801 31.070  -66.346 1.00 37.10  ? 5   GLN A OE1   1 
ATOM   23   N NE2   . GLN A 1 5   ? 24.706 30.624  -67.010 1.00 36.83  ? 5   GLN A NE2   1 
ATOM   24   N N     . ILE A 1 6   ? 25.863 32.169  -60.987 1.00 27.13  ? 6   ILE A N     1 
ATOM   25   C CA    . ILE A 1 6   ? 26.724 31.834  -59.873 1.00 24.62  ? 6   ILE A CA    1 
ATOM   26   C C     . ILE A 1 6   ? 27.598 30.674  -60.342 1.00 24.36  ? 6   ILE A C     1 
ATOM   27   O O     . ILE A 1 6   ? 27.082 29.623  -60.730 1.00 23.83  ? 6   ILE A O     1 
ATOM   28   C CB    . ILE A 1 6   ? 25.914 31.372  -58.666 1.00 23.09  ? 6   ILE A CB    1 
ATOM   29   C CG1   . ILE A 1 6   ? 25.041 32.527  -58.138 1.00 22.13  ? 6   ILE A CG1   1 
ATOM   30   C CG2   . ILE A 1 6   ? 26.857 30.792  -57.619 1.00 22.00  ? 6   ILE A CG2   1 
ATOM   31   C CD1   . ILE A 1 6   ? 24.299 32.215  -56.870 1.00 22.73  ? 6   ILE A CD1   1 
ATOM   32   N N     . LEU A 1 7   ? 28.910 30.861  -60.311 1.00 23.05  ? 7   LEU A N     1 
ATOM   33   C CA    . LEU A 1 7   ? 29.831 29.809  -60.688 1.00 23.22  ? 7   LEU A CA    1 
ATOM   34   C C     . LEU A 1 7   ? 30.293 28.991  -59.464 1.00 23.29  ? 7   LEU A C     1 
ATOM   35   O O     . LEU A 1 7   ? 30.669 29.564  -58.438 1.00 22.70  ? 7   LEU A O     1 
ATOM   36   C CB    . LEU A 1 7   ? 31.039 30.418  -61.383 1.00 22.87  ? 7   LEU A CB    1 
ATOM   37   C CG    . LEU A 1 7   ? 32.163 29.462  -61.778 1.00 23.13  ? 7   LEU A CG    1 
ATOM   38   C CD1   . LEU A 1 7   ? 31.714 28.532  -62.933 1.00 23.57  ? 7   LEU A CD1   1 
ATOM   39   C CD2   . LEU A 1 7   ? 33.388 30.244  -62.188 1.00 24.18  ? 7   LEU A CD2   1 
ATOM   40   N N     . CYS A 1 8   ? 30.254 27.661  -59.572 1.00 23.13  ? 8   CYS A N     1 
ATOM   41   C CA    . CYS A 1 8   ? 30.902 26.800  -58.580 1.00 22.83  ? 8   CYS A CA    1 
ATOM   42   C C     . CYS A 1 8   ? 32.061 26.047  -59.216 1.00 22.30  ? 8   CYS A C     1 
ATOM   43   O O     . CYS A 1 8   ? 31.890 25.412  -60.256 1.00 21.35  ? 8   CYS A O     1 
ATOM   44   C CB    . CYS A 1 8   ? 29.919 25.798  -57.978 1.00 23.95  ? 8   CYS A CB    1 
ATOM   45   S SG    . CYS A 1 8   ? 28.479 26.532  -57.129 1.00 24.65  ? 8   CYS A SG    1 
ATOM   46   N N     . VAL A 1 9   ? 33.230 26.111  -58.580 1.00 20.86  ? 9   VAL A N     1 
ATOM   47   C CA    . VAL A 1 9   ? 34.398 25.378  -59.024 1.00 21.31  ? 9   VAL A CA    1 
ATOM   48   C C     . VAL A 1 9   ? 34.632 24.264  -58.029 1.00 22.44  ? 9   VAL A C     1 
ATOM   49   O O     . VAL A 1 9   ? 34.694 24.519  -56.817 1.00 22.76  ? 9   VAL A O     1 
ATOM   50   C CB    . VAL A 1 9   ? 35.649 26.295  -59.050 1.00 21.95  ? 9   VAL A CB    1 
ATOM   51   C CG1   . VAL A 1 9   ? 36.931 25.515  -59.469 1.00 20.80  ? 9   VAL A CG1   1 
ATOM   52   C CG2   . VAL A 1 9   ? 35.397 27.510  -59.932 1.00 21.72  ? 9   VAL A CG2   1 
ATOM   53   N N     . GLY A 1 10  ? 34.777 23.036  -58.525 1.00 22.26  ? 10  GLY A N     1 
ATOM   54   C CA    . GLY A 1 10  ? 34.914 21.880  -57.651 1.00 24.15  ? 10  GLY A CA    1 
ATOM   55   C C     . GLY A 1 10  ? 34.999 20.592  -58.446 1.00 25.79  ? 10  GLY A C     1 
ATOM   56   O O     . GLY A 1 10  ? 35.405 20.605  -59.603 1.00 25.87  ? 10  GLY A O     1 
ATOM   57   N N     . LEU A 1 11  ? 34.617 19.471  -57.843 1.00 27.82  ? 11  LEU A N     1 
ATOM   58   C CA    . LEU A 1 11  ? 34.717 18.184  -58.550 1.00 29.04  ? 11  LEU A CA    1 
ATOM   59   C C     . LEU A 1 11  ? 33.424 17.403  -58.513 1.00 28.31  ? 11  LEU A C     1 
ATOM   60   O O     . LEU A 1 11  ? 32.844 17.217  -57.456 1.00 30.45  ? 11  LEU A O     1 
ATOM   61   C CB    . LEU A 1 11  ? 35.847 17.323  -57.963 1.00 30.22  ? 11  LEU A CB    1 
ATOM   62   C CG    . LEU A 1 11  ? 36.152 15.971  -58.653 1.00 30.02  ? 11  LEU A CG    1 
ATOM   63   C CD1   . LEU A 1 11  ? 36.334 16.077  -60.206 1.00 30.65  ? 11  LEU A CD1   1 
ATOM   64   C CD2   . LEU A 1 11  ? 37.367 15.360  -57.988 1.00 30.57  ? 11  LEU A CD2   1 
ATOM   65   N N     . VAL A 1 12  ? 32.954 16.951  -59.666 1.00 26.30  ? 12  VAL A N     1 
ATOM   66   C CA    . VAL A 1 12  ? 31.841 16.026  -59.693 1.00 24.31  ? 12  VAL A CA    1 
ATOM   67   C C     . VAL A 1 12  ? 32.358 14.642  -59.278 1.00 22.58  ? 12  VAL A C     1 
ATOM   68   O O     . VAL A 1 12  ? 33.469 14.243  -59.653 1.00 21.53  ? 12  VAL A O     1 
ATOM   69   C CB    . VAL A 1 12  ? 31.176 15.961  -61.092 1.00 26.20  ? 12  VAL A CB    1 
ATOM   70   C CG1   . VAL A 1 12  ? 29.951 15.112  -61.048 1.00 26.03  ? 12  VAL A CG1   1 
ATOM   71   C CG2   . VAL A 1 12  ? 30.759 17.318  -61.525 1.00 28.05  ? 12  VAL A CG2   1 
ATOM   72   N N     . VAL A 1 13  ? 31.564 13.939  -58.472 1.00 20.07  ? 13  VAL A N     1 
ATOM   73   C CA    . VAL A 1 13  ? 31.880 12.597  -58.000 1.00 19.02  ? 13  VAL A CA    1 
ATOM   74   C C     . VAL A 1 13  ? 30.687 11.714  -58.328 1.00 19.52  ? 13  VAL A C     1 
ATOM   75   O O     . VAL A 1 13  ? 29.551 12.178  -58.290 1.00 18.55  ? 13  VAL A O     1 
ATOM   76   C CB    . VAL A 1 13  ? 32.060 12.590  -56.450 1.00 18.85  ? 13  VAL A CB    1 
ATOM   77   C CG1   . VAL A 1 13  ? 32.378 11.198  -55.931 1.00 18.19  ? 13  VAL A CG1   1 
ATOM   78   C CG2   . VAL A 1 13  ? 33.147 13.547  -56.044 1.00 18.36  ? 13  VAL A CG2   1 
ATOM   79   N N     . LEU A 1 14  ? 30.933 10.447  -58.651 1.00 19.54  ? 14  LEU A N     1 
ATOM   80   C CA    . LEU A 1 14  ? 29.857 9.486   -58.751 1.00 19.09  ? 14  LEU A CA    1 
ATOM   81   C C     . LEU A 1 14  ? 29.643 8.865   -57.374 1.00 18.32  ? 14  LEU A C     1 
ATOM   82   O O     . LEU A 1 14  ? 30.526 8.154   -56.869 1.00 18.16  ? 14  LEU A O     1 
ATOM   83   C CB    . LEU A 1 14  ? 30.217 8.365   -59.730 1.00 20.68  ? 14  LEU A CB    1 
ATOM   84   C CG    . LEU A 1 14  ? 29.096 7.315   -59.873 1.00 21.04  ? 14  LEU A CG    1 
ATOM   85   C CD1   . LEU A 1 14  ? 27.850 7.939   -60.498 1.00 21.13  ? 14  LEU A CD1   1 
ATOM   86   C CD2   . LEU A 1 14  ? 29.542 6.106   -60.677 1.00 20.70  ? 14  LEU A CD2   1 
ATOM   87   N N     . ASP A 1 15  ? 28.494 9.120   -56.760 1.00 15.82  ? 15  ASP A N     1 
ATOM   88   C CA    . ASP A 1 15  ? 28.187 8.425   -55.507 1.00 15.92  ? 15  ASP A CA    1 
ATOM   89   C C     . ASP A 1 15  ? 27.436 7.139   -55.808 1.00 16.37  ? 15  ASP A C     1 
ATOM   90   O O     . ASP A 1 15  ? 26.354 7.151   -56.405 1.00 17.14  ? 15  ASP A O     1 
ATOM   91   C CB    . ASP A 1 15  ? 27.358 9.279   -54.569 1.00 14.47  ? 15  ASP A CB    1 
ATOM   92   C CG    . ASP A 1 15  ? 27.984 10.602  -54.284 1.00 15.64  ? 15  ASP A CG    1 
ATOM   93   O OD1   . ASP A 1 15  ? 29.164 10.827  -54.603 1.00 15.55  ? 15  ASP A OD1   1 
ATOM   94   O OD2   . ASP A 1 15  ? 27.288 11.437  -53.714 1.00 17.25  ? 15  ASP A OD2   1 
ATOM   95   N N     . VAL A 1 16  ? 28.025 6.026   -55.416 1.00 15.82  ? 16  VAL A N     1 
ATOM   96   C CA    . VAL A 1 16  ? 27.364 4.755   -55.545 1.00 15.19  ? 16  VAL A CA    1 
ATOM   97   C C     . VAL A 1 16  ? 26.771 4.420   -54.170 1.00 15.76  ? 16  VAL A C     1 
ATOM   98   O O     . VAL A 1 16  ? 27.505 4.130   -53.211 1.00 13.73  ? 16  VAL A O     1 
ATOM   99   C CB    . VAL A 1 16  ? 28.353 3.691   -55.992 1.00 15.43  ? 16  VAL A CB    1 
ATOM   100  C CG1   . VAL A 1 16  ? 27.647 2.366   -56.152 1.00 15.59  ? 16  VAL A CG1   1 
ATOM   101  C CG2   . VAL A 1 16  ? 29.002 4.121   -57.313 1.00 16.18  ? 16  VAL A CG2   1 
ATOM   102  N N     . ILE A 1 17  ? 25.447 4.480   -54.082 1.00 15.79  ? 17  ILE A N     1 
ATOM   103  C CA    . ILE A 1 17  ? 24.781 4.516   -52.779 1.00 17.41  ? 17  ILE A CA    1 
ATOM   104  C C     . ILE A 1 17  ? 24.094 3.213   -52.425 1.00 18.82  ? 17  ILE A C     1 
ATOM   105  O O     . ILE A 1 17  ? 23.214 2.771   -53.149 1.00 20.11  ? 17  ILE A O     1 
ATOM   106  C CB    . ILE A 1 17  ? 23.702 5.608   -52.751 1.00 17.65  ? 17  ILE A CB    1 
ATOM   107  C CG1   . ILE A 1 17  ? 24.310 6.969   -53.097 1.00 17.58  ? 17  ILE A CG1   1 
ATOM   108  C CG2   . ILE A 1 17  ? 23.031 5.681   -51.371 1.00 17.71  ? 17  ILE A CG2   1 
ATOM   109  C CD1   . ILE A 1 17  ? 23.280 8.054   -53.221 1.00 16.22  ? 17  ILE A CD1   1 
ATOM   110  N N     . SER A 1 18  ? 24.487 2.626   -51.299 1.00 19.08  ? 18  SER A N     1 
ATOM   111  C CA    . SER A 1 18  ? 23.860 1.419   -50.775 1.00 20.08  ? 18  SER A CA    1 
ATOM   112  C C     . SER A 1 18  ? 23.001 1.762   -49.572 1.00 20.10  ? 18  SER A C     1 
ATOM   113  O O     . SER A 1 18  ? 23.501 2.227   -48.564 1.00 21.22  ? 18  SER A O     1 
ATOM   114  C CB    . SER A 1 18  ? 24.923 0.393   -50.353 1.00 20.98  ? 18  SER A CB    1 
ATOM   115  O OG    . SER A 1 18  ? 25.683 -0.024  -51.471 1.00 20.72  ? 18  SER A OG    1 
ATOM   116  N N     . LEU A 1 19  ? 21.705 1.548   -49.694 1.00 21.56  ? 19  LEU A N     1 
ATOM   117  C CA    . LEU A 1 19  ? 20.792 1.801   -48.586 1.00 23.65  ? 19  LEU A CA    1 
ATOM   118  C C     . LEU A 1 19  ? 20.649 0.509   -47.779 1.00 22.87  ? 19  LEU A C     1 
ATOM   119  O O     . LEU A 1 19  ? 20.319 -0.537  -48.342 1.00 22.52  ? 19  LEU A O     1 
ATOM   120  C CB    . LEU A 1 19  ? 19.426 2.231   -49.132 1.00 24.59  ? 19  LEU A CB    1 
ATOM   121  C CG    . LEU A 1 19  ? 18.301 2.490   -48.121 1.00 26.06  ? 19  LEU A CG    1 
ATOM   122  C CD1   . LEU A 1 19  ? 18.529 3.797   -47.406 1.00 26.76  ? 19  LEU A CD1   1 
ATOM   123  C CD2   . LEU A 1 19  ? 16.913 2.467   -48.810 1.00 25.85  ? 19  LEU A CD2   1 
ATOM   124  N N     . VAL A 1 20  ? 20.913 0.582   -46.474 1.00 23.18  ? 20  VAL A N     1 
ATOM   125  C CA    . VAL A 1 20  ? 20.755 -0.571  -45.581 1.00 24.32  ? 20  VAL A CA    1 
ATOM   126  C C     . VAL A 1 20  ? 19.816 -0.230  -44.391 1.00 25.75  ? 20  VAL A C     1 
ATOM   127  O O     . VAL A 1 20  ? 19.638 0.935   -44.040 1.00 23.33  ? 20  VAL A O     1 
ATOM   128  C CB    . VAL A 1 20  ? 22.134 -1.047  -45.046 1.00 23.87  ? 20  VAL A CB    1 
ATOM   129  C CG1   . VAL A 1 20  ? 22.991 -1.601  -46.201 1.00 24.20  ? 20  VAL A CG1   1 
ATOM   130  C CG2   . VAL A 1 20  ? 22.858 0.100   -44.342 1.00 21.37  ? 20  VAL A CG2   1 
ATOM   131  N N     . ASP A 1 21  ? 19.216 -1.240  -43.776 1.00 28.76  ? 21  ASP A N     1 
ATOM   132  C CA    . ASP A 1 21  ? 18.278 -0.956  -42.677 1.00 32.21  ? 21  ASP A CA    1 
ATOM   133  C C     . ASP A 1 21  ? 18.952 -0.694  -41.337 1.00 32.47  ? 21  ASP A C     1 
ATOM   134  O O     . ASP A 1 21  ? 18.326 -0.158  -40.436 1.00 33.92  ? 21  ASP A O     1 
ATOM   135  C CB    . ASP A 1 21  ? 17.177 -2.018  -42.569 1.00 35.24  ? 21  ASP A CB    1 
ATOM   136  C CG    . ASP A 1 21  ? 17.711 -3.394  -42.266 1.00 38.04  ? 21  ASP A CG    1 
ATOM   137  O OD1   . ASP A 1 21  ? 18.950 -3.577  -42.220 1.00 39.56  ? 21  ASP A OD1   1 
ATOM   138  O OD2   . ASP A 1 21  ? 16.878 -4.307  -42.072 1.00 39.82  ? 21  ASP A OD2   1 
ATOM   139  N N     . LYS A 1 22  ? 20.236 -1.039  -41.229 1.00 32.24  ? 22  LYS A N     1 
ATOM   140  C CA    . LYS A 1 22  ? 21.044 -0.772  -40.045 1.00 32.34  ? 22  LYS A CA    1 
ATOM   141  C C     . LYS A 1 22  ? 22.499 -0.605  -40.471 1.00 30.55  ? 22  LYS A C     1 
ATOM   142  O O     . LYS A 1 22  ? 22.903 -1.101  -41.519 1.00 30.12  ? 22  LYS A O     1 
ATOM   143  C CB    . LYS A 1 22  ? 20.923 -1.929  -39.026 1.00 33.87  ? 22  LYS A CB    1 
ATOM   144  C CG    . LYS A 1 22  ? 21.573 -3.253  -39.484 1.00 35.42  ? 22  LYS A CG    1 
ATOM   145  C CD    . LYS A 1 22  ? 21.574 -4.352  -38.397 1.00 36.67  ? 22  LYS A CD    1 
ATOM   146  C CE    . LYS A 1 22  ? 22.375 -3.919  -37.157 1.00 39.56  ? 22  LYS A CE    1 
ATOM   147  N NZ    . LYS A 1 22  ? 22.969 -5.088  -36.381 1.00 41.50  ? 22  LYS A NZ    1 
ATOM   148  N N     . TYR A 1 23  ? 23.297 0.086   -39.674 1.00 29.05  ? 23  TYR A N     1 
ATOM   149  C CA    . TYR A 1 23  ? 24.703 0.203   -39.993 1.00 28.76  ? 23  TYR A CA    1 
ATOM   150  C C     . TYR A 1 23  ? 25.403 -1.162  -39.888 1.00 30.02  ? 23  TYR A C     1 
ATOM   151  O O     . TYR A 1 23  ? 25.335 -1.816  -38.846 1.00 30.35  ? 23  TYR A O     1 
ATOM   152  C CB    . TYR A 1 23  ? 25.398 1.230   -39.103 1.00 27.05  ? 23  TYR A CB    1 
ATOM   153  C CG    . TYR A 1 23  ? 26.772 1.561   -39.622 1.00 26.73  ? 23  TYR A CG    1 
ATOM   154  C CD1   . TYR A 1 23  ? 26.932 2.276   -40.801 1.00 26.48  ? 23  TYR A CD1   1 
ATOM   155  C CD2   . TYR A 1 23  ? 27.908 1.112   -38.970 1.00 26.23  ? 23  TYR A CD2   1 
ATOM   156  C CE1   . TYR A 1 23  ? 28.196 2.571   -41.295 1.00 26.04  ? 23  TYR A CE1   1 
ATOM   157  C CE2   . TYR A 1 23  ? 29.169 1.399   -39.457 1.00 26.42  ? 23  TYR A CE2   1 
ATOM   158  C CZ    . TYR A 1 23  ? 29.303 2.126   -40.623 1.00 26.03  ? 23  TYR A CZ    1 
ATOM   159  O OH    . TYR A 1 23  ? 30.558 2.401   -41.113 1.00 26.17  ? 23  TYR A OH    1 
ATOM   160  N N     . PRO A 1 24  ? 26.076 -1.590  -40.974 1.00 30.16  ? 24  PRO A N     1 
ATOM   161  C CA    . PRO A 1 24  ? 26.730 -2.888  -41.059 1.00 30.30  ? 24  PRO A CA    1 
ATOM   162  C C     . PRO A 1 24  ? 27.675 -3.144  -39.892 1.00 30.76  ? 24  PRO A C     1 
ATOM   163  O O     . PRO A 1 24  ? 28.645 -2.401  -39.683 1.00 29.61  ? 24  PRO A O     1 
ATOM   164  C CB    . PRO A 1 24  ? 27.552 -2.784  -42.356 1.00 30.33  ? 24  PRO A CB    1 
ATOM   165  C CG    . PRO A 1 24  ? 26.859 -1.779  -43.167 1.00 30.98  ? 24  PRO A CG    1 
ATOM   166  C CD    . PRO A 1 24  ? 26.248 -0.801  -42.208 1.00 30.31  ? 24  PRO A CD    1 
ATOM   167  N N     . LYS A 1 25  ? 27.395 -4.196  -39.137 1.00 32.07  ? 25  LYS A N     1 
ATOM   168  C CA    . LYS A 1 25  ? 28.352 -4.669  -38.158 1.00 32.79  ? 25  LYS A CA    1 
ATOM   169  C C     . LYS A 1 25  ? 29.563 -5.221  -38.897 1.00 31.57  ? 25  LYS A C     1 
ATOM   170  O O     . LYS A 1 25  ? 29.413 -5.974  -39.861 1.00 29.63  ? 25  LYS A O     1 
ATOM   171  C CB    . LYS A 1 25  ? 27.732 -5.772  -37.304 1.00 36.20  ? 25  LYS A CB    1 
ATOM   172  C CG    . LYS A 1 25  ? 28.541 -6.041  -36.049 1.00 39.61  ? 25  LYS A CG    1 
ATOM   173  C CD    . LYS A 1 25  ? 28.492 -7.509  -35.637 1.00 42.10  ? 25  LYS A CD    1 
ATOM   174  C CE    . LYS A 1 25  ? 29.746 -7.880  -34.820 1.00 43.44  ? 25  LYS A CE    1 
ATOM   175  N NZ    . LYS A 1 25  ? 29.795 -9.354  -34.554 1.00 44.48  ? 25  LYS A NZ    1 
ATOM   176  N N     . GLU A 1 26  ? 30.757 -4.852  -38.442 1.00 30.96  ? 26  GLU A N     1 
ATOM   177  C CA    . GLU A 1 26  ? 31.980 -5.337  -39.046 1.00 30.62  ? 26  GLU A CA    1 
ATOM   178  C C     . GLU A 1 26  ? 31.950 -6.854  -39.132 1.00 32.31  ? 26  GLU A C     1 
ATOM   179  O O     . GLU A 1 26  ? 31.510 -7.536  -38.197 1.00 31.93  ? 26  GLU A O     1 
ATOM   180  C CB    . GLU A 1 26  ? 33.210 -4.879  -38.266 1.00 30.24  ? 26  GLU A CB    1 
ATOM   181  C CG    . GLU A 1 26  ? 34.532 -5.362  -38.867 1.00 29.45  ? 26  GLU A CG    1 
ATOM   182  C CD    . GLU A 1 26  ? 35.741 -4.737  -38.195 1.00 29.44  ? 26  GLU A CD    1 
ATOM   183  O OE1   . GLU A 1 26  ? 35.549 -3.980  -37.227 1.00 29.88  ? 26  GLU A OE1   1 
ATOM   184  O OE2   . GLU A 1 26  ? 36.883 -4.974  -38.642 1.00 28.67  ? 26  GLU A OE2   1 
ATOM   185  N N     . ASP A 1 27  ? 32.387 -7.365  -40.284 1.00 32.84  ? 27  ASP A N     1 
ATOM   186  C CA    . ASP A 1 27  ? 32.541 -8.794  -40.520 1.00 33.06  ? 27  ASP A CA    1 
ATOM   187  C C     . ASP A 1 27  ? 31.202 -9.504  -40.731 1.00 32.69  ? 27  ASP A C     1 
ATOM   188  O O     . ASP A 1 27  ? 31.142 -10.728 -40.774 1.00 33.36  ? 27  ASP A O     1 
ATOM   189  C CB    . ASP A 1 27  ? 33.365 -9.440  -39.394 1.00 35.46  ? 27  ASP A CB    1 
ATOM   190  C CG    . ASP A 1 27  ? 34.198 -10.602 -39.872 1.00 37.33  ? 27  ASP A CG    1 
ATOM   191  O OD1   . ASP A 1 27  ? 34.993 -10.442 -40.834 1.00 38.25  ? 27  ASP A OD1   1 
ATOM   192  O OD2   . ASP A 1 27  ? 34.067 -11.684 -39.268 1.00 38.78  ? 27  ASP A OD2   1 
ATOM   193  N N     . SER A 1 28  ? 30.124 -8.746  -40.888 1.00 31.46  ? 28  SER A N     1 
ATOM   194  C CA    . SER A 1 28  ? 28.849 -9.364  -41.232 1.00 31.20  ? 28  SER A CA    1 
ATOM   195  C C     . SER A 1 28  ? 28.591 -9.350  -42.736 1.00 30.94  ? 28  SER A C     1 
ATOM   196  O O     . SER A 1 28  ? 29.382 -8.834  -43.513 1.00 30.21  ? 28  SER A O     1 
ATOM   197  C CB    . SER A 1 28  ? 27.691 -8.655  -40.517 1.00 31.43  ? 28  SER A CB    1 
ATOM   198  O OG    . SER A 1 28  ? 27.594 -7.306  -40.964 1.00 31.16  ? 28  SER A OG    1 
ATOM   199  N N     . GLU A 1 29  ? 27.466 -9.929  -43.127 1.00 32.58  ? 29  GLU A N     1 
ATOM   200  C CA    . GLU A 1 29  ? 26.953 -9.837  -44.485 1.00 35.12  ? 29  GLU A CA    1 
ATOM   201  C C     . GLU A 1 29  ? 25.556 -9.280  -44.327 1.00 33.87  ? 29  GLU A C     1 
ATOM   202  O O     . GLU A 1 29  ? 24.790 -9.749  -43.492 1.00 33.23  ? 29  GLU A O     1 
ATOM   203  C CB    . GLU A 1 29  ? 26.885 -11.220 -45.142 1.00 36.77  ? 29  GLU A CB    1 
ATOM   204  C CG    . GLU A 1 29  ? 28.241 -11.925 -45.301 1.00 39.86  ? 29  GLU A CG    1 
ATOM   205  C CD    . GLU A 1 29  ? 28.121 -13.436 -45.536 1.00 40.48  ? 29  GLU A CD    1 
ATOM   206  O OE1   . GLU A 1 29  ? 27.693 -14.154 -44.602 1.00 43.49  ? 29  GLU A OE1   1 
ATOM   207  O OE2   . GLU A 1 29  ? 28.477 -13.918 -46.641 1.00 42.51  ? 29  GLU A OE2   1 
ATOM   208  N N     . ILE A 1 30  ? 25.222 -8.259  -45.102 1.00 32.88  ? 30  ILE A N     1 
ATOM   209  C CA    . ILE A 1 30  ? 23.918 -7.630  -44.971 1.00 32.76  ? 30  ILE A CA    1 
ATOM   210  C C     . ILE A 1 30  ? 23.316 -7.409  -46.348 1.00 32.66  ? 30  ILE A C     1 
ATOM   211  O O     . ILE A 1 30  ? 24.021 -7.030  -47.281 1.00 31.78  ? 30  ILE A O     1 
ATOM   212  C CB    . ILE A 1 30  ? 24.032 -6.300  -44.182 1.00 32.52  ? 30  ILE A CB    1 
ATOM   213  C CG1   . ILE A 1 30  ? 22.648 -5.746  -43.834 1.00 33.17  ? 30  ILE A CG1   1 
ATOM   214  C CG2   . ILE A 1 30  ? 24.874 -5.265  -44.929 1.00 31.68  ? 30  ILE A CG2   1 
ATOM   215  C CD1   . ILE A 1 30  ? 22.706 -4.533  -42.927 1.00 33.48  ? 30  ILE A CD1   1 
ATOM   216  N N     . ARG A 1 31  ? 22.023 -7.675  -46.485 1.00 33.29  ? 31  ARG A N     1 
ATOM   217  C CA    . ARG A 1 31  ? 21.341 -7.446  -47.748 1.00 35.41  ? 31  ARG A CA    1 
ATOM   218  C C     . ARG A 1 31  ? 20.982 -5.969  -47.856 1.00 35.09  ? 31  ARG A C     1 
ATOM   219  O O     . ARG A 1 31  ? 20.364 -5.417  -46.956 1.00 34.97  ? 31  ARG A O     1 
ATOM   220  C CB    . ARG A 1 31  ? 20.085 -8.315  -47.859 1.00 37.91  ? 31  ARG A CB    1 
ATOM   221  C CG    . ARG A 1 31  ? 19.373 -8.182  -49.179 1.00 41.61  ? 31  ARG A CG    1 
ATOM   222  C CD    . ARG A 1 31  ? 17.939 -8.731  -49.136 1.00 45.25  ? 31  ARG A CD    1 
ATOM   223  N NE    . ARG A 1 31  ? 17.900 -10.193 -49.061 1.00 48.06  ? 31  ARG A NE    1 
ATOM   224  C CZ    . ARG A 1 31  ? 18.212 -11.013 -50.067 1.00 49.52  ? 31  ARG A CZ    1 
ATOM   225  N NH1   . ARG A 1 31  ? 18.593 -10.523 -51.248 1.00 49.50  ? 31  ARG A NH1   1 
ATOM   226  N NH2   . ARG A 1 31  ? 18.150 -12.335 -49.883 1.00 50.13  ? 31  ARG A NH2   1 
ATOM   227  N N     . CYS A 1 32  ? 21.382 -5.320  -48.946 1.00 34.36  ? 32  CYS A N     1 
ATOM   228  C CA    . CYS A 1 32  ? 21.043 -3.911  -49.130 1.00 34.37  ? 32  CYS A CA    1 
ATOM   229  C C     . CYS A 1 32  ? 19.574 -3.775  -49.506 1.00 33.35  ? 32  CYS A C     1 
ATOM   230  O O     . CYS A 1 32  ? 19.041 -4.601  -50.239 1.00 33.50  ? 32  CYS A O     1 
ATOM   231  C CB    . CYS A 1 32  ? 21.918 -3.272  -50.209 1.00 35.39  ? 32  CYS A CB    1 
ATOM   232  S SG    . CYS A 1 32  ? 23.674 -3.151  -49.770 1.00 37.62  ? 32  CYS A SG    1 
ATOM   233  N N     . LEU A 1 33  ? 18.928 -2.737  -48.999 1.00 31.84  ? 33  LEU A N     1 
ATOM   234  C CA    . LEU A 1 33  ? 17.553 -2.456  -49.376 1.00 31.87  ? 33  LEU A CA    1 
ATOM   235  C C     . LEU A 1 33  ? 17.513 -2.036  -50.837 1.00 31.80  ? 33  LEU A C     1 
ATOM   236  O O     . LEU A 1 33  ? 16.606 -2.418  -51.580 1.00 31.21  ? 33  LEU A O     1 
ATOM   237  C CB    . LEU A 1 33  ? 16.966 -1.364  -48.489 1.00 31.90  ? 33  LEU A CB    1 
ATOM   238  C CG    . LEU A 1 33  ? 16.860 -1.777  -47.022 1.00 32.73  ? 33  LEU A CG    1 
ATOM   239  C CD1   . LEU A 1 33  ? 16.362 -0.647  -46.166 1.00 32.93  ? 33  LEU A CD1   1 
ATOM   240  C CD2   . LEU A 1 33  ? 15.925 -2.977  -46.924 1.00 34.08  ? 33  LEU A CD2   1 
ATOM   241  N N     . SER A 1 34  ? 18.511 -1.247  -51.240 1.00 30.33  ? 34  SER A N     1 
ATOM   242  C CA    . SER A 1 34  ? 18.651 -0.852  -52.628 1.00 29.82  ? 34  SER A CA    1 
ATOM   243  C C     . SER A 1 34  ? 20.040 -0.263  -52.867 1.00 29.25  ? 34  SER A C     1 
ATOM   244  O O     . SER A 1 34  ? 20.818 -0.087  -51.933 1.00 27.56  ? 34  SER A O     1 
ATOM   245  C CB    . SER A 1 34  ? 17.588 0.177   -53.001 1.00 29.61  ? 34  SER A CB    1 
ATOM   246  O OG    . SER A 1 34  ? 17.799 1.374   -52.284 1.00 30.28  ? 34  SER A OG    1 
ATOM   247  N N     . GLN A 1 35  ? 20.336 0.012   -54.135 1.00 29.13  ? 35  GLN A N     1 
ATOM   248  C CA    . GLN A 1 35  ? 21.589 0.627   -54.529 1.00 29.56  ? 35  GLN A CA    1 
ATOM   249  C C     . GLN A 1 35  ? 21.305 1.541   -55.707 1.00 28.74  ? 35  GLN A C     1 
ATOM   250  O O     . GLN A 1 35  ? 20.616 1.139   -56.632 1.00 29.04  ? 35  GLN A O     1 
ATOM   251  C CB    . GLN A 1 35  ? 22.601 -0.439  -54.937 1.00 29.75  ? 35  GLN A CB    1 
ATOM   252  C CG    . GLN A 1 35  ? 24.053 0.054   -54.940 1.00 30.74  ? 35  GLN A CG    1 
ATOM   253  C CD    . GLN A 1 35  ? 25.054 -1.086  -55.083 1.00 31.03  ? 35  GLN A CD    1 
ATOM   254  O OE1   . GLN A 1 35  ? 25.500 -1.373  -56.183 1.00 33.06  ? 35  GLN A OE1   1 
ATOM   255  N NE2   . GLN A 1 35  ? 25.389 -1.754  -53.971 1.00 32.18  ? 35  GLN A NE2   1 
ATOM   256  N N     . ARG A 1 36  ? 21.823 2.765   -55.665 1.00 27.79  ? 36  ARG A N     1 
ATOM   257  C CA    . ARG A 1 36  ? 21.619 3.721   -56.753 1.00 27.70  ? 36  ARG A CA    1 
ATOM   258  C C     . ARG A 1 36  ? 22.888 4.548   -57.018 1.00 26.25  ? 36  ARG A C     1 
ATOM   259  O O     . ARG A 1 36  ? 23.754 4.687   -56.156 1.00 23.71  ? 36  ARG A O     1 
ATOM   260  C CB    . ARG A 1 36  ? 20.429 4.649   -56.449 1.00 27.92  ? 36  ARG A CB    1 
ATOM   261  C CG    . ARG A 1 36  ? 20.659 5.661   -55.302 1.00 29.86  ? 36  ARG A CG    1 
ATOM   262  C CD    . ARG A 1 36  ? 19.391 6.510   -55.019 1.00 30.90  ? 36  ARG A CD    1 
ATOM   263  N NE    . ARG A 1 36  ? 19.683 7.773   -54.320 1.00 32.95  ? 36  ARG A NE    1 
ATOM   264  C CZ    . ARG A 1 36  ? 19.615 7.943   -52.997 1.00 34.51  ? 36  ARG A CZ    1 
ATOM   265  N NH1   . ARG A 1 36  ? 19.270 6.933   -52.207 1.00 35.62  ? 36  ARG A NH1   1 
ATOM   266  N NH2   . ARG A 1 36  ? 19.897 9.127   -52.452 1.00 35.06  ? 36  ARG A NH2   1 
ATOM   267  N N     . TRP A 1 37  ? 22.980 5.066   -58.234 1.00 25.99  ? 37  TRP A N     1 
ATOM   268  C CA    . TRP A 1 37  ? 23.974 6.043   -58.623 1.00 26.41  ? 37  TRP A CA    1 
ATOM   269  C C     . TRP A 1 37  ? 23.365 7.419   -58.402 1.00 26.28  ? 37  TRP A C     1 
ATOM   270  O O     . TRP A 1 37  ? 22.175 7.632   -58.651 1.00 27.71  ? 37  TRP A O     1 
ATOM   271  C CB    . TRP A 1 37  ? 24.307 5.871   -60.105 1.00 27.45  ? 37  TRP A CB    1 
ATOM   272  C CG    . TRP A 1 37  ? 25.286 4.799   -60.385 1.00 27.91  ? 37  TRP A CG    1 
ATOM   273  C CD1   . TRP A 1 37  ? 25.612 3.740   -59.578 1.00 27.65  ? 37  TRP A CD1   1 
ATOM   274  C CD2   . TRP A 1 37  ? 26.076 4.656   -61.581 1.00 28.36  ? 37  TRP A CD2   1 
ATOM   275  N NE1   . TRP A 1 37  ? 26.568 2.955   -60.192 1.00 28.25  ? 37  TRP A NE1   1 
ATOM   276  C CE2   . TRP A 1 37  ? 26.869 3.491   -61.422 1.00 28.49  ? 37  TRP A CE2   1 
ATOM   277  C CE3   . TRP A 1 37  ? 26.194 5.403   -62.768 1.00 28.41  ? 37  TRP A CE3   1 
ATOM   278  C CZ2   . TRP A 1 37  ? 27.782 3.058   -62.406 1.00 28.65  ? 37  TRP A CZ2   1 
ATOM   279  C CZ3   . TRP A 1 37  ? 27.090 4.969   -63.756 1.00 28.07  ? 37  TRP A CZ3   1 
ATOM   280  C CH2   . TRP A 1 37  ? 27.880 3.808   -63.561 1.00 28.19  ? 37  TRP A CH2   1 
ATOM   281  N N     . GLN A 1 38  ? 24.168 8.355   -57.914 1.00 25.12  ? 38  GLN A N     1 
ATOM   282  C CA    . GLN A 1 38  ? 23.718 9.730   -57.749 1.00 24.49  ? 38  GLN A CA    1 
ATOM   283  C C     . GLN A 1 38  ? 24.933 10.604  -58.049 1.00 22.89  ? 38  GLN A C     1 
ATOM   284  O O     . GLN A 1 38  ? 26.042 10.315  -57.585 1.00 21.73  ? 38  GLN A O     1 
ATOM   285  C CB    . GLN A 1 38  ? 23.206 9.949   -56.318 1.00 25.72  ? 38  GLN A CB    1 
ATOM   286  C CG    . GLN A 1 38  ? 22.732 11.379  -55.934 1.00 27.44  ? 38  GLN A CG    1 
ATOM   287  C CD    . GLN A 1 38  ? 22.008 11.427  -54.557 1.00 27.75  ? 38  GLN A CD    1 
ATOM   288  O OE1   . GLN A 1 38  ? 20.991 10.762  -54.357 1.00 29.72  ? 38  GLN A OE1   1 
ATOM   289  N NE2   . GLN A 1 38  ? 22.531 12.219  -53.625 1.00 27.80  ? 38  GLN A NE2   1 
ATOM   290  N N     . ARG A 1 39  ? 24.744 11.641  -58.857 1.00 20.79  ? 39  ARG A N     1 
ATOM   291  C CA    . ARG A 1 39  ? 25.788 12.634  -59.013 1.00 20.06  ? 39  ARG A CA    1 
ATOM   292  C C     . ARG A 1 39  ? 26.090 13.261  -57.659 1.00 18.56  ? 39  ARG A C     1 
ATOM   293  O O     . ARG A 1 39  ? 25.191 13.653  -56.928 1.00 19.59  ? 39  ARG A O     1 
ATOM   294  C CB    . ARG A 1 39  ? 25.379 13.744  -59.971 1.00 19.74  ? 39  ARG A CB    1 
ATOM   295  C CG    . ARG A 1 39  ? 26.421 14.852  -60.019 1.00 19.62  ? 39  ARG A CG    1 
ATOM   296  C CD    . ARG A 1 39  ? 26.151 15.826  -61.143 1.00 19.69  ? 39  ARG A CD    1 
ATOM   297  N NE    . ARG A 1 39  ? 24.789 16.334  -61.058 1.00 19.05  ? 39  ARG A NE    1 
ATOM   298  C CZ    . ARG A 1 39  ? 24.436 17.438  -60.405 1.00 18.81  ? 39  ARG A CZ    1 
ATOM   299  N NH1   . ARG A 1 39  ? 25.351 18.165  -59.750 1.00 17.65  ? 39  ARG A NH1   1 
ATOM   300  N NH2   . ARG A 1 39  ? 23.156 17.810  -60.398 1.00 17.86  ? 39  ARG A NH2   1 
ATOM   301  N N     . GLY A 1 40  ? 27.360 13.392  -57.346 1.00 18.51  ? 40  GLY A N     1 
ATOM   302  C CA    . GLY A 1 40  ? 27.772 13.994  -56.083 1.00 18.29  ? 40  GLY A CA    1 
ATOM   303  C C     . GLY A 1 40  ? 28.943 14.944  -56.267 1.00 18.58  ? 40  GLY A C     1 
ATOM   304  O O     . GLY A 1 40  ? 29.173 15.460  -57.367 1.00 17.45  ? 40  GLY A O     1 
ATOM   305  N N     . GLY A 1 41  ? 29.684 15.172  -55.188 1.00 17.68  ? 41  GLY A N     1 
ATOM   306  C CA    . GLY A 1 41  ? 30.729 16.193  -55.149 1.00 17.70  ? 41  GLY A CA    1 
ATOM   307  C C     . GLY A 1 41  ? 30.157 17.433  -54.489 1.00 18.36  ? 41  GLY A C     1 
ATOM   308  O O     . GLY A 1 41  ? 28.995 17.802  -54.750 1.00 19.28  ? 41  GLY A O     1 
ATOM   309  N N     . ASN A 1 42  ? 30.941 18.081  -53.633 1.00 17.77  ? 42  ASN A N     1 
ATOM   310  C CA    . ASN A 1 42  ? 30.439 19.234  -52.881 1.00 19.94  ? 42  ASN A CA    1 
ATOM   311  C C     . ASN A 1 42  ? 29.900 20.384  -53.740 1.00 19.50  ? 42  ASN A C     1 
ATOM   312  O O     . ASN A 1 42  ? 28.728 20.743  -53.647 1.00 20.11  ? 42  ASN A O     1 
ATOM   313  C CB    . ASN A 1 42  ? 31.497 19.820  -51.942 1.00 20.04  ? 42  ASN A CB    1 
ATOM   314  C CG    . ASN A 1 42  ? 31.978 18.849  -50.930 1.00 21.99  ? 42  ASN A CG    1 
ATOM   315  O OD1   . ASN A 1 42  ? 31.980 17.642  -51.153 1.00 23.05  ? 42  ASN A OD1   1 
ATOM   316  N ND2   . ASN A 1 42  ? 32.450 19.366  -49.811 1.00 24.05  ? 42  ASN A ND2   1 
ATOM   317  N N     . ALA A 1 43  ? 30.779 21.005  -54.508 1.00 19.48  ? 43  ALA A N     1 
ATOM   318  C CA    . ALA A 1 43  ? 30.386 22.117  -55.376 1.00 20.53  ? 43  ALA A CA    1 
ATOM   319  C C     . ALA A 1 43  ? 29.315 21.669  -56.371 1.00 20.98  ? 43  ALA A C     1 
ATOM   320  O O     . ALA A 1 43  ? 28.410 22.441  -56.738 1.00 22.44  ? 43  ALA A O     1 
ATOM   321  C CB    . ALA A 1 43  ? 31.584 22.632  -56.123 1.00 19.16  ? 43  ALA A CB    1 
ATOM   322  N N     . SER A 1 44  ? 29.446 20.435  -56.845 1.00 20.05  ? 44  SER A N     1 
ATOM   323  C CA    . SER A 1 44  ? 28.448 19.856  -57.747 1.00 19.08  ? 44  SER A CA    1 
ATOM   324  C C     . SER A 1 44  ? 27.051 19.733  -57.098 1.00 18.60  ? 44  SER A C     1 
ATOM   325  O O     . SER A 1 44  ? 26.048 20.032  -57.719 1.00 19.12  ? 44  SER A O     1 
ATOM   326  C CB    . SER A 1 44  ? 28.952 18.515  -58.283 1.00 18.40  ? 44  SER A CB    1 
ATOM   327  O OG    . SER A 1 44  ? 27.884 17.642  -58.590 1.00 17.97  ? 44  SER A OG    1 
ATOM   328  N N     . ASN A 1 45  ? 26.979 19.281  -55.856 1.00 19.36  ? 45  ASN A N     1 
ATOM   329  C CA    . ASN A 1 45  ? 25.697 19.206  -55.153 1.00 19.27  ? 45  ASN A CA    1 
ATOM   330  C C     . ASN A 1 45  ? 25.135 20.613  -54.890 1.00 20.69  ? 45  ASN A C     1 
ATOM   331  O O     . ASN A 1 45  ? 23.912 20.849  -54.995 1.00 20.17  ? 45  ASN A O     1 
ATOM   332  C CB    . ASN A 1 45  ? 25.849 18.446  -53.823 1.00 19.42  ? 45  ASN A CB    1 
ATOM   333  C CG    . ASN A 1 45  ? 25.935 16.935  -54.013 1.00 19.23  ? 45  ASN A CG    1 
ATOM   334  O OD1   . ASN A 1 45  ? 25.549 16.417  -55.065 1.00 20.08  ? 45  ASN A OD1   1 
ATOM   335  N ND2   . ASN A 1 45  ? 26.446 16.227  -53.005 1.00 17.71  ? 45  ASN A ND2   1 
ATOM   336  N N     . SER A 1 46  ? 26.024 21.549  -54.550 1.00 20.05  ? 46  SER A N     1 
ATOM   337  C CA    . SER A 1 46  ? 25.608 22.947  -54.375 1.00 21.05  ? 46  SER A CA    1 
ATOM   338  C C     . SER A 1 46  ? 24.965 23.549  -55.638 1.00 20.67  ? 46  SER A C     1 
ATOM   339  O O     . SER A 1 46  ? 23.999 24.289  -55.519 1.00 19.30  ? 46  SER A O     1 
ATOM   340  C CB    . SER A 1 46  ? 26.771 23.814  -53.862 1.00 20.36  ? 46  SER A CB    1 
ATOM   341  O OG    . SER A 1 46  ? 27.086 23.416  -52.516 1.00 20.86  ? 46  SER A OG    1 
ATOM   342  N N     . CYS A 1 47  ? 25.495 23.236  -56.827 1.00 21.12  ? 47  CYS A N     1 
ATOM   343  C CA    . CYS A 1 47  ? 24.855 23.654  -58.093 1.00 22.53  ? 47  CYS A CA    1 
ATOM   344  C C     . CYS A 1 47  ? 23.462 23.098  -58.228 1.00 21.77  ? 47  CYS A C     1 
ATOM   345  O O     . CYS A 1 47  ? 22.569 23.777  -58.709 1.00 22.56  ? 47  CYS A O     1 
ATOM   346  C CB    . CYS A 1 47  ? 25.650 23.193  -59.317 1.00 23.85  ? 47  CYS A CB    1 
ATOM   347  S SG    . CYS A 1 47  ? 26.998 24.250  -59.726 1.00 28.58  ? 47  CYS A SG    1 
ATOM   348  N N     . THR A 1 48  ? 23.288 21.838  -57.834 1.00 21.69  ? 48  THR A N     1 
ATOM   349  C CA    . THR A 1 48  ? 21.994 21.203  -57.876 1.00 19.58  ? 48  THR A CA    1 
ATOM   350  C C     . THR A 1 48  ? 21.003 22.014  -57.056 1.00 20.76  ? 48  THR A C     1 
ATOM   351  O O     . THR A 1 48  ? 19.903 22.338  -57.521 1.00 19.74  ? 48  THR A O     1 
ATOM   352  C CB    . THR A 1 48  ? 22.058 19.762  -57.358 1.00 18.69  ? 48  THR A CB    1 
ATOM   353  O OG1   . THR A 1 48  ? 23.049 19.040  -58.103 1.00 18.43  ? 48  THR A OG1   1 
ATOM   354  C CG2   . THR A 1 48  ? 20.691 19.067  -57.487 1.00 17.60  ? 48  THR A CG2   1 
ATOM   355  N N     . VAL A 1 49  ? 21.398 22.379  -55.844 1.00 19.81  ? 49  VAL A N     1 
ATOM   356  C CA    . VAL A 1 49  ? 20.481 23.068  -54.952 1.00 19.19  ? 49  VAL A CA    1 
ATOM   357  C C     . VAL A 1 49  ? 20.228 24.495  -55.435 1.00 19.77  ? 49  VAL A C     1 
ATOM   358  O O     . VAL A 1 49  ? 19.082 24.956  -55.428 1.00 20.23  ? 49  VAL A O     1 
ATOM   359  C CB    . VAL A 1 49  ? 20.993 23.013  -53.479 1.00 19.83  ? 49  VAL A CB    1 
