data_2HW6
# 
_entry.id   2HW6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HW6         
RCSB  RCSB038833   
WWPDB D_1000038833 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2AC3 '2AC3 is the crystal structure of human Mnk2 kinase domain at 2.10 angstrom resolution' unspecified 
PDB 2AC5 '2AC5 is the crystal structure of human Mnk2 kinase domain D228G mutant at 3.20 angstrom resolution' unspecified 
PDB 2HW7 
'2HW7 is the crystal structure of human Mnk2 kinase domain D228G mutant in complex with staurosporine at 2.71 angstrom resolution' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HW6 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jauch, R.'  1 
'Wahl, M.C.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Mitogen-activated protein kinases interacting kinases are autoinhibited by a reprogrammed activation segment.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            25 
_citation.page_first                4020 
_citation.page_last                 4032 
_citation.year                      2006 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16917500 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7601285 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jauch, R.'        1 
primary 'Cho, M.K.'        2 
primary 'Netter, C.'       3 
primary 'Schreiter, K.'    4 
primary 'Aicher, B.'       5 
primary 'Zweckstetter, M.' 6 
primary 'Wahl, M.C.'       7 
# 
_cell.entry_id           2HW6 
_cell.length_a           93.468 
_cell.length_b           93.468 
_cell.length_c           175.181 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HW6 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MAP kinase-interacting serine/threonine-protein kinase 1' 34478.141 2   2.7.11.1 ? Mnk1-KR ? 
2 non-polymer syn 'SULFATE ION'                                              96.063    2   ?        ? ?       ? 
3 water       nat water                                                      18.015    138 ?        ? ?       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MAP kinase signal-integrating kinase 1, Mnk1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSTDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFF
EDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKGIAHRDLKPENILCESPEKVSPVKICDFDL
GSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGE
VCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSTDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFF
EDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKGIAHRDLKPENILCESPEKVSPVKICDFDL
GSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGE
VCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   THR n 
1 4   ASP n 
1 5   SER n 
1 6   LEU n 
1 7   PRO n 
1 8   GLY n 
1 9   LYS n 
1 10  PHE n 
1 11  GLU n 
1 12  ASP n 
1 13  MET n 
1 14  TYR n 
1 15  LYS n 
1 16  LEU n 
1 17  THR n 
1 18  SER n 
1 19  GLU n 
1 20  LEU n 
1 21  LEU n 
1 22  GLY n 
1 23  GLU n 
1 24  GLY n 
1 25  ALA n 
1 26  TYR n 
1 27  ALA n 
1 28  LYS n 
1 29  VAL n 
1 30  GLN n 
1 31  GLY n 
1 32  ALA n 
1 33  VAL n 
1 34  SER n 
1 35  LEU n 
1 36  GLN n 
1 37  ASN n 
1 38  GLY n 
1 39  LYS n 
1 40  GLU n 
1 41  TYR n 
1 42  ALA n 
1 43  VAL n 
1 44  LYS n 
1 45  ILE n 
1 46  ILE n 
1 47  GLU n 
1 48  LYS n 
1 49  GLN n 
1 50  ALA n 
1 51  GLY n 
1 52  HIS n 
1 53  SER n 
1 54  ARG n 
1 55  SER n 
1 56  ARG n 
1 57  VAL n 
1 58  PHE n 
1 59  ARG n 
1 60  GLU n 
1 61  VAL n 
1 62  GLU n 
1 63  THR n 
1 64  LEU n 
1 65  TYR n 
1 66  GLN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLY n 
1 70  ASN n 
1 71  LYS n 
1 72  ASN n 
1 73  ILE n 
1 74  LEU n 
1 75  GLU n 
1 76  LEU n 
1 77  ILE n 
1 78  GLU n 
1 79  PHE n 
1 80  PHE n 
1 81  GLU n 
1 82  ASP n 
1 83  ASP n 
1 84  THR n 
1 85  ARG n 
1 86  PHE n 
1 87  TYR n 
1 88  LEU n 
1 89  VAL n 
1 90  PHE n 
1 91  GLU n 
1 92  LYS n 
1 93  LEU n 
1 94  GLN n 
1 95  GLY n 
1 96  GLY n 
1 97  SER n 
1 98  ILE n 
1 99  LEU n 
1 100 ALA n 
1 101 HIS n 
1 102 ILE n 
1 103 GLN n 
1 104 LYS n 
1 105 GLN n 
1 106 LYS n 
1 107 HIS n 
1 108 PHE n 
1 109 ASN n 
1 110 GLU n 
1 111 ARG n 
1 112 GLU n 
1 113 ALA n 
1 114 SER n 
1 115 ARG n 
1 116 VAL n 
1 117 VAL n 
1 118 ARG n 
1 119 ASP n 
1 120 VAL n 
1 121 ALA n 
1 122 ALA n 
1 123 ALA n 
1 124 LEU n 
1 125 ASP n 
1 126 PHE n 
1 127 LEU n 
1 128 HIS n 
1 129 THR n 
1 130 LYS n 
1 131 GLY n 
1 132 ILE n 
1 133 ALA n 
1 134 HIS n 
1 135 ARG n 
1 136 ASP n 
1 137 LEU n 
1 138 LYS n 
1 139 PRO n 
1 140 GLU n 
1 141 ASN n 
1 142 ILE n 
1 143 LEU n 
1 144 CYS n 
1 145 GLU n 
1 146 SER n 
1 147 PRO n 
1 148 GLU n 
1 149 LYS n 
1 150 VAL n 
1 151 SER n 
1 152 PRO n 
1 153 VAL n 
1 154 LYS n 
1 155 ILE n 
1 156 CYS n 
1 157 ASP n 
1 158 PHE n 
1 159 ASP n 
1 160 LEU n 
1 161 GLY n 
1 162 SER n 
1 163 GLY n 
1 164 MET n 
1 165 LYS n 
1 166 LEU n 
1 167 ASN n 
1 168 ASN n 
1 169 SER n 
1 170 CYS n 
1 171 THR n 
1 172 PRO n 
1 173 ILE n 
1 174 THR n 
1 175 THR n 
1 176 PRO n 
1 177 GLU n 
1 178 LEU n 
1 179 THR n 
1 180 THR n 
1 181 PRO n 
1 182 CYS n 
1 183 GLY n 
1 184 SER n 
1 185 ALA n 
1 186 GLU n 
1 187 TYR n 
1 188 MET n 
1 189 ALA n 
1 190 PRO n 
1 191 GLU n 
1 192 VAL n 
1 193 VAL n 
1 194 GLU n 
1 195 VAL n 
1 196 PHE n 
1 197 THR n 
1 198 ASP n 
1 199 GLN n 
1 200 ALA n 
1 201 THR n 
1 202 PHE n 
1 203 TYR n 
1 204 ASP n 
1 205 LYS n 
1 206 ARG n 
1 207 CYS n 
1 208 ASP n 
1 209 LEU n 
1 210 TRP n 
1 211 SER n 
1 212 LEU n 
1 213 GLY n 
1 214 VAL n 
1 215 VAL n 
1 216 LEU n 
1 217 TYR n 
1 218 ILE n 
1 219 MET n 
1 220 LEU n 
1 221 SER n 
1 222 GLY n 
1 223 TYR n 
1 224 PRO n 
1 225 PRO n 
1 226 PHE n 
1 227 VAL n 
1 228 GLY n 
1 229 HIS n 
1 230 CYS n 
1 231 GLY n 
1 232 ALA n 
1 233 ASP n 
1 234 CYS n 
1 235 GLY n 
1 236 TRP n 
1 237 ASP n 
1 238 ARG n 
1 239 GLY n 
1 240 GLU n 
1 241 VAL n 
1 242 CYS n 
1 243 ARG n 
1 244 VAL n 
1 245 CYS n 
1 246 GLN n 
1 247 ASN n 
1 248 LYS n 
1 249 LEU n 
1 250 PHE n 
1 251 GLU n 
1 252 SER n 
1 253 ILE n 
1 254 GLN n 
1 255 GLU n 
1 256 GLY n 
1 257 LYS n 
1 258 TYR n 
1 259 GLU n 
1 260 PHE n 
1 261 PRO n 
1 262 ASP n 
1 263 LYS n 
1 264 ASP n 
1 265 TRP n 
1 266 ALA n 
1 267 HIS n 
1 268 ILE n 
1 269 SER n 
1 270 SER n 
1 271 GLU n 
1 272 ALA n 
1 273 LYS n 
1 274 ASP n 
1 275 LEU n 
1 276 ILE n 
1 277 SER n 
1 278 LYS n 
1 279 LEU n 
1 280 LEU n 
1 281 VAL n 
1 282 ARG n 
1 283 ASP n 
1 284 ALA n 
1 285 LYS n 
1 286 GLN n 
1 287 ARG n 
1 288 LEU n 
1 289 SER n 
1 290 ALA n 
1 291 ALA n 
1 292 GLN n 
1 293 VAL n 
1 294 LEU n 
1 295 GLN n 
1 296 HIS n 
1 297 PRO n 
1 298 TRP n 
1 299 VAL n 
1 300 GLN n 
1 301 GLY n 
1 302 GLN n 
1 303 ALA n 
1 304 PRO n 
1 305 GLU n 
1 306 LYS n 
1 307 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'MKNK1, MNK1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-4T1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MKNK1_HUMAN 
_struct_ref.pdbx_db_accession          Q9BUB5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFED
DTRFYLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPT
SASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQAT
FYDKRCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLV
RDAKQRLSAAQVLQHPWVQGQAPEKG
;
_struct_ref.pdbx_align_begin           37 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HW6 A 3 ? 307 ? Q9BUB5 37 ? 382 ? 37 341 
2 1 2HW6 B 3 ? 307 ? Q9BUB5 37 ? 382 ? 37 341 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HW6 GLY A 1 ? UNP Q9BUB5 ?   ?   'CLONING ARTIFACT' 35 1  
1 2HW6 SER A 2 ? UNP Q9BUB5 ?   ?   'CLONING ARTIFACT' 36 2  
1 2HW6 ?   A ? ? UNP Q9BUB5 ASP 165 'SEE REMARK 999'   ?  3  
1 2HW6 ?   A ? ? UNP Q9BUB5 LYS 166 'SEE REMARK 999'   ?  4  
1 2HW6 ?   A ? ? UNP Q9BUB5 VAL 167 'SEE REMARK 999'   ?  5  
1 2HW6 ?   A ? ? UNP Q9BUB5 SER 168 'SEE REMARK 999'   ?  6  
1 2HW6 ?   A ? ? UNP Q9BUB5 LEU 169 'SEE REMARK 999'   ?  7  
1 2HW6 ?   A ? ? UNP Q9BUB5 CYS 170 'SEE REMARK 999'   ?  8  
1 2HW6 ?   A ? ? UNP Q9BUB5 HIS 171 'SEE REMARK 999'   ?  9  
1 2HW6 ?   A ? ? UNP Q9BUB5 LEU 172 'SEE REMARK 999'   ?  10 
1 2HW6 ?   A ? ? UNP Q9BUB5 GLY 173 'SEE REMARK 999'   ?  11 
1 2HW6 ?   A ? ? UNP Q9BUB5 TRP 174 'SEE REMARK 999'   ?  12 
1 2HW6 ?   A ? ? UNP Q9BUB5 SER 175 'SEE REMARK 999'   ?  13 
1 2HW6 ?   A ? ? UNP Q9BUB5 ALA 176 'SEE REMARK 999'   ?  14 
1 2HW6 ?   A ? ? UNP Q9BUB5 MET 177 'SEE REMARK 999'   ?  15 
1 2HW6 ?   A ? ? UNP Q9BUB5 ALA 178 'SEE REMARK 999'   ?  16 
1 2HW6 ?   A ? ? UNP Q9BUB5 PRO 179 'SEE REMARK 999'   ?  17 
1 2HW6 ?   A ? ? UNP Q9BUB5 SER 180 'SEE REMARK 999'   ?  18 
1 2HW6 ?   A ? ? UNP Q9BUB5 GLY 181 'SEE REMARK 999'   ?  19 
1 2HW6 ?   A ? ? UNP Q9BUB5 LEU 182 'SEE REMARK 999'   ?  20 
1 2HW6 ?   A ? ? UNP Q9BUB5 THR 183 'SEE REMARK 999'   ?  21 
1 2HW6 ?   A ? ? UNP Q9BUB5 ALA 184 'SEE REMARK 999'   ?  22 
1 2HW6 ?   A ? ? UNP Q9BUB5 ALA 185 'SEE REMARK 999'   ?  23 
1 2HW6 ?   A ? ? UNP Q9BUB5 PRO 186 'SEE REMARK 999'   ?  24 
1 2HW6 ?   A ? ? UNP Q9BUB5 THR 187 'SEE REMARK 999'   ?  25 
1 2HW6 ?   A ? ? UNP Q9BUB5 SER 188 'SEE REMARK 999'   ?  26 
1 2HW6 ?   A ? ? UNP Q9BUB5 LEU 189 'SEE REMARK 999'   ?  27 
1 2HW6 ?   A ? ? UNP Q9BUB5 GLY 190 'SEE REMARK 999'   ?  28 
1 2HW6 ?   A ? ? UNP Q9BUB5 SER 191 'SEE REMARK 999'   ?  29 
1 2HW6 ?   A ? ? UNP Q9BUB5 SER 192 'SEE REMARK 999'   ?  30 
1 2HW6 ?   A ? ? UNP Q9BUB5 ASP 193 'SEE REMARK 999'   ?  31 
1 2HW6 ?   A ? ? UNP Q9BUB5 PRO 194 'SEE REMARK 999'   ?  32 
1 2HW6 ?   A ? ? UNP Q9BUB5 PRO 195 'SEE REMARK 999'   ?  33 
1 2HW6 ?   A ? ? UNP Q9BUB5 THR 196 'SEE REMARK 999'   ?  34 
1 2HW6 ?   A ? ? UNP Q9BUB5 SER 197 'SEE REMARK 999'   ?  35 
1 2HW6 ?   A ? ? UNP Q9BUB5 ALA 198 'SEE REMARK 999'   ?  36 
1 2HW6 ?   A ? ? UNP Q9BUB5 SER 199 'SEE REMARK 999'   ?  37 
1 2HW6 ?   A ? ? UNP Q9BUB5 GLN 200 'SEE REMARK 999'   ?  38 
1 2HW6 ?   A ? ? UNP Q9BUB5 VAL 201 'SEE REMARK 999'   ?  39 
1 2HW6 ?   A ? ? UNP Q9BUB5 ALA 202 'SEE REMARK 999'   ?  40 
1 2HW6 ?   A ? ? UNP Q9BUB5 GLY 203 'SEE REMARK 999'   ?  41 
1 2HW6 ?   A ? ? UNP Q9BUB5 THR 204 'SEE REMARK 999'   ?  42 
1 2HW6 ?   A ? ? UNP Q9BUB5 THR 205 'SEE REMARK 999'   ?  43 
2 2HW6 GLY B 1 ? UNP Q9BUB5 ?   ?   'CLONING ARTIFACT' 35 44 
2 2HW6 SER B 2 ? UNP Q9BUB5 ?   ?   'CLONING ARTIFACT' 36 45 
2 2HW6 ?   B ? ? UNP Q9BUB5 ASP 165 'SEE REMARK 999'   ?  46 
2 2HW6 ?   B ? ? UNP Q9BUB5 LYS 166 'SEE REMARK 999'   ?  47 
2 2HW6 ?   B ? ? UNP Q9BUB5 VAL 167 'SEE REMARK 999'   ?  48 
2 2HW6 ?   B ? ? UNP Q9BUB5 SER 168 'SEE REMARK 999'   ?  49 
2 2HW6 ?   B ? ? UNP Q9BUB5 LEU 169 'SEE REMARK 999'   ?  50 
2 2HW6 ?   B ? ? UNP Q9BUB5 CYS 170 'SEE REMARK 999'   ?  51 
2 2HW6 ?   B ? ? UNP Q9BUB5 HIS 171 'SEE REMARK 999'   ?  52 
2 2HW6 ?   B ? ? UNP Q9BUB5 LEU 172 'SEE REMARK 999'   ?  53 
2 2HW6 ?   B ? ? UNP Q9BUB5 GLY 173 'SEE REMARK 999'   ?  54 
2 2HW6 ?   B ? ? UNP Q9BUB5 TRP 174 'SEE REMARK 999'   ?  55 
2 2HW6 ?   B ? ? UNP Q9BUB5 SER 175 'SEE REMARK 999'   ?  56 
2 2HW6 ?   B ? ? UNP Q9BUB5 ALA 176 'SEE REMARK 999'   ?  57 
2 2HW6 ?   B ? ? UNP Q9BUB5 MET 177 'SEE REMARK 999'   ?  58 
2 2HW6 ?   B ? ? UNP Q9BUB5 ALA 178 'SEE REMARK 999'   ?  59 
2 2HW6 ?   B ? ? UNP Q9BUB5 PRO 179 'SEE REMARK 999'   ?  60 
2 2HW6 ?   B ? ? UNP Q9BUB5 SER 180 'SEE REMARK 999'   ?  61 
2 2HW6 ?   B ? ? UNP Q9BUB5 GLY 181 'SEE REMARK 999'   ?  62 
2 2HW6 ?   B ? ? UNP Q9BUB5 LEU 182 'SEE REMARK 999'   ?  63 
2 2HW6 ?   B ? ? UNP Q9BUB5 THR 183 'SEE REMARK 999'   ?  64 
2 2HW6 ?   B ? ? UNP Q9BUB5 ALA 184 'SEE REMARK 999'   ?  65 
2 2HW6 ?   B ? ? UNP Q9BUB5 ALA 185 'SEE REMARK 999'   ?  66 
2 2HW6 ?   B ? ? UNP Q9BUB5 PRO 186 'SEE REMARK 999'   ?  67 
2 2HW6 ?   B ? ? UNP Q9BUB5 THR 187 'SEE REMARK 999'   ?  68 
2 2HW6 ?   B ? ? UNP Q9BUB5 SER 188 'SEE REMARK 999'   ?  69 
2 2HW6 ?   B ? ? UNP Q9BUB5 LEU 189 'SEE REMARK 999'   ?  70 
2 2HW6 ?   B ? ? UNP Q9BUB5 GLY 190 'SEE REMARK 999'   ?  71 
2 2HW6 ?   B ? ? UNP Q9BUB5 SER 191 'SEE REMARK 999'   ?  72 
2 2HW6 ?   B ? ? UNP Q9BUB5 SER 192 'SEE REMARK 999'   ?  73 
2 2HW6 ?   B ? ? UNP Q9BUB5 ASP 193 'SEE REMARK 999'   ?  74 
2 2HW6 ?   B ? ? UNP Q9BUB5 PRO 194 'SEE REMARK 999'   ?  75 
2 2HW6 ?   B ? ? UNP Q9BUB5 PRO 195 'SEE REMARK 999'   ?  76 
2 2HW6 ?   B ? ? UNP Q9BUB5 THR 196 'SEE REMARK 999'   ?  77 
2 2HW6 ?   B ? ? UNP Q9BUB5 SER 197 'SEE REMARK 999'   ?  78 
2 2HW6 ?   B ? ? UNP Q9BUB5 ALA 198 'SEE REMARK 999'   ?  79 
2 2HW6 ?   B ? ? UNP Q9BUB5 SER 199 'SEE REMARK 999'   ?  80 
2 2HW6 ?   B ? ? UNP Q9BUB5 GLN 200 'SEE REMARK 999'   ?  81 
2 2HW6 ?   B ? ? UNP Q9BUB5 VAL 201 'SEE REMARK 999'   ?  82 
2 2HW6 ?   B ? ? UNP Q9BUB5 ALA 202 'SEE REMARK 999'   ?  83 
2 2HW6 ?   B ? ? UNP Q9BUB5 GLY 203 'SEE REMARK 999'   ?  84 
2 2HW6 ?   B ? ? UNP Q9BUB5 THR 204 'SEE REMARK 999'   ?  85 
2 2HW6 ?   B ? ? UNP Q9BUB5 THR 205 'SEE REMARK 999'   ?  86 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2HW6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.77 
_exptl_crystal.density_percent_sol   55.65 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    '20% PEG3350, 0.2M Ammonium sulfate, pH 5.6, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2005-04-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98008 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98008 
# 
_reflns.entry_id                     2HW6 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             30 
_reflns.number_all                   19844 
_reflns.number_obs                   18256 
_reflns.percent_possible_obs         92.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2HW6 
_refine.ls_number_reflns_obs                     18206 
_refine.ls_number_reflns_all                     19844 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    69.61 
_refine.ls_R_factor_obs                          0.20911 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20666 
_refine.ls_R_factor_R_free                       0.25701 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  937 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.932 
_refine.correlation_coeff_Fo_to_Fc_free          0.908 
_refine.B_iso_mean                               48.140 
_refine.aniso_B[1][1]                            1.46 
_refine.aniso_B[2][2]                            1.46 
_refine.aniso_B[3][3]                            -2.93 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2AC3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.770 
_refine.pdbx_overall_ESU_R_Free                  0.344 
_refine.overall_SU_ML                            0.219 
_refine.overall_SU_B                             20.494 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3815 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             138 
_refine_hist.number_atoms_total               3963 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010  0.022  ? 3903 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.174  1.962  ? 5262 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.559  5.000  ? 469  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   37.159 24.309 ? 188  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.792 15.000 ? 701  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   18.526 15.000 ? 22   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.081  0.200  ? 571  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.003  0.020  ? 2929 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.209  0.200  ? 1847 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.307  0.200  ? 2649 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.131  0.200  ? 145  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.152  0.200  ? 23   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.165  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.544  1.500  ? 2414 'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.999  2.000  ? 3787 'X-RAY DIFFRACTION' ? 
r_scbond_it              0.964  3.000  ? 1672 'X-RAY DIFFRACTION' ? 
r_scangle_it             1.669  4.500  ? 1475 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.57 
_refine_ls_shell.number_reflns_R_work             161 
_refine_ls_shell.R_factor_R_work                  0.333 
_refine_ls_shell.percent_reflns_obs               8.72 
_refine_ls_shell.R_factor_R_free                  0.469 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             10 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HW6 
_struct.title                     'Crystal structure of Mnk1 catalytic domain' 
_struct.pdbx_descriptor           'MAP kinase-interacting serine/threonine-protein kinase 1 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HW6 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'protein kinase, drug design, mnk1, phosphorylation, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;the asymmetric unit contains 2 molecules  
the biological unit is a monomer
;
? 
2 ?                                                                             ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 9   ? ASP A 12  ? LYS A 43  ASP A 46  5 ? 4  
HELX_P HELX_P2  2  HIS A 52  ? GLN A 68  ? HIS A 86  GLN A 102 1 ? 17 
HELX_P HELX_P3  3  SER A 97  ? LYS A 106 ? SER A 131 LYS A 140 1 ? 10 
HELX_P HELX_P4  4  ASN A 109 ? LYS A 130 ? ASN A 143 LYS A 164 1 ? 22 
HELX_P HELX_P5  5  LYS A 138 ? GLU A 140 ? LYS A 172 GLU A 174 5 ? 3  
HELX_P HELX_P6  6  THR A 201 ? GLY A 222 ? THR A 235 GLY A 256 1 ? 22 
HELX_P HELX_P7  7  PRO A 261 ? ALA A 266 ? PRO A 295 ALA A 300 1 ? 6  
HELX_P HELX_P8  8  SER A 269 ? LEU A 280 ? SER A 303 LEU A 314 1 ? 12 
HELX_P HELX_P9  9  SER A 289 ? HIS A 296 ? SER A 323 HIS A 330 1 ? 8  
HELX_P HELX_P10 10 LYS B 9   ? ASP B 12  ? LYS B 43  ASP B 46  5 ? 4  
HELX_P HELX_P11 11 HIS B 52  ? GLN B 66  ? HIS B 86  GLN B 100 1 ? 15 
HELX_P HELX_P12 12 LEU B 99  ? LYS B 104 ? LEU B 133 LYS B 138 1 ? 6  
HELX_P HELX_P13 13 ASN B 109 ? LYS B 130 ? ASN B 143 LYS B 164 1 ? 22 
HELX_P HELX_P14 14 LYS B 138 ? GLU B 140 ? LYS B 172 GLU B 174 5 ? 3  
HELX_P HELX_P15 15 THR B 201 ? GLY B 222 ? THR B 235 GLY B 256 1 ? 22 
HELX_P HELX_P16 16 SER B 269 ? LYS B 278 ? SER B 303 LYS B 312 1 ? 10 
HELX_P HELX_P17 17 SER B 289 ? LEU B 294 ? SER B 323 LEU B 328 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
D ? 5 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 14  ? GLU A 23  ? TYR A 48  GLU A 57  
A 2 ALA A 27  ? SER A 34  ? ALA A 61  SER A 68  
A 3 GLU A 40  ? GLU A 47  ? GLU A 74  GLU A 81  
A 4 ARG A 85  ? GLU A 91  ? ARG A 119 GLU A 125 
A 5 LEU A 76  ? GLU A 81  ? LEU A 110 GLU A 115 
B 1 ILE A 142 ? CYS A 144 ? ILE A 176 CYS A 178 
B 2 VAL A 153 ? ILE A 155 ? VAL A 187 ILE A 189 
C 1 TYR B 14  ? LEU B 16  ? TYR B 48  LEU B 50  
C 2 ALA B 27  ? SER B 34  ? ALA B 61  SER B 68  
C 3 GLY B 22  ? GLU B 23  ? GLY B 56  GLU B 57  
D 1 TYR B 14  ? LEU B 16  ? TYR B 48  LEU B 50  
D 2 ALA B 27  ? SER B 34  ? ALA B 61  SER B 68  
D 3 GLU B 40  ? GLU B 47  ? GLU B 74  GLU B 81  
D 4 ARG B 85  ? GLU B 91  ? ARG B 119 GLU B 125 
D 5 LEU B 76  ? GLU B 81  ? LEU B 110 GLU B 115 
E 1 GLY B 96  ? SER B 97  ? GLY B 130 SER B 131 
E 2 ILE B 142 ? CYS B 144 ? ILE B 176 CYS B 178 
E 3 LYS B 154 ? ILE B 155 ? LYS B 188 ILE B 189 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 17  ? N THR A 51  O GLY A 31  ? O GLY A 65  
A 2 3 N GLN A 30  ? N GLN A 64  O VAL A 43  ? O VAL A 77  
A 3 4 N LYS A 44  ? N LYS A 78  O LEU A 88  ? O LEU A 122 
A 4 5 O VAL A 89  ? O VAL A 123 N ILE A 77  ? N ILE A 111 
B 1 2 N LEU A 143 ? N LEU A 177 O LYS A 154 ? O LYS A 188 
C 1 2 N LYS B 15  ? N LYS B 49  O VAL B 33  ? O VAL B 67  
C 2 3 O VAL B 29  ? O VAL B 63  N GLY B 22  ? N GLY B 56  
D 1 2 N LYS B 15  ? N LYS B 49  O VAL B 33  ? O VAL B 67  
D 2 3 N ALA B 32  ? N ALA B 66  O TYR B 41  ? O TYR B 75  
D 3 4 N LYS B 44  ? N LYS B 78  O LEU B 88  ? O LEU B 122 
D 4 5 O TYR B 87  ? O TYR B 121 N PHE B 80  ? N PHE B 114 
E 1 2 N GLY B 96  ? N GLY B 130 O CYS B 144 ? O CYS B 178 
E 2 3 N LEU B 143 ? N LEU B 177 O LYS B 154 ? O LYS B 188 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 B 342' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 342' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 HIS A 52  ? HIS A 86  . ? 4_455 ? 
2  AC1 8 SER A 55  ? SER A 89  . ? 4_455 ? 
3  AC1 8 ARG A 56  ? ARG A 90  . ? 4_455 ? 
4  AC1 8 ARG A 59  ? ARG A 93  . ? 4_455 ? 
5  AC1 8 HIS B 52  ? HIS B 86  . ? 1_555 ? 
6  AC1 8 SER B 55  ? SER B 89  . ? 1_555 ? 
7  AC1 8 ARG B 56  ? ARG B 90  . ? 1_555 ? 
8  AC1 8 ARG B 59  ? ARG B 93  . ? 1_555 ? 
9  AC2 5 HIS A 128 ? HIS A 162 . ? 1_555 ? 
10 AC2 5 PHE A 202 ? PHE A 236 . ? 1_555 ? 
11 AC2 5 LYS A 205 ? LYS A 239 . ? 1_555 ? 
12 AC2 5 ARG A 206 ? ARG A 240 . ? 1_555 ? 
13 AC2 5 HOH E .   ? HOH A 363 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2HW6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HW6 
_atom_sites.fract_transf_matrix[1][1]   0.010699 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010699 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005708 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 5   ? 0.983   22.357 83.354  1.00 56.59 ? 39  SER A N   1 
ATOM   2    C CA  . SER A 1 5   ? 1.679   23.377 84.207  1.00 56.57 ? 39  SER A CA  1 
ATOM   3    C C   . SER A 1 5   ? 1.189   24.810 83.894  1.00 56.13 ? 39  SER A C   1 
ATOM   4    O O   . SER A 1 5   ? 1.142   25.227 82.721  1.00 56.21 ? 39  SER A O   1 
ATOM   5    C CB  . SER A 1 5   ? 3.212   23.259 84.065  1.00 56.82 ? 39  SER A CB  1 
ATOM   6    O OG  . SER A 1 5   ? 3.901   23.886 85.143  1.00 57.09 ? 39  SER A OG  1 
ATOM   7    N N   . LEU A 1 6   ? 0.837   25.544 84.958  1.00 55.20 ? 40  LEU A N   1 
ATOM   8    C CA  . LEU A 1 6   ? 0.235   26.890 84.880  1.00 54.04 ? 40  LEU A CA  1 
ATOM   9    C C   . LEU A 1 6   ? 0.990   27.883 83.967  1.00 52.84 ? 40  LEU A C   1 
ATOM   10   O O   . LEU A 1 6   ? 2.217   27.784 83.816  1.00 52.97 ? 40  LEU A O   1 
ATOM   11   C CB  . LEU A 1 6   ? 0.055   27.473 86.297  1.00 54.16 ? 40  LEU A CB  1 
ATOM   12   C CG  . LEU A 1 6   ? -1.062  26.907 87.197  1.00 54.27 ? 40  LEU A CG  1 
ATOM   13   C CD1 . LEU A 1 6   ? -0.635  25.633 87.937  1.00 53.38 ? 40  LEU A CD1 1 
ATOM   14   C CD2 . LEU A 1 6   ? -1.553  27.976 88.198  1.00 54.35 ? 40  LEU A CD2 1 
ATOM   15   N N   . PRO A 1 7   ? 0.253   28.824 83.337  1.00 51.49 ? 41  PRO A N   1 
ATOM   16   C CA  . PRO A 1 7   ? 0.838   29.875 82.485  1.00 50.22 ? 41  PRO A CA  1 
ATOM   17   C C   . PRO A 1 7   ? 2.159   30.496 82.992  1.00 48.73 ? 41  PRO A C   1 
ATOM   18   O O   . PRO A 1 7   ? 3.127   30.565 82.220  1.00 48.79 ? 41  PRO A O   1 
ATOM   19   C CB  . PRO A 1 7   ? -0.275  30.927 82.425  1.00 50.29 ? 41  PRO A CB  1 
ATOM   20   C CG  . PRO A 1 7   ? -1.525  30.116 82.485  1.00 51.02 ? 41  PRO A CG  1 
ATOM   21   C CD  . PRO A 1 7   ? -1.222  28.919 83.373  1.00 51.40 ? 41  PRO A CD  1 
ATOM   22   N N   . GLY A 1 8   ? 2.200   30.932 84.257  1.00 46.67 ? 42  GLY A N   1 
ATOM   23   C CA  . GLY A 1 8   ? 3.374   31.615 84.809  1.00 43.94 ? 42  GLY A CA  1 
ATOM   24   C C   . GLY A 1 8   ? 3.208   33.120 84.741  1.00 42.20 ? 42  GLY A C   1 
ATOM   25   O O   . GLY A 1 8   ? 2.895   33.660 83.689  1.00 42.10 ? 42  GLY A O   1 
ATOM   26   N N   . LYS A 1 9   ? 3.414   33.797 85.867  1.00 40.58 ? 43  LYS A N   1 
ATOM   27   C CA  . LYS A 1 9   ? 3.198   35.245 85.978  1.00 38.96 ? 43  LYS A CA  1 
ATOM   28   C C   . LYS A 1 9   ? 4.515   36.015 86.030  1.00 38.27 ? 43  LYS A C   1 
ATOM   29   O O   . LYS A 1 9   ? 5.551   35.465 86.396  1.00 38.38 ? 43  LYS A O   1 
ATOM   30   C CB  . LYS A 1 9   ? 2.390   35.573 87.234  1.00 38.85 ? 43  LYS A CB  1 
ATOM   31   C CG  . LYS A 1 9   ? 1.225   34.645 87.521  1.00 38.05 ? 43  LYS A CG  1 
ATOM   32   C CD  . LYS A 1 9   ? 0.288   35.257 88.533  1.00 36.81 ? 43  LYS A CD  1 
ATOM   33   C CE  . LYS A 1 9   ? -0.981  34.459 88.637  1.00 36.57 ? 43  LYS A CE  1 
ATOM   34   N NZ  . LYS A 1 9   ? -1.910  35.108 89.587  1.00 37.13 ? 43  LYS A NZ  1 
ATOM   35   N N   . PHE A 1 10  ? 4.475   37.297 85.685  1.00 37.24 ? 44  PHE A N   1 
ATOM   36   C CA  . PHE A 1 10  ? 5.692   38.108 85.635  1.00 36.19 ? 44  PHE A CA  1 
ATOM   37   C C   . PHE A 1 10  ? 6.266   38.394 87.034  1.00 36.03 ? 44  PHE A C   1 
ATOM   38   O O   . PHE A 1 10  ? 7.487   38.452 87.218  1.00 36.00 ? 44  PHE A O   1 
ATOM   39   C CB  . PHE A 1 10  ? 5.424   39.399 84.860  1.00 35.68 ? 44  PHE A CB  1 
ATOM   40   C CG  . PHE A 1 10  ? 6.629   40.270 84.675  1.00 34.69 ? 44  PHE A CG  1 
ATOM   41   C CD1 . PHE A 1 10  ? 7.625   39.923 83.774  1.00 34.69 ? 44  PHE A CD1 1 
ATOM   42   C CD2 . PHE A 1 10  ? 6.754   41.457 85.382  1.00 33.59 ? 44  PHE A CD2 1 
ATOM   43   C CE1 . PHE A 1 10  ? 8.740   40.739 83.591  1.00 33.55 ? 44  PHE A CE1 1 
ATOM   44   C CE2 . PHE A 1 10  ? 7.858   42.272 85.213  1.00 32.92 ? 44  PHE A CE2 1 
ATOM   45   C CZ  . PHE A 1 10  ? 8.855   41.911 84.312  1.00 34.03 ? 44  PHE A CZ  1 
ATOM   46   N N   . GLU A 1 11  ? 5.385   38.554 88.019  1.00 35.70 ? 45  GLU A N   1 
ATOM   47   C CA  . GLU A 1 11  ? 5.818   38.887 89.381  1.00 35.67 ? 45  GLU A CA  1 
ATOM   48   C C   . GLU A 1 11  ? 6.610   37.749 90.009  1.00 35.45 ? 45  GLU A C   1 
ATOM   49   O O   . GLU A 1 11  ? 7.189   37.910 91.085  1.00 35.68 ? 45  GLU A O   1 
ATOM   50   C CB  . GLU A 1 11  ? 4.641   39.282 90.278  1.00 35.26 ? 45  GLU A CB  1 
ATOM   51   C CG  . GLU A 1 11  ? 3.466   38.347 90.177  1.00 35.89 ? 45  GLU A CG  1 
ATOM   52   C CD  . GLU A 1 11  ? 2.392   38.588 91.222  1.00 36.14 ? 45  GLU A CD  1 
ATOM   53   O OE1 . GLU A 1 11  ? 2.270   39.720 91.747  1.00 35.76 ? 45  GLU A OE1 1 
ATOM   54   O OE2 . GLU A 1 11  ? 1.656   37.618 91.509  1.00 37.44 ? 45  GLU A OE2 1 
ATOM   55   N N   . ASP A 1 12  ? 6.641   36.610 89.319  1.00 35.03 ? 46  ASP A N   1 
ATOM   56   C CA  . ASP A 1 12  ? 7.349   35.425 89.793  1.00 34.37 ? 46  ASP A CA  1 
ATOM   57   C C   . ASP A 1 12  ? 8.693   35.276 89.117  1.00 33.84 ? 46  ASP A C   1 
ATOM   58   O O   . ASP A 1 12  ? 9.472   34.377 89.462  1.00 33.81 ? 46  ASP A O   1 
ATOM   59   C CB  . ASP A 1 12  ? 6.502   34.180 89.555  1.00 34.44 ? 46  ASP A CB  1 
ATOM   60   C CG  . ASP A 1 12  ? 5.251   34.174 90.396  1.00 34.70 ? 46  ASP A CG  1 
ATOM   61   O OD1 . ASP A 1 12  ? 5.332   34.589 91.575  1.00 34.65 ? 46  ASP A OD1 1 
ATOM   62   O OD2 . ASP A 1 12  ? 4.193   33.764 89.877  1.00 35.05 ? 46  ASP A OD2 1 
ATOM   63   N N   . MET A 1 13  ? 8.958   36.165 88.160  1.00 33.13 ? 47  MET A N   1 
ATOM   64   C CA  . MET A 1 13  ? 10.194  36.120 87.392  1.00 32.48 ? 47  MET A CA  1 
ATOM   65   C C   . MET A 1 13  ? 11.021  37.398 87.499  1.00 32.18 ? 47  MET A C   1 
ATOM   66   O O   . MET A 1 13  ? 12.247  37.332 87.459  1.00 32.45 ? 47  MET A O   1 
ATOM   67   C CB  . MET A 1 13  ? 9.947   35.701 85.933  1.00 32.37 ? 47  MET A CB  1 
ATOM   68   C CG  . MET A 1 13  ? 8.581   36.063 85.384  1.00 32.10 ? 47  MET A CG  1 
ATOM   69   S SD  . MET A 1 13  ? 8.283   35.492 83.703  1.00 32.37 ? 47  MET A SD  1 
ATOM   70   C CE  . MET A 1 13  ? 7.388   33.969 83.993  1.00 33.23 ? 47  MET A CE  1 
ATOM   71   N N   . TYR A 1 14  ? 10.375  38.550 87.659  1.00 31.68 ? 48  TYR A N   1 
ATOM   72   C CA  . TYR A 1 14  ? 11.124  39.801 87.868  1.00 31.48 ? 48  TYR A CA  1 
ATOM   73   C C   . TYR A 1 14  ? 10.533  40.714 88.933  1.00 31.35 ? 48  TYR A C   1 
ATOM   74   O O   . TYR A 1 14  ? 9.312   40.804 89.090  1.00 31.20 ? 48  TYR A O   1 
ATOM   75   C CB  . TYR A 1 14  ? 11.239  40.590 86.568  1.00 31.63 ? 48  TYR A CB  1 
ATOM   76   C CG  . TYR A 1 14  ? 12.010  39.884 85.489  1.00 31.77 ? 48  TYR A CG  1 
ATOM   77   C CD1 . TYR A 1 14  ? 11.391  38.947 84.661  1.00 31.31 ? 48  TYR A CD1 1 
ATOM   78   C CD2 . TYR A 1 14  ? 13.359  40.159 85.288  1.00 31.88 ? 48  TYR A CD2 1 
ATOM   79   C CE1 . TYR A 1 14  ? 12.096  38.292 83.671  1.00 31.80 ? 48  TYR A CE1 1 
ATOM   80   C CE2 . TYR A 1 14  ? 14.076  39.514 84.298  1.00 31.98 ? 48  TYR A CE2 1 
ATOM   81   C CZ  . TYR A 1 14  ? 13.441  38.581 83.492  1.00 32.15 ? 48  TYR A CZ  1 
ATOM   82   O OH  . TYR A 1 14  ? 14.158  37.933 82.510  1.00 31.98 ? 48  TYR A OH  1 
ATOM   83   N N   . LYS A 1 15  ? 11.412  41.403 89.647  1.00 31.27 ? 49  LYS A N   1 
ATOM   84   C CA  . LYS A 1 15  ? 10.998  42.430 90.595  1.00 31.74 ? 49  LYS A CA  1 
ATOM   85   C C   . LYS A 1 15  ? 11.421  43.775 90.033  1.00 31.43 ? 49  LYS A C   1 
ATOM   86   O O   . LYS A 1 15  ? 12.606  44.013 89.800  1.00 31.34 ? 49  LYS A O   1 
ATOM   87   C CB  . LYS A 1 15  ? 11.619  42.182 91.988  1.00 32.24 ? 49  LYS A CB  1 
ATOM   88   C CG  . LYS A 1 15  ? 11.151  43.091 93.146  1.00 33.31 ? 49  LYS A CG  1 
ATOM   89   C CD  . LYS A 1 15  ? 9.624   43.089 93.342  1.00 37.05 ? 49  LYS A CD  1 
ATOM   90   C CE  . LYS A 1 15  ? 9.085   41.780 93.958  1.00 38.06 ? 49  LYS A CE  1 
ATOM   91   N NZ  . LYS A 1 15  ? 7.614   41.568 93.664  1.00 37.64 ? 49  LYS A NZ  1 
ATOM   92   N N   . LEU A 1 16  ? 10.442  44.642 89.800  1.00 31.27 ? 50  LEU A N   1 
ATOM   93   C CA  . LEU A 1 16  ? 10.702  45.965 89.247  1.00 31.02 ? 50  LEU A CA  1 
ATOM   94   C C   . LEU A 1 16  ? 11.251  46.871 90.334  1.00 30.83 ? 50  LEU A C   1 
ATOM   95   O O   . LEU A 1 16  ? 10.705  46.938 91.430  1.00 30.65 ? 50  LEU A O   1 
ATOM   96   C CB  . LEU A 1 16  ? 9.435   46.564 88.625  1.00 31.09 ? 50  LEU A CB  1 
ATOM   97   C CG  . LEU A 1 16  ? 8.724   45.753 87.526  1.00 30.88 ? 50  LEU A CG  1 
ATOM   98   C CD1 . LEU A 1 16  ? 7.408   46.391 87.110  1.00 30.03 ? 50  LEU A CD1 1 
ATOM   99   C CD2 . LEU A 1 16  ? 9.619   45.557 86.320  1.00 30.75 ? 50  LEU A CD2 1 
ATOM   100  N N   . THR A 1 17  ? 12.350  47.545 90.022  1.00 30.87 ? 51  THR A N   1 
ATOM   101  C CA  . THR A 1 17  ? 13.016  48.419 90.968  1.00 30.81 ? 51  THR A CA  1 
ATOM   102  C C   . THR A 1 17  ? 12.370  49.793 90.919  1.00 31.22 ? 51  THR A C   1 
ATOM   103  O O   . THR A 1 17  ? 11.473  50.041 90.117  1.00 31.18 ? 51  THR A O   1 
ATOM   104  C CB  . THR A 1 17  ? 14.538  48.490 90.706  1.00 30.55 ? 51  THR A CB  1 
ATOM   105  O OG1 . THR A 1 17  ? 14.813  49.300 89.564  1.00 30.59 ? 51  THR A OG1 1 
ATOM   106  C CG2 . THR A 1 17  ? 15.090  47.110 90.452  1.00 30.43 ? 51  THR A CG2 1 
ATOM   107  N N   . SER A 1 18  ? 12.812  50.685 91.794  1.00 31.95 ? 52  SER A N   1 
ATOM   108  C CA  . SER A 1 18  ? 12.279  52.041 91.821  1.00 32.44 ? 52  SER A CA  1 
ATOM   109  C C   . SER A 1 18  ? 12.782  52.858 90.642  1.00 32.74 ? 52  SER A C   1 
ATOM   110  O O   . SER A 1 18  ? 12.364  54.004 90.460  1.00 33.47 ? 52  SER A O   1 
ATOM   111  C CB  . SER A 1 18  ? 12.667  52.735 93.112  1.00 31.96 ? 52  SER A CB  1 
ATOM   112  O OG  . SER A 1 18  ? 12.644  51.808 94.168  1.00 32.97 ? 52  SER A OG  1 
ATOM   113  N N   . GLU A 1 19  ? 13.672  52.276 89.842  1.00 32.75 ? 53  GLU A N   1 
ATOM   114  C CA  . GLU A 1 19  ? 14.283  53.005 88.738  1.00 33.00 ? 53  GLU A CA  1 
ATOM   115  C C   . GLU A 1 19  ? 13.428  52.998 87.487  1.00 32.59 ? 53  GLU A C   1 
ATOM   116  O O   . GLU A 1 19  ? 13.434  52.036 86.722  1.00 32.27 ? 53  GLU A O   1 
ATOM   117  C CB  . GLU A 1 19  ? 15.664  52.461 88.410  1.00 33.32 ? 53  GLU A CB  1 
ATOM   118  C CG  . GLU A 1 19  ? 16.487  53.435 87.607  1.00 34.67 ? 53  GLU A CG  1 
ATOM   119  C CD  . GLU A 1 19  ? 17.654  52.774 86.949  1.00 36.89 ? 53  GLU A CD  1 
ATOM   120  O OE1 . GLU A 1 19  ? 18.465  53.497 86.336  1.00 38.60 ? 53  GLU A OE1 1 
ATOM   121  O OE2 . GLU A 1 19  ? 17.756  51.531 87.041  1.00 37.89 ? 53  GLU A OE2 1 
ATOM   122  N N   . LEU A 1 20  ? 12.695  54.087 87.300  1.00 32.49 ? 54  LEU A N   1 
ATOM   123  C CA  . LEU A 1 20  ? 11.899  54.282 86.117  1.00 32.58 ? 54  LEU A CA  1 
ATOM   124  C C   . LEU A 1 20  ? 12.739  55.073 85.127  1.00 32.58 ? 54  LEU A C   1 
ATOM   125  O O   . LEU A 1 20  ? 13.124  56.203 85.408  1.00 32.59 ? 54  LEU A O   1 
ATOM   126  C CB  . LEU A 1 20  ? 10.595  55.014 86.461  1.00 32.50 ? 54  LEU A CB  1 
ATOM   127  C CG  . LEU A 1 20  ? 9.606   55.193 85.301  1.00 32.70 ? 54  LEU A CG  1 
ATOM   128  C CD1 . LEU A 1 20  ? 9.171   53.852 84.701  1.00 32.54 ? 54  LEU A CD1 1 
ATOM   129  C CD2 . LEU A 1 20  ? 8.408   56.019 85.733  1.00 32.55 ? 54  LEU A CD2 1 
ATOM   130  N N   . LEU A 1 21  ? 13.024  54.459 83.981  1.00 32.69 ? 55  LEU A N   1 
ATOM   131  C CA  . LEU A 1 21  ? 13.885  55.035 82.950  1.00 32.92 ? 55  LEU A CA  1 
ATOM   132  C C   . LEU A 1 21  ? 13.101  55.856 81.911  1.00 33.14 ? 55  LEU A C   1 
ATOM   133  O O   . LEU A 1 21  ? 13.690  56.509 81.050  1.00 33.22 ? 55  LEU A O   1 
ATOM   134  C CB  . LEU A 1 21  ? 14.655  53.915 82.257  1.00 33.06 ? 55  LEU A CB  1 
ATOM   135  C CG  . LEU A 1 21  ? 15.685  53.223 83.143  1.00 33.59 ? 55  LEU A CG  1 
ATOM   136  C CD1 . LEU A 1 21  ? 15.585  51.727 83.030  1.00 33.61 ? 55  LEU A CD1 1 
ATOM   137  C CD2 . LEU A 1 21  ? 17.073  53.694 82.775  1.00 36.04 ? 55  LEU A CD2 1 
ATOM   138  N N   . GLY A 1 22  ? 11.773  55.815 82.002  1.00 33.13 ? 56  GLY A N   1 
ATOM   139  C CA  . GLY A 1 22  ? 10.893  56.574 81.118  1.00 32.95 ? 56  GLY A CA  1 
ATOM   140  C C   . GLY A 1 22  ? 9.523   55.942 81.043  1.00 32.92 ? 56  GLY A C   1 
ATOM   141  O O   . GLY A 1 22  ? 9.405   54.721 81.086  1.00 33.12 ? 56  GLY A O   1 
ATOM   142  N N   . GLU A 1 23  ? 8.485   56.765 80.961  1.00 32.99 ? 57  GLU A N   1 
ATOM   143  C CA  . GLU A 1 23  ? 7.133   56.266 80.723  1.00 33.21 ? 57  GLU A CA  1 
ATOM   144  C C   . GLU A 1 23  ? 6.413   57.154 79.703  1.00 32.87 ? 57  GLU A C   1 
ATOM   145  O O   . GLU A 1 23  ? 6.509   58.377 79.748  1.00 33.09 ? 57  GLU A O   1 
ATOM   146  C CB  . GLU A 1 23  ? 6.335   56.152 82.042  1.00 33.30 ? 57  GLU A CB  1 
ATOM   147  C CG  . GLU A 1 23  ? 4.911   55.492 81.926  1.00 33.61 ? 57  GLU A CG  1 
ATOM   148  C CD  . GLU A 1 23  ? 4.450   54.718 83.194  1.00 34.45 ? 57  GLU A CD  1 
ATOM   149  O OE1 . GLU A 1 23  ? 4.708   55.174 84.337  1.00 34.15 ? 57  GLU A OE1 1 
ATOM   150  O OE2 . GLU A 1 23  ? 3.808   53.643 83.041  1.00 36.44 ? 57  GLU A OE2 1 
ATOM   151  N N   . GLY A 1 24  ? 5.711   56.527 78.771  1.00 32.38 ? 58  GLY A N   1 
ATOM   152  C CA  . GLY A 1 24  ? 4.861   57.252 77.839  1.00 31.80 ? 58  GLY A CA  1 
ATOM   153  C C   . GLY A 1 24  ? 3.467   56.657 77.845  1.00 31.44 ? 58  GLY A C   1 
ATOM   154  O O   . GLY A 1 24  ? 3.123   55.872 78.735  1.00 31.59 ? 58  GLY A O   1 
ATOM   155  N N   . ALA A 1 25  ? 2.669   57.008 76.844  1.00 30.74 ? 59  ALA A N   1 
ATOM   156  C CA  . ALA A 1 25  ? 1.275   56.608 76.824  1.00 30.16 ? 59  ALA A CA  1 
ATOM   157  C C   . ALA A 1 25  ? 1.040   55.134 76.487  1.00 29.79 ? 59  ALA A C   1 
ATOM   158  O O   . ALA A 1 25  ? -0.015  54.608 76.801  1.00 29.98 ? 59  ALA A O   1 
ATOM   159  C CB  . ALA A 1 25  ? 0.468   57.522 75.902  1.00 30.48 ? 59  ALA A CB  1 
ATOM   160  N N   . TYR A 1 26  ? 1.992   54.456 75.857  1.00 29.38 ? 60  TYR A N   1 
ATOM   161  C CA  . TYR A 1 26  ? 1.806   53.018 75.614  1.00 29.42 ? 60  TYR A CA  1 
ATOM   162  C C   . TYR A 1 26  ? 2.870   52.122 76.246  1.00 29.74 ? 60  TYR A C   1 
ATOM   163  O O   . TYR A 1 26  ? 2.710   50.897 76.267  1.00 30.28 ? 60  TYR A O   1 
ATOM   164  C CB  . TYR A 1 26  ? 1.608   52.677 74.124  1.00 29.26 ? 60  TYR A CB  1 
ATOM   165  C CG  . TYR A 1 26  ? 2.810   52.874 73.221  1.00 28.94 ? 60  TYR A CG  1 
ATOM   166  C CD1 . TYR A 1 26  ? 2.946   54.041 72.463  1.00 29.31 ? 60  TYR A CD1 1 
ATOM   167  C CD2 . TYR A 1 26  ? 3.798   51.885 73.094  1.00 28.97 ? 60  TYR A CD2 1 
ATOM   168  C CE1 . TYR A 1 26  ? 4.048   54.236 71.608  1.00 30.12 ? 60  TYR A CE1 1 
ATOM   169  C CE2 . TYR A 1 26  ? 4.912   52.069 72.243  1.00 29.33 ? 60  TYR A CE2 1 
ATOM   170  C CZ  . TYR A 1 26  ? 5.029   53.252 71.502  1.00 29.73 ? 60  TYR A CZ  1 
ATOM   171  O OH  . TYR A 1 26  ? 6.108   53.469 70.663  1.00 28.49 ? 60  TYR A OH  1 