ATOM   360  C CG1   . VAL A 1 49  ? 20.157 23.927  -52.555 1.00 18.47  ? 49  VAL A CG1   1 
ATOM   361  C CG2   . VAL A 1 49  ? 20.986 21.553  -52.987 1.00 18.43  ? 49  VAL A CG2   1 
ATOM   362  N N     . LEU A 1 50  ? 21.277 25.186  -55.891 1.00 20.22  ? 50  LEU A N     1 
ATOM   363  C CA    . LEU A 1 50  ? 21.122 26.554  -56.416 1.00 20.34  ? 50  LEU A CA    1 
ATOM   364  C C     . LEU A 1 50  ? 20.178 26.548  -57.618 1.00 21.91  ? 50  LEU A C     1 
ATOM   365  O O     . LEU A 1 50  ? 19.294 27.393  -57.742 1.00 22.03  ? 50  LEU A O     1 
ATOM   366  C CB    . LEU A 1 50  ? 22.475 27.126  -56.846 1.00 19.98  ? 50  LEU A CB    1 
ATOM   367  C CG    . LEU A 1 50  ? 23.471 27.612  -55.786 1.00 20.38  ? 50  LEU A CG    1 
ATOM   368  C CD1   . LEU A 1 50  ? 24.823 27.859  -56.478 1.00 19.95  ? 50  LEU A CD1   1 
ATOM   369  C CD2   . LEU A 1 50  ? 22.979 28.857  -55.051 1.00 19.77  ? 50  LEU A CD2   1 
ATOM   370  N N     . SER A 1 51  ? 20.356 25.578  -58.505 1.00 23.05  ? 51  SER A N     1 
ATOM   371  C CA    . SER A 1 51  ? 19.448 25.433  -59.644 1.00 24.90  ? 51  SER A CA    1 
ATOM   372  C C     . SER A 1 51  ? 18.000 25.245  -59.151 1.00 24.69  ? 51  SER A C     1 
ATOM   373  O O     . SER A 1 51  ? 17.083 25.916  -59.617 1.00 25.39  ? 51  SER A O     1 
ATOM   374  C CB    . SER A 1 51  ? 19.919 24.290  -60.554 1.00 26.83  ? 51  SER A CB    1 
ATOM   375  O OG    . SER A 1 51  ? 18.909 23.912  -61.497 1.00 32.41  ? 51  SER A OG    1 
ATOM   376  N N     . LEU A 1 52  ? 17.802 24.378  -58.168 1.00 23.87  ? 52  LEU A N     1 
ATOM   377  C CA    . LEU A 1 52  ? 16.470 24.117  -57.627 1.00 23.95  ? 52  LEU A CA    1 
ATOM   378  C C     . LEU A 1 52  ? 15.842 25.365  -56.979 1.00 24.67  ? 52  LEU A C     1 
ATOM   379  O O     . LEU A 1 52  ? 14.622 25.572  -57.065 1.00 24.46  ? 52  LEU A O     1 
ATOM   380  C CB    . LEU A 1 52  ? 16.508 22.946  -56.627 1.00 24.08  ? 52  LEU A CB    1 
ATOM   381  C CG    . LEU A 1 52  ? 16.667 21.502  -57.159 1.00 24.76  ? 52  LEU A CG    1 
ATOM   382  C CD1   . LEU A 1 52  ? 16.971 20.517  -56.019 1.00 24.86  ? 52  LEU A CD1   1 
ATOM   383  C CD2   . LEU A 1 52  ? 15.434 21.011  -57.950 1.00 24.13  ? 52  LEU A CD2   1 
ATOM   384  N N     . LEU A 1 53  ? 16.675 26.190  -56.340 1.00 23.88  ? 53  LEU A N     1 
ATOM   385  C CA    . LEU A 1 53  ? 16.217 27.431  -55.711 1.00 23.91  ? 53  LEU A CA    1 
ATOM   386  C C     . LEU A 1 53  ? 15.918 28.521  -56.736 1.00 24.45  ? 53  LEU A C     1 
ATOM   387  O O     . LEU A 1 53  ? 15.334 29.533  -56.401 1.00 24.66  ? 53  LEU A O     1 
ATOM   388  C CB    . LEU A 1 53  ? 17.255 27.956  -54.714 1.00 22.81  ? 53  LEU A CB    1 
ATOM   389  C CG    . LEU A 1 53  ? 17.470 27.068  -53.493 1.00 23.12  ? 53  LEU A CG    1 
ATOM   390  C CD1   . LEU A 1 53  ? 18.624 27.598  -52.609 1.00 22.50  ? 53  LEU A CD1   1 
ATOM   391  C CD2   . LEU A 1 53  ? 16.170 26.917  -52.697 1.00 22.14  ? 53  LEU A CD2   1 
ATOM   392  N N     . GLY A 1 54  ? 16.339 28.313  -57.976 1.00 26.17  ? 54  GLY A N     1 
ATOM   393  C CA    . GLY A 1 54  ? 16.032 29.233  -59.059 1.00 26.49  ? 54  GLY A CA    1 
ATOM   394  C C     . GLY A 1 54  ? 17.172 30.148  -59.446 1.00 27.90  ? 54  GLY A C     1 
ATOM   395  O O     . GLY A 1 54  ? 16.964 31.132  -60.163 1.00 28.28  ? 54  GLY A O     1 
ATOM   396  N N     . ALA A 1 55  ? 18.385 29.844  -58.989 1.00 27.28  ? 55  ALA A N     1 
ATOM   397  C CA    . ALA A 1 55  ? 19.548 30.626  -59.406 1.00 27.05  ? 55  ALA A CA    1 
ATOM   398  C C     . ALA A 1 55  ? 20.267 30.030  -60.618 1.00 27.56  ? 55  ALA A C     1 
ATOM   399  O O     . ALA A 1 55  ? 20.742 28.900  -60.559 1.00 28.20  ? 55  ALA A O     1 
ATOM   400  C CB    . ALA A 1 55  ? 20.525 30.777  -58.242 1.00 27.88  ? 55  ALA A CB    1 
ATOM   401  N N     . PRO A 1 56  ? 20.347 30.787  -61.731 1.00 27.52  ? 56  PRO A N     1 
ATOM   402  C CA    . PRO A 1 56  ? 21.208 30.379  -62.842 1.00 27.67  ? 56  PRO A CA    1 
ATOM   403  C C     . PRO A 1 56  ? 22.623 30.117  -62.328 1.00 26.95  ? 56  PRO A C     1 
ATOM   404  O O     . PRO A 1 56  ? 23.171 30.929  -61.587 1.00 27.18  ? 56  PRO A O     1 
ATOM   405  C CB    . PRO A 1 56  ? 21.223 31.614  -63.754 1.00 28.47  ? 56  PRO A CB    1 
ATOM   406  C CG    . PRO A 1 56  ? 19.973 32.348  -63.445 1.00 28.81  ? 56  PRO A CG    1 
ATOM   407  C CD    . PRO A 1 56  ? 19.627 32.046  -62.008 1.00 28.55  ? 56  PRO A CD    1 
ATOM   408  N N     . CYS A 1 57  ? 23.215 28.995  -62.707 1.00 26.05  ? 57  CYS A N     1 
ATOM   409  C CA    . CYS A 1 57  ? 24.547 28.688  -62.230 1.00 25.51  ? 57  CYS A CA    1 
ATOM   410  C C     . CYS A 1 57  ? 25.341 27.871  -63.237 1.00 24.78  ? 57  CYS A C     1 
ATOM   411  O O     . CYS A 1 57  ? 24.798 27.303  -64.200 1.00 24.09  ? 57  CYS A O     1 
ATOM   412  C CB    . CYS A 1 57  ? 24.501 28.013  -60.840 1.00 27.01  ? 57  CYS A CB    1 
ATOM   413  S SG    . CYS A 1 57  ? 23.627 26.446  -60.802 1.00 30.07  ? 57  CYS A SG    1 
ATOM   414  N N     . ALA A 1 58  ? 26.645 27.856  -63.019 1.00 22.66  ? 58  ALA A N     1 
ATOM   415  C CA    . ALA A 1 58  ? 27.581 27.203  -63.890 1.00 21.56  ? 58  ALA A CA    1 
ATOM   416  C C     . ALA A 1 58  ? 28.462 26.359  -63.003 1.00 21.45  ? 58  ALA A C     1 
ATOM   417  O O     . ALA A 1 58  ? 28.805 26.776  -61.895 1.00 22.36  ? 58  ALA A O     1 
ATOM   418  C CB    . ALA A 1 58  ? 28.412 28.230  -64.615 1.00 19.87  ? 58  ALA A CB    1 
ATOM   419  N N     . PHE A 1 59  ? 28.820 25.174  -63.479 1.00 21.14  ? 59  PHE A N     1 
ATOM   420  C CA    . PHE A 1 59  ? 29.768 24.336  -62.767 1.00 22.40  ? 59  PHE A CA    1 
ATOM   421  C C     . PHE A 1 59  ? 31.081 24.219  -63.555 1.00 21.28  ? 59  PHE A C     1 
ATOM   422  O O     . PHE A 1 59  ? 31.065 24.011  -64.763 1.00 20.06  ? 59  PHE A O     1 
ATOM   423  C CB    . PHE A 1 59  ? 29.174 22.937  -62.498 1.00 23.17  ? 59  PHE A CB    1 
ATOM   424  C CG    . PHE A 1 59  ? 30.144 22.008  -61.812 1.00 24.06  ? 59  PHE A CG    1 
ATOM   425  C CD1   . PHE A 1 59  ? 30.334 22.070  -60.428 1.00 23.58  ? 59  PHE A CD1   1 
ATOM   426  C CD2   . PHE A 1 59  ? 30.908 21.117  -62.552 1.00 23.85  ? 59  PHE A CD2   1 
ATOM   427  C CE1   . PHE A 1 59  ? 31.261 21.230  -59.798 1.00 23.72  ? 59  PHE A CE1   1 
ATOM   428  C CE2   . PHE A 1 59  ? 31.816 20.275  -61.930 1.00 24.24  ? 59  PHE A CE2   1 
ATOM   429  C CZ    . PHE A 1 59  ? 31.997 20.342  -60.551 1.00 24.13  ? 59  PHE A CZ    1 
ATOM   430  N N     . MET A 1 60  ? 32.206 24.352  -62.863 1.00 21.23  ? 60  MET A N     1 
ATOM   431  C CA    . MET A 1 60  ? 33.529 24.149  -63.455 1.00 21.31  ? 60  MET A CA    1 
ATOM   432  C C     . MET A 1 60  ? 34.298 23.067  -62.702 1.00 21.88  ? 60  MET A C     1 
ATOM   433  O O     . MET A 1 60  ? 34.644 23.231  -61.530 1.00 22.26  ? 60  MET A O     1 
ATOM   434  C CB    . MET A 1 60  ? 34.340 25.456  -63.484 1.00 21.83  ? 60  MET A CB    1 
ATOM   435  C CG    . MET A 1 60  ? 35.772 25.314  -64.105 1.00 22.48  ? 60  MET A CG    1 
ATOM   436  S SD    . MET A 1 60  ? 36.688 26.873  -64.242 1.00 22.57  ? 60  MET A SD    1 
ATOM   437  C CE    . MET A 1 60  ? 38.020 26.451  -65.368 1.00 22.56  ? 60  MET A CE    1 
ATOM   438  N N     . GLY A 1 61  ? 34.566 21.953  -63.383 1.00 22.15  ? 61  GLY A N     1 
ATOM   439  C CA    . GLY A 1 61  ? 35.345 20.860  -62.821 1.00 21.64  ? 61  GLY A CA    1 
ATOM   440  C C     . GLY A 1 61  ? 35.977 20.011  -63.916 1.00 22.81  ? 61  GLY A C     1 
ATOM   441  O O     . GLY A 1 61  ? 35.631 20.131  -65.099 1.00 21.46  ? 61  GLY A O     1 
ATOM   442  N N     . SER A 1 62  ? 36.923 19.170  -63.521 1.00 22.60  ? 62  SER A N     1 
ATOM   443  C CA    . SER A 1 62  ? 37.537 18.233  -64.446 1.00 23.37  ? 62  SER A CA    1 
ATOM   444  C C     . SER A 1 62  ? 36.547 17.146  -64.799 1.00 23.77  ? 62  SER A C     1 
ATOM   445  O O     . SER A 1 62  ? 35.654 16.820  -64.006 1.00 20.47  ? 62  SER A O     1 
ATOM   446  C CB    . SER A 1 62  ? 38.788 17.616  -63.849 1.00 22.38  ? 62  SER A CB    1 
ATOM   447  O OG    . SER A 1 62  ? 39.816 18.578  -63.766 1.00 22.46  ? 62  SER A OG    1 
ATOM   448  N N     . MET A 1 63  ? 36.721 16.588  -65.999 1.00 25.16  ? 63  MET A N     1 
ATOM   449  C CA    . MET A 1 63  ? 35.883 15.495  -66.491 1.00 26.42  ? 63  MET A CA    1 
ATOM   450  C C     . MET A 1 63  ? 36.701 14.533  -67.373 1.00 27.99  ? 63  MET A C     1 
ATOM   451  O O     . MET A 1 63  ? 37.609 14.952  -68.102 1.00 27.96  ? 63  MET A O     1 
ATOM   452  C CB    . MET A 1 63  ? 34.690 16.062  -67.245 1.00 27.30  ? 63  MET A CB    1 
ATOM   453  C CG    . MET A 1 63  ? 33.631 15.039  -67.631 1.00 29.23  ? 63  MET A CG    1 
ATOM   454  S SD    . MET A 1 63  ? 33.070 14.042  -66.225 1.00 30.66  ? 63  MET A SD    1 
ATOM   455  C CE    . MET A 1 63  ? 32.413 15.301  -65.141 1.00 29.31  ? 63  MET A CE    1 
ATOM   456  N N     . ALA A 1 64  ? 36.416 13.238  -67.261 1.00 28.63  ? 64  ALA A N     1 
ATOM   457  C CA    . ALA A 1 64  ? 37.010 12.219  -68.137 1.00 28.23  ? 64  ALA A CA    1 
ATOM   458  C C     . ALA A 1 64  ? 35.883 11.531  -68.891 1.00 28.43  ? 64  ALA A C     1 
ATOM   459  O O     . ALA A 1 64  ? 35.012 10.915  -68.271 1.00 28.83  ? 64  ALA A O     1 
ATOM   460  C CB    . ALA A 1 64  ? 37.770 11.219  -67.330 1.00 28.72  ? 64  ALA A CB    1 
ATOM   461  N N     . PRO A 1 65  ? 35.887 11.631  -70.232 1.00 27.41  ? 65  PRO A N     1 
ATOM   462  C CA    . PRO A 1 65  ? 34.819 11.076  -71.053 1.00 25.97  ? 65  PRO A CA    1 
ATOM   463  C C     . PRO A 1 65  ? 34.602 9.583   -70.789 1.00 24.84  ? 65  PRO A C     1 
ATOM   464  O O     . PRO A 1 65  ? 35.520 8.874   -70.387 1.00 24.77  ? 65  PRO A O     1 
ATOM   465  C CB    . PRO A 1 65  ? 35.335 11.301  -72.490 1.00 26.45  ? 65  PRO A CB    1 
ATOM   466  C CG    . PRO A 1 65  ? 36.193 12.501  -72.374 1.00 27.23  ? 65  PRO A CG    1 
ATOM   467  C CD    . PRO A 1 65  ? 36.922 12.279  -71.062 1.00 27.82  ? 65  PRO A CD    1 
ATOM   468  N N     . GLY A 1 66  ? 33.390 9.112   -71.021 1.00 24.22  ? 66  GLY A N     1 
ATOM   469  C CA    . GLY A 1 66  ? 33.066 7.738   -70.704 1.00 24.65  ? 66  GLY A CA    1 
ATOM   470  C C     . GLY A 1 66  ? 31.629 7.734   -70.258 1.00 25.06  ? 66  GLY A C     1 
ATOM   471  O O     . GLY A 1 66  ? 30.976 8.781   -70.278 1.00 24.09  ? 66  GLY A O     1 
ATOM   472  N N     . HIS A 1 67  ? 31.136 6.568   -69.845 1.00 25.64  ? 67  HIS A N     1 
ATOM   473  C CA    . HIS A 1 67  ? 29.731 6.415   -69.483 1.00 25.71  ? 67  HIS A CA    1 
ATOM   474  C C     . HIS A 1 67  ? 29.399 7.040   -68.139 1.00 24.10  ? 67  HIS A C     1 
ATOM   475  O O     . HIS A 1 67  ? 28.292 7.516   -67.949 1.00 23.88  ? 67  HIS A O     1 
ATOM   476  C CB    . HIS A 1 67  ? 29.314 4.937   -69.503 1.00 30.15  ? 67  HIS A CB    1 
ATOM   477  C CG    . HIS A 1 67  ? 29.097 4.394   -70.886 1.00 33.82  ? 67  HIS A CG    1 
ATOM   478  N ND1   . HIS A 1 67  ? 28.649 5.180   -71.932 1.00 35.42  ? 67  HIS A ND1   1 
ATOM   479  C CD2   . HIS A 1 67  ? 29.253 3.147   -71.393 1.00 35.16  ? 67  HIS A CD2   1 
ATOM   480  C CE1   . HIS A 1 67  ? 28.548 4.441   -73.024 1.00 35.77  ? 67  HIS A CE1   1 
ATOM   481  N NE2   . HIS A 1 67  ? 28.911 3.206   -72.725 1.00 36.26  ? 67  HIS A NE2   1 
ATOM   482  N N     . VAL A 1 68  ? 30.346 7.007   -67.203 1.00 23.13  ? 68  VAL A N     1 
ATOM   483  C CA    . VAL A 1 68  ? 30.156 7.710   -65.929 1.00 23.54  ? 68  VAL A CA    1 
ATOM   484  C C     . VAL A 1 68  ? 30.031 9.219   -66.196 1.00 22.92  ? 68  VAL A C     1 
ATOM   485  O O     . VAL A 1 68  ? 29.036 9.832   -65.828 1.00 22.36  ? 68  VAL A O     1 
ATOM   486  C CB    . VAL A 1 68  ? 31.278 7.397   -64.911 1.00 22.90  ? 68  VAL A CB    1 
ATOM   487  C CG1   . VAL A 1 68  ? 31.162 8.289   -63.681 1.00 23.51  ? 68  VAL A CG1   1 
ATOM   488  C CG2   . VAL A 1 68  ? 31.220 5.936   -64.492 1.00 21.48  ? 68  VAL A CG2   1 
ATOM   489  N N     . ALA A 1 69  ? 31.011 9.784   -66.906 1.00 22.84  ? 69  ALA A N     1 
ATOM   490  C CA    . ALA A 1 69  ? 30.919 11.164  -67.406 1.00 22.34  ? 69  ALA A CA    1 
ATOM   491  C C     . ALA A 1 69  ? 29.548 11.473  -67.953 1.00 22.48  ? 69  ALA A C     1 
ATOM   492  O O     . ALA A 1 69  ? 28.933 12.486  -67.574 1.00 23.06  ? 69  ALA A O     1 
ATOM   493  C CB    . ALA A 1 69  ? 32.019 11.449  -68.480 1.00 22.13  ? 69  ALA A CB    1 
ATOM   494  N N     . ASP A 1 70  ? 29.045 10.614  -68.839 1.00 22.51  ? 70  ASP A N     1 
ATOM   495  C CA    . ASP A 1 70  ? 27.754 10.876  -69.487 1.00 22.89  ? 70  ASP A CA    1 
ATOM   496  C C     . ASP A 1 70  ? 26.625 10.888  -68.468 1.00 23.17  ? 70  ASP A C     1 
ATOM   497  O O     . ASP A 1 70  ? 25.683 11.690  -68.569 1.00 23.90  ? 70  ASP A O     1 
ATOM   498  C CB    . ASP A 1 70  ? 27.424 9.833   -70.571 1.00 23.81  ? 70  ASP A CB    1 
ATOM   499  C CG    . ASP A 1 70  ? 28.414 9.844   -71.750 1.00 26.84  ? 70  ASP A CG    1 
ATOM   500  O OD1   . ASP A 1 70  ? 29.228 10.802  -71.893 1.00 26.56  ? 70  ASP A OD1   1 
ATOM   501  O OD2   . ASP A 1 70  ? 28.384 8.859   -72.539 1.00 27.83  ? 70  ASP A OD2   1 
ATOM   502  N N     . PHE A 1 71  ? 26.687 9.975   -67.501 1.00 22.91  ? 71  PHE A N     1 
ATOM   503  C CA    . PHE A 1 71  ? 25.651 9.953   -66.456 1.00 23.02  ? 71  PHE A CA    1 
ATOM   504  C C     . PHE A 1 71  ? 25.611 11.284  -65.666 1.00 22.62  ? 71  PHE A C     1 
ATOM   505  O O     . PHE A 1 71  ? 24.562 11.907  -65.556 1.00 22.51  ? 71  PHE A O     1 
ATOM   506  C CB    . PHE A 1 71  ? 25.833 8.750   -65.522 1.00 23.47  ? 71  PHE A CB    1 
ATOM   507  C CG    . PHE A 1 71  ? 24.904 8.768   -64.322 1.00 23.46  ? 71  PHE A CG    1 
ATOM   508  C CD1   . PHE A 1 71  ? 23.591 8.351   -64.445 1.00 24.54  ? 71  PHE A CD1   1 
ATOM   509  C CD2   . PHE A 1 71  ? 25.354 9.215   -63.086 1.00 23.17  ? 71  PHE A CD2   1 
ATOM   510  C CE1   . PHE A 1 71  ? 22.723 8.372   -63.338 1.00 25.45  ? 71  PHE A CE1   1 
ATOM   511  C CE2   . PHE A 1 71  ? 24.500 9.253   -61.977 1.00 23.91  ? 71  PHE A CE2   1 
ATOM   512  C CZ    . PHE A 1 71  ? 23.180 8.822   -62.111 1.00 23.58  ? 71  PHE A CZ    1 
ATOM   513  N N     . VAL A 1 72  ? 26.758 11.720  -65.157 1.00 22.99  ? 72  VAL A N     1 
ATOM   514  C CA    . VAL A 1 72  ? 26.829 12.952  -64.355 1.00 23.65  ? 72  VAL A CA    1 
ATOM   515  C C     . VAL A 1 72  ? 26.619 14.237  -65.167 1.00 24.71  ? 72  VAL A C     1 
ATOM   516  O O     . VAL A 1 72  ? 25.964 15.171  -64.685 1.00 24.83  ? 72  VAL A O     1 
ATOM   517  C CB    . VAL A 1 72  ? 28.127 13.045  -63.498 1.00 23.51  ? 72  VAL A CB    1 
ATOM   518  C CG1   . VAL A 1 72  ? 28.254 11.839  -62.540 1.00 23.27  ? 72  VAL A CG1   1 
ATOM   519  C CG2   . VAL A 1 72  ? 29.352 13.179  -64.366 1.00 23.12  ? 72  VAL A CG2   1 
ATOM   520  N N     . LEU A 1 73  ? 27.144 14.294  -66.401 1.00 24.75  ? 73  LEU A N     1 
ATOM   521  C CA    . LEU A 1 73  ? 26.927 15.480  -67.239 1.00 23.98  ? 73  LEU A CA    1 
ATOM   522  C C     . LEU A 1 73  ? 25.489 15.573  -67.685 1.00 23.89  ? 73  LEU A C     1 
ATOM   523  O O     . LEU A 1 73  ? 24.899 16.648  -67.672 1.00 23.43  ? 73  LEU A O     1 
ATOM   524  C CB    . LEU A 1 73  ? 27.885 15.530  -68.449 1.00 24.67  ? 73  LEU A CB    1 
ATOM   525  C CG    . LEU A 1 73  ? 29.357 15.707  -68.068 1.00 25.27  ? 73  LEU A CG    1 
ATOM   526  C CD1   . LEU A 1 73  ? 30.312 15.523  -69.258 1.00 26.15  ? 73  LEU A CD1   1 
ATOM   527  C CD2   . LEU A 1 73  ? 29.605 17.050  -67.383 1.00 26.66  ? 73  LEU A CD2   1 
ATOM   528  N N     . ASP A 1 74  ? 24.906 14.440  -68.059 1.00 24.20  ? 74  ASP A N     1 
ATOM   529  C CA    . ASP A 1 74  ? 23.483 14.405  -68.359 1.00 24.55  ? 74  ASP A CA    1 
ATOM   530  C C     . ASP A 1 74  ? 22.699 14.911  -67.148 1.00 24.01  ? 74  ASP A C     1 
ATOM   531  O O     . ASP A 1 74  ? 21.676 15.599  -67.280 1.00 23.60  ? 74  ASP A O     1 
ATOM   532  C CB    . ASP A 1 74  ? 23.041 12.964  -68.732 1.00 27.76  ? 74  ASP A CB    1 
ATOM   533  C CG    . ASP A 1 74  ? 23.428 12.563  -70.202 1.00 31.76  ? 74  ASP A CG    1 
ATOM   534  O OD1   . ASP A 1 74  ? 24.194 13.310  -70.875 1.00 32.75  ? 74  ASP A OD1   1 
ATOM   535  O OD2   . ASP A 1 74  ? 22.965 11.490  -70.689 1.00 32.99  ? 74  ASP A OD2   1 
ATOM   536  N N     . ASP A 1 75  ? 23.161 14.560  -65.953 1.00 21.96  ? 75  ASP A N     1 
ATOM   537  C CA    . ASP A 1 75  ? 22.411 14.946  -64.756 1.00 22.35  ? 75  ASP A CA    1 
ATOM   538  C C     . ASP A 1 75  ? 22.484 16.449  -64.527 1.00 21.14  ? 75  ASP A C     1 
ATOM   539  O O     . ASP A 1 75  ? 21.475 17.086  -64.266 1.00 22.06  ? 75  ASP A O     1 
ATOM   540  C CB    . ASP A 1 75  ? 22.881 14.182  -63.512 1.00 22.38  ? 75  ASP A CB    1 
ATOM   541  C CG    . ASP A 1 75  ? 22.009 14.483  -62.304 1.00 24.39  ? 75  ASP A CG    1 
ATOM   542  O OD1   . ASP A 1 75  ? 22.425 15.328  -61.482 1.00 24.07  ? 75  ASP A OD1   1 
ATOM   543  O OD2   . ASP A 1 75  ? 20.875 13.947  -62.227 1.00 24.45  ? 75  ASP A OD2   1 
ATOM   544  N N     . LEU A 1 76  ? 23.674 17.014  -64.653 1.00 21.73  ? 76  LEU A N     1 
ATOM   545  C CA    . LEU A 1 76  ? 23.844 18.475  -64.577 1.00 22.86  ? 76  LEU A CA    1 
ATOM   546  C C     . LEU A 1 76  ? 23.007 19.215  -65.632 1.00 24.73  ? 76  LEU A C     1 
ATOM   547  O O     . LEU A 1 76  ? 22.381 20.234  -65.328 1.00 24.54  ? 76  LEU A O     1 
ATOM   548  C CB    . LEU A 1 76  ? 25.321 18.831  -64.720 1.00 21.53  ? 76  LEU A CB    1 
ATOM   549  C CG    . LEU A 1 76  ? 26.169 18.638  -63.457 1.00 21.23  ? 76  LEU A CG    1 
ATOM   550  C CD1   . LEU A 1 76  ? 27.586 18.282  -63.811 1.00 20.31  ? 76  LEU A CD1   1 
ATOM   551  C CD2   . LEU A 1 76  ? 26.128 19.903  -62.578 1.00 18.94  ? 76  LEU A CD2   1 
ATOM   552  N N     . ARG A 1 77  ? 22.994 18.729  -66.872 1.00 26.85  ? 77  ARG A N     1 
ATOM   553  C CA    . ARG A 1 77  ? 22.147 19.324  -67.926 1.00 29.26  ? 77  ARG A CA    1 
ATOM   554  C C     . ARG A 1 77  ? 20.681 19.336  -67.550 1.00 29.45  ? 77  ARG A C     1 
ATOM   555  O O     . ARG A 1 77  ? 19.986 20.319  -67.798 1.00 29.77  ? 77  ARG A O     1 
ATOM   556  C CB    . ARG A 1 77  ? 22.345 18.637  -69.280 1.00 29.90  ? 77  ARG A CB    1 
ATOM   557  C CG    . ARG A 1 77  ? 23.687 18.915  -69.897 1.00 31.47  ? 77  ARG A CG    1 
ATOM   558  C CD    . ARG A 1 77  ? 23.660 18.850  -71.472 1.00 32.52  ? 77  ARG A CD    1 
ATOM   559  N NE    . ARG A 1 77  ? 24.091 17.512  -71.859 1.00 35.63  ? 77  ARG A NE    1 
ATOM   560  C CZ    . ARG A 1 77  ? 25.287 16.979  -71.621 1.00 36.24  ? 77  ARG A CZ    1 
ATOM   561  N NH1   . ARG A 1 77  ? 26.367 17.739  -71.509 1.00 37.28  ? 77  ARG A NH1   1 
ATOM   562  N NH2   . ARG A 1 77  ? 25.386 15.668  -71.477 1.00 36.18  ? 77  ARG A NH2   1 
ATOM   563  N N     . ARG A 1 78  ? 20.191 18.239  -66.912 1.00 30.58  ? 78  ARG A N     1 
ATOM   564  C CA    . ARG A 1 78  ? 18.805 18.219  -66.425 1.00 31.18  ? 78  ARG A CA    1 
ATOM   565  C C     . ARG A 1 78  ? 18.499 19.381  -65.493 1.00 29.78  ? 78  ARG A C     1 
ATOM   566  O O     . ARG A 1 78  ? 17.345 19.770  -65.352 1.00 29.74  ? 78  ARG A O     1 
ATOM   567  C CB    . ARG A 1 78  ? 18.479 16.921  -65.669 1.00 32.53  ? 78  ARG A CB    1 
ATOM   568  C CG    . ARG A 1 78  ? 18.384 15.682  -66.511 1.00 35.82  ? 78  ARG A CG    1 
ATOM   569  C CD    . ARG A 1 78  ? 17.666 14.542  -65.743 1.00 36.12  ? 78  ARG A CD    1 
ATOM   570  N NE    . ARG A 1 78  ? 18.239 14.289  -64.411 1.00 38.99  ? 78  ARG A NE    1 
ATOM   571  C CZ    . ARG A 1 78  ? 17.647 14.596  -63.254 1.00 40.13  ? 78  ARG A CZ    1 
ATOM   572  N NH1   . ARG A 1 78  ? 16.456 15.181  -63.245 1.00 40.58  ? 78  ARG A NH1   1 
ATOM   573  N NH2   . ARG A 1 78  ? 18.248 14.318  -62.096 1.00 41.12  ? 78  ARG A NH2   1 
ATOM   574  N N     . TYR A 1 79  ? 19.512 19.896  -64.802 1.00 28.25  ? 79  TYR A N     1 
ATOM   575  C CA    . TYR A 1 79  ? 19.286 20.990  -63.861 1.00 27.06  ? 79  TYR A CA    1 
ATOM   576  C C     . TYR A 1 79  ? 19.580 22.342  -64.490 1.00 27.57  ? 79  TYR A C     1 
ATOM   577  O O     . TYR A 1 79  ? 19.559 23.372  -63.804 1.00 27.69  ? 79  TYR A O     1 
ATOM   578  C CB    . TYR A 1 79  ? 20.102 20.799  -62.575 1.00 25.90  ? 79  TYR A CB    1 
ATOM   579  C CG    . TYR A 1 79  ? 19.500 19.741  -61.702 1.00 25.39  ? 79  TYR A CG    1 
ATOM   580  C CD1   . TYR A 1 79  ? 19.904 18.425  -61.812 1.00 25.47  ? 79  TYR A CD1   1 
ATOM   581  C CD2   . TYR A 1 79  ? 18.489 20.048  -60.795 1.00 25.06  ? 79  TYR A CD2   1 
ATOM   582  C CE1   . TYR A 1 79  ? 19.321 17.427  -61.034 1.00 25.90  ? 79  TYR A CE1   1 
ATOM   583  C CE2   . TYR A 1 79  ? 17.919 19.074  -60.008 1.00 25.01  ? 79  TYR A CE2   1 
ATOM   584  C CZ    . TYR A 1 79  ? 18.340 17.760  -60.142 1.00 26.02  ? 79  TYR A CZ    1 
ATOM   585  O OH    . TYR A 1 79  ? 17.787 16.770  -59.373 1.00 26.66  ? 79  TYR A OH    1 
ATOM   586  N N     . SER A 1 80  ? 19.856 22.330  -65.794 1.00 27.51  ? 80  SER A N     1 
ATOM   587  C CA    . SER A 1 80  ? 20.158 23.552  -66.525 1.00 27.65  ? 80  SER A CA    1 
ATOM   588  C C     . SER A 1 80  ? 21.408 24.226  -65.990 1.00 27.62  ? 80  SER A C     1 
ATOM   589  O O     . SER A 1 80  ? 21.525 25.448  -66.020 1.00 27.72  ? 80  SER A O     1 
ATOM   590  C CB    . SER A 1 80  ? 18.980 24.526  -66.447 1.00 29.28  ? 80  SER A CB    1 
ATOM   591  O OG    . SER A 1 80  ? 17.808 23.971  -67.034 1.00 31.03  ? 80  SER A OG    1 
ATOM   592  N N     . VAL A 1 81  ? 22.343 23.433  -65.485 1.00 26.89  ? 81  VAL A N     1 
ATOM   593  C CA    . VAL A 1 81  ? 23.617 23.971  -65.037 1.00 26.39  ? 81  VAL A CA    1 
ATOM   594  C C     . VAL A 1 81  ? 24.533 24.157  -66.238 1.00 27.28  ? 81  VAL A C     1 
ATOM   595  O O     . VAL A 1 81  ? 24.750 23.215  -66.987 1.00 28.21  ? 81  VAL A O     1 
ATOM   596  C CB    . VAL A 1 81  ? 24.303 23.035  -64.015 1.00 24.24  ? 81  VAL A CB    1 
ATOM   597  C CG1   . VAL A 1 81  ? 25.683 23.557  -63.681 1.00 22.91  ? 81  VAL A CG1   1 
ATOM   598  C CG2   . VAL A 1 81  ? 23.449 22.894  -62.782 1.00 22.13  ? 81  VAL A CG2   1 
ATOM   599  N N     . ASP A 1 82  ? 25.067 25.367  -66.403 1.00 28.11  ? 82  ASP A N     1 
ATOM   600  C CA    . ASP A 1 82  ? 25.974 25.706  -67.512 1.00 28.61  ? 82  ASP A CA    1 
ATOM   601  C C     . ASP A 1 82  ? 27.308 24.975  -67.424 1.00 28.06  ? 82  ASP A C     1 
ATOM   602  O O     . ASP A 1 82  ? 28.023 25.088  -66.415 1.00 29.26  ? 82  ASP A O     1 
ATOM   603  C CB    . ASP A 1 82  ? 26.202 27.227  -67.569 1.00 29.24  ? 82  ASP A CB    1 
ATOM   604  C CG    . ASP A 1 82  ? 26.940 27.673  -68.840 1.00 30.61  ? 82  ASP A CG    1 
ATOM   605  O OD1   . ASP A 1 82  ? 27.971 27.089  -69.206 1.00 31.72  ? 82  ASP A OD1   1 
ATOM   606  O OD2   . ASP A 1 82  ? 26.512 28.653  -69.462 1.00 32.76  ? 82  ASP A OD2   1 
ATOM   607  N N     . LEU A 1 83  ? 27.654 24.249  -68.487 1.00 26.94  ? 83  LEU A N     1 
ATOM   608  C CA    . LEU A 1 83  ? 28.814 23.340  -68.482 1.00 27.16  ? 83  LEU A CA    1 
ATOM   609  C C     . LEU A 1 83  ? 29.945 23.835  -69.399 1.00 26.88  ? 83  LEU A C     1 
ATOM   610  O O     . LEU A 1 83  ? 30.904 23.121  -69.712 1.00 25.67  ? 83  LEU A O     1 
ATOM   611  C CB    . LEU A 1 83  ? 28.369 21.922  -68.866 1.00 26.80  ? 83  LEU A CB    1 
ATOM   612  C CG    . LEU A 1 83  ? 27.537 21.199  -67.795 1.00 27.56  ? 83  LEU A CG    1 
ATOM   613  C CD1   . LEU A 1 83  ? 27.106 19.829  -68.274 1.00 26.45  ? 83  LEU A CD1   1 
ATOM   614  C CD2   . LEU A 1 83  ? 28.306 21.086  -66.464 1.00 26.63  ? 83  LEU A CD2   1 
ATOM   615  N N     . ARG A 1 84  ? 29.817 25.085  -69.801 1.00 28.06  ? 84  ARG A N     1 
ATOM   616  C CA    . ARG A 1 84  ? 30.789 25.745  -70.662 1.00 29.58  ? 84  ARG A CA    1 
ATOM   617  C C     . ARG A 1 84  ? 32.220 25.492  -70.228 1.00 28.73  ? 84  ARG A C     1 
ATOM   618  O O     . ARG A 1 84  ? 33.113 25.273  -71.053 1.00 27.38  ? 84  ARG A O     1 
ATOM   619  C CB    . ARG A 1 84  ? 30.502 27.242  -70.641 1.00 31.23  ? 84  ARG A CB    1 
ATOM   620  C CG    . ARG A 1 84  ? 31.330 28.042  -71.579 1.00 32.99  ? 84  ARG A CG    1 
ATOM   621  C CD    . ARG A 1 84  ? 31.084 29.544  -71.370 1.00 33.84  ? 84  ARG A CD    1 
ATOM   622  N NE    . ARG A 1 84  ? 32.146 30.296  -72.024 1.00 34.59  ? 84  ARG A NE    1 
ATOM   623  C CZ    . ARG A 1 84  ? 32.133 31.608  -72.203 1.00 34.95  ? 84  ARG A CZ    1 
ATOM   624  N NH1   . ARG A 1 84  ? 31.099 32.323  -71.782 1.00 34.60  ? 84  ARG A NH1   1 
ATOM   625  N NH2   . ARG A 1 84  ? 33.155 32.193  -72.816 1.00 36.07  ? 84  ARG A NH2   1 
ATOM   626  N N     . TYR A 1 85  ? 32.452 25.517  -68.924 1.00 28.78  ? 85  TYR A N     1 
ATOM   627  C CA    . TYR A 1 85  ? 33.826 25.485  -68.436 1.00 29.11  ? 85  TYR A CA    1 
ATOM   628  C C     . TYR A 1 85  ? 34.267 24.103  -67.951 1.00 29.73  ? 85  TYR A C     1 
ATOM   629  O O     . TYR A 1 85  ? 35.254 23.987  -67.217 1.00 30.46  ? 85  TYR A O     1 
ATOM   630  C CB    . TYR A 1 85  ? 34.054 26.562  -67.366 1.00 30.04  ? 85  TYR A CB    1 
ATOM   631  C CG    . TYR A 1 85  ? 33.925 27.953  -67.932 1.00 30.58  ? 85  TYR A CG    1 
ATOM   632  C CD1   . TYR A 1 85  ? 32.900 28.801  -67.532 1.00 30.03  ? 85  TYR A CD1   1 
ATOM   633  C CD2   . TYR A 1 85  ? 34.807 28.404  -68.910 1.00 30.72  ? 85  TYR A CD2   1 
ATOM   634  C CE1   . TYR A 1 85  ? 32.774 30.077  -68.063 1.00 29.91  ? 85  TYR A CE1   1 
ATOM   635  C CE2   . TYR A 1 85  ? 34.686 29.679  -69.452 1.00 30.88  ? 85  TYR A CE2   1 
ATOM   636  C CZ    . TYR A 1 85  ? 33.666 30.499  -69.025 1.00 30.69  ? 85  TYR A CZ    1 
ATOM   637  O OH    . TYR A 1 85  ? 33.551 31.759  -69.563 1.00 32.07  ? 85  TYR A OH    1 
ATOM   638  N N     . THR A 1 86  ? 33.563 23.058  -68.369 1.00 29.11  ? 86  THR A N     1 
ATOM   639  C CA    . THR A 1 86  ? 34.060 21.705  -68.092 1.00 29.73  ? 86  THR A CA    1 
ATOM   640  C C     . THR A 1 86  ? 35.490 21.551  -68.600 1.00 29.78  ? 86  THR A C     1 
ATOM   641  O O     . THR A 1 86  ? 35.793 21.935  -69.733 1.00 30.09  ? 86  THR A O     1 
ATOM   642  C CB    . THR A 1 86  ? 33.165 20.622  -68.705 1.00 29.28  ? 86  THR A CB    1 
ATOM   643  O OG1   . THR A 1 86  ? 31.807 20.821  -68.284 1.00 29.71  ? 86  THR A OG1   1 
ATOM   644  C CG2   . THR A 1 86  ? 33.627 19.239  -68.250 1.00 30.08  ? 86  THR A CG2   1 
ATOM   645  N N     . VAL A 1 87  ? 36.385 21.026  -67.765 1.00 29.64  ? 87  VAL A N     1 
ATOM   646  C CA    . VAL A 1 87  ? 37.760 20.776  -68.207 1.00 30.62  ? 87  VAL A CA    1 
ATOM   647  C C     . VAL A 1 87  ? 37.966 19.293  -68.533 1.00 31.68  ? 87  VAL A C     1 
ATOM   648  O O     . VAL A 1 87  ? 38.165 18.469  -67.639 1.00 31.33  ? 87  VAL A O     1 
ATOM   649  C CB    . VAL A 1 87  ? 38.805 21.180  -67.161 1.00 30.42  ? 87  VAL A CB    1 
ATOM   650  C CG1   . VAL A 1 87  ? 40.188 21.117  -67.768 1.00 31.08  ? 87  VAL A CG1   1 
ATOM   651  C CG2   . VAL A 1 87  ? 38.536 22.575  -66.658 1.00 31.08  ? 87  VAL A CG2   1 
ATOM   652  N N     . PHE A 1 88  ? 37.911 18.952  -69.818 1.00 31.72  ? 88  PHE A N     1 
ATOM   653  C CA    . PHE A 1 88  ? 38.112 17.569  -70.217 1.00 31.37  ? 88  PHE A CA    1 
ATOM   654  C C     . PHE A 1 88  ? 39.565 17.138  -70.089 1.00 32.55  ? 88  PHE A C     1 
ATOM   655  O O     . PHE A 1 88  ? 40.470 17.842  -70.526 1.00 32.27  ? 88  PHE A O     1 
ATOM   656  C CB    . PHE A 1 88  ? 37.518 17.325  -71.601 1.00 30.51  ? 88  PHE A CB    1 
ATOM   657  C CG    . PHE A 1 88  ? 36.028 17.339  -71.591 1.00 29.02  ? 88  PHE A CG    1 
ATOM   658  C CD1   . PHE A 1 88  ? 35.333 18.510  -71.816 1.00 28.87  ? 88  PHE A CD1   1 
ATOM   659  C CD2   . PHE A 1 88  ? 35.323 16.193  -71.275 1.00 29.81  ? 88  PHE A CD2   1 
ATOM   660  C CE1   . PHE A 1 88  ? 33.959 18.539  -71.764 1.00 28.94  ? 88  PHE A CE1   1 
ATOM   661  C CE2   . PHE A 1 88  ? 33.940 16.202  -71.224 1.00 29.92  ? 88  PHE A CE2   1 
ATOM   662  C CZ    . PHE A 1 88  ? 33.252 17.378  -71.472 1.00 29.95  ? 88  PHE A CZ    1 
ATOM   663  N N     . GLN A 1 89  ? 39.780 16.010  -69.412 1.00 33.17  ? 89  GLN A N     1 
ATOM   664  C CA    . GLN A 1 89  ? 41.116 15.500  -69.169 1.00 35.02  ? 89  GLN A CA    1 
ATOM   665  C C     . GLN A 1 89  ? 41.298 14.244  -70.009 1.00 36.86  ? 89  GLN A C     1 
ATOM   666  O O     . GLN A 1 89  ? 40.330 13.554  -70.330 1.00 37.41  ? 89  GLN A O     1 
ATOM   667  C CB    . GLN A 1 89  ? 41.342 15.175  -67.688 1.00 34.87  ? 89  GLN A CB    1 
ATOM   668  C CG    . GLN A 1 89  ? 41.009 16.308  -66.708 1.00 35.12  ? 89  GLN A CG    1 
ATOM   669  C CD    . GLN A 1 89  ? 42.019 17.432  -66.746 1.00 35.62  ? 89  GLN A CD    1 
ATOM   670  O OE1   . GLN A 1 89  ? 43.064 17.328  -67.397 1.00 37.01  ? 89  GLN A OE1   1 
ATOM   671  N NE2   . GLN A 1 89  ? 41.723 18.514  -66.048 1.00 34.92  ? 89  GLN A NE2   1 
ATOM   672  N N     . THR A 1 90  ? 42.532 13.944  -70.379 1.00 38.87  ? 90  THR A N     1 
ATOM   673  C CA    . THR A 1 90  ? 42.752 12.814  -71.267 1.00 40.98  ? 90  THR A CA    1 
ATOM   674  C C     . THR A 1 90  ? 43.275 11.642  -70.464 1.00 41.91  ? 90  THR A C     1 
ATOM   675  O O     . THR A 1 90  ? 43.404 10.540  -70.990 1.00 43.80  ? 90  THR A O     1 
ATOM   676  C CB    . THR A 1 90  ? 43.717 13.162  -72.432 1.00 40.88  ? 90  THR A CB    1 
ATOM   677  O OG1   . THR A 1 90  ? 44.931 13.706  -71.907 1.00 40.53  ? 90  THR A OG1   1 
ATOM   678  C CG2   . THR A 1 90  ? 43.084 14.179  -73.339 1.00 40.95  ? 90  THR A CG2   1 
ATOM   679  N N     . THR A 1 91  ? 43.549 11.884  -69.185 1.00 41.74  ? 91  THR A N     1 
ATOM   680  C CA    . THR A 1 91  ? 43.966 10.838  -68.252 1.00 41.46  ? 91  THR A CA    1 
ATOM   681  C C     . THR A 1 91  ? 43.070 10.811  -66.991 1.00 40.96  ? 91  THR A C     1 
ATOM   682  O O     . THR A 1 91  ? 42.335 11.760  -66.730 1.00 40.57  ? 91  THR A O     1 
ATOM   683  C CB    . THR A 1 91  ? 45.399 11.076  -67.797 1.00 42.07  ? 91  THR A CB    1 
ATOM   684  O OG1   . THR A 1 91  ? 45.488 12.379  -67.205 1.00 42.65  ? 91  THR A OG1   1 
ATOM   685  C CG2   . THR A 1 91  ? 46.362 11.003  -68.999 1.00 42.89  ? 91  THR A CG2   1 
ATOM   686  N N     . GLY A 1 92  ? 43.149 9.725   -66.220 1.00 39.04  ? 92  GLY A N     1 
ATOM   687  C CA    . GLY A 1 92  ? 42.393 9.585   -64.972 1.00 37.05  ? 92  GLY A CA    1 
ATOM   688  C C     . GLY A 1 92  ? 40.915 9.382   -65.227 1.00 34.85  ? 92  GLY A C     1 
ATOM   689  O O     . GLY A 1 92  ? 40.482 9.326   -66.369 1.00 35.34  ? 92  GLY A O     1 
ATOM   690  N N     . SER A 1 93  ? 40.125 9.269   -64.165 1.00 33.36  ? 93  SER A N     1 
ATOM   691  C CA    . SER A 1 93  ? 38.683 9.106   -64.337 1.00 31.16  ? 93  SER A CA    1 
ATOM   692  C C     . SER A 1 93  ? 37.871 9.742   -63.201 1.00 29.08  ? 93  SER A C     1 
ATOM   693  O O     . SER A 1 93  ? 38.425 10.148  -62.174 1.00 28.51  ? 93  SER A O     1 
ATOM   694  C CB    . SER A 1 93  ? 38.336 7.623   -64.484 1.00 31.86  ? 93  SER A CB    1 
ATOM   695  O OG    . SER A 1 93  ? 39.024 6.888   -63.506 1.00 32.90  ? 93  SER A OG    1 
ATOM   696  N N     . VAL A 1 94  ? 36.563 9.843   -63.410 1.00 27.23  ? 94  VAL A N     1 