ATOM   172  N N   . ALA A 1 27  ? 3.939   52.717 76.773  1.00 29.42 ? 61  ALA A N   1 
ATOM   173  C CA  . ALA A 1 27  ? 5.023   51.923 77.322  1.00 29.13 ? 61  ALA A CA  1 
ATOM   174  C C   . ALA A 1 27  ? 5.775   52.613 78.461  1.00 29.14 ? 61  ALA A C   1 
ATOM   175  O O   . ALA A 1 27  ? 5.638   53.824 78.673  1.00 29.22 ? 61  ALA A O   1 
ATOM   176  C CB  . ALA A 1 27  ? 5.974   51.533 76.217  1.00 28.88 ? 61  ALA A CB  1 
ATOM   177  N N   . LYS A 1 28  ? 6.551   51.826 79.204  1.00 28.61 ? 62  LYS A N   1 
ATOM   178  C CA  . LYS A 1 28  ? 7.536   52.369 80.130  1.00 28.38 ? 62  LYS A CA  1 
ATOM   179  C C   . LYS A 1 28  ? 8.732   51.474 80.105  1.00 28.43 ? 62  LYS A C   1 
ATOM   180  O O   . LYS A 1 28  ? 8.637   50.328 79.681  1.00 29.14 ? 62  LYS A O   1 
ATOM   181  C CB  . LYS A 1 28  ? 7.005   52.476 81.568  1.00 28.26 ? 62  LYS A CB  1 
ATOM   182  C CG  . LYS A 1 28  ? 6.828   51.164 82.337  1.00 27.95 ? 62  LYS A CG  1 
ATOM   183  C CD  . LYS A 1 28  ? 6.095   51.405 83.668  1.00 28.09 ? 62  LYS A CD  1 
ATOM   184  C CE  . LYS A 1 28  ? 5.813   50.113 84.441  1.00 27.94 ? 62  LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 28  ? 5.420   50.339 85.891  1.00 27.01 ? 62  LYS A NZ  1 
ATOM   186  N N   . VAL A 1 29  ? 9.858   52.003 80.555  1.00 28.15 ? 63  VAL A N   1 
ATOM   187  C CA  . VAL A 1 29  ? 11.078  51.236 80.678  1.00 27.81 ? 63  VAL A CA  1 
ATOM   188  C C   . VAL A 1 29  ? 11.441  51.406 82.134  1.00 28.45 ? 63  VAL A C   1 
ATOM   189  O O   . VAL A 1 29  ? 11.552  52.531 82.637  1.00 28.69 ? 63  VAL A O   1 
ATOM   190  C CB  . VAL A 1 29  ? 12.205  51.762 79.742  1.00 27.69 ? 63  VAL A CB  1 
ATOM   191  C CG1 . VAL A 1 29  ? 13.461  50.914 79.865  1.00 27.34 ? 63  VAL A CG1 1 
ATOM   192  C CG2 . VAL A 1 29  ? 11.751  51.777 78.304  1.00 26.03 ? 63  VAL A CG2 1 
ATOM   193  N N   . GLN A 1 30  ? 11.578  50.278 82.820  1.00 28.77 ? 64  GLN A N   1 
ATOM   194  C CA  . GLN A 1 30  ? 11.794  50.259 84.252  1.00 28.67 ? 64  GLN A CA  1 
ATOM   195  C C   . GLN A 1 30  ? 12.890  49.260 84.573  1.00 29.21 ? 64  GLN A C   1 
ATOM   196  O O   . GLN A 1 30  ? 13.086  48.298 83.830  1.00 29.44 ? 64  GLN A O   1 
ATOM   197  C CB  . GLN A 1 30  ? 10.496  49.874 84.972  1.00 28.50 ? 64  GLN A CB  1 
ATOM   198  C CG  . GLN A 1 30  ? 10.545  50.090 86.487  1.00 27.35 ? 64  GLN A CG  1 
ATOM   199  C CD  . GLN A 1 30  ? 9.180   50.232 87.123  1.00 26.31 ? 64  GLN A CD  1 
ATOM   200  O OE1 . GLN A 1 30  ? 8.154   50.283 86.437  1.00 26.02 ? 64  GLN A OE1 1 
ATOM   201  N NE2 . GLN A 1 30  ? 9.159   50.307 88.450  1.00 25.16 ? 64  GLN A NE2 1 
ATOM   202  N N   . GLY A 1 31  ? 13.611  49.496 85.667  1.00 29.61 ? 65  GLY A N   1 
ATOM   203  C CA  . GLY A 1 31  ? 14.626  48.564 86.122  1.00 30.30 ? 65  GLY A CA  1 
ATOM   204  C C   . GLY A 1 31  ? 13.967  47.354 86.753  1.00 31.02 ? 65  GLY A C   1 
ATOM   205  O O   . GLY A 1 31  ? 12.966  47.481 87.460  1.00 31.15 ? 65  GLY A O   1 
ATOM   206  N N   . ALA A 1 32  ? 14.518  46.173 86.487  1.00 31.43 ? 66  ALA A N   1 
ATOM   207  C CA  . ALA A 1 32  ? 14.009  44.939 87.073  1.00 31.79 ? 66  ALA A CA  1 
ATOM   208  C C   . ALA A 1 32  ? 15.154  44.060 87.540  1.00 32.18 ? 66  ALA A C   1 
ATOM   209  O O   . ALA A 1 32  ? 16.244  44.090 86.962  1.00 32.76 ? 66  ALA A O   1 
ATOM   210  C CB  . ALA A 1 32  ? 13.157  44.191 86.080  1.00 31.50 ? 66  ALA A CB  1 
ATOM   211  N N   . VAL A 1 33  ? 14.905  43.284 88.588  1.00 32.22 ? 67  VAL A N   1 
ATOM   212  C CA  . VAL A 1 33  ? 15.851  42.286 89.036  1.00 32.40 ? 67  VAL A CA  1 
ATOM   213  C C   . VAL A 1 33  ? 15.250  40.922 88.744  1.00 32.87 ? 67  VAL A C   1 
ATOM   214  O O   . VAL A 1 33  ? 14.100  40.653 89.080  1.00 33.01 ? 67  VAL A O   1 
ATOM   215  C CB  . VAL A 1 33  ? 16.174  42.431 90.540  1.00 32.38 ? 67  VAL A CB  1 
ATOM   216  C CG1 . VAL A 1 33  ? 17.262  41.459 90.955  1.00 32.26 ? 67  VAL A CG1 1 
ATOM   217  C CG2 . VAL A 1 33  ? 16.639  43.832 90.845  1.00 32.42 ? 67  VAL A CG2 1 
ATOM   218  N N   . SER A 1 34  ? 16.025  40.073 88.087  1.00 33.58 ? 68  SER A N   1 
ATOM   219  C CA  . SER A 1 34  ? 15.605  38.716 87.844  1.00 34.38 ? 68  SER A CA  1 
ATOM   220  C C   . SER A 1 34  ? 15.523  37.989 89.156  1.00 35.16 ? 68  SER A C   1 
ATOM   221  O O   . SER A 1 34  ? 16.501  37.937 89.902  1.00 35.36 ? 68  SER A O   1 
ATOM   222  C CB  . SER A 1 34  ? 16.594  37.996 86.942  1.00 34.38 ? 68  SER A CB  1 
ATOM   223  O OG  . SER A 1 34  ? 16.404  36.590 87.020  1.00 34.60 ? 68  SER A OG  1 
ATOM   224  N N   . LEU A 1 35  ? 14.353  37.424 89.429  1.00 36.18 ? 69  LEU A N   1 
ATOM   225  C CA  . LEU A 1 35  ? 14.151  36.587 90.606  1.00 37.07 ? 69  LEU A CA  1 
ATOM   226  C C   . LEU A 1 35  ? 14.737  35.167 90.422  1.00 38.41 ? 69  LEU A C   1 
ATOM   227  O O   . LEU A 1 35  ? 14.575  34.298 91.287  1.00 38.76 ? 69  LEU A O   1 
ATOM   228  C CB  . LEU A 1 35  ? 12.658  36.508 90.949  1.00 36.55 ? 69  LEU A CB  1 
ATOM   229  C CG  . LEU A 1 35  ? 11.870  37.770 91.288  1.00 34.99 ? 69  LEU A CG  1 
ATOM   230  C CD1 . LEU A 1 35  ? 10.439  37.396 91.542  1.00 32.93 ? 69  LEU A CD1 1 
ATOM   231  C CD2 . LEU A 1 35  ? 12.438  38.483 92.486  1.00 33.49 ? 69  LEU A CD2 1 
ATOM   232  N N   . GLN A 1 36  ? 15.421  34.938 89.303  1.00 39.69 ? 70  GLN A N   1 
ATOM   233  C CA  . GLN A 1 36  ? 15.967  33.626 88.983  1.00 41.12 ? 70  GLN A CA  1 
ATOM   234  C C   . GLN A 1 36  ? 17.483  33.604 89.131  1.00 41.21 ? 70  GLN A C   1 
ATOM   235  O O   . GLN A 1 36  ? 18.045  32.695 89.737  1.00 41.54 ? 70  GLN A O   1 
ATOM   236  C CB  . GLN A 1 36  ? 15.579  33.246 87.557  1.00 41.14 ? 70  GLN A CB  1 
ATOM   237  C CG  . GLN A 1 36  ? 15.764  31.771 87.213  1.00 42.76 ? 70  GLN A CG  1 
ATOM   238  C CD  . GLN A 1 36  ? 15.524  31.474 85.727  1.00 43.15 ? 70  GLN A CD  1 
ATOM   239  O OE1 . GLN A 1 36  ? 16.082  32.138 84.838  1.00 45.76 ? 70  GLN A OE1 1 
ATOM   240  N NE2 . GLN A 1 36  ? 14.695  30.464 85.455  1.00 45.67 ? 70  GLN A NE2 1 
ATOM   241  N N   . ASN A 1 37  ? 18.142  34.606 88.559  1.00 41.61 ? 71  ASN A N   1 
ATOM   242  C CA  . ASN A 1 37  ? 19.595  34.702 88.599  1.00 41.67 ? 71  ASN A CA  1 
ATOM   243  C C   . ASN A 1 37  ? 20.077  35.929 89.382  1.00 41.62 ? 71  ASN A C   1 
ATOM   244  O O   . ASN A 1 37  ? 21.276  36.084 89.621  1.00 41.88 ? 71  ASN A O   1 
ATOM   245  C CB  . ASN A 1 37  ? 20.148  34.727 87.174  1.00 41.65 ? 71  ASN A CB  1 
ATOM   246  C CG  . ASN A 1 37  ? 19.683  35.939 86.395  1.00 42.19 ? 71  ASN A CG  1 
ATOM   247  O OD1 . ASN A 1 37  ? 19.585  37.031 86.943  1.00 42.94 ? 71  ASN A OD1 1 
ATOM   248  N ND2 . ASN A 1 37  ? 19.390  35.755 85.112  1.00 42.94 ? 71  ASN A ND2 1 
ATOM   249  N N   . GLY A 1 38  ? 19.144  36.804 89.755  1.00 41.39 ? 72  GLY A N   1 
ATOM   250  C CA  . GLY A 1 38  ? 19.462  38.006 90.525  1.00 41.12 ? 72  GLY A CA  1 
ATOM   251  C C   . GLY A 1 38  ? 20.092  39.171 89.768  1.00 41.05 ? 72  GLY A C   1 
ATOM   252  O O   . GLY A 1 38  ? 20.490  40.158 90.392  1.00 41.18 ? 72  GLY A O   1 
ATOM   253  N N   . LYS A 1 39  ? 20.185  39.070 88.439  1.00 40.62 ? 73  LYS A N   1 
ATOM   254  C CA  . LYS A 1 39  ? 20.794  40.119 87.605  1.00 40.29 ? 73  LYS A CA  1 
ATOM   255  C C   . LYS A 1 39  ? 19.825  41.245 87.283  1.00 39.62 ? 73  LYS A C   1 
ATOM   256  O O   . LYS A 1 39  ? 18.612  41.041 87.233  1.00 39.50 ? 73  LYS A O   1 
ATOM   257  C CB  . LYS A 1 39  ? 21.353  39.538 86.302  1.00 40.42 ? 73  LYS A CB  1 
ATOM   258  C CG  . LYS A 1 39  ? 22.774  39.016 86.419  1.00 41.34 ? 73  LYS A CG  1 
ATOM   259  C CD  . LYS A 1 39  ? 23.189  38.149 85.232  1.00 41.29 ? 73  LYS A CD  1 
ATOM   260  C CE  . LYS A 1 39  ? 24.474  37.385 85.578  1.00 43.26 ? 73  LYS A CE  1 
ATOM   261  N NZ  . LYS A 1 39  ? 24.828  36.340 84.568  1.00 44.47 ? 73  LYS A NZ  1 
ATOM   262  N N   . GLU A 1 40  ? 20.367  42.434 87.049  1.00 38.93 ? 74  GLU A N   1 
ATOM   263  C CA  . GLU A 1 40  ? 19.527  43.583 86.760  1.00 38.62 ? 74  GLU A CA  1 
ATOM   264  C C   . GLU A 1 40  ? 19.319  43.800 85.254  1.00 37.22 ? 74  GLU A C   1 
ATOM   265  O O   . GLU A 1 40  ? 20.233  43.584 84.444  1.00 37.18 ? 74  GLU A O   1 
ATOM   266  C CB  . GLU A 1 40  ? 20.074  44.833 87.447  1.00 38.51 ? 74  GLU A CB  1 
ATOM   267  C CG  . GLU A 1 40  ? 19.052  45.968 87.514  1.00 40.42 ? 74  GLU A CG  1 
ATOM   268  C CD  . GLU A 1 40  ? 19.475  47.130 88.413  1.00 41.03 ? 74  GLU A CD  1 
ATOM   269  O OE1 . GLU A 1 40  ? 20.706  47.301 88.636  1.00 43.94 ? 74  GLU A OE1 1 
ATOM   270  O OE2 . GLU A 1 40  ? 18.565  47.876 88.885  1.00 44.05 ? 74  GLU A OE2 1 
ATOM   271  N N   . TYR A 1 41  ? 18.104  44.216 84.895  1.00 35.71 ? 75  TYR A N   1 
ATOM   272  C CA  . TYR A 1 41  ? 17.717  44.424 83.500  1.00 34.09 ? 75  TYR A CA  1 
ATOM   273  C C   . TYR A 1 41  ? 16.963  45.737 83.299  1.00 33.54 ? 75  TYR A C   1 
ATOM   274  O O   . TYR A 1 41  ? 16.712  46.467 84.260  1.00 33.80 ? 75  TYR A O   1 
ATOM   275  C CB  . TYR A 1 41  ? 16.897  43.235 83.007  1.00 33.58 ? 75  TYR A CB  1 
ATOM   276  C CG  . TYR A 1 41  ? 17.676  41.933 83.024  1.00 33.28 ? 75  TYR A CG  1 
ATOM   277  C CD1 . TYR A 1 41  ? 17.601  41.061 84.109  1.00 33.25 ? 75  TYR A CD1 1 
ATOM   278  C CD2 . TYR A 1 41  ? 18.502  41.580 81.965  1.00 33.20 ? 75  TYR A CD2 1 
ATOM   279  C CE1 . TYR A 1 41  ? 18.317  39.868 84.129  1.00 32.66 ? 75  TYR A CE1 1 
ATOM   280  C CE2 . TYR A 1 41  ? 19.230  40.397 81.983  1.00 33.06 ? 75  TYR A CE2 1 
ATOM   281  C CZ  . TYR A 1 41  ? 19.130  39.544 83.063  1.00 32.89 ? 75  TYR A CZ  1 
ATOM   282  O OH  . TYR A 1 41  ? 19.848  38.369 83.069  1.00 32.94 ? 75  TYR A OH  1 
ATOM   283  N N   . ALA A 1 42  ? 16.645  46.060 82.049  1.00 32.69 ? 76  ALA A N   1 
ATOM   284  C CA  . ALA A 1 42  ? 15.793  47.202 81.742  1.00 31.95 ? 76  ALA A CA  1 
ATOM   285  C C   . ALA A 1 42  ? 14.624  46.640 80.973  1.00 31.66 ? 76  ALA A C   1 
ATOM   286  O O   . ALA A 1 42  ? 14.810  46.078 79.893  1.00 31.94 ? 76  ALA A O   1 
ATOM   287  C CB  . ALA A 1 42  ? 16.539  48.214 80.909  1.00 31.69 ? 76  ALA A CB  1 
ATOM   288  N N   . VAL A 1 43  ? 13.418  46.748 81.518  1.00 30.97 ? 77  VAL A N   1 
ATOM   289  C CA  . VAL A 1 43  ? 12.291  46.082 80.863  1.00 30.59 ? 77  VAL A CA  1 
ATOM   290  C C   . VAL A 1 43  ? 11.238  47.029 80.283  1.00 30.24 ? 77  VAL A C   1 
ATOM   291  O O   . VAL A 1 43  ? 10.654  47.859 80.992  1.00 29.83 ? 77  VAL A O   1 
ATOM   292  C CB  . VAL A 1 43  ? 11.706  44.925 81.721  1.00 30.47 ? 77  VAL A CB  1 
ATOM   293  C CG1 . VAL A 1 43  ? 11.933  45.185 83.148  1.00 30.98 ? 77  VAL A CG1 1 
ATOM   294  C CG2 . VAL A 1 43  ? 10.230  44.700 81.454  1.00 30.57 ? 77  VAL A CG2 1 
ATOM   295  N N   . LYS A 1 44  ? 11.038  46.902 78.970  1.00 29.70 ? 78  LYS A N   1 
ATOM   296  C CA  . LYS A 1 44  ? 10.034  47.680 78.275  1.00 29.47 ? 78  LYS A CA  1 
ATOM   297  C C   . LYS A 1 44  ? 8.669   47.026 78.433  1.00 29.36 ? 78  LYS A C   1 
ATOM   298  O O   . LYS A 1 44  ? 8.442   45.904 77.964  1.00 29.26 ? 78  LYS A O   1 
ATOM   299  C CB  . LYS A 1 44  ? 10.388  47.856 76.803  1.00 29.41 ? 78  LYS A CB  1 
ATOM   300  C CG  . LYS A 1 44  ? 9.742   49.084 76.201  1.00 29.40 ? 78  LYS A CG  1 
ATOM   301  C CD  . LYS A 1 44  ? 10.020  49.226 74.724  1.00 30.07 ? 78  LYS A CD  1 
ATOM   302  C CE  . LYS A 1 44  ? 9.014   50.188 74.105  1.00 30.86 ? 78  LYS A CE  1 
ATOM   303  N NZ  . LYS A 1 44  ? 9.375   50.629 72.726  1.00 30.55 ? 78  LYS A NZ  1 
ATOM   304  N N   . ILE A 1 45  ? 7.778   47.735 79.118  1.00 29.09 ? 79  ILE A N   1 
ATOM   305  C CA  . ILE A 1 45  ? 6.447   47.236 79.430  1.00 29.17 ? 79  ILE A CA  1 
ATOM   306  C C   . ILE A 1 45  ? 5.391   48.003 78.607  1.00 29.65 ? 79  ILE A C   1 
ATOM   307  O O   . ILE A 1 45  ? 5.152   49.203 78.845  1.00 29.67 ? 79  ILE A O   1 
ATOM   308  C CB  . ILE A 1 45  ? 6.180   47.331 80.946  1.00 29.06 ? 79  ILE A CB  1 
ATOM   309  C CG1 . ILE A 1 45  ? 7.159   46.441 81.711  1.00 28.44 ? 79  ILE A CG1 1 
ATOM   310  C CG2 . ILE A 1 45  ? 4.746   46.933 81.284  1.00 29.29 ? 79  ILE A CG2 1 
ATOM   311  C CD1 . ILE A 1 45  ? 7.462   46.924 83.117  1.00 27.44 ? 79  ILE A CD1 1 
ATOM   312  N N   . ILE A 1 46  ? 4.789   47.295 77.636  1.00 29.81 ? 80  ILE A N   1 
ATOM   313  C CA  . ILE A 1 46  ? 3.855   47.860 76.640  1.00 29.61 ? 80  ILE A CA  1 
ATOM   314  C C   . ILE A 1 46  ? 2.401   47.413 76.880  1.00 29.60 ? 80  ILE A C   1 
ATOM   315  O O   . ILE A 1 46  ? 2.144   46.245 77.168  1.00 29.69 ? 80  ILE A O   1 
ATOM   316  C CB  . ILE A 1 46  ? 4.251   47.461 75.181  1.00 29.70 ? 80  ILE A CB  1 
ATOM   317  C CG1 . ILE A 1 46  ? 5.657   47.937 74.825  1.00 29.82 ? 80  ILE A CG1 1 
ATOM   318  C CG2 . ILE A 1 46  ? 3.273   48.027 74.152  1.00 29.42 ? 80  ILE A CG2 1 
ATOM   319  C CD1 . ILE A 1 46  ? 6.618   46.827 74.614  1.00 29.09 ? 80  ILE A CD1 1 
ATOM   320  N N   . GLU A 1 47  ? 1.462   48.346 76.745  1.00 29.44 ? 81  GLU A N   1 
ATOM   321  C CA  . GLU A 1 47  ? 0.031   48.061 76.867  1.00 29.60 ? 81  GLU A CA  1 
ATOM   322  C C   . GLU A 1 47  ? -0.476  47.231 75.694  1.00 29.46 ? 81  GLU A C   1 
ATOM   323  O O   . GLU A 1 47  ? -0.237  47.575 74.535  1.00 29.24 ? 81  GLU A O   1 
ATOM   324  C CB  . GLU A 1 47  ? -0.756  49.372 76.896  1.00 29.72 ? 81  GLU A CB  1 
ATOM   325  C CG  . GLU A 1 47  ? -0.367  50.317 78.006  1.00 31.07 ? 81  GLU A CG  1 
ATOM   326  C CD  . GLU A 1 47  ? -1.056  49.995 79.331  1.00 33.08 ? 81  GLU A CD  1 
ATOM   327  O OE1 . GLU A 1 47  ? -0.773  50.698 80.324  1.00 34.99 ? 81  GLU A OE1 1 
ATOM   328  O OE2 . GLU A 1 47  ? -1.883  49.056 79.384  1.00 32.14 ? 81  GLU A OE2 1 
ATOM   329  N N   . LYS A 1 48  ? -1.201  46.156 75.972  1.00 29.36 ? 82  LYS A N   1 
ATOM   330  C CA  . LYS A 1 48  ? -1.746  45.376 74.870  1.00 29.44 ? 82  LYS A CA  1 
ATOM   331  C C   . LYS A 1 48  ? -2.882  46.104 74.186  1.00 29.97 ? 82  LYS A C   1 
ATOM   332  O O   . LYS A 1 48  ? -3.235  45.786 73.038  1.00 30.58 ? 82  LYS A O   1 
ATOM   333  C CB  . LYS A 1 48  ? -2.219  44.005 75.316  1.00 29.29 ? 82  LYS A CB  1 
ATOM   334  C CG  . LYS A 1 48  ? -1.142  42.957 75.288  1.00 28.72 ? 82  LYS A CG  1 
ATOM   335  C CD  . LYS A 1 48  ? -1.763  41.599 75.284  1.00 27.85 ? 82  LYS A CD  1 
ATOM   336  C CE  . LYS A 1 48  ? -0.705  40.554 75.250  1.00 27.77 ? 82  LYS A CE  1 
ATOM   337  N NZ  . LYS A 1 48  ? -1.318  39.210 75.349  1.00 29.25 ? 82  LYS A NZ  1 
ATOM   338  N N   . GLN A 1 49  ? -3.447  47.090 74.874  1.00 29.87 ? 83  GLN A N   1 
ATOM   339  C CA  . GLN A 1 49  ? -4.582  47.819 74.324  1.00 29.75 ? 83  GLN A CA  1 
ATOM   340  C C   . GLN A 1 49  ? -4.216  49.044 73.470  1.00 29.69 ? 83  GLN A C   1 
ATOM   341  O O   . GLN A 1 49  ? -5.098  49.682 72.892  1.00 29.78 ? 83  GLN A O   1 
ATOM   342  C CB  . GLN A 1 49  ? -5.527  48.212 75.442  1.00 29.76 ? 83  GLN A CB  1 
ATOM   343  C CG  . GLN A 1 49  ? -5.082  49.405 76.213  1.00 29.56 ? 83  GLN A CG  1 
ATOM   344  C CD  . GLN A 1 49  ? -6.217  49.978 76.977  1.00 29.91 ? 83  GLN A CD  1 
ATOM   345  O OE1 . GLN A 1 49  ? -6.702  51.058 76.663  1.00 30.99 ? 83  GLN A OE1 1 
ATOM   346  N NE2 . GLN A 1 49  ? -6.684  49.242 77.972  1.00 30.60 ? 83  GLN A NE2 1 
ATOM   347  N N   . ALA A 1 50  ? -2.929  49.375 73.391  1.00 29.62 ? 84  ALA A N   1 
ATOM   348  C CA  . ALA A 1 50  ? -2.481  50.488 72.552  1.00 29.60 ? 84  ALA A CA  1 
ATOM   349  C C   . ALA A 1 50  ? -2.761  50.211 71.056  1.00 29.92 ? 84  ALA A C   1 
ATOM   350  O O   . ALA A 1 50  ? -3.145  49.091 70.669  1.00 30.32 ? 84  ALA A O   1 
ATOM   351  C CB  . ALA A 1 50  ? -1.007  50.784 72.796  1.00 29.07 ? 84  ALA A CB  1 
ATOM   352  N N   . GLY A 1 51  ? -2.585  51.231 70.221  1.00 29.75 ? 85  GLY A N   1 
ATOM   353  C CA  . GLY A 1 51  ? -2.873  51.112 68.804  1.00 29.40 ? 85  GLY A CA  1 
ATOM   354  C C   . GLY A 1 51  ? -1.942  50.139 68.125  1.00 29.33 ? 85  GLY A C   1 
ATOM   355  O O   . GLY A 1 51  ? -0.722  50.313 68.160  1.00 29.44 ? 85  GLY A O   1 
ATOM   356  N N   . HIS A 1 52  ? -2.527  49.108 67.522  1.00 29.26 ? 86  HIS A N   1 
ATOM   357  C CA  . HIS A 1 52  ? -1.788  48.121 66.729  1.00 29.37 ? 86  HIS A CA  1 
ATOM   358  C C   . HIS A 1 52  ? -0.686  47.460 67.538  1.00 29.59 ? 86  HIS A C   1 
ATOM   359  O O   . HIS A 1 52  ? 0.396   47.182 67.034  1.00 29.69 ? 86  HIS A O   1 
ATOM   360  C CB  . HIS A 1 52  ? -1.241  48.758 65.445  1.00 29.14 ? 86  HIS A CB  1 
ATOM   361  C CG  . HIS A 1 52  ? -2.306  49.360 64.589  1.00 28.70 ? 86  HIS A CG  1 
ATOM   362  N ND1 . HIS A 1 52  ? -2.649  50.692 64.657  1.00 28.45 ? 86  HIS A ND1 1 
ATOM   363  C CD2 . HIS A 1 52  ? -3.140  48.803 63.683  1.00 28.48 ? 86  HIS A CD2 1 
ATOM   364  C CE1 . HIS A 1 52  ? -3.637  50.935 63.817  1.00 28.46 ? 86  HIS A CE1 1 
ATOM   365  N NE2 . HIS A 1 52  ? -3.953  49.804 63.212  1.00 29.05 ? 86  HIS A NE2 1 
ATOM   366  N N   . SER A 1 53  ? -0.985  47.197 68.802  1.00 30.06 ? 87  SER A N   1 
ATOM   367  C CA  . SER A 1 53  ? 0.019   46.753 69.741  1.00 30.48 ? 87  SER A CA  1 
ATOM   368  C C   . SER A 1 53  ? 0.425   45.310 69.480  1.00 30.92 ? 87  SER A C   1 
ATOM   369  O O   . SER A 1 53  ? 1.605   45.014 69.269  1.00 30.97 ? 87  SER A O   1 
ATOM   370  C CB  . SER A 1 53  ? -0.495  46.922 71.161  1.00 30.30 ? 87  SER A CB  1 
ATOM   371  O OG  . SER A 1 53  ? 0.570   46.775 72.064  1.00 30.92 ? 87  SER A OG  1 
ATOM   372  N N   . ARG A 1 54  ? -0.563  44.418 69.468  1.00 31.36 ? 88  ARG A N   1 
ATOM   373  C CA  . ARG A 1 54  ? -0.309  42.987 69.331  1.00 31.75 ? 88  ARG A CA  1 
ATOM   374  C C   . ARG A 1 54  ? 0.469   42.633 68.064  1.00 31.59 ? 88  ARG A C   1 
ATOM   375  O O   . ARG A 1 54  ? 1.360   41.788 68.104  1.00 31.61 ? 88  ARG A O   1 
ATOM   376  C CB  . ARG A 1 54  ? -1.620  42.204 69.406  1.00 31.95 ? 88  ARG A CB  1 
ATOM   377  C CG  . ARG A 1 54  ? -2.190  42.123 70.802  1.00 33.46 ? 88  ARG A CG  1 
ATOM   378  C CD  . ARG A 1 54  ? -3.431  41.266 70.854  1.00 36.59 ? 88  ARG A CD  1 
ATOM   379  N NE  . ARG A 1 54  ? -3.933  41.168 72.221  1.00 38.99 ? 88  ARG A NE  1 
ATOM   380  C CZ  . ARG A 1 54  ? -4.771  42.042 72.776  1.00 40.69 ? 88  ARG A CZ  1 
ATOM   381  N NH1 . ARG A 1 54  ? -5.164  41.871 74.033  1.00 41.62 ? 88  ARG A NH1 1 
ATOM   382  N NH2 . ARG A 1 54  ? -5.217  43.089 72.086  1.00 40.64 ? 88  ARG A NH2 1 
ATOM   383  N N   . SER A 1 55  ? 0.135   43.293 66.955  1.00 31.49 ? 89  SER A N   1 
ATOM   384  C CA  . SER A 1 55  ? 0.783   43.027 65.681  1.00 31.53 ? 89  SER A CA  1 
ATOM   385  C C   . SER A 1 55  ? 2.150   43.695 65.583  1.00 31.81 ? 89  SER A C   1 
ATOM   386  O O   . SER A 1 55  ? 3.123   43.042 65.211  1.00 32.38 ? 89  SER A O   1 
ATOM   387  C CB  . SER A 1 55  ? -0.101  43.455 64.519  1.00 31.31 ? 89  SER A CB  1 
ATOM   388  O OG  . SER A 1 55  ? -0.520  44.790 64.688  1.00 30.81 ? 89  SER A OG  1 
ATOM   389  N N   . ARG A 1 56  ? 2.235   44.979 65.926  1.00 31.60 ? 90  ARG A N   1 
ATOM   390  C CA  . ARG A 1 56  ? 3.500   45.705 65.809  1.00 31.57 ? 90  ARG A CA  1 
ATOM   391  C C   . ARG A 1 56  ? 4.594   45.155 66.725  1.00 31.77 ? 90  ARG A C   1 
ATOM   392  O O   . ARG A 1 56  ? 5.743   45.002 66.291  1.00 31.71 ? 90  ARG A O   1 
ATOM   393  C CB  . ARG A 1 56  ? 3.299   47.212 65.975  1.00 31.25 ? 90  ARG A CB  1 
ATOM   394  C CG  . ARG A 1 56  ? 2.758   47.841 64.709  1.00 31.77 ? 90  ARG A CG  1 
ATOM   395  C CD  . ARG A 1 56  ? 2.398   49.299 64.824  1.00 32.54 ? 90  ARG A CD  1 
ATOM   396  N NE  . ARG A 1 56  ? 1.618   49.721 63.658  1.00 35.00 ? 90  ARG A NE  1 
ATOM   397  C CZ  . ARG A 1 56  ? 1.127   50.948 63.459  1.00 36.23 ? 90  ARG A CZ  1 
ATOM   398  N NH1 . ARG A 1 56  ? 1.342   51.908 64.352  1.00 36.13 ? 90  ARG A NH1 1 
ATOM   399  N NH2 . ARG A 1 56  ? 0.412   51.218 62.359  1.00 35.59 ? 90  ARG A NH2 1 
ATOM   400  N N   . VAL A 1 57  ? 4.225   44.837 67.971  1.00 32.03 ? 91  VAL A N   1 
ATOM   401  C CA  . VAL A 1 57  ? 5.155   44.236 68.939  1.00 32.23 ? 91  VAL A CA  1 
ATOM   402  C C   . VAL A 1 57  ? 5.573   42.798 68.551  1.00 32.95 ? 91  VAL A C   1 
ATOM   403  O O   . VAL A 1 57  ? 6.742   42.420 68.716  1.00 33.23 ? 91  VAL A O   1 
ATOM   404  C CB  . VAL A 1 57  ? 4.626   44.270 70.406  1.00 31.87 ? 91  VAL A CB  1 
ATOM   405  C CG1 . VAL A 1 57  ? 5.672   43.730 71.347  1.00 31.56 ? 91  VAL A CG1 1 
ATOM   406  C CG2 . VAL A 1 57  ? 4.272   45.669 70.840  1.00 31.36 ? 91  VAL A CG2 1 
ATOM   407  N N   . PHE A 1 58  ? 4.638   42.004 68.029  1.00 33.37 ? 92  PHE A N   1 
ATOM   408  C CA  . PHE A 1 58  ? 4.976   40.654 67.598  1.00 33.67 ? 92  PHE A CA  1 
ATOM   409  C C   . PHE A 1 58  ? 6.047   40.657 66.515  1.00 33.97 ? 92  PHE A C   1 
ATOM   410  O O   . PHE A 1 58  ? 6.966   39.838 66.561  1.00 34.24 ? 92  PHE A O   1 
ATOM   411  C CB  . PHE A 1 58  ? 3.760   39.886 67.099  1.00 33.77 ? 92  PHE A CB  1 
ATOM   412  C CG  . PHE A 1 58  ? 4.110   38.568 66.466  1.00 34.44 ? 92  PHE A CG  1 
ATOM   413  C CD1 . PHE A 1 58  ? 4.081   38.415 65.079  1.00 35.65 ? 92  PHE A CD1 1 
ATOM   414  C CD2 . PHE A 1 58  ? 4.504   37.489 67.250  1.00 34.84 ? 92  PHE A CD2 1 
ATOM   415  C CE1 . PHE A 1 58  ? 4.416   37.190 64.483  1.00 35.74 ? 92  PHE A CE1 1 
ATOM   416  C CE2 . PHE A 1 58  ? 4.835   36.264 66.675  1.00 35.47 ? 92  PHE A CE2 1 
ATOM   417  C CZ  . PHE A 1 58  ? 4.793   36.110 65.283  1.00 35.69 ? 92  PHE A CZ  1 
ATOM   418  N N   . ARG A 1 59  ? 5.912   41.566 65.545  1.00 33.92 ? 93  ARG A N   1 
ATOM   419  C CA  . ARG A 1 59  ? 6.881   41.711 64.460  1.00 33.93 ? 93  ARG A CA  1 
ATOM   420  C C   . ARG A 1 59  ? 8.205   42.301 64.961  1.00 33.52 ? 93  ARG A C   1 
ATOM   421  O O   . ARG A 1 59  ? 9.274   41.920 64.481  1.00 33.47 ? 93  ARG A O   1 
ATOM   422  C CB  . ARG A 1 59  ? 6.312   42.558 63.317  1.00 33.77 ? 93  ARG A CB  1 
ATOM   423  C CG  . ARG A 1 59  ? 5.056   41.972 62.646  1.00 35.00 ? 93  ARG A CG  1 
ATOM   424  C CD  . ARG A 1 59  ? 4.686   42.691 61.321  1.00 34.95 ? 93  ARG A CD  1 
ATOM   425  N NE  . ARG A 1 59  ? 4.522   44.133 61.517  1.00 37.89 ? 93  ARG A NE  1 
ATOM   426  C CZ  . ARG A 1 59  ? 3.370   44.748 61.801  1.00 39.21 ? 93  ARG A CZ  1 
ATOM   427  N NH1 . ARG A 1 59  ? 2.229   44.059 61.903  1.00 39.76 ? 93  ARG A NH1 1 
ATOM   428  N NH2 . ARG A 1 59  ? 3.358   46.069 61.975  1.00 39.14 ? 93  ARG A NH2 1 
ATOM   429  N N   . GLU A 1 60  ? 8.139   43.215 65.928  1.00 33.15 ? 94  GLU A N   1 
ATOM   430  C CA  . GLU A 1 60  ? 9.357   43.805 66.481  1.00 32.84 ? 94  GLU A CA  1 
ATOM   431  C C   . GLU A 1 60  ? 10.181  42.795 67.273  1.00 32.79 ? 94  GLU A C   1 
ATOM   432  O O   . GLU A 1 60  ? 11.410  42.808 67.189  1.00 33.00 ? 94  GLU A O   1 
ATOM   433  C CB  . GLU A 1 60  ? 9.064   45.029 67.344  1.00 32.60 ? 94  GLU A CB  1 
ATOM   434  C CG  . GLU A 1 60  ? 10.329  45.695 67.877  1.00 32.21 ? 94  GLU A CG  1 
ATOM   435  C CD  . GLU A 1 60  ? 10.088  47.040 68.575  1.00 33.08 ? 94  GLU A CD  1 
ATOM   436  O OE1 . GLU A 1 60  ? 8.920   47.485 68.695  1.00 34.34 ? 94  GLU A OE1 1 
ATOM   437  O OE2 . GLU A 1 60  ? 11.084  47.667 69.005  1.00 32.11 ? 94  GLU A OE2 1 
ATOM   438  N N   . VAL A 1 61  ? 9.517   41.930 68.040  1.00 32.35 ? 95  VAL A N   1 
ATOM   439  C CA  . VAL A 1 61  ? 10.227  40.914 68.821  1.00 31.93 ? 95  VAL A CA  1 
ATOM   440  C C   . VAL A 1 61  ? 10.935  39.934 67.888  1.00 32.22 ? 95  VAL A C   1 
ATOM   441  O O   . VAL A 1 61  ? 12.143  39.735 67.994  1.00 32.08 ? 95  VAL A O   1 
ATOM   442  C CB  . VAL A 1 61  ? 9.302   40.179 69.804  1.00 31.56 ? 95  VAL A CB  1 
ATOM   443  C CG1 . VAL A 1 61  ? 9.951   38.916 70.313  1.00 31.13 ? 95  VAL A CG1 1 
ATOM   444  C CG2 . VAL A 1 61  ? 8.967   41.070 70.950  1.00 31.02 ? 95  VAL A CG2 1 
ATOM   445  N N   . GLU A 1 62  ? 10.181  39.349 66.963  1.00 32.53 ? 96  GLU A N   1 
ATOM   446  C CA  . GLU A 1 62  ? 10.738  38.471 65.952  1.00 32.92 ? 96  GLU A CA  1 
ATOM   447  C C   . GLU A 1 62  ? 11.988  39.075 65.314  1.00 32.89 ? 96  GLU A C   1 
ATOM   448  O O   . GLU A 1 62  ? 13.008  38.397 65.172  1.00 32.98 ? 96  GLU A O   1 
ATOM   449  C CB  . GLU A 1 62  ? 9.694   38.196 64.883  1.00 33.14 ? 96  GLU A CB  1 
ATOM   450  C CG  . GLU A 1 62  ? 8.462   37.490 65.388  1.00 35.39 ? 96  GLU A CG  1 
ATOM   451  C CD  . GLU A 1 62  ? 8.740   36.079 65.874  1.00 39.14 ? 96  GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 62  ? 8.159   35.696 66.916  1.00 41.98 ? 96  GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 62  ? 9.537   35.355 65.229  1.00 40.28 ? 96  GLU A OE2 1 
ATOM   454  N N   . THR A 1 63  ? 11.914  40.351 64.939  1.00 32.84 ? 97  THR A N   1 
ATOM   455  C CA  . THR A 1 63  ? 13.063  41.035 64.355  1.00 32.91 ? 97  THR A CA  1 
ATOM   456  C C   . THR A 1 63  ? 14.215  41.116 65.365  1.00 32.88 ? 97  THR A C   1 
ATOM   457  O O   . THR A 1 63  ? 15.348  40.800 65.028  1.00 33.16 ? 97  THR A O   1 
ATOM   458  C CB  . THR A 1 63  ? 12.691  42.435 63.770  1.00 33.01 ? 97  THR A CB  1 
ATOM   459  O OG1 . THR A 1 63  ? 11.939  42.280 62.553  1.00 32.95 ? 97  THR A OG1 1 
ATOM   460  C CG2 . THR A 1 63  ? 13.935  43.248 63.462  1.00 33.16 ? 97  THR A CG2 1 
ATOM   461  N N   . LEU A 1 64  ? 13.917  41.500 66.602  1.00 32.97 ? 98  LEU A N   1 
ATOM   462  C CA  . LEU A 1 64  ? 14.945  41.653 67.642  1.00 33.14 ? 98  LEU A CA  1 
ATOM   463  C C   . LEU A 1 64  ? 15.646  40.349 68.061  1.00 33.81 ? 98  LEU A C   1 
ATOM   464  O O   . LEU A 1 64  ? 16.757  40.389 68.577  1.00 33.97 ? 98  LEU A O   1 
ATOM   465  C CB  . LEU A 1 64  ? 14.377  42.379 68.869  1.00 32.76 ? 98  LEU A CB  1 
ATOM   466  C CG  . LEU A 1 64  ? 14.147  43.887 68.739  1.00 31.76 ? 98  LEU A CG  1 
ATOM   467  C CD1 . LEU A 1 64  ? 13.343  44.419 69.892  1.00 29.39 ? 98  LEU A CD1 1 
ATOM   468  C CD2 . LEU A 1 64  ? 15.456  44.625 68.652  1.00 31.92 ? 98  LEU A CD2 1 
ATOM   469  N N   . TYR A 1 65  ? 14.999  39.201 67.856  1.00 34.51 ? 99  TYR A N   1 
ATOM   470  C CA  . TYR A 1 65  ? 15.667  37.910 68.005  1.00 35.21 ? 99  TYR A CA  1 
ATOM   471  C C   . TYR A 1 65  ? 16.862  37.812 67.051  1.00 36.08 ? 99  TYR A C   1 
ATOM   472  O O   . TYR A 1 65  ? 17.964  37.445 67.451  1.00 36.04 ? 99  TYR A O   1 
ATOM   473  C CB  . TYR A 1 65  ? 14.702  36.744 67.755  1.00 34.86 ? 99  TYR A CB  1 
ATOM   474  C CG  . TYR A 1 65  ? 13.688  36.477 68.858  1.00 34.85 ? 99  TYR A CG  1 
ATOM   475  C CD1 . TYR A 1 65  ? 12.477  35.850 68.571  1.00 34.65 ? 99  TYR A CD1 1 
ATOM   476  C CD2 . TYR A 1 65  ? 13.938  36.841 70.190  1.00 34.87 ? 99  TYR A CD2 1 
ATOM   477  C CE1 . TYR A 1 65  ? 11.536  35.590 69.577  1.00 34.20 ? 99  TYR A CE1 1 
ATOM   478  C CE2 . TYR A 1 65  ? 13.002  36.585 71.200  1.00 33.97 ? 99  TYR A CE2 1 
ATOM   479  C CZ  . TYR A 1 65  ? 11.803  35.959 70.886  1.00 34.14 ? 99  TYR A CZ  1 
ATOM   480  O OH  . TYR A 1 65  ? 10.862  35.710 71.872  1.00 33.81 ? 99  TYR A OH  1 
ATOM   481  N N   . GLN A 1 66  ? 16.644  38.166 65.791  1.00 37.38 ? 100 GLN A N   1 
ATOM   482  C CA  . GLN A 1 66  ? 17.710  38.126 64.792  1.00 38.93 ? 100 GLN A CA  1 
ATOM   483  C C   . GLN A 1 66  ? 18.863  39.095 65.088  1.00 39.46 ? 100 GLN A C   1 
ATOM   484  O O   . GLN A 1 66  ? 19.996  38.854 64.657  1.00 39.92 ? 100 GLN A O   1 
ATOM   485  C CB  . GLN A 1 66  ? 17.154  38.404 63.405  1.00 38.88 ? 100 GLN A CB  1 
ATOM   486  C CG  . GLN A 1 66  ? 15.921  37.613 63.058  1.00 41.25 ? 100 GLN A CG  1 
ATOM   487  C CD  . GLN A 1 66  ? 15.264  38.137 61.791  1.00 45.75 ? 100 GLN A CD  1 
ATOM   488  O OE1 . GLN A 1 66  ? 15.850  38.066 60.697  1.00 47.37 ? 100 GLN A OE1 1 
ATOM   489  N NE2 . GLN A 1 66  ? 14.040  38.678 61.925  1.00 47.33 ? 100 GLN A NE2 1 
ATOM   490  N N   . CYS A 1 67  ? 18.570  40.172 65.820  1.00 39.98 ? 101 CYS A N   1 
ATOM   491  C CA  . CYS A 1 67  ? 19.555  41.215 66.140  1.00 40.33 ? 101 CYS A CA  1 
ATOM   492  C C   . CYS A 1 67  ? 20.448  40.900 67.332  1.00 41.14 ? 101 CYS A C   1 
ATOM   493  O O   . CYS A 1 67  ? 21.516  41.510 67.483  1.00 41.26 ? 101 CYS A O   1 
ATOM   494  C CB  . CYS A 1 67  ? 18.860  42.537 66.430  1.00 40.06 ? 101 CYS A CB  1 
ATOM   495  S SG  . CYS A 1 67  ? 18.053  43.229 65.031  1.00 39.00 ? 101 CYS A SG  1 
ATOM   496  N N   . GLN A 1 68  ? 20.005  39.984 68.193  1.00 41.73 ? 102 GLN A N   1 
ATOM   497  C CA  . GLN A 1 68  ? 20.767  39.676 69.394  1.00 42.49 ? 102 GLN A CA  1 
ATOM   498  C C   . GLN A 1 68  ? 22.086  39.067 68.991  1.00 42.19 ? 102 GLN A C   1 
ATOM   499  O O   . GLN A 1 68  ? 22.139  38.205 68.114  1.00 42.01 ? 102 GLN A O   1 
ATOM   500  C CB  . GLN A 1 68  ? 19.993  38.781 70.355  1.00 42.41 ? 102 GLN A CB  1 
ATOM   501  C CG  . GLN A 1 68  ? 19.774  37.358 69.900  1.00 43.18 ? 102 GLN A CG  1 
ATOM   502  C CD  . GLN A 1 68  ? 18.973  36.559 70.918  1.00 44.22 ? 102 GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 68  ? 19.295  35.388 71.180  1.00 47.22 ? 102 GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 68  ? 17.929  37.189 71.515  1.00 43.81 ? 102 GLN A NE2 1 
ATOM   505  N N   . GLY A 1 69  ? 23.153  39.559 69.605  1.00 42.24 ? 103 GLY A N   1 
ATOM   506  C CA  . GLY A 1 69  ? 24.489  39.171 69.188  1.00 42.39 ? 103 GLY A CA  1 
ATOM   507  C C   . GLY A 1 69  ? 25.266  40.312 68.557  1.00 42.28 ? 103 GLY A C   1 
ATOM   508  O O   . GLY A 1 69  ? 26.478  40.422 68.775  1.00 42.73 ? 103 GLY A O   1 
ATOM   509  N N   . ASN A 1 70  ? 24.587  41.149 67.767  1.00 41.62 ? 104 ASN A N   1 
ATOM   510  C CA  . ASN A 1 70  ? 25.202  42.372 67.266  1.00 40.85 ? 104 ASN A CA  1 
ATOM   511  C C   . ASN A 1 70  ? 25.418  43.319 68.424  1.00 40.14 ? 104 ASN A C   1 
ATOM   512  O O   . ASN A 1 70  ? 24.479  43.649 69.142  1.00 40.00 ? 104 ASN A O   1 
ATOM   513  C CB  . ASN A 1 70  ? 24.341  43.042 66.204  1.00 41.16 ? 104 ASN A CB  1 
ATOM   514  C CG  . ASN A 1 70  ? 24.967  44.325 65.678  1.00 41.61 ? 104 ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 70  ? 25.781  44.302 64.756  1.00 42.71 ? 104 ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 70  ? 24.581  45.449 66.260  1.00 41.97 ? 104 ASN A ND2 1 
ATOM   517  N N   . LYS A 1 71  ? 26.659  43.755 68.597  1.00 39.52 ? 105 LYS A N   1 
ATOM   518  C CA  . LYS A 1 71  ? 27.059  44.509 69.791  1.00 38.86 ? 105 LYS A CA  1 
ATOM   519  C C   . LYS A 1 71  ? 26.695  45.992 69.739  1.00 38.09 ? 105 LYS A C   1 
ATOM   520  O O   . LYS A 1 71  ? 27.040  46.742 70.652  1.00 38.27 ? 105 LYS A O   1 
ATOM   521  C CB  . LYS A 1 71  ? 28.562  44.346 70.055  1.00 38.89 ? 105 LYS A CB  1 
ATOM   522  C CG  . LYS A 1 71  ? 29.437  44.743 68.874  1.00 40.12 ? 105 LYS A CG  1 
ATOM   523  C CD  . LYS A 1 71  ? 30.777  45.310 69.316  1.00 41.79 ? 105 LYS A CD  1 
ATOM   524  C CE  . LYS A 1 71  ? 31.426  46.108 68.187  1.00 42.62 ? 105 LYS A CE  1 
ATOM   525  N NZ  . LYS A 1 71  ? 32.754  46.655 68.586  1.00 43.87 ? 105 LYS A NZ  1 
ATOM   526  N N   . ASN A 1 72  ? 26.015  46.412 68.673  1.00 37.12 ? 106 ASN A N   1 
ATOM   527  C CA  . ASN A 1 72  ? 25.597  47.809 68.503  1.00 36.04 ? 106 ASN A CA  1 
ATOM   528  C C   . ASN A 1 72  ? 24.078  47.954 68.540  1.00 35.01 ? 106 ASN A C   1 
ATOM   529  O O   . ASN A 1 72  ? 23.531  48.994 68.145  1.00 34.77 ? 106 ASN A O   1 
ATOM   530  C CB  . ASN A 1 72  ? 26.144  48.391 67.195  1.00 36.31 ? 106 ASN A CB  1 
ATOM   531  C CG  . ASN A 1 72  ? 27.648  48.235 67.068  1.00 37.33 ? 106 ASN A CG  1 
ATOM   532  O OD1 . ASN A 1 72  ? 28.134  47.458 66.238  1.00 38.63 ? 106 ASN A OD1 1 
ATOM   533  N ND2 . ASN A 1 72  ? 28.396  48.970 67.893  1.00 38.12 ? 106 ASN A ND2 1 
ATOM   534  N N   . ILE A 1 73  ? 23.408  46.904 69.015  1.00 33.58 ? 107 ILE A N   1 
ATOM   535  C CA  . ILE A 1 73  ? 21.957  46.892 69.133  1.00 32.32 ? 107 ILE A CA  1 
ATOM   536  C C   . ILE A 1 73  ? 21.576  46.363 70.509  1.00 31.73 ? 107 ILE A C   1 
ATOM   537  O O   . ILE A 1 73  ? 21.935  45.236 70.864  1.00 31.70 ? 107 ILE A O   1 
ATOM   538  C CB  . ILE A 1 73  ? 21.312  46.052 68.008  1.00 32.03 ? 107 ILE A CB  1 
ATOM   539  C CG1 . ILE A 1 73  ? 21.434  46.794 66.680  1.00 31.68 ? 107 ILE A CG1 1 
ATOM   540  C CG2 . ILE A 1 73  ? 19.838  45.770 68.300  1.00 32.10 ? 107 ILE A CG2 1 
ATOM   541  C CD1 . ILE A 1 73  ? 21.475  45.913 65.463  1.00 31.08 ? 107 ILE A CD1 1 
ATOM   542  N N   . LEU A 1 74  ? 20.857  47.177 71.283  1.00 30.94 ? 108 LEU A N   1 
ATOM   543  C CA  . LEU A 1 74  ? 20.435  46.775 72.616  1.00 30.13 ? 108 LEU A CA  1 
ATOM   544  C C   . LEU A 1 74  ? 19.790  45.417 72.511  1.00 30.51 ? 108 LEU A C   1 
ATOM   545  O O   . LEU A 1 74  ? 18.846  45.228 71.742  1.00 31.02 ? 108 LEU A O   1 
ATOM   546  C CB  . LEU A 1 74  ? 19.463  47.769 73.226  1.00 29.66 ? 108 LEU A CB  1 
ATOM   547  C CG  . LEU A 1 74  ? 19.220  47.622 74.729  1.00 27.85 ? 108 LEU A CG  1 
ATOM   548  C CD1 . LEU A 1 74  ? 20.391  48.138 75.513  1.00 25.36 ? 108 LEU A CD1 1 
ATOM   549  C CD2 . LEU A 1 74  ? 17.976  48.380 75.109  1.00 27.05 ? 108 LEU A CD2 1 
ATOM   550  N N   . GLU A 1 75  ? 20.329  44.468 73.265  1.00 30.60 ? 109 GLU A N   1 
ATOM   551  C CA  . GLU A 1 75  ? 19.942  43.076 73.144  1.00 30.37 ? 109 GLU A CA  1 
ATOM   552  C C   . GLU A 1 75  ? 18.706  42.731 73.964  1.00 30.10 ? 109 GLU A C   1 
ATOM   553  O O   . GLU A 1 75  ? 18.697  42.867 75.195  1.00 29.82 ? 109 GLU A O   1 
ATOM   554  C CB  . GLU A 1 75  ? 21.109  42.174 73.538  1.00 30.49 ? 109 GLU A CB  1 
ATOM   555  C CG  . GLU A 1 75  ? 20.685  40.761 73.877  1.00 31.40 ? 109 GLU A CG  1 
ATOM   556  C CD  . GLU A 1 75  ? 21.778  39.749 73.684  1.00 32.04 ? 109 GLU A CD  1 
ATOM   557  O OE1 . GLU A 1 75  ? 22.677  40.005 72.858  1.00 33.65 ? 109 GLU A OE1 1 
ATOM   558  O OE2 . GLU A 1 75  ? 21.720  38.688 74.343  1.00 31.95 ? 109 GLU A OE2 1 
ATOM   559  N N   . LEU A 1 76  ? 17.669  42.272 73.266  1.00 29.80 ? 110 LEU A N   1 
ATOM   560  C CA  . LEU A 1 76  ? 16.514  41.665 73.920  1.00 29.50 ? 110 LEU A CA  1 
ATOM   561  C C   . LEU A 1 76  ? 16.963  40.375 74.612  1.00 29.57 ? 110 LEU A C   1 
ATOM   562  O O   . LEU A 1 76  ? 17.491  39.459 73.967  1.00 29.81 ? 110 LEU A O   1 
ATOM   563  C CB  . LEU A 1 76  ? 15.402  41.398 72.901  1.00 29.18 ? 110 LEU A CB  1 
ATOM   564  C CG  . LEU A 1 76  ? 14.126  40.689 73.357  1.00 28.77 ? 110 LEU A CG  1 
ATOM   565  C CD1 . LEU A 1 76  ? 13.396  41.464 74.428  1.00 28.04 ? 110 LEU A CD1 1 
ATOM   566  C CD2 . LEU A 1 76  ? 13.218  40.466 72.171  1.00 29.04 ? 110 LEU A CD2 1 
ATOM   567  N N   . ILE A 1 77  ? 16.788  40.321 75.928  1.00 29.63 ? 111 ILE A N   1 
ATOM   568  C CA  . ILE A 1 77  ? 17.217  39.155 76.707  1.00 29.61 ? 111 ILE A CA  1 
ATOM   569  C C   . ILE A 1 77  ? 16.087  38.145 76.814  1.00 29.91 ? 111 ILE A C   1 
ATOM   570  O O   . ILE A 1 77  ? 16.299  36.952 76.589  1.00 29.90 ? 111 ILE A O   1 
ATOM   571  C CB  . ILE A 1 77  ? 17.710  39.538 78.126  1.00 29.43 ? 111 ILE A CB  1 
ATOM   572  C CG1 . ILE A 1 77  ? 18.865  40.558 78.067  1.00 29.36 ? 111 ILE A CG1 1 
ATOM   573  C CG2 . ILE A 1 77  ? 18.090  38.303 78.906  1.00 28.89 ? 111 ILE A CG2 1 
ATOM   574  C CD1 . ILE A 1 77  ? 20.196  40.038 77.495  1.00 28.22 ? 111 ILE A CD1 1 
ATOM   575  N N   . GLU A 1 78  ? 14.890  38.626 77.156  1.00 30.12 ? 112 GLU A N   1 
ATOM   576  C CA  . GLU A 1 78  ? 13.705  37.767 77.226  1.00 30.52 ? 112 GLU A CA  1 
ATOM   577  C C   . GLU A 1 78  ? 12.437  38.516 76.830  1.00 29.78 ? 112 GLU A C   1 
ATOM   578  O O   . GLU A 1 78  ? 12.318  39.729 77.025  1.00 29.93 ? 112 GLU A O   1 
ATOM   579  C CB  . GLU A 1 78  ? 13.549  37.188 78.632  1.00 30.52 ? 112 GLU A CB  1 
ATOM   580  C CG  . GLU A 1 78  ? 12.634  35.966 78.720  1.00 32.31 ? 112 GLU A CG  1 
ATOM   581  C CD  . GLU A 1 78  ? 12.273  35.575 80.162  1.00 32.48 ? 112 GLU A CD  1 