ATOM   697  C CA    . VAL A 1 94  ? 35.675 10.470  -62.433 1.00 26.05  ? 94  VAL A CA    1 
ATOM   698  C C     . VAL A 1 94  ? 35.792 9.671   -61.149 1.00 23.87  ? 94  VAL A C     1 
ATOM   699  O O     . VAL A 1 94  ? 35.607 8.469   -61.174 1.00 24.46  ? 94  VAL A O     1 
ATOM   700  C CB    . VAL A 1 94  ? 34.233 10.397  -62.907 1.00 26.20  ? 94  VAL A CB    1 
ATOM   701  C CG1   . VAL A 1 94  ? 33.273 11.056  -61.894 1.00 26.66  ? 94  VAL A CG1   1 
ATOM   702  C CG2   . VAL A 1 94  ? 34.098 11.020  -64.277 1.00 27.40  ? 94  VAL A CG2   1 
ATOM   703  N N     . PRO A 1 95  ? 36.083 10.331  -60.026 1.00 22.65  ? 95  PRO A N     1 
ATOM   704  C CA    . PRO A 1 95  ? 36.205 9.617   -58.770 1.00 22.80  ? 95  PRO A CA    1 
ATOM   705  C C     . PRO A 1 95  ? 34.875 8.994   -58.364 1.00 21.94  ? 95  PRO A C     1 
ATOM   706  O O     . PRO A 1 95  ? 33.827 9.421   -58.841 1.00 21.08  ? 95  PRO A O     1 
ATOM   707  C CB    . PRO A 1 95  ? 36.600 10.719  -57.770 1.00 22.47  ? 95  PRO A CB    1 
ATOM   708  C CG    . PRO A 1 95  ? 36.140 11.946  -58.356 1.00 21.41  ? 95  PRO A CG    1 
ATOM   709  C CD    . PRO A 1 95  ? 36.239 11.788  -59.845 1.00 22.74  ? 95  PRO A CD    1 
ATOM   710  N N     . ILE A 1 96  ? 34.953 7.984   -57.498 1.00 23.63  ? 96  ILE A N     1 
ATOM   711  C CA    . ILE A 1 96  ? 33.813 7.178   -57.074 1.00 23.49  ? 96  ILE A CA    1 
ATOM   712  C C     . ILE A 1 96  ? 33.770 7.271   -55.553 1.00 23.00  ? 96  ILE A C     1 
ATOM   713  O O     . ILE A 1 96  ? 34.802 7.119   -54.910 1.00 22.97  ? 96  ILE A O     1 
ATOM   714  C CB    . ILE A 1 96  ? 34.028 5.669   -57.397 1.00 24.40  ? 96  ILE A CB    1 
ATOM   715  C CG1   . ILE A 1 96  ? 34.223 5.421   -58.910 1.00 25.47  ? 96  ILE A CG1   1 
ATOM   716  C CG2   . ILE A 1 96  ? 32.878 4.822   -56.818 1.00 25.12  ? 96  ILE A CG2   1 
ATOM   717  C CD1   . ILE A 1 96  ? 33.053 5.912   -59.774 1.00 26.35  ? 96  ILE A CD1   1 
ATOM   718  N N     . ALA A 1 97  ? 32.592 7.521   -54.987 1.00 20.41  ? 97  ALA A N     1 
ATOM   719  C CA    . ALA A 1 97  ? 32.410 7.427   -53.543 1.00 19.52  ? 97  ALA A CA    1 
ATOM   720  C C     . ALA A 1 97  ? 31.379 6.350   -53.294 1.00 19.89  ? 97  ALA A C     1 
ATOM   721  O O     . ALA A 1 97  ? 30.315 6.311   -53.922 1.00 20.59  ? 97  ALA A O     1 
ATOM   722  C CB    . ALA A 1 97  ? 31.972 8.741   -52.957 1.00 19.83  ? 97  ALA A CB    1 
ATOM   723  N N     . THR A 1 98  ? 31.731 5.438   -52.409 1.00 19.07  ? 98  THR A N     1 
ATOM   724  C CA    . THR A 1 98  ? 30.891 4.345   -52.054 1.00 19.20  ? 98  THR A CA    1 
ATOM   725  C C     . THR A 1 98  ? 30.193 4.845   -50.805 1.00 18.76  ? 98  THR A C     1 
ATOM   726  O O     . THR A 1 98  ? 30.842 5.142   -49.802 1.00 19.61  ? 98  THR A O     1 
ATOM   727  C CB    . THR A 1 98  ? 31.761 3.084   -51.781 1.00 20.40  ? 98  THR A CB    1 
ATOM   728  O OG1   . THR A 1 98  ? 32.362 2.657   -53.015 1.00 21.88  ? 98  THR A OG1   1 
ATOM   729  C CG2   . THR A 1 98  ? 30.934 1.948   -51.183 1.00 20.35  ? 98  THR A CG2   1 
ATOM   730  N N     . VAL A 1 99  ? 28.875 4.970   -50.868 1.00 17.45  ? 99  VAL A N     1 
ATOM   731  C CA    . VAL A 1 99  ? 28.143 5.616   -49.783 1.00 18.09  ? 99  VAL A CA    1 
ATOM   732  C C     . VAL A 1 99  ? 27.169 4.646   -49.143 1.00 18.43  ? 99  VAL A C     1 
ATOM   733  O O     . VAL A 1 99  ? 26.329 4.071   -49.818 1.00 19.56  ? 99  VAL A O     1 
ATOM   734  C CB    . VAL A 1 99  ? 27.363 6.891   -50.252 1.00 16.91  ? 99  VAL A CB    1 
ATOM   735  C CG1   . VAL A 1 99  ? 26.677 7.579   -49.051 1.00 16.34  ? 99  VAL A CG1   1 
ATOM   736  C CG2   . VAL A 1 99  ? 28.304 7.884   -50.960 1.00 16.46  ? 99  VAL A CG2   1 
ATOM   737  N N     . ILE A 1 100 ? 27.285 4.481   -47.832 1.00 18.70  ? 100 ILE A N     1 
ATOM   738  C CA    . ILE A 1 100 ? 26.373 3.639   -47.071 1.00 19.56  ? 100 ILE A CA    1 
ATOM   739  C C     . ILE A 1 100 ? 25.381 4.544   -46.356 1.00 19.89  ? 100 ILE A C     1 
ATOM   740  O O     . ILE A 1 100 ? 25.771 5.375   -45.538 1.00 21.15  ? 100 ILE A O     1 
ATOM   741  C CB    . ILE A 1 100 ? 27.120 2.800   -46.005 1.00 19.84  ? 100 ILE A CB    1 
ATOM   742  C CG1   . ILE A 1 100 ? 28.247 1.988   -46.651 1.00 20.12  ? 100 ILE A CG1   1 
ATOM   743  C CG2   . ILE A 1 100 ? 26.146 1.904   -45.243 1.00 19.70  ? 100 ILE A CG2   1 
ATOM   744  C CD1   . ILE A 1 100 ? 29.153 1.263   -45.668 1.00 20.55  ? 100 ILE A CD1   1 
ATOM   745  N N     . ILE A 1 101 ? 24.101 4.389   -46.671 1.00 20.96  ? 101 ILE A N     1 
ATOM   746  C CA    . ILE A 1 101 ? 23.067 5.161   -45.974 1.00 22.54  ? 101 ILE A CA    1 
ATOM   747  C C     . ILE A 1 101 ? 22.285 4.242   -45.041 1.00 22.52  ? 101 ILE A C     1 
ATOM   748  O O     . ILE A 1 101 ? 21.700 3.250   -45.471 1.00 23.14  ? 101 ILE A O     1 
ATOM   749  C CB    . ILE A 1 101 ? 22.153 5.914   -46.968 1.00 23.85  ? 101 ILE A CB    1 
ATOM   750  C CG1   . ILE A 1 101 ? 22.981 7.001   -47.675 1.00 24.36  ? 101 ILE A CG1   1 
ATOM   751  C CG2   . ILE A 1 101 ? 20.942 6.533   -46.243 1.00 24.57  ? 101 ILE A CG2   1 
ATOM   752  C CD1   . ILE A 1 101 ? 22.188 7.871   -48.611 1.00 26.09  ? 101 ILE A CD1   1 
ATOM   753  N N     . ASN A 1 102 ? 22.340 4.544   -43.754 1.00 23.10  ? 102 ASN A N     1 
ATOM   754  C CA    . ASN A 1 102 ? 21.602 3.781   -42.767 1.00 25.32  ? 102 ASN A CA    1 
ATOM   755  C C     . ASN A 1 102 ? 20.157 4.260   -42.745 1.00 27.77  ? 102 ASN A C     1 
ATOM   756  O O     . ASN A 1 102 ? 19.883 5.368   -42.283 1.00 27.70  ? 102 ASN A O     1 
ATOM   757  C CB    . ASN A 1 102 ? 22.263 3.922   -41.393 1.00 24.80  ? 102 ASN A CB    1 
ATOM   758  C CG    . ASN A 1 102 ? 21.501 3.197   -40.294 1.00 24.98  ? 102 ASN A CG    1 
ATOM   759  O OD1   . ASN A 1 102 ? 20.397 2.701   -40.507 1.00 24.93  ? 102 ASN A OD1   1 
ATOM   760  N ND2   . ASN A 1 102 ? 22.095 3.136   -39.112 1.00 23.96  ? 102 ASN A ND2   1 
ATOM   761  N N     . GLU A 1 103 ? 19.247 3.441   -43.268 1.00 30.85  ? 103 GLU A N     1 
ATOM   762  C CA    . GLU A 1 103 ? 17.826 3.808   -43.374 1.00 36.17  ? 103 GLU A CA    1 
ATOM   763  C C     . GLU A 1 103 ? 17.208 4.149   -42.007 1.00 37.15  ? 103 GLU A C     1 
ATOM   764  O O     . GLU A 1 103 ? 16.221 4.873   -41.932 1.00 38.74  ? 103 GLU A O     1 
ATOM   765  C CB    . GLU A 1 103 ? 17.016 2.678   -44.044 1.00 37.56  ? 103 GLU A CB    1 
ATOM   766  C CG    . GLU A 1 103 ? 15.540 3.023   -44.397 1.00 39.80  ? 103 GLU A CG    1 
ATOM   767  C CD    . GLU A 1 103 ? 14.631 1.789   -44.521 1.00 40.65  ? 103 GLU A CD    1 
ATOM   768  O OE1   . GLU A 1 103 ? 14.725 0.867   -43.673 1.00 42.99  ? 103 GLU A OE1   1 
ATOM   769  O OE2   . GLU A 1 103 ? 13.803 1.731   -45.466 1.00 42.99  ? 103 GLU A OE2   1 
ATOM   770  N N     . ALA A 1 104 ? 17.787 3.630   -40.931 1.00 37.62  ? 104 ALA A N     1 
ATOM   771  C CA    . ALA A 1 104 ? 17.243 3.862   -39.591 1.00 38.39  ? 104 ALA A CA    1 
ATOM   772  C C     . ALA A 1 104 ? 17.499 5.280   -39.062 1.00 38.48  ? 104 ALA A C     1 
ATOM   773  O O     . ALA A 1 104 ? 16.706 5.801   -38.278 1.00 39.71  ? 104 ALA A O     1 
ATOM   774  C CB    . ALA A 1 104 ? 17.768 2.813   -38.600 1.00 37.26  ? 104 ALA A CB    1 
ATOM   775  N N     . SER A 1 105 ? 18.592 5.906   -39.493 1.00 37.47  ? 105 SER A N     1 
ATOM   776  C CA    . SER A 1 105 ? 18.968 7.203   -38.961 1.00 36.43  ? 105 SER A CA    1 
ATOM   777  C C     . SER A 1 105 ? 19.240 8.262   -40.030 1.00 36.36  ? 105 SER A C     1 
ATOM   778  O O     . SER A 1 105 ? 19.429 9.443   -39.710 1.00 36.65  ? 105 SER A O     1 
ATOM   779  C CB    . SER A 1 105 ? 20.208 7.059   -38.090 1.00 37.00  ? 105 SER A CB    1 
ATOM   780  O OG    . SER A 1 105 ? 21.357 6.816   -38.888 1.00 36.72  ? 105 SER A OG    1 
ATOM   781  N N     . GLY A 1 106 ? 19.306 7.839   -41.290 1.00 35.12  ? 106 GLY A N     1 
ATOM   782  C CA    . GLY A 1 106 ? 19.720 8.727   -42.371 1.00 32.15  ? 106 GLY A CA    1 
ATOM   783  C C     . GLY A 1 106 ? 21.210 9.034   -42.427 1.00 30.46  ? 106 GLY A C     1 
ATOM   784  O O     . GLY A 1 106 ? 21.642 9.786   -43.285 1.00 31.18  ? 106 GLY A O     1 
ATOM   785  N N     . SER A 1 107 ? 22.007 8.465   -41.523 1.00 28.84  ? 107 SER A N     1 
ATOM   786  C CA    . SER A 1 107 ? 23.454 8.655   -41.570 1.00 27.71  ? 107 SER A CA    1 
ATOM   787  C C     . SER A 1 107 ? 24.042 8.322   -42.958 1.00 27.29  ? 107 SER A C     1 
ATOM   788  O O     . SER A 1 107 ? 23.472 7.545   -43.719 1.00 26.45  ? 107 SER A O     1 
ATOM   789  C CB    . SER A 1 107 ? 24.150 7.779   -40.527 1.00 27.72  ? 107 SER A CB    1 
ATOM   790  O OG    . SER A 1 107 ? 24.019 6.405   -40.871 1.00 27.68  ? 107 SER A OG    1 
ATOM   791  N N     . ARG A 1 108 ? 25.189 8.901   -43.281 1.00 26.69  ? 108 ARG A N     1 
ATOM   792  C CA    . ARG A 1 108 ? 25.852 8.521   -44.505 1.00 25.99  ? 108 ARG A CA    1 
ATOM   793  C C     . ARG A 1 108 ? 27.318 8.348   -44.189 1.00 24.94  ? 108 ARG A C     1 
ATOM   794  O O     . ARG A 1 108 ? 27.929 9.163   -43.504 1.00 24.46  ? 108 ARG A O     1 
ATOM   795  C CB    . ARG A 1 108 ? 25.594 9.500   -45.673 1.00 27.33  ? 108 ARG A CB    1 
ATOM   796  C CG    . ARG A 1 108 ? 26.662 10.540  -45.896 1.00 29.09  ? 108 ARG A CG    1 
ATOM   797  C CD    . ARG A 1 108 ? 26.518 11.636  -44.910 1.00 30.75  ? 108 ARG A CD    1 
ATOM   798  N NE    . ARG A 1 108 ? 27.529 12.676  -45.037 1.00 32.36  ? 108 ARG A NE    1 
ATOM   799  C CZ    . ARG A 1 108 ? 28.673 12.682  -44.365 1.00 32.53  ? 108 ARG A CZ    1 
ATOM   800  N NH1   . ARG A 1 108 ? 28.973 11.672  -43.573 1.00 32.66  ? 108 ARG A NH1   1 
ATOM   801  N NH2   . ARG A 1 108 ? 29.528 13.683  -44.504 1.00 32.63  ? 108 ARG A NH2   1 
ATOM   802  N N     . THR A 1 109 ? 27.857 7.230   -44.648 1.00 23.62  ? 109 THR A N     1 
ATOM   803  C CA    . THR A 1 109 ? 29.238 6.890   -44.397 1.00 23.10  ? 109 THR A CA    1 
ATOM   804  C C     . THR A 1 109 ? 29.860 6.682   -45.756 1.00 21.96  ? 109 THR A C     1 
ATOM   805  O O     . THR A 1 109 ? 29.329 5.940   -46.581 1.00 20.70  ? 109 THR A O     1 
ATOM   806  C CB    . THR A 1 109 ? 29.298 5.629   -43.564 1.00 23.31  ? 109 THR A CB    1 
ATOM   807  O OG1   . THR A 1 109 ? 28.491 5.829   -42.396 1.00 22.89  ? 109 THR A OG1   1 
ATOM   808  C CG2   . THR A 1 109 ? 30.765 5.245   -43.212 1.00 23.41  ? 109 THR A CG2   1 
ATOM   809  N N     . ILE A 1 110 ? 30.951 7.390   -45.997 1.00 22.45  ? 110 ILE A N     1 
ATOM   810  C CA    . ILE A 1 110 ? 31.475 7.569   -47.349 1.00 23.44  ? 110 ILE A CA    1 
ATOM   811  C C     . ILE A 1 110 ? 32.863 6.972   -47.428 1.00 23.29  ? 110 ILE A C     1 
ATOM   812  O O     . ILE A 1 110 ? 33.747 7.365   -46.668 1.00 23.43  ? 110 ILE A O     1 
ATOM   813  C CB    . ILE A 1 110 ? 31.580 9.080   -47.716 1.00 23.77  ? 110 ILE A CB    1 
ATOM   814  C CG1   . ILE A 1 110 ? 30.190 9.755   -47.688 1.00 24.36  ? 110 ILE A CG1   1 
ATOM   815  C CG2   . ILE A 1 110 ? 32.242 9.268   -49.088 1.00 23.95  ? 110 ILE A CG2   1 
ATOM   816  C CD1   . ILE A 1 110 ? 30.203 11.238  -48.045 1.00 23.37  ? 110 ILE A CD1   1 
ATOM   817  N N     . LEU A 1 111 ? 33.047 6.011   -48.327 1.00 22.87  ? 111 LEU A N     1 
ATOM   818  C CA    . LEU A 1 111 ? 34.373 5.494   -48.597 1.00 24.07  ? 111 LEU A CA    1 
ATOM   819  C C     . LEU A 1 111 ? 34.809 6.043   -49.943 1.00 25.08  ? 111 LEU A C     1 
ATOM   820  O O     . LEU A 1 111 ? 34.200 5.747   -50.987 1.00 23.72  ? 111 LEU A O     1 
ATOM   821  C CB    . LEU A 1 111 ? 34.415 3.970   -48.604 1.00 24.26  ? 111 LEU A CB    1 
ATOM   822  C CG    . LEU A 1 111 ? 33.665 3.129   -47.576 1.00 26.45  ? 111 LEU A CG    1 
ATOM   823  C CD1   . LEU A 1 111 ? 34.492 1.903   -47.210 1.00 26.43  ? 111 LEU A CD1   1 
ATOM   824  C CD2   . LEU A 1 111 ? 33.255 3.902   -46.340 1.00 27.02  ? 111 LEU A CD2   1 
ATOM   825  N N     . TYR A 1 112 ? 35.853 6.849   -49.913 1.00 25.20  ? 112 TYR A N     1 
ATOM   826  C CA    . TYR A 1 112 ? 36.213 7.632   -51.066 1.00 28.80  ? 112 TYR A CA    1 
ATOM   827  C C     . TYR A 1 112 ? 37.482 7.057   -51.694 1.00 30.23  ? 112 TYR A C     1 
ATOM   828  O O     . TYR A 1 112 ? 38.365 6.565   -51.008 1.00 28.98  ? 112 TYR A O     1 
ATOM   829  C CB    . TYR A 1 112 ? 36.406 9.082   -50.642 1.00 30.70  ? 112 TYR A CB    1 
ATOM   830  C CG    . TYR A 1 112 ? 36.555 10.059  -51.773 1.00 32.03  ? 112 TYR A CG    1 
ATOM   831  C CD1   . TYR A 1 112 ? 35.433 10.565  -52.437 1.00 32.60  ? 112 TYR A CD1   1 
ATOM   832  C CD2   . TYR A 1 112 ? 37.817 10.521  -52.163 1.00 32.67  ? 112 TYR A CD2   1 
ATOM   833  C CE1   . TYR A 1 112 ? 35.555 11.487  -53.475 1.00 32.15  ? 112 TYR A CE1   1 
ATOM   834  C CE2   . TYR A 1 112 ? 37.950 11.456  -53.206 1.00 32.91  ? 112 TYR A CE2   1 
ATOM   835  C CZ    . TYR A 1 112 ? 36.807 11.926  -53.841 1.00 32.50  ? 112 TYR A CZ    1 
ATOM   836  O OH    . TYR A 1 112 ? 36.920 12.826  -54.852 1.00 33.03  ? 112 TYR A OH    1 
ATOM   837  N N     . TYR A 1 113 ? 37.558 7.117   -53.011 1.00 33.89  ? 113 TYR A N     1 
ATOM   838  C CA    . TYR A 1 113 ? 38.624 6.448   -53.755 1.00 36.89  ? 113 TYR A CA    1 
ATOM   839  C C     . TYR A 1 113 ? 39.044 7.370   -54.891 1.00 39.28  ? 113 TYR A C     1 
ATOM   840  O O     . TYR A 1 113 ? 38.297 7.559   -55.872 1.00 38.16  ? 113 TYR A O     1 
ATOM   841  C CB    . TYR A 1 113 ? 38.116 5.098   -54.277 1.00 37.65  ? 113 TYR A CB    1 
ATOM   842  C CG    . TYR A 1 113 ? 39.062 4.373   -55.230 1.00 38.88  ? 113 TYR A CG    1 
ATOM   843  C CD1   . TYR A 1 113 ? 40.363 4.038   -54.832 1.00 38.86  ? 113 TYR A CD1   1 
ATOM   844  C CD2   . TYR A 1 113 ? 38.647 3.998   -56.522 1.00 38.19  ? 113 TYR A CD2   1 
ATOM   845  C CE1   . TYR A 1 113 ? 41.233 3.377   -55.684 1.00 38.47  ? 113 TYR A CE1   1 
ATOM   846  C CE2   . TYR A 1 113 ? 39.515 3.323   -57.384 1.00 38.66  ? 113 TYR A CE2   1 
ATOM   847  C CZ    . TYR A 1 113 ? 40.807 3.022   -56.954 1.00 38.54  ? 113 TYR A CZ    1 
ATOM   848  O OH    . TYR A 1 113 ? 41.692 2.357   -57.783 1.00 39.19  ? 113 TYR A OH    1 
ATOM   849  N N     . ASP A 1 114 ? 40.203 8.010   -54.722 1.00 41.61  ? 114 ASP A N     1 
ATOM   850  C CA    . ASP A 1 114 ? 40.760 8.860   -55.773 1.00 42.90  ? 114 ASP A CA    1 
ATOM   851  C C     . ASP A 1 114 ? 41.077 8.055   -57.025 1.00 43.64  ? 114 ASP A C     1 
ATOM   852  O O     . ASP A 1 114 ? 41.637 6.949   -56.957 1.00 43.68  ? 114 ASP A O     1 
ATOM   853  C CB    . ASP A 1 114 ? 42.027 9.560   -55.293 1.00 43.56  ? 114 ASP A CB    1 
ATOM   854  C CG    . ASP A 1 114 ? 42.485 10.643  -56.242 1.00 44.49  ? 114 ASP A CG    1 
ATOM   855  O OD1   . ASP A 1 114 ? 41.666 11.502  -56.613 1.00 45.05  ? 114 ASP A OD1   1 
ATOM   856  O OD2   . ASP A 1 114 ? 43.671 10.641  -56.633 1.00 46.25  ? 114 ASP A OD2   1 
ATOM   857  N N     . ARG A 1 115 ? 40.699 8.607   -58.175 1.00 44.85  ? 115 ARG A N     1 
ATOM   858  C CA    . ARG A 1 115 ? 41.098 8.034   -59.465 1.00 44.89  ? 115 ARG A CA    1 
ATOM   859  C C     . ARG A 1 115 ? 41.944 9.033   -60.280 1.00 44.31  ? 115 ARG A C     1 
ATOM   860  O O     . ARG A 1 115 ? 41.801 9.162   -61.510 1.00 43.89  ? 115 ARG A O     1 
ATOM   861  C CB    . ARG A 1 115 ? 39.890 7.489   -60.241 1.00 45.12  ? 115 ARG A CB    1 
ATOM   862  C CG    . ARG A 1 115 ? 39.196 6.311   -59.536 1.00 45.48  ? 115 ARG A CG    1 
ATOM   863  C CD    . ARG A 1 115 ? 38.374 5.439   -60.515 1.00 46.05  ? 115 ARG A CD    1 
ATOM   864  N NE    . ARG A 1 115 ? 37.233 6.145   -61.113 1.00 46.44  ? 115 ARG A NE    1 
ATOM   865  C CZ    . ARG A 1 115 ? 36.414 5.610   -62.026 1.00 47.00  ? 115 ARG A CZ    1 
ATOM   866  N NH1   . ARG A 1 115 ? 36.617 4.364   -62.448 1.00 47.12  ? 115 ARG A NH1   1 
ATOM   867  N NH2   . ARG A 1 115 ? 35.393 6.314   -62.517 1.00 47.15  ? 115 ARG A NH2   1 
ATOM   868  N N     . SER A 1 116 ? 42.807 9.760   -59.565 1.00 43.06  ? 116 SER A N     1 
ATOM   869  C CA    . SER A 1 116 ? 43.919 10.477  -60.204 1.00 41.75  ? 116 SER A CA    1 
ATOM   870  C C     . SER A 1 116 ? 43.527 11.377  -61.382 1.00 40.10  ? 116 SER A C     1 
ATOM   871  O O     . SER A 1 116 ? 44.378 11.692  -62.238 1.00 39.05  ? 116 SER A O     1 
ATOM   872  C CB    . SER A 1 116 ? 45.003 9.483   -60.659 1.00 42.54  ? 116 SER A CB    1 
ATOM   873  O OG    . SER A 1 116 ? 45.610 8.820   -59.554 1.00 43.29  ? 116 SER A OG    1 
ATOM   874  N N     . LEU A 1 117 ? 42.253 11.774  -61.438 1.00 36.94  ? 117 LEU A N     1 
ATOM   875  C CA    . LEU A 1 117 ? 41.823 12.766  -62.409 1.00 35.05  ? 117 LEU A CA    1 
ATOM   876  C C     . LEU A 1 117 ? 42.531 14.066  -62.060 1.00 33.50  ? 117 LEU A C     1 
ATOM   877  O O     . LEU A 1 117 ? 42.516 14.478  -60.906 1.00 34.08  ? 117 LEU A O     1 
ATOM   878  C CB    . LEU A 1 117 ? 40.305 12.962  -62.319 1.00 35.80  ? 117 LEU A CB    1 
ATOM   879  C CG    . LEU A 1 117 ? 39.561 13.931  -63.235 1.00 35.35  ? 117 LEU A CG    1 
ATOM   880  C CD1   . LEU A 1 117 ? 39.530 13.429  -64.662 1.00 35.18  ? 117 LEU A CD1   1 
ATOM   881  C CD2   . LEU A 1 117 ? 38.150 14.086  -62.719 1.00 34.74  ? 117 LEU A CD2   1 
ATOM   882  N N     . PRO A 1 118 ? 43.195 14.697  -63.039 1.00 32.23  ? 118 PRO A N     1 
ATOM   883  C CA    . PRO A 1 118 ? 43.830 15.975  -62.744 1.00 31.23  ? 118 PRO A CA    1 
ATOM   884  C C     . PRO A 1 118 ? 42.827 17.076  -62.365 1.00 29.86  ? 118 PRO A C     1 
ATOM   885  O O     . PRO A 1 118 ? 41.743 17.159  -62.938 1.00 28.65  ? 118 PRO A O     1 
ATOM   886  C CB    . PRO A 1 118 ? 44.561 16.323  -64.062 1.00 31.56  ? 118 PRO A CB    1 
ATOM   887  C CG    . PRO A 1 118 ? 44.721 14.997  -64.773 1.00 31.46  ? 118 PRO A CG    1 
ATOM   888  C CD    . PRO A 1 118 ? 43.445 14.262  -64.427 1.00 31.86  ? 118 PRO A CD    1 
ATOM   889  N N     . ASP A 1 119 ? 43.214 17.912  -61.408 1.00 29.51  ? 119 ASP A N     1 
ATOM   890  C CA    . ASP A 1 119 ? 42.393 19.021  -60.948 1.00 29.84  ? 119 ASP A CA    1 
ATOM   891  C C     . ASP A 1 119 ? 42.369 20.190  -61.932 1.00 30.64  ? 119 ASP A C     1 
ATOM   892  O O     . ASP A 1 119 ? 43.270 20.341  -62.759 1.00 31.15  ? 119 ASP A O     1 
ATOM   893  C CB    . ASP A 1 119 ? 42.904 19.514  -59.596 1.00 29.44  ? 119 ASP A CB    1 
ATOM   894  C CG    . ASP A 1 119 ? 42.543 18.574  -58.464 1.00 29.81  ? 119 ASP A CG    1 
ATOM   895  O OD1   . ASP A 1 119 ? 41.359 18.168  -58.394 1.00 28.59  ? 119 ASP A OD1   1 
ATOM   896  O OD2   . ASP A 1 119 ? 43.444 18.240  -57.660 1.00 29.41  ? 119 ASP A OD2   1 
ATOM   897  N N     . VAL A 1 120 ? 41.318 21.002  -61.837 1.00 30.14  ? 120 VAL A N     1 
ATOM   898  C CA    . VAL A 1 120 ? 41.236 22.283  -62.521 1.00 29.13  ? 120 VAL A CA    1 
ATOM   899  C C     . VAL A 1 120 ? 42.369 23.218  -62.069 1.00 30.16  ? 120 VAL A C     1 
ATOM   900  O O     . VAL A 1 120 ? 42.592 23.402  -60.873 1.00 29.31  ? 120 VAL A O     1 
ATOM   901  C CB    . VAL A 1 120 ? 39.875 22.951  -62.257 1.00 28.76  ? 120 VAL A CB    1 
ATOM   902  C CG1   . VAL A 1 120 ? 39.825 24.336  -62.889 1.00 27.80  ? 120 VAL A CG1   1 
ATOM   903  C CG2   . VAL A 1 120 ? 38.749 22.076  -62.781 1.00 27.50  ? 120 VAL A CG2   1 
ATOM   904  N N     . SER A 1 121 ? 43.082 23.811  -63.030 1.00 30.48  ? 121 SER A N     1 
ATOM   905  C CA    . SER A 1 121 ? 44.267 24.610  -62.709 1.00 30.72  ? 121 SER A CA    1 
ATOM   906  C C     . SER A 1 121 ? 44.013 26.100  -62.828 1.00 30.53  ? 121 SER A C     1 
ATOM   907  O O     . SER A 1 121 ? 43.030 26.535  -63.443 1.00 30.04  ? 121 SER A O     1 
ATOM   908  C CB    . SER A 1 121 ? 45.460 24.222  -63.605 1.00 31.69  ? 121 SER A CB    1 
ATOM   909  O OG    . SER A 1 121 ? 45.258 24.659  -64.940 1.00 31.33  ? 121 SER A OG    1 
ATOM   910  N N     . ALA A 1 122 ? 44.913 26.880  -62.235 1.00 30.37  ? 122 ALA A N     1 
ATOM   911  C CA    . ALA A 1 122 ? 44.836 28.338  -62.308 1.00 31.13  ? 122 ALA A CA    1 
ATOM   912  C C     . ALA A 1 122 ? 44.788 28.769  -63.764 1.00 30.72  ? 122 ALA A C     1 
ATOM   913  O O     . ALA A 1 122 ? 44.096 29.722  -64.122 1.00 30.08  ? 122 ALA A O     1 
ATOM   914  C CB    . ALA A 1 122 ? 46.026 28.966  -61.605 1.00 30.17  ? 122 ALA A CB    1 
ATOM   915  N N     . THR A 1 123 ? 45.517 28.035  -64.600 1.00 30.89  ? 123 THR A N     1 
ATOM   916  C CA    . THR A 1 123 ? 45.578 28.327  -66.032 1.00 31.68  ? 123 THR A CA    1 
ATOM   917  C C     . THR A 1 123 ? 44.263 28.023  -66.701 1.00 30.54  ? 123 THR A C     1 
ATOM   918  O O     . THR A 1 123 ? 43.789 28.798  -67.520 1.00 30.63  ? 123 THR A O     1 
ATOM   919  C CB    . THR A 1 123 ? 46.693 27.531  -66.706 1.00 32.92  ? 123 THR A CB    1 
ATOM   920  O OG1   . THR A 1 123 ? 47.940 27.918  -66.120 1.00 34.08  ? 123 THR A OG1   1 
ATOM   921  C CG2   . THR A 1 123 ? 46.724 27.833  -68.175 1.00 33.85  ? 123 THR A CG2   1 
ATOM   922  N N     . ASP A 1 124 ? 43.659 26.894  -66.339 1.00 30.92  ? 124 ASP A N     1 
ATOM   923  C CA    . ASP A 1 124 ? 42.285 26.612  -66.750 1.00 29.71  ? 124 ASP A CA    1 
ATOM   924  C C     . ASP A 1 124 ? 41.377 27.766  -66.345 1.00 28.75  ? 124 ASP A C     1 
ATOM   925  O O     . ASP A 1 124 ? 40.555 28.215  -67.131 1.00 28.42  ? 124 ASP A O     1 
ATOM   926  C CB    . ASP A 1 124 ? 41.779 25.313  -66.112 1.00 30.26  ? 124 ASP A CB    1 
ATOM   927  C CG    . ASP A 1 124 ? 42.473 24.088  -66.649 1.00 30.90  ? 124 ASP A CG    1 
ATOM   928  O OD1   . ASP A 1 124 ? 42.809 24.077  -67.855 1.00 31.15  ? 124 ASP A OD1   1 
ATOM   929  O OD2   . ASP A 1 124 ? 42.682 23.128  -65.863 1.00 31.59  ? 124 ASP A OD2   1 
ATOM   930  N N     . PHE A 1 125 ? 41.526 28.251  -65.117 1.00 28.88  ? 125 PHE A N     1 
ATOM   931  C CA    . PHE A 1 125 ? 40.613 29.288  -64.611 1.00 29.91  ? 125 PHE A CA    1 
ATOM   932  C C     . PHE A 1 125 ? 40.785 30.647  -65.327 1.00 31.19  ? 125 PHE A C     1 
ATOM   933  O O     . PHE A 1 125 ? 39.830 31.412  -65.473 1.00 29.34  ? 125 PHE A O     1 
ATOM   934  C CB    . PHE A 1 125 ? 40.715 29.434  -63.076 1.00 28.06  ? 125 PHE A CB    1 
ATOM   935  C CG    . PHE A 1 125 ? 39.710 30.399  -62.486 1.00 27.11  ? 125 PHE A CG    1 
ATOM   936  C CD1   . PHE A 1 125 ? 38.419 29.989  -62.202 1.00 26.96  ? 125 PHE A CD1   1 
ATOM   937  C CD2   . PHE A 1 125 ? 40.059 31.716  -62.216 1.00 26.86  ? 125 PHE A CD2   1 
ATOM   938  C CE1   . PHE A 1 125 ? 37.481 30.872  -61.659 1.00 26.31  ? 125 PHE A CE1   1 
ATOM   939  C CE2   . PHE A 1 125 ? 39.127 32.617  -61.674 1.00 26.58  ? 125 PHE A CE2   1 
ATOM   940  C CZ    . PHE A 1 125 ? 37.833 32.193  -61.409 1.00 27.02  ? 125 PHE A CZ    1 
ATOM   941  N N     . GLU A 1 126 ? 42.000 30.934  -65.791 1.00 34.74  ? 126 GLU A N     1 
ATOM   942  C CA    . GLU A 1 126 ? 42.255 32.180  -66.541 1.00 37.25  ? 126 GLU A CA    1 
ATOM   943  C C     . GLU A 1 126 ? 41.305 32.375  -67.728 1.00 37.60  ? 126 GLU A C     1 
ATOM   944  O O     . GLU A 1 126 ? 41.032 33.502  -68.131 1.00 37.67  ? 126 GLU A O     1 
ATOM   945  C CB    . GLU A 1 126 ? 43.713 32.246  -67.004 1.00 39.58  ? 126 GLU A CB    1 
ATOM   946  C CG    . GLU A 1 126 ? 44.692 32.606  -65.901 1.00 41.97  ? 126 GLU A CG    1 
ATOM   947  C CD    . GLU A 1 126 ? 46.128 32.315  -66.294 1.00 44.60  ? 126 GLU A CD    1 
ATOM   948  O OE1   . GLU A 1 126 ? 46.410 32.243  -67.519 1.00 45.42  ? 126 GLU A OE1   1 
ATOM   949  O OE2   . GLU A 1 126 ? 46.973 32.146  -65.384 1.00 45.15  ? 126 GLU A OE2   1 
ATOM   950  N N     . LYS A 1 127 ? 40.779 31.273  -68.260 1.00 37.93  ? 127 LYS A N     1 
ATOM   951  C CA    . LYS A 1 127 ? 39.891 31.314  -69.422 1.00 38.26  ? 127 LYS A CA    1 
ATOM   952  C C     . LYS A 1 127 ? 38.450 31.724  -69.093 1.00 37.41  ? 127 LYS A C     1 
ATOM   953  O O     . LYS A 1 127 ? 37.651 32.016  -69.992 1.00 36.97  ? 127 LYS A O     1 
ATOM   954  C CB    . LYS A 1 127 ? 39.923 29.967  -70.158 1.00 39.05  ? 127 LYS A CB    1 
ATOM   955  C CG    . LYS A 1 127 ? 41.335 29.553  -70.595 1.00 40.49  ? 127 LYS A CG    1 
ATOM   956  C CD    . LYS A 1 127 ? 41.365 28.182  -71.283 1.00 40.97  ? 127 LYS A CD    1 
ATOM   957  C CE    . LYS A 1 127 ? 42.799 27.659  -71.364 1.00 42.53  ? 127 LYS A CE    1 
ATOM   958  N NZ    . LYS A 1 127 ? 42.881 26.229  -71.813 1.00 42.85  ? 127 LYS A NZ    1 
ATOM   959  N N     . VAL A 1 128 ? 38.108 31.764  -67.809 1.00 35.69  ? 128 VAL A N     1 
ATOM   960  C CA    . VAL A 1 128 ? 36.747 32.118  -67.445 1.00 33.89  ? 128 VAL A CA    1 
ATOM   961  C C     . VAL A 1 128 ? 36.476 33.597  -67.712 1.00 34.22  ? 128 VAL A C     1 
ATOM   962  O O     . VAL A 1 128 ? 37.264 34.453  -67.316 1.00 34.16  ? 128 VAL A O     1 
ATOM   963  C CB    . VAL A 1 128 ? 36.457 31.803  -65.956 1.00 32.48  ? 128 VAL A CB    1 
ATOM   964  C CG1   . VAL A 1 128 ? 35.052 32.205  -65.605 1.00 31.79  ? 128 VAL A CG1   1 
ATOM   965  C CG2   . VAL A 1 128 ? 36.683 30.316  -65.669 1.00 32.12  ? 128 VAL A CG2   1 
ATOM   966  N N     . ASP A 1 129 ? 35.356 33.894  -68.369 1.00 34.67  ? 129 ASP A N     1 
ATOM   967  C CA    . ASP A 1 129 ? 34.919 35.275  -68.554 1.00 35.02  ? 129 ASP A CA    1 
ATOM   968  C C     . ASP A 1 129 ? 34.235 35.728  -67.278 1.00 34.64  ? 129 ASP A C     1 
ATOM   969  O O     . ASP A 1 129 ? 33.053 35.461  -67.059 1.00 33.81  ? 129 ASP A O     1 
ATOM   970  C CB    . ASP A 1 129 ? 33.983 35.405  -69.762 1.00 36.47  ? 129 ASP A CB    1 
ATOM   971  C CG    . ASP A 1 129 ? 33.360 36.797  -69.887 1.00 37.94  ? 129 ASP A CG    1 
ATOM   972  O OD1   . ASP A 1 129 ? 33.841 37.751  -69.232 1.00 38.59  ? 129 ASP A OD1   1 
ATOM   973  O OD2   . ASP A 1 129 ? 32.363 36.933  -70.634 1.00 38.52  ? 129 ASP A OD2   1 
ATOM   974  N N     . LEU A 1 130 ? 34.998 36.420  -66.437 1.00 34.61  ? 130 LEU A N     1 
ATOM   975  C CA    . LEU A 1 130 ? 34.532 36.828  -65.116 1.00 34.48  ? 130 LEU A CA    1 
ATOM   976  C C     . LEU A 1 130 ? 33.314 37.751  -65.157 1.00 35.08  ? 130 LEU A C     1 
ATOM   977  O O     . LEU A 1 130 ? 32.529 37.785  -64.210 1.00 35.65  ? 130 LEU A O     1 
ATOM   978  C CB    . LEU A 1 130 ? 35.679 37.459  -64.316 1.00 33.24  ? 130 LEU A CB    1 
ATOM   979  C CG    . LEU A 1 130 ? 36.830 36.521  -63.934 1.00 33.10  ? 130 LEU A CG    1 
ATOM   980  C CD1   . LEU A 1 130 ? 37.908 37.261  -63.132 1.00 32.36  ? 130 LEU A CD1   1 
ATOM   981  C CD2   . LEU A 1 130 ? 36.321 35.276  -63.157 1.00 32.94  ? 130 LEU A CD2   1 
ATOM   982  N N     . THR A 1 131 ? 33.145 38.488  -66.253 1.00 35.46  ? 131 THR A N     1 
ATOM   983  C CA    . THR A 1 131 ? 32.020 39.415  -66.378 1.00 35.61  ? 131 THR A CA    1 
ATOM   984  C C     . THR A 1 131 ? 30.684 38.687  -66.323 1.00 35.94  ? 131 THR A C     1 
ATOM   985  O O     . THR A 1 131 ? 29.633 39.302  -66.120 1.00 36.01  ? 131 THR A O     1 
ATOM   986  C CB    . THR A 1 131 ? 32.072 40.230  -67.702 1.00 36.36  ? 131 THR A CB    1 
ATOM   987  O OG1   . THR A 1 131 ? 31.859 39.354  -68.819 1.00 36.98  ? 131 THR A OG1   1 
ATOM   988  C CG2   . THR A 1 131 ? 33.408 40.932  -67.858 1.00 35.62  ? 131 THR A CG2   1 
ATOM   989  N N     . GLN A 1 132 ? 30.710 37.371  -66.491 1.00 36.31  ? 132 GLN A N     1 
ATOM   990  C CA    . GLN A 1 132 ? 29.452 36.616  -66.537 1.00 36.70  ? 132 GLN A CA    1 
ATOM   991  C C     . GLN A 1 132 ? 28.859 36.295  -65.164 1.00 35.38  ? 132 GLN A C     1 
ATOM   992  O O     . GLN A 1 132 ? 27.682 35.948  -65.062 1.00 35.62  ? 132 GLN A O     1 
ATOM   993  C CB    . GLN A 1 132 ? 29.637 35.333  -67.348 1.00 38.26  ? 132 GLN A CB    1 
ATOM   994  C CG    . GLN A 1 132 ? 30.104 35.582  -68.785 1.00 40.49  ? 132 GLN A CG    1 
ATOM   995  C CD    . GLN A 1 132 ? 29.014 36.175  -69.675 1.00 41.73  ? 132 GLN A CD    1 
ATOM   996  O OE1   . GLN A 1 132 ? 28.494 35.492  -70.560 1.00 42.69  ? 132 GLN A OE1   1 
ATOM   997  N NE2   . GLN A 1 132 ? 28.660 37.443  -69.442 1.00 41.72  ? 132 GLN A NE2   1 
ATOM   998  N N     . PHE A 1 133 ? 29.658 36.436  -64.107 1.00 33.81  ? 133 PHE A N     1 
ATOM   999  C CA    . PHE A 1 133 ? 29.273 35.907  -62.793 1.00 31.71  ? 133 PHE A CA    1 
ATOM   1000 C C     . PHE A 1 133 ? 29.133 36.967  -61.715 1.00 31.50  ? 133 PHE A C     1 
ATOM   1001 O O     . PHE A 1 133 ? 29.914 37.922  -61.669 1.00 32.01  ? 133 PHE A O     1 
ATOM   1002 C CB    . PHE A 1 133 ? 30.279 34.825  -62.370 1.00 30.64  ? 133 PHE A CB    1 
ATOM   1003 C CG    . PHE A 1 133 ? 30.399 33.714  -63.368 1.00 29.67  ? 133 PHE A CG    1 
ATOM   1004 C CD1   . PHE A 1 133 ? 31.516 33.606  -64.181 1.00 29.14  ? 133 PHE A CD1   1 
ATOM   1005 C CD2   . PHE A 1 133 ? 29.361 32.811  -63.543 1.00 29.21  ? 133 PHE A CD2   1 
ATOM   1006 C CE1   . PHE A 1 133 ? 31.612 32.602  -65.131 1.00 28.71  ? 133 PHE A CE1   1 
ATOM   1007 C CE2   . PHE A 1 133 ? 29.455 31.803  -64.495 1.00 28.90  ? 133 PHE A CE2   1 
ATOM   1008 C CZ    . PHE A 1 133 ? 30.585 31.704  -65.289 1.00 29.05  ? 133 PHE A CZ    1 
ATOM   1009 N N     . LYS A 1 134 ? 28.123 36.811  -60.857 1.00 30.43  ? 134 LYS A N     1 
ATOM   1010 C CA    . LYS A 1 134 ? 27.933 37.711  -59.734 1.00 29.03  ? 134 LYS A CA    1 
ATOM   1011 C C     . LYS A 1 134 ? 28.431 37.098  -58.437 1.00 27.77  ? 134 LYS A C     1 
ATOM   1012 O O     . LYS A 1 134 ? 28.525 37.784  -57.426 1.00 28.62  ? 134 LYS A O     1 
ATOM   1013 C CB    . LYS A 1 134 ? 26.459 38.071  -59.561 1.00 30.56  ? 134 LYS A CB    1 
ATOM   1014 C CG    . LYS A 1 134 ? 25.529 36.883  -59.468 1.00 31.88  ? 134 LYS A CG    1 
ATOM   1015 C CD    . LYS A 1 134 ? 24.298 37.236  -58.673 1.00 33.36  ? 134 LYS A CD    1 
ATOM   1016 C CE    . LYS A 1 134 ? 23.056 36.931  -59.438 1.00 33.72  ? 134 LYS A CE    1 
ATOM   1017 N NZ    . LYS A 1 134 ? 21.896 37.158  -58.544 1.00 36.31  ? 134 LYS A NZ    1 
ATOM   1018 N N     . TRP A 1 135 ? 28.710 35.798  -58.456 1.00 25.31  ? 135 TRP A N     1 
ATOM   1019 C CA    . TRP A 1 135 ? 29.193 35.093  -57.275 1.00 23.48  ? 135 TRP A CA    1 
ATOM   1020 C C     . TRP A 1 135 ? 30.017 33.921  -57.745 1.00 22.79  ? 135 TRP A C     1 
ATOM   1021 O O     . TRP A 1 135 ? 29.625 33.226  -58.671 1.00 23.26  ? 135 TRP A O     1 
ATOM   1022 C CB    . TRP A 1 135 ? 28.023 34.606  -56.400 1.00 22.31  ? 135 TRP A CB    1 
ATOM   1023 C CG    . TRP A 1 135 ? 28.421 34.110  -55.010 1.00 22.12  ? 135 TRP A CG    1 
ATOM   1024 C CD1   . TRP A 1 135 ? 29.204 33.026  -54.714 1.00 22.00  ? 135 TRP A CD1   1 
ATOM   1025 C CD2   . TRP A 1 135 ? 28.006 34.660  -53.741 1.00 21.56  ? 135 TRP A CD2   1 
ATOM   1026 N NE1   . TRP A 1 135 ? 29.315 32.880  -53.345 1.00 21.86  ? 135 TRP A NE1   1 
ATOM   1027 C CE2   . TRP A 1 135 ? 28.596 33.875  -52.730 1.00 21.63  ? 135 TRP A CE2   1 
ATOM   1028 C CE3   . TRP A 1 135 ? 27.215 35.753  -53.371 1.00 21.18  ? 135 TRP A CE3   1 
ATOM   1029 C CZ2   . TRP A 1 135 ? 28.413 34.142  -51.372 1.00 21.72  ? 135 TRP A CZ2   1 
ATOM   1030 C CZ3   . TRP A 1 135 ? 27.033 36.020  -52.018 1.00 22.18  ? 135 TRP A CZ3   1 
ATOM   1031 C CH2   . TRP A 1 135 ? 27.632 35.214  -51.035 1.00 21.79  ? 135 TRP A CH2   1 
ATOM   1032 N N     . ILE A 1 136 ? 31.176 33.710  -57.133 1.00 22.30  ? 136 ILE A N     1 
ATOM   1033 C CA    . ILE A 1 136 ? 31.976 32.544  -57.450 1.00 21.69  ? 136 ILE A CA    1 
ATOM   1034 C C     . ILE A 1 136 ? 32.297 31.768  -56.183 1.00 22.53  ? 136 ILE A C     1 
ATOM   1035 O O     . ILE A 1 136 ? 32.877 32.320  -55.225 1.00 24.06  ? 136 ILE A O     1 
ATOM   1036 C CB    . ILE A 1 136 ? 33.273 32.932  -58.181 1.00 21.58  ? 136 ILE A CB    1 
ATOM   1037 C CG1   . ILE A 1 136 ? 32.953 33.509  -59.566 1.00 20.99  ? 136 ILE A CG1   1 
ATOM   1038 C CG2   . ILE A 1 136 ? 34.197 31.752  -58.289 1.00 18.92  ? 136 ILE A CG2   1 
ATOM   1039 C CD1   . ILE A 1 136 ? 34.194 34.000  -60.319 1.00 21.57  ? 136 ILE A CD1   1 
ATOM   1040 N N     . HIS A 1 137 ? 31.884 30.504  -56.167 1.00 21.16  ? 137 HIS A N     1 
ATOM   1041 C CA    . HIS A 1 137 ? 32.126 29.617  -55.040 1.00 20.41  ? 137 HIS A CA    1 
ATOM   1042 C C     . HIS A 1 137 ? 33.192 28.604  -55.388 1.00 20.89  ? 137 HIS A C     1 
ATOM   1043 O O     . HIS A 1 137 ? 33.109 27.923  -56.414 1.00 19.78  ? 137 HIS A O     1 
ATOM   1044 C CB    . HIS A 1 137 ? 30.858 28.876  -54.615 1.00 18.86  ? 137 HIS A CB    1 
ATOM   1045 C CG    . HIS A 1 137 ? 31.095 27.885  -53.513 1.00 18.77  ? 137 HIS A CG    1 
ATOM   1046 N ND1   . HIS A 1 137 ? 31.418 28.267  -52.224 1.00 18.13  ? 137 HIS A ND1   1 
ATOM   1047 C CD2   . HIS A 1 137 ? 31.074 26.530  -53.509 1.00 17.81  ? 137 HIS A CD2   1 
ATOM   1048 C CE1   . HIS A 1 137 ? 31.580 27.186  -51.477 1.00 18.58  ? 137 HIS A CE1   1 
ATOM   1049 N NE2   . HIS A 1 137 ? 31.389 26.119  -52.234 1.00 17.63  ? 137 HIS A NE2   1 
ATOM   1050 N N     . ILE A 1 138 ? 34.190 28.495  -54.511 1.00 21.61  ? 138 ILE A N     1 
ATOM   1051 C CA    . ILE A 1 138 ? 35.286 27.554  -54.715 1.00 21.76  ? 138 ILE A CA    1 
ATOM   1052 C C     . ILE A 1 138 ? 35.382 26.480  -53.620 1.00 20.90  ? 138 ILE A C     1 
ATOM   1053 O O     . ILE A 1 138 ? 35.600 26.778  -52.437 1.00 20.87  ? 138 ILE A O     1 
ATOM   1054 C CB    . ILE A 1 138 ? 36.622 28.289  -54.896 1.00 23.02  ? 138 ILE A CB    1 
ATOM   1055 C CG1   . ILE A 1 138 ? 36.549 29.169  -56.151 1.00 23.77  ? 138 ILE A CG1   1 
ATOM   1056 C CG2   . ILE A 1 138 ? 37.767 27.299  -55.015 1.00 22.93  ? 138 ILE A CG2   1 
ATOM   1057 C CD1   . ILE A 1 138 ? 37.759 29.999  -56.376 1.00 25.04  ? 138 ILE A CD1   1 
ATOM   1058 N N     . GLU A 1 139 ? 35.175 25.233  -54.025 1.00 18.79  ? 139 GLU A N     1 
ATOM   1059 C CA    . GLU A 1 139 ? 35.397 24.090  -53.164 1.00 18.50  ? 139 GLU A CA    1 
ATOM   1060 C C     . GLU A 1 139 ? 36.899 23.824  -52.976 1.00 18.72  ? 139 GLU A C     1 
ATOM   1061 O O     . GLU A 1 139 ? 37.629 23.508  -53.936 1.00 17.19  ? 139 GLU A O     1 
ATOM   1062 C CB    . GLU A 1 139 ? 34.725 22.854  -53.739 1.00 18.79  ? 139 GLU A CB    1 
ATOM   1063 C CG    . GLU A 1 139 ? 35.032 21.590  -52.958 1.00 20.02  ? 139 GLU A CG    1 
ATOM   1064 C CD    . GLU A 1 139 ? 34.570 20.328  -53.677 1.00 21.85  ? 139 GLU A CD    1 
ATOM   1065 O OE1   . GLU A 1 139 ? 33.712 20.396  -54.573 1.00 21.47  ? 139 GLU A OE1   1 
ATOM   1066 O OE2   . GLU A 1 139 ? 35.048 19.243  -53.320 1.00 24.21  ? 139 GLU A OE2   1 
ATOM   1067 N N     . GLY A 1 140 ? 37.352 23.949  -51.734 1.00 18.71  ? 140 GLY A N     1 
ATOM   1068 C CA    . GLY A 1 140 ? 38.769 23.831  -51.418 1.00 17.75  ? 140 GLY A CA    1 
ATOM   1069 C C     . GLY A 1 140 ? 39.316 22.456  -51.732 1.00 19.93  ? 140 GLY A C     1 
ATOM   1070 O O     . GLY A 1 140 ? 38.817 21.434  -51.233 1.00 16.76  ? 140 GLY A O     1 
ATOM   1071 N N     . ARG A 1 141 ? 40.365 22.436  -52.555 1.00 21.81  ? 141 ARG A N     1 
ATOM   1072 C CA    . ARG A 1 141 ? 40.987 21.187  -52.965 1.00 24.68  ? 141 ARG A CA    1 
ATOM   1073 C C     . ARG A 1 141 ? 42.507 21.343  -53.218 1.00 24.95  ? 141 ARG A C     1 
ATOM   1074 O O     . ARG A 1 141 ? 43.315 21.022  -52.362 1.00 24.20  ? 141 ARG A O     1 
ATOM   1075 C CB    . ARG A 1 141 ? 40.300 20.618  -54.213 1.00 26.60  ? 141 ARG A CB    1 
ATOM   1076 C CG    . ARG A 1 141 ? 40.676 19.161  -54.385 1.00 30.67  ? 141 ARG A CG    1 
ATOM   1077 C CD    . ARG A 1 141 ? 40.091 18.528  -55.610 1.00 34.37  ? 141 ARG A CD    1 
ATOM   1078 N NE    . ARG A 1 141 ? 40.825 17.300  -55.913 1.00 37.15  ? 141 ARG A NE    1 
ATOM   1079 C CZ    . ARG A 1 141 ? 40.515 16.106  -55.423 1.00 39.23  ? 141 ARG A CZ    1 
ATOM   1080 N NH1   . ARG A 1 141 ? 39.464 15.972  -54.621 1.00 39.71  ? 141 ARG A NH1   1 
ATOM   1081 N NH2   . ARG A 1 141 ? 41.237 15.041  -55.757 1.00 40.16  ? 141 ARG A NH2   1 
ATOM   1082 N N     . ASN A 1 142 ? 42.875 21.828  -54.403 1.00 26.09  ? 142 ASN A N     1 
ATOM   1083 C CA    . ASN A 1 142 ? 44.281 22.077  -54.721 1.00 27.23  ? 142 ASN A CA    1 
ATOM   1084 C C     . ASN A 1 142 ? 44.563 23.557  -54.467 1.00 28.01  ? 142 ASN A C     1 
ATOM   1085 O O     . ASN A 1 142 ? 44.498 24.390  -55.388 1.00 27.56  ? 142 ASN A O     1 
ATOM   1086 C CB    . ASN A 1 142 ? 44.603 21.675  -56.170 1.00 27.53  ? 142 ASN A CB    1 
ATOM   1087 C CG    . ASN A 1 142 ? 43.654 22.282  -57.178 1.00 28.77  ? 142 ASN A CG    1 
ATOM   1088 O OD1   . ASN A 1 142 ? 42.469 22.533  -56.888 1.00 28.69  ? 142 ASN A OD1   1 
ATOM   1089 N ND2   . ASN A 1 142 ? 44.157 22.505  -58.394 1.00 28.10  ? 142 ASN A ND2   1 
ATOM   1090 N N     . ALA A 1 143 ? 44.855 23.870  -53.202 1.00 27.73  ? 143 ALA A N     1 
ATOM   1091 C CA    . ALA A 1 143 ? 44.808 25.237  -52.710 1.00 28.36  ? 143 ALA A CA    1 
ATOM   1092 C C     . ALA A 1 143 ? 45.792 26.198  -53.367 1.00 28.80  ? 143 ALA A C     1 
ATOM   1093 O O     . ALA A 1 143 ? 45.451 27.354  -53.638 1.00 30.14  ? 143 ALA A O     1 
ATOM   1094 C CB    . ALA A 1 143 ? 44.971 25.259  -51.174 1.00 28.63  ? 143 ALA A CB    1 
ATOM   1095 N N     . SER A 1 144 ? 47.006 25.739  -53.638 1.00 29.00  ? 144 SER A N     1 
ATOM   1096 C CA    . SER A 1 144 ? 48.000 26.662  -54.185 1.00 29.08  ? 144 SER A CA    1 
ATOM   1097 C C     . SER A 1 144 ? 47.559 27.211  -55.546 1.00 27.89  ? 144 SER A C     1 
ATOM   1098 O O     . SER A 1 144 ? 47.783 28.391  -55.852 1.00 28.26  ? 144 SER A O     1 
ATOM   1099 C CB    . SER A 1 144 ? 49.409 26.042  -54.207 1.00 29.32  ? 144 SER A CB    1 
ATOM   1100 O OG    . SER A 1 144 ? 49.621 25.276  -55.383 1.00 31.42  ? 144 SER A OG    1 
ATOM   1101 N N     . GLU A 1 145 ? 46.897 26.371  -56.342 1.00 27.27  ? 145 GLU A N     1 
ATOM   1102 C CA    . GLU A 1 145 ? 46.294 26.806  -57.611 1.00 26.14  ? 145 GLU A CA    1 
ATOM   1103 C C     . GLU A 1 145 ? 45.044 27.633  -57.373 1.00 25.45  ? 145 GLU A C     1 
ATOM   1104 O O     . GLU A 1 145 ? 44.788 28.625  -58.062 1.00 25.21  ? 145 GLU A O     1 
ATOM   1105 C CB    . GLU A 1 145 ? 45.914 25.595  -58.469 1.00 27.50  ? 145 GLU A CB    1 
ATOM   1106 C CG    . GLU A 1 145 ? 47.096 24.848  -59.046 1.00 29.25  ? 145 GLU A CG    1 
ATOM   1107 C CD    . GLU A 1 145 ? 47.853 25.696  -60.041 1.00 29.57  ? 145 GLU A CD    1 
ATOM   1108 O OE1   . GLU A 1 145 ? 47.254 26.111  -61.056 1.00 29.92  ? 145 GLU A OE1   1 
ATOM   1109 O OE2   . GLU A 1 145 ? 49.034 25.973  -59.788 1.00 31.01  ? 145 GLU A OE2   1 
ATOM   1110 N N     . GLN A 1 146 ? 44.247 27.221  -56.393 1.00 24.11  ? 146 GLN A N     1 
ATOM   1111 C CA    . GLN A 1 146 ? 43.010 27.944  -56.135 1.00 23.40  ? 146 GLN A CA    1 
ATOM   1112 C C     . GLN A 1 146 ? 43.286 29.350  -55.612 1.00 23.70  ? 146 GLN A C     1 
ATOM   1113 O O     . GLN A 1 146 ? 42.530 30.280  -55.889 1.00 22.80  ? 146 GLN A O     1 
ATOM   1114 C CB    . GLN A 1 146 ? 42.103 27.131  -55.218 1.00 22.51  ? 146 GLN A CB    1 
ATOM   1115 C CG    . GLN A 1 146 ? 41.618 25.866  -55.910 1.00 21.28  ? 146 GLN A CG    1 
ATOM   1116 C CD    . GLN A 1 146 ? 40.869 24.943  -54.974 1.00 21.95  ? 146 GLN A CD    1 
ATOM   1117 O OE1   . GLN A 1 146 ? 41.202 24.849  -53.793 1.00 22.64  ? 146 GLN A OE1   1 
ATOM   1118 N NE2   . GLN A 1 146 ? 39.869 24.248  -55.493 1.00 19.40  ? 146 GLN A NE2   1 
ATOM   1119 N N     . VAL A 1 147 ? 44.394 29.512  -54.892 1.00 24.58  ? 147 VAL A N     1 
ATOM   1120 C CA    . VAL A 1 147 ? 44.780 30.844  -54.419 1.00 26.11  ? 147 VAL A CA    1 
ATOM   1121 C C     . VAL A 1 147 ? 45.005 31.769  -55.605 1.00 26.28  ? 147 VAL A C     1 
ATOM   1122 O O     . VAL A 1 147 ? 44.587 32.929  -55.592 1.00 25.59  ? 147 VAL A O     1 
ATOM   1123 C CB    . VAL A 1 147 ? 46.038 30.790  -53.534 1.00 26.33  ? 147 VAL A CB    1 
ATOM   1124 C CG1   . VAL A 1 147 ? 46.722 32.157  -53.504 1.00 26.78  ? 147 VAL A CG1   1 
ATOM   1125 C CG2   . VAL A 1 147 ? 45.670 30.317  -52.123 1.00 25.71  ? 147 VAL A CG2   1 
ATOM   1126 N N     . LYS A 1 148 ? 45.620 31.234  -56.657 1.00 28.07  ? 148 LYS A N     1 
ATOM   1127 C CA    . LYS A 1 148 ? 45.817 31.996  -57.897 1.00 29.92  ? 148 LYS A CA    1 
ATOM   1128 C C     . LYS A 1 148 ? 44.483 32.347  -58.542 1.00 28.90  ? 148 LYS A C     1 
ATOM   1129 O O     . LYS A 1 148 ? 44.296 33.458  -59.047 1.00 29.14  ? 148 LYS A O     1 
ATOM   1130 C CB    . LYS A 1 148 ? 46.679 31.213  -58.904 1.00 30.61  ? 148 LYS A CB    1 
ATOM   1131 C CG    . LYS A 1 148 ? 48.030 30.726  -58.375 1.00 32.69  ? 148 LYS A CG    1 
ATOM   1132 C CD    . LYS A 1 148 ? 48.865 30.126  -59.526 1.00 33.65  ? 148 LYS A CD    1 
ATOM   1133 C CE    . LYS A 1 148 ? 49.909 29.127  -59.050 1.00 35.64  ? 148 LYS A CE    1 
ATOM   1134 N NZ    . LYS A 1 148 ? 50.500 28.349  -60.205 1.00 36.99  ? 148 LYS A NZ    1 
ATOM   1135 N N     . MET A 1 149 ? 43.531 31.415  -58.538 1.00 28.59  ? 149 MET A N     1 
ATOM   1136 C CA    . MET A 1 149 ? 42.224 31.757  -59.105 1.00 27.21  ? 149 MET A CA    1 
ATOM   1137 C C     . MET A 1 149 ? 41.631 32.898  -58.309 1.00 27.09  ? 149 MET A C     1 
ATOM   1138 O O     . MET A 1 149 ? 41.067 33.835  -58.873 1.00 27.29  ? 149 MET A O     1 
ATOM   1139 C CB    . MET A 1 149 ? 41.263 30.573  -59.101 1.00 27.35  ? 149 MET A CB    1 
ATOM   1140 C CG    . MET A 1 149 ? 41.853 29.275  -59.617 1.00 27.12  ? 149 MET A CG    1 
ATOM   1141 S SD    . MET A 1 149 ? 40.700 27.932  -59.412 1.00 27.08  ? 149 MET A SD    1 
ATOM   1142 C CE    . MET A 1 149 ? 41.724 26.536  -59.847 1.00 27.34  ? 149 MET A CE    1 
ATOM   1143 N N     . LEU A 1 150 ? 41.744 32.808  -56.987 1.00 27.07  ? 150 LEU A N     1 
ATOM   1144 C CA    . LEU A 1 150 ? 41.149 33.808  -56.094 1.00 26.35  ? 150 LEU A CA    1 
ATOM   1145 C C     . LEU A 1 150 ? 41.843 35.163  -56.266 1.00 26.71  ? 150 LEU A C     1 
ATOM   1146 O O     . LEU A 1 150 ? 41.221 36.219  -56.187 1.00 25.95  ? 150 LEU A O     1 
ATOM   1147 C CB    . LEU A 1 150 ? 41.237 33.327  -54.636 1.00 26.06  ? 150 LEU A CB    1 
ATOM   1148 C CG    . LEU A 1 150 ? 40.298 32.148  -54.270 1.00 25.29  ? 150 LEU A CG    1 
ATOM   1149 C CD1   . LEU A 1 150 ? 40.828 31.323  -53.112 1.00 24.67  ? 150 LEU A CD1   1 
ATOM   1150 C CD2   . LEU A 1 150 ? 38.872 32.627  -53.994 1.00 25.30  ? 150 LEU A CD2   1 
ATOM   1151 N N     . GLN A 1 151 ? 43.146 35.127  -56.494 1.00 27.96  ? 151 GLN A N     1 
ATOM   1152 C CA    . GLN A 1 151 ? 43.884 36.340  -56.809 1.00 29.13  ? 151 GLN A CA    1 
ATOM   1153 C C     . GLN A 1 151 ? 43.413 36.986  -58.116 1.00 29.13  ? 151 GLN A C     1 
ATOM   1154 O O     . GLN A 1 151 ? 43.306 38.210  -58.199 1.00 29.76  ? 151 GLN A O     1 
ATOM   1155 C CB    . GLN A 1 151 ? 45.387 36.045  -56.839 1.00 30.58  ? 151 GLN A CB    1 
ATOM   1156 C CG    . GLN A 1 151 ? 45.999 35.959  -55.435 1.00 32.13  ? 151 GLN A CG    1 
ATOM   1157 C CD    . GLN A 1 151 ? 47.325 35.259  -55.437 1.00 33.96  ? 151 GLN A CD    1 
ATOM   1158 O OE1   . GLN A 1 151 ? 47.776 34.798  -56.477 1.00 35.77  ? 151 GLN A OE1   1 
ATOM   1159 N NE2   . GLN A 1 151 ? 47.960 35.159  -54.273 1.00 34.92  ? 151 GLN A NE2   1 
ATOM   1160 N N     . ARG A 1 152 ? 43.118 36.174  -59.132 1.00 29.36  ? 152 ARG A N     1 
ATOM   1161 C CA    . ARG A 1 152 ? 42.595 36.710  -60.397 1.00 28.90  ? 152 ARG A CA    1 
ATOM   1162 C C     . ARG A 1 152 ? 41.242 37.388  -60.196 1.00 29.56  ? 152 ARG A C     1 
ATOM   1163 O O     . ARG A 1 152 ? 40.972 38.453  -60.754 1.00 29.83  ? 152 ARG A O     1 
ATOM   1164 C CB    . ARG A 1 152 ? 42.500 35.625  -61.471 1.00 29.05  ? 152 ARG A CB    1 
ATOM   1165 C CG    . ARG A 1 152 ? 41.798 36.093  -62.750 1.00 29.04  ? 152 ARG A CG    1 
ATOM   1166 C CD    . ARG A 1 152 ? 41.865 35.103  -63.910 1.00 29.35  ? 152 ARG A CD    1 
ATOM   1167 N NE    . ARG A 1 152 ? 41.256 35.741  -65.074 1.00 30.85  ? 152 ARG A NE    1 
ATOM   1168 C CZ    . ARG A 1 152 ? 40.096 35.398  -65.628 1.00 31.85  ? 152 ARG A CZ    1 
ATOM   1169 N NH1   . ARG A 1 152 ? 39.397 34.362  -65.168 1.00 31.81  ? 152 ARG A NH1   1 
ATOM   1170 N NH2   . ARG A 1 152 ? 39.638 36.093  -66.666 1.00 32.07  ? 152 ARG A NH2   1 
ATOM   1171 N N     . ILE A 1 153 ? 40.385 36.789  -59.380 1.00 29.26  ? 153 ILE A N     1 
ATOM   1172 C CA    . ILE A 1 153 ? 39.093 37.415  -59.095 1.00 28.60  ? 153 ILE A CA    1 
ATOM   1173 C C     . ILE A 1 153 ? 39.265 38.740  -58.345 1.00 28.90  ? 153 ILE A C     1 
ATOM   1174 O O     . ILE A 1 153 ? 38.578 39.714  -58.633 1.00 27.11  ? 153 ILE A O     1 
ATOM   1175 C CB    . ILE A 1 153 ? 38.190 36.493  -58.272 1.00 27.78  ? 153 ILE A CB    1 
ATOM   1176 C CG1   . ILE A 1 153 ? 37.983 35.165  -59.005 1.00 27.21  ? 153 ILE A CG1   1 
ATOM   1177 C CG2   . ILE A 1 153 ? 36.868 37.155  -58.015 1.00 26.68  ? 153 ILE A CG2   1 
ATOM   1178 C CD1   . ILE A 1 153 ? 37.389 34.092  -58.135 1.00 26.10  ? 153 ILE A CD1   1 
ATOM   1179 N N     . ASP A 1 154 ? 40.172 38.769  -57.370 1.00 30.56  ? 154 ASP A N     1 
ATOM   1180 C CA    . ASP A 1 154 ? 40.455 40.013  -56.638 1.00 32.28  ? 154 ASP A CA    1 
ATOM   1181 C C     . ASP A 1 154 ? 40.879 41.119  -57.599 1.00 32.47  ? 154 ASP A C     1 
ATOM   1182 O O     . ASP A 1 154 ? 40.296 42.211  -57.617 1.00 33.39  ? 154 ASP A O     1 
ATOM   1183 C CB    . ASP A 1 154 ? 41.547 39.793  -55.591 1.00 32.81  ? 154 ASP A CB    1 
ATOM   1184 C CG    . ASP A 1 154 ? 41.034 39.086  -54.363 1.00 34.39  ? 154 ASP A CG    1 
ATOM   1185 O OD1   . ASP A 1 154 ? 39.840 39.152  -54.056 1.00 34.66  ? 154 ASP A OD1   1 
ATOM   1186 O OD2   . ASP A 1 154 ? 41.928 38.408  -53.642 1.00 34.56  ? 154 ASP A OD2   1 
ATOM   1187 N N     . ALA A 1 155 ? 41.885 40.814  -58.409 1.00 33.15  ? 155 ALA A N     1 
ATOM   1188 C CA    . ALA A 1 155 ? 42.392 41.749  -59.407 1.00 34.33  ? 155 ALA A CA    1 
ATOM   1189 C C     . ALA A 1 155 ? 41.271 42.283  -60.295 1.00 35.16  ? 155 ALA A C     1 
ATOM   1190 O O     . ALA A 1 155 ? 41.217 43.473  -60.595 1.00 36.04  ? 155 ALA A O     1 
ATOM   1191 C CB    . ALA A 1 155 ? 43.489 41.084  -60.247 1.00 34.26  ? 155 ALA A CB    1 
ATOM   1192 N N     . HIS A 1 156 ? 40.365 41.409  -60.715 1.00 35.07  ? 156 HIS A N     1 
ATOM   1193 C CA    . HIS A 1 156 ? 39.220 41.843  -61.496 1.00 34.34  ? 156 HIS A CA    1 
ATOM   1194 C C     . HIS A 1 156 ? 38.385 42.817  -60.687 1.00 35.79  ? 156 HIS A C     1 
ATOM   1195 O O     . HIS A 1 156 ? 37.936 43.856  -61.190 1.00 36.16  ? 156 HIS A O     1 
ATOM   1196 C CB    . HIS A 1 156 ? 38.380 40.637  -61.894 1.00 33.34  ? 156 HIS A CB    1 
ATOM   1197 C CG    . HIS A 1 156 ? 37.029 40.984  -62.445 1.00 32.36  ? 156 HIS A CG    1 
ATOM   1198 N ND1   . HIS A 1 156 ? 36.768 41.042  -63.797 1.00 31.56  ? 156 HIS A ND1   1 
ATOM   1199 C CD2   . HIS A 1 156 ? 35.861 41.278  -61.825 1.00 32.08  ? 156 HIS A CD2   1 
ATOM   1200 C CE1   . HIS A 1 156 ? 35.498 41.350  -63.987 1.00 31.71  ? 156 HIS A CE1   1 
ATOM   1201 N NE2   . HIS A 1 156 ? 34.923 41.499  -62.806 1.00 31.92  ? 156 HIS A NE2   1 
ATOM   1202 N N     . ASN A 1 157 ? 38.181 42.487  -59.422 1.00 36.15  ? 157 ASN A N     1 
ATOM   1203 C CA    . ASN A 1 157 ? 37.289 43.278  -58.594 1.00 37.39  ? 157 ASN A CA    1 
ATOM   1204 C C     . ASN A 1 157 ? 37.778 44.720  -58.359 1.00 38.51  ? 157 ASN A C     1 
ATOM   1205 O O     . ASN A 1 157 ? 36.961 45.641  -58.278 1.00 37.27  ? 157 ASN A O     1 
ATOM   1206 C CB    . ASN A 1 157 ? 36.985 42.554  -57.268 1.00 36.72  ? 157 ASN A CB    1 
ATOM   1207 C CG    . ASN A 1 157 ? 35.939 41.445  -57.426 1.00 36.58  ? 157 ASN A CG    1 
ATOM   1208 O OD1   . ASN A 1 157 ? 35.127 41.464  -58.357 1.00 36.66  ? 157 ASN A OD1   1 
ATOM   1209 N ND2   . ASN A 1 157 ? 35.952 40.483  -56.512 1.00 35.69  ? 157 ASN A ND2   1 
ATOM   1210 N N     . THR A 1 158 ? 39.096 44.912  -58.273 1.00 39.99  ? 158 THR A N     1 
ATOM   1211 C CA    . THR A 1 158 ? 39.640 46.243  -58.000 1.00 42.31  ? 158 THR A CA    1 
ATOM   1212 C C     . THR A 1 158 ? 39.228 47.217  -59.075 1.00 44.42  ? 158 THR A C     1 
ATOM   1213 O O     . THR A 1 158 ? 39.076 48.408  -58.812 1.00 45.16  ? 158 THR A O     1 
ATOM   1214 C CB    . THR A 1 158 ? 41.164 46.257  -57.935 1.00 42.09  ? 158 THR A CB    1 
ATOM   1215 O OG1   . THR A 1 158 ? 41.697 45.920  -59.221 1.00 42.07  ? 158 THR A OG1   1 
ATOM   1216 C CG2   . THR A 1 158 ? 41.668 45.275  -56.887 1.00 41.80  ? 158 THR A CG2   1 
ATOM   1217 N N     . ARG A 1 159 ? 39.031 46.701  -60.284 1.00 46.70  ? 159 ARG A N     1 
ATOM   1218 C CA    . ARG A 1 159 ? 38.698 47.527  -61.439 1.00 48.89  ? 159 ARG A CA    1 
ATOM   1219 C C     . ARG A 1 159 ? 37.195 47.679  -61.652 1.00 49.80  ? 159 ARG A C     1 
ATOM   1220 O O     . ARG A 1 159 ? 36.772 48.211  -62.677 1.00 50.55  ? 159 ARG A O     1 
ATOM   1221 C CB    . ARG A 1 159 ? 39.358 46.964  -62.707 1.00 49.28  ? 159 ARG A CB    1 
ATOM   1222 C CG    . ARG A 1 159 ? 40.877 46.826  -62.608 1.00 50.23  ? 159 ARG A CG    1 
ATOM   1223 C CD    . ARG A 1 159 ? 41.508 46.275  -63.892 1.00 50.58  ? 159 ARG A CD    1 
ATOM   1224 N NE    . ARG A 1 159 ? 42.085 44.939  -63.718 1.00 51.74  ? 159 ARG A NE    1 
ATOM   1225 C CZ    . ARG A 1 159 ? 41.493 43.807  -64.097 1.00 52.66  ? 159 ARG A CZ    1 
ATOM   1226 N NH1   . ARG A 1 159 ? 40.293 43.838  -64.679 1.00 52.92  ? 159 ARG A NH1   1 
ATOM   1227 N NH2   . ARG A 1 159 ? 42.101 42.639  -63.896 1.00 52.69  ? 159 ARG A NH2   1 
ATOM   1228 N N     . GLN A 1 160 ? 36.386 47.210  -60.704 1.00 50.59  ? 160 GLN A N     1 
ATOM   1229 C CA    . GLN A 1 160 ? 34.931 47.332  -60.839 1.00 51.75  ? 160 GLN A CA    1 
ATOM   1230 C C     . GLN A 1 160 ? 34.325 48.173  -59.714 1.00 52.85  ? 160 GLN A C     1 
ATOM   1231 O O     . GLN A 1 160 ? 34.845 48.193  -58.595 1.00 52.75  ? 160 GLN A O     1 
ATOM   1232 C CB    . GLN A 1 160 ? 34.252 45.948  -60.849 1.00 51.63  ? 160 GLN A CB    1 
ATOM   1233 C CG    . GLN A 1 160 ? 34.994 44.835  -61.585 1.00 51.48  ? 160 GLN A CG    1 
ATOM   1234 C CD    . GLN A 1 160 ? 34.932 44.956  -63.107 1.00 51.35  ? 160 GLN A CD    1 
ATOM   1235 O OE1   . GLN A 1 160 ? 33.893 45.308  -63.679 1.00 50.96  ? 160 GLN A OE1   1 
ATOM   1236 N NE2   . GLN A 1 160 ? 36.052 44.652  -63.770 1.00 50.64  ? 160 GLN A NE2   1 
ATOM   1237 N N     . PRO A 1 161 ? 33.208 48.861  -60.005 1.00 54.16  ? 161 PRO A N     1 
ATOM   1238 C CA    . PRO A 1 161 ? 32.406 49.550  -58.993 1.00 55.20  ? 161 PRO A CA    1 
ATOM   1239 C C     . PRO A 1 161 ? 31.949 48.571  -57.931 1.00 56.22  ? 161 PRO A C     1 
ATOM   1240 O O     . PRO A 1 161 ? 31.818 47.387  -58.213 1.00 56.89  ? 161 PRO A O     1 
ATOM   1241 C CB    . PRO A 1 161 ? 31.180 50.027  -59.776 1.00 55.33  ? 161 PRO A CB    1 
ATOM   1242 C CG    . PRO A 1 161 ? 31.627 50.088  -61.191 1.00 55.25  ? 161 PRO A CG    1 
ATOM   1243 C CD    . PRO A 1 161 ? 32.654 49.018  -61.360 1.00 54.56  ? 161 PRO A CD    1 
ATOM   1244 N N     . PRO A 1 162 ? 31.698 49.062  -56.710 1.00 57.25  ? 162 PRO A N     1 
ATOM   1245 C CA    . PRO A 1 162 ? 31.225 48.253  -55.582 1.00 57.43  ? 162 PRO A CA    1 
ATOM   1246 C C     . PRO A 1 162 ? 30.073 47.297  -55.915 1.00 57.48  ? 162 PRO A C     1 
ATOM   1247 O O     . PRO A 1 162 ? 30.009 46.191  -55.369 1.00 58.06  ? 162 PRO A O     1 
ATOM   1248 C CB    . PRO A 1 162 ? 30.756 49.310  -54.581 1.00 57.73  ? 162 PRO A CB    1 
ATOM   1249 C CG    . PRO A 1 162 ? 31.670 50.464  -54.836 1.00 57.83  ? 162 PRO A CG    1 
ATOM   1250 C CD    . PRO A 1 162 ? 31.891 50.474  -56.330 1.00 57.59  ? 162 PRO A CD    1 
ATOM   1251 N N     . GLU A 1 163 ? 29.170 47.714  -56.795 1.00 56.76  ? 163 GLU A N     1 
ATOM   1252 C CA    . GLU A 1 163 ? 27.999 46.895  -57.107 1.00 55.46  ? 163 GLU A CA    1 
ATOM   1253 C C     . GLU A 1 163 ? 28.242 45.931  -58.270 1.00 54.10  ? 163 GLU A C     1 
ATOM   1254 O O     . GLU A 1 163 ? 27.386 45.098  -58.570 1.00 54.55  ? 163 GLU A O     1 
ATOM   1255 C CB    . GLU A 1 163 ? 26.768 47.781  -57.378 1.00 56.00  ? 163 GLU A CB    1 
ATOM   1256 N N     . GLN A 1 164 ? 29.396 46.048  -58.928 1.00 51.89  ? 164 GLN A N     1 
ATOM   1257 C CA    . GLN A 1 164 ? 29.776 45.094  -59.980 1.00 49.57  ? 164 GLN A CA    1 
ATOM   1258 C C     . GLN A 1 164 ? 30.879 44.130  -59.537 1.00 46.41  ? 164 GLN A C     1 
ATOM   1259 O O     . GLN A 1 164 ? 31.384 43.338  -60.336 1.00 45.33  ? 164 GLN A O     1 
ATOM   1260 C CB    . GLN A 1 164 ? 30.213 45.808  -61.267 1.00 51.10  ? 164 GLN A CB    1 
ATOM   1261 C CG    . GLN A 1 164 ? 29.105 46.569  -61.981 1.00 53.41  ? 164 GLN A CG    1 
ATOM   1262 C CD    . GLN A 1 164 ? 27.824 45.762  -62.126 1.00 54.66  ? 164 GLN A CD    1 
ATOM   1263 O OE1   . GLN A 1 164 ? 27.720 44.879  -62.986 1.00 55.61  ? 164 GLN A OE1   1 
ATOM   1264 N NE2   . GLN A 1 164 ? 26.828 46.075  -61.293 1.00 54.94  ? 164 GLN A NE2   1 
ATOM   1265 N N     . LYS A 1 165 ? 31.270 44.205  -58.271 1.00 43.00  ? 165 LYS A N     1 
ATOM   1266 C CA    . LYS A 1 165 ? 32.271 43.278  -57.773 1.00 40.31  ? 165 LYS A CA    1 
ATOM   1267 C C     . LYS A 1 165 ? 31.653 41.886  -57.649 1.00 37.56  ? 165 LYS A C     1 
ATOM   1268 O O     . LYS A 1 165 ? 30.492 41.744  -57.255 1.00 37.00  ? 165 LYS A O     1 
ATOM   1269 C CB    . LYS A 1 165 ? 32.841 43.746  -56.435 1.00 40.55  ? 165 LYS A CB    1 
ATOM   1270 C CG    . LYS A 1 165 ? 33.623 45.066  -56.528 1.00 41.17  ? 165 LYS A CG    1 
ATOM   1271 C CD    . LYS A 1 165 ? 34.366 45.373  -55.219 1.00 41.07  ? 165 LYS A CD    1 
ATOM   1272 C CE    . LYS A 1 165 ? 34.856 46.817  -55.165 1.00 41.20  ? 165 LYS A CE    1 
ATOM   1273 N NZ    . LYS A 1 165 ? 35.891 47.077  -56.202 1.00 41.49  ? 165 LYS A NZ    1 
ATOM   1274 N N     . ILE A 1 166 ? 32.425 40.870  -58.023 1.00 34.32  ? 166 ILE A N     1 
ATOM   1275 C CA    . ILE A 1 166 ? 32.008 39.480  -57.884 1.00 31.00  ? 166 ILE A CA    1 
ATOM   1276 C C     . ILE A 1 166 ? 32.178 39.085  -56.418 1.00 30.27  ? 166 ILE A C     1 
ATOM   1277 O O     . ILE A 1 166 ? 33.251 39.271  -55.845 1.00 28.67  ? 166 ILE A O     1 
ATOM   1278 C CB    . ILE A 1 166 ? 32.873 38.585  -58.766 1.00 30.59  ? 166 ILE A CB    1 
ATOM   1279 C CG1   . ILE A 1 166 ? 32.872 39.109  -60.212 1.00 30.46  ? 166 ILE A CG1   1 
ATOM   1280 C CG2   . ILE A 1 166 ? 32.415 37.127  -58.678 1.00 28.97  ? 166 ILE A CG2   1 
ATOM   1281 C CD1   . ILE A 1 166 ? 33.677 38.257  -61.184 1.00 30.64  ? 166 ILE A CD1   1 
ATOM   1282 N N     . ARG A 1 167 ? 31.109 38.585  -55.800 1.00 29.85  ? 167 ARG A N     1 
ATOM   1283 C CA    . ARG A 1 167 ? 31.191 38.078  -54.436 1.00 29.81  ? 167 ARG A CA    1 
ATOM   1284 C C     . ARG A 1 167 ? 31.768 36.668  -54.436 1.00 27.95  ? 167 ARG A C     1 
ATOM   1285 O O     . ARG A 1 167 ? 31.495 35.883  -55.326 1.00 26.16  ? 167 ARG A O     1 
ATOM   1286 C CB    . ARG A 1 167 ? 29.822 38.103  -53.746 1.00 33.02  ? 167 ARG A CB    1 
ATOM   1287 C CG    . ARG A 1 167 ? 29.379 39.490  -53.328 1.00 37.71  ? 167 ARG A CG    1 
ATOM   1288 C CD    . ARG A 1 167 ? 28.246 39.444  -52.303 1.00 41.30  ? 167 ARG A CD    1 
ATOM   1289 N NE    . ARG A 1 167 ? 28.705 39.183  -50.926 1.00 45.05  ? 167 ARG A NE    1 
ATOM   1290 C CZ    . ARG A 1 167 ? 27.904 39.150  -49.849 1.00 45.90  ? 167 ARG A CZ    1 
ATOM   1291 N NH1   . ARG A 1 167 ? 26.596 39.363  -49.979 1.00 45.72  ? 167 ARG A NH1   1 
ATOM   1292 N NH2   . ARG A 1 167 ? 28.412 38.913  -48.639 1.00 45.86  ? 167 ARG A NH2   1 
ATOM   1293 N N     . VAL A 1 168 ? 32.586 36.353  -53.438 1.00 26.54  ? 168 VAL A N     1 
ATOM   1294 C CA    . VAL A 1 168 ? 33.330 35.101  -53.458 1.00 24.72  ? 168 VAL A CA    1 
ATOM   1295 C C     . VAL A 1 168 ? 33.124 34.317  -52.170 1.00 22.82  ? 168 VAL A C     1 
ATOM   1296 O O     . VAL A 1 168 ? 33.162 34.893  -51.079 1.00 20.69  ? 168 VAL A O     1 
ATOM   1297 C CB    . VAL A 1 168 ? 34.850 35.364  -53.638 1.00 24.64  ? 168 VAL A CB    1 
ATOM   1298 C CG1   . VAL A 1 168 ? 35.629 34.094  -53.422 1.00 24.89  ? 168 VAL A CG1   1 
ATOM   1299 C CG2   . VAL A 1 168 ? 35.138 35.911  -55.019 1.00 25.49  ? 168 VAL A CG2   1 
ATOM   1300 N N     . SER A 1 169 ? 32.905 33.008  -52.301 1.00 21.81  ? 169 SER A N     1 
ATOM   1301 C CA    . SER A 1 169 ? 32.922 32.113  -51.146 1.00 21.33  ? 169 SER A CA    1 
ATOM   1302 C C     . SER A 1 169 ? 33.855 30.943  -51.354 1.00 21.10  ? 169 SER A C     1 
ATOM   1303 O O     . SER A 1 169 ? 34.111 30.524  -52.492 1.00 22.07  ? 169 SER A O     1 
ATOM   1304 C CB    . SER A 1 169 ? 31.525 31.624  -50.752 1.00 21.17  ? 169 SER A CB    1 
ATOM   1305 O OG    . SER A 1 169 ? 30.837 30.999  -51.830 1.00 21.37  ? 169 SER A OG    1 
ATOM   1306 N N     . VAL A 1 170 ? 34.397 30.437  -50.250 1.00 19.73  ? 170 VAL A N     1 
ATOM   1307 C CA    . VAL A 1 170 ? 35.230 29.263  -50.299 1.00 19.74  ? 170 VAL A CA    1 
ATOM   1308 C C     . VAL A 1 170 ? 34.770 28.298  -49.233 1.00 19.70  ? 170 VAL A C     1 
ATOM   1309 O O     . VAL A 1 170 ? 34.211 28.710  -48.195 1.00 18.84  ? 170 VAL A O     1 
ATOM   1310 C CB    . VAL A 1 170 ? 36.758 29.598  -50.141 1.00 20.20  ? 170 VAL A CB    1 
ATOM   1311 C CG1   . VAL A 1 170 ? 37.143 30.753  -51.045 1.00 20.15  ? 170 VAL A CG1   1 
ATOM   1312 C CG2   . VAL A 1 170 ? 37.079 29.965  -48.707 1.00 20.45  ? 170 VAL A CG2   1 
ATOM   1313 N N     . GLU A 1 171 ? 34.961 27.011  -49.510 1.00 19.85  ? 171 GLU A N     1 
ATOM   1314 C CA    . GLU A 1 171 ? 34.712 25.967  -48.539 1.00 20.17  ? 171 GLU A CA    1 
ATOM   1315 C C     . GLU A 1 171 ? 36.008 25.247  -48.178 1.00 21.71  ? 171 GLU A C     1 
ATOM   1316 O O     . GLU A 1 171 ? 36.788 24.839  -49.053 1.00 21.61  ? 171 GLU A O     1 
ATOM   1317 C CB    . GLU A 1 171 ? 33.691 24.948  -49.042 1.00 21.43  ? 171 GLU A CB    1 
ATOM   1318 C CG    . GLU A 1 171 ? 33.444 23.840  -48.018 1.00 23.21  ? 171 GLU A CG    1 
ATOM   1319 C CD    . GLU A 1 171 ? 32.661 22.656  -48.547 1.00 24.78  ? 171 GLU A CD    1 
ATOM   1320 O OE1   . GLU A 1 171 ? 32.860 22.232  -49.714 1.00 25.34  ? 171 GLU A OE1   1 
ATOM   1321 O OE2   . GLU A 1 171 ? 31.855 22.126  -47.765 1.00 26.09  ? 171 GLU A OE2   1 
ATOM   1322 N N     . VAL A 1 172 ? 36.223 25.097  -46.875 1.00 22.12  ? 172 VAL A N     1 
ATOM   1323 C CA    . VAL A 1 172 ? 37.329 24.304  -46.338 1.00 21.95  ? 172 VAL A CA    1 
ATOM   1324 C C     . VAL A 1 172 ? 36.702 23.206  -45.504 1.00 22.78  ? 172 VAL A C     1 
ATOM   1325 O O     . VAL A 1 172 ? 36.284 23.432  -44.362 1.00 21.32  ? 172 VAL A O     1 
ATOM   1326 C CB    . VAL A 1 172 ? 38.274 25.138  -45.463 1.00 21.07  ? 172 VAL A CB    1 
ATOM   1327 C CG1   . VAL A 1 172 ? 39.412 24.255  -44.931 1.00 20.83  ? 172 VAL A CG1   1 
ATOM   1328 C CG2   . VAL A 1 172 ? 38.827 26.325  -46.251 1.00 19.93  ? 172 VAL A CG2   1 
ATOM   1329 N N     . GLU A 1 173 ? 36.658 22.014  -46.081 1.00 24.49  ? 173 GLU A N     1 
ATOM   1330 C CA    . GLU A 1 173 ? 35.853 20.933  -45.535 1.00 29.28  ? 173 GLU A CA    1 
ATOM   1331 C C     . GLU A 1 173 ? 36.690 19.745  -45.045 1.00 29.80  ? 173 GLU A C     1 
ATOM   1332 O O     . GLU A 1 173 ? 36.321 19.076  -44.084 1.00 29.71  ? 173 GLU A O     1 
ATOM   1333 C CB    . GLU A 1 173 ? 34.819 20.503  -46.580 1.00 30.78  ? 173 GLU A CB    1 
ATOM   1334 C CG    . GLU A 1 173 ? 33.811 19.509  -46.095 1.00 34.79  ? 173 GLU A CG    1 
ATOM   1335 C CD    . GLU A 1 173 ? 33.982 18.161  -46.742 1.00 37.05  ? 173 GLU A CD    1 
ATOM   1336 O OE1   . GLU A 1 173 ? 34.525 18.087  -47.867 1.00 37.90  ? 173 GLU A OE1   1 
ATOM   1337 O OE2   . GLU A 1 173 ? 33.568 17.166  -46.123 1.00 39.45  ? 173 GLU A OE2   1 
ATOM   1338 N N     . LYS A 1 174 ? 37.815 19.496  -45.709 1.00 31.23  ? 174 LYS A N     1 
ATOM   1339 C CA    . LYS A 1 174 ? 38.742 18.449  -45.291 1.00 33.03  ? 174 LYS A CA    1 
ATOM   1340 C C     . LYS A 1 174 ? 39.794 19.014  -44.354 1.00 32.94  ? 174 LYS A C     1 
ATOM   1341 O O     . LYS A 1 174 ? 40.288 20.107  -44.574 1.00 31.25  ? 174 LYS A O     1 
ATOM   1342 C CB    . LYS A 1 174 ? 39.439 17.827  -46.509 1.00 35.03  ? 174 LYS A CB    1 
ATOM   1343 C CG    . LYS A 1 174 ? 38.496 17.321  -47.595 1.00 37.16  ? 174 LYS A CG    1 
ATOM   1344 C CD    . LYS A 1 174 ? 37.648 16.158  -47.089 1.00 39.75  ? 174 LYS A CD    1 
ATOM   1345 C CE    . LYS A 1 174 ? 36.766 15.561  -48.193 1.00 41.15  ? 174 LYS A CE    1 
ATOM   1346 N NZ    . LYS A 1 174 ? 35.932 14.446  -47.626 1.00 42.17  ? 174 LYS A NZ    1 
ATOM   1347 N N     . PRO A 1 175 ? 40.160 18.255  -43.309 1.00 34.51  ? 175 PRO A N     1 
ATOM   1348 C CA    . PRO A 1 175 ? 41.226 18.698  -42.415 1.00 35.62  ? 175 PRO A CA    1 
ATOM   1349 C C     . PRO A 1 175 ? 42.631 18.486  -43.011 1.00 37.59  ? 175 PRO A C     1 
ATOM   1350 O O     . PRO A 1 175 ? 43.448 17.736  -42.464 1.00 38.92  ? 175 PRO A O     1 
ATOM   1351 C CB    . PRO A 1 175 ? 41.015 17.839  -41.161 1.00 35.64  ? 175 PRO A CB    1 
ATOM   1352 C CG    . PRO A 1 175 ? 40.318 16.610  -41.637 1.00 35.31  ? 175 PRO A CG    1 
ATOM   1353 C CD    . PRO A 1 175 ? 39.588 16.953  -42.914 1.00 34.88  ? 175 PRO A CD    1 
ATOM   1354 N N     . ARG A 1 176 ? 42.910 19.172  -44.112 1.00 38.41  ? 176 ARG A N     1 
ATOM   1355 C CA    . ARG A 1 176 ? 44.203 19.093  -44.769 1.00 38.93  ? 176 ARG A CA    1 
ATOM   1356 C C     . ARG A 1 176 ? 44.883 20.446  -44.747 1.00 38.67  ? 176 ARG A C     1 
ATOM   1357 O O     . ARG A 1 176 ? 44.311 21.438  -45.201 1.00 37.42  ? 176 ARG A O     1 
ATOM   1358 C CB    . ARG A 1 176 ? 44.032 18.594  -46.202 1.00 40.04  ? 176 ARG A CB    1 
ATOM   1359 C CG    . ARG A 1 176 ? 43.548 17.134  -46.262 1.00 42.13  ? 176 ARG A CG    1 
ATOM   1360 C CD    . ARG A 1 176 ? 43.012 16.761  -47.640 1.00 44.26  ? 176 ARG A CD    1 
ATOM   1361 N NE    . ARG A 1 176 ? 42.281 15.481  -47.630 1.00 45.42  ? 176 ARG A NE    1 
ATOM   1362 C CZ    . ARG A 1 176 ? 41.560 15.019  -48.656 1.00 45.63  ? 176 ARG A CZ    1 
ATOM   1363 N NH1   . ARG A 1 176 ? 41.451 15.726  -49.777 1.00 45.47  ? 176 ARG A NH1   1 
ATOM   1364 N NH2   . ARG A 1 176 ? 40.940 13.852  -48.560 1.00 45.61  ? 176 ARG A NH2   1 
ATOM   1365 N N     . GLU A 1 177 ? 46.110 20.458  -44.228 1.00 38.38  ? 177 GLU A N     1 
ATOM   1366 C CA    . GLU A 1 177 ? 46.919 21.665  -44.033 1.00 39.00  ? 177 GLU A CA    1 
ATOM   1367 C C     . GLU A 1 177 ? 46.911 22.649  -45.190 1.00 37.65  ? 177 GLU A C     1 
ATOM   1368 O O     . GLU A 1 177 ? 46.779 23.855  -44.983 1.00 37.31  ? 177 GLU A O     1 
ATOM   1369 C CB    . GLU A 1 177 ? 48.380 21.269  -43.734 1.00 41.26  ? 177 GLU A CB    1 
ATOM   1370 C CG    . GLU A 1 177 ? 49.419 22.402  -43.890 1.00 43.08  ? 177 GLU A CG    1 
ATOM   1371 C CD    . GLU A 1 177 ? 49.222 23.530  -42.878 1.00 44.36  ? 177 GLU A CD    1 