ATOM   582  O OE1 . GLU A 1 78  ? 11.554  34.565 80.336  1.00 35.39 ? 112 GLU A OE1 1 
ATOM   583  O OE2 . GLU A 1 78  ? 12.694  36.266 81.123  1.00 34.45 ? 112 GLU A OE2 1 
ATOM   584  N N   . PHE A 1 79  ? 11.496  37.779 76.258  1.00 29.29 ? 113 PHE A N   1 
ATOM   585  C CA  . PHE A 1 79  ? 10.174  38.307 75.945  1.00 28.65 ? 113 PHE A CA  1 
ATOM   586  C C   . PHE A 1 79  ? 9.135   37.556 76.781  1.00 28.96 ? 113 PHE A C   1 
ATOM   587  O O   . PHE A 1 79  ? 9.190   36.320 76.894  1.00 28.89 ? 113 PHE A O   1 
ATOM   588  C CB  . PHE A 1 79  ? 9.864   38.172 74.443  1.00 27.79 ? 113 PHE A CB  1 
ATOM   589  C CG  . PHE A 1 79  ? 8.438   38.496 74.090  1.00 26.75 ? 113 PHE A CG  1 
ATOM   590  C CD1 . PHE A 1 79  ? 7.983   39.814 74.095  1.00 25.14 ? 113 PHE A CD1 1 
ATOM   591  C CD2 . PHE A 1 79  ? 7.536   37.479 73.773  1.00 26.20 ? 113 PHE A CD2 1 
ATOM   592  C CE1 . PHE A 1 79  ? 6.663   40.114 73.785  1.00 24.47 ? 113 PHE A CE1 1 
ATOM   593  C CE2 . PHE A 1 79  ? 6.200   37.770 73.457  1.00 24.76 ? 113 PHE A CE2 1 
ATOM   594  C CZ  . PHE A 1 79  ? 5.768   39.087 73.463  1.00 25.48 ? 113 PHE A CZ  1 
ATOM   595  N N   . PHE A 1 80  ? 8.202   38.298 77.374  1.00 28.93 ? 114 PHE A N   1 
ATOM   596  C CA  . PHE A 1 80  ? 7.093   37.678 78.082  1.00 29.18 ? 114 PHE A CA  1 
ATOM   597  C C   . PHE A 1 80  ? 5.813   38.477 77.849  1.00 29.63 ? 114 PHE A C   1 
ATOM   598  O O   . PHE A 1 80  ? 5.865   39.688 77.648  1.00 29.70 ? 114 PHE A O   1 
ATOM   599  C CB  . PHE A 1 80  ? 7.423   37.518 79.574  1.00 28.86 ? 114 PHE A CB  1 
ATOM   600  C CG  . PHE A 1 80  ? 6.267   37.010 80.416  1.00 28.59 ? 114 PHE A CG  1 
ATOM   601  C CD1 . PHE A 1 80  ? 6.021   35.644 80.540  1.00 28.11 ? 114 PHE A CD1 1 
ATOM   602  C CD2 . PHE A 1 80  ? 5.438   37.901 81.100  1.00 26.83 ? 114 PHE A CD2 1 
ATOM   603  C CE1 . PHE A 1 80  ? 4.963   35.177 81.326  1.00 27.26 ? 114 PHE A CE1 1 
ATOM   604  C CE2 . PHE A 1 80  ? 4.387   37.444 81.870  1.00 26.26 ? 114 PHE A CE2 1 
ATOM   605  C CZ  . PHE A 1 80  ? 4.145   36.083 81.983  1.00 26.97 ? 114 PHE A CZ  1 
ATOM   606  N N   . GLU A 1 81  ? 4.675   37.787 77.900  1.00 30.01 ? 115 GLU A N   1 
ATOM   607  C CA  . GLU A 1 81  ? 3.399   38.336 77.496  1.00 30.58 ? 115 GLU A CA  1 
ATOM   608  C C   . GLU A 1 81  ? 2.301   38.019 78.522  1.00 31.15 ? 115 GLU A C   1 
ATOM   609  O O   . GLU A 1 81  ? 2.062   36.849 78.842  1.00 31.61 ? 115 GLU A O   1 
ATOM   610  C CB  . GLU A 1 81  ? 3.064   37.723 76.148  1.00 30.50 ? 115 GLU A CB  1 
ATOM   611  C CG  . GLU A 1 81  ? 1.747   38.114 75.543  1.00 31.22 ? 115 GLU A CG  1 
ATOM   612  C CD  . GLU A 1 81  ? 1.565   37.542 74.145  1.00 31.18 ? 115 GLU A CD  1 
ATOM   613  O OE1 . GLU A 1 81  ? 2.553   36.985 73.615  1.00 31.35 ? 115 GLU A OE1 1 
ATOM   614  O OE2 . GLU A 1 81  ? 0.444   37.647 73.580  1.00 31.57 ? 115 GLU A OE2 1 
ATOM   615  N N   . ASP A 1 82  ? 1.659   39.069 79.045  1.00 31.68 ? 116 ASP A N   1 
ATOM   616  C CA  . ASP A 1 82  ? 0.494   38.986 79.946  1.00 31.60 ? 116 ASP A CA  1 
ATOM   617  C C   . ASP A 1 82  ? -0.735  38.870 79.102  1.00 31.25 ? 116 ASP A C   1 
ATOM   618  O O   . ASP A 1 82  ? -0.686  38.995 77.889  1.00 31.19 ? 116 ASP A O   1 
ATOM   619  C CB  . ASP A 1 82  ? 0.274   40.324 80.636  1.00 32.08 ? 116 ASP A CB  1 
ATOM   620  C CG  . ASP A 1 82  ? 0.912   40.421 81.967  1.00 33.84 ? 116 ASP A CG  1 
ATOM   621  O OD1 . ASP A 1 82  ? 0.867   41.551 82.517  1.00 35.80 ? 116 ASP A OD1 1 
ATOM   622  O OD2 . ASP A 1 82  ? 1.438   39.404 82.465  1.00 35.62 ? 116 ASP A OD2 1 
ATOM   623  N N   . ASP A 1 83  ? -1.866  38.747 79.772  1.00 31.01 ? 117 ASP A N   1 
ATOM   624  C CA  . ASP A 1 83  ? -3.144  38.976 79.145  1.00 30.59 ? 117 ASP A CA  1 
ATOM   625  C C   . ASP A 1 83  ? -3.365  40.470 78.867  1.00 30.40 ? 117 ASP A C   1 
ATOM   626  O O   . ASP A 1 83  ? -4.262  40.828 78.097  1.00 30.64 ? 117 ASP A O   1 
ATOM   627  C CB  . ASP A 1 83  ? -4.253  38.447 80.043  1.00 30.72 ? 117 ASP A CB  1 
ATOM   628  C CG  . ASP A 1 83  ? -5.591  38.436 79.356  1.00 31.61 ? 117 ASP A CG  1 
ATOM   629  O OD1 . ASP A 1 83  ? -5.695  37.763 78.309  1.00 32.57 ? 117 ASP A OD1 1 
ATOM   630  O OD2 . ASP A 1 83  ? -6.532  39.097 79.855  1.00 32.41 ? 117 ASP A OD2 1 
ATOM   631  N N   . THR A 1 84  ? -2.563  41.343 79.485  1.00 30.00 ? 118 THR A N   1 
ATOM   632  C CA  . THR A 1 84  ? -2.746  42.794 79.312  1.00 29.66 ? 118 THR A CA  1 
ATOM   633  C C   . THR A 1 84  ? -1.504  43.574 78.879  1.00 29.23 ? 118 THR A C   1 
ATOM   634  O O   . THR A 1 84  ? -1.634  44.690 78.373  1.00 29.19 ? 118 THR A O   1 
ATOM   635  C CB  . THR A 1 84  ? -3.326  43.481 80.569  1.00 29.62 ? 118 THR A CB  1 
ATOM   636  O OG1 . THR A 1 84  ? -2.289  43.674 81.533  1.00 31.15 ? 118 THR A OG1 1 
ATOM   637  C CG2 . THR A 1 84  ? -4.459  42.663 81.187  1.00 29.81 ? 118 THR A CG2 1 
ATOM   638  N N   . ARG A 1 85  ? -0.312  43.012 79.077  1.00 28.65 ? 119 ARG A N   1 
ATOM   639  C CA  . ARG A 1 85  ? 0.920   43.722 78.708  1.00 27.94 ? 119 ARG A CA  1 
ATOM   640  C C   . ARG A 1 85  ? 2.001   42.854 78.073  1.00 27.79 ? 119 ARG A C   1 
ATOM   641  O O   . ARG A 1 85  ? 1.990   41.634 78.205  1.00 27.61 ? 119 ARG A O   1 
ATOM   642  C CB  . ARG A 1 85  ? 1.513   44.431 79.918  1.00 27.68 ? 119 ARG A CB  1 
ATOM   643  C CG  . ARG A 1 85  ? 0.592   45.401 80.583  1.00 27.13 ? 119 ARG A CG  1 
ATOM   644  C CD  . ARG A 1 85  ? 1.282   46.133 81.714  1.00 27.71 ? 119 ARG A CD  1 
ATOM   645  N NE  . ARG A 1 85  ? 1.611   45.264 82.840  1.00 28.93 ? 119 ARG A NE  1 
ATOM   646  C CZ  . ARG A 1 85  ? 2.207   45.684 83.957  1.00 29.20 ? 119 ARG A CZ  1 
ATOM   647  N NH1 . ARG A 1 85  ? 2.533   46.968 84.105  1.00 28.64 ? 119 ARG A NH1 1 
ATOM   648  N NH2 . ARG A 1 85  ? 2.471   44.822 84.930  1.00 27.72 ? 119 ARG A NH2 1 
ATOM   649  N N   . PHE A 1 86  ? 2.933   43.507 77.379  1.00 27.77 ? 120 PHE A N   1 
ATOM   650  C CA  . PHE A 1 86  ? 4.115   42.858 76.806  1.00 27.78 ? 120 PHE A CA  1 
ATOM   651  C C   . PHE A 1 86  ? 5.343   43.293 77.575  1.00 27.77 ? 120 PHE A C   1 
ATOM   652  O O   . PHE A 1 86  ? 5.507   44.474 77.892  1.00 27.88 ? 120 PHE A O   1 
ATOM   653  C CB  . PHE A 1 86  ? 4.348   43.272 75.350  1.00 27.76 ? 120 PHE A CB  1 
ATOM   654  C CG  . PHE A 1 86  ? 3.334   42.751 74.374  1.00 28.22 ? 120 PHE A CG  1 
ATOM   655  C CD1 . PHE A 1 86  ? 2.538   43.640 73.646  1.00 27.89 ? 120 PHE A CD1 1 
ATOM   656  C CD2 . PHE A 1 86  ? 3.203   41.380 74.137  1.00 28.61 ? 120 PHE A CD2 1 
ATOM   657  C CE1 . PHE A 1 86  ? 1.613   43.175 72.720  1.00 27.35 ? 120 PHE A CE1 1 
ATOM   658  C CE2 . PHE A 1 86  ? 2.275   40.905 73.210  1.00 28.01 ? 120 PHE A CE2 1 
ATOM   659  C CZ  . PHE A 1 86  ? 1.479   41.807 72.500  1.00 27.48 ? 120 PHE A CZ  1 
ATOM   660  N N   . TYR A 1 87  ? 6.228   42.346 77.835  1.00 27.79 ? 121 TYR A N   1 
ATOM   661  C CA  . TYR A 1 87  ? 7.437   42.631 78.576  1.00 28.05 ? 121 TYR A CA  1 
ATOM   662  C C   . TYR A 1 87  ? 8.656   42.256 77.743  1.00 28.56 ? 121 TYR A C   1 
ATOM   663  O O   . TYR A 1 87  ? 8.949   41.065 77.515  1.00 28.62 ? 121 TYR A O   1 
ATOM   664  C CB  . TYR A 1 87  ? 7.447   41.853 79.891  1.00 27.73 ? 121 TYR A CB  1 
ATOM   665  C CG  . TYR A 1 87  ? 6.230   42.032 80.784  1.00 27.09 ? 121 TYR A CG  1 
ATOM   666  C CD1 . TYR A 1 87  ? 5.062   41.302 80.571  1.00 26.11 ? 121 TYR A CD1 1 
ATOM   667  C CD2 . TYR A 1 87  ? 6.269   42.901 81.869  1.00 26.51 ? 121 TYR A CD2 1 
ATOM   668  C CE1 . TYR A 1 87  ? 3.965   41.445 81.407  1.00 25.35 ? 121 TYR A CE1 1 
ATOM   669  C CE2 . TYR A 1 87  ? 5.180   43.050 82.708  1.00 26.21 ? 121 TYR A CE2 1 
ATOM   670  C CZ  . TYR A 1 87  ? 4.035   42.317 82.476  1.00 26.40 ? 121 TYR A CZ  1 
ATOM   671  O OH  . TYR A 1 87  ? 2.966   42.481 83.321  1.00 26.30 ? 121 TYR A OH  1 
ATOM   672  N N   . LEU A 1 88  ? 9.357   43.277 77.275  1.00 28.87 ? 122 LEU A N   1 
ATOM   673  C CA  . LEU A 1 88  ? 10.596  43.063 76.554  1.00 29.19 ? 122 LEU A CA  1 
ATOM   674  C C   . LEU A 1 88  ? 11.721  43.337 77.530  1.00 29.59 ? 122 LEU A C   1 
ATOM   675  O O   . LEU A 1 88  ? 11.902  44.479 77.979  1.00 29.88 ? 122 LEU A O   1 
ATOM   676  C CB  . LEU A 1 88  ? 10.688  43.981 75.332  1.00 29.05 ? 122 LEU A CB  1 
ATOM   677  C CG  . LEU A 1 88  ? 9.950   43.574 74.055  1.00 28.99 ? 122 LEU A CG  1 
ATOM   678  C CD1 . LEU A 1 88  ? 8.430   43.554 74.238  1.00 28.66 ? 122 LEU A CD1 1 
ATOM   679  C CD2 . LEU A 1 88  ? 10.326  44.518 72.924  1.00 28.89 ? 122 LEU A CD2 1 
ATOM   680  N N   . VAL A 1 89  ? 12.450  42.283 77.886  1.00 29.90 ? 123 VAL A N   1 
ATOM   681  C CA  . VAL A 1 89  ? 13.513  42.397 78.887  1.00 30.41 ? 123 VAL A CA  1 
ATOM   682  C C   . VAL A 1 89  ? 14.860  42.603 78.195  1.00 31.05 ? 123 VAL A C   1 
ATOM   683  O O   . VAL A 1 89  ? 15.444  41.659 77.655  1.00 30.99 ? 123 VAL A O   1 
ATOM   684  C CB  . VAL A 1 89  ? 13.559  41.158 79.843  1.00 30.27 ? 123 VAL A CB  1 
ATOM   685  C CG1 . VAL A 1 89  ? 14.601  41.353 80.934  1.00 29.88 ? 123 VAL A CG1 1 
ATOM   686  C CG2 . VAL A 1 89  ? 12.185  40.867 80.450  1.00 28.84 ? 123 VAL A CG2 1 
ATOM   687  N N   . PHE A 1 90  ? 15.335  43.844 78.200  1.00 31.84 ? 124 PHE A N   1 
ATOM   688  C CA  . PHE A 1 90  ? 16.618  44.182 77.588  1.00 32.84 ? 124 PHE A CA  1 
ATOM   689  C C   . PHE A 1 90  ? 17.749  44.176 78.602  1.00 33.77 ? 124 PHE A C   1 
ATOM   690  O O   . PHE A 1 90  ? 17.528  44.405 79.794  1.00 34.01 ? 124 PHE A O   1 
ATOM   691  C CB  . PHE A 1 90  ? 16.558  45.570 76.949  1.00 32.42 ? 124 PHE A CB  1 
ATOM   692  C CG  . PHE A 1 90  ? 15.637  45.659 75.785  1.00 32.56 ? 124 PHE A CG  1 
ATOM   693  C CD1 . PHE A 1 90  ? 14.348  46.150 75.944  1.00 31.80 ? 124 PHE A CD1 1 
ATOM   694  C CD2 . PHE A 1 90  ? 16.055  45.249 74.517  1.00 33.13 ? 124 PHE A CD2 1 
ATOM   695  C CE1 . PHE A 1 90  ? 13.481  46.221 74.865  1.00 32.07 ? 124 PHE A CE1 1 
ATOM   696  C CE2 . PHE A 1 90  ? 15.194  45.323 73.417  1.00 32.52 ? 124 PHE A CE2 1 
ATOM   697  C CZ  . PHE A 1 90  ? 13.904  45.811 73.592  1.00 32.37 ? 124 PHE A CZ  1 
ATOM   698  N N   . GLU A 1 91  ? 18.963  43.940 78.114  1.00 34.88 ? 125 GLU A N   1 
ATOM   699  C CA  . GLU A 1 91  ? 20.179  44.190 78.878  1.00 36.00 ? 125 GLU A CA  1 
ATOM   700  C C   . GLU A 1 91  ? 20.223  45.622 79.440  1.00 36.98 ? 125 GLU A C   1 
ATOM   701  O O   . GLU A 1 91  ? 19.730  46.570 78.822  1.00 36.84 ? 125 GLU A O   1 
ATOM   702  C CB  . GLU A 1 91  ? 21.406  43.917 78.008  1.00 35.88 ? 125 GLU A CB  1 
ATOM   703  C CG  . GLU A 1 91  ? 21.454  44.697 76.687  1.00 35.91 ? 125 GLU A CG  1 
ATOM   704  C CD  . GLU A 1 91  ? 22.796  44.588 75.961  1.00 36.21 ? 125 GLU A CD  1 
ATOM   705  O OE1 . GLU A 1 91  ? 23.839  44.325 76.618  1.00 36.68 ? 125 GLU A OE1 1 
ATOM   706  O OE2 . GLU A 1 91  ? 22.803  44.771 74.721  1.00 35.94 ? 125 GLU A OE2 1 
ATOM   707  N N   . LYS A 1 92  ? 20.817  45.767 80.619  1.00 38.52 ? 126 LYS A N   1 
ATOM   708  C CA  . LYS A 1 92  ? 20.897  47.059 81.296  1.00 40.01 ? 126 LYS A CA  1 
ATOM   709  C C   . LYS A 1 92  ? 22.181  47.774 80.920  1.00 41.07 ? 126 LYS A C   1 
ATOM   710  O O   . LYS A 1 92  ? 23.254  47.168 80.902  1.00 41.31 ? 126 LYS A O   1 
ATOM   711  C CB  . LYS A 1 92  ? 20.859  46.852 82.808  1.00 40.06 ? 126 LYS A CB  1 
ATOM   712  C CG  . LYS A 1 92  ? 20.786  48.125 83.649  1.00 40.70 ? 126 LYS A CG  1 
ATOM   713  C CD  . LYS A 1 92  ? 19.351  48.469 84.034  1.00 41.58 ? 126 LYS A CD  1 
ATOM   714  C CE  . LYS A 1 92  ? 19.296  49.217 85.360  1.00 42.21 ? 126 LYS A CE  1 
ATOM   715  N NZ  . LYS A 1 92  ? 20.025  50.520 85.290  1.00 43.11 ? 126 LYS A NZ  1 
ATOM   716  N N   . LEU A 1 93  ? 22.072  49.064 80.630  1.00 42.41 ? 127 LEU A N   1 
ATOM   717  C CA  . LEU A 1 93  ? 23.256  49.879 80.371  1.00 43.84 ? 127 LEU A CA  1 
ATOM   718  C C   . LEU A 1 93  ? 23.396  51.040 81.369  1.00 45.04 ? 127 LEU A C   1 
ATOM   719  O O   . LEU A 1 93  ? 22.403  51.696 81.723  1.00 45.55 ? 127 LEU A O   1 
ATOM   720  C CB  . LEU A 1 93  ? 23.256  50.393 78.923  1.00 43.69 ? 127 LEU A CB  1 
ATOM   721  C CG  . LEU A 1 93  ? 23.457  49.375 77.794  1.00 42.81 ? 127 LEU A CG  1 
ATOM   722  C CD1 . LEU A 1 93  ? 23.566  50.099 76.482  1.00 41.42 ? 127 LEU A CD1 1 
ATOM   723  C CD2 . LEU A 1 93  ? 24.693  48.524 78.020  1.00 42.68 ? 127 LEU A CD2 1 
ATOM   724  N N   . GLN A 1 94  ? 24.629  51.290 81.812  1.00 45.94 ? 128 GLN A N   1 
ATOM   725  C CA  . GLN A 1 94  ? 24.912  52.376 82.755  1.00 47.14 ? 128 GLN A CA  1 
ATOM   726  C C   . GLN A 1 94  ? 24.810  53.801 82.175  1.00 47.25 ? 128 GLN A C   1 
ATOM   727  O O   . GLN A 1 94  ? 24.835  54.782 82.926  1.00 47.23 ? 128 GLN A O   1 
ATOM   728  C CB  . GLN A 1 94  ? 26.295  52.169 83.404  1.00 47.68 ? 128 GLN A CB  1 
ATOM   729  C CG  . GLN A 1 94  ? 26.274  51.473 84.784  1.00 50.20 ? 128 GLN A CG  1 
ATOM   730  C CD  . GLN A 1 94  ? 25.408  50.201 84.809  1.00 53.63 ? 128 GLN A CD  1 
ATOM   731  O OE1 . GLN A 1 94  ? 25.658  49.244 84.063  1.00 55.18 ? 128 GLN A OE1 1 
ATOM   732  N NE2 . GLN A 1 94  ? 24.380  50.195 85.666  1.00 54.07 ? 128 GLN A NE2 1 
ATOM   733  N N   . GLY A 1 95  ? 24.672  53.921 80.856  1.00 47.37 ? 129 GLY A N   1 
ATOM   734  C CA  . GLY A 1 95  ? 24.915  55.197 80.194  1.00 47.54 ? 129 GLY A CA  1 
ATOM   735  C C   . GLY A 1 95  ? 23.743  56.122 79.947  1.00 47.79 ? 129 GLY A C   1 
ATOM   736  O O   . GLY A 1 95  ? 23.919  57.346 79.905  1.00 47.73 ? 129 GLY A O   1 
ATOM   737  N N   . GLY A 1 96  ? 22.553  55.558 79.755  1.00 48.06 ? 130 GLY A N   1 
ATOM   738  C CA  . GLY A 1 96  ? 21.404  56.355 79.292  1.00 48.34 ? 130 GLY A CA  1 
ATOM   739  C C   . GLY A 1 96  ? 21.597  56.955 77.899  1.00 48.32 ? 130 GLY A C   1 
ATOM   740  O O   . GLY A 1 96  ? 22.685  56.868 77.321  1.00 48.22 ? 130 GLY A O   1 
ATOM   741  N N   . SER A 1 97  ? 20.546  57.585 77.371  1.00 48.35 ? 131 SER A N   1 
ATOM   742  C CA  . SER A 1 97  ? 20.519  58.034 75.976  1.00 48.31 ? 131 SER A CA  1 
ATOM   743  C C   . SER A 1 97  ? 21.590  59.059 75.646  1.00 48.45 ? 131 SER A C   1 
ATOM   744  O O   . SER A 1 97  ? 22.095  59.749 76.528  1.00 48.27 ? 131 SER A O   1 
ATOM   745  C CB  . SER A 1 97  ? 19.137  58.580 75.604  1.00 48.39 ? 131 SER A CB  1 
ATOM   746  O OG  . SER A 1 97  ? 18.844  59.774 76.311  1.00 48.49 ? 131 SER A OG  1 
ATOM   747  N N   . ILE A 1 98  ? 21.931  59.147 74.363  1.00 48.86 ? 132 ILE A N   1 
ATOM   748  C CA  . ILE A 1 98  ? 22.858  60.160 73.866  1.00 49.25 ? 132 ILE A CA  1 
ATOM   749  C C   . ILE A 1 98  ? 22.246  61.546 74.087  1.00 49.64 ? 132 ILE A C   1 
ATOM   750  O O   . ILE A 1 98  ? 22.973  62.514 74.298  1.00 49.48 ? 132 ILE A O   1 
ATOM   751  C CB  . ILE A 1 98  ? 23.259  59.917 72.348  1.00 49.30 ? 132 ILE A CB  1 
ATOM   752  C CG1 . ILE A 1 98  ? 24.771  59.908 72.164  1.00 49.17 ? 132 ILE A CG1 1 
ATOM   753  C CG2 . ILE A 1 98  ? 22.655  60.937 71.387  1.00 48.76 ? 132 ILE A CG2 1 
ATOM   754  C CD1 . ILE A 1 98  ? 25.352  58.532 72.142  1.00 49.39 ? 132 ILE A CD1 1 
ATOM   755  N N   . LEU A 1 99  ? 20.912  61.621 74.057  1.00 50.34 ? 133 LEU A N   1 
ATOM   756  C CA  . LEU A 1 99  ? 20.189  62.879 74.237  1.00 51.23 ? 133 LEU A CA  1 
ATOM   757  C C   . LEU A 1 99  ? 20.577  63.545 75.546  1.00 52.13 ? 133 LEU A C   1 
ATOM   758  O O   . LEU A 1 99  ? 20.858  64.749 75.576  1.00 52.37 ? 133 LEU A O   1 
ATOM   759  C CB  . LEU A 1 99  ? 18.667  62.673 74.185  1.00 51.07 ? 133 LEU A CB  1 
ATOM   760  C CG  . LEU A 1 99  ? 17.786  63.886 74.548  1.00 50.93 ? 133 LEU A CG  1 
ATOM   761  C CD1 . LEU A 1 99  ? 18.068  65.114 73.673  1.00 50.81 ? 133 LEU A CD1 1 
ATOM   762  C CD2 . LEU A 1 99  ? 16.302  63.543 74.521  1.00 51.06 ? 133 LEU A CD2 1 
ATOM   763  N N   . ALA A 1 100 ? 20.586  62.760 76.621  1.00 53.05 ? 134 ALA A N   1 
ATOM   764  C CA  . ALA A 1 100 ? 21.022  63.250 77.920  1.00 54.09 ? 134 ALA A CA  1 
ATOM   765  C C   . ALA A 1 100 ? 22.432  63.826 77.813  1.00 54.82 ? 134 ALA A C   1 
ATOM   766  O O   . ALA A 1 100 ? 22.657  64.977 78.174  1.00 54.95 ? 134 ALA A O   1 
ATOM   767  C CB  . ALA A 1 100 ? 20.958  62.145 78.956  1.00 54.07 ? 134 ALA A CB  1 
ATOM   768  N N   . HIS A 1 101 ? 23.357  63.041 77.262  1.00 55.88 ? 135 HIS A N   1 
ATOM   769  C CA  . HIS A 1 101 ? 24.759  63.449 77.115  1.00 57.04 ? 135 HIS A CA  1 
ATOM   770  C C   . HIS A 1 101 ? 24.937  64.715 76.283  1.00 57.70 ? 135 HIS A C   1 
ATOM   771  O O   . HIS A 1 101 ? 25.978  65.364 76.361  1.00 57.64 ? 135 HIS A O   1 
ATOM   772  C CB  . HIS A 1 101 ? 25.592  62.315 76.512  1.00 57.16 ? 135 HIS A CB  1 
ATOM   773  C CG  . HIS A 1 101 ? 25.770  61.133 77.420  1.00 57.98 ? 135 HIS A CG  1 
ATOM   774  N ND1 . HIS A 1 101 ? 27.011  60.659 77.790  1.00 58.48 ? 135 HIS A ND1 1 
ATOM   775  C CD2 . HIS A 1 101 ? 24.864  60.321 78.020  1.00 58.66 ? 135 HIS A CD2 1 
ATOM   776  C CE1 . HIS A 1 101 ? 26.862  59.612 78.583  1.00 59.09 ? 135 HIS A CE1 1 
ATOM   777  N NE2 . HIS A 1 101 ? 25.569  59.388 78.742  1.00 58.87 ? 135 HIS A NE2 1 
ATOM   778  N N   . ILE A 1 102 ? 23.926  65.057 75.485  1.00 58.92 ? 136 ILE A N   1 
ATOM   779  C CA  . ILE A 1 102 ? 23.959  66.278 74.672  1.00 60.15 ? 136 ILE A CA  1 
ATOM   780  C C   . ILE A 1 102 ? 23.645  67.478 75.549  1.00 60.76 ? 136 ILE A C   1 
ATOM   781  O O   . ILE A 1 102 ? 24.455  68.397 75.655  1.00 60.95 ? 136 ILE A O   1 
ATOM   782  C CB  . ILE A 1 102 ? 22.966  66.248 73.460  1.00 60.23 ? 136 ILE A CB  1 
ATOM   783  C CG1 . ILE A 1 102 ? 23.341  65.166 72.432  1.00 60.59 ? 136 ILE A CG1 1 
ATOM   784  C CG2 . ILE A 1 102 ? 22.875  67.628 72.789  1.00 60.31 ? 136 ILE A CG2 1 
ATOM   785  C CD1 . ILE A 1 102 ? 24.546  65.493 71.554  1.00 61.34 ? 136 ILE A CD1 1 
ATOM   786  N N   . GLN A 1 103 ? 22.472  67.458 76.181  1.00 61.55 ? 137 GLN A N   1 
ATOM   787  C CA  . GLN A 1 103 ? 22.031  68.561 77.037  1.00 62.47 ? 137 GLN A CA  1 
ATOM   788  C C   . GLN A 1 103 ? 22.857  68.682 78.324  1.00 63.13 ? 137 GLN A C   1 
ATOM   789  O O   . GLN A 1 103 ? 22.520  69.472 79.214  1.00 63.42 ? 137 GLN A O   1 
ATOM   790  C CB  . GLN A 1 103 ? 20.534  68.446 77.347  1.00 62.37 ? 137 GLN A CB  1 
ATOM   791  C CG  . GLN A 1 103 ? 20.094  67.089 77.885  1.00 62.43 ? 137 GLN A CG  1 
ATOM   792  C CD  . GLN A 1 103 ? 18.735  66.663 77.354  1.00 62.73 ? 137 GLN A CD  1 
ATOM   793  O OE1 . GLN A 1 103 ? 18.182  67.297 76.450  1.00 63.01 ? 137 GLN A OE1 1 
ATOM   794  N NE2 . GLN A 1 103 ? 18.190  65.578 77.909  1.00 62.46 ? 137 GLN A NE2 1 
ATOM   795  N N   . LYS A 1 104 ? 23.934  67.896 78.402  1.00 63.77 ? 138 LYS A N   1 
ATOM   796  C CA  . LYS A 1 104 ? 24.870  67.914 79.530  1.00 64.42 ? 138 LYS A CA  1 
ATOM   797  C C   . LYS A 1 104 ? 26.200  68.557 79.132  1.00 64.39 ? 138 LYS A C   1 
ATOM   798  O O   . LYS A 1 104 ? 26.852  69.196 79.961  1.00 64.55 ? 138 LYS A O   1 
ATOM   799  C CB  . LYS A 1 104 ? 25.098  66.492 80.069  1.00 64.33 ? 138 LYS A CB  1 
ATOM   800  C CG  . LYS A 1 104 ? 26.028  66.389 81.300  1.00 65.22 ? 138 LYS A CG  1 
ATOM   801  C CD  . LYS A 1 104 ? 25.866  65.062 82.091  1.00 65.49 ? 138 LYS A CD  1 
ATOM   802  C CE  . LYS A 1 104 ? 26.237  63.800 81.281  1.00 67.34 ? 138 LYS A CE  1 
ATOM   803  N NZ  . LYS A 1 104 ? 27.603  63.855 80.652  1.00 68.32 ? 138 LYS A NZ  1 
ATOM   804  N N   . GLN A 1 105 ? 26.592  68.384 77.869  1.00 64.42 ? 139 GLN A N   1 
ATOM   805  C CA  . GLN A 1 105 ? 27.865  68.908 77.357  1.00 64.37 ? 139 GLN A CA  1 
ATOM   806  C C   . GLN A 1 105 ? 27.656  70.056 76.360  1.00 64.09 ? 139 GLN A C   1 
ATOM   807  O O   . GLN A 1 105 ? 28.627  70.669 75.886  1.00 64.23 ? 139 GLN A O   1 
ATOM   808  C CB  . GLN A 1 105 ? 28.671  67.784 76.694  1.00 64.46 ? 139 GLN A CB  1 
ATOM   809  C CG  . GLN A 1 105 ? 29.132  66.675 77.639  1.00 65.42 ? 139 GLN A CG  1 
ATOM   810  C CD  . GLN A 1 105 ? 29.341  65.345 76.923  1.00 67.18 ? 139 GLN A CD  1 
ATOM   811  O OE1 . GLN A 1 105 ? 28.668  64.355 77.220  1.00 68.42 ? 139 GLN A OE1 1 
ATOM   812  N NE2 . GLN A 1 105 ? 30.267  65.321 75.966  1.00 67.54 ? 139 GLN A NE2 1 
ATOM   813  N N   . LYS A 1 106 ? 26.385  70.353 76.078  1.00 63.50 ? 140 LYS A N   1 
ATOM   814  C CA  . LYS A 1 106 ? 25.962  71.180 74.936  1.00 62.82 ? 140 LYS A CA  1 
ATOM   815  C C   . LYS A 1 106 ? 26.192  70.435 73.603  1.00 61.78 ? 140 LYS A C   1 
ATOM   816  O O   . LYS A 1 106 ? 25.260  70.288 72.809  1.00 61.65 ? 140 LYS A O   1 
ATOM   817  C CB  . LYS A 1 106 ? 26.608  72.585 74.947  1.00 63.33 ? 140 LYS A CB  1 
ATOM   818  C CG  . LYS A 1 106 ? 25.754  73.697 74.284  1.00 64.31 ? 140 LYS A CG  1 
ATOM   819  C CD  . LYS A 1 106 ? 25.752  73.628 72.740  1.00 65.43 ? 140 LYS A CD  1 
ATOM   820  C CE  . LYS A 1 106 ? 24.524  74.306 72.130  1.00 65.12 ? 140 LYS A CE  1 
ATOM   821  N NZ  . LYS A 1 106 ? 24.665  75.788 72.069  1.00 66.22 ? 140 LYS A NZ  1 
ATOM   822  N N   . HIS A 1 107 ? 27.424  69.966 73.380  1.00 60.43 ? 141 HIS A N   1 
ATOM   823  C CA  . HIS A 1 107 ? 27.788  69.183 72.191  1.00 59.07 ? 141 HIS A CA  1 
ATOM   824  C C   . HIS A 1 107 ? 29.033  68.306 72.411  1.00 58.15 ? 141 HIS A C   1 
ATOM   825  O O   . HIS A 1 107 ? 29.710  68.405 73.435  1.00 57.93 ? 141 HIS A O   1 
ATOM   826  C CB  . HIS A 1 107 ? 27.976  70.091 70.970  1.00 59.04 ? 141 HIS A CB  1 
ATOM   827  C CG  . HIS A 1 107 ? 28.991  71.171 71.167  1.00 59.07 ? 141 HIS A CG  1 
ATOM   828  N ND1 . HIS A 1 107 ? 30.349  70.934 71.119  1.00 59.16 ? 141 HIS A ND1 1 
ATOM   829  C CD2 . HIS A 1 107 ? 28.848  72.494 71.411  1.00 59.24 ? 141 HIS A CD2 1 
ATOM   830  C CE1 . HIS A 1 107 ? 30.998  72.064 71.331  1.00 59.41 ? 141 HIS A CE1 1 
ATOM   831  N NE2 . HIS A 1 107 ? 30.110  73.026 71.511  1.00 59.79 ? 141 HIS A NE2 1 
ATOM   832  N N   . PHE A 1 108 ? 29.313  67.446 71.438  1.00 57.03 ? 142 PHE A N   1 
ATOM   833  C CA  . PHE A 1 108 ? 30.444  66.529 71.487  1.00 56.14 ? 142 PHE A CA  1 
ATOM   834  C C   . PHE A 1 108 ? 31.580  67.119 70.684  1.00 55.37 ? 142 PHE A C   1 
ATOM   835  O O   . PHE A 1 108 ? 31.362  67.999 69.851  1.00 55.38 ? 142 PHE A O   1 
ATOM   836  C CB  . PHE A 1 108 ? 30.074  65.192 70.835  1.00 56.37 ? 142 PHE A CB  1 
ATOM   837  C CG  . PHE A 1 108 ? 29.018  64.401 71.570  1.00 56.64 ? 142 PHE A CG  1 
ATOM   838  C CD1 . PHE A 1 108 ? 28.292  64.950 72.626  1.00 57.54 ? 142 PHE A CD1 1 
ATOM   839  C CD2 . PHE A 1 108 ? 28.733  63.099 71.176  1.00 56.53 ? 142 PHE A CD2 1 
ATOM   840  C CE1 . PHE A 1 108 ? 27.313  64.206 73.289  1.00 57.71 ? 142 PHE A CE1 1 
ATOM   841  C CE2 . PHE A 1 108 ? 27.752  62.351 71.826  1.00 56.78 ? 142 PHE A CE2 1 
ATOM   842  C CZ  . PHE A 1 108 ? 27.041  62.906 72.883  1.00 57.00 ? 142 PHE A CZ  1 
ATOM   843  N N   . ASN A 1 109 ? 32.792  66.628 70.914  1.00 54.37 ? 143 ASN A N   1 
ATOM   844  C CA  . ASN A 1 109 ? 33.885  66.918 70.002  1.00 53.57 ? 143 ASN A CA  1 
ATOM   845  C C   . ASN A 1 109 ? 33.871  65.922 68.850  1.00 52.98 ? 143 ASN A C   1 
ATOM   846  O O   . ASN A 1 109 ? 33.081  64.975 68.852  1.00 52.99 ? 143 ASN A O   1 
ATOM   847  C CB  . ASN A 1 109 ? 35.234  66.932 70.723  1.00 53.68 ? 143 ASN A CB  1 
ATOM   848  C CG  . ASN A 1 109 ? 35.555  65.619 71.393  1.00 53.56 ? 143 ASN A CG  1 
ATOM   849  O OD1 . ASN A 1 109 ? 35.579  64.566 70.757  1.00 53.48 ? 143 ASN A OD1 1 
ATOM   850  N ND2 . ASN A 1 109 ? 35.825  65.677 72.689  1.00 54.34 ? 143 ASN A ND2 1 
ATOM   851  N N   . GLU A 1 110 ? 34.746  66.132 67.873  1.00 52.21 ? 144 GLU A N   1 
ATOM   852  C CA  . GLU A 1 110 ? 34.714  65.351 66.641  1.00 51.51 ? 144 GLU A CA  1 
ATOM   853  C C   . GLU A 1 110 ? 35.188  63.912 66.799  1.00 51.24 ? 144 GLU A C   1 
ATOM   854  O O   . GLU A 1 110 ? 34.797  63.040 66.028  1.00 50.99 ? 144 GLU A O   1 
ATOM   855  C CB  . GLU A 1 110 ? 35.524  66.039 65.550  1.00 51.49 ? 144 GLU A CB  1 
ATOM   856  C CG  . GLU A 1 110 ? 34.872  67.272 64.969  1.00 50.27 ? 144 GLU A CG  1 
ATOM   857  C CD  . GLU A 1 110 ? 35.602  67.754 63.745  1.00 49.63 ? 144 GLU A CD  1 
ATOM   858  O OE1 . GLU A 1 110 ? 36.111  66.900 62.988  1.00 49.44 ? 144 GLU A OE1 1 
ATOM   859  O OE2 . GLU A 1 110 ? 35.676  68.981 63.539  1.00 49.59 ? 144 GLU A OE2 1 
ATOM   860  N N   . ARG A 1 111 ? 36.041  63.665 67.784  1.00 51.03 ? 145 ARG A N   1 
ATOM   861  C CA  . ARG A 1 111 ? 36.485  62.304 68.049  1.00 50.87 ? 145 ARG A CA  1 
ATOM   862  C C   . ARG A 1 111 ? 35.382  61.501 68.719  1.00 50.08 ? 145 ARG A C   1 
ATOM   863  O O   . ARG A 1 111 ? 35.174  60.345 68.366  1.00 50.17 ? 145 ARG A O   1 
ATOM   864  C CB  . ARG A 1 111 ? 37.798  62.275 68.844  1.00 51.33 ? 145 ARG A CB  1 
ATOM   865  C CG  . ARG A 1 111 ? 39.061  61.899 68.014  1.00 53.85 ? 145 ARG A CG  1 
ATOM   866  C CD  . ARG A 1 111 ? 39.170  62.619 66.635  1.00 58.01 ? 145 ARG A CD  1 
ATOM   867  N NE  . ARG A 1 111 ? 38.696  61.803 65.497  1.00 60.34 ? 145 ARG A NE  1 
ATOM   868  C CZ  . ARG A 1 111 ? 38.341  62.281 64.296  1.00 60.62 ? 145 ARG A CZ  1 
ATOM   869  N NH1 . ARG A 1 111 ? 37.931  61.446 63.343  1.00 60.09 ? 145 ARG A NH1 1 
ATOM   870  N NH2 . ARG A 1 111 ? 38.384  63.589 64.043  1.00 60.64 ? 145 ARG A NH2 1 
ATOM   871  N N   . GLU A 1 112 ? 34.662  62.125 69.654  1.00 49.09 ? 146 GLU A N   1 
ATOM   872  C CA  . GLU A 1 112 ? 33.506  61.500 70.294  1.00 48.11 ? 146 GLU A CA  1 
ATOM   873  C C   . GLU A 1 112 ? 32.414  61.225 69.284  1.00 47.33 ? 146 GLU A C   1 
ATOM   874  O O   . GLU A 1 112 ? 31.946  60.095 69.164  1.00 47.30 ? 146 GLU A O   1 
ATOM   875  C CB  . GLU A 1 112 ? 32.953  62.379 71.406  1.00 48.06 ? 146 GLU A CB  1 
ATOM   876  C CG  . GLU A 1 112 ? 33.758  62.291 72.669  1.00 49.47 ? 146 GLU A CG  1 
ATOM   877  C CD  . GLU A 1 112 ? 33.263  63.217 73.762  1.00 50.73 ? 146 GLU A CD  1 
ATOM   878  O OE1 . GLU A 1 112 ? 33.134  62.737 74.911  1.00 51.95 ? 146 GLU A OE1 1 
ATOM   879  O OE2 . GLU A 1 112 ? 33.012  64.414 73.483  1.00 50.52 ? 146 GLU A OE2 1 
ATOM   880  N N   . ALA A 1 113 ? 32.026  62.264 68.550  1.00 46.42 ? 147 ALA A N   1 
ATOM   881  C CA  . ALA A 1 113 ? 30.967  62.164 67.559  1.00 45.50 ? 147 ALA A CA  1 
ATOM   882  C C   . ALA A 1 113 ? 31.281  61.116 66.500  1.00 45.08 ? 147 ALA A C   1 
ATOM   883  O O   . ALA A 1 113 ? 30.382  60.432 66.023  1.00 45.16 ? 147 ALA A O   1 
ATOM   884  C CB  . ALA A 1 113 ? 30.715  63.507 66.925  1.00 45.39 ? 147 ALA A CB  1 
ATOM   885  N N   . SER A 1 114 ? 32.555  60.976 66.146  1.00 44.65 ? 148 SER A N   1 
ATOM   886  C CA  . SER A 1 114 ? 32.973  59.999 65.139  1.00 44.35 ? 148 SER A CA  1 
ATOM   887  C C   . SER A 1 114 ? 32.738  58.556 65.577  1.00 43.99 ? 148 SER A C   1 
ATOM   888  O O   . SER A 1 114 ? 32.234  57.750 64.805  1.00 43.81 ? 148 SER A O   1 
ATOM   889  C CB  . SER A 1 114 ? 34.444  60.189 64.779  1.00 44.40 ? 148 SER A CB  1 
ATOM   890  O OG  . SER A 1 114 ? 34.891  59.131 63.949  1.00 45.49 ? 148 SER A OG  1 
ATOM   891  N N   . ARG A 1 115 ? 33.119  58.243 66.815  1.00 43.72 ? 149 ARG A N   1 
ATOM   892  C CA  . ARG A 1 115 ? 32.968  56.907 67.377  1.00 43.51 ? 149 ARG A CA  1 
ATOM   893  C C   . ARG A 1 115 ? 31.501  56.535 67.409  1.00 42.58 ? 149 ARG A C   1 
ATOM   894  O O   . ARG A 1 115 ? 31.146  55.378 67.216  1.00 42.73 ? 149 ARG A O   1 
ATOM   895  C CB  . ARG A 1 115 ? 33.532  56.834 68.803  1.00 43.46 ? 149 ARG A CB  1 
ATOM   896  C CG  . ARG A 1 115 ? 35.038  57.088 68.959  1.00 44.59 ? 149 ARG A CG  1 
ATOM   897  C CD  . ARG A 1 115 ? 35.499  56.797 70.405  1.00 45.37 ? 149 ARG A CD  1 
ATOM   898  N NE  . ARG A 1 115 ? 36.557  57.696 70.902  1.00 49.63 ? 149 ARG A NE  1 
ATOM   899  C CZ  . ARG A 1 115 ? 36.396  58.646 71.836  1.00 50.91 ? 149 ARG A CZ  1 
ATOM   900  N NH1 . ARG A 1 115 ? 37.432  59.398 72.205  1.00 51.58 ? 149 ARG A NH1 1 
ATOM   901  N NH2 . ARG A 1 115 ? 35.210  58.857 72.408  1.00 51.26 ? 149 ARG A NH2 1 
ATOM   902  N N   . VAL A 1 116 ? 30.649  57.523 67.658  1.00 41.73 ? 150 VAL A N   1 
ATOM   903  C CA  . VAL A 1 116 ? 29.217  57.287 67.765  1.00 40.92 ? 150 VAL A CA  1 
ATOM   904  C C   . VAL A 1 116 ? 28.622  57.014 66.394  1.00 40.59 ? 150 VAL A C   1 
ATOM   905  O O   . VAL A 1 116 ? 27.778  56.145 66.248  1.00 40.70 ? 150 VAL A O   1 
ATOM   906  C CB  . VAL A 1 116 ? 28.482  58.468 68.429  1.00 40.98 ? 150 VAL A CB  1 
ATOM   907  C CG1 . VAL A 1 116 ? 26.975  58.223 68.444  1.00 40.56 ? 150 VAL A CG1 1 
ATOM   908  C CG2 . VAL A 1 116 ? 29.010  58.715 69.845  1.00 40.65 ? 150 VAL A CG2 1 
ATOM   909  N N   . VAL A 1 117 ? 29.066  57.754 65.390  1.00 40.11 ? 151 VAL A N   1 
ATOM   910  C CA  . VAL A 1 117 ? 28.634  57.501 64.027  1.00 39.79 ? 151 VAL A CA  1 
ATOM   911  C C   . VAL A 1 117 ? 29.075  56.104 63.563  1.00 39.74 ? 151 VAL A C   1 
ATOM   912  O O   . VAL A 1 117 ? 28.307  55.386 62.927  1.00 39.79 ? 151 VAL A O   1 
ATOM   913  C CB  . VAL A 1 117 ? 29.162  58.585 63.070  1.00 39.66 ? 151 VAL A CB  1 
ATOM   914  C CG1 . VAL A 1 117 ? 28.865  58.230 61.627  1.00 39.72 ? 151 VAL A CG1 1 
ATOM   915  C CG2 . VAL A 1 117 ? 28.538  59.917 63.405  1.00 39.67 ? 151 VAL A CG2 1 
ATOM   916  N N   . ARG A 1 118 ? 30.305  55.726 63.901  1.00 39.68 ? 152 ARG A N   1 
ATOM   917  C CA  . ARG A 1 118 ? 30.882  54.449 63.490  1.00 39.74 ? 152 ARG A CA  1 
ATOM   918  C C   . ARG A 1 118 ? 30.073  53.280 64.040  1.00 39.46 ? 152 ARG A C   1 
ATOM   919  O O   . ARG A 1 118 ? 29.856  52.283 63.348  1.00 39.50 ? 152 ARG A O   1 
ATOM   920  C CB  . ARG A 1 118 ? 32.340  54.374 63.947  1.00 39.97 ? 152 ARG A CB  1 
ATOM   921  C CG  . ARG A 1 118 ? 33.197  53.298 63.289  1.00 42.06 ? 152 ARG A CG  1 
ATOM   922  C CD  . ARG A 1 118 ? 33.207  51.980 64.082  1.00 47.64 ? 152 ARG A CD  1 
ATOM   923  N NE  . ARG A 1 118 ? 33.140  52.151 65.550  1.00 51.61 ? 152 ARG A NE  1 
ATOM   924  C CZ  . ARG A 1 118 ? 34.167  52.477 66.350  1.00 53.07 ? 152 ARG A CZ  1 
ATOM   925  N NH1 . ARG A 1 118 ? 33.971  52.595 67.665  1.00 53.00 ? 152 ARG A NH1 1 
ATOM   926  N NH2 . ARG A 1 118 ? 35.385  52.695 65.850  1.00 53.30 ? 152 ARG A NH2 1 
ATOM   927  N N   . ASP A 1 119 ? 29.614  53.426 65.281  1.00 39.17 ? 153 ASP A N   1 
ATOM   928  C CA  . ASP A 1 119 ? 28.884  52.381 65.986  1.00 38.84 ? 153 ASP A CA  1 
ATOM   929  C C   . ASP A 1 119 ? 27.471  52.234 65.446  1.00 38.24 ? 153 ASP A C   1 
ATOM   930  O O   . ASP A 1 119 ? 27.026  51.130 65.146  1.00 38.57 ? 153 ASP A O   1 
ATOM   931  C CB  . ASP A 1 119 ? 28.857  52.679 67.488  1.00 39.30 ? 153 ASP A CB  1 
ATOM   932  C CG  . ASP A 1 119 ? 30.168  52.305 68.201  1.00 40.86 ? 153 ASP A CG  1 
ATOM   933  O OD1 . ASP A 1 119 ? 31.053  51.660 67.577  1.00 42.71 ? 153 ASP A OD1 1 
ATOM   934  O OD2 . ASP A 1 119 ? 30.307  52.651 69.401  1.00 41.35 ? 153 ASP A OD2 1 
ATOM   935  N N   . VAL A 1 120 ? 26.773  53.356 65.318  1.00 37.47 ? 154 VAL A N   1 
ATOM   936  C CA  . VAL A 1 120 ? 25.435  53.403 64.720  1.00 36.34 ? 154 VAL A CA  1 
ATOM   937  C C   . VAL A 1 120 ? 25.409  52.868 63.293  1.00 35.70 ? 154 VAL A C   1 
ATOM   938  O O   . VAL A 1 120 ? 24.519  52.105 62.938  1.00 35.94 ? 154 VAL A O   1 
ATOM   939  C CB  . VAL A 1 120 ? 24.870  54.840 64.717  1.00 36.32 ? 154 VAL A CB  1 
ATOM   940  C CG1 . VAL A 1 120 ? 23.559  54.896 63.961  1.00 36.31 ? 154 VAL A CG1 1 
ATOM   941  C CG2 . VAL A 1 120 ? 24.681  55.344 66.140  1.00 35.82 ? 154 VAL A CG2 1 
ATOM   942  N N   . ALA A 1 121 ? 26.376  53.273 62.475  1.00 34.97 ? 155 ALA A N   1 
ATOM   943  C CA  . ALA A 1 121 ? 26.456  52.802 61.093  1.00 33.99 ? 155 ALA A CA  1 
ATOM   944  C C   . ALA A 1 121 ? 26.708  51.299 61.043  1.00 33.65 ? 155 ALA A C   1 
ATOM   945  O O   . ALA A 1 121 ? 26.159  50.604 60.194  1.00 33.92 ? 155 ALA A O   1 
ATOM   946  C CB  . ALA A 1 121 ? 27.523  53.548 60.343  1.00 33.92 ? 155 ALA A CB  1 
ATOM   947  N N   . ALA A 1 122 ? 27.516  50.791 61.966  1.00 32.98 ? 156 ALA A N   1 
ATOM   948  C CA  . ALA A 1 122 ? 27.768  49.366 62.031  1.00 32.47 ? 156 ALA A CA  1 
ATOM   949  C C   . ALA A 1 122 ? 26.479  48.609 62.338  1.00 32.42 ? 156 ALA A C   1 
ATOM   950  O O   . ALA A 1 122 ? 26.279  47.486 61.864  1.00 32.77 ? 156 ALA A O   1 
ATOM   951  C CB  . ALA A 1 122 ? 28.820  49.072 63.066  1.00 32.44 ? 156 ALA A CB  1 
ATOM   952  N N   . ALA A 1 123 ? 25.608  49.227 63.134  1.00 32.00 ? 157 ALA A N   1 
ATOM   953  C CA  . ALA A 1 123 ? 24.300  48.653 63.444  1.00 31.43 ? 157 ALA A CA  1 
ATOM   954  C C   . ALA A 1 123 ? 23.433  48.701 62.202  1.00 31.04 ? 157 ALA A C   1 
ATOM   955  O O   . ALA A 1 123 ? 22.935  47.678 61.753  1.00 31.15 ? 157 ALA A O   1 
ATOM   956  C CB  . ALA A 1 123 ? 23.638  49.394 64.592  1.00 31.18 ? 157 ALA A CB  1 
ATOM   957  N N   . LEU A 1 124 ? 23.285  49.895 61.638  1.00 30.80 ? 158 LEU A N   1 
ATOM   958  C CA  . LEU A 1 124 ? 22.514  50.106 60.410  1.00 30.53 ? 158 LEU A CA  1 
ATOM   959  C C   . LEU A 1 124 ? 22.924  49.162 59.272  1.00 30.51 ? 158 LEU A C   1 
ATOM   960  O O   . LEU A 1 124 ? 22.074  48.567 58.607  1.00 30.27 ? 158 LEU A O   1 
ATOM   961  C CB  . LEU A 1 124 ? 22.607  51.573 59.968  1.00 30.16 ? 158 LEU A CB  1 
ATOM   962  C CG  . LEU A 1 124 ? 21.899  52.583 60.872  1.00 29.66 ? 158 LEU A CG  1 
ATOM   963  C CD1 . LEU A 1 124 ? 21.889  53.966 60.230  1.00 29.81 ? 158 LEU A CD1 1 
ATOM   964  C CD2 . LEU A 1 124 ? 20.478  52.128 61.181  1.00 28.84 ? 158 LEU A CD2 1 
ATOM   965  N N   . ASP A 1 125 ? 24.226  49.025 59.059  1.00 30.59 ? 159 ASP A N   1 
ATOM   966  C CA  . ASP A 1 125 ? 24.729  48.132 58.037  1.00 30.95 ? 159 ASP A CA  1 
ATOM   967  C C   . ASP A 1 125 ? 24.190  46.715 58.280  1.00 30.67 ? 159 ASP A C   1 
ATOM   968  O O   . ASP A 1 125 ? 23.677  46.067 57.364  1.00 30.66 ? 159 ASP A O   1 
ATOM   969  C CB  . ASP A 1 125 ? 26.258  48.153 58.030  1.00 31.30 ? 159 ASP A CB  1 
ATOM   970  C CG  . ASP A 1 125 ? 26.853  47.549 56.760  1.00 33.80 ? 159 ASP A CG  1 
ATOM   971  O OD1 . ASP A 1 125 ? 27.978  46.993 56.830  1.00 36.30 ? 159 ASP A OD1 1 
ATOM   972  O OD2 . ASP A 1 125 ? 26.211  47.633 55.684  1.00 36.95 ? 159 ASP A OD2 1 
ATOM   973  N N   . PHE A 1 126 ? 24.280  46.261 59.527  1.00 30.10 ? 160 PHE A N   1 
ATOM   974  C CA  . PHE A 1 126 ? 23.844  44.925 59.890  1.00 29.61 ? 160 PHE A CA  1 
ATOM   975  C C   . PHE A 1 126 ? 22.359  44.714 59.582  1.00 29.31 ? 160 PHE A C   1 
ATOM   976  O O   . PHE A 1 126 ? 21.987  43.719 58.965  1.00 29.57 ? 160 PHE A O   1 
ATOM   977  C CB  . PHE A 1 126 ? 24.155  44.649 61.368  1.00 29.61 ? 160 PHE A CB  1 
ATOM   978  C CG  . PHE A 1 126 ? 23.427  43.462 61.932  1.00 29.38 ? 160 PHE A CG  1 
ATOM   979  C CD1 . PHE A 1 126 ? 23.825  42.168 61.615  1.00 29.43 ? 160 PHE A CD1 1 
ATOM   980  C CD2 . PHE A 1 126 ? 22.338  43.637 62.770  1.00 29.24 ? 160 PHE A CD2 1 
ATOM   981  C CE1 . PHE A 1 126 ? 23.149  41.064 62.129  1.00 29.40 ? 160 PHE A CE1 1 
ATOM   982  C CE2 . PHE A 1 126 ? 21.658  42.542 63.284  1.00 29.69 ? 160 PHE A CE2 1 
ATOM   983  C CZ  . PHE A 1 126 ? 22.065  41.250 62.960  1.00 29.31 ? 160 PHE A CZ  1 
ATOM   984  N N   . LEU A 1 127 ? 21.525  45.652 60.014  1.00 28.84 ? 161 LEU A N   1 
ATOM   985  C CA  . LEU A 1 127 ? 20.089  45.597 59.779  1.00 28.38 ? 161 LEU A CA  1 
ATOM   986  C C   . LEU A 1 127 ? 19.779  45.606 58.298  1.00 28.73 ? 161 LEU A C   1 
ATOM   987  O O   . LEU A 1 127 ? 19.162  44.672 57.790  1.00 28.91 ? 161 LEU A O   1 
ATOM   988  C CB  . LEU A 1 127 ? 19.403  46.799 60.417  1.00 28.24 ? 161 LEU A CB  1 
ATOM   989  C CG  . LEU A 1 127 ? 19.558  47.026 61.910  1.00 27.15 ? 161 LEU A CG  1 
ATOM   990  C CD1 . LEU A 1 127 ? 19.017  48.393 62.214  1.00 26.40 ? 161 LEU A CD1 1 
ATOM   991  C CD2 . LEU A 1 127 ? 18.812  45.932 62.670  1.00 26.06 ? 161 LEU A CD2 1 
ATOM   992  N N   . HIS A 1 128 ? 20.216  46.662 57.611  1.00 28.79 ? 162 HIS A N   1 
ATOM   993  C CA  . HIS A 1 128 ? 19.940  46.829 56.184  1.00 28.87 ? 162 HIS A CA  1 