ATOM   1372 O OE1   . GLU A 1 177 ? 48.800 23.249  -41.729 1.00 45.00  ? 177 GLU A OE1   1 
ATOM   1373 O OE2   . GLU A 1 177 ? 49.479 24.702  -43.241 1.00 44.93  ? 177 GLU A OE2   1 
ATOM   1374 N N     . GLU A 1 178 ? 47.098 22.138  -46.402 1.00 36.52  ? 178 GLU A N     1 
ATOM   1375 C CA    . GLU A 1 178 ? 47.201 22.991  -47.576 1.00 36.28  ? 178 GLU A CA    1 
ATOM   1376 C C     . GLU A 1 178 ? 45.969 23.877  -47.768 1.00 32.85  ? 178 GLU A C     1 
ATOM   1377 O O     . GLU A 1 178 ? 46.072 24.958  -48.344 1.00 32.05  ? 178 GLU A O     1 
ATOM   1378 C CB    . GLU A 1 178 ? 47.430 22.148  -48.841 1.00 38.00  ? 178 GLU A CB    1 
ATOM   1379 C CG    . GLU A 1 178 ? 46.177 21.398  -49.327 1.00 39.84  ? 178 GLU A CG    1 
ATOM   1380 C CD    . GLU A 1 178 ? 46.362 20.766  -50.702 1.00 40.77  ? 178 GLU A CD    1 
ATOM   1381 O OE1   . GLU A 1 178 ? 46.628 21.515  -51.673 1.00 42.46  ? 178 GLU A OE1   1 
ATOM   1382 O OE2   . GLU A 1 178 ? 46.244 19.518  -50.804 1.00 42.14  ? 178 GLU A OE2   1 
ATOM   1383 N N     . LEU A 1 179 ? 44.814 23.423  -47.279 1.00 30.05  ? 179 LEU A N     1 
ATOM   1384 C CA    . LEU A 1 179 ? 43.562 24.173  -47.451 1.00 27.82  ? 179 LEU A CA    1 
ATOM   1385 C C     . LEU A 1 179 ? 43.463 25.425  -46.571 1.00 27.60  ? 179 LEU A C     1 
ATOM   1386 O O     . LEU A 1 179 ? 42.764 26.369  -46.910 1.00 25.89  ? 179 LEU A O     1 
ATOM   1387 C CB    . LEU A 1 179 ? 42.346 23.254  -47.233 1.00 26.95  ? 179 LEU A CB    1 
ATOM   1388 C CG    . LEU A 1 179 ? 42.159 22.077  -48.207 1.00 27.17  ? 179 LEU A CG    1 
ATOM   1389 C CD1   . LEU A 1 179 ? 40.914 21.257  -47.852 1.00 27.18  ? 179 LEU A CD1   1 
ATOM   1390 C CD2   . LEU A 1 179 ? 42.084 22.558  -49.662 1.00 26.40  ? 179 LEU A CD2   1 
ATOM   1391 N N     . PHE A 1 180 ? 44.175 25.458  -45.448 1.00 28.28  ? 180 PHE A N     1 
ATOM   1392 C CA    . PHE A 1 180 ? 43.965 26.557  -44.488 1.00 29.07  ? 180 PHE A CA    1 
ATOM   1393 C C     . PHE A 1 180 ? 44.323 27.926  -45.050 1.00 28.44  ? 180 PHE A C     1 
ATOM   1394 O O     . PHE A 1 180 ? 43.763 28.944  -44.647 1.00 28.93  ? 180 PHE A O     1 
ATOM   1395 C CB    . PHE A 1 180 ? 44.685 26.290  -43.164 1.00 30.09  ? 180 PHE A CB    1 
ATOM   1396 C CG    . PHE A 1 180 ? 44.312 24.990  -42.544 1.00 31.03  ? 180 PHE A CG    1 
ATOM   1397 C CD1   . PHE A 1 180 ? 45.196 24.307  -41.719 1.00 32.17  ? 180 PHE A CD1   1 
ATOM   1398 C CD2   . PHE A 1 180 ? 43.070 24.425  -42.806 1.00 31.22  ? 180 PHE A CD2   1 
ATOM   1399 C CE1   . PHE A 1 180 ? 44.829 23.079  -41.157 1.00 32.88  ? 180 PHE A CE1   1 
ATOM   1400 C CE2   . PHE A 1 180 ? 42.709 23.217  -42.265 1.00 31.35  ? 180 PHE A CE2   1 
ATOM   1401 C CZ    . PHE A 1 180 ? 43.583 22.537  -41.438 1.00 31.85  ? 180 PHE A CZ    1 
ATOM   1402 N N     . GLN A 1 181 ? 45.218 27.969  -46.020 1.00 27.20  ? 181 GLN A N     1 
ATOM   1403 C CA    . GLN A 1 181 ? 45.520 29.250  -46.629 1.00 27.42  ? 181 GLN A CA    1 
ATOM   1404 C C     . GLN A 1 181 ? 44.270 29.885  -47.241 1.00 25.69  ? 181 GLN A C     1 
ATOM   1405 O O     . GLN A 1 181 ? 44.197 31.104  -47.392 1.00 25.92  ? 181 GLN A O     1 
ATOM   1406 C CB    . GLN A 1 181 ? 46.632 29.109  -47.675 1.00 27.96  ? 181 GLN A CB    1 
ATOM   1407 C CG    . GLN A 1 181 ? 46.346 28.105  -48.762 1.00 29.29  ? 181 GLN A CG    1 
ATOM   1408 C CD    . GLN A 1 181 ? 47.585 27.808  -49.606 1.00 29.63  ? 181 GLN A CD    1 
ATOM   1409 O OE1   . GLN A 1 181 ? 48.242 28.722  -50.107 1.00 30.75  ? 181 GLN A OE1   1 
ATOM   1410 N NE2   . GLN A 1 181 ? 47.903 26.525  -49.764 1.00 29.87  ? 181 GLN A NE2   1 
ATOM   1411 N N     . LEU A 1 182 ? 43.287 29.064  -47.613 1.00 23.95  ? 182 LEU A N     1 
ATOM   1412 C CA    . LEU A 1 182 ? 42.107 29.594  -48.290 1.00 22.16  ? 182 LEU A CA    1 
ATOM   1413 C C     . LEU A 1 182 ? 41.262 30.438  -47.333 1.00 21.63  ? 182 LEU A C     1 
ATOM   1414 O O     . LEU A 1 182 ? 40.447 31.223  -47.782 1.00 21.47  ? 182 LEU A O     1 
ATOM   1415 C CB    . LEU A 1 182 ? 41.264 28.470  -48.920 1.00 21.78  ? 182 LEU A CB    1 
ATOM   1416 C CG    . LEU A 1 182 ? 41.918 27.650  -50.034 1.00 22.43  ? 182 LEU A CG    1 
ATOM   1417 C CD1   . LEU A 1 182 ? 41.070 26.428  -50.385 1.00 22.42  ? 182 LEU A CD1   1 
ATOM   1418 C CD2   . LEU A 1 182 ? 42.155 28.523  -51.251 1.00 20.87  ? 182 LEU A CD2   1 
ATOM   1419 N N     . PHE A 1 183 ? 41.458 30.268  -46.024 1.00 22.56  ? 183 PHE A N     1 
ATOM   1420 C CA    . PHE A 1 183 ? 40.722 31.067  -45.011 1.00 23.31  ? 183 PHE A CA    1 
ATOM   1421 C C     . PHE A 1 183 ? 40.804 32.571  -45.296 1.00 23.51  ? 183 PHE A C     1 
ATOM   1422 O O     . PHE A 1 183 ? 39.850 33.311  -45.060 1.00 23.36  ? 183 PHE A O     1 
ATOM   1423 C CB    . PHE A 1 183 ? 41.235 30.809  -43.589 1.00 22.65  ? 183 PHE A CB    1 
ATOM   1424 C CG    . PHE A 1 183 ? 40.826 29.475  -42.998 1.00 24.28  ? 183 PHE A CG    1 
ATOM   1425 C CD1   . PHE A 1 183 ? 41.668 28.809  -42.110 1.00 23.49  ? 183 PHE A CD1   1 
ATOM   1426 C CD2   . PHE A 1 183 ? 39.593 28.887  -43.309 1.00 25.10  ? 183 PHE A CD2   1 
ATOM   1427 C CE1   . PHE A 1 183 ? 41.299 27.598  -41.554 1.00 24.10  ? 183 PHE A CE1   1 
ATOM   1428 C CE2   . PHE A 1 183 ? 39.222 27.660  -42.745 1.00 23.64  ? 183 PHE A CE2   1 
ATOM   1429 C CZ    . PHE A 1 183 ? 40.066 27.019  -41.878 1.00 23.33  ? 183 PHE A CZ    1 
ATOM   1430 N N     . GLY A 1 184 ? 41.940 33.003  -45.833 1.00 23.61  ? 184 GLY A N     1 
ATOM   1431 C CA    . GLY A 1 184 ? 42.232 34.413  -46.069 1.00 24.38  ? 184 GLY A CA    1 
ATOM   1432 C C     . GLY A 1 184 ? 41.692 34.976  -47.359 1.00 26.28  ? 184 GLY A C     1 
ATOM   1433 O O     . GLY A 1 184 ? 41.977 36.112  -47.697 1.00 26.26  ? 184 GLY A O     1 
ATOM   1434 N N     . TYR A 1 185 ? 40.869 34.203  -48.068 1.00 27.06  ? 185 TYR A N     1 
ATOM   1435 C CA    . TYR A 1 185 ? 40.276 34.677  -49.315 1.00 27.84  ? 185 TYR A CA    1 
ATOM   1436 C C     . TYR A 1 185 ? 38.742 34.596  -49.232 1.00 28.39  ? 185 TYR A C     1 
ATOM   1437 O O     . TYR A 1 185 ? 38.190 33.837  -48.447 1.00 28.28  ? 185 TYR A O     1 
ATOM   1438 C CB    . TYR A 1 185 ? 40.796 33.851  -50.500 1.00 29.73  ? 185 TYR A CB    1 
ATOM   1439 C CG    . TYR A 1 185 ? 42.276 34.040  -50.736 1.00 30.18  ? 185 TYR A CG    1 
ATOM   1440 C CD1   . TYR A 1 185 ? 43.209 33.263  -50.064 1.00 29.79  ? 185 TYR A CD1   1 
ATOM   1441 C CD2   . TYR A 1 185 ? 42.740 35.033  -51.603 1.00 30.31  ? 185 TYR A CD2   1 
ATOM   1442 C CE1   . TYR A 1 185 ? 44.569 33.454  -50.255 1.00 30.34  ? 185 TYR A CE1   1 
ATOM   1443 C CE2   . TYR A 1 185 ? 44.102 35.240  -51.799 1.00 30.56  ? 185 TYR A CE2   1 
ATOM   1444 C CZ    . TYR A 1 185 ? 45.007 34.443  -51.124 1.00 30.88  ? 185 TYR A CZ    1 
ATOM   1445 O OH    . TYR A 1 185 ? 46.357 34.646  -51.309 1.00 31.94  ? 185 TYR A OH    1 
ATOM   1446 N N     . GLY A 1 186 ? 38.053 35.394  -50.027 1.00 27.98  ? 186 GLY A N     1 
ATOM   1447 C CA    . GLY A 1 186 ? 36.597 35.296  -50.062 1.00 28.07  ? 186 GLY A CA    1 
ATOM   1448 C C     . GLY A 1 186 ? 35.847 36.127  -49.046 1.00 26.07  ? 186 GLY A C     1 
ATOM   1449 O O     . GLY A 1 186 ? 36.347 36.417  -47.943 1.00 26.12  ? 186 GLY A O     1 
ATOM   1450 N N     . ASP A 1 187 ? 34.632 36.495  -49.441 1.00 24.53  ? 187 ASP A N     1 
ATOM   1451 C CA    . ASP A 1 187 ? 33.720 37.274  -48.641 1.00 23.60  ? 187 ASP A CA    1 
ATOM   1452 C C     . ASP A 1 187 ? 33.042 36.379  -47.614 1.00 22.36  ? 187 ASP A C     1 
ATOM   1453 O O     . ASP A 1 187 ? 32.685 36.824  -46.505 1.00 21.26  ? 187 ASP A O     1 
ATOM   1454 C CB    . ASP A 1 187 ? 32.690 37.901  -49.569 1.00 25.46  ? 187 ASP A CB    1 
ATOM   1455 C CG    . ASP A 1 187 ? 33.342 38.775  -50.621 1.00 27.72  ? 187 ASP A CG    1 
ATOM   1456 O OD1   . ASP A 1 187 ? 33.936 39.801  -50.228 1.00 28.92  ? 187 ASP A OD1   1 
ATOM   1457 O OD2   . ASP A 1 187 ? 33.306 38.430  -51.818 1.00 27.59  ? 187 ASP A OD2   1 
ATOM   1458 N N     . VAL A 1 188 ? 32.847 35.118  -47.999 1.00 19.50  ? 188 VAL A N     1 
ATOM   1459 C CA    . VAL A 1 188 ? 32.216 34.140  -47.133 1.00 18.52  ? 188 VAL A CA    1 
ATOM   1460 C C     . VAL A 1 188 ? 33.076 32.904  -47.129 1.00 18.58  ? 188 VAL A C     1 
ATOM   1461 O O     . VAL A 1 188 ? 33.429 32.396  -48.197 1.00 19.34  ? 188 VAL A O     1 
ATOM   1462 C CB    . VAL A 1 188 ? 30.797 33.729  -47.622 1.00 17.77  ? 188 VAL A CB    1 
ATOM   1463 C CG1   . VAL A 1 188 ? 30.208 32.666  -46.675 1.00 15.83  ? 188 VAL A CG1   1 
ATOM   1464 C CG2   . VAL A 1 188 ? 29.893 34.951  -47.732 1.00 15.62  ? 188 VAL A CG2   1 
ATOM   1465 N N     . VAL A 1 189 ? 33.434 32.447  -45.933 1.00 17.81  ? 189 VAL A N     1 
ATOM   1466 C CA    . VAL A 1 189 ? 34.279 31.289  -45.768 1.00 16.83  ? 189 VAL A CA    1 
ATOM   1467 C C     . VAL A 1 189 ? 33.515 30.233  -44.964 1.00 18.10  ? 189 VAL A C     1 
ATOM   1468 O O     . VAL A 1 189 ? 33.126 30.479  -43.803 1.00 18.21  ? 189 VAL A O     1 
ATOM   1469 C CB    . VAL A 1 189 ? 35.600 31.697  -45.028 1.00 17.53  ? 189 VAL A CB    1 
ATOM   1470 C CG1   . VAL A 1 189 ? 36.463 30.484  -44.746 1.00 16.30  ? 189 VAL A CG1   1 
ATOM   1471 C CG2   . VAL A 1 189 ? 36.376 32.764  -45.856 1.00 17.42  ? 189 VAL A CG2   1 
ATOM   1472 N N     . PHE A 1 190 ? 33.289 29.063  -45.572 1.00 16.62  ? 190 PHE A N     1 
ATOM   1473 C CA    . PHE A 1 190 ? 32.613 27.968  -44.878 1.00 17.61  ? 190 PHE A CA    1 
ATOM   1474 C C     . PHE A 1 190 ? 33.678 27.038  -44.345 1.00 18.03  ? 190 PHE A C     1 
ATOM   1475 O O     . PHE A 1 190 ? 34.509 26.538  -45.115 1.00 17.62  ? 190 PHE A O     1 
ATOM   1476 C CB    . PHE A 1 190 ? 31.701 27.159  -45.824 1.00 16.08  ? 190 PHE A CB    1 
ATOM   1477 C CG    . PHE A 1 190 ? 30.538 27.949  -46.400 1.00 16.76  ? 190 PHE A CG    1 
ATOM   1478 C CD1   . PHE A 1 190 ? 30.633 28.525  -47.657 1.00 17.37  ? 190 PHE A CD1   1 
ATOM   1479 C CD2   . PHE A 1 190 ? 29.342 28.068  -45.701 1.00 16.34  ? 190 PHE A CD2   1 
ATOM   1480 C CE1   . PHE A 1 190 ? 29.577 29.257  -48.212 1.00 16.96  ? 190 PHE A CE1   1 
ATOM   1481 C CE2   . PHE A 1 190 ? 28.258 28.780  -46.256 1.00 16.82  ? 190 PHE A CE2   1 
ATOM   1482 C CZ    . PHE A 1 190 ? 28.382 29.372  -47.508 1.00 16.30  ? 190 PHE A CZ    1 
ATOM   1483 N N     . VAL A 1 191 ? 33.669 26.803  -43.039 1.00 16.80  ? 191 VAL A N     1 
ATOM   1484 C CA    . VAL A 1 191 ? 34.567 25.822  -42.481 1.00 17.42  ? 191 VAL A CA    1 
ATOM   1485 C C     . VAL A 1 191 ? 33.767 24.676  -41.863 1.00 17.89  ? 191 VAL A C     1 
ATOM   1486 O O     . VAL A 1 191 ? 32.764 24.912  -41.189 1.00 19.23  ? 191 VAL A O     1 
ATOM   1487 C CB    . VAL A 1 191 ? 35.582 26.454  -41.478 1.00 17.02  ? 191 VAL A CB    1 
ATOM   1488 C CG1   . VAL A 1 191 ? 34.870 27.005  -40.224 1.00 17.87  ? 191 VAL A CG1   1 
ATOM   1489 C CG2   . VAL A 1 191 ? 36.614 25.404  -41.064 1.00 16.72  ? 191 VAL A CG2   1 
ATOM   1490 N N     . SER A 1 192 ? 34.179 23.431  -42.103 1.00 18.25  ? 192 SER A N     1 
ATOM   1491 C CA    . SER A 1 192 ? 33.389 22.291  -41.618 1.00 19.06  ? 192 SER A CA    1 
ATOM   1492 C C     . SER A 1 192 ? 33.595 21.997  -40.142 1.00 20.96  ? 192 SER A C     1 
ATOM   1493 O O     . SER A 1 192 ? 34.620 22.375  -39.552 1.00 20.93  ? 192 SER A O     1 
ATOM   1494 C CB    . SER A 1 192 ? 33.652 21.016  -42.430 1.00 19.58  ? 192 SER A CB    1 
ATOM   1495 O OG    . SER A 1 192 ? 34.985 20.528  -42.228 1.00 20.77  ? 192 SER A OG    1 
ATOM   1496 N N     . LYS A 1 193 ? 32.611 21.318  -39.546 1.00 21.27  ? 193 LYS A N     1 
ATOM   1497 C CA    . LYS A 1 193 ? 32.744 20.785  -38.210 1.00 23.53  ? 193 LYS A CA    1 
ATOM   1498 C C     . LYS A 1 193 ? 33.968 19.867  -38.101 1.00 23.61  ? 193 LYS A C     1 
ATOM   1499 O O     . LYS A 1 193 ? 34.671 19.882  -37.089 1.00 22.59  ? 193 LYS A O     1 
ATOM   1500 C CB    . LYS A 1 193 ? 31.494 19.996  -37.828 1.00 24.46  ? 193 LYS A CB    1 
ATOM   1501 C CG    . LYS A 1 193 ? 31.543 19.382  -36.442 1.00 25.96  ? 193 LYS A CG    1 
ATOM   1502 C CD    . LYS A 1 193 ? 30.354 18.441  -36.207 1.00 26.93  ? 193 LYS A CD    1 
ATOM   1503 C CE    . LYS A 1 193 ? 30.456 17.801  -34.823 1.00 30.02  ? 193 LYS A CE    1 
ATOM   1504 N NZ    . LYS A 1 193 ? 29.374 16.777  -34.536 1.00 30.34  ? 193 LYS A NZ    1 
ATOM   1505 N N     . ASP A 1 194 ? 34.214 19.061  -39.131 1.00 24.66  ? 194 ASP A N     1 
ATOM   1506 C CA    . ASP A 1 194 ? 35.356 18.144  -39.112 1.00 27.22  ? 194 ASP A CA    1 
ATOM   1507 C C     . ASP A 1 194 ? 36.670 18.923  -39.005 1.00 24.94  ? 194 ASP A C     1 
ATOM   1508 O O     . ASP A 1 194 ? 37.510 18.603  -38.178 1.00 23.90  ? 194 ASP A O     1 
ATOM   1509 C CB    . ASP A 1 194 ? 35.390 17.242  -40.359 1.00 32.15  ? 194 ASP A CB    1 
ATOM   1510 C CG    . ASP A 1 194 ? 36.510 16.188  -40.291 1.00 35.73  ? 194 ASP A CG    1 
ATOM   1511 O OD1   . ASP A 1 194 ? 37.103 15.865  -41.344 1.00 38.36  ? 194 ASP A OD1   1 
ATOM   1512 O OD2   . ASP A 1 194 ? 36.802 15.677  -39.182 1.00 37.54  ? 194 ASP A OD2   1 
ATOM   1513 N N     . VAL A 1 195 ? 36.826 19.950  -39.834 1.00 22.94  ? 195 VAL A N     1 
ATOM   1514 C CA    . VAL A 1 195 ? 37.994 20.812  -39.746 1.00 22.05  ? 195 VAL A CA    1 
ATOM   1515 C C     . VAL A 1 195 ? 38.109 21.404  -38.340 1.00 22.36  ? 195 VAL A C     1 
ATOM   1516 O O     . VAL A 1 195 ? 39.177 21.325  -37.726 1.00 20.30  ? 195 VAL A O     1 
ATOM   1517 C CB    . VAL A 1 195 ? 38.017 21.898  -40.854 1.00 21.56  ? 195 VAL A CB    1 
ATOM   1518 C CG1   . VAL A 1 195 ? 39.103 22.949  -40.577 1.00 22.10  ? 195 VAL A CG1   1 
ATOM   1519 C CG2   . VAL A 1 195 ? 38.284 21.244  -42.206 1.00 19.94  ? 195 VAL A CG2   1 
ATOM   1520 N N     . ALA A 1 196 ? 37.002 21.961  -37.829 1.00 21.34  ? 196 ALA A N     1 
ATOM   1521 C CA    . ALA A 1 196 ? 36.976 22.576  -36.505 1.00 22.30  ? 196 ALA A CA    1 
ATOM   1522 C C     . ALA A 1 196 ? 37.462 21.638  -35.424 1.00 23.40  ? 196 ALA A C     1 
ATOM   1523 O O     . ALA A 1 196 ? 38.320 22.007  -34.609 1.00 22.59  ? 196 ALA A O     1 
ATOM   1524 C CB    . ALA A 1 196 ? 35.560 23.083  -36.147 1.00 21.73  ? 196 ALA A CB    1 
ATOM   1525 N N     . LYS A 1 197 ? 36.896 20.431  -35.404 1.00 24.67  ? 197 LYS A N     1 
ATOM   1526 C CA    . LYS A 1 197 ? 37.255 19.439  -34.397 1.00 27.27  ? 197 LYS A CA    1 
ATOM   1527 C C     . LYS A 1 197 ? 38.706 18.976  -34.537 1.00 27.38  ? 197 LYS A C     1 
ATOM   1528 O O     . LYS A 1 197 ? 39.384 18.783  -33.528 1.00 27.89  ? 197 LYS A O     1 
ATOM   1529 C CB    . LYS A 1 197 ? 36.279 18.255  -34.423 1.00 27.60  ? 197 LYS A CB    1 
ATOM   1530 C CG    . LYS A 1 197 ? 34.864 18.632  -33.982 1.00 29.48  ? 197 LYS A CG    1 
ATOM   1531 C CD    . LYS A 1 197 ? 33.938 17.426  -33.957 1.00 30.68  ? 197 LYS A CD    1 
ATOM   1532 C CE    . LYS A 1 197 ? 34.457 16.366  -32.967 1.00 33.96  ? 197 LYS A CE    1 
ATOM   1533 N NZ    . LYS A 1 197 ? 33.355 15.640  -32.246 1.00 35.79  ? 197 LYS A NZ    1 
ATOM   1534 N N     . HIS A 1 198 ? 39.176 18.809  -35.774 1.00 28.48  ? 198 HIS A N     1 
ATOM   1535 C CA    . HIS A 1 198 ? 40.585 18.477  -36.032 1.00 30.77  ? 198 HIS A CA    1 
ATOM   1536 C C     . HIS A 1 198 ? 41.535 19.544  -35.456 1.00 30.38  ? 198 HIS A C     1 
ATOM   1537 O O     . HIS A 1 198 ? 42.633 19.217  -35.001 1.00 29.94  ? 198 HIS A O     1 
ATOM   1538 C CB    . HIS A 1 198 ? 40.861 18.266  -37.528 1.00 33.51  ? 198 HIS A CB    1 
ATOM   1539 C CG    . HIS A 1 198 ? 42.324 18.295  -37.889 1.00 37.61  ? 198 HIS A CG    1 
ATOM   1540 N ND1   . HIS A 1 198 ? 43.123 17.167  -37.883 1.00 38.93  ? 198 HIS A ND1   1 
ATOM   1541 C CD2   . HIS A 1 198 ? 43.133 19.319  -38.268 1.00 38.66  ? 198 HIS A CD2   1 
ATOM   1542 C CE1   . HIS A 1 198 ? 44.358 17.495  -38.232 1.00 38.78  ? 198 HIS A CE1   1 
ATOM   1543 N NE2   . HIS A 1 198 ? 44.390 18.794  -38.475 1.00 39.00  ? 198 HIS A NE2   1 
ATOM   1544 N N     . LEU A 1 199 ? 41.104 20.811  -35.456 1.00 28.87  ? 199 LEU A N     1 
ATOM   1545 C CA    . LEU A 1 199 ? 41.923 21.899  -34.888 1.00 27.30  ? 199 LEU A CA    1 
ATOM   1546 C C     . LEU A 1 199 ? 41.664 22.103  -33.383 1.00 27.75  ? 199 LEU A C     1 
ATOM   1547 O O     . LEU A 1 199 ? 42.107 23.090  -32.785 1.00 27.75  ? 199 LEU A O     1 
ATOM   1548 C CB    . LEU A 1 199 ? 41.739 23.211  -35.674 1.00 26.20  ? 199 LEU A CB    1 
ATOM   1549 C CG    . LEU A 1 199 ? 42.151 23.169  -37.158 1.00 26.42  ? 199 LEU A CG    1 
ATOM   1550 C CD1   . LEU A 1 199 ? 41.811 24.449  -37.902 1.00 26.71  ? 199 LEU A CD1   1 
ATOM   1551 C CD2   . LEU A 1 199 ? 43.660 22.805  -37.342 1.00 26.41  ? 199 LEU A CD2   1 
ATOM   1552 N N     . GLY A 1 200 ? 40.945 21.166  -32.776 1.00 27.83  ? 200 GLY A N     1 
ATOM   1553 C CA    . GLY A 1 200 ? 40.732 21.184  -31.333 1.00 28.60  ? 200 GLY A CA    1 
ATOM   1554 C C     . GLY A 1 200 ? 39.530 21.989  -30.860 1.00 28.96  ? 200 GLY A C     1 
ATOM   1555 O O     . GLY A 1 200 ? 39.382 22.236  -29.670 1.00 29.86  ? 200 GLY A O     1 
ATOM   1556 N N     . PHE A 1 201 ? 38.664 22.420  -31.770 1.00 27.76  ? 201 PHE A N     1 
ATOM   1557 C CA    . PHE A 1 201 ? 37.508 23.195  -31.324 1.00 27.97  ? 201 PHE A CA    1 
ATOM   1558 C C     . PHE A 1 201 ? 36.317 22.274  -31.067 1.00 28.79  ? 201 PHE A C     1 
ATOM   1559 O O     . PHE A 1 201 ? 36.136 21.275  -31.763 1.00 28.57  ? 201 PHE A O     1 
ATOM   1560 C CB    . PHE A 1 201 ? 37.155 24.293  -32.325 1.00 26.80  ? 201 PHE A CB    1 
ATOM   1561 C CG    . PHE A 1 201 ? 38.299 25.237  -32.626 1.00 27.51  ? 201 PHE A CG    1 
ATOM   1562 C CD1   . PHE A 1 201 ? 38.903 25.243  -33.877 1.00 26.69  ? 201 PHE A CD1   1 
ATOM   1563 C CD2   . PHE A 1 201 ? 38.762 26.122  -31.661 1.00 26.87  ? 201 PHE A CD2   1 
ATOM   1564 C CE1   . PHE A 1 201 ? 39.953 26.116  -34.160 1.00 26.29  ? 201 PHE A CE1   1 
ATOM   1565 C CE2   . PHE A 1 201 ? 39.810 26.988  -31.938 1.00 26.90  ? 201 PHE A CE2   1 
ATOM   1566 C CZ    . PHE A 1 201 ? 40.406 26.983  -33.187 1.00 26.23  ? 201 PHE A CZ    1 
ATOM   1567 N N     . GLN A 1 202 ? 35.505 22.630  -30.078 1.00 29.76  ? 202 GLN A N     1 
ATOM   1568 C CA    . GLN A 1 202 ? 34.429 21.763  -29.587 1.00 31.46  ? 202 GLN A CA    1 
ATOM   1569 C C     . GLN A 1 202 ? 33.021 22.228  -29.934 1.00 29.97  ? 202 GLN A C     1 
ATOM   1570 O O     . GLN A 1 202 ? 32.058 21.491  -29.744 1.00 29.06  ? 202 GLN A O     1 
ATOM   1571 C CB    . GLN A 1 202 ? 34.548 21.623  -28.070 1.00 34.60  ? 202 GLN A CB    1 
ATOM   1572 C CG    . GLN A 1 202 ? 35.835 20.953  -27.651 1.00 37.85  ? 202 GLN A CG    1 
ATOM   1573 C CD    . GLN A 1 202 ? 35.917 19.550  -28.192 1.00 40.48  ? 202 GLN A CD    1 
ATOM   1574 O OE1   . GLN A 1 202 ? 35.058 18.714  -27.888 1.00 42.41  ? 202 GLN A OE1   1 
ATOM   1575 N NE2   . GLN A 1 202 ? 36.942 19.275  -29.011 1.00 40.84  ? 202 GLN A NE2   1 
ATOM   1576 N N     . SER A 1 203 ? 32.902 23.456  -30.422 1.00 28.78  ? 203 SER A N     1 
ATOM   1577 C CA    . SER A 1 203 ? 31.623 23.988  -30.857 1.00 27.65  ? 203 SER A CA    1 
ATOM   1578 C C     . SER A 1 203 ? 31.880 24.924  -32.027 1.00 27.10  ? 203 SER A C     1 
ATOM   1579 O O     . SER A 1 203 ? 33.032 25.292  -32.284 1.00 27.01  ? 203 SER A O     1 
ATOM   1580 C CB    . SER A 1 203 ? 30.951 24.749  -29.726 1.00 28.67  ? 203 SER A CB    1 
ATOM   1581 O OG    . SER A 1 203 ? 31.677 25.940  -29.429 1.00 29.39  ? 203 SER A OG    1 
ATOM   1582 N N     . ALA A 1 204 ? 30.823 25.276  -32.754 1.00 24.96  ? 204 ALA A N     1 
ATOM   1583 C CA    . ALA A 1 204 ? 30.928 26.217  -33.859 1.00 24.53  ? 204 ALA A CA    1 
ATOM   1584 C C     . ALA A 1 204 ? 31.427 27.560  -33.334 1.00 23.89  ? 204 ALA A C     1 
ATOM   1585 O O     . ALA A 1 204 ? 32.240 28.225  -33.974 1.00 22.39  ? 204 ALA A O     1 
ATOM   1586 C CB    . ALA A 1 204 ? 29.559 26.387  -34.581 1.00 23.26  ? 204 ALA A CB    1 
ATOM   1587 N N     . GLU A 1 205 ? 30.946 27.945  -32.158 1.00 24.31  ? 205 GLU A N     1 
ATOM   1588 C CA    . GLU A 1 205 ? 31.337 29.221  -31.553 1.00 25.92  ? 205 GLU A CA    1 
ATOM   1589 C C     . GLU A 1 205 ? 32.832 29.292  -31.206 1.00 25.45  ? 205 GLU A C     1 
ATOM   1590 O O     . GLU A 1 205 ? 33.475 30.310  -31.452 1.00 24.77  ? 205 GLU A O     1 
ATOM   1591 C CB    . GLU A 1 205 ? 30.512 29.513  -30.299 1.00 28.63  ? 205 GLU A CB    1 
ATOM   1592 C CG    . GLU A 1 205 ? 30.994 30.774  -29.604 1.00 33.18  ? 205 GLU A CG    1 
ATOM   1593 C CD    . GLU A 1 205 ? 30.234 31.098  -28.323 1.00 36.00  ? 205 GLU A CD    1 
ATOM   1594 O OE1   . GLU A 1 205 ? 30.536 32.167  -27.748 1.00 37.80  ? 205 GLU A OE1   1 
ATOM   1595 O OE2   . GLU A 1 205 ? 29.353 30.303  -27.903 1.00 36.51  ? 205 GLU A OE2   1 
ATOM   1596 N N     . GLU A 1 206 ? 33.383 28.223  -30.643 1.00 24.43  ? 206 GLU A N     1 
ATOM   1597 C CA    . GLU A 1 206 ? 34.822 28.180  -30.378 1.00 25.79  ? 206 GLU A CA    1 
ATOM   1598 C C     . GLU A 1 206 ? 35.605 28.255  -31.671 1.00 24.90  ? 206 GLU A C     1 
ATOM   1599 O O     . GLU A 1 206 ? 36.588 28.968  -31.750 1.00 24.52  ? 206 GLU A O     1 
ATOM   1600 C CB    . GLU A 1 206 ? 35.234 26.893  -29.680 1.00 27.35  ? 206 GLU A CB    1 
ATOM   1601 C CG    . GLU A 1 206 ? 34.776 26.768  -28.275 1.00 30.57  ? 206 GLU A CG    1 
ATOM   1602 C CD    . GLU A 1 206 ? 35.306 25.487  -27.647 1.00 32.90  ? 206 GLU A CD    1 
ATOM   1603 O OE1   . GLU A 1 206 ? 34.833 25.139  -26.541 1.00 34.18  ? 206 GLU A OE1   1 
ATOM   1604 O OE2   . GLU A 1 206 ? 36.186 24.833  -28.267 1.00 33.02  ? 206 GLU A OE2   1 
ATOM   1605 N N     . ALA A 1 207 ? 35.172 27.484  -32.669 1.00 24.20  ? 207 ALA A N     1 
ATOM   1606 C CA    . ALA A 1 207 ? 35.809 27.483  -33.979 1.00 22.80  ? 207 ALA A CA    1 
ATOM   1607 C C     . ALA A 1 207 ? 35.831 28.874  -34.583 1.00 21.84  ? 207 ALA A C     1 
ATOM   1608 O O     . ALA A 1 207 ? 36.846 29.311  -35.101 1.00 23.22  ? 207 ALA A O     1 
ATOM   1609 C CB    . ALA A 1 207 ? 35.103 26.514  -34.918 1.00 22.17  ? 207 ALA A CB    1 
ATOM   1610 N N     . LEU A 1 208 ? 34.710 29.578  -34.532 1.00 20.87  ? 208 LEU A N     1 
ATOM   1611 C CA    . LEU A 1 208 ? 34.636 30.893  -35.168 1.00 20.08  ? 208 LEU A CA    1 
ATOM   1612 C C     . LEU A 1 208 ? 35.510 31.921  -34.436 1.00 20.69  ? 208 LEU A C     1 
ATOM   1613 O O     . LEU A 1 208 ? 36.235 32.691  -35.088 1.00 19.74  ? 208 LEU A O     1 
ATOM   1614 C CB    . LEU A 1 208 ? 33.194 31.384  -35.264 1.00 19.96  ? 208 LEU A CB    1 
ATOM   1615 C CG    . LEU A 1 208 ? 32.249 30.504  -36.124 1.00 20.49  ? 208 LEU A CG    1 
ATOM   1616 C CD1   . LEU A 1 208 ? 30.777 30.935  -35.955 1.00 19.44  ? 208 LEU A CD1   1 
ATOM   1617 C CD2   . LEU A 1 208 ? 32.647 30.549  -37.583 1.00 18.96  ? 208 LEU A CD2   1 
ATOM   1618 N N     . ARG A 1 209 ? 35.440 31.932  -33.101 1.00 19.94  ? 209 ARG A N     1 
ATOM   1619 C CA    . ARG A 1 209 ? 36.248 32.873  -32.329 1.00 21.57  ? 209 ARG A CA    1 
ATOM   1620 C C     . ARG A 1 209 ? 37.716 32.557  -32.568 1.00 20.18  ? 209 ARG A C     1 
ATOM   1621 O O     . ARG A 1 209 ? 38.518 33.455  -32.692 1.00 20.78  ? 209 ARG A O     1 
ATOM   1622 C CB    . ARG A 1 209 ? 35.968 32.788  -30.829 1.00 22.82  ? 209 ARG A CB    1 
ATOM   1623 C CG    . ARG A 1 209 ? 34.596 33.234  -30.404 1.00 26.33  ? 209 ARG A CG    1 
ATOM   1624 C CD    . ARG A 1 209 ? 34.458 34.741  -30.491 1.00 28.69  ? 209 ARG A CD    1 
ATOM   1625 N NE    . ARG A 1 209 ? 33.152 35.155  -29.988 1.00 31.08  ? 209 ARG A NE    1 
ATOM   1626 C CZ    . ARG A 1 209 ? 32.542 36.294  -30.302 1.00 31.53  ? 209 ARG A CZ    1 
ATOM   1627 N NH1   . ARG A 1 209 ? 33.113 37.169  -31.126 1.00 32.21  ? 209 ARG A NH1   1 
ATOM   1628 N NH2   . ARG A 1 209 ? 31.352 36.559  -29.782 1.00 32.40  ? 209 ARG A NH2   1 
ATOM   1629 N N     . GLY A 1 210 ? 38.047 31.273  -32.657 1.00 19.50  ? 210 GLY A N     1 
ATOM   1630 C CA    . GLY A 1 210 ? 39.448 30.846  -32.798 1.00 19.53  ? 210 GLY A CA    1 
ATOM   1631 C C     . GLY A 1 210 ? 40.023 30.976  -34.197 1.00 19.37  ? 210 GLY A C     1 
ATOM   1632 O O     . GLY A 1 210 ? 41.242 30.938  -34.378 1.00 21.48  ? 210 GLY A O     1 
ATOM   1633 N N     . LEU A 1 211 ? 39.166 31.130  -35.207 1.00 18.79  ? 211 LEU A N     1 
ATOM   1634 C CA    . LEU A 1 211 ? 39.665 31.171  -36.592 1.00 17.82  ? 211 LEU A CA    1 
ATOM   1635 C C     . LEU A 1 211 ? 39.403 32.493  -37.305 1.00 17.75  ? 211 LEU A C     1 
ATOM   1636 O O     . LEU A 1 211 ? 39.961 32.745  -38.378 1.00 17.92  ? 211 LEU A O     1 
ATOM   1637 C CB    . LEU A 1 211 ? 39.050 30.033  -37.421 1.00 18.18  ? 211 LEU A CB    1 
ATOM   1638 C CG    . LEU A 1 211 ? 39.486 28.580  -37.160 1.00 17.57  ? 211 LEU A CG    1 
ATOM   1639 C CD1   . LEU A 1 211 ? 38.523 27.676  -37.911 1.00 18.15  ? 211 LEU A CD1   1 
ATOM   1640 C CD2   . LEU A 1 211 ? 40.904 28.341  -37.615 1.00 16.56  ? 211 LEU A CD2   1 
ATOM   1641 N N     . TYR A 1 212 ? 38.552 33.332  -36.732 1.00 18.14  ? 212 TYR A N     1 
ATOM   1642 C CA    . TYR A 1 212 ? 38.192 34.600  -37.386 1.00 18.30  ? 212 TYR A CA    1 
ATOM   1643 C C     . TYR A 1 212 ? 39.419 35.452  -37.778 1.00 19.20  ? 212 TYR A C     1 
ATOM   1644 O O     . TYR A 1 212 ? 39.394 36.173  -38.791 1.00 18.59  ? 212 TYR A O     1 
ATOM   1645 C CB    . TYR A 1 212 ? 37.168 35.436  -36.557 1.00 18.57  ? 212 TYR A CB    1 
ATOM   1646 C CG    . TYR A 1 212 ? 36.564 36.509  -37.444 1.00 18.04  ? 212 TYR A CG    1 
ATOM   1647 C CD1   . TYR A 1 212 ? 35.517 36.203  -38.339 1.00 18.14  ? 212 TYR A CD1   1 
ATOM   1648 C CD2   . TYR A 1 212 ? 37.088 37.779  -37.466 1.00 18.04  ? 212 TYR A CD2   1 
ATOM   1649 C CE1   . TYR A 1 212 ? 35.019 37.153  -39.216 1.00 17.26  ? 212 TYR A CE1   1 
ATOM   1650 C CE2   . TYR A 1 212 ? 36.591 38.751  -38.343 1.00 18.52  ? 212 TYR A CE2   1 
ATOM   1651 C CZ    . TYR A 1 212 ? 35.562 38.426  -39.213 1.00 18.32  ? 212 TYR A CZ    1 
ATOM   1652 O OH    . TYR A 1 212 ? 35.075 39.385  -40.068 1.00 18.01  ? 212 TYR A OH    1 
ATOM   1653 N N     . GLY A 1 213 ? 40.486 35.395  -36.982 1.00 19.15  ? 213 GLY A N     1 
ATOM   1654 C CA    . GLY A 1 213 ? 41.666 36.225  -37.270 1.00 19.57  ? 213 GLY A CA    1 
ATOM   1655 C C     . GLY A 1 213 ? 42.341 35.867  -38.583 1.00 20.03  ? 213 GLY A C     1 
ATOM   1656 O O     . GLY A 1 213 ? 43.193 36.580  -39.071 1.00 20.89  ? 213 GLY A O     1 
ATOM   1657 N N     . ARG A 1 214 ? 41.935 34.755  -39.176 1.00 22.69  ? 214 ARG A N     1 
ATOM   1658 C CA    . ARG A 1 214 ? 42.520 34.292  -40.423 1.00 23.05  ? 214 ARG A CA    1 
ATOM   1659 C C     . ARG A 1 214 ? 41.780 34.729  -41.688 1.00 23.32  ? 214 ARG A C     1 
ATOM   1660 O O     . ARG A 1 214 ? 42.293 34.544  -42.790 1.00 23.95  ? 214 ARG A O     1 
ATOM   1661 C CB    . ARG A 1 214 ? 42.543 32.782  -40.406 1.00 24.52  ? 214 ARG A CB    1 
ATOM   1662 C CG    . ARG A 1 214 ? 43.377 32.227  -39.295 1.00 27.45  ? 214 ARG A CG    1 
ATOM   1663 C CD    . ARG A 1 214 ? 43.995 31.009  -39.831 1.00 28.93  ? 214 ARG A CD    1 
ATOM   1664 N NE    . ARG A 1 214 ? 44.080 29.947  -38.857 1.00 31.58  ? 214 ARG A NE    1 
ATOM   1665 C CZ    . ARG A 1 214 ? 44.714 28.811  -39.100 1.00 31.79  ? 214 ARG A CZ    1 
ATOM   1666 N NH1   . ARG A 1 214 ? 45.297 28.625  -40.292 1.00 32.86  ? 214 ARG A NH1   1 
ATOM   1667 N NH2   . ARG A 1 214 ? 44.774 27.888  -38.163 1.00 32.73  ? 214 ARG A NH2   1 
ATOM   1668 N N     . VAL A 1 215 ? 40.568 35.256  -41.555 1.00 22.02  ? 215 VAL A N     1 
ATOM   1669 C CA    . VAL A 1 215 ? 39.817 35.620  -42.753 1.00 20.80  ? 215 VAL A CA    1 
ATOM   1670 C C     . VAL A 1 215 ? 40.231 37.037  -43.174 1.00 22.74  ? 215 VAL A C     1 
ATOM   1671 O O     . VAL A 1 215 ? 40.811 37.769  -42.376 1.00 20.80  ? 215 VAL A O     1 
ATOM   1672 C CB    . VAL A 1 215 ? 38.267 35.537  -42.539 1.00 19.29  ? 215 VAL A CB    1 
ATOM   1673 C CG1   . VAL A 1 215 ? 37.853 34.157  -41.976 1.00 17.27  ? 215 VAL A CG1   1 
ATOM   1674 C CG2   . VAL A 1 215 ? 37.779 36.670  -41.642 1.00 15.95  ? 215 VAL A CG2   1 
ATOM   1675 N N     . ARG A 1 216 ? 39.946 37.400  -44.423 1.00 24.58  ? 216 ARG A N     1 
ATOM   1676 C CA    . ARG A 1 216 ? 40.286 38.720  -44.952 1.00 27.96  ? 216 ARG A CA    1 
ATOM   1677 C C     . ARG A 1 216 ? 39.372 39.759  -44.308 1.00 27.53  ? 216 ARG A C     1 
ATOM   1678 O O     . ARG A 1 216 ? 38.269 39.429  -43.862 1.00 26.20  ? 216 ARG A O     1 
ATOM   1679 C CB    . ARG A 1 216 ? 40.154 38.737  -46.486 1.00 30.73  ? 216 ARG A CB    1 
ATOM   1680 C CG    . ARG A 1 216 ? 39.049 39.617  -47.010 1.00 35.37  ? 216 ARG A CG    1 
ATOM   1681 C CD    . ARG A 1 216 ? 38.401 39.081  -48.263 1.00 38.35  ? 216 ARG A CD    1 
ATOM   1682 N NE    . ARG A 1 216 ? 39.311 39.134  -49.396 1.00 41.57  ? 216 ARG A NE    1 
ATOM   1683 C CZ    . ARG A 1 216 ? 38.940 39.008  -50.670 1.00 42.81  ? 216 ARG A CZ    1 
ATOM   1684 N NH1   . ARG A 1 216 ? 37.657 38.836  -51.003 1.00 43.20  ? 216 ARG A NH1   1 
ATOM   1685 N NH2   . ARG A 1 216 ? 39.866 39.056  -51.617 1.00 43.36  ? 216 ARG A NH2   1 
ATOM   1686 N N     . LYS A 1 217 ? 39.828 41.010  -44.237 1.00 29.47  ? 217 LYS A N     1 
ATOM   1687 C CA    . LYS A 1 217 ? 39.043 42.059  -43.582 1.00 30.04  ? 217 LYS A CA    1 
ATOM   1688 C C     . LYS A 1 217 ? 37.667 42.133  -44.215 1.00 28.57  ? 217 LYS A C     1 
ATOM   1689 O O     . LYS A 1 217 ? 37.550 42.115  -45.435 1.00 29.01  ? 217 LYS A O     1 
ATOM   1690 C CB    . LYS A 1 217 ? 39.741 43.417  -43.666 1.00 33.09  ? 217 LYS A CB    1 
ATOM   1691 C CG    . LYS A 1 217 ? 38.909 44.576  -43.115 1.00 35.27  ? 217 LYS A CG    1 
ATOM   1692 C CD    . LYS A 1 217 ? 39.621 45.903  -43.372 1.00 38.48  ? 217 LYS A CD    1 
ATOM   1693 C CE    . LYS A 1 217 ? 38.878 47.073  -42.728 1.00 40.14  ? 217 LYS A CE    1 
ATOM   1694 N NZ    . LYS A 1 217 ? 39.713 48.310  -42.818 1.00 42.18  ? 217 LYS A NZ    1 
ATOM   1695 N N     . GLY A 1 218 ? 36.625 42.144  -43.384 1.00 27.05  ? 218 GLY A N     1 
ATOM   1696 C CA    . GLY A 1 218 ? 35.250 42.234  -43.869 1.00 25.04  ? 218 GLY A CA    1 
ATOM   1697 C C     . GLY A 1 218 ? 34.556 40.902  -44.083 1.00 24.03  ? 218 GLY A C     1 
ATOM   1698 O O     . GLY A 1 218 ? 33.362 40.862  -44.288 1.00 24.26  ? 218 GLY A O     1 
ATOM   1699 N N     . ALA A 1 219 ? 35.291 39.796  -44.039 1.00 23.04  ? 219 ALA A N     1 
ATOM   1700 C CA    . ALA A 1 219 ? 34.674 38.489  -44.333 1.00 21.22  ? 219 ALA A CA    1 
ATOM   1701 C C     . ALA A 1 219 ? 33.752 37.967  -43.244 1.00 20.97  ? 219 ALA A C     1 
ATOM   1702 O O     . ALA A 1 219 ? 33.868 38.327  -42.065 1.00 21.42  ? 219 ALA A O     1 
ATOM   1703 C CB    . ALA A 1 219 ? 35.734 37.428  -44.662 1.00 19.24  ? 219 ALA A CB    1 
ATOM   1704 N N     . VAL A 1 220 ? 32.863 37.073  -43.666 1.00 19.69  ? 220 VAL A N     1 
ATOM   1705 C CA    . VAL A 1 220 ? 31.987 36.335  -42.784 1.00 19.05  ? 220 VAL A CA    1 
ATOM   1706 C C     . VAL A 1 220 ? 32.425 34.876  -42.794 1.00 18.25  ? 220 VAL A C     1 
ATOM   1707 O O     . VAL A 1 220 ? 32.580 34.257  -43.856 1.00 18.11  ? 220 VAL A O     1 
ATOM   1708 C CB    . VAL A 1 220 ? 30.519 36.436  -43.256 1.00 19.18  ? 220 VAL A CB    1 
ATOM   1709 C CG1   . VAL A 1 220 ? 29.621 35.542  -42.415 1.00 18.89  ? 220 VAL A CG1   1 
ATOM   1710 C CG2   . VAL A 1 220 ? 30.066 37.894  -43.182 1.00 19.87  ? 220 VAL A CG2   1 
ATOM   1711 N N     . LEU A 1 221 ? 32.656 34.355  -41.598 1.00 17.58  ? 221 LEU A N     1 
ATOM   1712 C CA    . LEU A 1 221 ? 33.071 32.989  -41.392 1.00 17.54  ? 221 LEU A CA    1 
ATOM   1713 C C     . LEU A 1 221 ? 31.864 32.204  -40.888 1.00 17.98  ? 221 LEU A C     1 
ATOM   1714 O O     . LEU A 1 221 ? 31.159 32.660  -39.978 1.00 17.87  ? 221 LEU A O     1 
ATOM   1715 C CB    . LEU A 1 221 ? 34.218 32.946  -40.359 1.00 16.69  ? 221 LEU A CB    1 
ATOM   1716 C CG    . LEU A 1 221 ? 34.770 31.554  -40.024 1.00 17.84  ? 221 LEU A CG    1 
ATOM   1717 C CD1   . LEU A 1 221 ? 35.315 30.838  -41.275 1.00 17.03  ? 221 LEU A CD1   1 
ATOM   1718 C CD2   . LEU A 1 221 ? 35.848 31.611  -38.887 1.00 17.88  ? 221 LEU A CD2   1 
ATOM   1719 N N     . VAL A 1 222 ? 31.639 31.028  -41.480 1.00 17.43  ? 222 VAL A N     1 
ATOM   1720 C CA    . VAL A 1 222 ? 30.427 30.250  -41.252 1.00 17.77  ? 222 VAL A CA    1 
ATOM   1721 C C     . VAL A 1 222 ? 30.822 28.850  -40.851 1.00 16.85  ? 222 VAL A C     1 
ATOM   1722 O O     . VAL A 1 222 ? 31.680 28.250  -41.470 1.00 15.13  ? 222 VAL A O     1 
ATOM   1723 C CB    . VAL A 1 222 ? 29.568 30.139  -42.556 1.00 17.92  ? 222 VAL A CB    1 
ATOM   1724 C CG1   . VAL A 1 222 ? 28.267 29.315  -42.307 1.00 16.83  ? 222 VAL A CG1   1 
ATOM   1725 C CG2   . VAL A 1 222 ? 29.248 31.519  -43.113 1.00 17.78  ? 222 VAL A CG2   1 
ATOM   1726 N N     . CYS A 1 223 ? 30.213 28.318  -39.803 1.00 17.57  ? 223 CYS A N     1 
ATOM   1727 C CA    . CYS A 1 223 ? 30.511 26.952  -39.410 1.00 17.80  ? 223 CYS A CA    1 
ATOM   1728 C C     . CYS A 1 223 ? 29.208 26.279  -39.030 1.00 20.14  ? 223 CYS A C     1 
ATOM   1729 O O     . CYS A 1 223 ? 28.580 26.655  -38.026 1.00 18.45  ? 223 CYS A O     1 
ATOM   1730 C CB    . CYS A 1 223 ? 31.521 26.921  -38.242 1.00 17.96  ? 223 CYS A CB    1 
ATOM   1731 S SG    . CYS A 1 223 ? 31.982 25.249  -37.660 1.00 19.12  ? 223 CYS A SG    1 
ATOM   1732 N N     . ALA A 1 224 ? 28.806 25.300  -39.847 1.00 19.97  ? 224 ALA A N     1 
ATOM   1733 C CA    . ALA A 1 224 ? 27.635 24.469  -39.594 1.00 21.90  ? 224 ALA A CA    1 
ATOM   1734 C C     . ALA A 1 224 ? 28.035 23.297  -38.713 1.00 22.92  ? 224 ALA A C     1 
ATOM   1735 O O     . ALA A 1 224 ? 29.140 22.737  -38.873 1.00 22.48  ? 224 ALA A O     1 
ATOM   1736 C CB    . ALA A 1 224 ? 27.038 23.969  -40.944 1.00 21.33  ? 224 ALA A CB    1 
ATOM   1737 N N     . TRP A 1 225 ? 27.160 22.939  -37.771 1.00 22.51  ? 225 TRP A N     1 
ATOM   1738 C CA    . TRP A 1 225 ? 27.471 21.931  -36.758 1.00 23.11  ? 225 TRP A CA    1 
ATOM   1739 C C     . TRP A 1 225 ? 26.323 20.911  -36.620 1.00 24.18  ? 225 TRP A C     1 
ATOM   1740 O O     . TRP A 1 225 ? 25.867 20.603  -35.507 1.00 23.37  ? 225 TRP A O     1 
ATOM   1741 C CB    . TRP A 1 225 ? 27.747 22.619  -35.409 1.00 24.04  ? 225 TRP A CB    1 
ATOM   1742 C CG    . TRP A 1 225 ? 28.704 21.887  -34.489 1.00 24.70  ? 225 TRP A CG    1 
ATOM   1743 C CD1   . TRP A 1 225 ? 28.388 20.947  -33.538 1.00 25.26  ? 225 TRP A CD1   1 
ATOM   1744 C CD2   . TRP A 1 225 ? 30.138 22.052  -34.422 1.00 24.86  ? 225 TRP A CD2   1 
ATOM   1745 N NE1   . TRP A 1 225 ? 29.530 20.508  -32.906 1.00 24.55  ? 225 TRP A NE1   1 
ATOM   1746 C CE2   . TRP A 1 225 ? 30.615 21.174  -33.423 1.00 25.32  ? 225 TRP A CE2   1 
ATOM   1747 C CE3   . TRP A 1 225 ? 31.059 22.844  -35.121 1.00 24.99  ? 225 TRP A CE3   1 
ATOM   1748 C CZ2   . TRP A 1 225 ? 31.979 21.066  -33.104 1.00 24.87  ? 225 TRP A CZ2   1 
ATOM   1749 C CZ3   . TRP A 1 225 ? 32.429 22.748  -34.785 1.00 24.01  ? 225 TRP A CZ3   1 
ATOM   1750 C CH2   . TRP A 1 225 ? 32.862 21.859  -33.795 1.00 24.88  ? 225 TRP A CH2   1 
ATOM   1751 N N     . ALA A 1 226 ? 25.853 20.414  -37.758 1.00 25.03  ? 226 ALA A N     1 
ATOM   1752 C CA    . ALA A 1 226 ? 24.829 19.383  -37.794 1.00 26.69  ? 226 ALA A CA    1 
ATOM   1753 C C     . ALA A 1 226 ? 23.601 19.700  -36.897 1.00 28.21  ? 226 ALA A C     1 
ATOM   1754 O O     . ALA A 1 226 ? 22.971 20.778  -37.019 1.00 26.51  ? 226 ALA A O     1 
ATOM   1755 C CB    . ALA A 1 226 ? 25.453 18.011  -37.450 1.00 26.39  ? 226 ALA A CB    1 
ATOM   1756 N N     . GLU A 1 227 ? 23.278 18.778  -35.991 1.00 29.89  ? 227 GLU A N     1 
ATOM   1757 C CA    . GLU A 1 227 ? 22.108 18.931  -35.107 1.00 32.72  ? 227 GLU A CA    1 
ATOM   1758 C C     . GLU A 1 227 ? 22.116 20.178  -34.249 1.00 32.47  ? 227 GLU A C     1 
ATOM   1759 O O     . GLU A 1 227 ? 21.088 20.529  -33.676 1.00 32.16  ? 227 GLU A O     1 
ATOM   1760 C CB    . GLU A 1 227 ? 21.963 17.740  -34.161 1.00 34.22  ? 227 GLU A CB    1 
ATOM   1761 C CG    . GLU A 1 227 ? 21.912 16.434  -34.860 1.00 38.01  ? 227 GLU A CG    1 
ATOM   1762 C CD    . GLU A 1 227 ? 23.284 15.809  -34.969 1.00 40.26  ? 227 GLU A CD    1 
ATOM   1763 O OE1   . GLU A 1 227 ? 24.259 16.453  -34.480 1.00 40.17  ? 227 GLU A OE1   1 
ATOM   1764 O OE2   . GLU A 1 227 ? 23.362 14.672  -35.520 1.00 41.55  ? 227 GLU A OE2   1 
ATOM   1765 N N     . GLU A 1 228 ? 23.265 20.827  -34.110 1.00 31.85  ? 228 GLU A N     1 
ATOM   1766 C CA    . GLU A 1 228 ? 23.333 22.001  -33.244 1.00 32.07  ? 228 GLU A CA    1 
ATOM   1767 C C     . GLU A 1 228 ? 23.111 23.292  -34.030 1.00 29.14  ? 228 GLU A C     1 
ATOM   1768 O O     . GLU A 1 228 ? 23.240 24.399  -33.500 1.00 29.68  ? 228 GLU A O     1 
ATOM   1769 C CB    . GLU A 1 228 ? 24.645 22.017  -32.447 1.00 33.84  ? 228 GLU A CB    1 
ATOM   1770 C CG    . GLU A 1 228 ? 24.715 20.919  -31.386 1.00 36.23  ? 228 GLU A CG    1 
ATOM   1771 C CD    . GLU A 1 228 ? 26.057 20.875  -30.659 1.00 37.39  ? 228 GLU A CD    1 
ATOM   1772 O OE1   . GLU A 1 228 ? 26.693 21.944  -30.458 1.00 39.49  ? 228 GLU A OE1   1 
ATOM   1773 O OE2   . GLU A 1 228 ? 26.475 19.757  -30.272 1.00 39.47  ? 228 GLU A OE2   1 
ATOM   1774 N N     . GLY A 1 229 ? 22.757 23.148  -35.298 1.00 26.41  ? 229 GLY A N     1 
ATOM   1775 C CA    . GLY A 1 229 ? 22.512 24.301  -36.143 1.00 24.77  ? 229 GLY A CA    1 
ATOM   1776 C C     . GLY A 1 229 ? 23.798 24.828  -36.760 1.00 24.89  ? 229 GLY A C     1 
ATOM   1777 O O     . GLY A 1 229 ? 24.740 24.075  -36.975 1.00 26.91  ? 229 GLY A O     1 
ATOM   1778 N N     . ALA A 1 230 ? 23.815 26.109  -37.088 1.00 22.11  ? 230 ALA A N     1 
ATOM   1779 C CA    . ALA A 1 230 ? 24.953 26.724  -37.752 1.00 22.13  ? 230 ALA A CA    1 
ATOM   1780 C C     . ALA A 1 230 ? 25.209 28.107  -37.126 1.00 21.01  ? 230 ALA A C     1 
ATOM   1781 O O     . ALA A 1 230 ? 24.280 28.762  -36.671 1.00 19.12  ? 230 ALA A O     1 
ATOM   1782 C CB    . ALA A 1 230 ? 24.682 26.857  -39.229 1.00 20.44  ? 230 ALA A CB    1 
ATOM   1783 N N     . ASP A 1 231 ? 26.475 28.517  -37.092 1.00 20.52  ? 231 ASP A N     1 
ATOM   1784 C CA    . ASP A 1 231 ? 26.860 29.819  -36.589 1.00 20.26  ? 231 ASP A CA    1 
ATOM   1785 C C     . ASP A 1 231 ? 27.630 30.587  -37.638 1.00 19.52  ? 231 ASP A C     1 
ATOM   1786 O O     . ASP A 1 231 ? 28.189 29.997  -38.561 1.00 18.67  ? 231 ASP A O     1 
ATOM   1787 C CB    . ASP A 1 231 ? 27.748 29.667  -35.354 1.00 21.68  ? 231 ASP A CB    1 
ATOM   1788 C CG    . ASP A 1 231 ? 26.994 29.139  -34.157 1.00 23.47  ? 231 ASP A CG    1 
ATOM   1789 O OD1   . ASP A 1 231 ? 26.131 28.253  -34.307 1.00 24.59  ? 231 ASP A OD1   1 
ATOM   1790 O OD2   . ASP A 1 231 ? 27.306 29.582  -33.045 1.00 26.26  ? 231 ASP A OD2   1 
ATOM   1791 N N     . ALA A 1 232 ? 27.681 31.902  -37.477 1.00 17.96  ? 232 ALA A N     1 
ATOM   1792 C CA    . ALA A 1 232 ? 28.506 32.735  -38.332 1.00 18.49  ? 232 ALA A CA    1 
ATOM   1793 C C     . ALA A 1 232 ? 29.052 33.919  -37.515 1.00 19.44  ? 232 ALA A C     1 
ATOM   1794 O O     . ALA A 1 232 ? 28.477 34.301  -36.496 1.00 18.11  ? 232 ALA A O     1 
ATOM   1795 C CB    . ALA A 1 232 ? 27.718 33.227  -39.529 1.00 18.21  ? 232 ALA A CB    1 
ATOM   1796 N N     . LEU A 1 233 ? 30.146 34.496  -37.996 1.00 19.42  ? 233 LEU A N     1 
ATOM   1797 C CA    . LEU A 1 233 ? 30.824 35.601  -37.332 1.00 20.57  ? 233 LEU A CA    1 
ATOM   1798 C C     . LEU A 1 233 ? 31.311 36.533  -38.429 1.00 21.11  ? 233 LEU A C     1 
ATOM   1799 O O     . LEU A 1 233 ? 31.994 36.100  -39.363 1.00 19.43  ? 233 LEU A O     1 
ATOM   1800 C CB    . LEU A 1 233 ? 32.005 35.085  -36.492 1.00 19.61  ? 233 LEU A CB    1 
ATOM   1801 C CG    . LEU A 1 233 ? 32.814 36.062  -35.628 1.00 20.63  ? 233 LEU A CG    1 
ATOM   1802 C CD1   . LEU A 1 233 ? 31.884 37.030  -34.798 1.00 20.04  ? 233 LEU A CD1   1 
ATOM   1803 C CD2   . LEU A 1 233 ? 33.807 35.301  -34.700 1.00 19.20  ? 233 LEU A CD2   1 
ATOM   1804 N N     . GLY A 1 234 ? 30.908 37.795  -38.338 1.00 22.12  ? 234 GLY A N     1 
ATOM   1805 C CA    . GLY A 1 234 ? 31.342 38.808  -39.275 1.00 23.11  ? 234 GLY A CA    1 
ATOM   1806 C C     . GLY A 1 234 ? 32.203 39.848  -38.577 1.00 25.30  ? 234 GLY A C     1 
ATOM   1807 O O     . GLY A 1 234 ? 32.551 39.698  -37.396 1.00 25.33  ? 234 GLY A O     1 
ATOM   1808 N N     . PRO A 1 235 ? 32.561 40.907  -39.314 1.00 26.34  ? 235 PRO A N     1 
ATOM   1809 C CA    . PRO A 1 235 ? 33.483 41.975  -38.897 1.00 27.56  ? 235 PRO A CA    1 
ATOM   1810 C C     . PRO A 1 235 ? 33.037 42.694  -37.619 1.00 28.94  ? 235 PRO A C     1 
ATOM   1811 O O     . PRO A 1 235 ? 33.885 43.088  -36.815 1.00 30.17  ? 235 PRO A O     1 
ATOM   1812 C CB    . PRO A 1 235 ? 33.468 42.950  -40.079 1.00 27.56  ? 235 PRO A CB    1 
ATOM   1813 C CG    . PRO A 1 235 ? 32.852 42.214  -41.230 1.00 27.46  ? 235 PRO A CG    1 
ATOM   1814 C CD    . PRO A 1 235 ? 32.046 41.082  -40.687 1.00 26.49  ? 235 PRO A CD    1 
ATOM   1815 N N     . ASP A 1 236 ? 31.727 42.828  -37.413 1.00 28.66  ? 236 ASP A N     1 
ATOM   1816 C CA    . ASP A 1 236 ? 31.207 43.541  -36.246 1.00 29.36  ? 236 ASP A CA    1 
ATOM   1817 C C     . ASP A 1 236 ? 31.387 42.770  -34.956 1.00 28.98  ? 236 ASP A C     1 
ATOM   1818 O O     . ASP A 1 236 ? 31.008 43.251  -33.903 1.00 29.13  ? 236 ASP A O     1 
ATOM   1819 C CB    . ASP A 1 236 ? 29.722 43.908  -36.436 1.00 30.34  ? 236 ASP A CB    1 
ATOM   1820 C CG    . ASP A 1 236 ? 28.788 42.684  -36.398 1.00 30.44  ? 236 ASP A CG    1 
ATOM   1821 O OD1   . ASP A 1 236 ? 29.239 41.564  -36.063 1.00 28.89  ? 236 ASP A OD1   1 
ATOM   1822 O OD2   . ASP A 1 236 ? 27.587 42.870  -36.690 1.00 31.61  ? 236 ASP A OD2   1 
ATOM   1823 N N     . GLY A 1 237 ? 31.922 41.551  -35.042 1.00 28.36  ? 237 GLY A N     1 
ATOM   1824 C CA    . GLY A 1 237 ? 32.185 40.744  -33.851 1.00 27.19  ? 237 GLY A CA    1 
ATOM   1825 C C     . GLY A 1 237 ? 30.984 40.047  -33.229 1.00 27.75  ? 237 GLY A C     1 
ATOM   1826 O O     . GLY A 1 237 ? 31.121 39.353  -32.225 1.00 26.45  ? 237 GLY A O     1 
ATOM   1827 N N     . LYS A 1 238 ? 29.810 40.197  -33.836 1.00 28.18  ? 238 LYS A N     1 
ATOM   1828 C CA    . LYS A 1 238 ? 28.605 39.535  -33.317 1.00 29.65  ? 238 LYS A CA    1 
ATOM   1829 C C     . LYS A 1 238 ? 28.457 38.076  -33.767 1.00 28.66  ? 238 LYS A C     1 
ATOM   1830 O O     . LYS A 1 238 ? 28.429 37.774  -34.960 1.00 27.88  ? 238 LYS A O     1 
ATOM   1831 C CB    . LYS A 1 238 ? 27.364 40.338  -33.678 1.00 31.56  ? 238 LYS A CB    1 
ATOM   1832 C CG    . LYS A 1 238 ? 27.435 41.770  -33.129 1.00 35.59  ? 238 LYS A CG    1 
ATOM   1833 C CD    . LYS A 1 238 ? 26.194 42.594  -33.485 1.00 38.22  ? 238 LYS A CD    1 
ATOM   1834 C CE    . LYS A 1 238 ? 26.388 44.051  -33.061 1.00 39.70  ? 238 LYS A CE    1 
ATOM   1835 N NZ    . LYS A 1 238 ? 25.403 44.928  -33.775 1.00 41.48  ? 238 LYS A NZ    1 
ATOM   1836 N N     . LEU A 1 239 ? 28.368 37.177  -32.798 1.00 27.82  ? 239 LEU A N     1 
ATOM   1837 C CA    . LEU A 1 239 ? 28.146 35.787  -33.101 1.00 28.60  ? 239 LEU A CA    1 
ATOM   1838 C C     . LEU A 1 239 ? 26.685 35.557  -33.498 1.00 27.89  ? 239 LEU A C     1 
ATOM   1839 O O     . LEU A 1 239 ? 25.764 35.913  -32.742 1.00 27.64  ? 239 LEU A O     1 
ATOM   1840 C CB    . LEU A 1 239 ? 28.512 34.922  -31.900 1.00 30.37  ? 239 LEU A CB    1 
ATOM   1841 C CG    . LEU A 1 239 ? 28.512 33.451  -32.312 1.00 32.45  ? 239 LEU A CG    1 
ATOM   1842 C CD1   . LEU A 1 239 ? 29.900 33.062  -32.862 1.00 32.75  ? 239 LEU A CD1   1 
ATOM   1843 C CD2   . LEU A 1 239 ? 28.099 32.578  -31.150 1.00 33.44  ? 239 LEU A CD2   1 
ATOM   1844 N N     . LEU A 1 240 ? 26.464 34.991  -34.687 1.00 25.33  ? 240 LEU A N     1 
ATOM   1845 C CA    . LEU A 1 240 ? 25.098 34.727  -35.146 1.00 24.51  ? 240 LEU A CA    1 
ATOM   1846 C C     . LEU A 1 240 ? 24.854 33.224  -35.126 1.00 24.51  ? 240 LEU A C     1 
ATOM   1847 O O     . LEU A 1 240 ? 25.786 32.456  -35.299 1.00 24.19  ? 240 LEU A O     1 
ATOM   1848 C CB    . LEU A 1 240 ? 24.850 35.317  -36.544 1.00 24.32  ? 240 LEU A CB    1 
ATOM   1849 C CG    . LEU A 1 240 ? 25.247 36.799  -36.714 1.00 25.05  ? 240 LEU A CG    1 
ATOM   1850 C CD1   . LEU A 1 240 ? 25.193 37.216  -38.152 1.00 24.32  ? 240 LEU A CD1   1 
ATOM   1851 C CD2   . LEU A 1 240 ? 24.399 37.734  -35.876 1.00 25.16  ? 240 LEU A CD2   1 
ATOM   1852 N N     . HIS A 1 241 ? 23.607 32.815  -34.897 1.00 23.19  ? 241 HIS A N     1 
ATOM   1853 C CA    . HIS A 1 241 ? 23.263 31.416  -34.782 1.00 22.58  ? 241 HIS A CA    1 
ATOM   1854 C C     . HIS A 1 241 ? 21.841 31.134  -35.295 1.00 23.00  ? 241 HIS A C     1 
ATOM   1855 O O     . HIS A 1 241 ? 20.907 31.941  -35.092 1.00 21.76  ? 241 HIS A O     1 
ATOM   1856 C CB    . HIS A 1 241 ? 23.366 30.990  -33.325 1.00 21.89  ? 241 HIS A CB    1 
ATOM   1857 C CG    . HIS A 1 241 ? 22.786 29.635  -33.032 1.00 22.79  ? 241 HIS A CG    1 
ATOM   1858 N ND1   . HIS A 1 241 ? 23.499 28.462  -33.191 1.00 22.19  ? 241 HIS A ND1   1 
ATOM   1859 C CD2   . HIS A 1 241 ? 21.574 29.271  -32.549 1.00 22.09  ? 241 HIS A CD2   1 
ATOM   1860 C CE1   . HIS A 1 241 ? 22.747 27.436  -32.844 1.00 21.46  ? 241 HIS A CE1   1 
ATOM   1861 N NE2   . HIS A 1 241 ? 21.577 27.900  -32.439 1.00 22.35  ? 241 HIS A NE2   1 
ATOM   1862 N N     . SER A 1 242 ? 21.693 29.985  -35.959 1.00 22.08  ? 242 SER A N     1 
ATOM   1863 C CA    . SER A 1 242 ? 20.390 29.375  -36.165 1.00 20.97  ? 242 SER A CA    1 
ATOM   1864 C C     . SER A 1 242 ? 20.399 27.970  -35.604 1.00 21.46  ? 242 SER A C     1 
ATOM   1865 O O     . SER A 1 242 ? 21.393 27.246  -35.738 1.00 20.98  ? 242 SER A O     1 
ATOM   1866 C CB    . SER A 1 242 ? 20.005 29.345  -37.644 1.00 19.71  ? 242 SER A CB    1 
ATOM   1867 O OG    . SER A 1 242 ? 18.860 28.526  -37.820 1.00 18.44  ? 242 SER A OG    1 
ATOM   1868 N N     . ASP A 1 243 ? 19.302 27.586  -34.946 1.00 21.34  ? 243 ASP A N     1 
ATOM   1869 C CA    . ASP A 1 243 ? 19.114 26.205  -34.531 1.00 20.97  ? 243 ASP A CA    1 
ATOM   1870 C C     . ASP A 1 243 ? 18.913 25.391  -35.792 1.00 19.29  ? 243 ASP A C     1 
ATOM   1871 O O     . ASP A 1 243 ? 18.576 25.941  -36.826 1.00 18.32  ? 243 ASP A O     1 
ATOM   1872 C CB    . ASP A 1 243 ? 17.860 26.069  -33.667 1.00 23.20  ? 243 ASP A CB    1 
ATOM   1873 C CG    . ASP A 1 243 ? 18.052 26.579  -32.261 1.00 25.81  ? 243 ASP A CG    1 
ATOM   1874 O OD1   . ASP A 1 243 ? 19.206 26.868  -31.851 1.00 26.87  ? 243 ASP A OD1   1 
ATOM   1875 O OD2   . ASP A 1 243 ? 17.034 26.679  -31.549 1.00 26.80  ? 243 ASP A OD2   1 
ATOM   1876 N N     . ALA A 1 244 ? 19.124 24.082  -35.712 1.00 19.22  ? 244 ALA A N     1 
ATOM   1877 C CA    . ALA A 1 244 ? 18.778 23.214  -36.821 1.00 19.81  ? 244 ALA A CA    1 
ATOM   1878 C C     . ALA A 1 244 ? 17.256 23.108  -36.945 1.00 20.19  ? 244 ALA A C     1 
ATOM   1879 O O     . ALA A 1 244 ? 16.508 23.297  -35.961 1.00 19.39  ? 244 ALA A O     1 
ATOM   1880 C CB    . ALA A 1 244 ? 19.371 21.820  -36.620 1.00 19.55  ? 244 ALA A CB    1 
ATOM   1881 N N     . PHE A 1 245 ? 16.803 22.773  -38.148 1.00 20.31  ? 245 PHE A N     1 
ATOM   1882 C CA    . PHE A 1 245 ? 15.390 22.498  -38.390 1.00 20.60  ? 245 PHE A CA    1 
ATOM   1883 C C     . PHE A 1 245 ? 15.225 21.066  -38.881 1.00 19.30  ? 245 PHE A C     1 
ATOM   1884 O O     . PHE A 1 245 ? 14.967 20.836  -40.052 1.00 19.56  ? 245 PHE A O     1 
ATOM   1885 C CB    . PHE A 1 245 ? 14.836 23.461  -39.440 1.00 22.46  ? 245 PHE A CB    1 
ATOM   1886 C CG    . PHE A 1 245 ? 14.679 24.889  -38.948 1.00 24.25  ? 245 PHE A CG    1 
ATOM   1887 C CD1   . PHE A 1 245 ? 15.757 25.770  -38.956 1.00 24.00  ? 245 PHE A CD1   1 
ATOM   1888 C CD2   . PHE A 1 245 ? 13.437 25.355  -38.496 1.00 24.95  ? 245 PHE A CD2   1 
ATOM   1889 C CE1   . PHE A 1 245 ? 15.615 27.093  -38.524 1.00 24.87  ? 245 PHE A CE1   1 
ATOM   1890 C CE2   . PHE A 1 245 ? 13.270 26.687  -38.065 1.00 24.83  ? 245 PHE A CE2   1 
ATOM   1891 C CZ    . PHE A 1 245 ? 14.363 27.558  -38.073 1.00 24.92  ? 245 PHE A CZ    1 
ATOM   1892 N N     . PRO A 1 246 ? 15.354 20.094  -37.987 1.00 19.59  ? 246 PRO A N     1 
ATOM   1893 C CA    . PRO A 1 246 ? 15.265 18.722  -38.459 1.00 19.60  ? 246 PRO A CA    1 
ATOM   1894 C C     . PRO A 1 246 ? 13.860 18.354  -38.972 1.00 21.77  ? 246 PRO A C     1 
ATOM   1895 O O     . PRO A 1 246 ? 12.835 18.880  -38.459 1.00 21.17  ? 246 PRO A O     1 
ATOM   1896 C CB    . PRO A 1 246 ? 15.590 17.907  -37.212 1.00 20.17  ? 246 PRO A CB    1 
ATOM   1897 C CG    . PRO A 1 246 ? 15.251 18.807  -36.072 1.00 20.76  ? 246 PRO A CG    1 
ATOM   1898 C CD    . PRO A 1 246 ? 15.554 20.181  -36.529 1.00 19.60  ? 246 PRO A CD    1 
ATOM   1899 N N     . PRO A 1 247 ? 13.802 17.424  -39.950 1.00 21.55  ? 247 PRO A N     1 
ATOM   1900 C CA    . PRO A 1 247 ? 12.521 16.896  -40.442 1.00 20.94  ? 247 PRO A CA    1 
ATOM   1901 C C     . PRO A 1 247 ? 11.948 15.950  -39.399 1.00 21.06  ? 247 PRO A C     1 
ATOM   1902 O O     . PRO A 1 247 ? 12.649 15.550  -38.497 1.00 19.90  ? 247 PRO A O     1 
ATOM   1903 C CB    . PRO A 1 247 ? 12.929 16.112  -41.702 1.00 20.91  ? 247 PRO A CB    1 
ATOM   1904 C CG    . PRO A 1 247 ? 14.345 15.636  -41.378 1.00 20.96  ? 247 PRO A CG    1 
ATOM   1905 C CD    . PRO A 1 247 ? 14.966 16.767  -40.588 1.00 21.27  ? 247 PRO A CD    1 
ATOM   1906 N N     . PRO A 1 248 ? 10.666 15.594  -39.510 1.00 23.76  ? 248 PRO A N     1 
ATOM   1907 C CA    . PRO A 1 248 ? 10.100 14.628  -38.572 1.00 24.51  ? 248 PRO A CA    1 
ATOM   1908 C C     . PRO A 1 248 ? 10.862 13.292  -38.604 1.00 26.28  ? 248 PRO A C     1 
ATOM   1909 O O     . PRO A 1 248 ? 10.998 12.617  -37.574 1.00 26.13  ? 248 PRO A O     1 
ATOM   1910 C CB    . PRO A 1 248 ? 8.674  14.450  -39.096 1.00 24.84  ? 248 PRO A CB    1 
ATOM   1911 C CG    . PRO A 1 248 ? 8.373  15.779  -39.786 1.00 24.74  ? 248 PRO A CG    1 
ATOM   1912 C CD    . PRO A 1 248 ? 9.668  16.086  -40.483 1.00 23.86  ? 248 PRO A CD    1 
ATOM   1913 N N     . ARG A 1 249 ? 11.373 12.920  -39.776 1.00 26.55  ? 249 ARG A N     1 
ATOM   1914 C CA    . ARG A 1 249 ? 12.173 11.702  -39.890 1.00 28.45  ? 249 ARG A CA    1 
ATOM   1915 C C     . ARG A 1 249 ? 13.369 11.924  -40.812 1.00 26.32  ? 249 ARG A C     1 
ATOM   1916 O O     . ARG A 1 249 ? 13.212 12.265  -41.968 1.00 24.95  ? 249 ARG A O     1 
ATOM   1917 C CB    . ARG A 1 249 ? 11.321 10.542  -40.410 1.00 31.37  ? 249 ARG A CB    1 
ATOM   1918 C CG    . ARG A 1 249 ? 12.001 9.164   -40.303 1.00 35.82  ? 249 ARG A CG    1 
ATOM   1919 C CD    . ARG A 1 249 ? 11.480 8.260   -41.421 1.00 39.70  ? 249 ARG A CD    1 
ATOM   1920 N NE    . ARG A 1 249 ? 11.675 6.825   -41.193 1.00 42.95  ? 249 ARG A NE    1 
ATOM   1921 C CZ    . ARG A 1 249 ? 12.854 6.210   -41.134 1.00 44.16  ? 249 ARG A CZ    1 
ATOM   1922 N NH1   . ARG A 1 249 ? 13.989 6.900   -41.240 1.00 44.85  ? 249 ARG A NH1   1 
ATOM   1923 N NH2   . ARG A 1 249 ? 12.897 4.897   -40.943 1.00 44.82  ? 249 ARG A NH2   1 
ATOM   1924 N N     . VAL A 1 250 ? 14.566 11.765  -40.278 1.00 26.75  ? 250 VAL A N     1 
ATOM   1925 C CA    . VAL A 1 250 ? 15.768 11.974  -41.061 1.00 27.34  ? 250 VAL A CA    1 
ATOM   1926 C C     . VAL A 1 250 ? 16.021 10.697  -41.876 1.00 28.56  ? 250 VAL A C     1 
ATOM   1927 O O     . VAL A 1 250 ? 16.242 9.623   -41.296 1.00 28.97  ? 250 VAL A O     1 
ATOM   1928 C CB    . VAL A 1 250 ? 16.964 12.268  -40.141 1.00 27.18  ? 250 VAL A CB    1 
ATOM   1929 C CG1   . VAL A 1 250 ? 18.284 12.416  -40.973 1.00 26.54  ? 250 VAL A CG1   1 
ATOM   1930 C CG2   . VAL A 1 250 ? 16.712 13.516  -39.321 1.00 26.04  ? 250 VAL A CG2   1 
ATOM   1931 N N     . VAL A 1 251 ? 15.951 10.799  -43.203 1.00 28.44  ? 251 VAL A N     1 
ATOM   1932 C CA    . VAL A 1 251 ? 16.109 9.613   -44.059 1.00 29.16  ? 251 VAL A CA    1 
ATOM   1933 C C     . VAL A 1 251 ? 17.420 9.591   -44.875 1.00 28.92  ? 251 VAL A C     1 
ATOM   1934 O O     . VAL A 1 251 ? 17.936 8.508   -45.206 1.00 29.11  ? 251 VAL A O     1 
ATOM   1935 C CB    . VAL A 1 251 ? 14.902 9.403   -45.014 1.00 30.16  ? 251 VAL A CB    1 
ATOM   1936 C CG1   . VAL A 1 251 ? 13.542 9.467   -44.258 1.00 30.61  ? 251 VAL A CG1   1 
ATOM   1937 C CG2   . VAL A 1 251 ? 14.920 10.396  -46.114 1.00 30.21  ? 251 VAL A CG2   1 
ATOM   1938 N N     . ASP A 1 252 ? 17.981 10.770  -45.165 1.00 26.65  ? 252 ASP A N     1 
ATOM   1939 C CA    . ASP A 1 252 ? 19.130 10.862  -46.084 1.00 23.64  ? 252 ASP A CA    1 
ATOM   1940 C C     . ASP A 1 252 ? 19.874 12.167  -45.874 1.00 21.83  ? 252 ASP A C     1 
ATOM   1941 O O     . ASP A 1 252 ? 19.383 13.235  -46.269 1.00 21.27  ? 252 ASP A O     1 
ATOM   1942 C CB    . ASP A 1 252 ? 18.623 10.762  -47.535 1.00 22.84  ? 252 ASP A CB    1 
ATOM   1943 C CG    . ASP A 1 252 ? 19.699 11.063  -48.555 1.00 23.35  ? 252 ASP A CG    1 
ATOM   1944 O OD1   . ASP A 1 252 ? 20.893 10.914  -48.241 1.00 21.74  ? 252 ASP A OD1   1 
ATOM   1945 O OD2   . ASP A 1 252 ? 19.345 11.480  -49.670 1.00 24.65  ? 252 ASP A OD2   1 
ATOM   1946 N N     . THR A 1 253 ? 21.042 12.100  -45.238 1.00 19.75  ? 253 THR A N     1 
ATOM   1947 C CA    . THR A 1 253 ? 21.825 13.292  -44.999 1.00 19.41  ? 253 THR A CA    1 
ATOM   1948 C C     . THR A 1 253 ? 23.001 13.440  -45.969 1.00 18.65  ? 253 THR A C     1 
ATOM   1949 O O     . THR A 1 253 ? 23.835 14.316  -45.782 1.00 18.53  ? 253 THR A O     1 
ATOM   1950 C CB    . THR A 1 253 ? 22.388 13.316  -43.590 1.00 20.88  ? 253 THR A CB    1 
ATOM   1951 O OG1   . THR A 1 253 ? 23.339 12.248  -43.451 1.00 21.24  ? 253 THR A OG1   1 
ATOM   1952 C CG2   . THR A 1 253 ? 21.242 13.146  -42.555 1.00 20.07  ? 253 THR A CG2   1 
ATOM   1953 N N     . LEU A 1 254 ? 23.074 12.589  -46.994 1.00 17.35  ? 254 LEU A N     1 
ATOM   1954 C CA    . LEU A 1 254 ? 24.118 12.764  -48.011 1.00 17.16  ? 254 LEU A CA    1 
ATOM   1955 C C     . LEU A 1 254 ? 23.878 14.093  -48.746 1.00 15.50  ? 254 LEU A C     1 
ATOM   1956 O O     . LEU A 1 254 ? 22.867 14.269  -49.446 1.00 16.27  ? 254 LEU A O     1 
ATOM   1957 C CB    . LEU A 1 254 ? 24.131 11.575  -49.000 1.00 16.36  ? 254 LEU A CB    1 
ATOM   1958 C CG    . LEU A 1 254 ? 25.105 11.756  -50.184 1.00 17.88  ? 254 LEU A CG    1 
ATOM   1959 C CD1   . LEU A 1 254 ? 26.535 11.771  -49.712 1.00 17.30  ? 254 LEU A CD1   1 
ATOM   1960 C CD2   . LEU A 1 254 ? 24.858 10.675  -51.242 1.00 17.37  ? 254 LEU A CD2   1 
ATOM   1961 N N     . GLY A 1 255 ? 24.792 15.031  -48.563 1.00 15.63  ? 255 GLY A N     1 
ATOM   1962 C CA    . GLY A 1 255 ? 24.744 16.314  -49.277 1.00 15.52  ? 255 GLY A CA    1 
ATOM   1963 C C     . GLY A 1 255 ? 24.042 17.420  -48.501 1.00 14.47  ? 255 GLY A C     1 
ATOM   1964 O O     . GLY A 1 255 ? 23.764 18.473  -49.040 1.00 13.97  ? 255 GLY A O     1 
ATOM   1965 N N     . ALA A 1 256 ? 23.753 17.168  -47.233 1.00 16.46  ? 256 ALA A N     1 
ATOM   1966 C CA    . ALA A 1 256 ? 23.064 18.152  -46.383 1.00 17.24  ? 256 ALA A CA    1 
ATOM   1967 C C     . ALA A 1 256 ? 23.898 19.401  -46.209 1.00 16.62  ? 256 ALA A C     1 
ATOM   1968 O O     . ALA A 1 256 ? 23.371 20.513  -46.228 1.00 16.97  ? 256 ALA A O     1 
ATOM   1969 C CB    . ALA A 1 256 ? 22.742 17.544  -45.011 1.00 16.55  ? 256 ALA A CB    1 
ATOM   1970 N N     . GLY A 1 257 ? 25.209 19.223  -46.021 1.00 16.76  ? 257 GLY A N     1 
ATOM   1971 C CA    . GLY A 1 257 ? 26.120 20.360  -45.863 1.00 15.56  ? 257 GLY A CA    1 
ATOM   1972 C C     . GLY A 1 257 ? 26.185 21.160  -47.148 1.00 16.78  ? 257 GLY A C     1 
ATOM   1973 O O     . GLY A 1 257 ? 26.186 22.404  -47.146 1.00 17.37  ? 257 GLY A O     1 
ATOM   1974 N N     . ASP A 1 258 ? 26.220 20.452  -48.275 1.00 16.65  ? 258 ASP A N     1 
ATOM   1975 C CA    . ASP A 1 258 ? 26.210 21.122  -49.577 1.00 16.68  ? 258 ASP A CA    1 
ATOM   1976 C C     . ASP A 1 258 ? 24.896 21.886  -49.782 1.00 15.27  ? 258 ASP A C     1 
ATOM   1977 O O     . ASP A 1 258 ? 24.882 22.944  -50.380 1.00 14.70  ? 258 ASP A O     1 
ATOM   1978 C CB    . ASP A 1 258 ? 26.370 20.107  -50.698 1.00 15.78  ? 258 ASP A CB    1 
ATOM   1979 C CG    . ASP A 1 258 ? 27.642 19.337  -50.579 1.00 17.43  ? 258 ASP A CG    1 
ATOM   1980 O OD1   . ASP A 1 258 ? 28.661 19.967  -50.174 1.00 17.88  ? 258 ASP A OD1   1 
ATOM   1981 O OD2   . ASP A 1 258 ? 27.624 18.126  -50.905 1.00 16.24  ? 258 ASP A OD2   1 
ATOM   1982 N N     . THR A 1 259 ? 23.799 21.313  -49.312 1.00 14.87  ? 259 THR A N     1 
ATOM   1983 C CA    . THR A 1 259 ? 22.511 22.004  -49.386 1.00 14.96  ? 259 THR A CA    1 
ATOM   1984 C C     . THR A 1 259 ? 22.550 23.267  -48.525 1.00 15.12  ? 259 THR A C     1 
ATOM   1985 O O     . THR A 1 259 ? 22.138 24.329  -48.965 1.00 14.83  ? 259 THR A O     1 
ATOM   1986 C CB    . THR A 1 259 ? 21.383 21.094  -48.927 1.00 15.10  ? 259 THR A CB    1 
ATOM   1987 O OG1   . THR A 1 259 ? 21.386 19.900  -49.747 1.00 17.45  ? 259 THR A OG1   1 
ATOM   1988 C CG2   . THR A 1 259 ? 20.042 21.792  -49.110 1.00 15.33  ? 259 THR A CG2   1 
ATOM   1989 N N     . PHE A 1 260 ? 23.054 23.146  -47.298 1.00 15.17  ? 260 PHE A N     1 
ATOM   1990 C CA    . PHE A 1 260 ? 23.279 24.307  -46.441 1.00 15.29  ? 260 PHE A CA    1 
ATOM   1991 C C     . PHE A 1 260 ? 24.130 25.370  -47.134 1.00 16.33  ? 260 PHE A C     1 
ATOM   1992 O O     . PHE A 1 260 ? 23.720 26.536  -47.223 1.00 18.32  ? 260 PHE A O     1 
ATOM   1993 C CB    . PHE A 1 260 ? 23.929 23.862  -45.113 1.00 16.48  ? 260 PHE A CB    1 
ATOM   1994 C CG    . PHE A 1 260 ? 24.350 25.015  -44.238 1.00 18.06  ? 260 PHE A CG    1 
ATOM   1995 C CD1   . PHE A 1 260 ? 23.436 25.605  -43.362 1.00 17.27  ? 260 PHE A CD1   1 
ATOM   1996 C CD2   . PHE A 1 260 ? 25.656 25.528  -44.320 1.00 17.33  ? 260 PHE A CD2   1 
ATOM   1997 C CE1   . PHE A 1 260 ? 23.825 26.685  -42.571 1.00 18.06  ? 260 PHE A CE1   1 
ATOM   1998 C CE2   . PHE A 1 260 ? 26.048 26.605  -43.563 1.00 17.70  ? 260 PHE A CE2   1 
ATOM   1999 C CZ    . PHE A 1 260 ? 25.126 27.185  -42.671 1.00 17.75  ? 260 PHE A CZ    1 
ATOM   2000 N N     . ASN A 1 261 ? 25.314 24.995  -47.643 1.00 16.21  ? 261 ASN A N     1 
ATOM   2001 C CA    . ASN A 1 261 ? 26.167 25.956  -48.330 1.00 16.31  ? 261 ASN A CA    1 
ATOM   2002 C C     . ASN A 1 261 ? 25.445 26.700  -49.459 1.00 16.71  ? 261 ASN A C     1 
ATOM   2003 O O     . ASN A 1 261 ? 25.493 27.933  -49.546 1.00 15.80  ? 261 ASN A O     1 
ATOM   2004 C CB    . ASN A 1 261 ? 27.444 25.278  -48.879 1.00 17.53  ? 261 ASN A CB    1 
ATOM   2005 C CG    . ASN A 1 261 ? 28.343 24.722  -47.772 1.00 19.55  ? 261 ASN A CG    1 
ATOM   2006 O OD1   . ASN A 1 261 ? 28.174 25.051  -46.588 1.00 18.98  ? 261 ASN A OD1   1 
ATOM   2007 N ND2   . ASN A 1 261 ? 29.276 23.849  -48.150 1.00 19.31  ? 261 ASN A ND2   1 
ATOM   2008 N N     . ALA A 1 262 ? 24.801 25.951  -50.347 1.00 16.19  ? 262 ALA A N     1 
ATOM   2009 C CA    . ALA A 1 262 ? 24.123 26.566  -51.514 1.00 16.95  ? 262 ALA A CA    1 
ATOM   2010 C C     . ALA A 1 262 ? 23.060 27.533  -51.063 1.00 18.31  ? 262 ALA A C     1 
ATOM   2011 O O     . ALA A 1 262 ? 22.878 28.594  -51.662 1.00 19.59  ? 262 ALA A O     1 
ATOM   2012 C CB    . ALA A 1 262 ? 23.487 25.504  -52.379 1.00 14.70  ? 262 ALA A CB    1 
ATOM   2013 N N     . SER A 1 263 ? 22.355 27.153  -49.998 1.00 18.08  ? 263 SER A N     1 
ATOM   2014 C CA    . SER A 1 263 ? 21.228 27.933  -49.517 1.00 18.50  ? 263 SER A CA    1 
ATOM   2015 C C     . SER A 1 263 ? 21.665 29.246  -48.870 1.00 19.11  ? 263 SER A C     1 
ATOM   2016 O O     . SER A 1 263 ? 21.018 30.283  -49.042 1.00 19.43  ? 263 SER A O     1 
ATOM   2017 C CB    . SER A 1 263 ? 20.412 27.082  -48.553 1.00 18.62  ? 263 SER A CB    1 
ATOM   2018 O OG    . SER A 1 263 ? 19.790 26.048  -49.306 1.00 19.09  ? 263 SER A OG    1 
ATOM   2019 N N     . VAL A 1 264 ? 22.783 29.201  -48.148 1.00 18.06  ? 264 VAL A N     1 
ATOM   2020 C CA    . VAL A 1 264 ? 23.359 30.390  -47.566 1.00 17.53  ? 264 VAL A CA    1 
ATOM   2021 C C     . VAL A 1 264 ? 23.843 31.300  -48.687 1.00 18.39  ? 264 VAL A C     1 
ATOM   2022 O O     . VAL A 1 264 ? 23.551 32.497  -48.699 1.00 18.77  ? 264 VAL A O     1 
ATOM   2023 C CB    . VAL A 1 264 ? 24.531 30.024  -46.603 1.00 18.05  ? 264 VAL A CB    1 
ATOM   2024 C CG1   . VAL A 1 264 ? 25.360 31.271  -46.256 1.00 17.43  ? 264 VAL A CG1   1 
ATOM   2025 C CG2   . VAL A 1 264 ? 23.982 29.344  -45.361 1.00 16.68  ? 264 VAL A CG2   1 
ATOM   2026 N N     . ILE A 1 265 ? 24.578 30.739  -49.646 1.00 18.72  ? 265 ILE A N     1 
ATOM   2027 C CA    . ILE A 1 265 ? 25.006 31.507  -50.805 1.00 18.82  ? 265 ILE A CA    1 
ATOM   2028 C C     . ILE A 1 265 ? 23.814 32.208  -51.493 1.00 19.76  ? 265 ILE A C     1 
ATOM   2029 O O     . ILE A 1 265 ? 23.859 33.408  -51.813 1.00 19.55  ? 265 ILE A O     1 
ATOM   2030 C CB    . ILE A 1 265 ? 25.760 30.611  -51.831 1.00 18.50  ? 265 ILE A CB    1 
ATOM   2031 C CG1   . ILE A 1 265 ? 27.156 30.217  -51.305 1.00 18.88  ? 265 ILE A CG1   1 
ATOM   2032 C CG2   . ILE A 1 265 ? 25.905 31.341  -53.154 1.00 17.94  ? 265 ILE A CG2   1 
ATOM   2033 C CD1   . ILE A 1 265 ? 27.800 28.987  -52.026 1.00 19.43  ? 265 ILE A CD1   1 
ATOM   2034 N N     . PHE A 1 266 ? 22.751 31.456  -51.733 1.00 21.15  ? 266 PHE A N     1 
ATOM   2035 C CA    . PHE A 1 266 ? 21.571 31.993  -52.426 1.00 22.38  ? 266 PHE A CA    1 
ATOM   2036 C C     . PHE A 1 266 ? 20.942 33.142  -51.627 1.00 23.00  ? 266 PHE A C     1 
ATOM   2037 O O     . PHE A 1 266 ? 20.662 34.214  -52.164 1.00 23.83  ? 266 PHE A O     1 
ATOM   2038 C CB    . PHE A 1 266 ? 20.537 30.892  -52.644 1.00 23.00  ? 266 PHE A CB    1 
ATOM   2039 C CG    . PHE A 1 266 ? 19.273 31.362  -53.355 1.00 23.89  ? 266 PHE A CG    1 
ATOM   2040 C CD1   . PHE A 1 266 ? 19.262 31.561  -54.732 1.00 24.40  ? 266 PHE A CD1   1 
ATOM   2041 C CD2   . PHE A 1 266 ? 18.109 31.590  -52.646 1.00 24.03  ? 266 PHE A CD2   1 
ATOM   2042 C CE1   . PHE A 1 266 ? 18.101 31.987  -55.380 1.00 25.03  ? 266 PHE A CE1   1 
ATOM   2043 C CE2   . PHE A 1 266 ? 16.951 32.017  -53.287 1.00 24.38  ? 266 PHE A CE2   1 
ATOM   2044 C CZ    . PHE A 1 266 ? 16.952 32.218  -54.648 1.00 23.94  ? 266 PHE A CZ    1 
ATOM   2045 N N     . SER A 1 267 ? 20.706 32.902  -50.346 1.00 22.77  ? 267 SER A N     1 
ATOM   2046 C CA    . SER A 1 267 ? 20.110 33.914  -49.492 1.00 23.39  ? 267 SER A CA    1 