ATOM   994  C C   . HIS A 1 128 ? 20.314  45.604 55.363  1.00 29.16 ? 162 HIS A C   1 
ATOM   995  O O   . HIS A 1 128 ? 19.524  45.170 54.532  1.00 29.29 ? 162 HIS A O   1 
ATOM   996  C CB  . HIS A 1 128 ? 20.588  48.093 55.616  1.00 28.46 ? 162 HIS A CB  1 
ATOM   997  C CG  . HIS A 1 128 ? 20.119  49.354 56.271  1.00 28.68 ? 162 HIS A CG  1 
ATOM   998  N ND1 . HIS A 1 128 ? 20.733  50.570 56.068  1.00 28.30 ? 162 HIS A ND1 1 
ATOM   999  C CD2 . HIS A 1 128 ? 19.109  49.585 57.148  1.00 28.53 ? 162 HIS A CD2 1 
ATOM   1000 C CE1 . HIS A 1 128 ? 20.115  51.497 56.780  1.00 28.16 ? 162 HIS A CE1 1 
ATOM   1001 N NE2 . HIS A 1 128 ? 19.125  50.927 57.442  1.00 27.65 ? 162 HIS A NE2 1 
ATOM   1002 N N   . THR A 1 129 ? 21.495  45.039 55.610  1.00 29.44 ? 163 THR A N   1 
ATOM   1003 C CA  . THR A 1 129 ? 21.922  43.793 54.956  1.00 29.84 ? 163 THR A CA  1 
ATOM   1004 C C   . THR A 1 129 ? 20.941  42.632 55.203  1.00 29.94 ? 163 THR A C   1 
ATOM   1005 O O   . THR A 1 129 ? 20.782  41.751 54.355  1.00 29.85 ? 163 THR A O   1 
ATOM   1006 C CB  . THR A 1 129 ? 23.340  43.405 55.412  1.00 29.97 ? 163 THR A CB  1 
ATOM   1007 O OG1 . THR A 1 129 ? 24.238  44.481 55.119  1.00 30.86 ? 163 THR A OG1 1 
ATOM   1008 C CG2 . THR A 1 129 ? 23.836  42.156 54.712  1.00 30.50 ? 163 THR A CG2 1 
ATOM   1009 N N   . LYS A 1 130 ? 20.279  42.645 56.359  1.00 30.12 ? 164 LYS A N   1 
ATOM   1010 C CA  . LYS A 1 130 ? 19.253  41.661 56.671  1.00 30.28 ? 164 LYS A CA  1 
ATOM   1011 C C   . LYS A 1 130 ? 17.858  42.140 56.261  1.00 30.16 ? 164 LYS A C   1 
ATOM   1012 O O   . LYS A 1 130 ? 16.853  41.506 56.582  1.00 30.41 ? 164 LYS A O   1 
ATOM   1013 C CB  . LYS A 1 130 ? 19.289  41.330 58.155  1.00 30.42 ? 164 LYS A CB  1 
ATOM   1014 C CG  . LYS A 1 130 ? 20.360  40.335 58.522  1.00 32.39 ? 164 LYS A CG  1 
ATOM   1015 C CD  . LYS A 1 130 ? 20.312  39.994 60.007  1.00 35.61 ? 164 LYS A CD  1 
ATOM   1016 C CE  . LYS A 1 130 ? 20.737  38.543 60.250  1.00 37.56 ? 164 LYS A CE  1 
ATOM   1017 N NZ  . LYS A 1 130 ? 19.580  37.600 60.097  1.00 38.49 ? 164 LYS A NZ  1 
ATOM   1018 N N   . GLY A 1 131 ? 17.797  43.266 55.559  1.00 30.00 ? 165 GLY A N   1 
ATOM   1019 C CA  . GLY A 1 131 ? 16.536  43.773 55.020  1.00 29.66 ? 165 GLY A CA  1 
ATOM   1020 C C   . GLY A 1 131 ? 15.649  44.410 56.060  1.00 29.67 ? 165 GLY A C   1 
ATOM   1021 O O   . GLY A 1 131 ? 14.434  44.425 55.896  1.00 29.95 ? 165 GLY A O   1 
ATOM   1022 N N   . ILE A 1 132 ? 16.266  44.933 57.123  1.00 29.42 ? 166 ILE A N   1 
ATOM   1023 C CA  . ILE A 1 132 ? 15.585  45.593 58.236  1.00 29.20 ? 166 ILE A CA  1 
ATOM   1024 C C   . ILE A 1 132 ? 15.997  47.067 58.299  1.00 29.74 ? 166 ILE A C   1 
ATOM   1025 O O   . ILE A 1 132 ? 17.164  47.416 58.046  1.00 29.84 ? 166 ILE A O   1 
ATOM   1026 C CB  . ILE A 1 132 ? 15.967  44.941 59.591  1.00 29.14 ? 166 ILE A CB  1 
ATOM   1027 C CG1 . ILE A 1 132 ? 15.558  43.470 59.633  1.00 28.61 ? 166 ILE A CG1 1 
ATOM   1028 C CG2 . ILE A 1 132 ? 15.371  45.701 60.771  1.00 28.63 ? 166 ILE A CG2 1 
ATOM   1029 C CD1 . ILE A 1 132 ? 16.403  42.654 60.578  1.00 26.89 ? 166 ILE A CD1 1 
ATOM   1030 N N   . ALA A 1 133 ? 15.036  47.923 58.634  1.00 30.01 ? 167 ALA A N   1 
ATOM   1031 C CA  . ALA A 1 133 ? 15.292  49.331 58.892  1.00 30.35 ? 167 ALA A CA  1 
ATOM   1032 C C   . ALA A 1 133 ? 14.890  49.628 60.322  1.00 30.79 ? 167 ALA A C   1 
ATOM   1033 O O   . ALA A 1 133 ? 13.922  49.065 60.834  1.00 31.08 ? 167 ALA A O   1 
ATOM   1034 C CB  . ALA A 1 133 ? 14.501  50.187 57.939  1.00 30.16 ? 167 ALA A CB  1 
ATOM   1035 N N   . HIS A 1 134 ? 15.632  50.503 60.982  1.00 31.39 ? 168 HIS A N   1 
ATOM   1036 C CA  . HIS A 1 134 ? 15.304  50.848 62.358  1.00 31.92 ? 168 HIS A CA  1 
ATOM   1037 C C   . HIS A 1 134 ? 14.026  51.686 62.370  1.00 32.51 ? 168 HIS A C   1 
ATOM   1038 O O   . HIS A 1 134 ? 13.075  51.364 63.071  1.00 32.66 ? 168 HIS A O   1 
ATOM   1039 C CB  . HIS A 1 134 ? 16.468  51.571 63.028  1.00 31.77 ? 168 HIS A CB  1 
ATOM   1040 C CG  . HIS A 1 134 ? 16.159  52.053 64.408  1.00 32.56 ? 168 HIS A CG  1 
ATOM   1041 N ND1 . HIS A 1 134 ? 15.427  53.196 64.650  1.00 33.50 ? 168 HIS A ND1 1 
ATOM   1042 C CD2 . HIS A 1 134 ? 16.464  51.537 65.621  1.00 32.54 ? 168 HIS A CD2 1 
ATOM   1043 C CE1 . HIS A 1 134 ? 15.299  53.366 65.955  1.00 32.83 ? 168 HIS A CE1 1 
ATOM   1044 N NE2 . HIS A 1 134 ? 15.918  52.373 66.566  1.00 32.68 ? 168 HIS A NE2 1 
ATOM   1045 N N   . ARG A 1 135 ? 14.013  52.749 61.576  1.00 33.37 ? 169 ARG A N   1 
ATOM   1046 C CA  . ARG A 1 135 ? 12.807  53.538 61.298  1.00 34.36 ? 169 ARG A CA  1 
ATOM   1047 C C   . ARG A 1 135 ? 12.486  54.706 62.219  1.00 34.95 ? 169 ARG A C   1 
ATOM   1048 O O   . ARG A 1 135 ? 11.534  55.453 61.964  1.00 35.38 ? 169 ARG A O   1 
ATOM   1049 C CB  . ARG A 1 135 ? 11.584  52.651 61.067  1.00 34.15 ? 169 ARG A CB  1 
ATOM   1050 C CG  . ARG A 1 135 ? 11.420  52.419 59.594  1.00 36.16 ? 169 ARG A CG  1 
ATOM   1051 C CD  . ARG A 1 135 ? 10.611  51.212 59.267  1.00 38.99 ? 169 ARG A CD  1 
ATOM   1052 N NE  . ARG A 1 135 ? 9.218   51.466 58.898  1.00 41.18 ? 169 ARG A NE  1 
ATOM   1053 C CZ  . ARG A 1 135 ? 8.722   52.600 58.409  1.00 42.33 ? 169 ARG A CZ  1 
ATOM   1054 N NH1 . ARG A 1 135 ? 7.426   52.664 58.122  1.00 43.13 ? 169 ARG A NH1 1 
ATOM   1055 N NH2 . ARG A 1 135 ? 9.493   53.664 58.200  1.00 43.49 ? 169 ARG A NH2 1 
ATOM   1056 N N   . ASP A 1 136 ? 13.277  54.875 63.273  1.00 35.54 ? 170 ASP A N   1 
ATOM   1057 C CA  . ASP A 1 136 ? 13.139  56.030 64.156  1.00 35.96 ? 170 ASP A CA  1 
ATOM   1058 C C   . ASP A 1 136 ? 14.440  56.291 64.906  1.00 36.03 ? 170 ASP A C   1 
ATOM   1059 O O   . ASP A 1 136 ? 14.493  56.314 66.135  1.00 36.04 ? 170 ASP A O   1 
ATOM   1060 C CB  . ASP A 1 136 ? 11.957  55.869 65.120  1.00 36.01 ? 170 ASP A CB  1 
ATOM   1061 C CG  . ASP A 1 136 ? 11.529  57.191 65.727  1.00 37.28 ? 170 ASP A CG  1 
ATOM   1062 O OD1 . ASP A 1 136 ? 10.661  57.195 66.623  1.00 38.50 ? 170 ASP A OD1 1 
ATOM   1063 O OD2 . ASP A 1 136 ? 12.068  58.243 65.311  1.00 38.75 ? 170 ASP A OD2 1 
ATOM   1064 N N   . LEU A 1 137 ? 15.504  56.462 64.141  1.00 36.21 ? 171 LEU A N   1 
ATOM   1065 C CA  . LEU A 1 137 ? 16.800  56.747 64.703  1.00 36.33 ? 171 LEU A CA  1 
ATOM   1066 C C   . LEU A 1 137 ? 16.812  58.216 65.145  1.00 36.89 ? 171 LEU A C   1 
ATOM   1067 O O   . LEU A 1 137 ? 16.525  59.121 64.359  1.00 37.35 ? 171 LEU A O   1 
ATOM   1068 C CB  . LEU A 1 137 ? 17.874  56.440 63.662  1.00 36.03 ? 171 LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 137 ? 19.357  56.541 63.980  1.00 35.50 ? 171 LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 137 ? 19.701  55.824 65.266  1.00 35.57 ? 171 LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 137 ? 20.114  55.939 62.831  1.00 34.78 ? 171 LEU A CD2 1 
ATOM   1072 N N   . LYS A 1 138 ? 17.104  58.435 66.421  1.00 37.22 ? 172 LYS A N   1 
ATOM   1073 C CA  . LYS A 1 138 ? 17.122  59.762 67.030  1.00 37.35 ? 172 LYS A CA  1 
ATOM   1074 C C   . LYS A 1 138 ? 17.892  59.632 68.346  1.00 37.73 ? 172 LYS A C   1 
ATOM   1075 O O   . LYS A 1 138 ? 18.146  58.509 68.790  1.00 38.11 ? 172 LYS A O   1 
ATOM   1076 C CB  . LYS A 1 138 ? 15.693  60.270 67.268  1.00 37.40 ? 172 LYS A CB  1 
ATOM   1077 C CG  . LYS A 1 138 ? 14.785  59.327 68.035  1.00 37.06 ? 172 LYS A CG  1 
ATOM   1078 C CD  . LYS A 1 138 ? 13.463  59.975 68.342  1.00 37.35 ? 172 LYS A CD  1 
ATOM   1079 C CE  . LYS A 1 138 ? 12.437  58.915 68.640  1.00 39.22 ? 172 LYS A CE  1 
ATOM   1080 N NZ  . LYS A 1 138 ? 11.306  59.421 69.480  1.00 41.86 ? 172 LYS A NZ  1 
ATOM   1081 N N   . PRO A 1 139 ? 18.276  60.763 68.978  1.00 37.85 ? 173 PRO A N   1 
ATOM   1082 C CA  . PRO A 1 139 ? 19.112  60.674 70.182  1.00 37.94 ? 173 PRO A CA  1 
ATOM   1083 C C   . PRO A 1 139 ? 18.547  59.807 71.318  1.00 38.23 ? 173 PRO A C   1 
ATOM   1084 O O   . PRO A 1 139 ? 19.311  59.217 72.081  1.00 38.44 ? 173 PRO A O   1 
ATOM   1085 C CB  . PRO A 1 139 ? 19.220  62.132 70.624  1.00 38.06 ? 173 PRO A CB  1 
ATOM   1086 C CG  . PRO A 1 139 ? 19.034  62.915 69.376  1.00 37.65 ? 173 PRO A CG  1 
ATOM   1087 C CD  . PRO A 1 139 ? 17.990  62.166 68.626  1.00 37.71 ? 173 PRO A CD  1 
ATOM   1088 N N   . GLU A 1 140 ? 17.225  59.724 71.417  1.00 38.58 ? 174 GLU A N   1 
ATOM   1089 C CA  . GLU A 1 140 ? 16.563  58.953 72.472  1.00 39.07 ? 174 GLU A CA  1 
ATOM   1090 C C   . GLU A 1 140 ? 16.689  57.460 72.254  1.00 38.94 ? 174 GLU A C   1 
ATOM   1091 O O   . GLU A 1 140 ? 16.453  56.678 73.174  1.00 39.28 ? 174 GLU A O   1 
ATOM   1092 C CB  . GLU A 1 140 ? 15.080  59.320 72.567  1.00 39.22 ? 174 GLU A CB  1 
ATOM   1093 C CG  . GLU A 1 140 ? 14.824  60.787 72.878  1.00 41.03 ? 174 GLU A CG  1 
ATOM   1094 C CD  . GLU A 1 140 ? 14.753  61.668 71.629  1.00 43.32 ? 174 GLU A CD  1 
ATOM   1095 O OE1 . GLU A 1 140 ? 13.659  62.206 71.369  1.00 45.60 ? 174 GLU A OE1 1 
ATOM   1096 O OE2 . GLU A 1 140 ? 15.768  61.831 70.907  1.00 43.29 ? 174 GLU A OE2 1 
ATOM   1097 N N   . ASN A 1 141 ? 17.061  57.075 71.039  1.00 38.77 ? 175 ASN A N   1 
ATOM   1098 C CA  . ASN A 1 141 ? 17.130  55.681 70.662  1.00 39.07 ? 175 ASN A CA  1 
ATOM   1099 C C   . ASN A 1 141 ? 18.564  55.213 70.419  1.00 39.78 ? 175 ASN A C   1 
ATOM   1100 O O   . ASN A 1 141 ? 18.800  54.206 69.757  1.00 39.96 ? 175 ASN A O   1 
ATOM   1101 C CB  . ASN A 1 141 ? 16.222  55.417 69.455  1.00 38.71 ? 175 ASN A CB  1 
ATOM   1102 C CG  . ASN A 1 141 ? 14.745  55.382 69.827  1.00 38.03 ? 175 ASN A CG  1 
ATOM   1103 O OD1 . ASN A 1 141 ? 14.382  55.132 70.977  1.00 39.34 ? 175 ASN A OD1 1 
ATOM   1104 N ND2 . ASN A 1 141 ? 13.888  55.627 68.855  1.00 36.31 ? 175 ASN A ND2 1 
ATOM   1105 N N   . ILE A 1 142 ? 19.515  55.964 70.963  1.00 40.78 ? 176 ILE A N   1 
ATOM   1106 C CA  . ILE A 1 142 ? 20.928  55.584 70.983  1.00 41.52 ? 176 ILE A CA  1 
ATOM   1107 C C   . ILE A 1 142 ? 21.412  55.704 72.420  1.00 42.57 ? 176 ILE A C   1 
ATOM   1108 O O   . ILE A 1 142 ? 21.342  56.780 73.015  1.00 42.51 ? 176 ILE A O   1 
ATOM   1109 C CB  . ILE A 1 142 ? 21.797  56.503 70.093  1.00 41.31 ? 176 ILE A CB  1 
ATOM   1110 C CG1 . ILE A 1 142 ? 21.207  56.622 68.692  1.00 40.45 ? 176 ILE A CG1 1 
ATOM   1111 C CG2 . ILE A 1 142 ? 23.230  55.994 70.025  1.00 41.04 ? 176 ILE A CG2 1 
ATOM   1112 C CD1 . ILE A 1 142 ? 21.882  57.654 67.848  1.00 40.07 ? 176 ILE A CD1 1 
ATOM   1113 N N   . LEU A 1 143 ? 21.910  54.601 72.967  1.00 43.92 ? 177 LEU A N   1 
ATOM   1114 C CA  . LEU A 1 143 ? 22.308  54.542 74.369  1.00 45.37 ? 177 LEU A CA  1 
ATOM   1115 C C   . LEU A 1 143 ? 23.815  54.353 74.530  1.00 46.70 ? 177 LEU A C   1 
ATOM   1116 O O   . LEU A 1 143 ? 24.438  53.665 73.733  1.00 46.77 ? 177 LEU A O   1 
ATOM   1117 C CB  . LEU A 1 143 ? 21.560  53.407 75.068  1.00 45.16 ? 177 LEU A CB  1 
ATOM   1118 C CG  . LEU A 1 143 ? 20.065  53.243 74.777  1.00 44.87 ? 177 LEU A CG  1 
ATOM   1119 C CD1 . LEU A 1 143 ? 19.550  51.973 75.427  1.00 44.00 ? 177 LEU A CD1 1 
ATOM   1120 C CD2 . LEU A 1 143 ? 19.241  54.462 75.215  1.00 44.54 ? 177 LEU A CD2 1 
ATOM   1121 N N   . CYS A 1 144 ? 24.395  54.968 75.559  1.00 48.61 ? 178 CYS A N   1 
ATOM   1122 C CA  . CYS A 1 144 ? 25.837  54.868 75.813  1.00 50.63 ? 178 CYS A CA  1 
ATOM   1123 C C   . CYS A 1 144 ? 26.143  53.742 76.789  1.00 52.04 ? 178 CYS A C   1 
ATOM   1124 O O   . CYS A 1 144 ? 25.360  53.479 77.710  1.00 52.24 ? 178 CYS A O   1 
ATOM   1125 C CB  . CYS A 1 144 ? 26.392  56.176 76.374  1.00 50.57 ? 178 CYS A CB  1 
ATOM   1126 S SG  . CYS A 1 144 ? 25.881  57.659 75.492  1.00 51.35 ? 178 CYS A SG  1 
ATOM   1127 N N   . GLU A 1 145 ? 27.288  53.089 76.585  1.00 53.79 ? 179 GLU A N   1 
ATOM   1128 C CA  . GLU A 1 145 ? 27.732  51.975 77.432  1.00 55.44 ? 179 GLU A CA  1 
ATOM   1129 C C   . GLU A 1 145 ? 27.974  52.424 78.885  1.00 56.06 ? 179 GLU A C   1 
ATOM   1130 O O   . GLU A 1 145 ? 27.537  51.746 79.818  1.00 56.31 ? 179 GLU A O   1 
ATOM   1131 C CB  . GLU A 1 145 ? 28.986  51.315 76.834  1.00 55.72 ? 179 GLU A CB  1 
ATOM   1132 C CG  . GLU A 1 145 ? 29.364  49.955 77.425  1.00 57.60 ? 179 GLU A CG  1 
ATOM   1133 C CD  . GLU A 1 145 ? 30.876  49.810 77.697  1.00 60.33 ? 179 GLU A CD  1 
ATOM   1134 O OE1 . GLU A 1 145 ? 31.305  48.703 78.106  1.00 61.20 ? 179 GLU A OE1 1 
ATOM   1135 O OE2 . GLU A 1 145 ? 31.638  50.797 77.520  1.00 61.17 ? 179 GLU A OE2 1 
ATOM   1136 N N   . SER A 1 146 ? 28.649  53.564 79.067  1.00 56.93 ? 180 SER A N   1 
ATOM   1137 C CA  . SER A 1 146 ? 28.931  54.104 80.407  1.00 57.75 ? 180 SER A CA  1 
ATOM   1138 C C   . SER A 1 146 ? 28.630  55.609 80.525  1.00 58.28 ? 180 SER A C   1 
ATOM   1139 O O   . SER A 1 146 ? 28.495  56.298 79.508  1.00 58.29 ? 180 SER A O   1 
ATOM   1140 C CB  . SER A 1 146 ? 30.375  53.784 80.835  1.00 57.75 ? 180 SER A CB  1 
ATOM   1141 O OG  . SER A 1 146 ? 31.298  54.749 80.364  1.00 58.27 ? 180 SER A OG  1 
ATOM   1142 N N   . PRO A 1 147 ? 28.513  56.123 81.770  1.00 58.92 ? 181 PRO A N   1 
ATOM   1143 C CA  . PRO A 1 147 ? 28.209  57.547 81.958  1.00 59.41 ? 181 PRO A CA  1 
ATOM   1144 C C   . PRO A 1 147 ? 29.423  58.447 81.735  1.00 59.93 ? 181 PRO A C   1 
ATOM   1145 O O   . PRO A 1 147 ? 29.261  59.632 81.427  1.00 60.07 ? 181 PRO A O   1 
ATOM   1146 C CB  . PRO A 1 147 ? 27.752  57.634 83.424  1.00 59.35 ? 181 PRO A CB  1 
ATOM   1147 C CG  . PRO A 1 147 ? 27.775  56.222 83.964  1.00 59.27 ? 181 PRO A CG  1 
ATOM   1148 C CD  . PRO A 1 147 ? 28.649  55.423 83.061  1.00 58.97 ? 181 PRO A CD  1 
ATOM   1149 N N   . GLU A 1 148 ? 30.620  57.882 81.900  1.00 60.40 ? 182 GLU A N   1 
ATOM   1150 C CA  . GLU A 1 148 ? 31.875  58.609 81.693  1.00 60.82 ? 182 GLU A CA  1 
ATOM   1151 C C   . GLU A 1 148 ? 32.286  58.632 80.217  1.00 60.83 ? 182 GLU A C   1 
ATOM   1152 O O   . GLU A 1 148 ? 32.571  59.695 79.660  1.00 61.05 ? 182 GLU A O   1 
ATOM   1153 C CB  . GLU A 1 148 ? 32.994  58.031 82.569  1.00 60.98 ? 182 GLU A CB  1 
ATOM   1154 C CG  . GLU A 1 148 ? 33.091  56.503 82.580  1.00 62.14 ? 182 GLU A CG  1 
ATOM   1155 C CD  . GLU A 1 148 ? 33.492  55.946 83.948  1.00 64.29 ? 182 GLU A CD  1 
ATOM   1156 O OE1 . GLU A 1 148 ? 34.377  56.537 84.618  1.00 65.00 ? 182 GLU A OE1 1 
ATOM   1157 O OE2 . GLU A 1 148 ? 32.919  54.907 84.354  1.00 64.95 ? 182 GLU A OE2 1 
ATOM   1158 N N   . LYS A 1 149 ? 32.299  57.460 79.586  1.00 60.63 ? 183 LYS A N   1 
ATOM   1159 C CA  . LYS A 1 149 ? 32.672  57.350 78.180  1.00 60.12 ? 183 LYS A CA  1 
ATOM   1160 C C   . LYS A 1 149 ? 31.432  57.230 77.275  1.00 59.52 ? 183 LYS A C   1 
ATOM   1161 O O   . LYS A 1 149 ? 30.685  56.240 77.320  1.00 59.72 ? 183 LYS A O   1 
ATOM   1162 C CB  . LYS A 1 149 ? 33.682  56.200 77.969  1.00 60.27 ? 183 LYS A CB  1 
ATOM   1163 C CG  . LYS A 1 149 ? 34.664  56.354 76.782  1.00 60.93 ? 183 LYS A CG  1 
ATOM   1164 C CD  . LYS A 1 149 ? 35.245  57.777 76.605  1.00 61.88 ? 183 LYS A CD  1 
ATOM   1165 C CE  . LYS A 1 149 ? 34.478  58.579 75.527  1.00 62.12 ? 183 LYS A CE  1 
ATOM   1166 N NZ  . LYS A 1 149 ? 34.810  60.037 75.458  1.00 61.70 ? 183 LYS A NZ  1 
ATOM   1167 N N   . VAL A 1 150 ? 31.223  58.265 76.470  1.00 58.53 ? 184 VAL A N   1 
ATOM   1168 C CA  . VAL A 1 150 ? 30.178  58.301 75.446  1.00 57.60 ? 184 VAL A CA  1 
ATOM   1169 C C   . VAL A 1 150 ? 30.343  57.200 74.365  1.00 56.75 ? 184 VAL A C   1 
ATOM   1170 O O   . VAL A 1 150 ? 29.473  57.038 73.503  1.00 56.66 ? 184 VAL A O   1 
ATOM   1171 C CB  . VAL A 1 150 ? 30.152  59.724 74.783  1.00 57.77 ? 184 VAL A CB  1 
ATOM   1172 C CG1 . VAL A 1 150 ? 31.152  59.830 73.611  1.00 57.56 ? 184 VAL A CG1 1 
ATOM   1173 C CG2 . VAL A 1 150 ? 28.762  60.093 74.338  1.00 57.61 ? 184 VAL A CG2 1 
ATOM   1174 N N   . SER A 1 151 ? 31.433  56.428 74.467  1.00 55.56 ? 185 SER A N   1 
ATOM   1175 C CA  . SER A 1 151 ? 32.037  55.683 73.338  1.00 54.27 ? 185 SER A CA  1 
ATOM   1176 C C   . SER A 1 151 ? 31.206  54.570 72.699  1.00 52.56 ? 185 SER A C   1 
ATOM   1177 O O   . SER A 1 151 ? 30.656  54.785 71.607  1.00 52.81 ? 185 SER A O   1 
ATOM   1178 C CB  . SER A 1 151 ? 33.455  55.169 73.685  1.00 54.94 ? 185 SER A CB  1 
ATOM   1179 O OG  . SER A 1 151 ? 34.476  56.144 73.460  1.00 56.00 ? 185 SER A OG  1 
ATOM   1180 N N   . PRO A 1 152 ? 31.150  53.368 73.326  1.00 50.39 ? 186 PRO A N   1 
ATOM   1181 C CA  . PRO A 1 152 ? 30.393  52.293 72.679  1.00 48.84 ? 186 PRO A CA  1 
ATOM   1182 C C   . PRO A 1 152 ? 28.898  52.538 72.815  1.00 47.19 ? 186 PRO A C   1 
ATOM   1183 O O   . PRO A 1 152 ? 28.403  52.704 73.929  1.00 47.53 ? 186 PRO A O   1 
ATOM   1184 C CB  . PRO A 1 152 ? 30.818  51.037 73.456  1.00 48.61 ? 186 PRO A CB  1 
ATOM   1185 C CG  . PRO A 1 152 ? 31.998  51.459 74.249  1.00 49.26 ? 186 PRO A CG  1 
ATOM   1186 C CD  . PRO A 1 152 ? 31.756  52.892 74.572  1.00 50.01 ? 186 PRO A CD  1 
ATOM   1187 N N   . VAL A 1 153 ? 28.190  52.602 71.690  1.00 45.04 ? 187 VAL A N   1 
ATOM   1188 C CA  . VAL A 1 153 ? 26.740  52.834 71.721  1.00 42.82 ? 187 VAL A CA  1 
ATOM   1189 C C   . VAL A 1 153 ? 25.922  51.676 71.115  1.00 41.57 ? 187 VAL A C   1 
ATOM   1190 O O   . VAL A 1 153 ? 26.456  50.822 70.397  1.00 41.48 ? 187 VAL A O   1 
ATOM   1191 C CB  . VAL A 1 153 ? 26.326  54.229 71.124  1.00 42.84 ? 187 VAL A CB  1 
ATOM   1192 C CG1 . VAL A 1 153 ? 27.052  55.361 71.840  1.00 42.34 ? 187 VAL A CG1 1 
ATOM   1193 C CG2 . VAL A 1 153 ? 26.549  54.297 69.618  1.00 41.68 ? 187 VAL A CG2 1 
ATOM   1194 N N   . LYS A 1 154 ? 24.633  51.657 71.432  1.00 39.66 ? 188 LYS A N   1 
ATOM   1195 C CA  . LYS A 1 154 ? 23.726  50.618 70.990  1.00 38.17 ? 188 LYS A CA  1 
ATOM   1196 C C   . LYS A 1 154 ? 22.391  51.257 70.657  1.00 37.61 ? 188 LYS A C   1 
ATOM   1197 O O   . LYS A 1 154 ? 21.818  51.961 71.485  1.00 37.65 ? 188 LYS A O   1 
ATOM   1198 C CB  . LYS A 1 154 ? 23.535  49.568 72.091  1.00 37.95 ? 188 LYS A CB  1 
ATOM   1199 C CG  . LYS A 1 154 ? 24.705  48.617 72.279  1.00 36.72 ? 188 LYS A CG  1 
ATOM   1200 C CD  . LYS A 1 154 ? 24.670  47.950 73.635  1.00 34.74 ? 188 LYS A CD  1 
ATOM   1201 C CE  . LYS A 1 154 ? 25.528  46.688 73.672  1.00 34.49 ? 188 LYS A CE  1 
ATOM   1202 N NZ  . LYS A 1 154 ? 24.825  45.517 73.057  1.00 33.97 ? 188 LYS A NZ  1 
ATOM   1203 N N   . ILE A 1 155 ? 21.898  51.024 69.442  1.00 36.82 ? 189 ILE A N   1 
ATOM   1204 C CA  . ILE A 1 155 ? 20.577  51.528 69.057  1.00 35.72 ? 189 ILE A CA  1 
ATOM   1205 C C   . ILE A 1 155 ? 19.490  50.668 69.694  1.00 35.32 ? 189 ILE A C   1 
ATOM   1206 O O   . ILE A 1 155 ? 19.692  49.484 69.944  1.00 35.39 ? 189 ILE A O   1 
ATOM   1207 C CB  . ILE A 1 155 ? 20.385  51.663 67.515  1.00 35.49 ? 189 ILE A CB  1 
ATOM   1208 C CG1 . ILE A 1 155 ? 20.633  50.345 66.795  1.00 35.05 ? 189 ILE A CG1 1 
ATOM   1209 C CG2 . ILE A 1 155 ? 21.298  52.732 66.937  1.00 34.99 ? 189 ILE A CG2 1 
ATOM   1210 C CD1 . ILE A 1 155 ? 20.275  50.401 65.343  1.00 34.43 ? 189 ILE A CD1 1 
ATOM   1211 N N   . CYS A 1 156 ? 18.354  51.281 69.983  1.00 34.79 ? 190 CYS A N   1 
ATOM   1212 C CA  . CYS A 1 156 ? 17.262  50.595 70.651  1.00 34.42 ? 190 CYS A CA  1 
ATOM   1213 C C   . CYS A 1 156 ? 15.952  51.175 70.155  1.00 34.17 ? 190 CYS A C   1 
ATOM   1214 O O   . CYS A 1 156 ? 15.953  52.074 69.320  1.00 34.27 ? 190 CYS A O   1 
ATOM   1215 C CB  . CYS A 1 156 ? 17.377  50.773 72.172  1.00 34.40 ? 190 CYS A CB  1 
ATOM   1216 S SG  . CYS A 1 156 ? 17.217  52.480 72.768  1.00 34.26 ? 190 CYS A SG  1 
ATOM   1217 N N   . ASP A 1 157 ? 14.838  50.658 70.658  1.00 33.68 ? 191 ASP A N   1 
ATOM   1218 C CA  . ASP A 1 157 ? 13.558  51.299 70.450  1.00 33.18 ? 191 ASP A CA  1 
ATOM   1219 C C   . ASP A 1 157 ? 13.049  51.656 71.818  1.00 33.24 ? 191 ASP A C   1 
ATOM   1220 O O   . ASP A 1 157 ? 12.498  50.799 72.512  1.00 33.52 ? 191 ASP A O   1 
ATOM   1221 C CB  . ASP A 1 157 ? 12.580  50.352 69.761  1.00 33.12 ? 191 ASP A CB  1 
ATOM   1222 C CG  . ASP A 1 157 ? 11.142  50.876 69.762  1.00 33.04 ? 191 ASP A CG  1 
ATOM   1223 O OD1 . ASP A 1 157 ? 10.921  52.076 70.035  1.00 32.59 ? 191 ASP A OD1 1 
ATOM   1224 O OD2 . ASP A 1 157 ? 10.218  50.084 69.487  1.00 32.25 ? 191 ASP A OD2 1 
ATOM   1225 N N   . PHE A 1 158 ? 13.247  52.908 72.224  1.00 32.98 ? 192 PHE A N   1 
ATOM   1226 C CA  . PHE A 1 158 ? 12.724  53.361 73.513  1.00 32.85 ? 192 PHE A CA  1 
ATOM   1227 C C   . PHE A 1 158 ? 11.535  54.304 73.346  1.00 33.35 ? 192 PHE A C   1 
ATOM   1228 O O   . PHE A 1 158 ? 11.343  55.248 74.131  1.00 33.51 ? 192 PHE A O   1 
ATOM   1229 C CB  . PHE A 1 158 ? 13.839  53.934 74.388  1.00 32.30 ? 192 PHE A CB  1 
ATOM   1230 C CG  . PHE A 1 158 ? 14.558  52.895 75.208  1.00 31.31 ? 192 PHE A CG  1 
ATOM   1231 C CD1 . PHE A 1 158 ? 15.557  53.266 76.097  1.00 30.86 ? 192 PHE A CD1 1 
ATOM   1232 C CD2 . PHE A 1 158 ? 14.217  51.542 75.113  1.00 30.65 ? 192 PHE A CD2 1 
ATOM   1233 C CE1 . PHE A 1 158 ? 16.222  52.302 76.867  1.00 31.36 ? 192 PHE A CE1 1 
ATOM   1234 C CE2 . PHE A 1 158 ? 14.876  50.565 75.874  1.00 30.33 ? 192 PHE A CE2 1 
ATOM   1235 C CZ  . PHE A 1 158 ? 15.882  50.945 76.753  1.00 30.97 ? 192 PHE A CZ  1 
ATOM   1236 N N   . ASP A 1 159 ? 10.734  54.006 72.319  1.00 33.73 ? 193 ASP A N   1 
ATOM   1237 C CA  . ASP A 1 159 ? 9.523   54.751 71.983  1.00 34.08 ? 193 ASP A CA  1 
ATOM   1238 C C   . ASP A 1 159 ? 8.355   54.297 72.840  1.00 34.14 ? 193 ASP A C   1 
ATOM   1239 O O   . ASP A 1 159 ? 7.980   53.120 72.827  1.00 33.60 ? 193 ASP A O   1 
ATOM   1240 C CB  . ASP A 1 159 ? 9.175   54.577 70.503  1.00 34.14 ? 193 ASP A CB  1 
ATOM   1241 C CG  . ASP A 1 159 ? 10.128  55.325 69.575  1.00 35.04 ? 193 ASP A CG  1 
ATOM   1242 O OD1 . ASP A 1 159 ? 11.056  56.024 70.062  1.00 35.48 ? 193 ASP A OD1 1 
ATOM   1243 O OD2 . ASP A 1 159 ? 9.937   55.210 68.341  1.00 35.66 ? 193 ASP A OD2 1 
ATOM   1244 N N   . LEU A 1 160 ? 7.776   55.252 73.562  1.00 34.55 ? 194 LEU A N   1 
ATOM   1245 C CA  . LEU A 1 160 ? 6.828   54.957 74.629  1.00 35.11 ? 194 LEU A CA  1 
ATOM   1246 C C   . LEU A 1 160 ? 5.462   55.614 74.434  1.00 35.85 ? 194 LEU A C   1 
ATOM   1247 O O   . LEU A 1 160 ? 4.489   55.217 75.079  1.00 36.04 ? 194 LEU A O   1 
ATOM   1248 C CB  . LEU A 1 160 ? 7.421   55.381 75.985  1.00 34.76 ? 194 LEU A CB  1 
ATOM   1249 C CG  . LEU A 1 160 ? 8.480   54.626 76.807  1.00 33.39 ? 194 LEU A CG  1 
ATOM   1250 C CD1 . LEU A 1 160 ? 9.220   53.520 76.078  1.00 32.19 ? 194 LEU A CD1 1 
ATOM   1251 C CD2 . LEU A 1 160 ? 9.471   55.620 77.386  1.00 32.02 ? 194 LEU A CD2 1 
ATOM   1252 N N   . GLY A 1 161 ? 5.385   56.616 73.564  1.00 36.81 ? 195 GLY A N   1 
ATOM   1253 C CA  . GLY A 1 161 ? 4.137   57.360 73.368  1.00 38.24 ? 195 GLY A CA  1 
ATOM   1254 C C   . GLY A 1 161 ? 4.235   58.832 73.732  1.00 39.24 ? 195 GLY A C   1 
ATOM   1255 O O   . GLY A 1 161 ? 5.144   59.241 74.463  1.00 39.41 ? 195 GLY A O   1 
ATOM   1256 N N   . SER A 1 162 ? 3.274   59.615 73.235  1.00 40.28 ? 196 SER A N   1 
ATOM   1257 C CA  . SER A 1 162 ? 3.311   61.097 73.236  1.00 41.07 ? 196 SER A CA  1 
ATOM   1258 C C   . SER A 1 162 ? 4.669   61.743 73.524  1.00 41.42 ? 196 SER A C   1 
ATOM   1259 O O   . SER A 1 162 ? 5.452   62.005 72.602  1.00 41.84 ? 196 SER A O   1 
ATOM   1260 C CB  . SER A 1 162 ? 2.244   61.681 74.157  1.00 41.22 ? 196 SER A CB  1 
ATOM   1261 O OG  . SER A 1 162 ? 1.193   62.244 73.396  1.00 41.96 ? 196 SER A OG  1 
ATOM   1262 N N   . ALA A 1 189 ? -5.866  58.587 71.322  1.00 33.74 ? 223 ALA A N   1 
ATOM   1263 C CA  . ALA A 1 189 ? -5.522  57.195 71.627  1.00 33.91 ? 223 ALA A CA  1 
ATOM   1264 C C   . ALA A 1 189 ? -4.122  56.850 71.107  1.00 33.85 ? 223 ALA A C   1 
ATOM   1265 O O   . ALA A 1 189 ? -3.805  57.146 69.947  1.00 34.04 ? 223 ALA A O   1 
ATOM   1266 C CB  . ALA A 1 189 ? -6.565  56.240 71.050  1.00 33.80 ? 223 ALA A CB  1 
ATOM   1267 N N   . PRO A 1 190 ? -3.279  56.223 71.958  1.00 33.46 ? 224 PRO A N   1 
ATOM   1268 C CA  . PRO A 1 190 ? -1.877  56.023 71.604  1.00 33.12 ? 224 PRO A CA  1 
ATOM   1269 C C   . PRO A 1 190 ? -1.689  54.814 70.698  1.00 32.87 ? 224 PRO A C   1 
ATOM   1270 O O   . PRO A 1 190 ? -2.452  53.855 70.775  1.00 33.10 ? 224 PRO A O   1 
ATOM   1271 C CB  . PRO A 1 190 ? -1.194  55.793 72.959  1.00 33.00 ? 224 PRO A CB  1 
ATOM   1272 C CG  . PRO A 1 190 ? -2.278  55.871 73.999  1.00 33.39 ? 224 PRO A CG  1 
ATOM   1273 C CD  . PRO A 1 190 ? -3.571  55.659 73.282  1.00 33.52 ? 224 PRO A CD  1 
ATOM   1274 N N   . GLU A 1 191 ? -0.664  54.866 69.857  1.00 32.33 ? 225 GLU A N   1 
ATOM   1275 C CA  . GLU A 1 191 ? -0.444  53.863 68.828  1.00 32.06 ? 225 GLU A CA  1 
ATOM   1276 C C   . GLU A 1 191 ? 1.017   53.438 68.890  1.00 31.06 ? 225 GLU A C   1 
ATOM   1277 O O   . GLU A 1 191 ? 1.893   54.289 69.018  1.00 30.96 ? 225 GLU A O   1 
ATOM   1278 C CB  . GLU A 1 191 ? -0.778  54.487 67.470  1.00 32.11 ? 225 GLU A CB  1 
ATOM   1279 C CG  . GLU A 1 191 ? -0.893  53.529 66.310  1.00 33.18 ? 225 GLU A CG  1 
ATOM   1280 C CD  . GLU A 1 191 ? -1.376  54.215 65.030  1.00 33.55 ? 225 GLU A CD  1 
ATOM   1281 O OE1 . GLU A 1 191 ? -2.617  54.358 64.862  1.00 35.83 ? 225 GLU A OE1 1 
ATOM   1282 O OE2 . GLU A 1 191 ? -0.516  54.590 64.190  1.00 34.24 ? 225 GLU A OE2 1 
ATOM   1283 N N   . VAL A 1 192 ? 1.280   52.135 68.823  1.00 30.14 ? 226 VAL A N   1 
ATOM   1284 C CA  . VAL A 1 192 ? 2.645   51.626 68.964  1.00 29.72 ? 226 VAL A CA  1 
ATOM   1285 C C   . VAL A 1 192 ? 3.483   52.002 67.735  1.00 29.86 ? 226 VAL A C   1 
ATOM   1286 O O   . VAL A 1 192 ? 3.047   51.789 66.609  1.00 29.98 ? 226 VAL A O   1 
ATOM   1287 C CB  . VAL A 1 192 ? 2.663   50.094 69.206  1.00 29.54 ? 226 VAL A CB  1 
ATOM   1288 C CG1 . VAL A 1 192 ? 4.086   49.555 69.258  1.00 28.86 ? 226 VAL A CG1 1 
ATOM   1289 C CG2 . VAL A 1 192 ? 1.947   49.752 70.496  1.00 29.78 ? 226 VAL A CG2 1 
ATOM   1290 N N   . VAL A 1 193 ? 4.666   52.582 67.952  1.00 29.79 ? 227 VAL A N   1 
ATOM   1291 C CA  . VAL A 1 193 ? 5.533   53.006 66.850  1.00 29.72 ? 227 VAL A CA  1 
ATOM   1292 C C   . VAL A 1 193 ? 6.233   51.789 66.252  1.00 30.15 ? 227 VAL A C   1 
ATOM   1293 O O   . VAL A 1 193 ? 6.721   50.931 66.990  1.00 30.43 ? 227 VAL A O   1 
ATOM   1294 C CB  . VAL A 1 193 ? 6.572   54.078 67.295  1.00 29.51 ? 227 VAL A CB  1 
ATOM   1295 C CG1 . VAL A 1 193 ? 7.529   54.433 66.176  1.00 28.95 ? 227 VAL A CG1 1 
ATOM   1296 C CG2 . VAL A 1 193 ? 5.875   55.326 67.741  1.00 29.57 ? 227 VAL A CG2 1 
ATOM   1297 N N   . GLU A 1 194 ? 6.250   51.711 64.919  1.00 30.27 ? 228 GLU A N   1 
ATOM   1298 C CA  . GLU A 1 194 ? 7.003   50.693 64.188  1.00 30.49 ? 228 GLU A CA  1 
ATOM   1299 C C   . GLU A 1 194 ? 8.486   51.020 64.146  1.00 30.13 ? 228 GLU A C   1 
ATOM   1300 O O   . GLU A 1 194 ? 8.898   52.020 63.565  1.00 30.33 ? 228 GLU A O   1 
ATOM   1301 C CB  . GLU A 1 194 ? 6.507   50.582 62.752  1.00 31.02 ? 228 GLU A CB  1 
ATOM   1302 C CG  . GLU A 1 194 ? 5.092   50.081 62.581  1.00 32.50 ? 228 GLU A CG  1 
ATOM   1303 C CD  . GLU A 1 194 ? 4.833   49.664 61.154  1.00 34.07 ? 228 GLU A CD  1 
ATOM   1304 O OE1 . GLU A 1 194 ? 4.578   50.560 60.317  1.00 34.62 ? 228 GLU A OE1 1 
ATOM   1305 O OE2 . GLU A 1 194 ? 4.895   48.441 60.876  1.00 35.33 ? 228 GLU A OE2 1 
ATOM   1306 N N   . VAL A 1 195 ? 9.284   50.159 64.754  1.00 29.86 ? 229 VAL A N   1 
ATOM   1307 C CA  . VAL A 1 195 ? 10.724  50.336 64.832  1.00 29.60 ? 229 VAL A CA  1 
ATOM   1308 C C   . VAL A 1 195 ? 11.289  48.931 64.623  1.00 29.80 ? 229 VAL A C   1 
ATOM   1309 O O   . VAL A 1 195 ? 10.623  47.950 64.955  1.00 29.67 ? 229 VAL A O   1 
ATOM   1310 C CB  . VAL A 1 195 ? 11.133  50.923 66.223  1.00 29.51 ? 229 VAL A CB  1 
ATOM   1311 C CG1 . VAL A 1 195 ? 12.588  51.313 66.262  1.00 29.45 ? 229 VAL A CG1 1 
ATOM   1312 C CG2 . VAL A 1 195 ? 10.280  52.125 66.585  1.00 28.55 ? 229 VAL A CG2 1 
ATOM   1313 N N   . PHE A 1 196 ? 12.490  48.821 64.060  1.00 30.19 ? 230 PHE A N   1 
ATOM   1314 C CA  . PHE A 1 196 ? 13.078  47.517 63.734  1.00 30.81 ? 230 PHE A CA  1 
ATOM   1315 C C   . PHE A 1 196 ? 12.113  46.701 62.866  1.00 31.66 ? 230 PHE A C   1 
ATOM   1316 O O   . PHE A 1 196 ? 11.590  45.664 63.294  1.00 31.60 ? 230 PHE A O   1 
ATOM   1317 C CB  . PHE A 1 196 ? 13.424  46.732 65.007  1.00 30.45 ? 230 PHE A CB  1 
ATOM   1318 C CG  . PHE A 1 196 ? 14.563  47.303 65.789  1.00 30.02 ? 230 PHE A CG  1 
ATOM   1319 C CD1 . PHE A 1 196 ? 14.338  47.952 66.990  1.00 30.75 ? 230 PHE A CD1 1 
ATOM   1320 C CD2 . PHE A 1 196 ? 15.866  47.179 65.335  1.00 29.65 ? 230 PHE A CD2 1 
ATOM   1321 C CE1 . PHE A 1 196 ? 15.394  48.484 67.722  1.00 30.61 ? 230 PHE A CE1 1 
ATOM   1322 C CE2 . PHE A 1 196 ? 16.928  47.707 66.058  1.00 29.13 ? 230 PHE A CE2 1 
ATOM   1323 C CZ  . PHE A 1 196 ? 16.694  48.356 67.248  1.00 30.27 ? 230 PHE A CZ  1 
ATOM   1324 N N   . THR A 1 197 ? 11.864  47.184 61.651  1.00 32.47 ? 231 THR A N   1 
ATOM   1325 C CA  . THR A 1 197 ? 10.863  46.572 60.796  1.00 33.31 ? 231 THR A CA  1 
ATOM   1326 C C   . THR A 1 197 ? 11.485  45.693 59.723  1.00 34.25 ? 231 THR A C   1 
ATOM   1327 O O   . THR A 1 197 ? 12.482  46.047 59.100  1.00 34.89 ? 231 THR A O   1 
ATOM   1328 C CB  . THR A 1 197 ? 9.985   47.615 60.100  1.00 33.25 ? 231 THR A CB  1 
ATOM   1329 O OG1 . THR A 1 197 ? 10.824  48.605 59.518  1.00 33.63 ? 231 THR A OG1 1 
ATOM   1330 C CG2 . THR A 1 197 ? 9.027   48.276 61.069  1.00 32.99 ? 231 THR A CG2 1 
ATOM   1331 N N   . ASP A 1 198 ? 10.865  44.545 59.501  1.00 35.05 ? 232 ASP A N   1 
ATOM   1332 C CA  . ASP A 1 198 ? 11.283  43.618 58.479  1.00 35.57 ? 232 ASP A CA  1 
ATOM   1333 C C   . ASP A 1 198 ? 10.799  44.106 57.115  1.00 35.22 ? 232 ASP A C   1 
ATOM   1334 O O   . ASP A 1 198 ? 9.952   45.004 57.040  1.00 35.46 ? 232 ASP A O   1 
ATOM   1335 C CB  . ASP A 1 198 ? 10.657  42.267 58.785  1.00 36.43 ? 232 ASP A CB  1 
ATOM   1336 C CG  . ASP A 1 198 ? 11.585  41.118 58.481  1.00 39.79 ? 232 ASP A CG  1 
ATOM   1337 O OD1 . ASP A 1 198 ? 12.769  41.387 58.137  1.00 43.07 ? 232 ASP A OD1 1 
ATOM   1338 O OD2 . ASP A 1 198 ? 11.127  39.948 58.587  1.00 42.81 ? 232 ASP A OD2 1 
ATOM   1339 N N   . GLN A 1 199 ? 11.334  43.517 56.043  1.00 34.37 ? 233 GLN A N   1 
ATOM   1340 C CA  . GLN A 1 199 ? 10.920  43.833 54.673  1.00 33.66 ? 233 GLN A CA  1 
ATOM   1341 C C   . GLN A 1 199 ? 11.029  45.305 54.287  1.00 32.91 ? 233 GLN A C   1 
ATOM   1342 O O   . GLN A 1 199 ? 10.203  45.814 53.521  1.00 32.82 ? 233 GLN A O   1 
ATOM   1343 C CB  . GLN A 1 199 ? 9.492   43.373 54.443  1.00 33.82 ? 233 GLN A CB  1 
ATOM   1344 C CG  . GLN A 1 199 ? 9.344   41.895 54.414  1.00 34.85 ? 233 GLN A CG  1 
ATOM   1345 C CD  . GLN A 1 199 ? 7.923   41.513 54.179  1.00 36.47 ? 233 GLN A CD  1 
ATOM   1346 O OE1 . GLN A 1 199 ? 7.026   41.933 54.919  1.00 37.48 ? 233 GLN A OE1 1 
ATOM   1347 N NE2 . GLN A 1 199 ? 7.690   40.719 53.137  1.00 36.99 ? 233 GLN A NE2 1 
ATOM   1348 N N   . ALA A 1 200 ? 12.050  45.978 54.807  1.00 31.95 ? 234 ALA A N   1 
ATOM   1349 C CA  . ALA A 1 200 ? 12.190  47.402 54.609  1.00 31.17 ? 234 ALA A CA  1 
ATOM   1350 C C   . ALA A 1 200 ? 12.499  47.667 53.161  1.00 30.98 ? 234 ALA A C   1 
ATOM   1351 O O   . ALA A 1 200 ? 13.302  46.965 52.538  1.00 30.94 ? 234 ALA A O   1 
ATOM   1352 C CB  . ALA A 1 200 ? 13.270  47.952 55.483  1.00 31.10 ? 234 ALA A CB  1 
ATOM   1353 N N   . THR A 1 201 ? 11.841  48.679 52.620  1.00 30.53 ? 235 THR A N   1 
ATOM   1354 C CA  . THR A 1 201 ? 12.108  49.081 51.268  1.00 30.09 ? 235 THR A CA  1 
ATOM   1355 C C   . THR A 1 201 ? 13.456  49.781 51.259  1.00 30.30 ? 235 THR A C   1 
ATOM   1356 O O   . THR A 1 201 ? 13.924  50.256 52.298  1.00 29.92 ? 235 THR A O   1 
ATOM   1357 C CB  . THR A 1 201 ? 11.005  49.987 50.735  1.00 29.80 ? 235 THR A CB  1 
ATOM   1358 O OG1 . THR A 1 201 ? 10.969  51.196 51.493  1.00 29.56 ? 235 THR A OG1 1 
ATOM   1359 C CG2 . THR A 1 201 ? 9.668   49.291 50.859  1.00 29.73 ? 235 THR A CG2 1 
ATOM   1360 N N   . PHE A 1 202 ? 14.090  49.818 50.089  1.00 30.67 ? 236 PHE A N   1 
ATOM   1361 C CA  . PHE A 1 202 ? 15.361  50.520 49.907  1.00 30.81 ? 236 PHE A CA  1 
ATOM   1362 C C   . PHE A 1 202 ? 15.261  51.954 50.448  1.00 31.14 ? 236 PHE A C   1 
ATOM   1363 O O   . PHE A 1 202 ? 16.164  52.457 51.117  1.00 30.98 ? 236 PHE A O   1 
ATOM   1364 C CB  . PHE A 1 202 ? 15.728  50.514 48.426  1.00 30.60 ? 236 PHE A CB  1 
ATOM   1365 C CG  . PHE A 1 202 ? 16.808  51.474 48.066  1.00 29.80 ? 236 PHE A CG  1 
ATOM   1366 C CD1 . PHE A 1 202 ? 16.499  52.779 47.696  1.00 29.94 ? 236 PHE A CD1 1 
ATOM   1367 C CD2 . PHE A 1 202 ? 18.130  51.077 48.081  1.00 28.79 ? 236 PHE A CD2 1 
ATOM   1368 C CE1 . PHE A 1 202 ? 17.500  53.688 47.359  1.00 30.12 ? 236 PHE A CE1 1 
ATOM   1369 C CE2 . PHE A 1 202 ? 19.138  51.969 47.745  1.00 29.41 ? 236 PHE A CE2 1 
ATOM   1370 C CZ  . PHE A 1 202 ? 18.823  53.283 47.384  1.00 29.77 ? 236 PHE A CZ  1 
ATOM   1371 N N   . TYR A 1 203 ? 14.137  52.593 50.155  1.00 31.67 ? 237 TYR A N   1 
ATOM   1372 C CA  . TYR A 1 203 ? 13.846  53.920 50.645  1.00 32.16 ? 237 TYR A CA  1 
ATOM   1373 C C   . TYR A 1 203 ? 13.837  54.001 52.167  1.00 32.67 ? 237 TYR A C   1 
ATOM   1374 O O   . TYR A 1 203 ? 14.394  54.940 52.740  1.00 33.49 ? 237 TYR A O   1 
ATOM   1375 C CB  . TYR A 1 203 ? 12.500  54.373 50.113  1.00 32.24 ? 237 TYR A CB  1 
ATOM   1376 C CG  . TYR A 1 203 ? 12.185  55.779 50.501  1.00 32.31 ? 237 TYR A CG  1 
ATOM   1377 C CD1 . TYR A 1 203 ? 11.296  56.058 51.537  1.00 32.52 ? 237 TYR A CD1 1 
ATOM   1378 C CD2 . TYR A 1 203 ? 12.791  56.836 49.848  1.00 32.43 ? 237 TYR A CD2 1 
ATOM   1379 C CE1 . TYR A 1 203 ? 11.012  57.365 51.897  1.00 32.50 ? 237 TYR A CE1 1 
ATOM   1380 C CE2 . TYR A 1 203 ? 12.519  58.142 50.198  1.00 33.22 ? 237 TYR A CE2 1 
ATOM   1381 C CZ  . TYR A 1 203 ? 11.630  58.404 51.217  1.00 32.95 ? 237 TYR A CZ  1 
ATOM   1382 O OH  . TYR A 1 203 ? 11.377  59.716 51.543  1.00 33.45 ? 237 TYR A OH  1 
ATOM   1383 N N   . ASP A 1 204 ? 13.190  53.040 52.823  1.00 32.84 ? 238 ASP A N   1 
ATOM   1384 C CA  . ASP A 1 204 ? 13.157  53.007 54.285  1.00 32.91 ? 238 ASP A CA  1 
ATOM   1385 C C   . ASP A 1 204 ? 14.552  52.853 54.867  1.00 32.83 ? 238 ASP A C   1 
ATOM   1386 O O   . ASP A 1 204 ? 14.912  53.568 55.792  1.00 33.34 ? 238 ASP A O   1 
ATOM   1387 C CB  . ASP A 1 204 ? 12.268  51.874 54.797  1.00 33.13 ? 238 ASP A CB  1 
ATOM   1388 C CG  . ASP A 1 204 ? 10.794  52.129 54.567  1.00 33.92 ? 238 ASP A CG  1 
ATOM   1389 O OD1 . ASP A 1 204 ? 10.012  51.145 54.640  1.00 35.12 ? 238 ASP A OD1 1 
ATOM   1390 O OD2 . ASP A 1 204 ? 10.421  53.300 54.313  1.00 34.24 ? 238 ASP A OD2 1 
ATOM   1391 N N   . LYS A 1 205 ? 15.337  51.922 54.334  1.00 32.74 ? 239 LYS A N   1 
ATOM   1392 C CA  . LYS A 1 205 ? 16.706  51.749 54.791  1.00 32.78 ? 239 LYS A CA  1 
ATOM   1393 C C   . LYS A 1 205 ? 17.480  53.061 54.702  1.00 33.33 ? 239 LYS A C   1 
ATOM   1394 O O   . LYS A 1 205 ? 18.252  53.379 55.600  1.00 33.76 ? 239 LYS A O   1 
ATOM   1395 C CB  . LYS A 1 205 ? 17.433  50.697 53.977  1.00 32.43 ? 239 LYS A CB  1 
ATOM   1396 C CG  . LYS A 1 205 ? 16.908  49.308 54.097  1.00 32.17 ? 239 LYS A CG  1 
ATOM   1397 C CD  . LYS A 1 205 ? 17.463  48.482 52.950  1.00 32.47 ? 239 LYS A CD  1 
ATOM   1398 C CE  . LYS A 1 205 ? 17.222  47.017 53.186  1.00 33.63 ? 239 LYS A CE  1 
ATOM   1399 N NZ  . LYS A 1 205 ? 17.528  46.208 51.988  1.00 34.21 ? 239 LYS A NZ  1 
ATOM   1400 N N   . ARG A 1 206 ? 17.271  53.821 53.629  1.00 33.84 ? 240 ARG A N   1 
ATOM   1401 C CA  . ARG A 1 206 ? 18.030  55.056 53.396  1.00 34.31 ? 240 ARG A CA  1 
ATOM   1402 C C   . ARG A 1 206 ? 17.628  56.208 54.317  1.00 35.07 ? 240 ARG A C   1 
ATOM   1403 O O   . ARG A 1 206 ? 18.413  57.141 54.523  1.00 35.31 ? 240 ARG A O   1 