ATOM   2047 C C     . SER A 1 267 ? 20.952 35.194  -49.481 1.00 23.80  ? 267 SER A C     1 
ATOM   2048 O O     . SER A 1 267 ? 20.428 36.299  -49.670 1.00 23.73  ? 267 SER A O     1 
ATOM   2049 C CB    . SER A 1 267 ? 19.912 33.350  -48.087 1.00 23.94  ? 267 SER A CB    1 
ATOM   2050 O OG    . SER A 1 267 ? 19.343 34.304  -47.211 1.00 25.86  ? 267 SER A OG    1 
ATOM   2051 N N     . LEU A 1 268 ? 22.263 35.055  -49.309 1.00 23.02  ? 268 LEU A N     1 
ATOM   2052 C CA    . LEU A 1 268 ? 23.139 36.227  -49.299 1.00 23.60  ? 268 LEU A CA    1 
ATOM   2053 C C     . LEU A 1 268 ? 23.200 36.936  -50.653 1.00 24.75  ? 268 LEU A C     1 
ATOM   2054 O O     . LEU A 1 268 ? 23.276 38.170  -50.724 1.00 24.41  ? 268 LEU A O     1 
ATOM   2055 C CB    . LEU A 1 268 ? 24.552 35.842  -48.847 1.00 22.47  ? 268 LEU A CB    1 
ATOM   2056 C CG    . LEU A 1 268 ? 24.700 35.423  -47.381 1.00 21.93  ? 268 LEU A CG    1 
ATOM   2057 C CD1   . LEU A 1 268 ? 26.167 35.054  -47.085 1.00 20.95  ? 268 LEU A CD1   1 
ATOM   2058 C CD2   . LEU A 1 268 ? 24.227 36.563  -46.478 1.00 21.47  ? 268 LEU A CD2   1 
ATOM   2059 N N     . SER A 1 269 ? 23.182 36.160  -51.732 1.00 25.63  ? 269 SER A N     1 
ATOM   2060 C CA    . SER A 1 269 ? 23.260 36.742  -53.067 1.00 27.35  ? 269 SER A CA    1 
ATOM   2061 C C     . SER A 1 269 ? 21.955 37.482  -53.390 1.00 29.34  ? 269 SER A C     1 
ATOM   2062 O O     . SER A 1 269 ? 21.925 38.333  -54.279 1.00 29.67  ? 269 SER A O     1 
ATOM   2063 C CB    . SER A 1 269 ? 23.540 35.660  -54.125 1.00 26.88  ? 269 SER A CB    1 
ATOM   2064 O OG    . SER A 1 269 ? 22.384 34.855  -54.317 1.00 27.07  ? 269 SER A OG    1 
ATOM   2065 N N     . GLN A 1 270 ? 20.881 37.143  -52.678 1.00 30.76  ? 270 GLN A N     1 
ATOM   2066 C CA    . GLN A 1 270 ? 19.600 37.833  -52.848 1.00 31.82  ? 270 GLN A CA    1 
ATOM   2067 C C     . GLN A 1 270 ? 19.545 39.086  -51.988 1.00 31.59  ? 270 GLN A C     1 
ATOM   2068 O O     . GLN A 1 270 ? 18.547 39.794  -51.985 1.00 32.67  ? 270 GLN A O     1 
ATOM   2069 C CB    . GLN A 1 270 ? 18.429 36.909  -52.511 1.00 32.66  ? 270 GLN A CB    1 
ATOM   2070 C CG    . GLN A 1 270 ? 18.229 35.773  -53.531 1.00 34.48  ? 270 GLN A CG    1 
ATOM   2071 C CD    . GLN A 1 270 ? 17.464 36.211  -54.783 1.00 36.14  ? 270 GLN A CD    1 
ATOM   2072 O OE1   . GLN A 1 270 ? 16.259 36.511  -54.722 1.00 36.75  ? 270 GLN A OE1   1 
ATOM   2073 N NE2   . GLN A 1 270 ? 18.154 36.227  -55.929 1.00 36.17  ? 270 GLN A NE2   1 
ATOM   2074 N N     . GLY A 1 271 ? 20.620 39.350  -51.253 1.00 30.67  ? 271 GLY A N     1 
ATOM   2075 C CA    . GLY A 1 271 ? 20.713 40.535  -50.418 1.00 28.94  ? 271 GLY A CA    1 
ATOM   2076 C C     . GLY A 1 271 ? 20.198 40.374  -48.993 1.00 28.75  ? 271 GLY A C     1 
ATOM   2077 O O     . GLY A 1 271 ? 20.015 41.370  -48.288 1.00 27.43  ? 271 GLY A O     1 
ATOM   2078 N N     . ARG A 1 272 ? 19.965 39.138  -48.546 1.00 27.73  ? 272 ARG A N     1 
ATOM   2079 C CA    . ARG A 1 272 ? 19.464 38.919  -47.188 1.00 26.51  ? 272 ARG A CA    1 
ATOM   2080 C C     . ARG A 1 272 ? 20.576 39.028  -46.150 1.00 25.50  ? 272 ARG A C     1 
ATOM   2081 O O     . ARG A 1 272 ? 21.748 38.924  -46.474 1.00 24.16  ? 272 ARG A O     1 
ATOM   2082 C CB    . ARG A 1 272 ? 18.769 37.561  -47.077 1.00 29.62  ? 272 ARG A CB    1 
ATOM   2083 C CG    . ARG A 1 272 ? 17.726 37.288  -48.187 1.00 33.14  ? 272 ARG A CG    1 
ATOM   2084 C CD    . ARG A 1 272 ? 16.599 38.324  -48.190 1.00 36.48  ? 272 ARG A CD    1 
ATOM   2085 N NE    . ARG A 1 272 ? 15.871 38.316  -46.922 1.00 40.04  ? 272 ARG A NE    1 
ATOM   2086 C CZ    . ARG A 1 272 ? 14.967 39.230  -46.559 1.00 42.43  ? 272 ARG A CZ    1 
ATOM   2087 N NH1   . ARG A 1 272 ? 14.656 40.238  -47.374 1.00 42.92  ? 272 ARG A NH1   1 
ATOM   2088 N NH2   . ARG A 1 272 ? 14.373 39.138  -45.369 1.00 43.11  ? 272 ARG A NH2   1 
ATOM   2089 N N     . SER A 1 273 ? 20.203 39.230  -44.893 1.00 24.23  ? 273 SER A N     1 
ATOM   2090 C CA    . SER A 1 273 ? 21.184 39.335  -43.829 1.00 23.08  ? 273 SER A CA    1 
ATOM   2091 C C     . SER A 1 273 ? 21.860 37.979  -43.554 1.00 23.41  ? 273 SER A C     1 
ATOM   2092 O O     . SER A 1 273 ? 21.312 36.915  -43.869 1.00 23.89  ? 273 SER A O     1 
ATOM   2093 C CB    . SER A 1 273 ? 20.493 39.827  -42.564 1.00 21.86  ? 273 SER A CB    1 
ATOM   2094 O OG    . SER A 1 273 ? 19.708 38.781  -42.000 1.00 20.00  ? 273 SER A OG    1 
ATOM   2095 N N     . VAL A 1 274 ? 23.039 38.011  -42.943 1.00 22.35  ? 274 VAL A N     1 
ATOM   2096 C CA    . VAL A 1 274 ? 23.680 36.774  -42.501 1.00 21.34  ? 274 VAL A CA    1 
ATOM   2097 C C     . VAL A 1 274 ? 22.761 35.926  -41.580 1.00 21.09  ? 274 VAL A C     1 
ATOM   2098 O O     . VAL A 1 274 ? 22.669 34.712  -41.739 1.00 18.53  ? 274 VAL A O     1 
ATOM   2099 C CB    . VAL A 1 274 ? 25.041 37.050  -41.814 1.00 20.24  ? 274 VAL A CB    1 
ATOM   2100 C CG1   . VAL A 1 274 ? 25.596 35.766  -41.176 1.00 20.33  ? 274 VAL A CG1   1 
ATOM   2101 C CG2   . VAL A 1 274 ? 26.030 37.613  -42.814 1.00 20.58  ? 274 VAL A CG2   1 
ATOM   2102 N N     . GLN A 1 275 ? 22.100 36.560  -40.612 1.00 22.34  ? 275 GLN A N     1 
ATOM   2103 C CA    . GLN A 1 275 ? 21.176 35.835  -39.718 1.00 22.04  ? 275 GLN A CA    1 
ATOM   2104 C C     . GLN A 1 275 ? 20.106 35.089  -40.531 1.00 22.09  ? 275 GLN A C     1 
ATOM   2105 O O     . GLN A 1 275 ? 19.817 33.916  -40.271 1.00 21.39  ? 275 GLN A O     1 
ATOM   2106 C CB    . GLN A 1 275 ? 20.518 36.784  -38.689 1.00 23.80  ? 275 GLN A CB    1 
ATOM   2107 C CG    . GLN A 1 275 ? 19.507 36.103  -37.730 1.00 26.29  ? 275 GLN A CG    1 
ATOM   2108 C CD    . GLN A 1 275 ? 20.158 35.084  -36.783 1.00 30.17  ? 275 GLN A CD    1 
ATOM   2109 O OE1   . GLN A 1 275 ? 20.853 35.461  -35.815 1.00 32.35  ? 275 GLN A OE1   1 
ATOM   2110 N NE2   . GLN A 1 275 ? 19.941 33.782  -37.058 1.00 31.16  ? 275 GLN A NE2   1 
ATOM   2111 N N     . GLU A 1 276 ? 19.549 35.760  -41.529 1.00 22.26  ? 276 GLU A N     1 
ATOM   2112 C CA    . GLU A 1 276 ? 18.521 35.175  -42.390 1.00 24.59  ? 276 GLU A CA    1 
ATOM   2113 C C     . GLU A 1 276 ? 19.077 34.012  -43.209 1.00 22.65  ? 276 GLU A C     1 
ATOM   2114 O O     . GLU A 1 276 ? 18.456 32.951  -43.300 1.00 21.74  ? 276 GLU A O     1 
ATOM   2115 C CB    . GLU A 1 276 ? 18.002 36.237  -43.349 1.00 28.39  ? 276 GLU A CB    1 
ATOM   2116 C CG    . GLU A 1 276 ? 16.523 36.487  -43.261 1.00 35.56  ? 276 GLU A CG    1 
ATOM   2117 C CD    . GLU A 1 276 ? 15.758 35.916  -44.444 1.00 39.20  ? 276 GLU A CD    1 
ATOM   2118 O OE1   . GLU A 1 276 ? 15.082 36.722  -45.138 1.00 39.85  ? 276 GLU A OE1   1 
ATOM   2119 O OE2   . GLU A 1 276 ? 15.840 34.673  -44.674 1.00 41.76  ? 276 GLU A OE2   1 
ATOM   2120 N N     . ALA A 1 277 ? 20.250 34.227  -43.809 1.00 20.54  ? 277 ALA A N     1 
ATOM   2121 C CA    . ALA A 1 277 ? 20.911 33.201  -44.607 1.00 19.09  ? 277 ALA A CA    1 
ATOM   2122 C C     . ALA A 1 277 ? 21.173 31.957  -43.773 1.00 17.88  ? 277 ALA A C     1 
ATOM   2123 O O     . ALA A 1 277 ? 20.913 30.855  -44.222 1.00 17.87  ? 277 ALA A O     1 
ATOM   2124 C CB    . ALA A 1 277 ? 22.207 33.748  -45.201 1.00 18.80  ? 277 ALA A CB    1 
ATOM   2125 N N     . LEU A 1 278 ? 21.648 32.135  -42.539 1.00 17.31  ? 278 LEU A N     1 
ATOM   2126 C CA    . LEU A 1 278 ? 21.908 31.003  -41.656 1.00 17.51  ? 278 LEU A CA    1 
ATOM   2127 C C     . LEU A 1 278 ? 20.647 30.225  -41.424 1.00 18.64  ? 278 LEU A C     1 
ATOM   2128 O O     . LEU A 1 278 ? 20.656 28.999  -41.518 1.00 17.61  ? 278 LEU A O     1 
ATOM   2129 C CB    . LEU A 1 278 ? 22.419 31.447  -40.284 1.00 16.85  ? 278 LEU A CB    1 
ATOM   2130 C CG    . LEU A 1 278 ? 23.885 31.793  -40.104 1.00 18.39  ? 278 LEU A CG    1 
ATOM   2131 C CD1   . LEU A 1 278 ? 24.092 32.127  -38.596 1.00 16.94  ? 278 LEU A CD1   1 
ATOM   2132 C CD2   . LEU A 1 278 ? 24.816 30.668  -40.602 1.00 15.43  ? 278 LEU A CD2   1 
ATOM   2133 N N     . ARG A 1 279 ? 19.576 30.938  -41.058 1.00 19.18  ? 279 ARG A N     1 
ATOM   2134 C CA    . ARG A 1 279 ? 18.266 30.302  -40.871 1.00 21.02  ? 279 ARG A CA    1 
ATOM   2135 C C     . ARG A 1 279 ? 17.753 29.602  -42.139 1.00 19.08  ? 279 ARG A C     1 
ATOM   2136 O O     . ARG A 1 279 ? 17.367 28.443  -42.090 1.00 18.55  ? 279 ARG A O     1 
ATOM   2137 C CB    . ARG A 1 279 ? 17.208 31.294  -40.368 1.00 21.86  ? 279 ARG A CB    1 
ATOM   2138 C CG    . ARG A 1 279 ? 15.805 30.658  -40.249 1.00 22.98  ? 279 ARG A CG    1 
ATOM   2139 C CD    . ARG A 1 279 ? 14.729 31.629  -39.717 1.00 24.35  ? 279 ARG A CD    1 
ATOM   2140 N NE    . ARG A 1 279 ? 14.519 32.799  -40.564 1.00 26.55  ? 279 ARG A NE    1 
ATOM   2141 C CZ    . ARG A 1 279 ? 14.876 34.037  -40.212 1.00 28.67  ? 279 ARG A CZ    1 
ATOM   2142 N NH1   . ARG A 1 279 ? 15.462 34.255  -39.032 1.00 29.13  ? 279 ARG A NH1   1 
ATOM   2143 N NH2   . ARG A 1 279 ? 14.648 35.054  -41.034 1.00 29.08  ? 279 ARG A NH2   1 
ATOM   2144 N N     . PHE A 1 280 ? 17.754 30.299  -43.266 1.00 19.25  ? 280 PHE A N     1 
ATOM   2145 C CA    . PHE A 1 280 ? 17.336 29.677  -44.526 1.00 20.17  ? 280 PHE A CA    1 
ATOM   2146 C C     . PHE A 1 280 ? 18.191 28.429  -44.797 1.00 21.16  ? 280 PHE A C     1 
ATOM   2147 O O     . PHE A 1 280 ? 17.668 27.377  -45.141 1.00 22.63  ? 280 PHE A O     1 
ATOM   2148 C CB    . PHE A 1 280 ? 17.455 30.672  -45.681 1.00 19.80  ? 280 PHE A CB    1 
ATOM   2149 C CG    . PHE A 1 280 ? 16.888 30.180  -46.980 1.00 19.01  ? 280 PHE A CG    1 
ATOM   2150 C CD1   . PHE A 1 280 ? 15.526 29.907  -47.107 1.00 19.54  ? 280 PHE A CD1   1 
ATOM   2151 C CD2   . PHE A 1 280 ? 17.715 30.007  -48.092 1.00 19.57  ? 280 PHE A CD2   1 
ATOM   2152 C CE1   . PHE A 1 280 ? 15.016 29.460  -48.297 1.00 18.34  ? 280 PHE A CE1   1 
ATOM   2153 C CE2   . PHE A 1 280 ? 17.205 29.569  -49.310 1.00 18.33  ? 280 PHE A CE2   1 
ATOM   2154 C CZ    . PHE A 1 280 ? 15.859 29.303  -49.419 1.00 18.85  ? 280 PHE A CZ    1 
ATOM   2155 N N     . GLY A 1 281 ? 19.511 28.552  -44.630 1.00 21.62  ? 281 GLY A N     1 
ATOM   2156 C CA    . GLY A 1 281 ? 20.409 27.440  -44.850 1.00 19.32  ? 281 GLY A CA    1 
ATOM   2157 C C     . GLY A 1 281 ? 20.037 26.246  -44.011 1.00 19.82  ? 281 GLY A C     1 
ATOM   2158 O O     . GLY A 1 281 ? 20.023 25.111  -44.499 1.00 20.05  ? 281 GLY A O     1 
ATOM   2159 N N     . CYS A 1 282 ? 19.752 26.479  -42.730 1.00 18.94  ? 282 CYS A N     1 
ATOM   2160 C CA    . CYS A 1 282 ? 19.366 25.389  -41.842 1.00 18.56  ? 282 CYS A CA    1 
ATOM   2161 C C     . CYS A 1 282 ? 18.019 24.746  -42.192 1.00 18.56  ? 282 CYS A C     1 
ATOM   2162 O O     . CYS A 1 282 ? 17.819 23.536  -41.979 1.00 15.93  ? 282 CYS A O     1 
ATOM   2163 C CB    . CYS A 1 282 ? 19.343 25.861  -40.390 1.00 19.45  ? 282 CYS A CB    1 
ATOM   2164 S SG    . CYS A 1 282 ? 21.018 26.038  -39.678 1.00 21.07  ? 282 CYS A SG    1 
ATOM   2165 N N     . GLN A 1 283 ? 17.101 25.564  -42.696 1.00 18.67  ? 283 GLN A N     1 
ATOM   2166 C CA    . GLN A 1 283 ? 15.742 25.107  -43.056 1.00 19.94  ? 283 GLN A CA    1 
ATOM   2167 C C     . GLN A 1 283 ? 15.736 24.252  -44.309 1.00 19.01  ? 283 GLN A C     1 
ATOM   2168 O O     . GLN A 1 283 ? 15.105 23.202  -44.343 1.00 18.41  ? 283 GLN A O     1 
ATOM   2169 C CB    . GLN A 1 283 ? 14.804 26.304  -43.247 1.00 19.92  ? 283 GLN A CB    1 
ATOM   2170 C CG    . GLN A 1 283 ? 14.385 26.933  -41.920 1.00 21.65  ? 283 GLN A CG    1 
ATOM   2171 C CD    . GLN A 1 283 ? 13.690 28.270  -42.079 1.00 23.29  ? 283 GLN A CD    1 
ATOM   2172 O OE1   . GLN A 1 283 ? 13.941 29.013  -43.039 1.00 23.87  ? 283 GLN A OE1   1 
ATOM   2173 N NE2   . GLN A 1 283 ? 12.808 28.593  -41.129 1.00 23.47  ? 283 GLN A NE2   1 
ATOM   2174 N N     . VAL A 1 284 ? 16.456 24.693  -45.335 1.00 19.37  ? 284 VAL A N     1 
ATOM   2175 C CA    . VAL A 1 284 ? 16.506 23.930  -46.569 1.00 18.93  ? 284 VAL A CA    1 
ATOM   2176 C C     . VAL A 1 284 ? 17.271 22.628  -46.317 1.00 19.28  ? 284 VAL A C     1 
ATOM   2177 O O     . VAL A 1 284 ? 16.814 21.557  -46.718 1.00 17.64  ? 284 VAL A O     1 
ATOM   2178 C CB    . VAL A 1 284 ? 17.089 24.745  -47.750 1.00 20.32  ? 284 VAL A CB    1 
ATOM   2179 C CG1   . VAL A 1 284 ? 17.098 23.912  -49.074 1.00 19.21  ? 284 VAL A CG1   1 
ATOM   2180 C CG2   . VAL A 1 284 ? 16.304 26.056  -47.927 1.00 20.45  ? 284 VAL A CG2   1 
ATOM   2181 N N     . ALA A 1 285 ? 18.410 22.709  -45.619 1.00 18.35  ? 285 ALA A N     1 
ATOM   2182 C CA    . ALA A 1 285 ? 19.171 21.499  -45.288 1.00 18.50  ? 285 ALA A CA    1 
ATOM   2183 C C     . ALA A 1 285 ? 18.317 20.517  -44.523 1.00 17.83  ? 285 ALA A C     1 
ATOM   2184 O O     . ALA A 1 285 ? 18.314 19.325  -44.824 1.00 19.02  ? 285 ALA A O     1 
ATOM   2185 C CB    . ALA A 1 285 ? 20.454 21.822  -44.467 1.00 17.48  ? 285 ALA A CB    1 
ATOM   2186 N N     . GLY A 1 286 ? 17.623 21.003  -43.499 1.00 17.78  ? 286 GLY A N     1 
ATOM   2187 C CA    . GLY A 1 286 ? 16.750 20.136  -42.703 1.00 18.15  ? 286 GLY A CA    1 
ATOM   2188 C C     . GLY A 1 286 ? 15.633 19.528  -43.531 1.00 18.78  ? 286 GLY A C     1 
ATOM   2189 O O     . GLY A 1 286 ? 15.308 18.360  -43.401 1.00 19.60  ? 286 GLY A O     1 
ATOM   2190 N N     . LYS A 1 287 ? 15.057 20.302  -44.426 1.00 20.90  ? 287 LYS A N     1 
ATOM   2191 C CA    . LYS A 1 287 ? 14.061 19.714  -45.320 1.00 23.15  ? 287 LYS A CA    1 
ATOM   2192 C C     . LYS A 1 287 ? 14.713 18.624  -46.180 1.00 23.29  ? 287 LYS A C     1 
ATOM   2193 O O     . LYS A 1 287 ? 14.149 17.544  -46.392 1.00 22.49  ? 287 LYS A O     1 
ATOM   2194 C CB    . LYS A 1 287 ? 13.446 20.786  -46.201 1.00 24.41  ? 287 LYS A CB    1 
ATOM   2195 C CG    . LYS A 1 287 ? 12.270 20.301  -46.987 1.00 27.31  ? 287 LYS A CG    1 
ATOM   2196 C CD    . LYS A 1 287 ? 11.679 21.428  -47.819 1.00 29.11  ? 287 LYS A CD    1 
ATOM   2197 C CE    . LYS A 1 287 ? 10.430 20.950  -48.610 1.00 29.64  ? 287 LYS A CE    1 
ATOM   2198 N NZ    . LYS A 1 287 ? 10.014 22.067  -49.525 1.00 30.46  ? 287 LYS A NZ    1 
ATOM   2199 N N     . LYS A 1 288 ? 15.919 18.899  -46.673 1.00 22.84  ? 288 LYS A N     1 
ATOM   2200 C CA    . LYS A 1 288 ? 16.596 17.932  -47.539 1.00 21.39  ? 288 LYS A CA    1 
ATOM   2201 C C     . LYS A 1 288 ? 16.847 16.604  -46.800 1.00 21.06  ? 288 LYS A C     1 
ATOM   2202 O O     . LYS A 1 288 ? 16.726 15.516  -47.380 1.00 19.48  ? 288 LYS A O     1 
ATOM   2203 C CB    . LYS A 1 288 ? 17.880 18.533  -48.094 1.00 21.46  ? 288 LYS A CB    1 
ATOM   2204 C CG    . LYS A 1 288 ? 19.073 17.601  -48.044 1.00 24.23  ? 288 LYS A CG    1 
ATOM   2205 C CD    . LYS A 1 288 ? 19.040 16.625  -49.131 1.00 23.52  ? 288 LYS A CD    1 
ATOM   2206 C CE    . LYS A 1 288 ? 19.719 15.320  -48.678 1.00 21.94  ? 288 LYS A CE    1 
ATOM   2207 N NZ    . LYS A 1 288 ? 18.758 14.226  -48.971 1.00 18.90  ? 288 LYS A NZ    1 
ATOM   2208 N N     . CYS A 1 289 ? 17.161 16.693  -45.511 1.00 19.94  ? 289 CYS A N     1 
ATOM   2209 C CA    . CYS A 1 289 ? 17.427 15.503  -44.712 1.00 19.60  ? 289 CYS A CA    1 
ATOM   2210 C C     . CYS A 1 289 ? 16.259 14.522  -44.597 1.00 20.72  ? 289 CYS A C     1 
ATOM   2211 O O     . CYS A 1 289 ? 16.465 13.355  -44.269 1.00 19.72  ? 289 CYS A O     1 
ATOM   2212 C CB    . CYS A 1 289 ? 17.915 15.900  -43.327 1.00 19.25  ? 289 CYS A CB    1 
ATOM   2213 S SG    . CYS A 1 289 ? 19.611 16.538  -43.372 1.00 22.59  ? 289 CYS A SG    1 
ATOM   2214 N N     . GLY A 1 290 ? 15.046 14.990  -44.870 1.00 21.92  ? 290 GLY A N     1 
ATOM   2215 C CA    . GLY A 1 290 ? 13.857 14.169  -44.703 1.00 25.11  ? 290 GLY A CA    1 
ATOM   2216 C C     . GLY A 1 290 ? 13.433 13.580  -46.025 1.00 26.97  ? 290 GLY A C     1 
ATOM   2217 O O     . GLY A 1 290 ? 12.324 13.094  -46.143 1.00 28.85  ? 290 GLY A O     1 
ATOM   2218 N N     . LEU A 1 291 ? 14.327 13.627  -47.014 1.00 28.28  ? 291 LEU A N     1 
ATOM   2219 C CA    . LEU A 1 291 ? 14.025 13.265  -48.410 1.00 29.53  ? 291 LEU A CA    1 
ATOM   2220 C C     . LEU A 1 291 ? 15.223 12.556  -49.009 1.00 30.06  ? 291 LEU A C     1 
ATOM   2221 O O     . LEU A 1 291 ? 16.369 12.837  -48.659 1.00 28.65  ? 291 LEU A O     1 
ATOM   2222 C CB    . LEU A 1 291 ? 13.790 14.521  -49.259 1.00 31.22  ? 291 LEU A CB    1 
ATOM   2223 C CG    . LEU A 1 291 ? 12.595 15.423  -48.966 1.00 32.50  ? 291 LEU A CG    1 
ATOM   2224 C CD1   . LEU A 1 291 ? 12.744 16.774  -49.651 1.00 32.15  ? 291 LEU A CD1   1 
ATOM   2225 C CD2   . LEU A 1 291 ? 11.285 14.715  -49.377 1.00 33.55  ? 291 LEU A CD2   1 
ATOM   2226 N N     . GLN A 1 292 ? 14.960 11.640  -49.931 1.00 31.08  ? 292 GLN A N     1 
ATOM   2227 C CA    . GLN A 1 292 ? 16.034 10.973  -50.648 1.00 32.05  ? 292 GLN A CA    1 
ATOM   2228 C C     . GLN A 1 292 ? 16.526 11.939  -51.724 1.00 30.25  ? 292 GLN A C     1 
ATOM   2229 O O     . GLN A 1 292 ? 15.715 12.484  -52.466 1.00 29.08  ? 292 GLN A O     1 
ATOM   2230 C CB    . GLN A 1 292 ? 15.499 9.684   -51.284 1.00 35.02  ? 292 GLN A CB    1 
ATOM   2231 C CG    . GLN A 1 292 ? 16.455 8.519   -51.169 1.00 38.72  ? 292 GLN A CG    1 
ATOM   2232 C CD    . GLN A 1 292 ? 16.508 7.930   -49.759 1.00 41.00  ? 292 GLN A CD    1 
ATOM   2233 O OE1   . GLN A 1 292 ? 17.726 7.635   -49.273 1.00 42.23  ? 292 GLN A OE1   1 
ATOM   2234 N NE2   . GLN A 1 292 ? 15.466 7.721   -49.127 1.00 40.85  ? 292 GLN A NE2   1 
ATOM   2235 N N     . GLY A 1 293 ? 17.834 12.190  -51.792 1.00 29.27  ? 293 GLY A N     1 
ATOM   2236 C CA    . GLY A 1 293 ? 18.361 13.121  -52.819 1.00 28.49  ? 293 GLY A CA    1 
ATOM   2237 C C     . GLY A 1 293 ? 17.920 14.572  -52.591 1.00 27.60  ? 293 GLY A C     1 
ATOM   2238 O O     . GLY A 1 293 ? 17.708 14.972  -51.443 1.00 27.05  ? 293 GLY A O     1 
ATOM   2239 N N     . PHE A 1 294 ? 17.758 15.345  -53.670 1.00 26.40  ? 294 PHE A N     1 
ATOM   2240 C CA    . PHE A 1 294 ? 17.554 16.810  -53.571 1.00 27.49  ? 294 PHE A CA    1 
ATOM   2241 C C     . PHE A 1 294 ? 16.227 17.357  -54.104 1.00 29.10  ? 294 PHE A C     1 
ATOM   2242 O O     . PHE A 1 294 ? 15.772 18.410  -53.681 1.00 29.43  ? 294 PHE A O     1 
ATOM   2243 C CB    . PHE A 1 294 ? 18.697 17.561  -54.286 1.00 24.88  ? 294 PHE A CB    1 
ATOM   2244 C CG    . PHE A 1 294 ? 20.074 17.203  -53.771 1.00 24.38  ? 294 PHE A CG    1 
ATOM   2245 C CD1   . PHE A 1 294 ? 20.870 16.308  -54.462 1.00 23.90  ? 294 PHE A CD1   1 
ATOM   2246 C CD2   . PHE A 1 294 ? 20.557 17.756  -52.586 1.00 23.77  ? 294 PHE A CD2   1 
ATOM   2247 C CE1   . PHE A 1 294 ? 22.136 15.955  -53.996 1.00 24.47  ? 294 PHE A CE1   1 
ATOM   2248 C CE2   . PHE A 1 294 ? 21.826 17.414  -52.109 1.00 24.53  ? 294 PHE A CE2   1 
ATOM   2249 C CZ    . PHE A 1 294 ? 22.617 16.500  -52.826 1.00 24.32  ? 294 PHE A CZ    1 
ATOM   2250 N N     . ASP A 1 295 ? 15.618 16.657  -55.047 1.00 31.91  ? 295 ASP A N     1 
ATOM   2251 C CA    . ASP A 1 295 ? 14.509 17.229  -55.806 1.00 34.94  ? 295 ASP A CA    1 
ATOM   2252 C C     . ASP A 1 295 ? 13.340 17.812  -55.006 1.00 35.84  ? 295 ASP A C     1 
ATOM   2253 O O     . ASP A 1 295 ? 12.839 18.890  -55.345 1.00 37.19  ? 295 ASP A O     1 
ATOM   2254 C CB    . ASP A 1 295 ? 14.007 16.231  -56.844 1.00 36.10  ? 295 ASP A CB    1 
ATOM   2255 C CG    . ASP A 1 295 ? 14.950 16.123  -58.015 1.00 37.20  ? 295 ASP A CG    1 
ATOM   2256 O OD1   . ASP A 1 295 ? 15.916 16.916  -58.059 1.00 37.32  ? 295 ASP A OD1   1 
ATOM   2257 O OD2   . ASP A 1 295 ? 14.728 15.263  -58.883 1.00 38.09  ? 295 ASP A OD2   1 
ATOM   2258 N N     . GLY A 1 296 ? 12.904 17.119  -53.962 1.00 35.86  ? 296 GLY A N     1 
ATOM   2259 C CA    . GLY A 1 296 ? 11.751 17.603  -53.188 1.00 35.93  ? 296 GLY A CA    1 
ATOM   2260 C C     . GLY A 1 296 ? 11.941 18.833  -52.298 1.00 36.11  ? 296 GLY A C     1 
ATOM   2261 O O     . GLY A 1 296 ? 11.007 19.229  -51.570 1.00 34.97  ? 296 GLY A O     1 
ATOM   2262 N N     . ILE A 1 297 ? 13.126 19.444  -52.312 1.00 35.09  ? 297 ILE A N     1 
ATOM   2263 C CA    . ILE A 1 297 ? 13.308 20.622  -51.468 1.00 35.91  ? 297 ILE A CA    1 
ATOM   2264 C C     . ILE A 1 297 ? 12.392 21.758  -51.940 1.00 37.16  ? 297 ILE A C     1 
ATOM   2265 O O     . ILE A 1 297 ? 11.977 22.594  -51.143 1.00 36.44  ? 297 ILE A O     1 
ATOM   2266 C CB    . ILE A 1 297 ? 14.799 21.102  -51.312 1.00 35.62  ? 297 ILE A CB    1 
ATOM   2267 C CG1   . ILE A 1 297 ? 15.318 21.740  -52.599 1.00 36.04  ? 297 ILE A CG1   1 
ATOM   2268 C CG2   . ILE A 1 297 ? 15.703 19.974  -50.816 1.00 35.62  ? 297 ILE A CG2   1 
ATOM   2269 C CD1   . ILE A 1 297 ? 16.785 22.214  -52.512 1.00 35.86  ? 297 ILE A CD1   1 
ATOM   2270 N N     . VAL A 1 298 ? 12.079 21.777  -53.236 1.00 38.94  ? 298 VAL A N     1 
ATOM   2271 C CA    . VAL A 1 298 ? 11.087 22.711  -53.772 1.00 41.26  ? 298 VAL A CA    1 
ATOM   2272 C C     . VAL A 1 298 ? 9.937  21.950  -54.432 1.00 42.71  ? 298 VAL A C     1 
ATOM   2273 O O     . VAL A 1 298 ? 10.023 20.757  -54.737 1.00 43.46  ? 298 VAL A O     1 
ATOM   2274 C CB    . VAL A 1 298 ? 11.682 23.711  -54.792 1.00 41.22  ? 298 VAL A CB    1 
ATOM   2275 C CG1   . VAL A 1 298 ? 12.651 24.672  -54.116 1.00 41.40  ? 298 VAL A CG1   1 
ATOM   2276 C CG2   . VAL A 1 298 ? 12.344 22.979  -55.958 1.00 41.45  ? 298 VAL A CG2   1 
ATOM   2277 O OXT   . VAL A 1 298 ? 8.880  22.520  -54.681 1.00 44.61  ? 298 VAL A OXT   1 
HETATM 2278 C C1    . FRU B 2 .   ? 29.022 15.282  -49.835 1.00 49.54  ? 601 FRU A C1    1 
HETATM 2279 C C2    . FRU B 2 .   ? 29.959 14.865  -50.994 1.00 50.06  ? 601 FRU A C2    1 
HETATM 2280 C C3    . FRU B 2 .   ? 29.495 13.605  -51.707 1.00 50.08  ? 601 FRU A C3    1 
HETATM 2281 C C4    . FRU B 2 .   ? 30.745 13.310  -52.512 1.00 50.49  ? 601 FRU A C4    1 
HETATM 2282 C C5    . FRU B 2 .   ? 31.812 13.432  -51.410 1.00 51.79  ? 601 FRU A C5    1 
HETATM 2283 C C6    . FRU B 2 .   ? 33.268 13.550  -51.976 1.00 51.95  ? 601 FRU A C6    1 
HETATM 2284 O O1    . FRU B 2 .   ? 29.300 16.639  -49.442 1.00 48.40  ? 601 FRU A O1    1 
HETATM 2285 O O2    . FRU B 2 .   ? 30.049 15.905  -51.951 1.00 49.82  ? 601 FRU A O2    1 
HETATM 2286 O O3    . FRU B 2 .   ? 28.413 13.900  -52.584 1.00 49.66  ? 601 FRU A O3    1 
HETATM 2287 O O4    . FRU B 2 .   ? 30.695 11.983  -52.974 1.00 49.78  ? 601 FRU A O4    1 
HETATM 2288 O O5    . FRU B 2 .   ? 31.319 14.557  -50.536 1.00 51.38  ? 601 FRU A O5    1 
HETATM 2289 O O6    . FRU B 2 .   ? 33.716 14.928  -52.024 1.00 52.79  ? 601 FRU A O6    1 
HETATM 2290 S S     . SO4 C 3 .   ? 34.014 3.798   -70.186 1.00 127.94 ? 401 SO4 A S     1 
HETATM 2291 O O1    . SO4 C 3 .   ? 32.575 4.221   -70.244 1.00 127.93 ? 401 SO4 A O1    1 
HETATM 2292 O O2    . SO4 C 3 .   ? 34.106 2.338   -70.520 1.00 128.01 ? 401 SO4 A O2    1 
HETATM 2293 O O3    . SO4 C 3 .   ? 34.815 4.591   -71.178 1.00 127.88 ? 401 SO4 A O3    1 
HETATM 2294 O O4    . SO4 C 3 .   ? 34.560 4.031   -68.806 1.00 127.92 ? 401 SO4 A O4    1 
HETATM 2295 P PG    . ANP D 4 .   ? 27.533 16.187  -46.573 1.00 55.71  ? 301 ANP A PG    1 
HETATM 2296 O O1G   . ANP D 4 .   ? 29.134 16.120  -46.199 1.00 55.60  ? 301 ANP A O1G   1 
HETATM 2297 O O2G   . ANP D 4 .   ? 27.099 14.849  -47.075 1.00 52.57  ? 301 ANP A O2G   1 
HETATM 2298 O O3G   . ANP D 4 .   ? 27.398 17.386  -47.693 1.00 54.71  ? 301 ANP A O3G   1 
HETATM 2299 P PB    . ANP D 4 .   ? 27.672 17.344  -43.958 1.00 61.56  ? 301 ANP A PB    1 
HETATM 2300 O O1B   . ANP D 4 .   ? 28.549 16.114  -43.323 1.00 61.26  ? 301 ANP A O1B   1 
HETATM 2301 O O2B   . ANP D 4 .   ? 28.799 18.430  -44.516 1.00 61.57  ? 301 ANP A O2B   1 
HETATM 2302 N N3B   . ANP D 4 .   ? 26.734 16.765  -45.227 1.00 57.55  ? 301 ANP A N3B   1 
HETATM 2303 P PA    . ANP D 4 .   ? 26.864 19.505  -41.942 1.00 64.37  ? 301 ANP A PA    1 
HETATM 2304 O O1A   . ANP D 4 .   ? 27.272 19.396  -40.510 1.00 63.91  ? 301 ANP A O1A   1 
HETATM 2305 O O2A   . ANP D 4 .   ? 27.601 20.458  -42.819 1.00 64.28  ? 301 ANP A O2A   1 
HETATM 2306 O O3A   . ANP D 4 .   ? 26.741 17.989  -42.691 1.00 62.92  ? 301 ANP A O3A   1 
HETATM 2307 O "O5'" . ANP D 4 .   ? 25.300 19.953  -41.964 1.00 64.40  ? 301 ANP A "O5'" 1 
HETATM 2308 C "C5'" . ANP D 4 .   ? 24.921 21.212  -42.536 1.00 64.60  ? 301 ANP A "C5'" 1 
HETATM 2309 C "C4'" . ANP D 4 .   ? 23.600 21.699  -41.957 1.00 64.74  ? 301 ANP A "C4'" 1 
HETATM 2310 O "O4'" . ANP D 4 .   ? 22.676 20.656  -42.280 1.00 64.92  ? 301 ANP A "O4'" 1 
HETATM 2311 C "C3'" . ANP D 4 .   ? 23.621 21.741  -40.426 1.00 64.90  ? 301 ANP A "C3'" 1 
HETATM 2312 O "O3'" . ANP D 4 .   ? 24.018 23.024  -39.949 1.00 64.86  ? 301 ANP A "O3'" 1 
HETATM 2313 C "C2'" . ANP D 4 .   ? 22.159 21.576  -40.103 1.00 65.21  ? 301 ANP A "C2'" 1 
HETATM 2314 O "O2'" . ANP D 4 .   ? 21.542 22.860  -40.216 1.00 65.52  ? 301 ANP A "O2'" 1 
HETATM 2315 C "C1'" . ANP D 4 .   ? 21.674 20.624  -41.210 1.00 65.68  ? 301 ANP A "C1'" 1 
HETATM 2316 N N9    . ANP D 4 .   ? 21.671 19.257  -40.640 1.00 65.95  ? 301 ANP A N9    1 
HETATM 2317 C C8    . ANP D 4 .   ? 22.658 18.366  -40.782 1.00 66.01  ? 301 ANP A C8    1 
HETATM 2318 N N7    . ANP D 4 .   ? 22.338 17.249  -40.134 1.00 66.34  ? 301 ANP A N7    1 
HETATM 2319 C C5    . ANP D 4 .   ? 21.148 17.425  -39.576 1.00 66.16  ? 301 ANP A C5    1 
HETATM 2320 C C6    . ANP D 4 .   ? 20.336 16.612  -38.803 1.00 66.21  ? 301 ANP A C6    1 
HETATM 2321 N N6    . ANP D 4 .   ? 20.734 15.378  -38.491 1.00 65.88  ? 301 ANP A N6    1 
HETATM 2322 N N1    . ANP D 4 .   ? 19.154 17.101  -38.383 1.00 66.05  ? 301 ANP A N1    1 
HETATM 2323 C C2    . ANP D 4 .   ? 18.774 18.332  -38.704 1.00 65.86  ? 301 ANP A C2    1 
HETATM 2324 N N3    . ANP D 4 .   ? 19.524 19.131  -39.445 1.00 65.83  ? 301 ANP A N3    1 
HETATM 2325 C C4    . ANP D 4 .   ? 20.716 18.704  -39.892 1.00 66.11  ? 301 ANP A C4    1 
HETATM 2326 C C1    . GOL E 5 .   ? 29.224 -2.466  -62.665 1.00 60.27  ? 501 GOL A C1    1 
HETATM 2327 O O1    . GOL E 5 .   ? 29.576 -2.428  -61.272 1.00 59.25  ? 501 GOL A O1    1 
HETATM 2328 C C2    . GOL E 5 .   ? 29.501 -1.075  -63.253 1.00 60.65  ? 501 GOL A C2    1 
HETATM 2329 O O2    . GOL E 5 .   ? 29.053 -0.086  -62.308 1.00 60.58  ? 501 GOL A O2    1 
HETATM 2330 C C3    . GOL E 5 .   ? 28.855 -0.862  -64.648 1.00 60.84  ? 501 GOL A C3    1 
HETATM 2331 O O3    . GOL E 5 .   ? 27.422 -0.762  -64.556 1.00 61.00  ? 501 GOL A O3    1 
HETATM 2332 O O     . HOH F 6 .   ? 23.609 16.773  -57.035 1.00 20.39  ? 602 HOH A O     1 
HETATM 2333 O O     . HOH F 6 .   ? 12.371 21.442  -37.428 1.00 21.27  ? 603 HOH A O     1 
HETATM 2334 O O     . HOH F 6 .   ? 29.185 22.659  -50.981 1.00 22.15  ? 604 HOH A O     1 
HETATM 2335 O O     . HOH F 6 .   ? 27.460 1.360   -52.508 1.00 21.06  ? 605 HOH A O     1 
HETATM 2336 O O     . HOH F 6 .   ? 39.665 20.021  -59.573 1.00 17.99  ? 606 HOH A O     1 
HETATM 2337 O O     . HOH F 6 .   ? 37.466 19.309  -60.795 1.00 20.00  ? 607 HOH A O     1 
HETATM 2338 O O     . HOH F 6 .   ? 40.637 34.482  -34.233 1.00 18.24  ? 608 HOH A O     1 
HETATM 2339 O O     . HOH F 6 .   ? 31.662 23.587  -51.781 1.00 22.58  ? 609 HOH A O     1 
HETATM 2340 O O     . HOH F 6 .   ? 31.999 0.244   -54.112 1.00 18.06  ? 610 HOH A O     1 
HETATM 2341 O O     . HOH F 6 .   ? 22.000 11.221  -65.633 1.00 30.55  ? 611 HOH A O     1 
HETATM 2342 O O     . HOH F 6 .   ? 38.437 35.526  -46.135 1.00 18.31  ? 612 HOH A O     1 
HETATM 2343 O O     . HOH F 6 .   ? 33.705 17.113  -53.551 1.00 29.42  ? 613 HOH A O     1 
HETATM 2344 O O     . HOH F 6 .   ? 21.322 12.845  -51.100 1.00 20.87  ? 614 HOH A O     1 
HETATM 2345 O O     . HOH F 6 .   ? 25.103 13.420  -54.076 1.00 21.57  ? 615 HOH A O     1 
HETATM 2346 O O     . HOH F 6 .   ? 31.691 11.257  -72.099 1.00 27.62  ? 616 HOH A O     1 
HETATM 2347 O O     . HOH F 6 .   ? 33.685 8.528   -67.494 1.00 24.52  ? 617 HOH A O     1 
HETATM 2348 O O     . HOH F 6 .   ? 32.172 18.059  -41.138 1.00 26.02  ? 618 HOH A O     1 
HETATM 2349 O O     . HOH F 6 .   ? 29.516 24.114  -44.534 1.00 28.51  ? 619 HOH A O     1 
HETATM 2350 O O     . HOH F 6 .   ? 40.464 23.626  -58.460 1.00 25.40  ? 620 HOH A O     1 
HETATM 2351 O O     . HOH F 6 .   ? 46.703 21.249  -58.968 1.00 36.55  ? 621 HOH A O     1 
HETATM 2352 O O     . HOH F 6 .   ? 37.428 21.370  -48.718 1.00 27.45  ? 622 HOH A O     1 
HETATM 2353 O O     . HOH F 6 .   ? 33.107 5.398   -67.410 1.00 29.43  ? 623 HOH A O     1 
HETATM 2354 O O     . HOH F 6 .   ? 28.654 38.961  -37.184 1.00 27.07  ? 624 HOH A O     1 
HETATM 2355 O O     . HOH F 6 .   ? 30.223 24.880  -42.093 1.00 25.22  ? 625 HOH A O     1 
HETATM 2356 O O     . HOH F 6 .   ? 31.648 22.430  -44.934 1.00 38.91  ? 626 HOH A O     1 
HETATM 2357 O O     . HOH F 6 .   ? 22.699 39.285  -39.565 1.00 21.88  ? 627 HOH A O     1 
HETATM 2358 O O     . HOH F 6 .   ? 29.811 20.135  -47.827 1.00 31.10  ? 628 HOH A O     1 
HETATM 2359 O O     . HOH F 6 .   ? 11.623 27.115  -45.692 1.00 48.75  ? 629 HOH A O     1 
HETATM 2360 O O     . HOH F 6 .   ? 40.682 15.703  -59.250 1.00 35.66  ? 630 HOH A O     1 
HETATM 2361 O O     . HOH F 6 .   ? 13.686 31.561  -43.135 1.00 26.80  ? 631 HOH A O     1 
HETATM 2362 O O     . HOH F 6 .   ? 35.408 8.138   -65.753 1.00 33.51  ? 632 HOH A O     1 
HETATM 2363 O O     . HOH F 6 .   ? 24.173 40.846  -42.478 1.00 25.90  ? 633 HOH A O     1 
HETATM 2364 O O     . HOH F 6 .   ? 30.597 25.846  -66.769 1.00 22.90  ? 634 HOH A O     1 
HETATM 2365 O O     . HOH F 6 .   ? 25.946 5.306   -42.714 1.00 20.39  ? 635 HOH A O     1 
HETATM 2366 O O     . HOH F 6 .   ? 37.410 21.198  -55.547 1.00 26.38  ? 636 HOH A O     1 
HETATM 2367 O O     . HOH F 6 .   ? 16.506 33.884  -47.323 1.00 28.57  ? 637 HOH A O     1 
HETATM 2368 O O     . HOH F 6 .   ? 28.383 26.947  -30.977 1.00 24.64  ? 638 HOH A O     1 
HETATM 2369 O O     . HOH F 6 .   ? 18.236 13.919  -56.162 1.00 33.21  ? 639 HOH A O     1 
HETATM 2370 O O     . HOH F 6 .   ? 15.715 7.530   -53.968 1.00 41.80  ? 640 HOH A O     1 
HETATM 2371 O O     . HOH F 6 .   ? 31.758 34.829  -72.652 1.00 37.26  ? 641 HOH A O     1 
HETATM 2372 O O     . HOH F 6 .   ? 11.752 16.958  -45.541 1.00 31.09  ? 642 HOH A O     1 
HETATM 2373 O O     . HOH F 6 .   ? 26.317 24.196  -70.913 1.00 35.96  ? 643 HOH A O     1 
HETATM 2374 O O     . HOH F 6 .   ? 43.012 39.682  -38.823 1.00 40.66  ? 644 HOH A O     1 
HETATM 2375 O O     . HOH F 6 .   ? 46.201 18.903  -58.422 1.00 39.53  ? 645 HOH A O     1 
HETATM 2376 O O     . HOH F 6 .   ? 46.181 34.955  -60.596 1.00 41.29  ? 646 HOH A O     1 
HETATM 2377 O O     . HOH F 6 .   ? 31.120 17.119  -31.487 1.00 52.70  ? 647 HOH A O     1 
HETATM 2378 O O     . HOH F 6 .   ? 26.122 25.713  -33.904 1.00 25.04  ? 648 HOH A O     1 
HETATM 2379 O O     . HOH F 6 .   ? 47.516 22.883  -55.694 1.00 46.61  ? 649 HOH A O     1 
HETATM 2380 O O     . HOH F 6 .   ? 34.830 39.181  -35.386 1.00 31.99  ? 650 HOH A O     1 
HETATM 2381 O O     . HOH F 6 .   ? 46.002 17.675  -60.478 1.00 44.75  ? 651 HOH A O     1 
HETATM 2382 O O     . HOH F 6 .   ? 43.411 31.809  -62.620 1.00 30.21  ? 652 HOH A O     1 
HETATM 2383 O O     . HOH F 6 .   ? 44.178 21.843  -68.501 1.00 44.93  ? 653 HOH A O     1 
HETATM 2384 O O     . HOH F 6 .   ? 20.990 11.297  -62.998 1.00 45.71  ? 654 HOH A O     1 