ATOM   1404 C CB  . ARG A 1 206 ? 17.962  55.483 51.923  1.00 34.06 ? 240 ARG A CB  1 
ATOM   1405 C CG  . ARG A 1 206 ? 18.827  54.638 50.987  1.00 33.30 ? 240 ARG A CG  1 
ATOM   1406 C CD  . ARG A 1 206 ? 20.317  54.936 51.154  1.00 32.16 ? 240 ARG A CD  1 
ATOM   1407 N NE  . ARG A 1 206 ? 21.171  53.867 50.627  1.00 31.67 ? 240 ARG A NE  1 
ATOM   1408 C CZ  . ARG A 1 206 ? 21.704  53.859 49.403  1.00 30.83 ? 240 ARG A CZ  1 
ATOM   1409 N NH1 . ARG A 1 206 ? 22.466  52.846 49.011  1.00 29.06 ? 240 ARG A NH1 1 
ATOM   1410 N NH2 . ARG A 1 206 ? 21.483  54.865 48.564  1.00 30.73 ? 240 ARG A NH2 1 
ATOM   1411 N N   . CYS A 1 207 ? 16.418  56.144 54.873  1.00 35.72 ? 241 CYS A N   1 
ATOM   1412 C CA  . CYS A 1 207 ? 15.992  57.134 55.862  1.00 36.60 ? 241 CYS A CA  1 
ATOM   1413 C C   . CYS A 1 207 ? 16.723  57.038 57.181  1.00 35.81 ? 241 CYS A C   1 
ATOM   1414 O O   . CYS A 1 207 ? 16.881  58.044 57.862  1.00 36.73 ? 241 CYS A O   1 
ATOM   1415 C CB  . CYS A 1 207 ? 14.490  57.091 56.104  1.00 37.07 ? 241 CYS A CB  1 
ATOM   1416 S SG  . CYS A 1 207 ? 13.643  58.442 55.256  1.00 42.60 ? 241 CYS A SG  1 
ATOM   1417 N N   . ASP A 1 208 ? 17.158  55.838 57.555  1.00 34.79 ? 242 ASP A N   1 
ATOM   1418 C CA  . ASP A 1 208 ? 18.011  55.677 58.726  1.00 33.55 ? 242 ASP A CA  1 
ATOM   1419 C C   . ASP A 1 208 ? 19.272  56.522 58.559  1.00 33.34 ? 242 ASP A C   1 
ATOM   1420 O O   . ASP A 1 208 ? 19.753  57.121 59.518  1.00 33.46 ? 242 ASP A O   1 
ATOM   1421 C CB  . ASP A 1 208 ? 18.410  54.215 58.929  1.00 33.20 ? 242 ASP A CB  1 
ATOM   1422 C CG  . ASP A 1 208 ? 17.235  53.310 59.220  1.00 32.42 ? 242 ASP A CG  1 
ATOM   1423 O OD1 . ASP A 1 208 ? 17.346  52.110 58.918  1.00 32.49 ? 242 ASP A OD1 1 
ATOM   1424 O OD2 . ASP A 1 208 ? 16.210  53.770 59.755  1.00 31.66 ? 242 ASP A OD2 1 
ATOM   1425 N N   . LEU A 1 209 ? 19.803  56.573 57.338  1.00 33.00 ? 243 LEU A N   1 
ATOM   1426 C CA  . LEU A 1 209 ? 21.051  57.285 57.078  1.00 32.75 ? 243 LEU A CA  1 
ATOM   1427 C C   . LEU A 1 209 ? 20.859  58.795 57.097  1.00 32.99 ? 243 LEU A C   1 
ATOM   1428 O O   . LEU A 1 209 ? 21.699  59.522 57.617  1.00 32.82 ? 243 LEU A O   1 
ATOM   1429 C CB  . LEU A 1 209 ? 21.690  56.831 55.769  1.00 32.36 ? 243 LEU A CB  1 
ATOM   1430 C CG  . LEU A 1 209 ? 22.461  55.504 55.763  1.00 31.45 ? 243 LEU A CG  1 
ATOM   1431 C CD1 . LEU A 1 209 ? 23.478  55.425 56.876  1.00 27.95 ? 243 LEU A CD1 1 
ATOM   1432 C CD2 . LEU A 1 209 ? 21.520  54.305 55.791  1.00 30.58 ? 243 LEU A CD2 1 
ATOM   1433 N N   . TRP A 1 210 ? 19.746  59.257 56.542  1.00 33.39 ? 244 TRP A N   1 
ATOM   1434 C CA  . TRP A 1 210 ? 19.345  60.641 56.701  1.00 33.99 ? 244 TRP A CA  1 
ATOM   1435 C C   . TRP A 1 210 ? 19.243  61.022 58.183  1.00 34.18 ? 244 TRP A C   1 
ATOM   1436 O O   . TRP A 1 210 ? 19.834  62.025 58.612  1.00 34.47 ? 244 TRP A O   1 
ATOM   1437 C CB  . TRP A 1 210 ? 18.011  60.876 56.011  1.00 34.67 ? 244 TRP A CB  1 
ATOM   1438 C CG  . TRP A 1 210 ? 17.609  62.317 55.933  1.00 35.13 ? 244 TRP A CG  1 
ATOM   1439 C CD1 . TRP A 1 210 ? 18.014  63.234 55.005  1.00 35.92 ? 244 TRP A CD1 1 
ATOM   1440 C CD2 . TRP A 1 210 ? 16.709  62.998 56.805  1.00 35.57 ? 244 TRP A CD2 1 
ATOM   1441 N NE1 . TRP A 1 210 ? 17.422  64.448 55.244  1.00 36.30 ? 244 TRP A NE1 1 
ATOM   1442 C CE2 . TRP A 1 210 ? 16.612  64.335 56.343  1.00 35.79 ? 244 TRP A CE2 1 
ATOM   1443 C CE3 . TRP A 1 210 ? 15.969  62.609 57.936  1.00 36.12 ? 244 TRP A CE3 1 
ATOM   1444 C CZ2 . TRP A 1 210 ? 15.804  65.296 56.971  1.00 35.84 ? 244 TRP A CZ2 1 
ATOM   1445 C CZ3 . TRP A 1 210 ? 15.158  63.562 58.566  1.00 36.38 ? 244 TRP A CZ3 1 
ATOM   1446 C CH2 . TRP A 1 210 ? 15.089  64.898 58.080  1.00 36.25 ? 244 TRP A CH2 1 
ATOM   1447 N N   . SER A 1 211 ? 18.509  60.220 58.964  1.00 33.97 ? 245 SER A N   1 
ATOM   1448 C CA  . SER A 1 211 ? 18.388  60.444 60.408  1.00 33.74 ? 245 SER A CA  1 
ATOM   1449 C C   . SER A 1 211 ? 19.746  60.437 61.087  1.00 33.78 ? 245 SER A C   1 
ATOM   1450 O O   . SER A 1 211 ? 19.971  61.207 62.019  1.00 34.26 ? 245 SER A O   1 
ATOM   1451 C CB  . SER A 1 211 ? 17.492  59.404 61.054  1.00 33.50 ? 245 SER A CB  1 
ATOM   1452 O OG  . SER A 1 211 ? 16.250  59.335 60.382  1.00 34.19 ? 245 SER A OG  1 
ATOM   1453 N N   . LEU A 1 212 ? 20.650  59.573 60.623  1.00 33.45 ? 246 LEU A N   1 
ATOM   1454 C CA  . LEU A 1 212 ? 22.006  59.535 61.156  1.00 33.31 ? 246 LEU A CA  1 
ATOM   1455 C C   . LEU A 1 212 ? 22.707  60.861 60.907  1.00 33.47 ? 246 LEU A C   1 
ATOM   1456 O O   . LEU A 1 212 ? 23.417  61.352 61.778  1.00 33.79 ? 246 LEU A O   1 
ATOM   1457 C CB  . LEU A 1 212 ? 22.811  58.366 60.571  1.00 33.42 ? 246 LEU A CB  1 
ATOM   1458 C CG  . LEU A 1 212 ? 24.296  58.177 60.937  1.00 32.98 ? 246 LEU A CG  1 
ATOM   1459 C CD1 . LEU A 1 212 ? 24.561  58.310 62.420  1.00 31.78 ? 246 LEU A CD1 1 
ATOM   1460 C CD2 . LEU A 1 212 ? 24.786  56.837 60.446  1.00 32.87 ? 246 LEU A CD2 1 
ATOM   1461 N N   . GLY A 1 213 ? 22.499  61.437 59.725  1.00 33.56 ? 247 GLY A N   1 
ATOM   1462 C CA  . GLY A 1 213 ? 23.018  62.768 59.399  1.00 33.52 ? 247 GLY A CA  1 
ATOM   1463 C C   . GLY A 1 213 ? 22.473  63.795 60.374  1.00 33.69 ? 247 GLY A C   1 
ATOM   1464 O O   . GLY A 1 213 ? 23.230  64.607 60.910  1.00 33.80 ? 247 GLY A O   1 
ATOM   1465 N N   . VAL A 1 214 ? 21.164  63.731 60.628  1.00 33.53 ? 248 VAL A N   1 
ATOM   1466 C CA  . VAL A 1 214 ? 20.503  64.629 61.577  1.00 33.48 ? 248 VAL A CA  1 
ATOM   1467 C C   . VAL A 1 214 ? 21.052  64.495 62.999  1.00 33.71 ? 248 VAL A C   1 
ATOM   1468 O O   . VAL A 1 214 ? 21.250  65.500 63.680  1.00 33.67 ? 248 VAL A O   1 
ATOM   1469 C CB  . VAL A 1 214 ? 18.978  64.420 61.600  1.00 33.36 ? 248 VAL A CB  1 
ATOM   1470 C CG1 . VAL A 1 214 ? 18.322  65.377 62.584  1.00 32.89 ? 248 VAL A CG1 1 
ATOM   1471 C CG2 . VAL A 1 214 ? 18.396  64.604 60.206  1.00 33.32 ? 248 VAL A CG2 1 
ATOM   1472 N N   . VAL A 1 215 ? 21.293  63.257 63.439  1.00 34.03 ? 249 VAL A N   1 
ATOM   1473 C CA  . VAL A 1 215 ? 21.867  62.998 64.767  1.00 34.10 ? 249 VAL A CA  1 
ATOM   1474 C C   . VAL A 1 215 ? 23.258  63.592 64.837  1.00 34.28 ? 249 VAL A C   1 
ATOM   1475 O O   . VAL A 1 215 ? 23.573  64.301 65.783  1.00 34.75 ? 249 VAL A O   1 
ATOM   1476 C CB  . VAL A 1 215 ? 21.942  61.498 65.100  1.00 33.92 ? 249 VAL A CB  1 
ATOM   1477 C CG1 . VAL A 1 215 ? 22.760  61.265 66.351  1.00 33.86 ? 249 VAL A CG1 1 
ATOM   1478 C CG2 . VAL A 1 215 ? 20.557  60.933 65.283  1.00 34.54 ? 249 VAL A CG2 1 
ATOM   1479 N N   . LEU A 1 216 ? 24.073  63.323 63.820  1.00 34.29 ? 250 LEU A N   1 
ATOM   1480 C CA  . LEU A 1 216 ? 25.448  63.798 63.789  1.00 34.43 ? 250 LEU A CA  1 
ATOM   1481 C C   . LEU A 1 216 ? 25.505  65.322 63.804  1.00 34.51 ? 250 LEU A C   1 
ATOM   1482 O O   . LEU A 1 216 ? 26.409  65.902 64.411  1.00 34.51 ? 250 LEU A O   1 
ATOM   1483 C CB  . LEU A 1 216 ? 26.187  63.231 62.579  1.00 34.24 ? 250 LEU A CB  1 
ATOM   1484 C CG  . LEU A 1 216 ? 27.585  63.772 62.252  1.00 34.92 ? 250 LEU A CG  1 
ATOM   1485 C CD1 . LEU A 1 216 ? 28.557  63.647 63.432  1.00 34.23 ? 250 LEU A CD1 1 
ATOM   1486 C CD2 . LEU A 1 216 ? 28.145  63.102 60.987  1.00 34.64 ? 250 LEU A CD2 1 
ATOM   1487 N N   . TYR A 1 217 ? 24.531  65.959 63.155  1.00 34.57 ? 251 TYR A N   1 
ATOM   1488 C CA  . TYR A 1 217 ? 24.446  67.417 63.114  1.00 34.66 ? 251 TYR A CA  1 
ATOM   1489 C C   . TYR A 1 217 ? 24.201  68.008 64.495  1.00 35.09 ? 251 TYR A C   1 
ATOM   1490 O O   . TYR A 1 217 ? 24.823  69.006 64.867  1.00 35.28 ? 251 TYR A O   1 
ATOM   1491 C CB  . TYR A 1 217 ? 23.334  67.854 62.177  1.00 34.40 ? 251 TYR A CB  1 
ATOM   1492 C CG  . TYR A 1 217 ? 23.329  69.337 61.901  1.00 34.66 ? 251 TYR A CG  1 
ATOM   1493 C CD1 . TYR A 1 217 ? 22.853  70.238 62.847  1.00 34.47 ? 251 TYR A CD1 1 
ATOM   1494 C CD2 . TYR A 1 217 ? 23.799  69.844 60.693  1.00 33.69 ? 251 TYR A CD2 1 
ATOM   1495 C CE1 . TYR A 1 217 ? 22.843  71.592 62.600  1.00 33.77 ? 251 TYR A CE1 1 
ATOM   1496 C CE2 . TYR A 1 217 ? 23.788  71.204 60.443  1.00 32.93 ? 251 TYR A CE2 1 
ATOM   1497 C CZ  . TYR A 1 217 ? 23.307  72.067 61.401  1.00 33.38 ? 251 TYR A CZ  1 
ATOM   1498 O OH  . TYR A 1 217 ? 23.286  73.423 61.173  1.00 34.90 ? 251 TYR A OH  1 
ATOM   1499 N N   . ILE A 1 218 ? 23.281  67.385 65.233  1.00 35.47 ? 252 ILE A N   1 
ATOM   1500 C CA  . ILE A 1 218 ? 22.931  67.759 66.604  1.00 35.58 ? 252 ILE A CA  1 
ATOM   1501 C C   . ILE A 1 218 ? 24.112  67.502 67.516  1.00 36.15 ? 252 ILE A C   1 
ATOM   1502 O O   . ILE A 1 218 ? 24.508  68.352 68.312  1.00 36.47 ? 252 ILE A O   1 
ATOM   1503 C CB  . ILE A 1 218 ? 21.746  66.930 67.095  1.00 35.25 ? 252 ILE A CB  1 
ATOM   1504 C CG1 . ILE A 1 218 ? 20.479  67.351 66.358  1.00 35.04 ? 252 ILE A CG1 1 
ATOM   1505 C CG2 . ILE A 1 218 ? 21.562  67.103 68.578  1.00 35.13 ? 252 ILE A CG2 1 
ATOM   1506 C CD1 . ILE A 1 218 ? 19.442  66.262 66.221  1.00 34.74 ? 252 ILE A CD1 1 
ATOM   1507 N N   . MET A 1 219 ? 24.670  66.311 67.381  1.00 36.71 ? 253 MET A N   1 
ATOM   1508 C CA  . MET A 1 219 ? 25.880  65.914 68.065  1.00 37.26 ? 253 MET A CA  1 
ATOM   1509 C C   . MET A 1 219 ? 26.986  66.961 67.944  1.00 37.48 ? 253 MET A C   1 
ATOM   1510 O O   . MET A 1 219 ? 27.641  67.273 68.922  1.00 37.86 ? 253 MET A O   1 
ATOM   1511 C CB  . MET A 1 219 ? 26.348  64.599 67.472  1.00 37.10 ? 253 MET A CB  1 
ATOM   1512 C CG  . MET A 1 219 ? 26.860  63.628 68.471  1.00 37.43 ? 253 MET A CG  1 
ATOM   1513 S SD  . MET A 1 219 ? 26.281  61.957 68.155  1.00 38.02 ? 253 MET A SD  1 
ATOM   1514 C CE  . MET A 1 219 ? 27.173  61.518 66.663  1.00 38.98 ? 253 MET A CE  1 
ATOM   1515 N N   . LEU A 1 220 ? 27.179  67.524 66.759  1.00 37.99 ? 254 LEU A N   1 
ATOM   1516 C CA  . LEU A 1 220 ? 28.296  68.450 66.541  1.00 38.43 ? 254 LEU A CA  1 
ATOM   1517 C C   . LEU A 1 220 ? 28.027  69.920 66.883  1.00 38.76 ? 254 LEU A C   1 
ATOM   1518 O O   . LEU A 1 220 ? 28.953  70.647 67.238  1.00 38.35 ? 254 LEU A O   1 
ATOM   1519 C CB  . LEU A 1 220 ? 28.830  68.334 65.106  1.00 38.33 ? 254 LEU A CB  1 
ATOM   1520 C CG  . LEU A 1 220 ? 29.672  67.109 64.736  1.00 37.84 ? 254 LEU A CG  1 
ATOM   1521 C CD1 . LEU A 1 220 ? 30.084  67.197 63.280  1.00 37.82 ? 254 LEU A CD1 1 
ATOM   1522 C CD2 . LEU A 1 220 ? 30.894  66.969 65.622  1.00 37.35 ? 254 LEU A CD2 1 
ATOM   1523 N N   . SER A 1 221 ? 26.774  70.351 66.764  1.00 39.55 ? 255 SER A N   1 
ATOM   1524 C CA  . SER A 1 221 ? 26.413  71.751 66.988  1.00 40.46 ? 255 SER A CA  1 
ATOM   1525 C C   . SER A 1 221 ? 25.553  71.957 68.227  1.00 41.30 ? 255 SER A C   1 
ATOM   1526 O O   . SER A 1 221 ? 25.473  73.068 68.756  1.00 41.26 ? 255 SER A O   1 
ATOM   1527 C CB  . SER A 1 221 ? 25.669  72.303 65.780  1.00 40.31 ? 255 SER A CB  1 
ATOM   1528 O OG  . SER A 1 221 ? 24.422  71.648 65.616  1.00 40.48 ? 255 SER A OG  1 
ATOM   1529 N N   . GLY A 1 222 ? 24.898  70.890 68.668  1.00 42.35 ? 256 GLY A N   1 
ATOM   1530 C CA  . GLY A 1 222 ? 24.004  70.957 69.813  1.00 44.12 ? 256 GLY A CA  1 
ATOM   1531 C C   . GLY A 1 222 ? 22.560  71.261 69.468  1.00 45.45 ? 256 GLY A C   1 
ATOM   1532 O O   . GLY A 1 222 ? 21.705  71.316 70.357  1.00 45.50 ? 256 GLY A O   1 
ATOM   1533 N N   . TYR A 1 223 ? 22.286  71.465 68.181  1.00 46.91 ? 257 TYR A N   1 
ATOM   1534 C CA  . TYR A 1 223 ? 20.919  71.708 67.707  1.00 48.30 ? 257 TYR A CA  1 
ATOM   1535 C C   . TYR A 1 223 ? 20.614  70.954 66.404  1.00 49.02 ? 257 TYR A C   1 
ATOM   1536 O O   . TYR A 1 223 ? 21.536  70.460 65.746  1.00 49.09 ? 257 TYR A O   1 
ATOM   1537 C CB  . TYR A 1 223 ? 20.643  73.210 67.556  1.00 48.71 ? 257 TYR A CB  1 
ATOM   1538 C CG  . TYR A 1 223 ? 21.663  73.956 66.740  1.00 49.34 ? 257 TYR A CG  1 
ATOM   1539 C CD1 . TYR A 1 223 ? 22.746  74.575 67.358  1.00 50.18 ? 257 TYR A CD1 1 
ATOM   1540 C CD2 . TYR A 1 223 ? 21.543  74.052 65.351  1.00 49.77 ? 257 TYR A CD2 1 
ATOM   1541 C CE1 . TYR A 1 223 ? 23.692  75.267 66.614  1.00 51.11 ? 257 TYR A CE1 1 
ATOM   1542 C CE2 . TYR A 1 223 ? 22.485  74.739 64.588  1.00 50.09 ? 257 TYR A CE2 1 
ATOM   1543 C CZ  . TYR A 1 223 ? 23.559  75.345 65.226  1.00 50.66 ? 257 TYR A CZ  1 
ATOM   1544 O OH  . TYR A 1 223 ? 24.503  76.033 64.492  1.00 50.75 ? 257 TYR A OH  1 
ATOM   1545 N N   . PRO A 1 224 ? 19.316  70.844 66.044  1.00 49.65 ? 258 PRO A N   1 
ATOM   1546 C CA  . PRO A 1 224 ? 18.883  70.161 64.822  1.00 49.99 ? 258 PRO A CA  1 
ATOM   1547 C C   . PRO A 1 224 ? 19.096  70.994 63.560  1.00 50.45 ? 258 PRO A C   1 
ATOM   1548 O O   . PRO A 1 224 ? 18.943  72.218 63.605  1.00 50.35 ? 258 PRO A O   1 
ATOM   1549 C CB  . PRO A 1 224 ? 17.379  69.938 65.058  1.00 50.16 ? 258 PRO A CB  1 
ATOM   1550 C CG  . PRO A 1 224 ? 17.127  70.294 66.523  1.00 50.01 ? 258 PRO A CG  1 
ATOM   1551 C CD  . PRO A 1 224 ? 18.158  71.329 66.817  1.00 49.75 ? 258 PRO A CD  1 
ATOM   1552 N N   . PRO A 1 225 ? 19.432  70.333 62.431  1.00 50.88 ? 259 PRO A N   1 
ATOM   1553 C CA  . PRO A 1 225 ? 19.677  71.035 61.176  1.00 51.46 ? 259 PRO A CA  1 
ATOM   1554 C C   . PRO A 1 225 ? 18.391  71.599 60.601  1.00 52.35 ? 259 PRO A C   1 
ATOM   1555 O O   . PRO A 1 225 ? 18.415  72.596 59.869  1.00 52.31 ? 259 PRO A O   1 
ATOM   1556 C CB  . PRO A 1 225 ? 20.215  69.936 60.263  1.00 51.34 ? 259 PRO A CB  1 
ATOM   1557 C CG  . PRO A 1 225 ? 19.682  68.687 60.812  1.00 50.95 ? 259 PRO A CG  1 
ATOM   1558 C CD  . PRO A 1 225 ? 19.588  68.876 62.284  1.00 50.76 ? 259 PRO A CD  1 
ATOM   1559 N N   . PHE A 1 226 ? 17.278  70.953 60.948  1.00 53.37 ? 260 PHE A N   1 
ATOM   1560 C CA  . PHE A 1 226 ? 15.964  71.314 60.434  1.00 54.21 ? 260 PHE A CA  1 
ATOM   1561 C C   . PHE A 1 226 ? 15.003  71.610 61.589  1.00 54.33 ? 260 PHE A C   1 
ATOM   1562 O O   . PHE A 1 226 ? 14.682  72.771 61.859  1.00 54.55 ? 260 PHE A O   1 
ATOM   1563 C CB  . PHE A 1 226 ? 15.417  70.196 59.516  1.00 54.47 ? 260 PHE A CB  1 
ATOM   1564 C CG  . PHE A 1 226 ? 16.224  69.987 58.240  1.00 55.21 ? 260 PHE A CG  1 
ATOM   1565 C CD1 . PHE A 1 226 ? 16.417  71.036 57.326  1.00 55.55 ? 260 PHE A CD1 1 
ATOM   1566 C CD2 . PHE A 1 226 ? 16.782  68.736 57.945  1.00 55.92 ? 260 PHE A CD2 1 
ATOM   1567 C CE1 . PHE A 1 226 ? 17.162  70.844 56.141  1.00 55.45 ? 260 PHE A CE1 1 
ATOM   1568 C CE2 . PHE A 1 226 ? 17.533  68.535 56.760  1.00 55.92 ? 260 PHE A CE2 1 
ATOM   1569 C CZ  . PHE A 1 226 ? 17.718  69.595 55.859  1.00 55.32 ? 260 PHE A CZ  1 
ATOM   1570 N N   . GLY A 1 256 ? 15.377  70.149 50.782  1.00 68.96 ? 290 GLY A N   1 
ATOM   1571 C CA  . GLY A 1 256 ? 16.093  70.191 52.061  1.00 68.99 ? 290 GLY A CA  1 
ATOM   1572 C C   . GLY A 1 256 ? 16.372  71.607 52.555  1.00 68.83 ? 290 GLY A C   1 
ATOM   1573 O O   . GLY A 1 256 ? 15.467  72.280 53.078  1.00 69.10 ? 290 GLY A O   1 
ATOM   1574 N N   . LYS A 1 257 ? 17.627  72.045 52.380  1.00 68.22 ? 291 LYS A N   1 
ATOM   1575 C CA  . LYS A 1 257 ? 18.136  73.393 52.751  1.00 67.43 ? 291 LYS A CA  1 
ATOM   1576 C C   . LYS A 1 257 ? 18.500  73.567 54.242  1.00 66.53 ? 291 LYS A C   1 
ATOM   1577 O O   . LYS A 1 257 ? 17.637  73.851 55.088  1.00 66.57 ? 291 LYS A O   1 
ATOM   1578 C CB  . LYS A 1 257 ? 17.224  74.539 52.258  1.00 67.62 ? 291 LYS A CB  1 
ATOM   1579 C CG  . LYS A 1 257 ? 16.918  74.543 50.760  1.00 68.71 ? 291 LYS A CG  1 
ATOM   1580 C CD  . LYS A 1 257 ? 18.172  74.691 49.902  1.00 70.54 ? 291 LYS A CD  1 
ATOM   1581 C CE  . LYS A 1 257 ? 17.822  74.593 48.420  1.00 71.60 ? 291 LYS A CE  1 
ATOM   1582 N NZ  . LYS A 1 257 ? 19.031  74.447 47.560  1.00 72.30 ? 291 LYS A NZ  1 
ATOM   1583 N N   . TYR A 1 258 ? 19.790  73.390 54.537  1.00 65.17 ? 292 TYR A N   1 
ATOM   1584 C CA  . TYR A 1 258 ? 20.356  73.556 55.885  1.00 63.70 ? 292 TYR A CA  1 
ATOM   1585 C C   . TYR A 1 258 ? 21.645  74.399 55.800  1.00 62.57 ? 292 TYR A C   1 
ATOM   1586 O O   . TYR A 1 258 ? 22.221  74.577 54.720  1.00 62.46 ? 292 TYR A O   1 
ATOM   1587 C CB  . TYR A 1 258 ? 20.645  72.187 56.529  1.00 63.83 ? 292 TYR A CB  1 
ATOM   1588 C CG  . TYR A 1 258 ? 21.633  71.379 55.729  1.00 63.77 ? 292 TYR A CG  1 
ATOM   1589 C CD1 . TYR A 1 258 ? 22.997  71.449 56.003  1.00 63.67 ? 292 TYR A CD1 1 
ATOM   1590 C CD2 . TYR A 1 258 ? 21.210  70.584 54.664  1.00 64.06 ? 292 TYR A CD2 1 
ATOM   1591 C CE1 . TYR A 1 258 ? 23.914  70.739 55.251  1.00 63.89 ? 292 TYR A CE1 1 
ATOM   1592 C CE2 . TYR A 1 258 ? 22.118  69.866 53.905  1.00 64.33 ? 292 TYR A CE2 1 
ATOM   1593 C CZ  . TYR A 1 258 ? 23.470  69.948 54.206  1.00 64.34 ? 292 TYR A CZ  1 
ATOM   1594 O OH  . TYR A 1 258 ? 24.380  69.243 53.458  1.00 64.36 ? 292 TYR A OH  1 
ATOM   1595 N N   . GLU A 1 259 ? 22.102  74.905 56.939  1.00 60.89 ? 293 GLU A N   1 
ATOM   1596 C CA  . GLU A 1 259 ? 23.287  75.743 56.961  1.00 59.24 ? 293 GLU A CA  1 
ATOM   1597 C C   . GLU A 1 259 ? 24.334  75.169 57.898  1.00 57.76 ? 293 GLU A C   1 
ATOM   1598 O O   . GLU A 1 259 ? 24.063  74.229 58.648  1.00 57.56 ? 293 GLU A O   1 
ATOM   1599 C CB  . GLU A 1 259 ? 22.919  77.166 57.401  1.00 59.58 ? 293 GLU A CB  1 
ATOM   1600 C CG  . GLU A 1 259 ? 22.001  77.922 56.450  1.00 60.99 ? 293 GLU A CG  1 
ATOM   1601 C CD  . GLU A 1 259 ? 22.684  78.314 55.141  1.00 64.07 ? 293 GLU A CD  1 
ATOM   1602 O OE1 . GLU A 1 259 ? 22.045  79.034 54.336  1.00 64.93 ? 293 GLU A OE1 1 
ATOM   1603 O OE2 . GLU A 1 259 ? 23.852  77.908 54.909  1.00 65.16 ? 293 GLU A OE2 1 
ATOM   1604 N N   . PHE A 1 260 ? 25.535  75.735 57.842  1.00 55.82 ? 294 PHE A N   1 
ATOM   1605 C CA  . PHE A 1 260 ? 26.537  75.505 58.863  1.00 53.93 ? 294 PHE A CA  1 
ATOM   1606 C C   . PHE A 1 260 ? 26.934  76.859 59.466  1.00 53.13 ? 294 PHE A C   1 
ATOM   1607 O O   . PHE A 1 260 ? 28.000  77.390 59.137  1.00 53.03 ? 294 PHE A O   1 
ATOM   1608 C CB  . PHE A 1 260 ? 27.758  74.783 58.284  1.00 53.48 ? 294 PHE A CB  1 
ATOM   1609 C CG  . PHE A 1 260 ? 27.489  73.368 57.833  1.00 52.60 ? 294 PHE A CG  1 
ATOM   1610 C CD1 . PHE A 1 260 ? 27.606  73.018 56.501  1.00 51.44 ? 294 PHE A CD1 1 
ATOM   1611 C CD2 . PHE A 1 260 ? 27.144  72.380 58.742  1.00 52.31 ? 294 PHE A CD2 1 
ATOM   1612 C CE1 . PHE A 1 260 ? 27.370  71.715 56.085  1.00 50.79 ? 294 PHE A CE1 1 
ATOM   1613 C CE2 . PHE A 1 260 ? 26.906  71.073 58.328  1.00 51.08 ? 294 PHE A CE2 1 
ATOM   1614 C CZ  . PHE A 1 260 ? 27.022  70.746 57.003  1.00 51.26 ? 294 PHE A CZ  1 
ATOM   1615 N N   . PRO A 1 261 ? 26.080  77.420 60.358  1.00 52.32 ? 295 PRO A N   1 
ATOM   1616 C CA  . PRO A 1 261 ? 26.329  78.741 60.953  1.00 51.78 ? 295 PRO A CA  1 
ATOM   1617 C C   . PRO A 1 261 ? 27.705  78.811 61.610  1.00 51.17 ? 295 PRO A C   1 
ATOM   1618 O O   . PRO A 1 261 ? 28.031  77.960 62.444  1.00 51.31 ? 295 PRO A O   1 
ATOM   1619 C CB  . PRO A 1 261 ? 25.227  78.863 62.011  1.00 51.74 ? 295 PRO A CB  1 
ATOM   1620 C CG  . PRO A 1 261 ? 24.150  77.989 61.527  1.00 51.69 ? 295 PRO A CG  1 
ATOM   1621 C CD  . PRO A 1 261 ? 24.833  76.830 60.880  1.00 52.16 ? 295 PRO A CD  1 
ATOM   1622 N N   . ASP A 1 262 ? 28.494  79.813 61.227  1.00 50.20 ? 296 ASP A N   1 
ATOM   1623 C CA  . ASP A 1 262 ? 29.907  79.898 61.606  1.00 49.28 ? 296 ASP A CA  1 
ATOM   1624 C C   . ASP A 1 262 ? 30.123  80.046 63.099  1.00 48.69 ? 296 ASP A C   1 
ATOM   1625 O O   . ASP A 1 262 ? 31.182  79.682 63.621  1.00 48.59 ? 296 ASP A O   1 
ATOM   1626 C CB  . ASP A 1 262 ? 30.594  81.042 60.868  1.00 49.21 ? 296 ASP A CB  1 
ATOM   1627 C CG  . ASP A 1 262 ? 30.857  80.720 59.414  1.00 49.43 ? 296 ASP A CG  1 
ATOM   1628 O OD1 . ASP A 1 262 ? 31.196  79.551 59.105  1.00 49.81 ? 296 ASP A OD1 1 
ATOM   1629 O OD2 . ASP A 1 262 ? 30.727  81.642 58.579  1.00 49.20 ? 296 ASP A OD2 1 
ATOM   1630 N N   . LYS A 1 263 ? 29.114  80.583 63.776  1.00 47.90 ? 297 LYS A N   1 
ATOM   1631 C CA  . LYS A 1 263 ? 29.103  80.656 65.229  1.00 47.19 ? 297 LYS A CA  1 
ATOM   1632 C C   . LYS A 1 263 ? 29.360  79.282 65.867  1.00 46.56 ? 297 LYS A C   1 
ATOM   1633 O O   . LYS A 1 263 ? 30.047  79.194 66.881  1.00 46.64 ? 297 LYS A O   1 
ATOM   1634 C CB  . LYS A 1 263 ? 27.791  81.295 65.699  1.00 47.12 ? 297 LYS A CB  1 
ATOM   1635 C CG  . LYS A 1 263 ? 27.144  80.683 66.929  1.00 47.24 ? 297 LYS A CG  1 
ATOM   1636 C CD  . LYS A 1 263 ? 25.712  81.183 67.122  1.00 47.30 ? 297 LYS A CD  1 
ATOM   1637 C CE  . LYS A 1 263 ? 24.769  80.700 66.015  1.00 47.50 ? 297 LYS A CE  1 
ATOM   1638 N NZ  . LYS A 1 263 ? 24.984  81.419 64.721  1.00 47.31 ? 297 LYS A NZ  1 
ATOM   1639 N N   . ASP A 1 264 ? 28.845  78.222 65.238  1.00 45.84 ? 298 ASP A N   1 
ATOM   1640 C CA  . ASP A 1 264 ? 28.984  76.844 65.723  1.00 44.89 ? 298 ASP A CA  1 
ATOM   1641 C C   . ASP A 1 264 ? 29.839  75.967 64.822  1.00 44.40 ? 298 ASP A C   1 
ATOM   1642 O O   . ASP A 1 264 ? 30.491  75.046 65.299  1.00 44.21 ? 298 ASP A O   1 
ATOM   1643 C CB  . ASP A 1 264 ? 27.608  76.202 65.868  1.00 44.76 ? 298 ASP A CB  1 
ATOM   1644 C CG  . ASP A 1 264 ? 26.676  77.018 66.742  1.00 45.01 ? 298 ASP A CG  1 
ATOM   1645 O OD1 . ASP A 1 264 ? 25.684  77.564 66.209  1.00 44.93 ? 298 ASP A OD1 1 
ATOM   1646 O OD2 . ASP A 1 264 ? 26.939  77.128 67.960  1.00 45.24 ? 298 ASP A OD2 1 
ATOM   1647 N N   . TRP A 1 265 ? 29.845  76.262 63.525  1.00 44.07 ? 299 TRP A N   1 
ATOM   1648 C CA  . TRP A 1 265 ? 30.395  75.339 62.528  1.00 43.95 ? 299 TRP A CA  1 
ATOM   1649 C C   . TRP A 1 265 ? 31.757  75.662 61.905  1.00 44.21 ? 299 TRP A C   1 
ATOM   1650 O O   . TRP A 1 265 ? 32.393  74.777 61.324  1.00 44.11 ? 299 TRP A O   1 
ATOM   1651 C CB  . TRP A 1 265 ? 29.373  75.071 61.435  1.00 43.52 ? 299 TRP A CB  1 
ATOM   1652 C CG  . TRP A 1 265 ? 28.255  74.226 61.906  1.00 43.50 ? 299 TRP A CG  1 
ATOM   1653 C CD1 . TRP A 1 265 ? 27.073  74.653 62.436  1.00 43.53 ? 299 TRP A CD1 1 
ATOM   1654 C CD2 . TRP A 1 265 ? 28.207  72.795 61.917  1.00 43.21 ? 299 TRP A CD2 1 
ATOM   1655 N NE1 . TRP A 1 265 ? 26.284  73.575 62.766  1.00 43.13 ? 299 TRP A NE1 1 
ATOM   1656 C CE2 . TRP A 1 265 ? 26.957  72.423 62.455  1.00 42.74 ? 299 TRP A CE2 1 
ATOM   1657 C CE3 . TRP A 1 265 ? 29.095  71.789 61.515  1.00 43.49 ? 299 TRP A CE3 1 
ATOM   1658 C CZ2 . TRP A 1 265 ? 26.573  71.093 62.601  1.00 42.90 ? 299 TRP A CZ2 1 
ATOM   1659 C CZ3 . TRP A 1 265 ? 28.708  70.464 61.660  1.00 43.15 ? 299 TRP A CZ3 1 
ATOM   1660 C CH2 . TRP A 1 265 ? 27.460  70.132 62.202  1.00 43.22 ? 299 TRP A CH2 1 
ATOM   1661 N N   . ALA A 1 266 ? 32.209  76.910 62.005  1.00 44.55 ? 300 ALA A N   1 
ATOM   1662 C CA  . ALA A 1 266 ? 33.584  77.221 61.623  1.00 44.93 ? 300 ALA A CA  1 
ATOM   1663 C C   . ALA A 1 266 ? 34.473  76.374 62.514  1.00 45.46 ? 300 ALA A C   1 
ATOM   1664 O O   . ALA A 1 266 ? 34.049  75.944 63.601  1.00 46.06 ? 300 ALA A O   1 
ATOM   1665 C CB  . ALA A 1 266 ? 33.877  78.677 61.824  1.00 44.81 ? 300 ALA A CB  1 
ATOM   1666 N N   . HIS A 1 267 ? 35.694  76.105 62.065  1.00 45.73 ? 301 HIS A N   1 
ATOM   1667 C CA  . HIS A 1 267 ? 36.640  75.280 62.850  1.00 45.71 ? 301 HIS A CA  1 
ATOM   1668 C C   . HIS A 1 267 ? 36.193  73.818 63.060  1.00 45.26 ? 301 HIS A C   1 
ATOM   1669 O O   . HIS A 1 267 ? 36.976  73.006 63.557  1.00 45.44 ? 301 HIS A O   1 
ATOM   1670 C CB  . HIS A 1 267 ? 36.985  75.927 64.207  1.00 45.90 ? 301 HIS A CB  1 
ATOM   1671 C CG  . HIS A 1 267 ? 37.209  77.410 64.145  1.00 46.78 ? 301 HIS A CG  1 
ATOM   1672 N ND1 . HIS A 1 267 ? 37.958  78.015 63.157  1.00 47.72 ? 301 HIS A ND1 1 
ATOM   1673 C CD2 . HIS A 1 267 ? 36.795  78.406 64.965  1.00 47.43 ? 301 HIS A CD2 1 
ATOM   1674 C CE1 . HIS A 1 267 ? 37.985  79.320 63.363  1.00 47.58 ? 301 HIS A CE1 1 
ATOM   1675 N NE2 . HIS A 1 267 ? 37.292  79.583 64.457  1.00 47.64 ? 301 HIS A NE2 1 
ATOM   1676 N N   . ILE A 1 268 ? 34.949  73.490 62.701  1.00 44.64 ? 302 ILE A N   1 
ATOM   1677 C CA  . ILE A 1 268 ? 34.525  72.093 62.598  1.00 44.18 ? 302 ILE A CA  1 
ATOM   1678 C C   . ILE A 1 268 ? 35.127  71.569 61.302  1.00 44.17 ? 302 ILE A C   1 
ATOM   1679 O O   . ILE A 1 268 ? 35.032  72.225 60.266  1.00 44.02 ? 302 ILE A O   1 
ATOM   1680 C CB  . ILE A 1 268 ? 32.970  71.920 62.565  1.00 44.11 ? 302 ILE A CB  1 
ATOM   1681 C CG1 . ILE A 1 268 ? 32.303  72.427 63.856  1.00 43.53 ? 302 ILE A CG1 1 
ATOM   1682 C CG2 . ILE A 1 268 ? 32.572  70.469 62.268  1.00 43.61 ? 302 ILE A CG2 1 
ATOM   1683 C CD1 . ILE A 1 268 ? 32.272  71.454 64.991  1.00 42.23 ? 302 ILE A CD1 1 
ATOM   1684 N N   . SER A 1 269 ? 35.755  70.397 61.381  1.00 44.31 ? 303 SER A N   1 
ATOM   1685 C CA  . SER A 1 269 ? 36.425  69.736 60.256  1.00 44.37 ? 303 SER A CA  1 
ATOM   1686 C C   . SER A 1 269 ? 35.627  69.819 58.966  1.00 44.68 ? 303 SER A C   1 
ATOM   1687 O O   . SER A 1 269 ? 34.398  69.715 58.982  1.00 45.00 ? 303 SER A O   1 
ATOM   1688 C CB  . SER A 1 269 ? 36.672  68.269 60.613  1.00 44.24 ? 303 SER A CB  1 
ATOM   1689 O OG  . SER A 1 269 ? 37.168  67.519 59.528  1.00 44.29 ? 303 SER A OG  1 
ATOM   1690 N N   . SER A 1 270 ? 36.315  70.009 57.844  1.00 44.86 ? 304 SER A N   1 
ATOM   1691 C CA  . SER A 1 270 ? 35.619  69.982 56.560  1.00 45.00 ? 304 SER A CA  1 
ATOM   1692 C C   . SER A 1 270 ? 35.175  68.555 56.214  1.00 44.85 ? 304 SER A C   1 
ATOM   1693 O O   . SER A 1 270 ? 34.156  68.380 55.546  1.00 45.20 ? 304 SER A O   1 
ATOM   1694 C CB  . SER A 1 270 ? 36.454  70.609 55.436  1.00 45.09 ? 304 SER A CB  1 
ATOM   1695 O OG  . SER A 1 270 ? 37.518  69.761 55.023  1.00 46.18 ? 304 SER A OG  1 
ATOM   1696 N N   . GLU A 1 271 ? 35.934  67.554 56.683  1.00 44.43 ? 305 GLU A N   1 
ATOM   1697 C CA  . GLU A 1 271 ? 35.594  66.135 56.509  1.00 44.07 ? 305 GLU A CA  1 
ATOM   1698 C C   . GLU A 1 271 ? 34.255  65.807 57.154  1.00 43.36 ? 305 GLU A C   1 
ATOM   1699 O O   . GLU A 1 271 ? 33.441  65.098 56.554  1.00 43.52 ? 305 GLU A O   1 
ATOM   1700 C CB  . GLU A 1 271 ? 36.666  65.219 57.113  1.00 44.50 ? 305 GLU A CB  1 
ATOM   1701 C CG  . GLU A 1 271 ? 37.909  64.992 56.260  1.00 46.80 ? 305 GLU A CG  1 
ATOM   1702 C CD  . GLU A 1 271 ? 38.917  66.144 56.340  1.00 50.40 ? 305 GLU A CD  1 
ATOM   1703 O OE1 . GLU A 1 271 ? 39.781  66.245 55.438  1.00 52.07 ? 305 GLU A OE1 1 
ATOM   1704 O OE2 . GLU A 1 271 ? 38.851  66.956 57.294  1.00 51.78 ? 305 GLU A OE2 1 
ATOM   1705 N N   . ALA A 1 272 ? 34.047  66.317 58.373  1.00 42.27 ? 306 ALA A N   1 
ATOM   1706 C CA  . ALA A 1 272 ? 32.803  66.144 59.131  1.00 41.26 ? 306 ALA A CA  1 
ATOM   1707 C C   . ALA A 1 272 ? 31.601  66.744 58.412  1.00 41.09 ? 306 ALA A C   1 
ATOM   1708 O O   . ALA A 1 272 ? 30.580  66.078 58.273  1.00 41.27 ? 306 ALA A O   1 
ATOM   1709 C CB  . ALA A 1 272 ? 32.933  66.751 60.503  1.00 41.14 ? 306 ALA A CB  1 
ATOM   1710 N N   . LYS A 1 273 ? 31.729  67.994 57.954  1.00 40.62 ? 307 LYS A N   1 
ATOM   1711 C CA  . LYS A 1 273 ? 30.674  68.682 57.198  1.00 39.86 ? 307 LYS A CA  1 
ATOM   1712 C C   . LYS A 1 273 ? 30.407  67.982 55.871  1.00 39.52 ? 307 LYS A C   1 
ATOM   1713 O O   . LYS A 1 273 ? 29.267  67.927 55.391  1.00 39.45 ? 307 LYS A O   1 
ATOM   1714 C CB  . LYS A 1 273 ? 31.059  70.136 56.925  1.00 39.96 ? 307 LYS A CB  1 
ATOM   1715 C CG  . LYS A 1 273 ? 31.471  70.962 58.134  1.00 39.71 ? 307 LYS A CG  1 
ATOM   1716 C CD  . LYS A 1 273 ? 31.312  72.440 57.803  1.00 40.83 ? 307 LYS A CD  1 
ATOM   1717 C CE  . LYS A 1 273 ? 32.427  73.306 58.388  1.00 41.48 ? 307 LYS A CE  1 
ATOM   1718 N NZ  . LYS A 1 273 ? 32.238  74.766 58.074  1.00 41.56 ? 307 LYS A NZ  1 
ATOM   1719 N N   . ASP A 1 274 ? 31.474  67.454 55.279  1.00 39.14 ? 308 ASP A N   1 
ATOM   1720 C CA  . ASP A 1 274 ? 31.373  66.663 54.063  1.00 39.00 ? 308 ASP A CA  1 
ATOM   1721 C C   . ASP A 1 274 ? 30.466  65.457 54.284  1.00 38.67 ? 308 ASP A C   1 
ATOM   1722 O O   . ASP A 1 274 ? 29.520  65.234 53.526  1.00 38.57 ? 308 ASP A O   1 
ATOM   1723 C CB  . ASP A 1 274 ? 32.755  66.198 53.611  1.00 39.10 ? 308 ASP A CB  1 
ATOM   1724 C CG  . ASP A 1 274 ? 32.695  65.319 52.386  1.00 39.94 ? 308 ASP A CG  1 
ATOM   1725 O OD1 . ASP A 1 274 ? 32.238  65.805 51.332  1.00 41.45 ? 308 ASP A OD1 1 
ATOM   1726 O OD2 . ASP A 1 274 ? 33.103  64.142 52.470  1.00 41.39 ? 308 ASP A OD2 1 
ATOM   1727 N N   . LEU A 1 275 ? 30.763  64.691 55.332  1.00 38.30 ? 309 LEU A N   1 
ATOM   1728 C CA  . LEU A 1 275 ? 29.964  63.527 55.680  1.00 37.95 ? 309 LEU A CA  1 
ATOM   1729 C C   . LEU A 1 275 ? 28.498  63.901 55.851  1.00 38.05 ? 309 LEU A C   1 
ATOM   1730 O O   . LEU A 1 275 ? 27.626  63.284 55.240  1.00 38.08 ? 309 LEU A O   1 
ATOM   1731 C CB  . LEU A 1 275 ? 30.495  62.857 56.946  1.00 37.71 ? 309 LEU A CB  1 
ATOM   1732 C CG  . LEU A 1 275 ? 29.720  61.649 57.486  1.00 37.10 ? 309 LEU A CG  1 
ATOM   1733 C CD1 . LEU A 1 275 ? 29.393  60.621 56.399  1.00 36.50 ? 309 LEU A CD1 1 
ATOM   1734 C CD2 . LEU A 1 275 ? 30.494  61.007 58.600  1.00 35.75 ? 309 LEU A CD2 1 
ATOM   1735 N N   . ILE A 1 276 ? 28.245  64.917 56.672  1.00 38.13 ? 310 ILE A N   1 
ATOM   1736 C CA  . ILE A 1 276 ? 26.895  65.386 56.950  1.00 38.27 ? 310 ILE A CA  1 
ATOM   1737 C C   . ILE A 1 276 ? 26.167  65.700 55.659  1.00 38.96 ? 310 ILE A C   1 
ATOM   1738 O O   . ILE A 1 276 ? 25.030  65.239 55.447  1.00 39.19 ? 310 ILE A O   1 
ATOM   1739 C CB  . ILE A 1 276 ? 26.907  66.625 57.859  1.00 38.21 ? 310 ILE A CB  1 
ATOM   1740 C CG1 . ILE A 1 276 ? 27.273  66.210 59.283  1.00 37.62 ? 310 ILE A CG1 1 
ATOM   1741 C CG2 . ILE A 1 276 ? 25.558  67.345 57.839  1.00 37.91 ? 310 ILE A CG2 1 
ATOM   1742 C CD1 . ILE A 1 276 ? 27.488  67.350 60.207  1.00 37.58 ? 310 ILE A CD1 1 
ATOM   1743 N N   . SER A 1 277 ? 26.827  66.454 54.782  1.00 39.23 ? 311 SER A N   1 
ATOM   1744 C CA  . SER A 1 277 ? 26.170  66.883 53.560  1.00 39.55 ? 311 SER A CA  1 
ATOM   1745 C C   . SER A 1 277 ? 25.902  65.712 52.603  1.00 39.49 ? 311 SER A C   1 
ATOM   1746 O O   . SER A 1 277 ? 24.980  65.788 51.782  1.00 39.93 ? 311 SER A O   1 
ATOM   1747 C CB  . SER A 1 277 ? 26.928  68.030 52.894  1.00 39.47 ? 311 SER A CB  1 
ATOM   1748 O OG  . SER A 1 277 ? 28.064  67.550 52.217  1.00 41.32 ? 311 SER A OG  1 
ATOM   1749 N N   . LYS A 1 278 ? 26.676  64.630 52.731  1.00 39.17 ? 312 LYS A N   1 
ATOM   1750 C CA  . LYS A 1 278 ? 26.459  63.421 51.923  1.00 38.92 ? 312 LYS A CA  1 
ATOM   1751 C C   . LYS A 1 278 ? 25.291  62.573 52.421  1.00 38.81 ? 312 LYS A C   1 
ATOM   1752 O O   . LYS A 1 278 ? 24.782  61.719 51.688  1.00 38.68 ? 312 LYS A O   1 
ATOM   1753 C CB  . LYS A 1 278 ? 27.720  62.570 51.873  1.00 38.90 ? 312 LYS A CB  1 
ATOM   1754 C CG  . LYS A 1 278 ? 28.853  63.183 51.096  1.00 39.52 ? 312 LYS A CG  1 
ATOM   1755 C CD  . LYS A 1 278 ? 29.882  62.126 50.721  1.00 40.69 ? 312 LYS A CD  1 
ATOM   1756 C CE  . LYS A 1 278 ? 31.119  62.756 50.122  1.00 41.16 ? 312 LYS A CE  1 
ATOM   1757 N NZ  . LYS A 1 278 ? 30.743  63.744 49.069  1.00 41.20 ? 312 LYS A NZ  1 
ATOM   1758 N N   . LEU A 1 279 ? 24.895  62.809 53.676  1.00 38.85 ? 313 LEU A N   1 
ATOM   1759 C CA  . LEU A 1 279 ? 23.775  62.123 54.330  1.00 38.52 ? 313 LEU A CA  1 
ATOM   1760 C C   . LEU A 1 279 ? 22.485  62.946 54.285  1.00 38.94 ? 313 LEU A C   1 
ATOM   1761 O O   . LEU A 1 279 ? 21.394  62.399 54.142  1.00 38.79 ? 313 LEU A O   1 
ATOM   1762 C CB  . LEU A 1 279 ? 24.117  61.806 55.785  1.00 38.05 ? 313 LEU A CB  1 
ATOM   1763 C CG  . LEU A 1 279 ? 25.144  60.709 56.085  1.00 37.16 ? 313 LEU A CG  1 
ATOM   1764 C CD1 . LEU A 1 279 ? 25.540  60.754 57.538  1.00 34.53 ? 313 LEU A CD1 1 
ATOM   1765 C CD2 . LEU A 1 279 ? 24.633  59.326 55.723  1.00 35.84 ? 313 LEU A CD2 1 
ATOM   1766 N N   . LEU A 1 280 ? 22.608  64.263 54.408  1.00 39.45 ? 314 LEU A N   1 
ATOM   1767 C CA  . LEU A 1 280 ? 21.436  65.140 54.371  1.00 39.92 ? 314 LEU A CA  1 
ATOM   1768 C C   . LEU A 1 280 ? 20.988  65.519 52.944  1.00 40.50 ? 314 LEU A C   1 
ATOM   1769 O O   . LEU A 1 280 ? 20.192  66.445 52.757  1.00 40.61 ? 314 LEU A O   1 
ATOM   1770 C CB  . LEU A 1 280 ? 21.672  66.379 55.245  1.00 39.82 ? 314 LEU A CB  1 
ATOM   1771 C CG  . LEU A 1 280 ? 21.748  66.155 56.761  1.00 39.16 ? 314 LEU A CG  1 
ATOM   1772 C CD1 . LEU A 1 280 ? 22.083  67.440 57.482  1.00 38.81 ? 314 LEU A CD1 1 
ATOM   1773 C CD2 . LEU A 1 280 ? 20.445  65.588 57.296  1.00 38.80 ? 314 LEU A CD2 1 
ATOM   1774 N N   . VAL A 1 281 ? 21.501  64.788 51.950  1.00 41.09 ? 315 VAL A N   1 
ATOM   1775 C CA  . VAL A 1 281 ? 21.054  64.896 50.555  1.00 41.39 ? 315 VAL A CA  1 
ATOM   1776 C C   . VAL A 1 281 ? 19.647  64.309 50.399  1.00 41.94 ? 315 VAL A C   1 
ATOM   1777 O O   . VAL A 1 281 ? 19.306  63.321 51.049  1.00 41.84 ? 315 VAL A O   1 
ATOM   1778 C CB  . VAL A 1 281 ? 22.050  64.209 49.600  1.00 41.02 ? 315 VAL A CB  1 
ATOM   1779 C CG1 . VAL A 1 281 ? 22.057  62.733 49.823  1.00 40.73 ? 315 VAL A CG1 1 
ATOM   1780 C CG2 . VAL A 1 281 ? 21.728  64.529 48.145  1.00 41.88 ? 315 VAL A CG2 1 
ATOM   1781 N N   . ARG A 1 282 ? 18.840  64.923 49.536  1.00 42.89 ? 316 ARG A N   1 
ATOM   1782 C CA  . ARG A 1 282 ? 17.412  64.587 49.418  1.00 43.89 ? 316 ARG A CA  1 
ATOM   1783 C C   . ARG A 1 282 ? 17.080  63.323 48.598  1.00 43.57 ? 316 ARG A C   1 
ATOM   1784 O O   . ARG A 1 282 ? 16.033  62.712 48.808  1.00 43.55 ? 316 ARG A O   1 
ATOM   1785 C CB  . ARG A 1 282 ? 16.619  65.787 48.876  1.00 44.52 ? 316 ARG A CB  1 
ATOM   1786 C CG  . ARG A 1 282 ? 15.231  65.915 49.491  1.00 47.41 ? 316 ARG A CG  1 
ATOM   1787 C CD  . ARG A 1 282 ? 14.225  66.562 48.542  1.00 52.57 ? 316 ARG A CD  1 
ATOM   1788 N NE  . ARG A 1 282 ? 12.846  66.249 48.936  1.00 56.86 ? 316 ARG A NE  1 
ATOM   1789 C CZ  . ARG A 1 282 ? 12.005  67.104 49.524  1.00 59.01 ? 316 ARG A CZ  1 
ATOM   1790 N NH1 . ARG A 1 282 ? 12.383  68.357 49.781  1.00 60.35 ? 316 ARG A NH1 1 
ATOM   1791 N NH2 . ARG A 1 282 ? 10.777  66.709 49.852  1.00 59.60 ? 316 ARG A NH2 1 
ATOM   1792 N N   . ASP A 1 283 ? 17.955  62.949 47.664  1.00 43.45 ? 317 ASP A N   1 
ATOM   1793 C CA  . ASP A 1 283 ? 17.763  61.751 46.837  1.00 43.19 ? 317 ASP A CA  1 
ATOM   1794 C C   . ASP A 1 283 ? 18.319  60.531 47.552  1.00 42.87 ? 317 ASP A C   1 
ATOM   1795 O O   . ASP A 1 283 ? 19.533  60.409 47.731  1.00 42.71 ? 317 ASP A O   1 
ATOM   1796 C CB  . ASP A 1 283 ? 18.449  61.922 45.473  1.00 43.38 ? 317 ASP A CB  1 
ATOM   1797 C CG  . ASP A 1 283 ? 18.095  60.814 44.470  1.00 43.90 ? 317 ASP A CG  1 
ATOM   1798 O OD1 . ASP A 1 283 ? 17.329  59.876 44.786  1.00 45.02 ? 317 ASP A OD1 1 
ATOM   1799 O OD2 . ASP A 1 283 ? 18.595  60.889 43.331  1.00 44.62 ? 317 ASP A OD2 1 
ATOM   1800 N N   . ALA A 1 284 ? 17.424  59.633 47.960  1.00 42.68 ? 318 ALA A N   1 
ATOM   1801 C CA  . ALA A 1 284 ? 17.818  58.405 48.652  1.00 42.62 ? 318 ALA A CA  1 
ATOM   1802 C C   . ALA A 1 284 ? 18.940  57.682 47.909  1.00 42.63 ? 318 ALA A C   1 
ATOM   1803 O O   . ALA A 1 284 ? 19.883  57.187 48.534  1.00 42.87 ? 318 ALA A O   1 
ATOM   1804 C CB  . ALA A 1 284 ? 16.621  57.485 48.847  1.00 42.45 ? 318 ALA A CB  1 
ATOM   1805 N N   . LYS A 1 285 ? 18.845  57.658 46.577  1.00 42.48 ? 319 LYS A N   1 
ATOM   1806 C CA  . LYS A 1 285 ? 19.829  56.990 45.723  1.00 42.19 ? 319 LYS A CA  1 
ATOM   1807 C C   . LYS A 1 285 ? 21.199  57.668 45.741  1.00 41.84 ? 319 LYS A C   1 
ATOM   1808 O O   . LYS A 1 285 ? 22.216  56.999 45.598  1.00 41.87 ? 319 LYS A O   1 
ATOM   1809 C CB  . LYS A 1 285 ? 19.316  56.848 44.291  1.00 42.16 ? 319 LYS A CB  1 
ATOM   1810 C CG  . LYS A 1 285 ? 19.955  55.686 43.560  1.00 43.22 ? 319 LYS A CG  1 
ATOM   1811 C CD  . LYS A 1 285 ? 19.319  55.446 42.207  1.00 46.51 ? 319 LYS A CD  1 
ATOM   1812 C CE  . LYS A 1 285 ? 19.998  54.266 41.490  1.00 48.61 ? 319 LYS A CE  1 
ATOM   1813 N NZ  . LYS A 1 285 ? 19.088  53.504 40.552  1.00 48.99 ? 319 LYS A NZ  1 
ATOM   1814 N N   . GLN A 1 286 ? 21.222  58.985 45.921  1.00 41.51 ? 320 GLN A N   1 
ATOM   1815 C CA  . GLN A 1 286 ? 22.474  59.725 46.048  1.00 41.25 ? 320 GLN A CA  1 
ATOM   1816 C C   . GLN A 1 286 ? 23.058  59.636 47.456  1.00 40.50 ? 320 GLN A C   1 
ATOM   1817 O O   . GLN A 1 286 ? 24.279  59.679 47.634  1.00 40.67 ? 320 GLN A O   1 
ATOM   1818 C CB  . GLN A 1 286 ? 22.267  61.191 45.686  1.00 41.79 ? 320 GLN A CB  1 
ATOM   1819 C CG  . GLN A 1 286 ? 22.078  61.454 44.199  1.00 44.63 ? 320 GLN A CG  1 
ATOM   1820 C CD  . GLN A 1 286 ? 23.263  60.986 43.352  1.00 48.19 ? 320 GLN A CD  1 
ATOM   1821 O OE1 . GLN A 1 286 ? 23.140  60.044 42.550  1.00 49.50 ? 320 GLN A OE1 1 
ATOM   1822 N NE2 . GLN A 1 286 ? 24.417  61.641 43.529  1.00 48.92 ? 320 GLN A NE2 1 
ATOM   1823 N N   . ARG A 1 287 ? 22.184  59.522 48.454  1.00 39.44 ? 321 ARG A N   1 
ATOM   1824 C CA  . ARG A 1 287 ? 22.602  59.464 49.847  1.00 38.10 ? 321 ARG A CA  1 
ATOM   1825 C C   . ARG A 1 287 ? 23.491  58.262 50.099  1.00 37.92 ? 321 ARG A C   1 
ATOM   1826 O O   . ARG A 1 287 ? 23.297  57.196 49.509  1.00 37.98 ? 321 ARG A O   1 
ATOM   1827 C CB  . ARG A 1 287 ? 21.376  59.386 50.743  1.00 37.92 ? 321 ARG A CB  1 
ATOM   1828 C CG  . ARG A 1 287 ? 21.627  59.658 52.218  1.00 36.07 ? 321 ARG A CG  1 
ATOM   1829 C CD  . ARG A 1 287 ? 20.296  59.704 52.922  1.00 33.58 ? 321 ARG A CD  1 
ATOM   1830 N NE  . ARG A 1 287 ? 19.400  60.636 52.242  1.00 32.40 ? 321 ARG A NE  1 
ATOM   1831 C CZ  . ARG A 1 287 ? 18.108  60.418 52.016  1.00 32.77 ? 321 ARG A CZ  1 
ATOM   1832 N NH1 . ARG A 1 287 ? 17.386  61.329 51.381  1.00 32.45 ? 321 ARG A NH1 1 
ATOM   1833 N NH2 . ARG A 1 287 ? 17.531  59.288 52.405  1.00 33.95 ? 321 ARG A NH2 1 
ATOM   1834 N N   . LEU A 1 288 ? 24.465  58.446 50.982  1.00 37.39 ? 322 LEU A N   1 
ATOM   1835 C CA  . LEU A 1 288 ? 25.361  57.376 51.403  1.00 36.69 ? 322 LEU A CA  1 
ATOM   1836 C C   . LEU A 1 288 ? 24.624  56.212 52.050  1.00 36.51 ? 322 LEU A C   1 
ATOM   1837 O O   . LEU A 1 288 ? 23.571  56.402 52.670  1.00 36.42 ? 322 LEU A O   1 
ATOM   1838 C CB  . LEU A 1 288 ? 26.386  57.932 52.394  1.00 36.54 ? 322 LEU A CB  1 
ATOM   1839 C CG  . LEU A 1 288 ? 27.780  58.320 51.904  1.00 35.61 ? 322 LEU A CG  1 
ATOM   1840 C CD1 . LEU A 1 288 ? 27.773  58.865 50.491  1.00 34.98 ? 322 LEU A CD1 1 
ATOM   1841 C CD2 . LEU A 1 288 ? 28.378  59.312 52.873  1.00 34.73 ? 322 LEU A CD2 1 
ATOM   1842 N N   . SER A 1 289 ? 25.186  55.013 51.895  1.00 36.15 ? 323 SER A N   1 
ATOM   1843 C CA  . SER A 1 289 ? 24.726  53.822 52.608  1.00 35.85 ? 323 SER A CA  1 
ATOM   1844 C C   . SER A 1 289 ? 25.585  53.637 53.840  1.00 35.71 ? 323 SER A C   1 
ATOM   1845 O O   . SER A 1 289 ? 26.694  54.175 53.903  1.00 35.79 ? 323 SER A O   1 
ATOM   1846 C CB  . SER A 1 289 ? 24.874  52.589 51.735  1.00 35.80 ? 323 SER A CB  1 
ATOM   1847 O OG  . SER A 1 289 ? 26.238  52.204 51.636  1.00 36.09 ? 323 SER A OG  1 
ATOM   1848 N N   . ALA A 1 290 ? 25.093  52.851 54.799  1.00 35.46 ? 324 ALA A N   1 
ATOM   1849 C CA  . ALA A 1 290 ? 25.829  52.591 56.038  1.00 35.12 ? 324 ALA A CA  1 
ATOM   1850 C C   . ALA A 1 290 ? 27.261  52.091 55.789  1.00 34.90 ? 324 ALA A C   1 
ATOM   1851 O O   . ALA A 1 290 ? 28.197  52.587 56.405  1.00 34.84 ? 324 ALA A O   1 
ATOM   1852 C CB  . ALA A 1 290 ? 25.060  51.636 56.924  1.00 35.05 ? 324 ALA A CB  1 
ATOM   1853 N N   . ALA A 1 291 ? 27.426  51.134 54.880  1.00 34.65 ? 325 ALA A N   1 
ATOM   1854 C CA  . ALA A 1 291 ? 28.756  50.674 54.468  1.00 34.68 ? 325 ALA A CA  1 
ATOM   1855 C C   . ALA A 1 291 ? 29.651  51.817 53.974  1.00 34.80 ? 325 ALA A C   1 
ATOM   1856 O O   . ALA A 1 291 ? 30.853  51.865 54.276  1.00 34.86 ? 325 ALA A O   1 
ATOM   1857 C CB  . ALA A 1 291 ? 28.634  49.613 53.394  1.00 34.54 ? 325 ALA A CB  1 
ATOM   1858 N N   . GLN A 1 292 ? 29.060  52.732 53.214  1.00 34.75 ? 326 GLN A N   1 
ATOM   1859 C CA  . GLN A 1 292 ? 29.787  53.885 52.710  1.00 34.95 ? 326 GLN A CA  1 
ATOM   1860 C C   . GLN A 1 292 ? 30.155  54.839 53.834  1.00 34.73 ? 326 GLN A C   1 
ATOM   1861 O O   . GLN A 1 292 ? 31.229  55.424 53.815  1.00 34.87 ? 326 GLN A O   1 
ATOM   1862 C CB  . GLN A 1 292 ? 28.987  54.600 51.622  1.00 34.94 ? 326 GLN A CB  1 
ATOM   1863 C CG  . GLN A 1 292 ? 29.024  53.887 50.271  1.00 35.53 ? 326 GLN A CG  1 
ATOM   1864 C CD  . GLN A 1 292 ? 27.912  54.310 49.312  1.00 35.56 ? 326 GLN A CD  1 
ATOM   1865 O OE1 . GLN A 1 292 ? 27.273  55.350 49.472  1.00 36.89 ? 326 GLN A OE1 1 
ATOM   1866 N NE2 . GLN A 1 292 ? 27.684  53.492 48.302  1.00 37.41 ? 326 GLN A NE2 1 
ATOM   1867 N N   . VAL A 1 293 ? 29.273  54.984 54.817  1.00 34.74 ? 327 VAL A N   1 
ATOM   1868 C CA  . VAL A 1 293 ? 29.551  55.832 55.975  1.00 34.88 ? 327 VAL A CA  1 
ATOM   1869 C C   . VAL A 1 293 ? 30.755  55.270 56.735  1.00 35.46 ? 327 VAL A C   1 
ATOM   1870 O O   . VAL A 1 293 ? 31.629  56.014 57.169  1.00 35.43 ? 327 VAL A O   1 
ATOM   1871 C CB  . VAL A 1 293 ? 28.327  55.940 56.921  1.00 34.66 ? 327 VAL A CB  1 
ATOM   1872 C CG1 . VAL A 1 293 ? 28.663  56.753 58.145  1.00 34.98 ? 327 VAL A CG1 1 
ATOM   1873 C CG2 . VAL A 1 293 ? 27.153  56.568 56.225  1.00 34.20 ? 327 VAL A CG2 1 
ATOM   1874 N N   . LEU A 1 294 ? 30.795  53.946 56.877  1.00 36.32 ? 328 LEU A N   1 
ATOM   1875 C CA  . LEU A 1 294 ? 31.890  53.256 57.556  1.00 36.79 ? 328 LEU A CA  1 
ATOM   1876 C C   . LEU A 1 294 ? 33.209  53.500 56.850  1.00 37.50 ? 328 LEU A C   1 
ATOM   1877 O O   . LEU A 1 294 ? 34.245  53.681 57.503  1.00 37.50 ? 328 LEU A O   1 
ATOM   1878 C CB  . LEU A 1 294 ? 31.601  51.758 57.658  1.00 36.51 ? 328 LEU A CB  1 
ATOM   1879 C CG  . LEU A 1 294 ? 30.411  51.385 58.556  1.00 36.32 ? 328 LEU A CG  1 
ATOM   1880 C CD1 . LEU A 1 294 ? 30.050  49.912 58.390  1.00 36.07 ? 328 LEU A CD1 1 
ATOM   1881 C CD2 . LEU A 1 294 ? 30.656  51.727 60.032  1.00 35.09 ? 328 LEU A CD2 1 
ATOM   1882 N N   . GLN A 1 295 ? 33.152  53.536 55.518  1.00 38.44 ? 329 GLN A N   1 
ATOM   1883 C CA  . GLN A 1 295 ? 34.324  53.780 54.681  1.00 39.29 ? 329 GLN A CA  1 
ATOM   1884 C C   . GLN A 1 295 ? 34.737  55.247 54.556  1.00 39.74 ? 329 GLN A C   1 
ATOM   1885 O O   . GLN A 1 295 ? 35.796  55.540 54.008  1.00 40.07 ? 329 GLN A O   1 
ATOM   1886 C CB  . GLN A 1 295 ? 34.122  53.174 53.295  1.00 39.30 ? 329 GLN A CB  1 
ATOM   1887 C CG  . GLN A 1 295 ? 34.229  51.669 53.274  1.00 40.94 ? 329 GLN A CG  1 
ATOM   1888 C CD  . GLN A 1 295 ? 35.405  51.167 54.101  1.00 43.10 ? 329 GLN A CD  1 
ATOM   1889 O OE1 . GLN A 1 295 ? 36.551  51.578 53.894  1.00 44.16 ? 329 GLN A OE1 1 
ATOM   1890 N NE2 . GLN A 1 295 ? 35.124  50.278 55.051  1.00 43.81 ? 329 GLN A NE2 1 
ATOM   1891 N N   . HIS A 1 296 ? 33.915  56.162 55.063  1.00 40.32 ? 330 HIS A N   1 
ATOM   1892 C CA  . HIS A 1 296 ? 34.225  57.586 54.998  1.00 41.16 ? 330 HIS A CA  1 
ATOM   1893 C C   . HIS A 1 296 ? 35.447  57.921 55.862  1.00 42.17 ? 330 HIS A C   1 
ATOM   1894 O O   . HIS A 1 296 ? 35.561  57.413 56.974  1.00 42.36 ? 330 HIS A O   1 
ATOM   1895 C CB  . HIS A 1 296 ? 33.016  58.410 55.441  1.00 40.99 ? 330 HIS A CB  1 
ATOM   1896 C CG  . HIS A 1 296 ? 33.165  59.877 55.199  1.00 40.70 ? 330 HIS A CG  1 
ATOM   1897 N ND1 . HIS A 1 296 ? 33.915  60.694 56.018  1.00 41.05 ? 330 HIS A ND1 1 
ATOM   1898 C CD2 . HIS A 1 296 ? 32.675  60.672 54.221  1.00 40.27 ? 330 HIS A CD2 1 
ATOM   1899 C CE1 . HIS A 1 296 ? 33.878  61.931 55.558  1.00 40.70 ? 330 HIS A CE1 1 
ATOM   1900 N NE2 . HIS A 1 296 ? 33.130  61.945 54.469  1.00 40.74 ? 330 HIS A NE2 1 
ATOM   1901 N N   . PRO A 1 297 ? 36.369  58.767 55.346  1.00 43.20 ? 331 PRO A N   1 
ATOM   1902 C CA  . PRO A 1 297 ? 37.601  59.203 56.038  1.00 43.97 ? 331 PRO A CA  1 
ATOM   1903 C C   . PRO A 1 297 ? 37.437  59.779 57.459  1.00 44.91 ? 331 PRO A C   1 
ATOM   1904 O O   . PRO A 1 297 ? 38.346  59.622 58.286  1.00 44.99 ? 331 PRO A O   1 
ATOM   1905 C CB  . PRO A 1 297 ? 38.158  60.287 55.109  1.00 43.91 ? 331 PRO A CB  1 
ATOM   1906 C CG  . PRO A 1 297 ? 37.646  59.944 53.778  1.00 43.52 ? 331 PRO A CG  1 
ATOM   1907 C CD  . PRO A 1 297 ? 36.289  59.340 53.987  1.00 43.28 ? 331 PRO A CD  1 
ATOM   1908 N N   . TRP A 1 298 ? 36.318  60.453 57.731  1.00 45.82 ? 332 TRP A N   1 
ATOM   1909 C CA  . TRP A 1 298 ? 36.068  61.039 59.055  1.00 46.75 ? 332 TRP A CA  1 
ATOM   1910 C C   . TRP A 1 298 ? 35.689  59.978 60.082  1.00 47.76 ? 332 TRP A C   1 
ATOM   1911 O O   . TRP A 1 298 ? 36.082  60.055 61.247  1.00 47.88 ? 332 TRP A O   1 
ATOM   1912 C CB  . TRP A 1 298 ? 34.984  62.108 58.978  1.00 46.27 ? 332 TRP A CB  1 
ATOM   1913 C CG  . TRP A 1 298 ? 34.796  62.907 60.254  1.00 46.01 ? 332 TRP A CG  1 
ATOM   1914 C CD1 . TRP A 1 298 ? 35.610  63.903 60.731  1.00 45.74 ? 332 TRP A CD1 1 
ATOM   1915 C CD2 . TRP A 1 298 ? 33.714  62.794 61.193  1.00 45.52 ? 332 TRP A CD2 1 
ATOM   1916 N NE1 . TRP A 1 298 ? 35.105  64.405 61.907  1.00 45.59 ? 332 TRP A NE1 1 
ATOM   1917 C CE2 . TRP A 1 298 ? 33.942  63.746 62.211  1.00 45.13 ? 332 TRP A CE2 1 
ATOM   1918 C CE3 . TRP A 1 298 ? 32.573  61.979 61.272  1.00 45.59 ? 332 TRP A CE3 1 
ATOM   1919 C CZ2 . TRP A 1 298 ? 33.072  63.908 63.291  1.00 45.25 ? 332 TRP A CZ2 1 
ATOM   1920 C CZ3 . TRP A 1 298 ? 31.703  62.145 62.349  1.00 45.48 ? 332 TRP A CZ3 1 
ATOM   1921 C CH2 . TRP A 1 298 ? 31.962  63.100 63.342  1.00 45.61 ? 332 TRP A CH2 1 
ATOM   1922 N N   . VAL A 1 299 ? 34.912  58.998 59.639  1.00 49.19 ? 333 VAL A N   1 
ATOM   1923 C CA  . VAL A 1 299 ? 34.645  57.805 60.424  1.00 50.62 ? 333 VAL A CA  1 
ATOM   1924 C C   . VAL A 1 299 ? 35.932  56.967 60.468  1.00 51.93 ? 333 VAL A C   1 
ATOM   1925 O O   . VAL A 1 299 ? 36.167  56.226 61.423  1.00 52.19 ? 333 VAL A O   1 
ATOM   1926 C CB  . VAL A 1 299 ? 33.455  57.020 59.837  1.00 50.45 ? 333 VAL A CB  1 
ATOM   1927 C CG1 . VAL A 1 299 ? 33.175  55.771 60.637  1.00 50.55 ? 333 VAL A CG1 1 
ATOM   1928 C CG2 . VAL A 1 299 ? 32.219  57.894 59.814  1.00 50.04 ? 333 VAL A CG2 1 
ATOM   1929 N N   . GLN A 1 300 ? 36.755  57.109 59.424  1.00 53.55 ? 334 GLN A N   1 
ATOM   1930 C CA  . GLN A 1 300 ? 38.159  56.649 59.390  1.00 55.14 ? 334 GLN A CA  1 
ATOM   1931 C C   . GLN A 1 300 ? 38.336  55.131 59.346  1.00 55.74 ? 334 GLN A C   1 
ATOM   1932 O O   . GLN A 1 300 ? 39.126  54.567 60.118  1.00 56.00 ? 334 GLN A O   1 
ATOM   1933 C CB  . GLN A 1 300 ? 38.952  57.249 60.558  1.00 55.32 ? 334 GLN A CB  1 
ATOM   1934 C CG  . GLN A 1 300 ? 40.366  57.665 60.203  1.00 57.46 ? 334 GLN A CG  1 
ATOM   1935 C CD  . GLN A 1 300 ? 40.788  58.957 60.907  1.00 60.31 ? 334 GLN A CD  1 
ATOM   1936 O OE1 . GLN A 1 300 ? 39.972  59.630 61.552  1.00 61.04 ? 334 GLN A OE1 1 
ATOM   1937 N NE2 . GLN A 1 300 ? 42.069  59.312 60.776  1.00 61.13 ? 334 GLN A NE2 1 
ATOM   1938 N N   . GLY A 1 301 ? 37.613  54.482 58.430  1.00 56.34 ? 335 GLY A N   1 
ATOM   1939 C CA  . GLY A 1 301 ? 37.638  53.017 58.301  1.00 56.76 ? 335 GLY A CA  1 
ATOM   1940 C C   . GLY A 1 301 ? 38.218  52.538 56.981  1.00 56.96 ? 335 GLY A C   1 
ATOM   1941 O O   . GLY A 1 301 ? 38.203  53.264 55.982  1.00 57.11 ? 335 GLY A O   1 
ATOM   1942 N N   . LEU B 1 6   ? -16.610 34.611 80.806  1.00 56.34 ? 40  LEU B N   1 
ATOM   1943 C CA  . LEU B 1 6   ? -15.295 35.127 81.295  1.00 56.42 ? 40  LEU B CA  1 
ATOM   1944 C C   . LEU B 1 6   ? -15.464 36.549 81.873  1.00 55.97 ? 40  LEU B C   1 
ATOM   1945 O O   . LEU B 1 6   ? -16.233 37.346 81.313  1.00 56.15 ? 40  LEU B O   1 
ATOM   1946 C CB  . LEU B 1 6   ? -14.243 35.095 80.158  1.00 56.72 ? 40  LEU B CB  1 
ATOM   1947 C CG  . LEU B 1 6   ? -13.824 33.739 79.538  1.00 57.11 ? 40  LEU B CG  1 
ATOM   1948 C CD1 . LEU B 1 6   ? -13.353 33.895 78.087  1.00 56.92 ? 40  LEU B CD1 1 
ATOM   1949 C CD2 . LEU B 1 6   ? -12.762 32.997 80.377  1.00 57.33 ? 40  LEU B CD2 1 
ATOM   1950 N N   . PRO B 1 7   ? -14.766 36.866 83.000  1.00 55.28 ? 41  PRO B N   1 
ATOM   1951 C CA  . PRO B 1 7   ? -14.838 38.224 83.583  1.00 54.42 ? 41  PRO B CA  1 
ATOM   1952 C C   . PRO B 1 7   ? -14.289 39.308 82.645  1.00 53.37 ? 41  PRO B C   1 
ATOM   1953 O O   . PRO B 1 7   ? -13.570 38.998 81.678  1.00 53.17 ? 41  PRO B O   1 
ATOM   1954 C CB  . PRO B 1 7   ? -13.976 38.124 84.858  1.00 54.47 ? 41  PRO B CB  1 
ATOM   1955 C CG  . PRO B 1 7   ? -13.069 36.960 84.621  1.00 54.91 ? 41  PRO B CG  1 
ATOM   1956 C CD  . PRO B 1 7   ? -13.883 35.984 83.793  1.00 55.27 ? 41  PRO B CD  1 
ATOM   1957 N N   . GLY B 1 8   ? -14.633 40.562 82.942  1.00 52.10 ? 42  GLY B N   1 
ATOM   1958 C CA  . GLY B 1 8   ? -14.265 41.690 82.101  1.00 50.29 ? 42  GLY B CA  1 
ATOM   1959 C C   . GLY B 1 8   ? -12.766 41.849 81.963  1.00 49.03 ? 42  GLY B C   1 
ATOM   1960 O O   . GLY B 1 8   ? -12.008 41.510 82.874  1.00 49.02 ? 42  GLY B O   1 
ATOM   1961 N N   . LYS B 1 9   ? -12.345 42.324 80.794  1.00 47.71 ? 43  LYS B N   1 
ATOM   1962 C CA  . LYS B 1 9   ? -10.990 42.819 80.584  1.00 46.12 ? 43  LYS B CA  1 
ATOM   1963 C C   . LYS B 1 9   ? -11.064 44.332 80.597  1.00 45.42 ? 43  LYS B C   1 
ATOM   1964 O O   . LYS B 1 9   ? -12.083 44.918 80.240  1.00 45.24 ? 43  LYS B O   1 
ATOM   1965 C CB  . LYS B 1 9   ? -10.418 42.332 79.253  1.00 45.95 ? 43  LYS B CB  1 
ATOM   1966 C CG  . LYS B 1 9   ? -10.292 40.831 79.164  1.00 45.07 ? 43  LYS B CG  1 
ATOM   1967 C CD  . LYS B 1 9   ? -9.306  40.399 78.106  1.00 43.84 ? 43  LYS B CD  1 
ATOM   1968 C CE  . LYS B 1 9   ? -9.207  38.889 78.098  1.00 43.72 ? 43  LYS B CE  1 
ATOM   1969 N NZ  . LYS B 1 9   ? -8.441  38.370 76.948  1.00 43.60 ? 43  LYS B NZ  1 
ATOM   1970 N N   . PHE B 1 10  ? -9.989  44.974 81.019  1.00 44.62 ? 44  PHE B N   1 
ATOM   1971 C CA  . PHE B 1 10  ? -9.984  46.421 81.079  1.00 43.73 ? 44  PHE B CA  1 
ATOM   1972 C C   . PHE B 1 10  ? -10.165 46.988 79.671  1.00 43.73 ? 44  PHE B C   1 
ATOM   1973 O O   . PHE B 1 10  ? -10.879 47.970 79.483  1.00 43.77 ? 44  PHE B O   1 
ATOM   1974 C CB  . PHE B 1 10  ? -8.694  46.912 81.730  1.00 43.25 ? 44  PHE B CB  1 
ATOM   1975 C CG  . PHE B 1 10  ? -8.644  48.390 81.937  1.00 42.39 ? 44  PHE B CG  1 
ATOM   1976 C CD1 . PHE B 1 10  ? -7.782  49.179 81.177  1.00 41.68 ? 44  PHE B CD1 1 
ATOM   1977 C CD2 . PHE B 1 10  ? -9.456  49.000 82.887  1.00 41.50 ? 44  PHE B CD2 1 
ATOM   1978 C CE1 . PHE B 1 10  ? -7.725  50.556 81.354  1.00 40.96 ? 44  PHE B CE1 1 
ATOM   1979 C CE2 . PHE B 1 10  ? -9.410  50.377 83.075  1.00 41.58 ? 44  PHE B CE2 1 
ATOM   1980 C CZ  . PHE B 1 10  ? -8.538  51.157 82.302  1.00 42.03 ? 44  PHE B CZ  1 
ATOM   1981 N N   . GLU B 1 11  ? -9.556  46.328 78.684  1.00 43.59 ? 45  GLU B N   1 
ATOM   1982 C CA  . GLU B 1 11  ? -9.545  46.808 77.298  1.00 43.50 ? 45  GLU B CA  1 
ATOM   1983 C C   . GLU B 1 11  ? -10.913 46.784 76.585  1.00 43.47 ? 45  GLU B C   1 
ATOM   1984 O O   . GLU B 1 11  ? -11.065 47.348 75.498  1.00 43.46 ? 45  GLU B O   1 
ATOM   1985 C CB  . GLU B 1 11  ? -8.486  46.071 76.473  1.00 43.35 ? 45  GLU B CB  1 
ATOM   1986 C CG  . GLU B 1 11  ? -8.832  44.640 76.155  1.00 43.44 ? 45  GLU B CG  1 
ATOM   1987 C CD  . GLU B 1 11  ? -7.804  43.975 75.270  1.00 43.86 ? 45  GLU B CD  1 
ATOM   1988 O OE1 . GLU B 1 11  ? -7.830  42.726 75.190  1.00 44.29 ? 45  GLU B OE1 1 
ATOM   1989 O OE2 . GLU B 1 11  ? -6.979  44.693 74.653  1.00 44.08 ? 45  GLU B OE2 1 
ATOM   1990 N N   . ASP B 1 12  ? -11.892 46.122 77.198  1.00 43.30 ? 46  ASP B N   1 
ATOM   1991 C CA  . ASP B 1 12  ? -13.272 46.131 76.715  1.00 42.93 ? 46  ASP B CA  1 
ATOM   1992 C C   . ASP B 1 12  ? -14.099 47.179 77.465  1.00 42.92 ? 46  ASP B C   1 
ATOM   1993 O O   . ASP B 1 12  ? -15.287 47.358 77.193  1.00 42.78 ? 46  ASP B O   1 
ATOM   1994 C CB  . ASP B 1 12  ? -13.888 44.747 76.899  1.00 42.85 ? 46  ASP B CB  1 
ATOM   1995 C CG  . ASP B 1 12  ? -13.022 43.646 76.327  1.00 42.76 ? 46  ASP B CG  1 
ATOM   1996 O OD1 . ASP B 1 12  ? -12.522 43.808 75.196  1.00 43.03 ? 46  ASP B OD1 1 
ATOM   1997 O OD2 . ASP B 1 12  ? -12.844 42.617 77.009  1.00 42.82 ? 46  ASP B OD2 1 
ATOM   1998 N N   . MET B 1 13  ? -13.449 47.875 78.398  1.00 42.88 ? 47  MET B N   1 
ATOM   1999 C CA  . MET B 1 13  ? -14.112 48.802 79.305  1.00 43.18 ? 47  MET B CA  1 
ATOM   2000 C C   . MET B 1 13  ? -13.636 50.233 79.115  1.00 42.60 ? 47  MET B C   1 
ATOM   2001 O O   . MET B 1 13  ? -14.447 51.146 79.041  1.00 42.65 ? 47  MET B O   1 
ATOM   2002 C CB  . MET B 1 13  ? -13.861 48.394 80.759  1.00 43.47 ? 47  MET B CB  1 
ATOM   2003 C CG  . MET B 1 13  ? -14.566 47.137 81.237  1.00 43.83 ? 47  MET B CG  1 
ATOM   2004 S SD  . MET B 1 13  ? -13.901 46.596 82.838  1.00 44.66 ? 47  MET B SD  1 
ATOM   2005 C CE  . MET B 1 13  ? -14.926 45.128 83.096  1.00 45.08 ? 47  MET B CE  1 
ATOM   2006 N N   . TYR B 1 14  ? -12.323 50.433 79.077  1.00 42.18 ? 48  TYR B N   1 
ATOM   2007 C CA  . TYR B 1 14  ? -11.764 51.769 78.920  1.00 42.10 ? 48  TYR B CA  1 
ATOM   2008 C C   . TYR B 1 14  ? -10.663 51.778 77.876  1.00 42.26 ? 48  TYR B C   1 
ATOM   2009 O O   . TYR B 1 14  ? -9.845  50.859 77.824  1.00 42.19 ? 48  TYR B O   1 
ATOM   2010 C CB  . TYR B 1 14  ? -11.189 52.289 80.245  1.00 42.01 ? 48  TYR B CB  1 
ATOM   2011 C CG  . TYR B 1 14  ? -12.210 52.610 81.312  1.00 41.64 ? 48  TYR B CG  1 
ATOM   2012 C CD1 . TYR B 1 14  ? -12.781 51.595 82.083  1.00 41.86 ? 48  TYR B CD1 1 
ATOM   2013 C CD2 . TYR B 1 14  ? -12.591 53.921 81.571  1.00 40.83 ? 48  TYR B CD2 1 
ATOM   2014 C CE1 . TYR B 1 14  ? -13.727 51.867 83.070  1.00 41.46 ? 48  TYR B CE1 1 
ATOM   2015 C CE2 . TYR B 1 14  ? -13.539 54.209 82.561  1.00 41.65 ? 48  TYR B CE2 1 
ATOM   2016 C CZ  . TYR B 1 14  ? -14.099 53.169 83.308  1.00 41.81 ? 48  TYR B CZ  1 
ATOM   2017 O OH  . TYR B 1 14  ? -15.031 53.416 84.293  1.00 42.17 ? 48  TYR B OH  1 
ATOM   2018 N N   . LYS B 1 15  ? -10.641 52.821 77.051  1.00 42.42 ? 49  LYS B N   1 
ATOM   2019 C CA  . LYS B 1 15  ? -9.520  53.054 76.151  1.00 42.83 ? 49  LYS B CA  1 
ATOM   2020 C C   . LYS B 1 15  ? -8.680  54.163 76.752  1.00 42.85 ? 49  LYS B C   1 
ATOM   2021 O O   . LYS B 1 15  ? -9.178  55.262 76.992  1.00 42.74 ? 49  LYS B O   1 
ATOM   2022 C CB  . LYS B 1 15  ? -9.998  53.438 74.739  1.00 43.09 ? 49  LYS B CB  1 
ATOM   2023 C CG  . LYS B 1 15  ? -8.887  53.615 73.677  1.00 43.75 ? 49  LYS B CG  1 
ATOM   2024 C CD  . LYS B 1 15  ? -8.756  52.404 72.743  1.00 45.97 ? 49  LYS B CD  1 
ATOM   2025 C CE  . LYS B 1 15  ? -7.826  51.316 73.313  1.00 47.27 ? 49  LYS B CE  1 
ATOM   2026 N NZ  . LYS B 1 15  ? -8.027  49.969 72.666  1.00 46.99 ? 49  LYS B NZ  1 
ATOM   2027 N N   . LEU B 1 16  ? -7.414  53.851 77.012  1.00 43.15 ? 50  LEU B N   1 
ATOM   2028 C CA  . LEU B 1 16  ? -6.456  54.818 77.534  1.00 43.42 ? 50  LEU B CA  1 
ATOM   2029 C C   . LEU B 1 16  ? -6.105  55.828 76.459  1.00 43.66 ? 50  LEU B C   1 
ATOM   2030 O O   . LEU B 1 16  ? -6.098  55.523 75.268  1.00 43.70 ? 50  LEU B O   1 
ATOM   2031 C CB  . LEU B 1 16  ? -5.190  54.127 78.065  1.00 43.39 ? 50  LEU B CB  1 
ATOM   2032 C CG  . LEU B 1 16  ? -5.334  53.229 79.301  1.00 43.50 ? 50  LEU B CG  1 
ATOM   2033 C CD1 . LEU B 1 16  ? -4.132  52.318 79.472  1.00 43.52 ? 50  LEU B CD1 1 
ATOM   2034 C CD2 . LEU B 1 16  ? -5.548  54.053 80.561  1.00 43.92 ? 50  LEU B CD2 1 
ATOM   2035 N N   . THR B 1 17  ? -5.810  57.034 76.913  1.00 44.27 ? 51  THR B N   1 
ATOM   2036 C CA  . THR B 1 17  ? -5.627  58.198 76.069  1.00 44.90 ? 51  THR B CA  1 
ATOM   2037 C C   . THR B 1 17  ? -4.135  58.489 75.952  1.00 45.34 ? 51  THR B C   1 
ATOM   2038 O O   . THR B 1 17  ? -3.348  58.029 76.770  1.00 45.92 ? 51  THR B O   1 
ATOM   2039 C CB  . THR B 1 17  ? -6.409  59.377 76.697  1.00 44.95 ? 51  THR B CB  1 
ATOM   2040 O OG1 . THR B 1 17  ? -7.793  59.254 76.353  1.00 44.89 ? 51  THR B OG1 1 
ATOM   2041 C CG2 . THR B 1 17  ? -5.913  60.722 76.243  1.00 45.66 ? 51  THR B CG2 1 
ATOM   2042 N N   . SER B 1 18  ? -3.739  59.227 74.923  1.00 45.86 ? 52  SER B N   1 
ATOM   2043 C CA  . SER B 1 18  ? -2.341  59.618 74.753  1.00 46.47 ? 52  SER B CA  1 
ATOM   2044 C C   . SER B 1 18  ? -1.907  60.675 75.783  1.00 46.78 ? 52  SER B C   1 
ATOM   2045 O O   . SER B 1 18  ? -0.814  61.255 75.683  1.00 47.04 ? 52  SER B O   1 
ATOM   2046 C CB  . SER B 1 18  ? -2.087  60.097 73.316  1.00 46.58 ? 52  SER B CB  1 
ATOM   2047 O OG  . SER B 1 18  ? -3.290  60.484 72.660  1.00 47.47 ? 52  SER B OG  1 
ATOM   2048 N N   . GLU B 1 19  ? -2.768  60.899 76.776  1.00 46.86 ? 53  GLU B N   1 
ATOM   2049 C CA  . GLU B 1 19  ? -2.560  61.905 77.810  1.00 47.19 ? 53  GLU B CA  1 
ATOM   2050 C C   . GLU B 1 19  ? -1.360  61.607 78.721  1.00 47.09 ? 53  GLU B C   1 
ATOM   2051 O O   . GLU B 1 19  ? -0.247  62.097 78.471  1.00 47.87 ? 53  GLU B O   1 
ATOM   2052 C CB  . GLU B 1 19  ? -3.826  62.073 78.643  1.00 47.32 ? 53  GLU B CB  1 
ATOM   2053 C CG  . GLU B 1 19  ? -3.862  63.370 79.418  1.00 48.86 ? 53  GLU B CG  1 
ATOM   2054 C CD  . GLU B 1 19  ? -5.260  63.945 79.523  1.00 50.86 ? 53  GLU B CD  1 
ATOM   2055 O OE1 . GLU B 1 19  ? -5.420  64.965 80.231  1.00 50.61 ? 53  GLU B OE1 1 
ATOM   2056 O OE2 . GLU B 1 19  ? -6.194  63.380 78.894  1.00 52.41 ? 53  GLU B OE2 1 
ATOM   2057 N N   . LEU B 1 20  ? -1.583  60.794 79.750  1.00 45.97 ? 54  LEU B N   1 
ATOM   2058 C CA  . LEU B 1 20  ? -0.577  60.525 80.776  1.00 45.46 ? 54  LEU B CA  1 
ATOM   2059 C C   . LEU B 1 20  ? -0.358  61.739 81.665  1.00 45.11 ? 54  LEU B C   1 
ATOM   2060 O O   . LEU B 1 20  ? 0.404   62.642 81.344  1.00 44.91 ? 54  LEU B O   1 
ATOM   2061 C CB  . LEU B 1 20  ? 0.756   59.983 80.218  1.00 45.14 ? 54  LEU B CB  1 
ATOM   2062 C CG  . LEU B 1 20  ? 1.611   59.266 81.284  1.00 44.74 ? 54  LEU B CG  1 
ATOM   2063 C CD1 . LEU B 1 20  ? 1.145   57.834 81.524  1.00 43.87 ? 54  LEU B CD1 1 
ATOM   2064 C CD2 . LEU B 1 20  ? 3.077   59.259 80.934  1.00 44.82 ? 54  LEU B CD2 1 
ATOM   2065 N N   . LEU B 1 21  ? -1.060  61.737 82.788  1.00 44.87 ? 55  LEU B N   1 
ATOM   2066 C CA  . LEU B 1 21  ? -0.980  62.797 83.761  1.00 44.72 ? 55  LEU B CA  1 
ATOM   2067 C C   . LEU B 1 21  ? 0.236   62.596 84.656  1.00 44.60 ? 55  LEU B C   1 
ATOM   2068 O O   . LEU B 1 21  ? 0.894   63.569 85.025  1.00 45.12 ? 55  LEU B O   1 
ATOM   2069 C CB  . LEU B 1 21  ? -2.255  62.839 84.607  1.00 44.88 ? 55  LEU B CB  1 
ATOM   2070 C CG  . LEU B 1 21  ? -3.593  63.080 83.905  1.00 44.83 ? 55  LEU B CG  1 
ATOM   2071 C CD1 . LEU B 1 21  ? -4.301  61.765 83.682  1.00 44.39 ? 55  LEU B CD1 1 
ATOM   2072 C CD2 . LEU B 1 21  ? -4.464  63.995 84.748  1.00 45.42 ? 55  LEU B CD2 1 
ATOM   2073 N N   . GLY B 1 22  ? 0.531   61.344 85.007  1.00 44.04 ? 56  GLY B N   1 
ATOM   2074 C CA  . GLY B 1 22  ? 1.683   61.036 85.847  1.00 43.10 ? 56  GLY B CA  1 
ATOM   2075 C C   . GLY B 1 22  ? 2.180   59.611 85.742  1.00 42.63 ? 56  GLY B C   1 
ATOM   2076 O O   . GLY B 1 22  ? 1.436   58.705 85.370  1.00 42.15 ? 56  GLY B O   1 
ATOM   2077 N N   . GLU B 1 23  ? 3.446   59.422 86.106  1.00 42.51 ? 57  GLU B N   1 
ATOM   2078 C CA  . GLU B 1 23  ? 4.113   58.122 86.019  1.00 42.61 ? 57  GLU B CA  1 
ATOM   2079 C C   . GLU B 1 23  ? 5.126   57.894 87.145  1.00 41.67 ? 57  GLU B C   1 
ATOM   2080 O O   . GLU B 1 23  ? 5.926   58.772 87.465  1.00 41.88 ? 57  GLU B O   1 
ATOM   2081 C CB  . GLU B 1 23  ? 4.812   57.984 84.668  1.00 43.17 ? 57  GLU B CB  1 
ATOM   2082 C CG  . GLU B 1 23  ? 6.139   58.777 84.513  1.00 46.70 ? 57  GLU B CG  1 
ATOM   2083 C CD  . GLU B 1 23  ? 5.958   60.242 84.071  1.00 49.99 ? 57  GLU B CD  1 
ATOM   2084 O OE1 . GLU B 1 23  ? 5.403   61.055 84.857  1.00 51.69 ? 57  GLU B OE1 1 
ATOM   2085 O OE2 . GLU B 1 23  ? 6.399   60.577 82.942  1.00 50.29 ? 57  GLU B OE2 1 
ATOM   2086 N N   . GLY B 1 24  ? 5.087   56.710 87.744  1.00 40.57 ? 58  GLY B N   1 
ATOM   2087 C CA  . GLY B 1 24  ? 6.050   56.342 88.773  1.00 39.01 ? 58  GLY B CA  1 
ATOM   2088 C C   . GLY B 1 24  ? 6.297   54.846 88.827  1.00 38.17 ? 58  GLY B C   1 
ATOM   2089 O O   . GLY B 1 24  ? 5.685   54.078 88.073  1.00 38.03 ? 58  GLY B O   1 
ATOM   2090 N N   . ALA B 1 25  ? 7.172   54.432 89.743  1.00 37.00 ? 59  ALA B N   1 
ATOM   2091 C CA  . ALA B 1 25  ? 7.630   53.051 89.811  1.00 35.74 ? 59  ALA B CA  1 
ATOM   2092 C C   . ALA B 1 25  ? 6.564   52.048 90.239  1.00 35.23 ? 59  ALA B C   1 
ATOM   2093 O O   . ALA B 1 25  ? 6.770   50.842 90.077  1.00 35.31 ? 59  ALA B O   1 
ATOM   2094 C CB  . ALA B 1 25  ? 8.863   52.933 90.683  1.00 35.61 ? 59  ALA B CB  1 
ATOM   2095 N N   . TYR B 1 26  ? 5.431   52.511 90.771  1.00 34.32 ? 60  TYR B N   1 
ATOM   2096 C CA  . TYR B 1 26  ? 4.342   51.568 91.065  1.00 33.78 ? 60  TYR B CA  1 
ATOM   2097 C C   . TYR B 1 26  ? 2.987   51.916 90.484  1.00 33.93 ? 60  TYR B C   1 
ATOM   2098 O O   . TYR B 1 26  ? 2.093   51.071 90.481  1.00 34.23 ? 60  TYR B O   1 
ATOM   2099 C CB  . TYR B 1 26  ? 4.221   51.233 92.564  1.00 33.32 ? 60  TYR B CB  1 
ATOM   2100 C CG  . TYR B 1 26  ? 3.749   52.348 93.477  1.00 32.54 ? 60  TYR B CG  1 
ATOM   2101 C CD1 . TYR B 1 26  ? 2.398   52.684 93.577  1.00 31.80 ? 60  TYR B CD1 1 
ATOM   2102 C CD2 . TYR B 1 26  ? 4.657   53.043 94.272  1.00 31.49 ? 60  TYR B CD2 1 
ATOM   2103 C CE1 . TYR B 1 26  ? 1.976   53.710 94.424  1.00 31.41 ? 60  TYR B CE1 1 
ATOM   2104 C CE2 . TYR B 1 26  ? 4.245   54.054 95.115  1.00 30.96 ? 60  TYR B CE2 1 
ATOM   2105 C CZ  . TYR B 1 26  ? 2.912   54.383 95.191  1.00 31.44 ? 60  TYR B CZ  1 
ATOM   2106 O OH  . TYR B 1 26  ? 2.526   55.386 96.051  1.00 31.76 ? 60  TYR B OH  1 
ATOM   2107 N N   . ALA B 1 27  ? 2.836   53.145 89.995  1.00 33.98 ? 61  ALA B N   1 
ATOM   2108 C CA  . ALA B 1 27  ? 1.566   53.600 89.433  1.00 34.03 ? 61  ALA B CA  1 
ATOM   2109 C C   . ALA B 1 27  ? 1.732   54.668 88.355  1.00 34.42 ? 61  ALA B C   1 
ATOM   2110 O O   . ALA B 1 27  ? 2.729   55.405 88.326  1.00 34.56 ? 61  ALA B O   1 
ATOM   2111 C CB  . ALA B 1 27  ? 0.649   54.111 90.533  1.00 33.52 ? 61  ALA B CB  1 
ATOM   2112 N N   . LYS B 1 28  ? 0.746   54.736 87.464  1.00 34.66 ? 62  LYS B N   1 
ATOM   2113 C CA  . LYS B 1 28  ? 0.590   55.880 86.572  1.00 34.58 ? 62  LYS B CA  1 
ATOM   2114 C C   . LYS B 1 28  ? -0.829  56.432 86.690  1.00 35.15 ? 62  LYS B C   1 
ATOM   2115 O O   . LYS B 1 28  ? -1.713  55.797 87.289  1.00 35.06 ? 62  LYS B O   1 
ATOM   2116 C CB  . LYS B 1 28  ? 0.957   55.542 85.110  1.00 34.43 ? 62  LYS B CB  1 
ATOM   2117 C CG  . LYS B 1 28  ? 0.087   54.491 84.417  1.00 33.77 ? 62  LYS B CG  1 
ATOM   2118 C CD  . LYS B 1 28  ? 0.523   54.319 82.984  1.00 33.60 ? 62  LYS B CD  1 
ATOM   2119 C CE  . LYS B 1 28  ? -0.185  53.173 82.278  1.00 33.01 ? 62  LYS B CE  1 
ATOM   2120 N NZ  . LYS B 1 28  ? 0.089   53.131 80.771  1.00 31.71 ? 62  LYS B NZ  1 
ATOM   2121 N N   . VAL B 1 29  ? -1.023  57.634 86.155  1.00 35.56 ? 63  VAL B N   1 
ATOM   2122 C CA  . VAL B 1 29  ? -2.349  58.211 86.015  1.00 35.97 ? 63  VAL B CA  1 
ATOM   2123 C C   . VAL B 1 29  ? -2.425  58.637 84.568  1.00 36.46 ? 63  VAL B C   1 
ATOM   2124 O O   . VAL B 1 29  ? -1.633  59.453 84.101  1.00 36.63 ? 63  VAL B O   1 
ATOM   2125 C CB  . VAL B 1 29  ? -2.600  59.427 86.960  1.00 36.09 ? 63  VAL B CB  1 
ATOM   2126 C CG1 . VAL B 1 29  ? -4.030  59.928 86.818  1.00 36.16 ? 63  VAL B CG1 1 
ATOM   2127 C CG2 . VAL B 1 29  ? -2.341  59.067 88.401  1.00 35.18 ? 63  VAL B CG2 1 
ATOM   2128 N N   . GLN B 1 30  ? -3.368  58.055 83.847  1.00 37.02 ? 64  GLN B N   1 
ATOM   2129 C CA  . GLN B 1 30  ? -3.492  58.322 82.437  1.00 37.32 ? 64  GLN B CA  1 
ATOM   2130 C C   . GLN B 1 30  ? -4.926  58.640 82.123  1.00 37.81 ? 64  GLN B C   1 
ATOM   2131 O O   . GLN B 1 30  ? -5.833  58.050 82.700  1.00 37.81 ? 64  GLN B O   1 
ATOM   2132 C CB  . GLN B 1 30  ? -3.080  57.095 81.665  1.00 37.15 ? 64  GLN B CB  1 
ATOM   2133 C CG  . GLN B 1 30  ? -2.719  57.373 80.245  1.00 37.77 ? 64  GLN B CG  1 
ATOM   2134 C CD  . GLN B 1 30  ? -2.087  56.173 79.613  1.00 38.53 ? 64  GLN B CD  1 
ATOM   2135 O OE1 . GLN B 1 30  ? -1.803  55.186 80.299  1.00 38.59 ? 64  GLN B OE1 1 
ATOM   2136 N NE2 . GLN B 1 30  ? -1.856  56.236 78.301  1.00 36.70 ? 64  GLN B NE2 1 
ATOM   2137 N N   . GLY B 1 31  ? -5.134  59.587 81.217  1.00 38.66 ? 65  GLY B N   1 
ATOM   2138 C CA  . GLY B 1 31  ? -6.476  59.867 80.730  1.00 39.77 ? 65  GLY B CA  1 
ATOM   2139 C C   . GLY B 1 31  ? -7.050  58.599 80.121  1.00 40.49 ? 65  GLY B C   1 
ATOM   2140 O O   . GLY B 1 31  ? -6.311  57.771 79.582  1.00 40.75 ? 65  GLY B O   1 
ATOM   2141 N N   . ALA B 1 32  ? -8.361  58.427 80.229  1.00 41.04 ? 66  ALA B N   1 
ATOM   2142 C CA  . ALA B 1 32  ? -9.031  57.298 79.597  1.00 41.65 ? 66  ALA B CA  1 
ATOM   2143 C C   . ALA B 1 32  ? -10.453 57.654 79.205  1.00 42.17 ? 66  ALA B C   1 
ATOM   2144 O O   . ALA B 1 32  ? -11.061 58.562 79.784  1.00 42.36 ? 66  ALA B O   1 
ATOM   2145 C CB  . ALA B 1 32  ? -9.024  56.090 80.509  1.00 41.62 ? 66  ALA B CB  1 
ATOM   2146 N N   . VAL B 1 33  ? -10.972 56.934 78.215  1.00 42.69 ? 67  VAL B N   1 
ATOM   2147 C CA  . VAL B 1 33  ? -12.346 57.110 77.765  1.00 43.39 ? 67  VAL B CA  1 
ATOM   2148 C C   . VAL B 1 33  ? -13.116 55.824 78.051  1.00 44.04 ? 67  VAL B C   1 
ATOM   2149 O O   . VAL B 1 33  ? -12.639 54.729 77.723  1.00 44.12 ? 67  VAL B O   1 
ATOM   2150 C CB  . VAL B 1 33  ? -12.419 57.500 76.248  1.00 43.38 ? 67  VAL B CB  1 
ATOM   2151 C CG1 . VAL B 1 33  ? -13.853 57.459 75.721  1.00 42.70 ? 67  VAL B CG1 1 
ATOM   2152 C CG2 . VAL B 1 33  ? -11.816 58.879 76.022  1.00 43.05 ? 67  VAL B CG2 1 
ATOM   2153 N N   . SER B 1 34  ? -14.281 55.964 78.693  1.00 44.78 ? 68  SER B N   1 
ATOM   2154 C CA  . SER B 1 34  ? -15.179 54.842 78.938  1.00 45.54 ? 68  SER B CA  1 
ATOM   2155 C C   . SER B 1 34  ? -15.689 54.368 77.605  1.00 46.25 ? 68  SER B C   1 
ATOM   2156 O O   . SER B 1 34  ? -16.019 55.182 76.752  1.00 46.77 ? 68  SER B O   1 
ATOM   2157 C CB  . SER B 1 34  ? -16.362 55.264 79.797  1.00 45.43 ? 68  SER B CB  1 
ATOM   2158 O OG  . SER B 1 34  ? -17.224 54.163 80.031  1.00 45.50 ? 68  SER B OG  1 
ATOM   2159 N N   . LEU B 1 35  ? -15.740 53.062 77.400  1.00 47.09 ? 69  LEU B N   1 
ATOM   2160 C CA  . LEU B 1 35  ? -16.243 52.566 76.132  1.00 47.99 ? 69  LEU B CA  1 
ATOM   2161 C C   . LEU B 1 35  ? -17.774 52.555 76.137  1.00 48.95 ? 69  LEU B C   1 
ATOM   2162 O O   . LEU B 1 35  ? -18.412 52.913 75.136  1.00 49.27 ? 69  LEU B O   1 
ATOM   2163 C CB  . LEU B 1 35  ? -15.625 51.213 75.767  1.00 47.84 ? 69  LEU B CB  1 
ATOM   2164 C CG  . LEU B 1 35  ? -14.156 51.252 75.312  1.00 47.37 ? 69  LEU B CG  1 
ATOM   2165 C CD1 . LEU B 1 35  ? -13.582 49.852 75.211  1.00 46.94 ? 69  LEU B CD1 1 
ATOM   2166 C CD2 . LEU B 1 35  ? -13.976 51.988 73.990  1.00 46.67 ? 69  LEU B CD2 1 
ATOM   2167 N N   . GLN B 1 36  ? -18.359 52.184 77.276  1.00 49.94 ? 70  GLN B N   1 
ATOM   2168 C CA  . GLN B 1 36  ? -19.816 52.172 77.425  1.00 50.82 ? 70  GLN B CA  1 
ATOM   2169 C C   . GLN B 1 36  ? -20.232 53.505 78.033  1.00 51.11 ? 70  GLN B C   1 
ATOM   2170 O O   . GLN B 1 36  ? -19.871 53.806 79.172  1.00 51.51 ? 70  GLN B O   1 
ATOM   2171 C CB  . GLN B 1 36  ? -20.284 50.988 78.295  1.00 50.94 ? 70  GLN B CB  1 
ATOM   2172 C CG  . GLN B 1 36  ? -19.284 49.797 78.429  1.00 51.98 ? 70  GLN B CG  1 
ATOM   2173 C CD  . GLN B 1 36  ? -18.885 49.103 77.098  1.00 52.79 ? 70  GLN B CD  1 
ATOM   2174 O OE1 . GLN B 1 36  ? -19.384 49.425 76.006  1.00 52.53 ? 70  GLN B OE1 1 
ATOM   2175 N NE2 . GLN B 1 36  ? -17.970 48.141 77.204  1.00 53.10 ? 70  GLN B NE2 1 
ATOM   2176 N N   . ASN B 1 37  ? -20.970 54.305 77.264  1.00 51.47 ? 71  ASN B N   1 
ATOM   2177 C CA  . ASN B 1 37  ? -21.312 55.691 77.638  1.00 51.74 ? 71  ASN B CA  1 
ATOM   2178 C C   . ASN B 1 37  ? -20.059 56.540 77.901  1.00 51.44 ? 71  ASN B C   1 
ATOM   2179 O O   . ASN B 1 37  ? -19.685 56.810 79.055  1.00 51.45 ? 71  ASN B O   1 
ATOM   2180 C CB  . ASN B 1 37  ? -22.325 55.729 78.798  1.00 52.14 ? 71  ASN B CB  1 
ATOM   2181 C CG  . ASN B 1 37  ? -23.727 55.266 78.370  1.00 53.15 ? 71  ASN B CG  1 
ATOM   2182 O OD1 . ASN B 1 37  ? -24.454 55.993 77.679  1.00 54.21 ? 71  ASN B OD1 1 
ATOM   2183 N ND2 . ASN B 1 37  ? -24.104 54.052 78.778  1.00 53.56 ? 71  ASN B ND2 1 
ATOM   2184 N N   . GLY B 1 38  ? -19.452 56.966 76.792  1.00 51.20 ? 72  GLY B N   1 
ATOM   2185 C CA  . GLY B 1 38  ? -18.046 57.360 76.709  1.00 50.92 ? 72  GLY B CA  1 
ATOM   2186 C C   . GLY B 1 38  ? -17.578 58.697 77.241  1.00 50.81 ? 72  GLY B C   1 
ATOM   2187 O O   . GLY B 1 38  ? -17.176 59.574 76.476  1.00 50.76 ? 72  GLY B O   1 
ATOM   2188 N N   . LYS B 1 39  ? -17.599 58.834 78.560  1.00 50.77 ? 73  LYS B N   1 
ATOM   2189 C CA  . LYS B 1 39  ? -17.032 59.996 79.226  1.00 50.80 ? 73  LYS B CA  1 
ATOM   2190 C C   . LYS B 1 39  ? -15.533 59.787 79.420  1.00 50.46 ? 73  LYS B C   1 
ATOM   2191 O O   . LYS B 1 39  ? -15.030 58.673 79.272  1.00 50.29 ? 73  LYS B O   1 
ATOM   2192 C CB  . LYS B 1 39  ? -17.736 60.233 80.566  1.00 50.99 ? 73  LYS B CB  1 
ATOM   2193 C CG  . LYS B 1 39  ? -19.173 60.708 80.411  1.00 51.92 ? 73  LYS B CG  1 
ATOM   2194 C CD  . LYS B 1 39  ? -20.149 59.922 81.294  1.00 53.66 ? 73  LYS B CD  1 
ATOM   2195 C CE  . LYS B 1 39  ? -20.539 60.687 82.565  1.00 54.36 ? 73  LYS B CE  1 
ATOM   2196 N NZ  . LYS B 1 39  ? -21.862 60.230 83.110  1.00 54.34 ? 73  LYS B NZ  1 
ATOM   2197 N N   . GLU B 1 40  ? -14.832 60.866 79.747  1.00 50.10 ? 74  GLU B N   1 
ATOM   2198 C CA  . GLU B 1 40  ? -13.393 60.840 79.938  1.00 50.03 ? 74  GLU B CA  1 
ATOM   2199 C C   . GLU B 1 40  ? -13.061 60.902 81.431  1.00 49.17 ? 74  GLU B C   1 
ATOM   2200 O O   . GLU B 1 40  ? -13.638 61.699 82.182  1.00 49.27 ? 74  GLU B O   1 
ATOM   2201 C CB  . GLU B 1 40  ? -12.768 62.012 79.183  1.00 50.24 ? 74  GLU B CB  1 
ATOM   2202 C CG  . GLU B 1 40  ? -11.238 62.063 79.168  1.00 51.49 ? 74  GLU B CG  1 
ATOM   2203 C CD  . GLU B 1 40  ? -10.724 63.408 78.645  1.00 51.60 ? 74  GLU B CD  1 
ATOM   2204 O OE1 . GLU B 1 40  ? -11.039 63.767 77.488  1.00 52.65 ? 74  GLU B OE1 1 
ATOM   2205 O OE2 . GLU B 1 40  ? -10.016 64.113 79.400  1.00 54.13 ? 74  GLU B OE2 1 
ATOM   2206 N N   . TYR B 1 41  ? -12.135 60.051 81.861  1.00 48.10 ? 75  TYR B N   1 
ATOM   2207 C CA  . TYR B 1 41  ? -11.800 59.945 83.275  1.00 47.02 ? 75  TYR B CA  1 
ATOM   2208 C C   . TYR B 1 41  ? -10.304 60.069 83.506  1.00 46.06 ? 75  TYR B C   1 
ATOM   2209 O O   . TYR B 1 41  ? -9.532  60.258 82.566  1.00 46.13 ? 75  TYR B O   1 
ATOM   2210 C CB  . TYR B 1 41  ? -12.292 58.611 83.838  1.00 47.39 ? 75  TYR B CB  1 
ATOM   2211 C CG  . TYR B 1 41  ? -13.780 58.388 83.710  1.00 47.85 ? 75  TYR B CG  1 
ATOM   2212 C CD1 . TYR B 1 41  ? -14.308 57.703 82.614  1.00 48.09 ? 75  TYR B CD1 1 
ATOM   2213 C CD2 . TYR B 1 41  ? -14.666 58.857 84.687  1.00 48.50 ? 75  TYR B CD2 1 
ATOM   2214 C CE1 . TYR B 1 41  ? -15.684 57.494 82.488  1.00 48.62 ? 75  TYR B CE1 1 
ATOM   2215 C CE2 . TYR B 1 41  ? -16.048 58.653 84.572  1.00 48.72 ? 75  TYR B CE2 1 
ATOM   2216 C CZ  . TYR B 1 41  ? -16.549 57.967 83.469  1.00 48.52 ? 75  TYR B CZ  1 
ATOM   2217 O OH  . TYR B 1 41  ? -17.907 57.754 83.338  1.00 48.32 ? 75  TYR B OH  1 
ATOM   2218 N N   . ALA B 1 42  ? -9.902  59.971 84.767  1.00 44.62 ? 76  ALA B N   1 
ATOM   2219 C CA  . ALA B 1 42  ? -8.498  59.867 85.102  1.00 43.38 ? 76  ALA B CA  1 
ATOM   2220 C C   . ALA B 1 42  ? -8.332  58.590 85.910  1.00 42.55 ? 76  ALA B C   1 
ATOM   2221 O O   . ALA B 1 42  ? -8.786  58.497 87.050  1.00 42.77 ? 76  ALA B O   1 
ATOM   2222 C CB  . ALA B 1 42  ? -8.033  61.090 85.884  1.00 43.31 ? 76  ALA B CB  1 
ATOM   2223 N N   . VAL B 1 43  ? -7.712  57.589 85.302  1.00 41.29 ? 77  VAL B N   1 
ATOM   2224 C CA  . VAL B 1 43  ? -7.573  56.289 85.944  1.00 39.93 ? 77  VAL B CA  1 
ATOM   2225 C C   . VAL B 1 43  ? -6.164  56.148 86.491  1.00 39.40 ? 77  VAL B C   1 
ATOM   2226 O O   . VAL B 1 43  ? -5.188  56.453 85.792  1.00 39.39 ? 77  VAL B O   1 