HETATM 2385 O O     . HOH F 6 .   ? 19.537 15.072  -57.949 1.00 44.10  ? 655 HOH A O     1 
HETATM 2386 O O     . HOH F 6 .   ? 28.405 -1.119  -56.828 1.00 33.64  ? 656 HOH A O     1 
HETATM 2387 O O     . HOH F 6 .   ? 18.639 22.015  -40.010 1.00 18.00  ? 657 HOH A O     1 
HETATM 2388 O O     . HOH F 6 .   ? 43.427 20.810  -65.522 1.00 38.42  ? 658 HOH A O     1 
HETATM 2389 O O     . HOH F 6 .   ? 21.806 34.944  -33.733 1.00 26.74  ? 659 HOH A O     1 
HETATM 2390 O O     . HOH F 6 .   ? 29.582 42.399  -39.388 1.00 32.43  ? 660 HOH A O     1 
HETATM 2391 O O     . HOH F 6 .   ? 48.190 24.224  -39.363 1.00 23.80  ? 661 HOH A O     1 
HETATM 2392 O O     . HOH F 6 .   ? 31.813 21.415  -65.561 1.00 33.81  ? 662 HOH A O     1 
HETATM 2393 O O     . HOH F 6 .   ? 27.296 0.178   -59.352 1.00 29.44  ? 663 HOH A O     1 
HETATM 2394 O O     . HOH F 6 .   ? 13.643 14.695  -36.408 1.00 35.93  ? 664 HOH A O     1 
HETATM 2395 O O     . HOH F 6 .   ? 35.537 19.283  -50.158 1.00 32.38  ? 665 HOH A O     1 
HETATM 2396 O O     . HOH F 6 .   ? 25.617 15.268  -43.438 1.00 39.60  ? 666 HOH A O     1 
HETATM 2397 O O     . HOH F 6 .   ? 43.028 0.893   -56.101 1.00 31.41  ? 667 HOH A O     1 
HETATM 2398 O O     . HOH F 6 .   ? 28.013 24.391  -32.231 1.00 26.86  ? 668 HOH A O     1 
HETATM 2399 O O     . HOH F 6 .   ? 35.384 37.750  -32.801 1.00 38.56  ? 669 HOH A O     1 
HETATM 2400 O O     . HOH F 6 .   ? 39.298 13.807  -73.025 1.00 43.28  ? 670 HOH A O     1 
HETATM 2401 O O     . HOH F 6 .   ? 28.063 13.836  -72.065 1.00 40.45  ? 671 HOH A O     1 
HETATM 2402 O O     . HOH F 6 .   ? 46.712 23.346  -66.475 1.00 33.38  ? 672 HOH A O     1 
HETATM 2403 O O     . HOH F 6 .   ? 25.862 -11.851 -41.510 1.00 39.81  ? 673 HOH A O     1 
HETATM 2404 O O     . HOH F 6 .   ? 45.783 37.148  -40.544 1.00 44.45  ? 674 HOH A O     1 
HETATM 2405 O O     . HOH F 6 .   ? 12.484 27.797  -58.345 1.00 53.02  ? 675 HOH A O     1 
HETATM 2406 O O     . HOH F 6 .   ? 22.485 33.423  -60.463 1.00 25.23  ? 676 HOH A O     1 
HETATM 2407 O O     . HOH F 6 .   ? 29.061 32.069  -69.741 1.00 54.31  ? 677 HOH A O     1 
HETATM 2408 O O     . HOH F 6 .   ? 33.890 17.805  -62.357 1.00 39.95  ? 678 HOH A O     1 
HETATM 2409 O O     . HOH F 6 .   ? 44.460 38.895  -53.886 1.00 40.47  ? 679 HOH A O     1 
HETATM 2410 O O     . HOH F 6 .   ? 34.276 22.387  -71.653 1.00 48.81  ? 680 HOH A O     1 
HETATM 2411 O O     . HOH F 6 .   ? 39.204 42.915  -47.778 1.00 56.67  ? 681 HOH A O     1 
HETATM 2412 O O     . HOH F 6 .   ? 40.366 10.235  -69.716 1.00 48.22  ? 682 HOH A O     1 
HETATM 2413 O O     . HOH F 6 .   ? 17.473 25.942  -29.175 1.00 45.24  ? 683 HOH A O     1 
HETATM 2414 O O     . HOH F 6 .   ? 48.222 26.672  -63.659 1.00 42.21  ? 684 HOH A O     1 
HETATM 2415 O O     . HOH F 6 .   ? 45.854 33.069  -46.204 1.00 52.29  ? 685 HOH A O     1 
HETATM 2416 O O     . HOH F 6 .   ? 45.753 18.913  -66.932 1.00 51.80  ? 686 HOH A O     1 
HETATM 2417 O O     . HOH F 6 .   ? 39.351 26.248  -69.010 1.00 35.78  ? 687 HOH A O     1 
HETATM 2418 O O     . HOH F 6 .   ? 16.565 29.964  -36.585 1.00 35.71  ? 688 HOH A O     1 
HETATM 2419 O O     . HOH F 6 .   ? 20.952 26.954  -63.471 1.00 45.45  ? 689 HOH A O     1 
HETATM 2420 O O     . HOH F 6 .   ? 13.216 24.621  -59.876 1.00 42.44  ? 690 HOH A O     1 
HETATM 2421 O O     . HOH F 6 .   ? 41.188 24.608  -69.894 1.00 38.92  ? 691 HOH A O     1 
HETATM 2422 O O     . HOH F 6 .   ? 20.635 34.348  -58.749 1.00 33.35  ? 692 HOH A O     1 
HETATM 2423 O O     . HOH F 6 .   ? 37.166 41.347  -40.858 1.00 25.64  ? 693 HOH A O     1 
HETATM 2424 O O     . HOH F 6 .   ? 47.597 26.232  -45.906 1.00 34.48  ? 694 HOH A O     1 
HETATM 2425 O O     . HOH F 6 .   ? 23.510 39.848  -48.456 1.00 32.54  ? 695 HOH A O     1 
HETATM 2426 O O     . HOH F 6 .   ? 30.739 39.319  -46.856 1.00 42.84  ? 696 HOH A O     1 
HETATM 2427 O O     . HOH F 6 .   ? 19.797 -3.921  -45.024 1.00 31.19  ? 697 HOH A O     1 
HETATM 2428 O O     . HOH F 6 .   ? 22.478 0.885   -36.864 1.00 34.62  ? 698 HOH A O     1 
HETATM 2429 O O     . HOH F 6 .   ? 45.023 30.683  -42.528 1.00 46.89  ? 699 HOH A O     1 
HETATM 2430 O O     . HOH F 6 .   ? 49.967 32.550  -55.540 1.00 45.47  ? 700 HOH A O     1 
HETATM 2431 O O     . HOH F 6 .   ? 40.150 38.669  -39.414 1.00 37.92  ? 701 HOH A O     1 
HETATM 2432 O O     . HOH F 6 .   ? 25.693 41.421  -37.421 1.00 43.05  ? 702 HOH A O     1 
HETATM 2433 O O     . HOH F 6 .   ? 25.443 13.314  -41.757 1.00 44.44  ? 703 HOH A O     1 
HETATM 2434 O O     . HOH F 6 .   ? 12.641 22.929  -42.139 1.00 36.48  ? 704 HOH A O     1 
HETATM 2435 O O     . HOH F 6 .   ? 23.339 22.777  -69.183 1.00 35.57  ? 705 HOH A O     1 
HETATM 2436 O O     . HOH F 6 .   ? 28.816 21.714  -29.365 1.00 45.48  ? 706 HOH A O     1 
HETATM 2437 O O     . HOH F 6 .   ? 33.175 -2.999  -35.714 1.00 35.62  ? 707 HOH A O     1 
HETATM 2438 O O     . HOH F 6 .   ? 19.872 3.628   -52.827 1.00 42.17  ? 708 HOH A O     1 
HETATM 2439 O O     . HOH F 6 .   ? 44.333 15.444  -69.278 1.00 47.24  ? 709 HOH A O     1 
HETATM 2440 O O     . HOH F 6 .   ? 27.343 28.249  -72.599 1.00 63.83  ? 710 HOH A O     1 
HETATM 2441 O O     . HOH F 6 .   ? 42.992 18.878  -50.627 1.00 42.44  ? 711 HOH A O     1 
HETATM 2442 O O     . HOH F 6 .   ? 38.138 29.497  -29.611 1.00 24.84  ? 712 HOH A O     1 
HETATM 2443 O O     . HOH F 6 .   ? 16.491 -6.321  -49.717 1.00 59.34  ? 713 HOH A O     1 
HETATM 2444 O O     . HOH F 6 .   ? 45.053 40.025  -56.703 1.00 48.03  ? 714 HOH A O     1 
HETATM 2445 O O     . HOH F 6 .   ? 21.196 24.669  -31.174 1.00 46.37  ? 715 HOH A O     1 
HETATM 2446 O O     . HOH F 6 .   ? 16.347 22.736  -65.398 1.00 46.50  ? 716 HOH A O     1 
HETATM 2447 O O     . HOH F 6 .   ? 18.647 -0.038  -37.356 1.00 59.86  ? 717 HOH A O     1 
HETATM 2448 O O     . HOH F 6 .   ? 19.805 13.403  -36.584 1.00 47.02  ? 718 HOH A O     1 
HETATM 2449 O O     . HOH F 6 .   ? 42.202 39.373  -63.189 1.00 49.18  ? 719 HOH A O     1 
HETATM 2450 O O     . HOH F 6 .   ? 25.012 -6.326  -40.222 1.00 38.68  ? 720 HOH A O     1 
HETATM 2451 O O     . HOH F 6 .   ? 48.253 34.756  -59.050 1.00 52.49  ? 721 HOH A O     1 
HETATM 2452 O O     . HOH F 6 .   ? 20.560 -8.767  -44.325 1.00 37.08  ? 722 HOH A O     1 
HETATM 2453 O O     . HOH F 6 .   ? 37.448 37.707  -67.280 1.00 40.82  ? 723 HOH A O     1 
HETATM 2454 O O     . HOH F 6 .   ? 20.717 5.022   -60.203 1.00 43.54  ? 724 HOH A O     1 
HETATM 2455 O O     . HOH F 6 .   ? 30.631 40.144  -63.074 1.00 35.69  ? 725 HOH A O     1 
HETATM 2456 O O     . HOH F 6 .   ? 38.136 21.101  -71.943 1.00 34.51  ? 726 HOH A O     1 
HETATM 2457 O O     . HOH F 6 .   ? 25.082 16.163  -41.040 1.00 49.06  ? 727 HOH A O     1 
HETATM 2458 O O     . HOH F 6 .   ? 50.203 24.937  -50.542 1.00 54.16  ? 728 HOH A O     1 
HETATM 2459 O O     . HOH F 6 .   ? 26.037 21.254  -71.988 1.00 46.05  ? 729 HOH A O     1 
HETATM 2460 O O     . HOH F 6 .   ? 20.386 15.311  -69.897 1.00 38.53  ? 730 HOH A O     1 
HETATM 2461 O O     . HOH F 6 .   ? 32.346 42.522  -65.061 1.00 48.97  ? 731 HOH A O     1 
HETATM 2462 O O     . HOH F 6 .   ? 48.327 31.542  -63.436 1.00 47.55  ? 732 HOH A O     1 
HETATM 2463 O O     . HOH F 6 .   ? 14.105 -3.500  -50.460 1.00 39.90  ? 733 HOH A O     1 
HETATM 2464 O O     . HOH F 6 .   ? 18.096 39.819  -39.736 1.00 42.45  ? 734 HOH A O     1 
HETATM 2465 O O     . HOH F 6 .   ? 49.407 30.091  -54.768 1.00 41.81  ? 735 HOH A O     1 
HETATM 2466 O O     . HOH F 6 .   ? 37.889 19.089  -52.141 1.00 46.31  ? 736 HOH A O     1 
HETATM 2467 O O     . HOH F 6 .   ? 16.140 6.117   -44.919 1.00 38.57  ? 737 HOH A O     1 
HETATM 2468 O O     . HOH F 6 .   ? 32.586 18.883  -64.682 1.00 44.31  ? 738 HOH A O     1 
HETATM 2469 O O     . HOH F 6 .   ? 46.270 21.970  -61.208 1.00 50.09  ? 739 HOH A O     1 
HETATM 2470 O O     . HOH F 6 .   ? 26.392 7.036   -72.351 1.00 38.48  ? 740 HOH A O     1 
HETATM 2471 O O     . HOH F 6 .   ? 15.285 13.697  -55.080 1.00 65.62  ? 741 HOH A O     1 
HETATM 2472 O O     . HOH F 6 .   ? 20.805 35.600  -56.449 1.00 37.31  ? 742 HOH A O     1 
HETATM 2473 O O     . HOH F 6 .   ? 26.100 29.102  -30.896 1.00 44.34  ? 743 HOH A O     1 
HETATM 2474 O O     . HOH F 6 .   ? 38.530 21.821  -57.973 1.00 30.84  ? 744 HOH A O     1 
HETATM 2475 O O     . HOH F 6 .   ? 41.922 38.473  -50.334 1.00 42.03  ? 745 HOH A O     1 
HETATM 2476 O O     . HOH F 6 .   ? 21.935 15.922  -71.934 1.00 33.35  ? 746 HOH A O     1 
HETATM 2477 O O     . HOH F 6 .   ? 16.301 14.732  -35.734 1.00 35.37  ? 747 HOH A O     1 
HETATM 2478 O O     . HOH F 6 .   ? 32.183 13.787  -71.724 1.00 44.51  ? 748 HOH A O     1 
HETATM 2479 O O     . HOH F 6 .   ? 10.829 18.971  -43.001 1.00 41.31  ? 749 HOH A O     1 
HETATM 2480 O O     . HOH F 6 .   ? 28.026 39.263  -39.788 1.00 33.84  ? 750 HOH A O     1 
HETATM 2481 O O     . HOH F 6 .   ? 29.995 -9.483  -37.366 1.00 46.08  ? 751 HOH A O     1 
HETATM 2482 O O     . HOH F 6 .   ? 36.030 41.422  -35.569 1.00 38.43  ? 752 HOH A O     1 
HETATM 2483 O O     . HOH F 6 .   ? 16.900 22.538  -33.586 1.00 32.27  ? 753 HOH A O     1 
HETATM 2484 O O     . HOH F 6 .   ? 42.645 41.458  -45.010 1.00 37.45  ? 754 HOH A O     1 
HETATM 2485 O O     . HOH F 6 .   ? 49.192 24.323  -64.779 1.00 51.15  ? 755 HOH A O     1 
HETATM 2486 O O     . HOH F 6 .   ? 25.201 40.413  -40.211 1.00 37.14  ? 756 HOH A O     1 
HETATM 2487 O O     . HOH F 6 .   ? 19.048 9.800   -61.869 1.00 44.39  ? 757 HOH A O     1 
HETATM 2488 O O     . HOH F 6 .   ? 15.703 22.872  -62.109 1.00 48.93  ? 758 HOH A O     1 
HETATM 2489 O O     . HOH F 6 .   ? 16.982 39.234  -43.923 1.00 43.36  ? 759 HOH A O     1 
HETATM 2490 O O     . HOH F 6 .   ? 35.831 40.417  -47.740 1.00 45.26  ? 760 HOH A O     1 
HETATM 2491 O O     . HOH F 6 .   ? 46.034 33.486  -62.941 1.00 48.03  ? 761 HOH A O     1 
HETATM 2492 O O     . HOH F 6 .   ? 46.530 20.249  -38.828 1.00 41.61  ? 762 HOH A O     1 
HETATM 2493 O O     . HOH F 6 .   ? 29.515 21.030  -44.538 1.00 48.49  ? 763 HOH A O     1 
HETATM 2494 O O     . HOH F 6 .   ? 18.201 16.977  -69.692 1.00 47.24  ? 764 HOH A O     1 
HETATM 2495 O O     . HOH F 6 .   ? 13.663 26.969  -61.301 1.00 56.94  ? 765 HOH A O     1 
HETATM 2496 O O     . HOH F 6 .   ? 17.395 33.961  -58.857 1.00 56.86  ? 766 HOH A O     1 
HETATM 2497 O O     . HOH F 6 .   ? 49.684 29.034  -63.087 1.00 51.55  ? 767 HOH A O     1 
HETATM 2498 O O     . HOH F 6 .   ? 30.930 -2.767  -66.781 1.00 45.48  ? 768 HOH A O     1 
HETATM 2499 O O     . HOH F 6 .   ? 21.865 8.767   -67.560 1.00 52.09  ? 769 HOH A O     1 
HETATM 2500 O O     . HOH F 6 .   ? 39.012 12.808  -55.688 1.00 36.71  ? 770 HOH A O     1 
HETATM 2501 O O     . HOH F 6 .   ? 19.209 10.941  -56.187 1.00 57.83  ? 771 HOH A O     1 
HETATM 2502 O O     . HOH F 6 .   ? 33.060 25.091  -73.886 1.00 47.89  ? 772 HOH A O     1 
HETATM 2503 O O     . HOH F 6 .   ? 15.646 0.333   -41.045 1.00 38.71  ? 773 HOH A O     1 
HETATM 2504 O O     . HOH F 6 .   ? 40.441 22.655  -71.621 1.00 53.42  ? 774 HOH A O     1 
HETATM 2505 O O     . HOH F 6 .   ? 35.761 32.431  -71.813 1.00 55.11  ? 775 HOH A O     1 
HETATM 2506 O O     . HOH F 6 .   ? 23.634 8.276   -68.990 1.00 39.32  ? 776 HOH A O     1 
HETATM 2507 O O     . HOH F 6 .   ? 22.344 14.497  -57.316 1.00 32.29  ? 777 HOH A O     1 
HETATM 2508 O O     . HOH F 6 .   ? 31.781 21.846  -72.869 1.00 52.43  ? 778 HOH A O     1 
HETATM 2509 O O     . HOH F 6 .   ? 47.749 19.546  -46.895 1.00 40.09  ? 779 HOH A O     1 
HETATM 2510 O O     . HOH F 6 .   ? 43.642 5.114   -57.911 1.00 53.56  ? 780 HOH A O     1 
HETATM 2511 O O     . HOH F 6 .   ? 20.485 37.867  -34.935 1.00 49.80  ? 781 HOH A O     1 
HETATM 2512 O O     . HOH F 6 .   ? 18.292 27.376  -63.155 1.00 54.19  ? 782 HOH A O     1 
HETATM 2513 O O     . HOH F 6 .   ? 46.828 36.904  -52.259 1.00 44.58  ? 783 HOH A O     1 
HETATM 2514 O O     . HOH F 6 .   ? 50.423 25.854  -57.681 1.00 44.21  ? 784 HOH A O     1 
HETATM 2515 O O     . HOH F 6 .   ? 13.630 29.657  -53.476 1.00 48.62  ? 785 HOH A O     1 
HETATM 2516 O O     . HOH F 6 .   ? 37.669 40.554  -54.186 1.00 48.06  ? 786 HOH A O     1 
HETATM 2517 O O     . HOH F 6 .   ? 22.257 42.980  -42.048 1.00 38.60  ? 787 HOH A O     1 
HETATM 2518 O O     . HOH F 6 .   ? 23.816 9.028   -72.019 1.00 42.01  ? 788 HOH A O     1 
HETATM 2519 O O     . HOH F 6 .   ? 28.614 37.927  -29.848 1.00 35.55  ? 789 HOH A O     1 
HETATM 2520 O O     . HOH F 6 .   ? 28.821 16.746  -39.245 1.00 43.28  ? 790 HOH A O     1 
HETATM 2521 O O     . HOH F 6 .   ? 8.584  18.018  -51.494 1.00 49.72  ? 791 HOH A O     1 
HETATM 2522 O O     . HOH F 6 .   ? 50.475 23.909  -47.646 1.00 55.35  ? 792 HOH A O     1 
HETATM 2523 O O     . HOH F 6 .   ? 16.545 -6.711  -46.938 1.00 57.18  ? 793 HOH A O     1 
HETATM 2524 O O     . HOH F 6 .   ? 30.415 7.770   -73.538 0.50 12.20  ? 794 HOH A O     1 
HETATM 2525 O O     . HOH F 6 .   ? 18.956 -13.135 -53.091 1.00 59.20  ? 795 HOH A O     1 
HETATM 2526 O O     . HOH F 6 .   ? 10.084 13.463  -42.481 1.00 36.14  ? 796 HOH A O     1 
HETATM 2527 O O     . HOH F 6 .   ? 8.557  24.014  -50.953 1.00 48.96  ? 797 HOH A O     1 
HETATM 2528 O O     . HOH F 6 .   ? 43.536 34.839  -69.219 1.00 60.76  ? 798 HOH A O     1 
HETATM 2529 O O     . HOH F 6 .   ? 29.063 30.081  -67.685 1.00 73.77  ? 799 HOH A O     1 
HETATM 2530 O O     . HOH F 6 .   ? 28.387 19.369  -71.841 1.00 48.42  ? 800 HOH A O     1 
HETATM 2531 O O     . HOH F 6 .   ? 37.226 -2.936  -35.561 1.00 38.59  ? 801 HOH A O     1 
HETATM 2532 O O     . HOH F 6 .   ? 31.744 0.338   -69.736 0.50 34.53  ? 802 HOH A O     1 
HETATM 2533 O O     . HOH F 6 .   ? 36.539 5.881   -69.295 1.00 57.00  ? 803 HOH A O     1 
HETATM 2534 O O     . HOH F 6 .   ? 14.234 18.209  -61.593 1.00 53.02  ? 804 HOH A O     1 
HETATM 2535 O O     . HOH F 6 .   ? 14.572 20.562  -62.266 1.00 48.67  ? 805 HOH A O     1 
HETATM 2536 O O     . HOH F 6 .   ? 12.192 21.880  -59.875 1.00 53.07  ? 806 HOH A O     1 
HETATM 2537 O O     . HOH F 6 .   ? 32.284 42.081  -62.486 1.00 39.41  ? 807 HOH A O     1 
HETATM 2538 O O     . HOH F 6 .   ? 19.801 22.894  -33.313 1.00 22.76  ? 808 HOH A O     1 
HETATM 2539 O O     . HOH F 6 .   ? 41.206 29.739  -29.447 1.00 42.67  ? 809 HOH A O     1 
HETATM 2540 O O     . HOH F 6 .   ? 30.094 21.237  -40.879 1.00 23.31  ? 810 HOH A O     1 
HETATM 2541 O O     . HOH F 6 .   ? 21.998 11.855  -59.996 1.00 33.85  ? 811 HOH A O     1 
HETATM 2542 O O     . HOH F 6 .   ? 44.901 33.667  -43.185 1.00 21.82  ? 812 HOH A O     1 
HETATM 2543 O O     . HOH F 6 .   ? 20.256 9.705   -58.428 1.00 42.76  ? 813 HOH A O     1 
HETATM 2544 O O     . HOH F 6 .   ? 46.207 35.861  -47.348 1.00 58.47  ? 814 HOH A O     1 
HETATM 2545 O O     . HOH F 6 .   ? 18.672 19.222  -34.287 1.00 32.34  ? 815 HOH A O     1 
HETATM 2546 O O     . HOH F 6 .   ? 39.665 43.374  -55.299 1.00 50.91  ? 816 HOH A O     1 
HETATM 2547 O O     . HOH F 6 .   ? 12.604 34.533  -43.345 1.00 48.24  ? 817 HOH A O     1 
HETATM 2548 O O     . HOH F 6 .   ? 14.852 11.210  -37.299 1.00 34.85  ? 818 HOH A O     1 
HETATM 2549 O O     . HOH F 6 .   ? 46.155 13.851  -60.009 1.00 59.25  ? 819 HOH A O     1 
HETATM 2550 O O     . HOH F 6 .   ? 39.597 10.418  -59.848 1.00 37.00  ? 820 HOH A O     1 
HETATM 2551 O O     . HOH F 6 .   ? 12.303 25.628  -47.961 1.00 35.25  ? 821 HOH A O     1 
HETATM 2552 O O     . HOH F 6 .   ? 26.066 -4.186  -53.471 1.00 39.88  ? 822 HOH A O     1 
HETATM 2553 O O     . HOH F 6 .   ? 20.081 12.979  -68.273 1.00 41.27  ? 823 HOH A O     1 
HETATM 2554 O O     . HOH F 6 .   ? 36.729 9.085   -54.458 1.00 34.30  ? 824 HOH A O     1 
HETATM 2555 O O     . HOH F 6 .   ? 16.796 33.017  -37.096 1.00 27.81  ? 825 HOH A O     1 
HETATM 2556 O O     . HOH F 6 .   ? 29.410 -1.197  -37.023 1.00 43.03  ? 826 HOH A O     1 
HETATM 2557 O O     . HOH F 6 .   ? 41.629 6.942   -52.992 1.00 44.17  ? 827 HOH A O     1 
HETATM 2558 O O     . HOH F 6 .   ? 35.091 12.193  -48.376 1.00 54.92  ? 828 HOH A O     1 
HETATM 2559 O O     . HOH F 6 .   ? 24.882 0.648   -63.520 1.00 50.56  ? 829 HOH A O     1 
HETATM 2560 O O     . HOH F 6 .   ? 46.052 25.245  -38.580 1.00 39.40  ? 830 HOH A O     1 
HETATM 2561 O O     . HOH F 6 .   ? 23.730 41.339  -35.948 1.00 43.78  ? 831 HOH A O     1 
HETATM 2562 O O     . HOH F 6 .   ? 25.880 39.992  -52.471 1.00 43.31  ? 832 HOH A O     1 
HETATM 2563 O O     . HOH F 6 .   ? 12.189 20.435  -41.434 1.00 38.29  ? 833 HOH A O     1 
HETATM 2564 O O     . HOH F 6 .   ? 39.400 40.352  -65.716 1.00 50.66  ? 834 HOH A O     1 
HETATM 2565 O O     . HOH F 6 .   ? 48.141 23.157  -52.522 1.00 47.24  ? 835 HOH A O     1 
HETATM 2566 O O     . HOH F 6 .   ? 41.172 15.174  -37.291 1.00 49.59  ? 836 HOH A O     1 
HETATM 2567 O O     . HOH F 6 .   ? 35.825 16.372  -43.728 1.00 43.65  ? 837 HOH A O     1 
HETATM 2568 O O     . HOH F 6 .   ? 23.073 39.857  -61.781 1.00 47.19  ? 838 HOH A O     1 
HETATM 2569 O O     . HOH F 6 .   ? 43.234 13.077  -57.891 1.00 43.12  ? 839 HOH A O     1 
HETATM 2570 O O     . HOH F 6 .   ? 36.979 40.877  -67.184 1.00 59.49  ? 840 HOH A O     1 
HETATM 2571 O O     . HOH F 6 .   ? 12.480 26.262  -50.554 1.00 34.96  ? 841 HOH A O     1 
HETATM 2572 O O     . HOH F 6 .   ? 31.788 19.214  -56.594 1.00 30.70  ? 842 HOH A O     1 
HETATM 2573 O O     . HOH F 6 .   ? 15.143 33.909  -49.804 1.00 43.18  ? 843 HOH A O     1 
HETATM 2574 O O     . HOH F 6 .   ? 16.917 -8.150  -52.255 1.00 55.31  ? 844 HOH A O     1 
HETATM 2575 O O     . HOH F 6 .   ? 30.646 15.351  -73.347 0.50 55.19  ? 845 HOH A O     1 
HETATM 2576 O O     . HOH F 6 .   ? 39.616 13.556  -58.561 1.00 45.07  ? 846 HOH A O     1 
HETATM 2577 O O     . HOH F 6 .   ? 30.645 42.695  -30.674 1.00 46.06  ? 847 HOH A O     1 
HETATM 2578 O O     . HOH F 6 .   ? 38.222 10.988  -48.564 1.00 48.64  ? 848 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   GLN 5   5   5   GLN GLN A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  CYS 32  32  32  CYS CYS A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  TRP 37  37  37  TRP TRP A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  CYS 57  57  57  CYS CYS A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  MET 60  60  60  MET MET A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  MET 63  63  63  MET MET A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 TRP 135 135 135 TRP TRP A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 HIS 137 137 137 HIS HIS A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 HIS 156 156 156 HIS HIS A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 GLN 160 160 160 GLN GLN A . n 
A 1 161 PRO 161 161 161 PRO PRO A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 ARG 176 176 176 ARG ARG A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 PHE 183 183 183 PHE PHE A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 TYR 185 185 185 TYR TYR A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 GLN 202 202 202 GLN GLN A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLU 205 205 205 GLU GLU A . n 
A 1 206 GLU 206 206 206 GLU GLU A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 TYR 212 212 212 TYR TYR A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 ALA 219 219 219 ALA ALA A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 CYS 223 223 223 CYS CYS A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 TRP 225 225 225 TRP TRP A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 ASP 231 231 231 ASP ASP A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 ASP 236 236 236 ASP ASP A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 HIS 241 241 241 HIS HIS A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 PHE 245 245 245 PHE PHE A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 PRO 248 248 248 PRO PRO A . n 
A 1 249 ARG 249 249 249 ARG ARG A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 GLY 257 257 257 GLY GLY A . n 
A 1 258 ASP 258 258 258 ASP ASP A . n 
A 1 259 THR 259 259 259 THR THR A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 SER 263 263 263 SER SER A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 SER 269 269 269 SER SER A . n 
A 1 270 GLN 270 270 270 GLN GLN A . n 
A 1 271 GLY 271 271 271 GLY GLY A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 SER 273 273 273 SER SER A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 GLN 275 275 275 GLN GLN A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 PHE 280 280 280 PHE PHE A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 CYS 282 282 282 CYS CYS A . n 
A 1 283 GLN 283 283 283 GLN GLN A . n 
A 1 284 VAL 284 284 284 VAL VAL A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 LYS 288 288 288 LYS LYS A . n 
A 1 289 CYS 289 289 289 CYS CYS A . n 
A 1 290 GLY 290 290 290 GLY GLY A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 GLN 292 292 292 GLN GLN A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 PHE 294 294 294 PHE PHE A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 GLY 296 296 296 GLY GLY A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 VAL 298 298 298 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FRU 1   601 601 FRU FRU A . 
C 3 SO4 1   401 401 SO4 SO4 A . 
D 4 ANP 1   301 301 ANP ANP A . 
E 5 GOL 1   501 501 GOL GOL A . 
F 6 HOH 1   602 1   HOH HOH A . 
F 6 HOH 2   603 2   HOH HOH A . 
F 6 HOH 3   604 3   HOH HOH A . 
F 6 HOH 4   605 4   HOH HOH A . 
F 6 HOH 5   606 5   HOH HOH A . 
F 6 HOH 6   607 6   HOH HOH A . 
F 6 HOH 7   608 7   HOH HOH A . 
F 6 HOH 8   609 8   HOH HOH A . 
F 6 HOH 9   610 9   HOH HOH A . 
F 6 HOH 10  611 10  HOH HOH A . 
F 6 HOH 11  612 11  HOH HOH A . 
F 6 HOH 12  613 12  HOH HOH A . 
F 6 HOH 13  614 13  HOH HOH A . 
F 6 HOH 14  615 14  HOH HOH A . 
F 6 HOH 15  616 15  HOH HOH A . 
F 6 HOH 16  617 16  HOH HOH A . 
F 6 HOH 17  618 17  HOH HOH A . 
F 6 HOH 18  619 18  HOH HOH A . 
F 6 HOH 19  620 19  HOH HOH A . 
F 6 HOH 20  621 21  HOH HOH A . 
F 6 HOH 21  622 22  HOH HOH A . 
F 6 HOH 22  623 23  HOH HOH A . 
F 6 HOH 23  624 24  HOH HOH A . 
F 6 HOH 24  625 25  HOH HOH A . 
F 6 HOH 25  626 26  HOH HOH A . 
F 6 HOH 26  627 27  HOH HOH A . 
F 6 HOH 27  628 28  HOH HOH A . 
F 6 HOH 28  629 29  HOH HOH A . 
F 6 HOH 29  630 30  HOH HOH A . 
F 6 HOH 30  631 31  HOH HOH A . 
F 6 HOH 31  632 32  HOH HOH A . 
F 6 HOH 32  633 33  HOH HOH A . 
F 6 HOH 33  634 34  HOH HOH A . 
F 6 HOH 34  635 35  HOH HOH A . 
F 6 HOH 35  636 36  HOH HOH A . 
F 6 HOH 36  637 37  HOH HOH A . 
F 6 HOH 37  638 38  HOH HOH A . 
F 6 HOH 38  639 39  HOH HOH A . 
F 6 HOH 39  640 40  HOH HOH A . 
F 6 HOH 40  641 41  HOH HOH A . 
F 6 HOH 41  642 42  HOH HOH A . 
F 6 HOH 42  643 43  HOH HOH A . 
F 6 HOH 43  644 44  HOH HOH A . 
F 6 HOH 44  645 45  HOH HOH A . 
F 6 HOH 45  646 46  HOH HOH A . 
F 6 HOH 46  647 47  HOH HOH A . 
F 6 HOH 47  648 48  HOH HOH A . 
F 6 HOH 48  649 49  HOH HOH A . 
F 6 HOH 49  650 50  HOH HOH A . 
F 6 HOH 50  651 51  HOH HOH A . 
F 6 HOH 51  652 52  HOH HOH A . 
F 6 HOH 52  653 53  HOH HOH A . 
F 6 HOH 53  654 54  HOH HOH A . 
F 6 HOH 54  655 55  HOH HOH A . 
F 6 HOH 55  656 56  HOH HOH A . 
F 6 HOH 56  657 57  HOH HOH A . 
F 6 HOH 57  658 58  HOH HOH A . 
F 6 HOH 58  659 59  HOH HOH A . 
F 6 HOH 59  660 60  HOH HOH A . 
F 6 HOH 60  661 61  HOH HOH A . 
F 6 HOH 61  662 62  HOH HOH A . 
F 6 HOH 62  663 63  HOH HOH A . 
F 6 HOH 63  664 64  HOH HOH A . 
F 6 HOH 64  665 65  HOH HOH A . 
F 6 HOH 65  666 66  HOH HOH A . 
F 6 HOH 66  667 67  HOH HOH A . 
F 6 HOH 67  668 68  HOH HOH A . 
F 6 HOH 68  669 69  HOH HOH A . 
F 6 HOH 69  670 70  HOH HOH A . 
F 6 HOH 70  671 71  HOH HOH A . 
F 6 HOH 71  672 72  HOH HOH A . 
F 6 HOH 72  673 73  HOH HOH A . 
F 6 HOH 73  674 74  HOH HOH A . 
F 6 HOH 74  675 75  HOH HOH A . 
F 6 HOH 75  676 76  HOH HOH A . 
F 6 HOH 76  677 77  HOH HOH A . 
F 6 HOH 77  678 78  HOH HOH A . 
F 6 HOH 78  679 79  HOH HOH A . 
F 6 HOH 79  680 80  HOH HOH A . 
F 6 HOH 80  681 81  HOH HOH A . 
F 6 HOH 81  682 82  HOH HOH A . 
F 6 HOH 82  683 83  HOH HOH A . 
F 6 HOH 83  684 84  HOH HOH A . 
F 6 HOH 84  685 85  HOH HOH A . 
F 6 HOH 85  686 86  HOH HOH A . 
F 6 HOH 86  687 87  HOH HOH A . 
F 6 HOH 87  688 88  HOH HOH A . 
F 6 HOH 88  689 89  HOH HOH A . 
F 6 HOH 89  690 90  HOH HOH A . 
F 6 HOH 90  691 91  HOH HOH A . 
F 6 HOH 91  692 92  HOH HOH A . 
F 6 HOH 92  693 93  HOH HOH A . 
F 6 HOH 93  694 94  HOH HOH A . 
F 6 HOH 94  695 95  HOH HOH A . 
F 6 HOH 95  696 96  HOH HOH A . 
F 6 HOH 96  697 97  HOH HOH A . 
F 6 HOH 97  698 98  HOH HOH A . 
F 6 HOH 98  699 99  HOH HOH A . 
F 6 HOH 99  700 100 HOH HOH A . 
F 6 HOH 100 701 101 HOH HOH A . 
F 6 HOH 101 702 102 HOH HOH A . 
F 6 HOH 102 703 103 HOH HOH A . 
F 6 HOH 103 704 104 HOH HOH A . 
F 6 HOH 104 705 105 HOH HOH A . 
F 6 HOH 105 706 106 HOH HOH A . 
F 6 HOH 106 707 107 HOH HOH A . 
F 6 HOH 107 708 108 HOH HOH A . 
F 6 HOH 108 709 109 HOH HOH A . 
F 6 HOH 109 710 110 HOH HOH A . 
F 6 HOH 110 711 111 HOH HOH A . 
F 6 HOH 111 712 112 HOH HOH A . 
F 6 HOH 112 713 113 HOH HOH A . 
F 6 HOH 113 714 114 HOH HOH A . 
F 6 HOH 114 715 115 HOH HOH A . 
F 6 HOH 115 716 116 HOH HOH A . 
F 6 HOH 116 717 117 HOH HOH A . 
F 6 HOH 117 718 118 HOH HOH A . 
F 6 HOH 118 719 119 HOH HOH A . 
F 6 HOH 119 720 120 HOH HOH A . 
F 6 HOH 120 721 121 HOH HOH A . 
F 6 HOH 121 722 122 HOH HOH A . 
F 6 HOH 122 723 123 HOH HOH A . 
F 6 HOH 123 724 124 HOH HOH A . 
F 6 HOH 124 725 125 HOH HOH A . 
F 6 HOH 125 726 126 HOH HOH A . 
F 6 HOH 126 727 127 HOH HOH A . 
F 6 HOH 127 728 128 HOH HOH A . 
F 6 HOH 128 729 129 HOH HOH A . 
F 6 HOH 129 730 130 HOH HOH A . 
F 6 HOH 130 731 131 HOH HOH A . 
F 6 HOH 131 732 132 HOH HOH A . 
F 6 HOH 132 733 133 HOH HOH A . 
F 6 HOH 133 734 134 HOH HOH A . 
F 6 HOH 134 735 135 HOH HOH A . 
F 6 HOH 135 736 136 HOH HOH A . 
F 6 HOH 136 737 137 HOH HOH A . 
F 6 HOH 137 738 138 HOH HOH A . 
F 6 HOH 138 739 139 HOH HOH A . 
F 6 HOH 139 740 140 HOH HOH A . 
F 6 HOH 140 741 141 HOH HOH A . 
F 6 HOH 141 742 142 HOH HOH A . 
F 6 HOH 142 743 143 HOH HOH A . 
F 6 HOH 143 744 144 HOH HOH A . 
F 6 HOH 144 745 145 HOH HOH A . 
F 6 HOH 145 746 146 HOH HOH A . 
F 6 HOH 146 747 147 HOH HOH A . 
F 6 HOH 147 748 148 HOH HOH A . 
F 6 HOH 148 749 149 HOH HOH A . 
F 6 HOH 149 750 150 HOH HOH A . 
F 6 HOH 150 751 151 HOH HOH A . 
F 6 HOH 151 752 152 HOH HOH A . 
F 6 HOH 152 753 153 HOH HOH A . 
F 6 HOH 153 754 154 HOH HOH A . 
F 6 HOH 154 755 155 HOH HOH A . 
F 6 HOH 155 756 156 HOH HOH A . 
F 6 HOH 156 757 157 HOH HOH A . 
F 6 HOH 157 758 158 HOH HOH A . 
F 6 HOH 158 759 159 HOH HOH A . 
F 6 HOH 159 760 160 HOH HOH A . 
F 6 HOH 160 761 161 HOH HOH A . 
F 6 HOH 161 762 162 HOH HOH A . 
F 6 HOH 162 763 163 HOH HOH A . 
F 6 HOH 163 764 164 HOH HOH A . 
F 6 HOH 164 765 165 HOH HOH A . 
F 6 HOH 165 766 166 HOH HOH A . 
F 6 HOH 166 767 167 HOH HOH A . 
F 6 HOH 167 768 168 HOH HOH A . 
F 6 HOH 168 769 169 HOH HOH A . 
F 6 HOH 169 770 170 HOH HOH A . 
F 6 HOH 170 771 171 HOH HOH A . 
F 6 HOH 171 772 172 HOH HOH A . 
F 6 HOH 172 773 173 HOH HOH A . 
F 6 HOH 173 774 174 HOH HOH A . 
F 6 HOH 174 775 175 HOH HOH A . 
F 6 HOH 175 776 176 HOH HOH A . 
F 6 HOH 176 777 177 HOH HOH A . 
F 6 HOH 177 778 178 HOH HOH A . 
F 6 HOH 178 779 179 HOH HOH A . 
F 6 HOH 179 780 180 HOH HOH A . 
F 6 HOH 180 781 181 HOH HOH A . 
F 6 HOH 181 782 182 HOH HOH A . 
F 6 HOH 182 783 183 HOH HOH A . 
F 6 HOH 183 784 184 HOH HOH A . 
F 6 HOH 184 785 185 HOH HOH A . 
F 6 HOH 185 786 186 HOH HOH A . 
F 6 HOH 186 787 187 HOH HOH A . 
F 6 HOH 187 788 188 HOH HOH A . 
F 6 HOH 188 789 189 HOH HOH A . 
F 6 HOH 189 790 190 HOH HOH A . 
F 6 HOH 190 791 191 HOH HOH A . 
F 6 HOH 191 792 192 HOH HOH A . 
F 6 HOH 192 793 193 HOH HOH A . 
F 6 HOH 193 794 194 HOH HOH A . 
F 6 HOH 194 795 195 HOH HOH A . 
F 6 HOH 195 796 196 HOH HOH A . 
F 6 HOH 196 797 197 HOH HOH A . 
F 6 HOH 197 798 198 HOH HOH A . 
F 6 HOH 198 799 199 HOH HOH A . 
F 6 HOH 199 800 200 HOH HOH A . 
F 6 HOH 200 801 201 HOH HOH A . 
F 6 HOH 201 802 202 HOH HOH A . 
F 6 HOH 202 803 203 HOH HOH A . 
F 6 HOH 203 804 204 HOH HOH A . 
F 6 HOH 204 805 205 HOH HOH A . 
F 6 HOH 205 806 206 HOH HOH A . 
F 6 HOH 206 807 207 HOH HOH A . 
F 6 HOH 207 808 208 HOH HOH A . 
F 6 HOH 208 809 209 HOH HOH A . 
F 6 HOH 209 810 210 HOH HOH A . 
F 6 HOH 210 811 211 HOH HOH A . 
F 6 HOH 211 812 212 HOH HOH A . 
F 6 HOH 212 813 213 HOH HOH A . 
F 6 HOH 213 814 214 HOH HOH A . 
F 6 HOH 214 815 215 HOH HOH A . 
F 6 HOH 215 816 216 HOH HOH A . 
F 6 HOH 216 817 217 HOH HOH A . 
F 6 HOH 217 818 218 HOH HOH A . 
F 6 HOH 218 819 219 HOH HOH A . 
F 6 HOH 219 820 220 HOH HOH A . 
F 6 HOH 220 821 221 HOH HOH A . 
F 6 HOH 221 822 222 HOH HOH A . 
F 6 HOH 222 823 223 HOH HOH A . 
F 6 HOH 223 824 224 HOH HOH A . 
F 6 HOH 224 825 225 HOH HOH A . 
F 6 HOH 225 826 226 HOH HOH A . 
F 6 HOH 226 827 227 HOH HOH A . 
F 6 HOH 227 828 228 HOH HOH A . 
F 6 HOH 228 829 229 HOH HOH A . 
F 6 HOH 229 830 230 HOH HOH A . 
F 6 HOH 230 831 231 HOH HOH A . 
F 6 HOH 231 832 232 HOH HOH A . 
F 6 HOH 232 833 233 HOH HOH A . 
F 6 HOH 233 834 234 HOH HOH A . 
F 6 HOH 234 835 235 HOH HOH A . 
F 6 HOH 235 836 236 HOH HOH A . 
F 6 HOH 236 837 237 HOH HOH A . 
F 6 HOH 237 838 238 HOH HOH A . 
F 6 HOH 238 839 239 HOH HOH A . 
F 6 HOH 239 840 240 HOH HOH A . 
F 6 HOH 240 841 241 HOH HOH A . 
F 6 HOH 241 842 242 HOH HOH A . 
F 6 HOH 242 843 243 HOH HOH A . 
F 6 HOH 243 844 244 HOH HOH A . 
F 6 HOH 244 845 245 HOH HOH A . 
F 6 HOH 245 846 246 HOH HOH A . 
F 6 HOH 246 847 247 HOH HOH A . 
F 6 HOH 247 848 248 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 61.2640000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     845 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-07-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_entity_nonpoly       
5 4 'Structure model' struct_site               
6 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'           
2 4 'Structure model' '_chem_comp.type'           
3 4 'Structure model' '_entity.pdbx_description'  
4 4 'Structure model' '_pdbx_entity_nonpoly.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
AMoRE  phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 141 ? ? -148.58 -81.94  
2 1 ALA A 226 ? ? 49.33   -124.72 
3 1 PHE A 245 ? ? -119.09 74.56   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     77 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.136 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 3   ? CG  ? A GLU 3   CG  
2 1 Y 1 A GLU 3   ? CD  ? A GLU 3   CD  
3 1 Y 1 A GLU 3   ? OE1 ? A GLU 3   OE1 
4 1 Y 1 A GLU 3   ? OE2 ? A GLU 3   OE2 
5 1 Y 1 A GLU 163 ? CG  ? A GLU 163 CG  
6 1 Y 1 A GLU 163 ? CD  ? A GLU 163 CD  
7 1 Y 1 A GLU 163 ? OE1 ? A GLU 163 OE1 
8 1 Y 1 A GLU 163 ? OE2 ? A GLU 163 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A GLU 2 ? A GLU 2 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 beta-D-fructofuranose                         FRU 
3 'SULFATE ION'                                 SO4 
4 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
5 GLYCEROL                                      GOL 
6 water                                         HOH 
#