ATOM   2227 C CB  . VAL B 1 43  ? -7.966  55.123 84.984  1.00 39.75 ? 77  VAL B CB  1 
ATOM   2228 C CG1 . VAL B 1 43  ? -7.702  55.494 83.570  1.00 39.56 ? 77  VAL B CG1 1 
ATOM   2229 C CG2 . VAL B 1 43  ? -7.247  53.834 85.323  1.00 39.27 ? 77  VAL B CG2 1 
ATOM   2230 N N   . LYS B 1 44  ? -6.070  55.737 87.758  1.00 38.41 ? 78  LYS B N   1 
ATOM   2231 C CA  . LYS B 1 44  ? -4.788  55.433 88.372  1.00 37.32 ? 78  LYS B CA  1 
ATOM   2232 C C   . LYS B 1 44  ? -4.574  53.924 88.340  1.00 36.82 ? 78  LYS B C   1 
ATOM   2233 O O   . LYS B 1 44  ? -5.403  53.152 88.841  1.00 36.51 ? 78  LYS B O   1 
ATOM   2234 C CB  . LYS B 1 44  ? -4.702  55.970 89.790  1.00 37.06 ? 78  LYS B CB  1 
ATOM   2235 C CG  . LYS B 1 44  ? -3.384  55.634 90.452  1.00 37.25 ? 78  LYS B CG  1 
ATOM   2236 C CD  . LYS B 1 44  ? -3.367  56.005 91.918  1.00 36.94 ? 78  LYS B CD  1 
ATOM   2237 C CE  . LYS B 1 44  ? -1.948  55.968 92.463  1.00 36.92 ? 78  LYS B CE  1 
ATOM   2238 N NZ  . LYS B 1 44  ? -1.861  56.552 93.830  1.00 36.39 ? 78  LYS B NZ  1 
ATOM   2239 N N   . ILE B 1 45  ? -3.462  53.524 87.722  1.00 36.14 ? 79  ILE B N   1 
ATOM   2240 C CA  . ILE B 1 45  ? -3.169  52.119 87.438  1.00 35.28 ? 79  ILE B CA  1 
ATOM   2241 C C   . ILE B 1 45  ? -1.938  51.714 88.226  1.00 34.93 ? 79  ILE B C   1 
ATOM   2242 O O   . ILE B 1 45  ? -0.860  52.284 88.047  1.00 34.92 ? 79  ILE B O   1 
ATOM   2243 C CB  . ILE B 1 45  ? -2.958  51.883 85.922  1.00 35.14 ? 79  ILE B CB  1 
ATOM   2244 C CG1 . ILE B 1 45  ? -4.240  52.206 85.163  1.00 34.78 ? 79  ILE B CG1 1 
ATOM   2245 C CG2 . ILE B 1 45  ? -2.580  50.447 85.645  1.00 34.94 ? 79  ILE B CG2 1 
ATOM   2246 C CD1 . ILE B 1 45  ? -4.043  52.565 83.739  1.00 33.76 ? 79  ILE B CD1 1 
ATOM   2247 N N   . ILE B 1 46  ? -2.114  50.722 89.094  1.00 34.51 ? 80  ILE B N   1 
ATOM   2248 C CA  . ILE B 1 46  ? -1.134  50.388 90.129  1.00 33.93 ? 80  ILE B CA  1 
ATOM   2249 C C   . ILE B 1 46  ? -0.627  48.965 89.926  1.00 33.74 ? 80  ILE B C   1 
ATOM   2250 O O   . ILE B 1 46  ? -1.420  48.058 89.676  1.00 34.15 ? 80  ILE B O   1 
ATOM   2251 C CB  . ILE B 1 46  ? -1.768  50.523 91.547  1.00 33.82 ? 80  ILE B CB  1 
ATOM   2252 C CG1 . ILE B 1 46  ? -2.395  51.896 91.724  1.00 32.93 ? 80  ILE B CG1 1 
ATOM   2253 C CG2 . ILE B 1 46  ? -0.743  50.294 92.653  1.00 33.82 ? 80  ILE B CG2 1 
ATOM   2254 C CD1 . ILE B 1 46  ? -3.504  51.898 92.709  1.00 33.10 ? 80  ILE B CD1 1 
ATOM   2255 N N   . GLU B 1 47  ? 0.683   48.775 90.025  1.00 33.17 ? 81  GLU B N   1 
ATOM   2256 C CA  . GLU B 1 47  ? 1.282   47.447 89.918  1.00 33.36 ? 81  GLU B CA  1 
ATOM   2257 C C   . GLU B 1 47  ? 0.932   46.591 91.126  1.00 33.06 ? 81  GLU B C   1 
ATOM   2258 O O   . GLU B 1 47  ? 1.205   46.990 92.259  1.00 33.69 ? 81  GLU B O   1 
ATOM   2259 C CB  . GLU B 1 47  ? 2.808   47.555 89.861  1.00 33.55 ? 81  GLU B CB  1 
ATOM   2260 C CG  . GLU B 1 47  ? 3.356   48.303 88.674  1.00 34.60 ? 81  GLU B CG  1 
ATOM   2261 C CD  . GLU B 1 47  ? 3.427   47.448 87.417  1.00 35.75 ? 81  GLU B CD  1 
ATOM   2262 O OE1 . GLU B 1 47  ? 3.735   48.023 86.350  1.00 36.86 ? 81  GLU B OE1 1 
ATOM   2263 O OE2 . GLU B 1 47  ? 3.182   46.219 87.495  1.00 35.19 ? 81  GLU B OE2 1 
ATOM   2264 N N   . LYS B 1 48  ? 0.367   45.407 90.903  1.00 32.47 ? 82  LYS B N   1 
ATOM   2265 C CA  . LYS B 1 48  ? 0.124   44.476 92.010  1.00 31.46 ? 82  LYS B CA  1 
ATOM   2266 C C   . LYS B 1 48  ? 1.410   43.963 92.667  1.00 31.50 ? 82  LYS B C   1 
ATOM   2267 O O   . LYS B 1 48  ? 1.414   43.619 93.852  1.00 31.58 ? 82  LYS B O   1 
ATOM   2268 C CB  . LYS B 1 48  ? -0.769  43.319 91.580  1.00 30.84 ? 82  LYS B CB  1 
ATOM   2269 C CG  . LYS B 1 48  ? -2.160  43.767 91.263  1.00 29.68 ? 82  LYS B CG  1 
ATOM   2270 C CD  . LYS B 1 48  ? -3.023  42.623 90.827  1.00 28.12 ? 82  LYS B CD  1 
ATOM   2271 C CE  . LYS B 1 48  ? -4.048  42.278 91.862  1.00 27.07 ? 82  LYS B CE  1 
ATOM   2272 N NZ  . LYS B 1 48  ? -5.241  41.664 91.233  1.00 26.58 ? 82  LYS B NZ  1 
ATOM   2273 N N   . GLN B 1 49  ? 2.506   43.942 91.919  1.00 31.52 ? 83  GLN B N   1 
ATOM   2274 C CA  . GLN B 1 49  ? 3.771   43.431 92.460  1.00 31.70 ? 83  GLN B CA  1 
ATOM   2275 C C   . GLN B 1 49  ? 4.537   44.431 93.321  1.00 32.01 ? 83  GLN B C   1 
ATOM   2276 O O   . GLN B 1 49  ? 5.561   44.088 93.917  1.00 31.85 ? 83  GLN B O   1 
ATOM   2277 C CB  . GLN B 1 49  ? 4.669   42.911 91.345  1.00 31.58 ? 83  GLN B CB  1 
ATOM   2278 C CG  . GLN B 1 49  ? 5.294   43.977 90.495  1.00 30.68 ? 83  GLN B CG  1 
ATOM   2279 C CD  . GLN B 1 49  ? 6.504   43.462 89.788  1.00 29.69 ? 83  GLN B CD  1 
ATOM   2280 O OE1 . GLN B 1 49  ? 7.632   43.744 90.192  1.00 29.35 ? 83  GLN B OE1 1 
ATOM   2281 N NE2 . GLN B 1 49  ? 6.287   42.669 88.741  1.00 29.13 ? 83  GLN B NE2 1 
ATOM   2282 N N   . ALA B 1 50  ? 4.046   45.669 93.367  1.00 32.64 ? 84  ALA B N   1 
ATOM   2283 C CA  . ALA B 1 50  ? 4.622   46.698 94.227  1.00 33.08 ? 84  ALA B CA  1 
ATOM   2284 C C   . ALA B 1 50  ? 4.507   46.272 95.686  1.00 33.65 ? 84  ALA B C   1 
ATOM   2285 O O   . ALA B 1 50  ? 3.698   45.384 96.029  1.00 34.02 ? 84  ALA B O   1 
ATOM   2286 C CB  . ALA B 1 50  ? 3.931   48.015 94.009  1.00 32.85 ? 84  ALA B CB  1 
ATOM   2287 N N   . GLY B 1 51  ? 5.326   46.897 96.537  1.00 33.88 ? 85  GLY B N   1 
ATOM   2288 C CA  . GLY B 1 51  ? 5.370   46.599 97.972  1.00 33.38 ? 85  GLY B CA  1 
ATOM   2289 C C   . GLY B 1 51  ? 4.046   46.851 98.663  1.00 33.33 ? 85  GLY B C   1 
ATOM   2290 O O   . GLY B 1 51  ? 3.518   47.968 98.617  1.00 33.33 ? 85  GLY B O   1 
ATOM   2291 N N   . HIS B 1 52  ? 3.514   45.794 99.284  1.00 33.36 ? 86  HIS B N   1 
ATOM   2292 C CA  . HIS B 1 52  ? 2.255   45.821 100.049 1.00 33.09 ? 86  HIS B CA  1 
ATOM   2293 C C   . HIS B 1 52  ? 1.101   46.370 99.227  1.00 33.19 ? 86  HIS B C   1 
ATOM   2294 O O   . HIS B 1 52  ? 0.172   46.969 99.763  1.00 33.45 ? 86  HIS B O   1 
ATOM   2295 C CB  . HIS B 1 52  ? 2.430   46.597 101.353 1.00 32.85 ? 86  HIS B CB  1 
ATOM   2296 C CG  . HIS B 1 52  ? 3.665   46.219 102.108 1.00 33.15 ? 86  HIS B CG  1 
ATOM   2297 N ND1 . HIS B 1 52  ? 3.773   45.041 102.818 1.00 33.01 ? 86  HIS B ND1 1 
ATOM   2298 C CD2 . HIS B 1 52  ? 4.854   46.854 102.250 1.00 33.17 ? 86  HIS B CD2 1 
ATOM   2299 C CE1 . HIS B 1 52  ? 4.972   44.972 103.368 1.00 33.65 ? 86  HIS B CE1 1 
ATOM   2300 N NE2 . HIS B 1 52  ? 5.647   46.059 103.041 1.00 33.53 ? 86  HIS B NE2 1 
ATOM   2301 N N   . SER B 1 53  ? 1.174   46.150 97.917  1.00 33.08 ? 87  SER B N   1 
ATOM   2302 C CA  . SER B 1 53  ? 0.230   46.721 96.979  1.00 32.90 ? 87  SER B CA  1 
ATOM   2303 C C   . SER B 1 53  ? -1.152  46.138 97.182  1.00 33.01 ? 87  SER B C   1 
ATOM   2304 O O   . SER B 1 53  ? -2.131  46.871 97.311  1.00 33.15 ? 87  SER B O   1 
ATOM   2305 C CB  . SER B 1 53  ? 0.696   46.477 95.545  1.00 32.75 ? 87  SER B CB  1 
ATOM   2306 O OG  . SER B 1 53  ? -0.285  46.905 94.628  1.00 31.88 ? 87  SER B OG  1 
ATOM   2307 N N   . ARG B 1 54  ? -1.222  44.815 97.228  1.00 32.95 ? 88  ARG B N   1 
ATOM   2308 C CA  . ARG B 1 54  ? -2.498  44.136 97.296  1.00 33.22 ? 88  ARG B CA  1 
ATOM   2309 C C   . ARG B 1 54  ? -3.343  44.550 98.498  1.00 33.60 ? 88  ARG B C   1 
ATOM   2310 O O   . ARG B 1 54  ? -4.549  44.801 98.356  1.00 33.76 ? 88  ARG B O   1 
ATOM   2311 C CB  . ARG B 1 54  ? -2.293  42.629 97.257  1.00 33.24 ? 88  ARG B CB  1 
ATOM   2312 C CG  . ARG B 1 54  ? -2.002  42.119 95.869  1.00 33.18 ? 88  ARG B CG  1 
ATOM   2313 C CD  . ARG B 1 54  ? -2.145  40.625 95.822  1.00 34.11 ? 88  ARG B CD  1 
ATOM   2314 N NE  . ARG B 1 54  ? -1.871  40.120 94.489  1.00 34.01 ? 88  ARG B NE  1 
ATOM   2315 C CZ  . ARG B 1 54  ? -0.655  40.037 93.960  1.00 35.21 ? 88  ARG B CZ  1 
ATOM   2316 N NH1 . ARG B 1 54  ? -0.498  39.569 92.731  1.00 36.61 ? 88  ARG B NH1 1 
ATOM   2317 N NH2 . ARG B 1 54  ? 0.405   40.437 94.646  1.00 35.85 ? 88  ARG B NH2 1 
ATOM   2318 N N   . SER B 1 55  ? -2.708  44.639 99.668  1.00 33.74 ? 89  SER B N   1 
ATOM   2319 C CA  . SER B 1 55  ? -3.417  44.958 100.904 1.00 33.93 ? 89  SER B CA  1 
ATOM   2320 C C   . SER B 1 55  ? -3.640  46.448 101.129 1.00 33.94 ? 89  SER B C   1 
ATOM   2321 O O   . SER B 1 55  ? -4.654  46.832 101.715 1.00 34.26 ? 89  SER B O   1 
ATOM   2322 C CB  . SER B 1 55  ? -2.692  44.366 102.100 1.00 33.98 ? 89  SER B CB  1 
ATOM   2323 O OG  . SER B 1 55  ? -1.388  44.902 102.197 1.00 34.85 ? 89  SER B OG  1 
ATOM   2324 N N   . ARG B 1 56  ? -2.700  47.281 100.684 1.00 33.83 ? 90  ARG B N   1 
ATOM   2325 C CA  . ARG B 1 56  ? -2.830  48.731 100.842 1.00 33.99 ? 90  ARG B CA  1 
ATOM   2326 C C   . ARG B 1 56  ? -3.882  49.331 99.912  1.00 35.07 ? 90  ARG B C   1 
ATOM   2327 O O   . ARG B 1 56  ? -4.678  50.178 100.342 1.00 35.22 ? 90  ARG B O   1 
ATOM   2328 C CB  . ARG B 1 56  ? -1.483  49.439 100.691 1.00 33.39 ? 90  ARG B CB  1 
ATOM   2329 C CG  . ARG B 1 56  ? -0.664  49.396 101.955 1.00 31.75 ? 90  ARG B CG  1 
ATOM   2330 C CD  . ARG B 1 56  ? 0.701   50.034 101.844 1.00 29.21 ? 90  ARG B CD  1 
ATOM   2331 N NE  . ARG B 1 56  ? 1.521   49.652 102.991 1.00 29.17 ? 90  ARG B NE  1 
ATOM   2332 C CZ  . ARG B 1 56  ? 2.808   49.942 103.163 1.00 28.75 ? 90  ARG B CZ  1 
ATOM   2333 N NH1 . ARG B 1 56  ? 3.485   50.649 102.263 1.00 28.18 ? 90  ARG B NH1 1 
ATOM   2334 N NH2 . ARG B 1 56  ? 3.427   49.507 104.250 1.00 28.12 ? 90  ARG B NH2 1 
ATOM   2335 N N   . VAL B 1 57  ? -3.894  48.892 98.648  1.00 36.08 ? 91  VAL B N   1 
ATOM   2336 C CA  . VAL B 1 57  ? -4.898  49.355 97.686  1.00 36.84 ? 91  VAL B CA  1 
ATOM   2337 C C   . VAL B 1 57  ? -6.317  48.934 98.103  1.00 37.78 ? 91  VAL B C   1 
ATOM   2338 O O   . VAL B 1 57  ? -7.230  49.769 98.108  1.00 38.40 ? 91  VAL B O   1 
ATOM   2339 C CB  . VAL B 1 57  ? -4.582  48.926 96.245  1.00 36.76 ? 91  VAL B CB  1 
ATOM   2340 C CG1 . VAL B 1 57  ? -5.744  49.246 95.336  1.00 36.29 ? 91  VAL B CG1 1 
ATOM   2341 C CG2 . VAL B 1 57  ? -3.330  49.629 95.749  1.00 36.56 ? 91  VAL B CG2 1 
ATOM   2342 N N   . PHE B 1 58  ? -6.489  47.666 98.485  1.00 38.26 ? 92  PHE B N   1 
ATOM   2343 C CA  . PHE B 1 58  ? -7.777  47.168 98.977  1.00 38.69 ? 92  PHE B CA  1 
ATOM   2344 C C   . PHE B 1 58  ? -8.387  48.057 100.048 1.00 38.94 ? 92  PHE B C   1 
ATOM   2345 O O   . PHE B 1 58  ? -9.572  48.377 100.003 1.00 38.75 ? 92  PHE B O   1 
ATOM   2346 C CB  . PHE B 1 58  ? -7.631  45.763 99.549  1.00 38.72 ? 92  PHE B CB  1 
ATOM   2347 C CG  . PHE B 1 58  ? -8.876  45.260 100.231 1.00 39.19 ? 92  PHE B CG  1 
ATOM   2348 C CD1 . PHE B 1 58  ? -9.076  45.474 101.600 1.00 40.14 ? 92  PHE B CD1 1 
ATOM   2349 C CD2 . PHE B 1 58  ? -9.852  44.571 99.511  1.00 39.29 ? 92  PHE B CD2 1 
ATOM   2350 C CE1 . PHE B 1 58  ? -10.237 45.008 102.245 1.00 39.62 ? 92  PHE B CE1 1 
ATOM   2351 C CE2 . PHE B 1 58  ? -11.011 44.099 100.144 1.00 39.55 ? 92  PHE B CE2 1 
ATOM   2352 C CZ  . PHE B 1 58  ? -11.203 44.321 101.513 1.00 39.18 ? 92  PHE B CZ  1 
ATOM   2353 N N   . ARG B 1 59  ? -7.562  48.423 101.021 1.00 39.63 ? 93  ARG B N   1 
ATOM   2354 C CA  . ARG B 1 59  ? -7.981  49.235 102.156 1.00 40.34 ? 93  ARG B CA  1 
ATOM   2355 C C   . ARG B 1 59  ? -8.249  50.685 101.756 1.00 40.32 ? 93  ARG B C   1 
ATOM   2356 O O   . ARG B 1 59  ? -9.152  51.316 102.290 1.00 40.33 ? 93  ARG B O   1 
ATOM   2357 C CB  . ARG B 1 59  ? -6.939  49.156 103.277 1.00 40.08 ? 93  ARG B CB  1 
ATOM   2358 C CG  . ARG B 1 59  ? -7.213  48.066 104.297 1.00 40.84 ? 93  ARG B CG  1 
ATOM   2359 C CD  . ARG B 1 59  ? -6.000  47.723 105.188 1.00 41.48 ? 93  ARG B CD  1 
ATOM   2360 N NE  . ARG B 1 59  ? -4.945  48.748 105.219 1.00 43.95 ? 93  ARG B NE  1 
ATOM   2361 C CZ  . ARG B 1 59  ? -3.650  48.529 104.940 1.00 44.69 ? 93  ARG B CZ  1 
ATOM   2362 N NH1 . ARG B 1 59  ? -2.786  49.534 105.000 1.00 44.82 ? 93  ARG B NH1 1 
ATOM   2363 N NH2 . ARG B 1 59  ? -3.200  47.315 104.614 1.00 44.14 ? 93  ARG B NH2 1 
ATOM   2364 N N   . GLU B 1 60  ? -7.477  51.202 100.806 1.00 40.83 ? 94  GLU B N   1 
ATOM   2365 C CA  . GLU B 1 60  ? -7.671  52.576 100.332 1.00 41.39 ? 94  GLU B CA  1 
ATOM   2366 C C   . GLU B 1 60  ? -8.937  52.721 99.487  1.00 41.65 ? 94  GLU B C   1 
ATOM   2367 O O   . GLU B 1 60  ? -9.596  53.759 99.510  1.00 41.48 ? 94  GLU B O   1 
ATOM   2368 C CB  . GLU B 1 60  ? -6.456  53.054 99.531  1.00 41.48 ? 94  GLU B CB  1 
ATOM   2369 C CG  . GLU B 1 60  ? -6.659  54.425 98.888  1.00 41.25 ? 94  GLU B CG  1 
ATOM   2370 C CD  . GLU B 1 60  ? -5.441  54.941 98.140  1.00 41.33 ? 94  GLU B CD  1 
ATOM   2371 O OE1 . GLU B 1 60  ? -4.464  54.188 97.948  1.00 40.83 ? 94  GLU B OE1 1 
ATOM   2372 O OE2 . GLU B 1 60  ? -5.465  56.122 97.742  1.00 41.45 ? 94  GLU B OE2 1 
ATOM   2373 N N   . VAL B 1 61  ? -9.252  51.674 98.735  1.00 42.11 ? 95  VAL B N   1 
ATOM   2374 C CA  . VAL B 1 61  ? -10.435 51.643 97.894  1.00 42.69 ? 95  VAL B CA  1 
ATOM   2375 C C   . VAL B 1 61  ? -11.711 51.583 98.739  1.00 43.45 ? 95  VAL B C   1 
ATOM   2376 O O   . VAL B 1 61  ? -12.712 52.239 98.412  1.00 43.49 ? 95  VAL B O   1 
ATOM   2377 C CB  . VAL B 1 61  ? -10.361 50.467 96.898  1.00 42.59 ? 95  VAL B CB  1 
ATOM   2378 C CG1 . VAL B 1 61  ? -11.694 50.243 96.200  1.00 42.23 ? 95  VAL B CG1 1 
ATOM   2379 C CG2 . VAL B 1 61  ? -9.270  50.727 95.890  1.00 41.92 ? 95  VAL B CG2 1 
ATOM   2380 N N   . GLU B 1 62  ? -11.662 50.806 99.824  1.00 44.19 ? 96  GLU B N   1 
ATOM   2381 C CA  . GLU B 1 62  ? -12.776 50.710 100.762 1.00 45.05 ? 96  GLU B CA  1 
ATOM   2382 C C   . GLU B 1 62  ? -13.050 52.066 101.379 1.00 45.01 ? 96  GLU B C   1 
ATOM   2383 O O   . GLU B 1 62  ? -14.202 52.482 101.503 1.00 45.09 ? 96  GLU B O   1 
ATOM   2384 C CB  . GLU B 1 62  ? -12.491 49.685 101.870 1.00 45.57 ? 96  GLU B CB  1 
ATOM   2385 C CG  . GLU B 1 62  ? -12.479 48.207 101.420 1.00 47.70 ? 96  GLU B CG  1 
ATOM   2386 C CD  . GLU B 1 62  ? -13.654 47.824 100.513 1.00 50.16 ? 96  GLU B CD  1 
ATOM   2387 O OE1 . GLU B 1 62  ? -13.400 47.257 99.427  1.00 51.43 ? 96  GLU B OE1 1 
ATOM   2388 O OE2 . GLU B 1 62  ? -14.824 48.088 100.878 1.00 51.17 ? 96  GLU B OE2 1 
ATOM   2389 N N   . THR B 1 63  ? -11.974 52.746 101.753 1.00 45.17 ? 97  THR B N   1 
ATOM   2390 C CA  . THR B 1 63  ? -12.047 54.084 102.309 1.00 45.59 ? 97  THR B CA  1 
ATOM   2391 C C   . THR B 1 63  ? -12.570 55.101 101.283 1.00 46.16 ? 97  THR B C   1 
ATOM   2392 O O   . THR B 1 63  ? -13.455 55.895 101.596 1.00 46.18 ? 97  THR B O   1 
ATOM   2393 C CB  . THR B 1 63  ? -10.678 54.502 102.886 1.00 45.40 ? 97  THR B CB  1 
ATOM   2394 O OG1 . THR B 1 63  ? -10.381 53.678 104.017 1.00 45.48 ? 97  THR B OG1 1 
ATOM   2395 C CG2 . THR B 1 63  ? -10.680 55.942 103.339 1.00 45.30 ? 97  THR B CG2 1 
ATOM   2396 N N   . LEU B 1 64  ? -12.043 55.062 100.061 1.00 46.89 ? 98  LEU B N   1 
ATOM   2397 C CA  . LEU B 1 64  ? -12.430 56.024 99.035  1.00 47.59 ? 98  LEU B CA  1 
ATOM   2398 C C   . LEU B 1 64  ? -13.897 55.891 98.642  1.00 48.43 ? 98  LEU B C   1 
ATOM   2399 O O   . LEU B 1 64  ? -14.526 56.859 98.200  1.00 48.48 ? 98  LEU B O   1 
ATOM   2400 C CB  . LEU B 1 64  ? -11.533 55.894 97.810  1.00 47.53 ? 98  LEU B CB  1 
ATOM   2401 C CG  . LEU B 1 64  ? -10.174 56.591 97.862  1.00 47.30 ? 98  LEU B CG  1 
ATOM   2402 C CD1 . LEU B 1 64  ? -9.302  56.059 96.755  1.00 46.88 ? 98  LEU B CD1 1 
ATOM   2403 C CD2 . LEU B 1 64  ? -10.326 58.094 97.730  1.00 47.61 ? 98  LEU B CD2 1 
ATOM   2404 N N   . TYR B 1 65  ? -14.436 54.685 98.806  1.00 49.48 ? 99  TYR B N   1 
ATOM   2405 C CA  . TYR B 1 65  ? -15.862 54.443 98.627  1.00 50.48 ? 99  TYR B CA  1 
ATOM   2406 C C   . TYR B 1 65  ? -16.689 55.282 99.591  1.00 51.11 ? 99  TYR B C   1 
ATOM   2407 O O   . TYR B 1 65  ? -17.770 55.757 99.240  1.00 51.47 ? 99  TYR B O   1 
ATOM   2408 C CB  . TYR B 1 65  ? -16.183 52.971 98.845  1.00 50.65 ? 99  TYR B CB  1 
ATOM   2409 C CG  . TYR B 1 65  ? -15.874 52.087 97.666  1.00 51.25 ? 99  TYR B CG  1 
ATOM   2410 C CD1 . TYR B 1 65  ? -15.654 50.722 97.839  1.00 51.86 ? 99  TYR B CD1 1 
ATOM   2411 C CD2 . TYR B 1 65  ? -15.802 52.610 96.371  1.00 51.83 ? 99  TYR B CD2 1 
ATOM   2412 C CE1 . TYR B 1 65  ? -15.378 49.890 96.751  1.00 51.95 ? 99  TYR B CE1 1 
ATOM   2413 C CE2 . TYR B 1 65  ? -15.525 51.791 95.273  1.00 51.78 ? 99  TYR B CE2 1 
ATOM   2414 C CZ  . TYR B 1 65  ? -15.315 50.432 95.473  1.00 51.85 ? 99  TYR B CZ  1 
ATOM   2415 O OH  . TYR B 1 65  ? -15.050 49.613 94.396  1.00 51.82 ? 99  TYR B OH  1 
ATOM   2416 N N   . GLN B 1 66  ? -16.166 55.461 100.806 1.00 51.70 ? 100 GLN B N   1 
ATOM   2417 C CA  . GLN B 1 66  ? -16.828 56.245 101.853 1.00 52.02 ? 100 GLN B CA  1 
ATOM   2418 C C   . GLN B 1 66  ? -16.714 57.764 101.669 1.00 51.88 ? 100 GLN B C   1 
ATOM   2419 O O   . GLN B 1 66  ? -17.109 58.522 102.558 1.00 51.88 ? 100 GLN B O   1 
ATOM   2420 C CB  . GLN B 1 66  ? -16.270 55.873 103.223 1.00 52.23 ? 100 GLN B CB  1 
ATOM   2421 C CG  . GLN B 1 66  ? -16.538 54.452 103.668 1.00 53.81 ? 100 GLN B CG  1 
ATOM   2422 C CD  . GLN B 1 66  ? -16.523 54.318 105.189 1.00 56.36 ? 100 GLN B CD  1 
ATOM   2423 O OE1 . GLN B 1 66  ? -17.479 53.814 105.782 1.00 57.43 ? 100 GLN B OE1 1 
ATOM   2424 N NE2 . GLN B 1 66  ? -15.444 54.790 105.828 1.00 56.92 ? 100 GLN B NE2 1 
ATOM   2425 N N   . CYS B 1 67  ? -16.172 58.200 100.530 1.00 51.87 ? 101 CYS B N   1 
ATOM   2426 C CA  . CYS B 1 67  ? -16.030 59.629 100.224 1.00 51.62 ? 101 CYS B CA  1 
ATOM   2427 C C   . CYS B 1 67  ? -16.737 60.042 98.937  1.00 52.08 ? 101 CYS B C   1 
ATOM   2428 O O   . CYS B 1 67  ? -16.616 61.194 98.515  1.00 52.30 ? 101 CYS B O   1 
ATOM   2429 C CB  . CYS B 1 67  ? -14.554 60.021 100.128 1.00 51.40 ? 101 CYS B CB  1 
ATOM   2430 S SG  . CYS B 1 67  ? -13.516 59.267 101.365 1.00 49.01 ? 101 CYS B SG  1 
ATOM   2431 N N   . GLN B 1 68  ? -17.475 59.110 98.330  1.00 52.45 ? 102 GLN B N   1 
ATOM   2432 C CA  . GLN B 1 68  ? -18.090 59.298 97.004  1.00 52.81 ? 102 GLN B CA  1 
ATOM   2433 C C   . GLN B 1 68  ? -19.212 60.355 96.951  1.00 52.83 ? 102 GLN B C   1 
ATOM   2434 O O   . GLN B 1 68  ? -20.174 60.216 96.186  1.00 52.97 ? 102 GLN B O   1 
ATOM   2435 C CB  . GLN B 1 68  ? -18.627 57.963 96.468  1.00 52.79 ? 102 GLN B CB  1 
ATOM   2436 C CG  . GLN B 1 68  ? -17.583 56.924 96.084  1.00 52.85 ? 102 GLN B CG  1 
ATOM   2437 C CD  . GLN B 1 68  ? -18.215 55.649 95.525  1.00 53.19 ? 102 GLN B CD  1 
ATOM   2438 O OE1 . GLN B 1 68  ? -17.625 54.972 94.687  1.00 54.15 ? 102 GLN B OE1 1 
ATOM   2439 N NE2 . GLN B 1 68  ? -19.425 55.325 95.984  1.00 53.88 ? 102 GLN B NE2 1 
ATOM   2440 N N   . GLY B 1 69  ? -19.086 61.407 97.755  1.00 52.72 ? 103 GLY B N   1 
ATOM   2441 C CA  . GLY B 1 69  ? -20.057 62.497 97.752  1.00 52.58 ? 103 GLY B CA  1 
ATOM   2442 C C   . GLY B 1 69  ? -19.490 63.794 98.295  1.00 52.47 ? 103 GLY B C   1 
ATOM   2443 O O   . GLY B 1 69  ? -20.225 64.774 98.492  1.00 52.64 ? 103 GLY B O   1 
ATOM   2444 N N   . ASN B 1 70  ? -18.184 63.792 98.552  1.00 52.10 ? 104 ASN B N   1 
ATOM   2445 C CA  . ASN B 1 70  ? -17.491 64.979 99.018  1.00 51.69 ? 104 ASN B CA  1 
ATOM   2446 C C   . ASN B 1 70  ? -16.934 65.763 97.837  1.00 51.59 ? 104 ASN B C   1 
ATOM   2447 O O   . ASN B 1 70  ? -16.116 65.250 97.062  1.00 51.74 ? 104 ASN B O   1 
ATOM   2448 C CB  . ASN B 1 70  ? -16.376 64.603 99.987  1.00 51.44 ? 104 ASN B CB  1 
ATOM   2449 C CG  . ASN B 1 70  ? -15.975 65.756 100.876 1.00 51.37 ? 104 ASN B CG  1 
ATOM   2450 O OD1 . ASN B 1 70  ? -16.632 66.047 101.879 1.00 51.01 ? 104 ASN B OD1 1 
ATOM   2451 N ND2 . ASN B 1 70  ? -14.887 66.417 100.520 1.00 50.94 ? 104 ASN B ND2 1 
ATOM   2452 N N   . LYS B 1 71  ? -17.393 67.003 97.696  1.00 51.35 ? 105 LYS B N   1 
ATOM   2453 C CA  . LYS B 1 71  ? -16.945 67.878 96.611  1.00 51.16 ? 105 LYS B CA  1 
ATOM   2454 C C   . LYS B 1 71  ? -15.467 68.278 96.738  1.00 50.72 ? 105 LYS B C   1 
ATOM   2455 O O   . LYS B 1 71  ? -14.924 68.946 95.855  1.00 50.90 ? 105 LYS B O   1 
ATOM   2456 C CB  . LYS B 1 71  ? -17.856 69.116 96.452  1.00 51.31 ? 105 LYS B CB  1 
ATOM   2457 C CG  . LYS B 1 71  ? -18.472 69.670 97.739  1.00 51.81 ? 105 LYS B CG  1 
ATOM   2458 C CD  . LYS B 1 71  ? -19.895 69.139 97.947  1.00 53.00 ? 105 LYS B CD  1 
ATOM   2459 C CE  . LYS B 1 71  ? -20.313 69.150 99.423  1.00 53.21 ? 105 LYS B CE  1 
ATOM   2460 N NZ  . LYS B 1 71  ? -19.634 68.081 100.220 1.00 52.62 ? 105 LYS B NZ  1 
ATOM   2461 N N   . ASN B 1 72  ? -14.821 67.856 97.822  1.00 49.99 ? 106 ASN B N   1 
ATOM   2462 C CA  . ASN B 1 72  ? -13.423 68.205 98.071  1.00 49.46 ? 106 ASN B CA  1 
ATOM   2463 C C   . ASN B 1 72  ? -12.473 67.001 98.031  1.00 49.04 ? 106 ASN B C   1 
ATOM   2464 O O   . ASN B 1 72  ? -11.261 67.141 98.228  1.00 48.95 ? 106 ASN B O   1 
ATOM   2465 C CB  . ASN B 1 72  ? -13.295 68.964 99.398  1.00 49.53 ? 106 ASN B CB  1 
ATOM   2466 C CG  . ASN B 1 72  ? -14.117 70.246 99.423  1.00 49.70 ? 106 ASN B CG  1 
ATOM   2467 O OD1 . ASN B 1 72  ? -15.013 70.410 100.258 1.00 49.72 ? 106 ASN B OD1 1 
ATOM   2468 N ND2 . ASN B 1 72  ? -13.820 71.159 98.499  1.00 49.66 ? 106 ASN B ND2 1 
ATOM   2469 N N   . ILE B 1 73  ? -13.032 65.821 97.774  1.00 48.49 ? 107 ILE B N   1 
ATOM   2470 C CA  . ILE B 1 73  ? -12.248 64.596 97.633  1.00 47.84 ? 107 ILE B CA  1 
ATOM   2471 C C   . ILE B 1 73  ? -12.458 64.024 96.229  1.00 47.55 ? 107 ILE B C   1 
ATOM   2472 O O   . ILE B 1 73  ? -13.588 63.676 95.852  1.00 47.42 ? 107 ILE B O   1 
ATOM   2473 C CB  . ILE B 1 73  ? -12.602 63.562 98.737  1.00 47.80 ? 107 ILE B CB  1 
ATOM   2474 C CG1 . ILE B 1 73  ? -12.139 64.075 100.099 1.00 47.24 ? 107 ILE B CG1 1 
ATOM   2475 C CG2 . ILE B 1 73  ? -11.964 62.203 98.455  1.00 47.83 ? 107 ILE B CG2 1 
ATOM   2476 C CD1 . ILE B 1 73  ? -12.858 63.447 101.247 1.00 47.13 ? 107 ILE B CD1 1 
ATOM   2477 N N   . LEU B 1 74  ? -11.364 63.958 95.464  1.00 46.96 ? 108 LEU B N   1 
ATOM   2478 C CA  . LEU B 1 74  ? -11.386 63.450 94.095  1.00 46.55 ? 108 LEU B CA  1 
ATOM   2479 C C   . LEU B 1 74  ? -12.087 62.098 94.065  1.00 46.57 ? 108 LEU B C   1 
ATOM   2480 O O   . LEU B 1 74  ? -11.637 61.133 94.701  1.00 46.64 ? 108 LEU B O   1 
ATOM   2481 C CB  . LEU B 1 74  ? -9.967  63.346 93.512  1.00 46.38 ? 108 LEU B CB  1 
ATOM   2482 C CG  . LEU B 1 74  ? -9.835  62.882 92.055  1.00 45.07 ? 108 LEU B CG  1 
ATOM   2483 C CD1 . LEU B 1 74  ? -10.173 63.999 91.092  1.00 44.68 ? 108 LEU B CD1 1 
ATOM   2484 C CD2 . LEU B 1 74  ? -8.444  62.389 91.798  1.00 43.96 ? 108 LEU B CD2 1 
ATOM   2485 N N   . GLU B 1 75  ? -13.190 62.044 93.325  1.00 46.31 ? 109 GLU B N   1 
ATOM   2486 C CA  . GLU B 1 75  ? -14.102 60.920 93.419  1.00 46.07 ? 109 GLU B CA  1 
ATOM   2487 C C   . GLU B 1 75  ? -13.629 59.710 92.663  1.00 45.49 ? 109 GLU B C   1 
ATOM   2488 O O   . GLU B 1 75  ? -13.271 59.806 91.494  1.00 45.60 ? 109 GLU B O   1 
ATOM   2489 C CB  . GLU B 1 75  ? -15.484 61.302 92.917  1.00 46.27 ? 109 GLU B CB  1 
ATOM   2490 C CG  . GLU B 1 75  ? -16.393 60.104 92.742  1.00 47.46 ? 109 GLU B CG  1 
ATOM   2491 C CD  . GLU B 1 75  ? -17.844 60.451 92.912  1.00 49.72 ? 109 GLU B CD  1 
ATOM   2492 O OE1 . GLU B 1 75  ? -18.134 61.525 93.489  1.00 50.80 ? 109 GLU B OE1 1 
ATOM   2493 O OE2 . GLU B 1 75  ? -18.695 59.645 92.476  1.00 51.04 ? 109 GLU B OE2 1 
ATOM   2494 N N   . LEU B 1 76  ? -13.645 58.571 93.347  1.00 44.77 ? 110 LEU B N   1 
ATOM   2495 C CA  . LEU B 1 76  ? -13.489 57.291 92.693  1.00 44.30 ? 110 LEU B CA  1 
ATOM   2496 C C   . LEU B 1 76  ? -14.811 56.930 92.032  1.00 44.08 ? 110 LEU B C   1 
ATOM   2497 O O   . LEU B 1 76  ? -15.812 56.731 92.708  1.00 44.08 ? 110 LEU B O   1 
ATOM   2498 C CB  . LEU B 1 76  ? -13.073 56.209 93.695  1.00 44.19 ? 110 LEU B CB  1 
ATOM   2499 C CG  . LEU B 1 76  ? -12.730 54.815 93.153  1.00 43.95 ? 110 LEU B CG  1 
ATOM   2500 C CD1 . LEU B 1 76  ? -11.442 54.841 92.373  1.00 44.31 ? 110 LEU B CD1 1 
ATOM   2501 C CD2 . LEU B 1 76  ? -12.621 53.793 94.266  1.00 44.24 ? 110 LEU B CD2 1 
ATOM   2502 N N   . ILE B 1 77  ? -14.809 56.874 90.705  1.00 43.91 ? 111 ILE B N   1 
ATOM   2503 C CA  . ILE B 1 77  ? -15.969 56.414 89.944  1.00 43.71 ? 111 ILE B CA  1 
ATOM   2504 C C   . ILE B 1 77  ? -16.085 54.883 90.015  1.00 43.62 ? 111 ILE B C   1 
ATOM   2505 O O   . ILE B 1 77  ? -17.120 54.345 90.430  1.00 43.82 ? 111 ILE B O   1 
ATOM   2506 C CB  . ILE B 1 77  ? -15.941 56.938 88.474  1.00 43.58 ? 111 ILE B CB  1 
ATOM   2507 C CG1 . ILE B 1 77  ? -16.628 58.294 88.391  1.00 43.62 ? 111 ILE B CG1 1 
ATOM   2508 C CG2 . ILE B 1 77  ? -16.656 55.985 87.518  1.00 43.58 ? 111 ILE B CG2 1 
ATOM   2509 C CD1 . ILE B 1 77  ? -15.912 59.397 89.119  1.00 44.50 ? 111 ILE B CD1 1 
ATOM   2510 N N   . GLU B 1 78  ? -15.016 54.185 89.641  1.00 43.24 ? 112 GLU B N   1 
ATOM   2511 C CA  . GLU B 1 78  ? -15.055 52.735 89.594  1.00 42.91 ? 112 GLU B CA  1 
ATOM   2512 C C   . GLU B 1 78  ? -13.719 52.127 90.004  1.00 42.16 ? 112 GLU B C   1 
ATOM   2513 O O   . GLU B 1 78  ? -12.663 52.761 89.864  1.00 42.34 ? 112 GLU B O   1 
ATOM   2514 C CB  . GLU B 1 78  ? -15.443 52.272 88.188  1.00 43.17 ? 112 GLU B CB  1 
ATOM   2515 C CG  . GLU B 1 78  ? -16.234 50.976 88.161  1.00 45.11 ? 112 GLU B CG  1 
ATOM   2516 C CD  . GLU B 1 78  ? -16.206 50.287 86.802  1.00 47.83 ? 112 GLU B CD  1 
ATOM   2517 O OE1 . GLU B 1 78  ? -16.958 49.302 86.620  1.00 49.06 ? 112 GLU B OE1 1 
ATOM   2518 O OE2 . GLU B 1 78  ? -15.437 50.722 85.912  1.00 49.02 ? 112 GLU B OE2 1 
ATOM   2519 N N   . PHE B 1 79  ? -13.781 50.902 90.522  1.00 40.97 ? 113 PHE B N   1 
ATOM   2520 C CA  . PHE B 1 79  ? -12.592 50.110 90.788  1.00 39.92 ? 113 PHE B CA  1 
ATOM   2521 C C   . PHE B 1 79  ? -12.593 48.817 89.983  1.00 39.52 ? 113 PHE B C   1 
ATOM   2522 O O   . PHE B 1 79  ? -13.581 48.077 89.964  1.00 39.59 ? 113 PHE B O   1 
ATOM   2523 C CB  . PHE B 1 79  ? -12.473 49.786 92.277  1.00 39.65 ? 113 PHE B CB  1 
ATOM   2524 C CG  . PHE B 1 79  ? -11.357 48.820 92.607  1.00 38.95 ? 113 PHE B CG  1 
ATOM   2525 C CD1 . PHE B 1 79  ? -10.030 49.250 92.639  1.00 38.20 ? 113 PHE B CD1 1 
ATOM   2526 C CD2 . PHE B 1 79  ? -11.635 47.483 92.882  1.00 38.43 ? 113 PHE B CD2 1 
ATOM   2527 C CE1 . PHE B 1 79  ? -9.006  48.368 92.940  1.00 38.38 ? 113 PHE B CE1 1 
ATOM   2528 C CE2 . PHE B 1 79  ? -10.610 46.589 93.188  1.00 38.69 ? 113 PHE B CE2 1 
ATOM   2529 C CZ  . PHE B 1 79  ? -9.297  47.031 93.219  1.00 39.17 ? 113 PHE B CZ  1 
ATOM   2530 N N   . PHE B 1 80  ? -11.466 48.544 89.336  1.00 39.01 ? 114 PHE B N   1 
ATOM   2531 C CA  . PHE B 1 80  ? -11.254 47.278 88.639  1.00 38.53 ? 114 PHE B CA  1 
ATOM   2532 C C   . PHE B 1 80  ? -9.854  46.744 88.962  1.00 38.05 ? 114 PHE B C   1 
ATOM   2533 O O   . PHE B 1 80  ? -8.939  47.511 89.256  1.00 37.75 ? 114 PHE B O   1 
ATOM   2534 C CB  . PHE B 1 80  ? -11.462 47.465 87.125  1.00 38.53 ? 114 PHE B CB  1 
ATOM   2535 C CG  . PHE B 1 80  ? -11.314 46.202 86.322  1.00 38.73 ? 114 PHE B CG  1 
ATOM   2536 C CD1 . PHE B 1 80  ? -12.389 45.342 86.148  1.00 39.29 ? 114 PHE B CD1 1 
ATOM   2537 C CD2 . PHE B 1 80  ? -10.093 45.872 85.731  1.00 39.24 ? 114 PHE B CD2 1 
ATOM   2538 C CE1 . PHE B 1 80  ? -12.244 44.163 85.404  1.00 39.62 ? 114 PHE B CE1 1 
ATOM   2539 C CE2 . PHE B 1 80  ? -9.939  44.699 84.987  1.00 38.78 ? 114 PHE B CE2 1 
ATOM   2540 C CZ  . PHE B 1 80  ? -11.013 43.847 84.823  1.00 38.71 ? 114 PHE B CZ  1 
ATOM   2541 N N   . GLU B 1 81  ? -9.709  45.424 88.932  1.00 37.65 ? 115 GLU B N   1 
ATOM   2542 C CA  . GLU B 1 81  ? -8.403  44.785 89.030  1.00 37.58 ? 115 GLU B CA  1 
ATOM   2543 C C   . GLU B 1 81  ? -8.354  43.539 88.149  1.00 37.29 ? 115 GLU B C   1 
ATOM   2544 O O   . GLU B 1 81  ? -9.340  42.805 88.068  1.00 37.46 ? 115 GLU B O   1 
ATOM   2545 C CB  . GLU B 1 81  ? -8.099  44.403 90.475  1.00 37.83 ? 115 GLU B CB  1 
ATOM   2546 C CG  . GLU B 1 81  ? -9.013  43.335 91.040  1.00 38.82 ? 115 GLU B CG  1 
ATOM   2547 C CD  . GLU B 1 81  ? -8.612  42.879 92.424  1.00 40.39 ? 115 GLU B CD  1 
ATOM   2548 O OE1 . GLU B 1 81  ? -9.508  42.791 93.292  1.00 41.18 ? 115 GLU B OE1 1 
ATOM   2549 O OE2 . GLU B 1 81  ? -7.414  42.597 92.646  1.00 41.24 ? 115 GLU B OE2 1 
ATOM   2550 N N   . ASP B 1 82  ? -7.227  43.310 87.475  1.00 36.63 ? 116 ASP B N   1 
ATOM   2551 C CA  . ASP B 1 82  ? -7.013  42.040 86.791  1.00 36.05 ? 116 ASP B CA  1 
ATOM   2552 C C   . ASP B 1 82  ? -5.909  41.280 87.492  1.00 35.66 ? 116 ASP B C   1 
ATOM   2553 O O   . ASP B 1 82  ? -5.664  41.494 88.673  1.00 35.84 ? 116 ASP B O   1 
ATOM   2554 C CB  . ASP B 1 82  ? -6.702  42.235 85.309  1.00 36.19 ? 116 ASP B CB  1 
ATOM   2555 C CG  . ASP B 1 82  ? -5.681  43.318 85.063  1.00 36.92 ? 116 ASP B CG  1 
ATOM   2556 O OD1 . ASP B 1 82  ? -4.791  43.514 85.921  1.00 37.28 ? 116 ASP B OD1 1 
ATOM   2557 O OD2 . ASP B 1 82  ? -5.775  43.974 84.000  1.00 37.19 ? 116 ASP B OD2 1 
ATOM   2558 N N   . ASP B 1 83  ? -5.231  40.403 86.767  1.00 35.10 ? 117 ASP B N   1 
ATOM   2559 C CA  . ASP B 1 83  ? -4.217  39.570 87.371  1.00 34.52 ? 117 ASP B CA  1 
ATOM   2560 C C   . ASP B 1 83  ? -2.926  40.292 87.755  1.00 34.32 ? 117 ASP B C   1 
ATOM   2561 O O   . ASP B 1 83  ? -2.161  39.776 88.565  1.00 34.15 ? 117 ASP B O   1 
ATOM   2562 C CB  . ASP B 1 83  ? -3.889  38.397 86.464  1.00 34.50 ? 117 ASP B CB  1 
ATOM   2563 C CG  . ASP B 1 83  ? -3.294  37.242 87.224  1.00 35.20 ? 117 ASP B CG  1 
ATOM   2564 O OD1 . ASP B 1 83  ? -3.781  36.981 88.344  1.00 36.58 ? 117 ASP B OD1 1 
ATOM   2565 O OD2 . ASP B 1 83  ? -2.347  36.601 86.718  1.00 35.34 ? 117 ASP B OD2 1 
ATOM   2566 N N   . THR B 1 84  ? -2.672  41.470 87.184  1.00 34.20 ? 118 THR B N   1 
ATOM   2567 C CA  . THR B 1 84  ? -1.376  42.138 87.376  1.00 34.22 ? 118 THR B CA  1 
ATOM   2568 C C   . THR B 1 84  ? -1.449  43.588 87.871  1.00 34.35 ? 118 THR B C   1 
ATOM   2569 O O   . THR B 1 84  ? -0.459  44.124 88.386  1.00 34.62 ? 118 THR B O   1 
ATOM   2570 C CB  . THR B 1 84  ? -0.529  42.113 86.097  1.00 33.95 ? 118 THR B CB  1 
ATOM   2571 O OG1 . THR B 1 84  ? -1.205  42.843 85.071  1.00 34.99 ? 118 THR B OG1 1 
ATOM   2572 C CG2 . THR B 1 84  ? -0.288  40.686 85.622  1.00 33.69 ? 118 THR B CG2 1 
ATOM   2573 N N   . ARG B 1 85  ? -2.608  44.221 87.724  1.00 34.23 ? 119 ARG B N   1 
ATOM   2574 C CA  . ARG B 1 85  ? -2.752  45.634 88.096  1.00 33.89 ? 119 ARG B CA  1 
ATOM   2575 C C   . ARG B 1 85  ? -4.097  45.974 88.753  1.00 34.10 ? 119 ARG B C   1 
ATOM   2576 O O   . ARG B 1 85  ? -5.056  45.192 88.701  1.00 33.75 ? 119 ARG B O   1 
ATOM   2577 C CB  . ARG B 1 85  ? -2.526  46.548 86.878  1.00 33.80 ? 119 ARG B CB  1 
ATOM   2578 C CG  . ARG B 1 85  ? -1.089  46.664 86.429  1.00 33.09 ? 119 ARG B CG  1 
ATOM   2579 C CD  . ARG B 1 85  ? -0.942  47.588 85.243  1.00 32.94 ? 119 ARG B CD  1 
ATOM   2580 N NE  . ARG B 1 85  ? -1.835  47.200 84.155  1.00 31.68 ? 119 ARG B NE  1 
ATOM   2581 C CZ  . ARG B 1 85  ? -1.849  47.753 82.942  1.00 30.66 ? 119 ARG B CZ  1 
ATOM   2582 N NH1 . ARG B 1 85  ? -1.014  48.740 82.621  1.00 30.29 ? 119 ARG B NH1 1 
ATOM   2583 N NH2 . ARG B 1 85  ? -2.711  47.312 82.044  1.00 28.70 ? 119 ARG B NH2 1 
ATOM   2584 N N   . PHE B 1 86  ? -4.140  47.149 89.374  1.00 34.11 ? 120 PHE B N   1 
ATOM   2585 C CA  . PHE B 1 86  ? -5.366  47.691 89.914  1.00 34.57 ? 120 PHE B CA  1 
ATOM   2586 C C   . PHE B 1 86  ? -5.700  48.892 89.064  1.00 35.21 ? 120 PHE B C   1 
ATOM   2587 O O   . PHE B 1 86  ? -4.802  49.611 88.612  1.00 35.45 ? 120 PHE B O   1 
ATOM   2588 C CB  . PHE B 1 86  ? -5.201  48.139 91.377  1.00 34.19 ? 120 PHE B CB  1 
ATOM   2589 C CG  . PHE B 1 86  ? -4.991  47.009 92.358  1.00 33.80 ? 120 PHE B CG  1 
ATOM   2590 C CD1 . PHE B 1 86  ? -3.769  46.856 93.010  1.00 33.24 ? 120 PHE B CD1 1 
ATOM   2591 C CD2 . PHE B 1 86  ? -6.016  46.116 92.650  1.00 33.04 ? 120 PHE B CD2 1 
ATOM   2592 C CE1 . PHE B 1 86  ? -3.572  45.824 93.913  1.00 32.37 ? 120 PHE B CE1 1 
ATOM   2593 C CE2 . PHE B 1 86  ? -5.821  45.077 93.554  1.00 32.36 ? 120 PHE B CE2 1 
ATOM   2594 C CZ  . PHE B 1 86  ? -4.600  44.931 94.183  1.00 32.32 ? 120 PHE B CZ  1 
ATOM   2595 N N   . TYR B 1 87  ? -6.993  49.114 88.861  1.00 35.89 ? 121 TYR B N   1 
ATOM   2596 C CA  . TYR B 1 87  ? -7.461  50.241 88.082  1.00 36.67 ? 121 TYR B CA  1 
ATOM   2597 C C   . TYR B 1 87  ? -8.441  51.080 88.901  1.00 37.40 ? 121 TYR B C   1 
ATOM   2598 O O   . TYR B 1 87  ? -9.570  50.651 89.189  1.00 37.48 ? 121 TYR B O   1 
ATOM   2599 C CB  . TYR B 1 87  ? -8.109  49.753 86.785  1.00 36.65 ? 121 TYR B CB  1 
ATOM   2600 C CG  . TYR B 1 87  ? -7.211  48.902 85.897  1.00 36.31 ? 121 TYR B CG  1 
ATOM   2601 C CD1 . TYR B 1 87  ? -7.198  47.514 86.015  1.00 35.54 ? 121 TYR B CD1 1 
ATOM   2602 C CD2 . TYR B 1 87  ? -6.397  49.490 84.923  1.00 36.55 ? 121 TYR B CD2 1 
ATOM   2603 C CE1 . TYR B 1 87  ? -6.395  46.736 85.202  1.00 35.99 ? 121 TYR B CE1 1 
ATOM   2604 C CE2 . TYR B 1 87  ? -5.586  48.718 84.094  1.00 36.23 ? 121 TYR B CE2 1 
ATOM   2605 C CZ  . TYR B 1 87  ? -5.590  47.343 84.245  1.00 36.46 ? 121 TYR B CZ  1 
ATOM   2606 O OH  . TYR B 1 87  ? -4.796  46.573 83.438  1.00 36.52 ? 121 TYR B OH  1 
ATOM   2607 N N   . LEU B 1 88  ? -7.991  52.273 89.285  1.00 38.11 ? 122 LEU B N   1 
ATOM   2608 C CA  . LEU B 1 88  ? -8.808  53.200 90.050  1.00 38.64 ? 122 LEU B CA  1 
ATOM   2609 C C   . LEU B 1 88  ? -9.288  54.321 89.143  1.00 39.59 ? 122 LEU B C   1 
ATOM   2610 O O   . LEU B 1 88  ? -8.527  55.237 88.817  1.00 39.57 ? 122 LEU B O   1 
ATOM   2611 C CB  . LEU B 1 88  ? -8.011  53.768 91.226  1.00 38.64 ? 122 LEU B CB  1 
ATOM   2612 C CG  . LEU B 1 88  ? -7.993  52.980 92.540  1.00 38.41 ? 122 LEU B CG  1 
ATOM   2613 C CD1 . LEU B 1 88  ? -7.289  51.620 92.389  1.00 37.78 ? 122 LEU B CD1 1 
ATOM   2614 C CD2 . LEU B 1 88  ? -7.355  53.827 93.646  1.00 37.83 ? 122 LEU B CD2 1 
ATOM   2615 N N   . VAL B 1 89  ? -10.548 54.235 88.724  1.00 40.60 ? 123 VAL B N   1 
ATOM   2616 C CA  . VAL B 1 89  ? -11.118 55.219 87.813  1.00 41.55 ? 123 VAL B CA  1 
ATOM   2617 C C   . VAL B 1 89  ? -11.635 56.401 88.617  1.00 42.58 ? 123 VAL B C   1 
ATOM   2618 O O   . VAL B 1 89  ? -12.579 56.270 89.394  1.00 42.59 ? 123 VAL B O   1 
ATOM   2619 C CB  . VAL B 1 89  ? -12.260 54.638 86.947  1.00 41.36 ? 123 VAL B CB  1 
ATOM   2620 C CG1 . VAL B 1 89  ? -12.782 55.690 86.001  1.00 41.04 ? 123 VAL B CG1 1 
ATOM   2621 C CG2 . VAL B 1 89  ? -11.792 53.424 86.174  1.00 40.73 ? 123 VAL B CG2 1 
ATOM   2622 N N   . PHE B 1 90  ? -10.996 57.549 88.424  1.00 43.82 ? 124 PHE B N   1 
ATOM   2623 C CA  . PHE B 1 90  ? -11.394 58.782 89.071  1.00 45.06 ? 124 PHE B CA  1 
ATOM   2624 C C   . PHE B 1 90  ? -12.017 59.730 88.071  1.00 46.13 ? 124 PHE B C   1 
ATOM   2625 O O   . PHE B 1 90  ? -11.745 59.646 86.869  1.00 46.32 ? 124 PHE B O   1 
ATOM   2626 C CB  . PHE B 1 90  ? -10.174 59.478 89.667  1.00 44.99 ? 124 PHE B CB  1 
ATOM   2627 C CG  . PHE B 1 90  ? -9.604  58.796 90.854  1.00 44.87 ? 124 PHE B CG  1 
ATOM   2628 C CD1 . PHE B 1 90  ? -8.420  58.089 90.752  1.00 44.63 ? 124 PHE B CD1 1 
ATOM   2629 C CD2 . PHE B 1 90  ? -10.241 58.873 92.091  1.00 45.28 ? 124 PHE B CD2 1 
ATOM   2630 C CE1 . PHE B 1 90  ? -7.881  57.452 91.868  1.00 45.10 ? 124 PHE B CE1 1 
ATOM   2631 C CE2 . PHE B 1 90  ? -9.708  58.240 93.215  1.00 44.77 ? 124 PHE B CE2 1 
ATOM   2632 C CZ  . PHE B 1 90  ? -8.525  57.529 93.102  1.00 44.48 ? 124 PHE B CZ  1 
ATOM   2633 N N   . GLU B 1 91  ? -12.827 60.655 88.581  1.00 47.56 ? 125 GLU B N   1 
ATOM   2634 C CA  . GLU B 1 91  ? -13.328 61.771 87.790  1.00 49.17 ? 125 GLU B CA  1 
ATOM   2635 C C   . GLU B 1 91  ? -12.164 62.580 87.229  1.00 50.04 ? 125 GLU B C   1 
ATOM   2636 O O   . GLU B 1 91  ? -11.116 62.724 87.874  1.00 49.78 ? 125 GLU B O   1 
ATOM   2637 C CB  . GLU B 1 91  ? -14.240 62.673 88.626  1.00 48.95 ? 125 GLU B CB  1 
ATOM   2638 C CG  . GLU B 1 91  ? -13.577 63.256 89.879  1.00 49.88 ? 125 GLU B CG  1 
ATOM   2639 C CD  . GLU B 1 91  ? -14.443 64.286 90.600  1.00 50.06 ? 125 GLU B CD  1 
ATOM   2640 O OE1 . GLU B 1 91  ? -15.278 64.946 89.934  1.00 51.05 ? 125 GLU B OE1 1 
ATOM   2641 O OE2 . GLU B 1 91  ? -14.283 64.431 91.838  1.00 50.74 ? 125 GLU B OE2 1 
ATOM   2642 N N   . LYS B 1 92  ? -12.363 63.097 86.020  1.00 51.50 ? 126 LYS B N   1 
ATOM   2643 C CA  . LYS B 1 92  ? -11.355 63.893 85.338  1.00 52.99 ? 126 LYS B CA  1 
ATOM   2644 C C   . LYS B 1 92  ? -11.488 65.370 85.688  1.00 54.28 ? 126 LYS B C   1 
ATOM   2645 O O   . LYS B 1 92  ? -12.571 65.947 85.593  1.00 54.65 ? 126 LYS B O   1 
ATOM   2646 C CB  . LYS B 1 92  ? -11.464 63.685 83.830  1.00 52.74 ? 126 LYS B CB  1 
ATOM   2647 C CG  . LYS B 1 92  ? -10.443 64.447 83.003  1.00 52.97 ? 126 LYS B CG  1 
ATOM   2648 C CD  . LYS B 1 92  ? -9.012  64.063 83.349  1.00 52.67 ? 126 LYS B CD  1 
ATOM   2649 C CE  . LYS B 1 92  ? -8.153  64.027 82.107  1.00 52.29 ? 126 LYS B CE  1 
ATOM   2650 N NZ  . LYS B 1 92  ? -8.552  62.889 81.220  1.00 52.15 ? 126 LYS B NZ  1 
ATOM   2651 N N   . LEU B 1 93  ? -10.383 65.972 86.112  1.00 55.92 ? 127 LEU B N   1 
ATOM   2652 C CA  . LEU B 1 93  ? -10.346 67.412 86.368  1.00 57.47 ? 127 LEU B CA  1 
ATOM   2653 C C   . LEU B 1 93  ? -9.360  68.071 85.419  1.00 58.71 ? 127 LEU B C   1 
ATOM   2654 O O   . LEU B 1 93  ? -8.331  67.487 85.062  1.00 59.11 ? 127 LEU B O   1 
ATOM   2655 C CB  . LEU B 1 93  ? -9.974  67.725 87.824  1.00 57.30 ? 127 LEU B CB  1 
ATOM   2656 C CG  . LEU B 1 93  ? -10.881 67.267 88.974  1.00 57.08 ? 127 LEU B CG  1 
ATOM   2657 C CD1 . LEU B 1 93  ? -10.318 67.776 90.290  1.00 56.58 ? 127 LEU B CD1 1 
ATOM   2658 C CD2 . LEU B 1 93  ? -12.337 67.711 88.799  1.00 56.80 ? 127 LEU B CD2 1 
ATOM   2659 N N   . GLN B 1 94  ? -9.673  69.294 85.021  1.00 60.15 ? 128 GLN B N   1 
ATOM   2660 C CA  . GLN B 1 94  ? -8.900  69.983 83.998  1.00 61.75 ? 128 GLN B CA  1 
ATOM   2661 C C   . GLN B 1 94  ? -7.782  70.811 84.615  1.00 62.49 ? 128 GLN B C   1 
ATOM   2662 O O   . GLN B 1 94  ? -6.882  71.277 83.911  1.00 62.59 ? 128 GLN B O   1 
ATOM   2663 C CB  . GLN B 1 94  ? -9.813  70.875 83.142  1.00 62.04 ? 128 GLN B CB  1 
ATOM   2664 C CG  . GLN B 1 94  ? -11.057 70.176 82.564  1.00 63.24 ? 128 GLN B CG  1 
ATOM   2665 C CD  . GLN B 1 94  ? -12.241 70.117 83.543  1.00 64.98 ? 128 GLN B CD  1 
ATOM   2666 O OE1 . GLN B 1 94  ? -12.071 70.144 84.772  1.00 65.47 ? 128 GLN B OE1 1 
ATOM   2667 N NE2 . GLN B 1 94  ? -13.449 70.028 82.991  1.00 65.30 ? 128 GLN B NE2 1 
ATOM   2668 N N   . GLY B 1 95  ? -7.837  70.978 85.933  1.00 63.41 ? 129 GLY B N   1 
ATOM   2669 C CA  . GLY B 1 95  ? -6.921  71.864 86.637  1.00 64.61 ? 129 GLY B CA  1 
ATOM   2670 C C   . GLY B 1 95  ? -5.507  71.344 86.781  1.00 65.45 ? 129 GLY B C   1 
ATOM   2671 O O   . GLY B 1 95  ? -4.546  72.086 86.597  1.00 65.48 ? 129 GLY B O   1 
ATOM   2672 N N   . GLY B 1 96  ? -5.372  70.071 87.119  1.00 66.43 ? 130 GLY B N   1 
ATOM   2673 C CA  . GLY B 1 96  ? -4.061  69.522 87.454  1.00 67.92 ? 130 GLY B CA  1 
ATOM   2674 C C   . GLY B 1 96  ? -3.542  69.962 88.821  1.00 68.88 ? 130 GLY B C   1 
ATOM   2675 O O   . GLY B 1 96  ? -4.193  70.735 89.542  1.00 68.98 ? 130 GLY B O   1 
ATOM   2676 N N   . SER B 1 97  ? -2.353  69.468 89.165  1.00 69.71 ? 131 SER B N   1 
ATOM   2677 C CA  . SER B 1 97  ? -1.752  69.660 90.486  1.00 70.25 ? 131 SER B CA  1 
ATOM   2678 C C   . SER B 1 97  ? -1.547  71.130 90.841  1.00 70.72 ? 131 SER B C   1 
ATOM   2679 O O   . SER B 1 97  ? -1.299  71.964 89.965  1.00 70.69 ? 131 SER B O   1 
ATOM   2680 C CB  . SER B 1 97  ? -0.420  68.905 90.561  1.00 70.20 ? 131 SER B CB  1 
ATOM   2681 O OG  . SER B 1 97  ? 0.267   69.189 91.761  1.00 70.01 ? 131 SER B OG  1 
ATOM   2682 N N   . ILE B 1 98  ? -1.651  71.429 92.134  1.00 71.41 ? 132 ILE B N   1 
ATOM   2683 C CA  . ILE B 1 98  ? -1.418  72.778 92.643  1.00 72.09 ? 132 ILE B CA  1 
ATOM   2684 C C   . ILE B 1 98  ? 0.076   73.127 92.619  1.00 72.75 ? 132 ILE B C   1 
ATOM   2685 O O   . ILE B 1 98  ? 0.440   74.297 92.699  1.00 72.82 ? 132 ILE B O   1 
ATOM   2686 C CB  . ILE B 1 98  ? -2.070  72.982 94.054  1.00 72.09 ? 132 ILE B CB  1 
ATOM   2687 C CG1 . ILE B 1 98  ? -2.825  74.305 94.107  1.00 71.95 ? 132 ILE B CG1 1 
ATOM   2688 C CG2 . ILE B 1 98  ? -1.061  72.841 95.207  1.00 71.67 ? 132 ILE B CG2 1 
ATOM   2689 C CD1 . ILE B 1 98  ? -3.980  74.280 95.070  1.00 72.10 ? 132 ILE B CD1 1 
ATOM   2690 N N   . LEU B 1 99  ? 0.923   72.102 92.495  1.00 73.69 ? 133 LEU B N   1 
ATOM   2691 C CA  . LEU B 1 99  ? 2.369   72.269 92.304  1.00 74.60 ? 133 LEU B CA  1 
ATOM   2692 C C   . LEU B 1 99  ? 2.675   72.904 90.958  1.00 75.44 ? 133 LEU B C   1 
ATOM   2693 O O   . LEU B 1 99  ? 3.579   73.733 90.853  1.00 75.63 ? 133 LEU B O   1 
ATOM   2694 C CB  . LEU B 1 99  ? 3.097   70.926 92.405  1.00 74.41 ? 133 LEU B CB  1 
ATOM   2695 C CG  . LEU B 1 99  ? 4.597   70.899 92.084  1.00 74.36 ? 133 LEU B CG  1 
ATOM   2696 C CD1 . LEU B 1 99  ? 5.440   71.529 93.203  1.00 73.83 ? 133 LEU B CD1 1 
ATOM   2697 C CD2 . LEU B 1 99  ? 5.060   69.475 91.782  1.00 74.64 ? 133 LEU B CD2 1 
ATOM   2698 N N   . ALA B 1 100 ? 1.933   72.495 89.929  1.00 76.49 ? 134 ALA B N   1 
ATOM   2699 C CA  . ALA B 1 100 ? 2.026   73.119 88.615  1.00 77.44 ? 134 ALA B CA  1 
ATOM   2700 C C   . ALA B 1 100 ? 1.752   74.622 88.746  1.00 78.20 ? 134 ALA B C   1 
ATOM   2701 O O   . ALA B 1 100 ? 2.547   75.443 88.291  1.00 78.29 ? 134 ALA B O   1 
ATOM   2702 C CB  . ALA B 1 100 ? 1.056   72.462 87.645  1.00 77.31 ? 134 ALA B CB  1 
ATOM   2703 N N   . HIS B 1 101 ? 0.654   74.968 89.414  1.00 79.18 ? 135 HIS B N   1 
ATOM   2704 C CA  . HIS B 1 101 ? 0.282   76.364 89.661  1.00 80.31 ? 135 HIS B CA  1 
ATOM   2705 C C   . HIS B 1 101 ? 1.284   77.104 90.557  1.00 80.94 ? 135 HIS B C   1 
ATOM   2706 O O   . HIS B 1 101 ? 1.176   78.313 90.740  1.00 80.93 ? 135 HIS B O   1 
ATOM   2707 C CB  . HIS B 1 101 ? -1.118  76.439 90.290  1.00 80.44 ? 135 HIS B CB  1 
ATOM   2708 C CG  . HIS B 1 101 ? -2.226  75.976 89.389  1.00 81.11 ? 135 HIS B CG  1 
ATOM   2709 N ND1 . HIS B 1 101 ? -3.218  76.820 88.935  1.00 81.64 ? 135 HIS B ND1 1 
ATOM   2710 C CD2 . HIS B 1 101 ? -2.511  74.755 88.874  1.00 81.53 ? 135 HIS B CD2 1 
ATOM   2711 C CE1 . HIS B 1 101 ? -4.060  76.143 88.174  1.00 81.47 ? 135 HIS B CE1 1 
ATOM   2712 N NE2 . HIS B 1 101 ? -3.654  74.887 88.122  1.00 81.48 ? 135 HIS B NE2 1 
ATOM   2713 N N   . ILE B 1 102 ? 2.241   76.371 91.121  1.00 81.93 ? 136 ILE B N   1 
ATOM   2714 C CA  . ILE B 1 102 ? 3.259   76.938 92.012  1.00 82.96 ? 136 ILE B CA  1 
ATOM   2715 C C   . ILE B 1 102 ? 4.486   77.388 91.222  1.00 83.57 ? 136 ILE B C   1 
ATOM   2716 O O   . ILE B 1 102 ? 4.894   78.550 91.306  1.00 83.62 ? 136 ILE B O   1 
ATOM   2717 C CB  . ILE B 1 102 ? 3.671   75.917 93.133  1.00 83.04 ? 136 ILE B CB  1 
ATOM   2718 C CG1 . ILE B 1 102 ? 2.654   75.907 94.288  1.00 83.34 ? 136 ILE B CG1 1 
ATOM   2719 C CG2 . ILE B 1 102 ? 5.108   76.156 93.644  1.00 83.19 ? 136 ILE B CG2 1 
ATOM   2720 C CD1 . ILE B 1 102 ? 2.698   77.122 95.216  1.00 83.96 ? 136 ILE B CD1 1 
ATOM   2721 N N   . GLN B 1 103 ? 5.062   76.459 90.461  1.00 84.35 ? 137 GLN B N   1 
ATOM   2722 C CA  . GLN B 1 103 ? 6.285   76.703 89.699  1.00 85.17 ? 137 GLN B CA  1 
ATOM   2723 C C   . GLN B 1 103 ? 6.014   77.611 88.506  1.00 85.79 ? 137 GLN B C   1 
ATOM   2724 O O   . GLN B 1 103 ? 6.873   78.412 88.123  1.00 85.94 ? 137 GLN B O   1 
ATOM   2725 C CB  . GLN B 1 103 ? 6.886   75.386 89.215  1.00 85.10 ? 137 GLN B CB  1 
ATOM   2726 C CG  . GLN B 1 103 ? 7.096   74.359 90.309  1.00 85.20 ? 137 GLN B CG  1 
ATOM   2727 C CD  . GLN B 1 103 ? 6.974   72.935 89.800  1.00 85.41 ? 137 GLN B CD  1 
ATOM   2728 O OE1 . GLN B 1 103 ? 7.804   72.083 90.115  1.00 85.70 ? 137 GLN B OE1 1 
ATOM   2729 N NE2 . GLN B 1 103 ? 5.934   72.667 89.012  1.00 85.34 ? 137 GLN B NE2 1 
ATOM   2730 N N   . LYS B 1 104 ? 4.820   77.480 87.924  1.00 86.46 ? 138 LYS B N   1 
ATOM   2731 C CA  . LYS B 1 104 ? 4.360   78.379 86.858  1.00 87.10 ? 138 LYS B CA  1 
ATOM   2732 C C   . LYS B 1 104 ? 3.899   79.727 87.434  1.00 87.36 ? 138 LYS B C   1 
ATOM   2733 O O   . LYS B 1 104 ? 3.136   80.467 86.805  1.00 87.40 ? 138 LYS B O   1 
ATOM   2734 C CB  . LYS B 1 104 ? 3.251   77.721 86.023  1.00 87.07 ? 138 LYS B CB  1 
ATOM   2735 C CG  . LYS B 1 104 ? 3.733   76.555 85.155  1.00 87.31 ? 138 LYS B CG  1 
ATOM   2736 C CD  . LYS B 1 104 ? 2.622   75.983 84.276  1.00 87.35 ? 138 LYS B CD  1 
ATOM   2737 C CE  . LYS B 1 104 ? 1.639   75.132 85.077  1.00 87.67 ? 138 LYS B CE  1 
ATOM   2738 N NZ  . LYS B 1 104 ? 0.621   74.469 84.215  1.00 87.62 ? 138 LYS B NZ  1 
ATOM   2739 N N   . GLN B 1 105 ? 4.383   80.021 88.640  1.00 87.71 ? 139 GLN B N   1 
ATOM   2740 C CA  . GLN B 1 105 ? 4.104   81.254 89.364  1.00 87.97 ? 139 GLN B CA  1 
ATOM   2741 C C   . GLN B 1 105 ? 5.336   81.576 90.213  1.00 88.11 ? 139 GLN B C   1 
ATOM   2742 O O   . GLN B 1 105 ? 6.471   81.299 89.810  1.00 88.18 ? 139 GLN B O   1 
ATOM   2743 C CB  . GLN B 1 105 ? 2.880   81.064 90.269  1.00 88.02 ? 139 GLN B CB  1 
ATOM   2744 C CG  . GLN B 1 105 ? 1.539   81.044 89.552  1.00 88.08 ? 139 GLN B CG  1 
ATOM   2745 C CD  . GLN B 1 105 ? 0.856   82.386 89.570  1.00 88.45 ? 139 GLN B CD  1 
ATOM   2746 O OE1 . GLN B 1 105 ? 0.747   83.051 88.541  1.00 88.91 ? 139 GLN B OE1 1 
ATOM   2747 N NE2 . GLN B 1 105 ? 0.396   82.802 90.748  1.00 88.49 ? 139 GLN B NE2 1 
ATOM   2748 N N   . LYS B 1 106 ? 5.097   82.167 91.382  1.00 88.21 ? 140 LYS B N   1 
ATOM   2749 C CA  . LYS B 1 106 ? 6.113   82.357 92.415  1.00 88.24 ? 140 LYS B CA  1 
ATOM   2750 C C   . LYS B 1 106 ? 5.418   82.186 93.759  1.00 88.26 ? 140 LYS B C   1 
ATOM   2751 O O   . LYS B 1 106 ? 5.697   81.244 94.502  1.00 88.26 ? 140 LYS B O   1 
ATOM   2752 C CB  . LYS B 1 106 ? 6.761   83.742 92.300  1.00 88.22 ? 140 LYS B CB  1 
ATOM   2753 C CG  . LYS B 1 106 ? 7.848   83.818 91.245  1.00 88.00 ? 140 LYS B CG  1 
ATOM   2754 C CD  . LYS B 1 106 ? 7.505   84.852 90.198  1.00 87.66 ? 140 LYS B CD  1 
ATOM   2755 C CE  . LYS B 1 106 ? 7.962   84.391 88.828  1.00 87.31 ? 140 LYS B CE  1 
ATOM   2756 N NZ  . LYS B 1 106 ? 7.302   85.176 87.756  1.00 87.14 ? 140 LYS B NZ  1 
ATOM   2757 N N   . HIS B 1 107 ? 4.494   83.101 94.040  1.00 88.27 ? 141 HIS B N   1 
ATOM   2758 C CA  . HIS B 1 107 ? 3.639   83.046 95.222  1.00 88.22 ? 141 HIS B CA  1 
ATOM   2759 C C   . HIS B 1 107 ? 2.177   82.802 94.818  1.00 87.95 ? 141 HIS B C   1 
ATOM   2760 O O   . HIS B 1 107 ? 1.896   82.414 93.680  1.00 87.91 ? 141 HIS B O   1 
ATOM   2761 C CB  . HIS B 1 107 ? 3.781   84.335 96.059  1.00 88.39 ? 141 HIS B CB  1 
ATOM   2762 C CG  . HIS B 1 107 ? 3.860   85.599 95.246  1.00 89.00 ? 141 HIS B CG  1 
ATOM   2763 N ND1 . HIS B 1 107 ? 2.810   86.067 94.482  1.00 89.56 ? 141 HIS B ND1 1 
ATOM   2764 C CD2 . HIS B 1 107 ? 4.858   86.506 95.104  1.00 89.42 ? 141 HIS B CD2 1 
ATOM   2765 C CE1 . HIS B 1 107 ? 3.162   87.197 93.893  1.00 89.56 ? 141 HIS B CE1 1 
ATOM   2766 N NE2 . HIS B 1 107 ? 4.399   87.487 94.256  1.00 89.60 ? 141 HIS B NE2 1 
ATOM   2767 N N   . PHE B 1 108 ? 1.263   83.012 95.764  1.00 87.64 ? 142 PHE B N   1 
ATOM   2768 C CA  . PHE B 1 108 ? -0.181  82.989 95.517  1.00 87.29 ? 142 PHE B CA  1 
ATOM   2769 C C   . PHE B 1 108 ? -0.781  84.294 96.033  1.00 86.87 ? 142 PHE B C   1 
ATOM   2770 O O   . PHE B 1 108 ? -0.131  85.025 96.782  1.00 86.78 ? 142 PHE B O   1 
ATOM   2771 C CB  . PHE B 1 108 ? -0.831  81.808 96.254  1.00 87.46 ? 142 PHE B CB  1 
ATOM   2772 C CG  . PHE B 1 108 ? -0.976  80.549 95.422  1.00 87.85 ? 142 PHE B CG  1 
ATOM   2773 C CD1 . PHE B 1 108 ? -2.197  79.875 95.377  1.00 88.03 ? 142 PHE B CD1 1 
ATOM   2774 C CD2 . PHE B 1 108 ? 0.100   80.024 94.699  1.00 88.28 ? 142 PHE B CD2 1 
ATOM   2775 C CE1 . PHE B 1 108 ? -2.347  78.703 94.622  1.00 88.01 ? 142 PHE B CE1 1 
ATOM   2776 C CE2 . PHE B 1 108 ? -0.042  78.855 93.935  1.00 88.15 ? 142 PHE B CE2 1 
ATOM   2777 C CZ  . PHE B 1 108 ? -1.266  78.193 93.900  1.00 87.86 ? 142 PHE B CZ  1 
ATOM   2778 N N   . ASN B 1 109 ? -2.013  84.589 95.631  1.00 86.38 ? 143 ASN B N   1 
ATOM   2779 C CA  . ASN B 1 109 ? -2.776  85.659 96.266  1.00 86.02 ? 143 ASN B CA  1 
ATOM   2780 C C   . ASN B 1 109 ? -3.373  85.149 97.585  1.00 85.59 ? 143 ASN B C   1 
ATOM   2781 O O   . ASN B 1 109 ? -3.670  83.959 97.714  1.00 85.52 ? 143 ASN B O   1 
ATOM   2782 C CB  . ASN B 1 109 ? -3.868  86.177 95.322  1.00 86.14 ? 143 ASN B CB  1 
ATOM   2783 C CG  . ASN B 1 109 ? -4.632  87.377 95.889  1.00 86.65 ? 143 ASN B CG  1 
ATOM   2784 O OD1 . ASN B 1 109 ? -5.841  87.496 95.690  1.00 87.34 ? 143 ASN B OD1 1 
ATOM   2785 N ND2 . ASN B 1 109 ? -3.929  88.268 96.591  1.00 86.99 ? 143 ASN B ND2 1 
ATOM   2786 N N   . GLU B 1 110 ? -3.529  86.043 98.562  1.00 85.04 ? 144 GLU B N   1 
ATOM   2787 C CA  . GLU B 1 110 ? -4.093  85.683 99.870  1.00 84.48 ? 144 GLU B CA  1 
ATOM   2788 C C   . GLU B 1 110 ? -5.560  85.256 99.796  1.00 84.03 ? 144 GLU B C   1 
ATOM   2789 O O   . GLU B 1 110 ? -6.014  84.458 100.613 1.00 83.97 ? 144 GLU B O   1 
ATOM   2790 C CB  . GLU B 1 110 ? -3.926  86.822 100.888 1.00 84.58 ? 144 GLU B CB  1 
ATOM   2791 C CG  . GLU B 1 110 ? -2.495  87.008 101.399 1.00 84.60 ? 144 GLU B CG  1 
ATOM   2792 C CD  . GLU B 1 110 ? -2.411  87.560 102.822 1.00 84.40 ? 144 GLU B CD  1 
ATOM   2793 O OE1 . GLU B 1 110 ? -3.451  87.958 103.394 1.00 84.33 ? 144 GLU B OE1 1 
ATOM   2794 O OE2 . GLU B 1 110 ? -1.288  87.592 103.369 1.00 84.13 ? 144 GLU B OE2 1 
ATOM   2795 N N   . ARG B 1 111 ? -6.297  85.793 98.826  1.00 83.54 ? 145 ARG B N   1 
ATOM   2796 C CA  . ARG B 1 111 ? -7.683  85.379 98.602  1.00 83.05 ? 145 ARG B CA  1 
ATOM   2797 C C   . ARG B 1 111 ? -7.723  84.048 97.852  1.00 82.63 ? 145 ARG B C   1 
ATOM   2798 O O   . ARG B 1 111 ? -8.682  83.286 97.984  1.00 82.61 ? 145 ARG B O   1 
ATOM   2799 C CB  . ARG B 1 111 ? -8.497  86.462 97.866  1.00 83.10 ? 145 ARG B CB  1 
ATOM   2800 C CG  . ARG B 1 111 ? -8.740  87.784 98.645  1.00 83.34 ? 145 ARG B CG  1 
ATOM   2801 C CD  . ARG B 1 111 ? -9.554  87.603 99.948  1.00 83.60 ? 145 ARG B CD  1 
ATOM   2802 N NE  . ARG B 1 111 ? -8.712  87.207 101.085 1.00 83.37 ? 145 ARG B NE  1 
ATOM   2803 C CZ  . ARG B 1 111 ? -9.153  86.681 102.228 1.00 82.86 ? 145 ARG B CZ  1 
ATOM   2804 N NH1 . ARG B 1 111 ? -8.287  86.363 103.178 1.00 82.59 ? 145 ARG B NH1 1 
ATOM   2805 N NH2 . ARG B 1 111 ? -10.448 86.466 102.429 1.00 82.70 ? 145 ARG B NH2 1 
ATOM   2806 N N   . GLU B 1 112 ? -6.672  83.776 97.077  1.00 82.11 ? 146 GLU B N   1 
ATOM   2807 C CA  . GLU B 1 112 ? -6.508  82.493 96.387  1.00 81.62 ? 146 GLU B CA  1 
ATOM   2808 C C   . GLU B 1 112 ? -6.072  81.390 97.356  1.00 80.98 ? 146 GLU B C   1 
ATOM   2809 O O   . GLU B 1 112 ? -6.653  80.301 97.372  1.00 80.90 ? 146 GLU B O   1 
ATOM   2810 C CB  . GLU B 1 112 ? -5.508  82.611 95.227  1.00 81.68 ? 146 GLU B CB  1 
ATOM   2811 C CG  . GLU B 1 112 ? -6.104  83.143 93.919  1.00 81.99 ? 146 GLU B CG  1 
ATOM   2812 C CD  . GLU B 1 112 ? -5.114  83.111 92.759  1.00 81.93 ? 146 GLU B CD  1 
ATOM   2813 O OE1 . GLU B 1 112 ? -4.112  83.861 92.803  1.00 82.40 ? 146 GLU B OE1 1 
ATOM   2814 O OE2 . GLU B 1 112 ? -5.345  82.342 91.797  1.00 81.87 ? 146 GLU B OE2 1 
ATOM   2815 N N   . ALA B 1 113 ? -5.056  81.687 98.164  1.00 80.22 ? 147 ALA B N   1 
ATOM   2816 C CA  . ALA B 1 113 ? -4.527  80.744 99.145  1.00 79.47 ? 147 ALA B CA  1 
ATOM   2817 C C   . ALA B 1 113 ? -5.557  80.337 100.202 1.00 78.98 ? 147 ALA B C   1 
ATOM   2818 O O   . ALA B 1 113 ? -5.598  79.175 100.604 1.00 79.12 ? 147 ALA B O   1 
ATOM   2819 C CB  . ALA B 1 113 ? -3.269  81.306 99.802  1.00 79.48 ? 147 ALA B CB  1 
ATOM   2820 N N   . SER B 1 114 ? -6.388  81.284 100.638 1.00 78.27 ? 148 SER B N   1 
ATOM   2821 C CA  . SER B 1 114 ? -7.402  81.015 101.662 1.00 77.61 ? 148 SER B CA  1 
ATOM   2822 C C   . SER B 1 114 ? -8.469  80.035 101.183 1.00 77.24 ? 148 SER B C   1 
ATOM   2823 O O   . SER B 1 114 ? -8.928  79.194 101.958 1.00 77.33 ? 148 SER B O   1 
ATOM   2824 C CB  . SER B 1 114 ? -8.064  82.309 102.147 1.00 77.57 ? 148 SER B CB  1 
ATOM   2825 O OG  . SER B 1 114 ? -9.214  82.624 101.380 1.00 77.42 ? 148 SER B OG  1 
ATOM   2826 N N   . ARG B 1 115 ? -8.854  80.145 99.912  1.00 76.62 ? 149 ARG B N   1 
ATOM   2827 C CA  . ARG B 1 115 ? -9.901  79.301 99.333  1.00 76.08 ? 149 ARG B CA  1 
ATOM   2828 C C   . ARG B 1 115 ? -9.433  77.854 99.177  1.00 75.15 ? 149 ARG B C   1 
ATOM   2829 O O   . ARG B 1 115 ? -10.236 76.922 99.269  1.00 75.05 ? 149 ARG B O   1 
ATOM   2830 C CB  . ARG B 1 115 ? -10.354 79.860 97.979  1.00 76.53 ? 149 ARG B CB  1 
ATOM   2831 C CG  . ARG B 1 115 ? -11.877 79.956 97.781  1.00 78.09 ? 149 ARG B CG  1 
ATOM   2832 C CD  . ARG B 1 115 ? -12.557 78.597 97.572  1.00 80.84 ? 149 ARG B CD  1 
ATOM   2833 N NE  . ARG B 1 115 ? -13.707 78.704 96.670  1.00 82.86 ? 149 ARG B NE  1 
ATOM   2834 C CZ  . ARG B 1 115 ? -14.515 77.699 96.331  1.00 83.65 ? 149 ARG B CZ  1 
ATOM   2835 N NH1 . ARG B 1 115 ? -15.522 77.924 95.495  1.00 83.98 ? 149 ARG B NH1 1 
ATOM   2836 N NH2 . ARG B 1 115 ? -14.327 76.474 96.819  1.00 83.60 ? 149 ARG B NH2 1 
ATOM   2837 N N   . VAL B 1 116 ? -8.135  77.679 98.937  1.00 74.01 ? 150 VAL B N   1 
ATOM   2838 C CA  . VAL B 1 116 ? -7.511  76.356 98.909  1.00 72.88 ? 150 VAL B CA  1 
ATOM   2839 C C   . VAL B 1 116 ? -7.639  75.711 100.285 1.00 72.05 ? 150 VAL B C   1 
ATOM   2840 O O   . VAL B 1 116 ? -8.241  74.650 100.428 1.00 71.89 ? 150 VAL B O   1 
ATOM   2841 C CB  . VAL B 1 116 ? -6.015  76.442 98.522  1.00 72.93 ? 150 VAL B CB  1 
ATOM   2842 C CG1 . VAL B 1 116 ? -5.371  75.063 98.546  1.00 72.85 ? 150 VAL B CG1 1 
ATOM   2843 C CG2 . VAL B 1 116 ? -5.850  77.084 97.154  1.00 72.86 ? 150 VAL B CG2 1 
ATOM   2844 N N   . VAL B 1 117 ? -7.077  76.385 101.285 1.00 71.09 ? 151 VAL B N   1 
ATOM   2845 C CA  . VAL B 1 117 ? -7.126  75.973 102.688 1.00 70.21 ? 151 VAL B CA  1 
ATOM   2846 C C   . VAL B 1 117 ? -8.550  75.653 103.181 1.00 69.72 ? 151 VAL B C   1 
ATOM   2847 O O   . VAL B 1 117 ? -8.755  74.674 103.899 1.00 69.66 ? 151 VAL B O   1 
ATOM   2848 C CB  . VAL B 1 117 ? -6.465  77.051 103.580 1.00 70.14 ? 151 VAL B CB  1 
ATOM   2849 C CG1 . VAL B 1 117 ? -6.596  76.707 105.051 1.00 70.06 ? 151 VAL B CG1 1 
ATOM   2850 C CG2 . VAL B 1 117 ? -5.001  77.219 103.201 1.00 69.84 ? 151 VAL B CG2 1 
ATOM   2851 N N   . ARG B 1 118 ? -9.521  76.474 102.783 1.00 69.03 ? 152 ARG B N   1 
ATOM   2852 C CA  . ARG B 1 118 ? -10.935 76.257 103.101 1.00 68.38 ? 152 ARG B CA  1 
ATOM   2853 C C   . ARG B 1 118 ? -11.466 74.934 102.543 1.00 67.54 ? 152 ARG B C   1 
ATOM   2854 O O   . ARG B 1 118 ? -12.172 74.201 103.232 1.00 67.44 ? 152 ARG B O   1 
ATOM   2855 C CB  . ARG B 1 118 ? -11.766 77.418 102.557 1.00 68.63 ? 152 ARG B CB  1 
ATOM   2856 C CG  . ARG B 1 118 ? -13.204 77.468 103.037 1.00 69.98 ? 152 ARG B CG  1 
ATOM   2857 C CD  . ARG B 1 118 ? -13.717 78.908 103.026 1.00 72.66 ? 152 ARG B CD  1 
ATOM   2858 N NE  . ARG B 1 118 ? -13.818 79.458 101.669 1.00 75.06 ? 152 ARG B NE  1 
ATOM   2859 C CZ  . ARG B 1 118 ? -13.916 80.756 101.374 1.00 76.11 ? 152 ARG B CZ  1 
ATOM   2860 N NH1 . ARG B 1 118 ? -14.009 81.142 100.104 1.00 76.38 ? 152 ARG B NH1 1 
ATOM   2861 N NH2 . ARG B 1 118 ? -13.920 81.673 102.339 1.00 76.76 ? 152 ARG B NH2 1 
ATOM   2862 N N   . ASP B 1 119 ? -11.123 74.643 101.291 1.00 66.54 ? 153 ASP B N   1 
ATOM   2863 C CA  . ASP B 1 119 ? -11.560 73.421 100.622 1.00 65.41 ? 153 ASP B CA  1 
ATOM   2864 C C   . ASP B 1 119 ? -10.856 72.180 101.170 1.00 64.39 ? 153 ASP B C   1 
ATOM   2865 O O   . ASP B 1 119 ? -11.497 71.162 101.420 1.00 64.38 ? 153 ASP B O   1 
ATOM   2866 C CB  . ASP B 1 119 ? -11.338 73.531 99.110  1.00 65.65 ? 153 ASP B CB  1 
ATOM   2867 C CG  . ASP B 1 119 ? -12.383 74.399 98.418  1.00 66.19 ? 153 ASP B CG  1 
ATOM   2868 O OD1 . ASP B 1 119 ? -12.678 75.514 98.906  1.00 67.03 ? 153 ASP B OD1 1 
ATOM   2869 O OD2 . ASP B 1 119 ? -12.906 73.962 97.371  1.00 66.70 ? 153 ASP B OD2 1 
ATOM   2870 N N   . VAL B 1 120 ? -9.540  72.272 101.352 1.00 63.03 ? 154 VAL B N   1 
ATOM   2871 C CA  . VAL B 1 120 ? -8.745  71.169 101.891 1.00 61.61 ? 154 VAL B CA  1 
ATOM   2872 C C   . VAL B 1 120 ? -9.198  70.818 103.308 1.00 60.83 ? 154 VAL B C   1 
ATOM   2873 O O   . VAL B 1 120 ? -9.507  69.664 103.589 1.00 60.70 ? 154 VAL B O   1 
ATOM   2874 C CB  . VAL B 1 120 ? -7.232  71.494 101.876 1.00 61.64 ? 154 VAL B CB  1 
ATOM   2875 C CG1 . VAL B 1 120 ? -6.432  70.344 102.450 1.00 61.05 ? 154 VAL B CG1 1 
ATOM   2876 C CG2 . VAL B 1 120 ? -6.765  71.802 100.456 1.00 61.39 ? 154 VAL B CG2 1 
ATOM   2877 N N   . ALA B 1 121 ? -9.258  71.824 104.181 1.00 59.83 ? 155 ALA B N   1 
ATOM   2878 C CA  . ALA B 1 121 ? -9.709  71.650 105.566 1.00 58.83 ? 155 ALA B CA  1 
ATOM   2879 C C   . ALA B 1 121 ? -11.105 71.037 105.674 1.00 58.14 ? 155 ALA B C   1 
ATOM   2880 O O   . ALA B 1 121 ? -11.367 70.261 106.592 1.00 58.12 ? 155 ALA B O   1 
ATOM   2881 C CB  . ALA B 1 121 ? -9.651  72.973 106.322 1.00 58.69 ? 155 ALA B CB  1 
ATOM   2882 N N   . ALA B 1 122 ? -11.991 71.385 104.739 1.00 57.36 ? 156 ALA B N   1 
ATOM   2883 C CA  . ALA B 1 122 ? -13.359 70.849 104.710 1.00 56.55 ? 156 ALA B CA  1 
ATOM   2884 C C   . ALA B 1 122 ? -13.335 69.352 104.437 1.00 56.10 ? 156 ALA B C   1 
ATOM   2885 O O   . ALA B 1 122 ? -14.137 68.599 104.996 1.00 56.04 ? 156 ALA B O   1 
ATOM   2886 C CB  . ALA B 1 122 ? -14.214 71.577 103.671 1.00 56.32 ? 156 ALA B CB  1 
ATOM   2887 N N   . ALA B 1 123 ? -12.399 68.938 103.579 1.00 55.46 ? 157 ALA B N   1 
ATOM   2888 C CA  . ALA B 1 123 ? -12.181 67.537 103.253 1.00 54.75 ? 157 ALA B CA  1 
ATOM   2889 C C   . ALA B 1 123 ? -11.602 66.821 104.463 1.00 54.45 ? 157 ALA B C   1 
ATOM   2890 O O   . ALA B 1 123 ? -12.121 65.782 104.875 1.00 54.41 ? 157 ALA B O   1 
ATOM   2891 C CB  . ALA B 1 123 ? -11.250 67.405 102.057 1.00 54.57 ? 157 ALA B CB  1 
ATOM   2892 N N   . LEU B 1 124 ? -10.539 67.396 105.033 1.00 53.96 ? 158 LEU B N   1 
ATOM   2893 C CA  . LEU B 1 124 ? -9.868  66.838 106.207 1.00 53.35 ? 158 LEU B CA  1 
ATOM   2894 C C   . LEU B 1 124 ? -10.838 66.687 107.359 1.00 53.26 ? 158 LEU B C   1 
ATOM   2895 O O   . LEU B 1 124 ? -10.757 65.728 108.124 1.00 53.47 ? 158 LEU B O   1 
ATOM   2896 C CB  . LEU B 1 124 ? -8.689  67.710 106.650 1.00 53.15 ? 158 LEU B CB  1 
ATOM   2897 C CG  . LEU B 1 124 ? -7.416  67.751 105.800 1.00 52.52 ? 158 LEU B CG  1 
ATOM   2898 C CD1 . LEU B 1 124 ? -6.392  68.666 106.441 1.00 52.39 ? 158 LEU B CD1 1 
ATOM   2899 C CD2 . LEU B 1 124 ? -6.820  66.376 105.600 1.00 51.94 ? 158 LEU B CD2 1 
ATOM   2900 N N   . ASP B 1 125 ? -11.760 67.633 107.482 1.00 52.89 ? 159 ASP B N   1 
ATOM   2901 C CA  . ASP B 1 125 ? -12.760 67.541 108.522 1.00 52.62 ? 159 ASP B CA  1 
ATOM   2902 C C   . ASP B 1 125 ? -13.674 66.357 108.280 1.00 52.21 ? 159 ASP B C   1 
ATOM   2903 O O   . ASP B 1 125 ? -13.890 65.556 109.181 1.00 52.30 ? 159 ASP B O   1 
ATOM   2904 C CB  . ASP B 1 125 ? -13.570 68.825 108.637 1.00 52.68 ? 159 ASP B CB  1 
ATOM   2905 C CG  . ASP B 1 125 ? -14.589 68.756 109.744 1.00 53.20 ? 159 ASP B CG  1 
ATOM   2906 O OD1 . ASP B 1 125 ? -15.763 69.073 109.465 1.00 53.66 ? 159 ASP B OD1 1 
ATOM   2907 O OD2 . ASP B 1 125 ? -14.220 68.360 110.879 1.00 53.83 ? 159 ASP B OD2 1 
ATOM   2908 N N   . PHE B 1 126 ? -14.198 66.249 107.064 1.00 51.82 ? 160 PHE B N   1 
ATOM   2909 C CA  . PHE B 1 126 ? -15.017 65.112 106.679 1.00 51.71 ? 160 PHE B CA  1 
ATOM   2910 C C   . PHE B 1 126 ? -14.304 63.823 107.099 1.00 51.83 ? 160 PHE B C   1 
ATOM   2911 O O   . PHE B 1 126 ? -14.895 62.952 107.757 1.00 51.67 ? 160 PHE B O   1 
ATOM   2912 C CB  . PHE B 1 126 ? -15.283 65.140 105.160 1.00 51.55 ? 160 PHE B CB  1 
ATOM   2913 C CG  . PHE B 1 126 ? -15.936 63.883 104.616 1.00 51.41 ? 160 PHE B CG  1 
ATOM   2914 C CD1 . PHE B 1 126 ? -17.324 63.786 104.527 1.00 50.70 ? 160 PHE B CD1 1 
ATOM   2915 C CD2 . PHE B 1 126 ? -15.158 62.801 104.182 1.00 50.76 ? 160 PHE B CD2 1 
ATOM   2916 C CE1 . PHE B 1 126 ? -17.927 62.630 104.030 1.00 50.39 ? 160 PHE B CE1 1 
ATOM   2917 C CE2 . PHE B 1 126 ? -15.755 61.643 103.692 1.00 49.87 ? 160 PHE B CE2 1 
ATOM   2918 C CZ  . PHE B 1 126 ? -17.140 61.559 103.615 1.00 50.48 ? 160 PHE B CZ  1 
ATOM   2919 N N   . LEU B 1 127 ? -13.023 63.738 106.730 1.00 52.03 ? 161 LEU B N   1 
ATOM   2920 C CA  . LEU B 1 127 ? -12.196 62.539 106.904 1.00 51.95 ? 161 LEU B CA  1 
ATOM   2921 C C   . LEU B 1 127 ? -11.860 62.245 108.365 1.00 52.00 ? 161 LEU B C   1 
ATOM   2922 O O   . LEU B 1 127 ? -11.993 61.108 108.819 1.00 52.05 ? 161 LEU B O   1 
ATOM   2923 C CB  . LEU B 1 127 ? -10.904 62.648 106.076 1.00 51.97 ? 161 LEU B CB  1 
ATOM   2924 C CG  . LEU B 1 127 ? -10.943 62.583 104.544 1.00 51.30 ? 161 LEU B CG  1 
ATOM   2925 C CD1 . LEU B 1 127 ? -9.538  62.699 104.006 1.00 50.47 ? 161 LEU B CD1 1 
ATOM   2926 C CD2 . LEU B 1 127 ? -11.585 61.301 104.036 1.00 51.18 ? 161 LEU B CD2 1 
ATOM   2927 N N   . HIS B 1 128 ? -11.424 63.268 109.095 1.00 52.05 ? 162 HIS B N   1 
ATOM   2928 C CA  . HIS B 1 128 ? -11.089 63.106 110.505 1.00 52.00 ? 162 HIS B CA  1 
ATOM   2929 C C   . HIS B 1 128 ? -12.273 62.689 111.345 1.00 52.22 ? 162 HIS B C   1 
ATOM   2930 O O   . HIS B 1 128 ? -12.118 61.865 112.238 1.00 52.67 ? 162 HIS B O   1 
ATOM   2931 C CB  . HIS B 1 128 ? -10.438 64.360 111.067 1.00 51.75 ? 162 HIS B CB  1 
ATOM   2932 C CG  . HIS B 1 128 ? -9.125  64.668 110.433 1.00 51.78 ? 162 HIS B CG  1 
ATOM   2933 N ND1 . HIS B 1 128 ? -8.568  65.926 110.444 1.00 52.14 ? 162 HIS B ND1 1 
ATOM   2934 C CD2 . HIS B 1 128 ? -8.273  63.883 109.731 1.00 51.72 ? 162 HIS B CD2 1 
ATOM   2935 C CE1 . HIS B 1 128 ? -7.416  65.896 109.796 1.00 52.29 ? 162 HIS B CE1 1 
ATOM   2936 N NE2 . HIS B 1 128 ? -7.213  64.667 109.356 1.00 51.51 ? 162 HIS B NE2 1 
ATOM   2937 N N   . THR B 1 129 ? -13.454 63.230 111.054 1.00 52.26 ? 163 THR B N   1 
ATOM   2938 C CA  . THR B 1 129 ? -14.654 62.820 111.785 1.00 52.41 ? 163 THR B CA  1 
ATOM   2939 C C   . THR B 1 129 ? -15.128 61.417 111.386 1.00 52.35 ? 163 THR B C   1 
ATOM   2940 O O   . THR B 1 129 ? -15.911 60.797 112.107 1.00 52.64 ? 163 THR B O   1 
ATOM   2941 C CB  . THR B 1 129 ? -15.812 63.830 111.665 1.00 52.36 ? 163 THR B CB  1 
ATOM   2942 O OG1 . THR B 1 129 ? -16.277 63.872 110.312 1.00 52.90 ? 163 THR B OG1 1 
ATOM   2943 C CG2 . THR B 1 129 ? -15.368 65.221 112.107 1.00 52.68 ? 163 THR B CG2 1 
ATOM   2944 N N   . LYS B 1 130 ? -14.651 60.907 110.254 1.00 52.10 ? 164 LYS B N   1 
ATOM   2945 C CA  . LYS B 1 130 ? -14.956 59.526 109.886 1.00 51.99 ? 164 LYS B CA  1 
ATOM   2946 C C   . LYS B 1 130 ? -13.866 58.544 110.355 1.00 51.72 ? 164 LYS B C   1 
ATOM   2947 O O   . LYS B 1 130 ? -13.963 57.330 110.124 1.00 51.65 ? 164 LYS B O   1 
ATOM   2948 C CB  . LYS B 1 130 ? -15.256 59.395 108.383 1.00 52.02 ? 164 LYS B CB  1 
ATOM   2949 C CG  . LYS B 1 130 ? -16.740 59.492 108.053 1.00 52.61 ? 164 LYS B CG  1 
ATOM   2950 C CD  . LYS B 1 130 ? -17.114 58.662 106.824 1.00 54.50 ? 164 LYS B CD  1 
ATOM   2951 C CE  . LYS B 1 130 ? -18.628 58.390 106.761 1.00 54.96 ? 164 LYS B CE  1 
ATOM   2952 N NZ  . LYS B 1 130 ? -19.022 57.529 105.596 1.00 54.85 ? 164 LYS B NZ  1 
ATOM   2953 N N   . GLY B 1 131 ? -12.848 59.076 111.030 1.00 51.33 ? 165 GLY B N   1 
ATOM   2954 C CA  . GLY B 1 131 ? -11.735 58.268 111.536 1.00 51.04 ? 165 GLY B CA  1 
ATOM   2955 C C   . GLY B 1 131 ? -10.681 57.969 110.485 1.00 50.80 ? 165 GLY B C   1 
ATOM   2956 O O   . GLY B 1 131 ? -9.911  57.016 110.615 1.00 50.63 ? 165 GLY B O   1 
ATOM   2957 N N   . ILE B 1 132 ? -10.651 58.801 109.450 1.00 50.64 ? 166 ILE B N   1 
ATOM   2958 C CA  . ILE B 1 132 ? -9.753  58.636 108.324 1.00 50.70 ? 166 ILE B CA  1 
ATOM   2959 C C   . ILE B 1 132 ? -8.758  59.793 108.312 1.00 50.98 ? 166 ILE B C   1 
ATOM   2960 O O   . ILE B 1 132 ? -9.161  60.948 108.432 1.00 51.23 ? 166 ILE B O   1 
ATOM   2961 C CB  . ILE B 1 132 ? -10.550 58.617 106.983 1.00 50.55 ? 166 ILE B CB  1 
ATOM   2962 C CG1 . ILE B 1 132 ? -11.530 57.439 106.950 1.00 50.04 ? 166 ILE B CG1 1 
ATOM   2963 C CG2 . ILE B 1 132 ? -9.609  58.553 105.785 1.00 50.31 ? 166 ILE B CG2 1 
ATOM   2964 C CD1 . ILE B 1 132 ? -12.712 57.636 106.034 1.00 48.82 ? 166 ILE B CD1 1 
ATOM   2965 N N   . ALA B 1 133 ? -7.468  59.490 108.181 1.00 51.05 ? 167 ALA B N   1 
ATOM   2966 C CA  . ALA B 1 133 ? -6.472  60.530 107.912 1.00 51.29 ? 167 ALA B CA  1 
ATOM   2967 C C   . ALA B 1 133 ? -5.954  60.409 106.479 1.00 51.58 ? 167 ALA B C   1 
ATOM   2968 O O   . ALA B 1 133 ? -5.880  59.297 105.933 1.00 51.60 ? 167 ALA B O   1 
ATOM   2969 C CB  . ALA B 1 133 ? -5.328  60.458 108.907 1.00 51.18 ? 167 ALA B CB  1 
ATOM   2970 N N   . HIS B 1 134 ? -5.600  61.543 105.869 1.00 51.82 ? 168 HIS B N   1 
ATOM   2971 C CA  . HIS B 1 134 ? -5.081  61.536 104.501 1.00 52.03 ? 168 HIS B CA  1 
ATOM   2972 C C   . HIS B 1 134 ? -3.712  60.860 104.443 1.00 52.24 ? 168 HIS B C   1 
ATOM   2973 O O   . HIS B 1 134 ? -3.469  59.994 103.594 1.00 52.05 ? 168 HIS B O   1 
ATOM   2974 C CB  . HIS B 1 134 ? -5.010  62.942 103.908 1.00 51.99 ? 168 HIS B CB  1 
ATOM   2975 C CG  . HIS B 1 134 ? -4.552  62.964 102.480 1.00 52.35 ? 168 HIS B CG  1 
ATOM   2976 N ND1 . HIS B 1 134 ? -3.227  62.836 102.119 1.00 52.41 ? 168 HIS B ND1 1 
ATOM   2977 C CD2 . HIS B 1 134 ? -5.244  63.076 101.322 1.00 52.50 ? 168 HIS B CD2 1 
ATOM   2978 C CE1 . HIS B 1 134 ? -3.123  62.876 100.803 1.00 52.15 ? 168 HIS B CE1 1 
ATOM   2979 N NE2 . HIS B 1 134 ? -4.332  63.022 100.295 1.00 52.26 ? 168 HIS B NE2 1 
ATOM   2980 N N   . ARG B 1 135 ? -2.833  61.278 105.352 1.00 52.50 ? 169 ARG B N   1 
ATOM   2981 C CA  . ARG B 1 135 ? -1.526  60.648 105.590 1.00 52.84 ? 169 ARG B CA  1 
ATOM   2982 C C   . ARG B 1 135 ? -0.383  61.197 104.751 1.00 53.23 ? 169 ARG B C   1 
ATOM   2983 O O   . ARG B 1 135 ? 0.778   60.966 105.072 1.00 53.20 ? 169 ARG B O   1 
ATOM   2984 C CB  . ARG B 1 135 ? -1.591  59.125 105.460 1.00 52.67 ? 169 ARG B CB  1 
ATOM   2985 C CG  . ARG B 1 135 ? -2.541  58.460 106.437 1.00 53.08 ? 169 ARG B CG  1 
ATOM   2986 C CD  . ARG B 1 135 ? -2.062  58.614 107.857 1.00 53.76 ? 169 ARG B CD  1 
ATOM   2987 N NE  . ARG B 1 135 ? -0.862  57.821 108.078 1.00 54.82 ? 169 ARG B NE  1 
ATOM   2988 C CZ  . ARG B 1 135 ? -0.871  56.560 108.491 1.00 55.70 ? 169 ARG B CZ  1 
ATOM   2989 N NH1 . ARG B 1 135 ? 0.273   55.909 108.659 1.00 55.69 ? 169 ARG B NH1 1 
ATOM   2990 N NH2 . ARG B 1 135 ? -2.027  55.948 108.741 1.00 57.09 ? 169 ARG B NH2 1 
ATOM   2991 N N   . ASP B 1 136 ? -0.700  61.926 103.685 1.00 53.85 ? 170 ASP B N   1 
ATOM   2992 C CA  . ASP B 1 136 ? 0.342   62.482 102.823 1.00 54.51 ? 170 ASP B CA  1 
ATOM   2993 C C   . ASP B 1 136 ? -0.154  63.693 102.050 1.00 55.00 ? 170 ASP B C   1 
ATOM   2994 O O   . ASP B 1 136 ? -0.249  63.668 100.829 1.00 55.09 ? 170 ASP B O   1 
ATOM   2995 C CB  . ASP B 1 136 ? 0.893   61.417 101.864 1.00 54.32 ? 170 ASP B CB  1 
ATOM   2996 C CG  . ASP B 1 136 ? 2.201   61.835 101.213 1.00 54.43 ? 170 ASP B CG  1 
ATOM   2997 O OD1 . ASP B 1 136 ? 2.465   61.408 100.074 1.00 54.50 ? 170 ASP B OD1 1 
ATOM   2998 O OD2 . ASP B 1 136 ? 2.970   62.596 101.831 1.00 55.41 ? 170 ASP B OD2 1 
ATOM   2999 N N   . LEU B 1 137 ? -0.475  64.758 102.768 1.00 55.81 ? 171 LEU B N   1 
ATOM   3000 C CA  . LEU B 1 137 ? -0.988  65.957 102.125 1.00 56.52 ? 171 LEU B CA  1 
ATOM   3001 C C   . LEU B 1 137 ? 0.160   66.828 101.619 1.00 56.83 ? 171 LEU B C   1 
ATOM   3002 O O   . LEU B 1 137 ? 1.013   67.279 102.398 1.00 57.00 ? 171 LEU B O   1 
ATOM   3003 C CB  . LEU B 1 137 ? -1.901  66.738 103.081 1.00 56.72 ? 171 LEU B CB  1 
ATOM   3004 C CG  . LEU B 1 137 ? -2.690  67.916 102.508 1.00 56.80 ? 171 LEU B CG  1 
ATOM   3005 C CD1 . LEU B 1 137 ? -3.601  67.488 101.352 1.00 57.26 ? 171 LEU B CD1 1 
ATOM   3006 C CD2 . LEU B 1 137 ? -3.488  68.559 103.615 1.00 56.65 ? 171 LEU B CD2 1 
ATOM   3007 N N   . LYS B 1 138 ? 0.172   67.046 100.306 1.00 57.02 ? 172 LYS B N   1 
ATOM   3008 C CA  . LYS B 1 138 ? 1.167   67.898 99.657  1.00 57.12 ? 172 LYS B CA  1 
ATOM   3009 C C   . LYS B 1 138 ? 0.620   68.494 98.347  1.00 57.40 ? 172 LYS B C   1 
ATOM   3010 O O   . LYS B 1 138 ? -0.417  68.034 97.847  1.00 57.42 ? 172 LYS B O   1 
ATOM   3011 C CB  . LYS B 1 138 ? 2.489   67.143 99.446  1.00 56.97 ? 172 LYS B CB  1 
ATOM   3012 C CG  . LYS B 1 138 ? 2.364   65.794 98.792  1.00 56.67 ? 172 LYS B CG  1 
ATOM   3013 C CD  . LYS B 1 138 ? 3.713   65.148 98.739  1.00 57.38 ? 172 LYS B CD  1 
ATOM   3014 C CE  . LYS B 1 138 ? 3.644   63.791 98.081  1.00 58.46 ? 172 LYS B CE  1 
ATOM   3015 N NZ  . LYS B 1 138 ? 4.977   63.120 98.144  1.00 59.64 ? 172 LYS B NZ  1 
ATOM   3016 N N   . PRO B 1 139 ? 1.298   69.533 97.802  1.00 57.59 ? 173 PRO B N   1 
ATOM   3017 C CA  . PRO B 1 139 ? 0.837   70.193 96.583  1.00 57.70 ? 173 PRO B CA  1 
ATOM   3018 C C   . PRO B 1 139 ? 0.444   69.241 95.449  1.00 57.86 ? 173 PRO B C   1 
ATOM   3019 O O   . PRO B 1 139 ? -0.548  69.499 94.757  1.00 58.01 ? 173 PRO B O   1 
ATOM   3020 C CB  . PRO B 1 139 ? 2.042   71.047 96.182  1.00 57.69 ? 173 PRO B CB  1 
ATOM   3021 C CG  . PRO B 1 139 ? 2.670   71.399 97.471  1.00 57.53 ? 173 PRO B CG  1 
ATOM   3022 C CD  . PRO B 1 139 ? 2.532   70.167 98.317  1.00 57.57 ? 173 PRO B CD  1 
ATOM   3023 N N   . GLU B 1 140 ? 1.197   68.156 95.267  1.00 57.93 ? 174 GLU B N   1 
ATOM   3024 C CA  . GLU B 1 140 ? 0.905   67.192 94.197  1.00 58.24 ? 174 GLU B CA  1 
ATOM   3025 C C   . GLU B 1 140 ? -0.345  66.360 94.464  1.00 58.37 ? 174 GLU B C   1 
ATOM   3026 O O   . GLU B 1 140 ? -0.830  65.660 93.573  1.00 58.37 ? 174 GLU B O   1 
ATOM   3027 C CB  . GLU B 1 140 ? 2.111   66.297 93.858  1.00 58.24 ? 174 GLU B CB  1 
ATOM   3028 C CG  . GLU B 1 140 ? 3.040   65.977 95.010  1.00 59.00 ? 174 GLU B CG  1 
ATOM   3029 C CD  . GLU B 1 140 ? 4.084   67.052 95.231  1.00 59.94 ? 174 GLU B CD  1 
ATOM   3030 O OE1 . GLU B 1 140 ? 4.902   67.291 94.322  1.00 60.17 ? 174 GLU B OE1 1 
ATOM   3031 O OE2 . GLU B 1 140 ? 4.087   67.661 96.321  1.00 61.10 ? 174 GLU B OE2 1 
ATOM   3032 N N   . ASN B 1 141 ? -0.867  66.449 95.686  1.00 58.62 ? 175 ASN B N   1 
ATOM   3033 C CA  . ASN B 1 141 ? -2.082  65.738 96.057  1.00 58.79 ? 175 ASN B CA  1 
ATOM   3034 C C   . ASN B 1 141 ? -3.274  66.664 96.213  1.00 58.91 ? 175 ASN B C   1 
ATOM   3035 O O   . ASN B 1 141 ? -4.354  66.236 96.611  1.00 58.82 ? 175 ASN B O   1 
ATOM   3036 C CB  . ASN B 1 141 ? -1.854  64.908 97.317  1.00 58.84 ? 175 ASN B CB  1 
ATOM   3037 C CG  . ASN B 1 141 ? -1.072  63.639 97.042  1.00 59.12 ? 175 ASN B CG  1 
ATOM   3038 O OD1 . ASN B 1 141 ? -1.445  62.834 96.187  1.00 60.28 ? 175 ASN B OD1 1 
ATOM   3039 N ND2 . ASN B 1 141 ? 0.021   63.454 97.765  1.00 59.34 ? 175 ASN B ND2 1 
ATOM   3040 N N   . ILE B 1 142 ? -3.071  67.935 95.886  1.00 59.36 ? 176 ILE B N   1 
ATOM   3041 C CA  . ILE B 1 142 ? -4.166  68.895 95.819  1.00 59.98 ? 176 ILE B CA  1 
ATOM   3042 C C   . ILE B 1 142 ? -4.393  69.326 94.373  1.00 60.45 ? 176 ILE B C   1 
ATOM   3043 O O   . ILE B 1 142 ? -3.515  69.903 93.730  1.00 60.32 ? 176 ILE B O   1 
ATOM   3044 C CB  . ILE B 1 142 ? -3.935  70.104 96.736  1.00 59.86 ? 176 ILE B CB  1 
ATOM   3045 C CG1 . ILE B 1 142 ? -3.810  69.639 98.188  1.00 59.70 ? 176 ILE B CG1 1 
ATOM   3046 C CG2 . ILE B 1 142 ? -5.091  71.068 96.619  1.00 60.30 ? 176 ILE B CG2 1 
ATOM   3047 C CD1 . ILE B 1 142 ? -3.181  70.646 99.106  1.00 59.61 ? 176 ILE B CD1 1 
ATOM   3048 N N   . LEU B 1 143 ? -5.590  69.026 93.883  1.00 61.30 ? 177 LEU B N   1 
ATOM   3049 C CA  . LEU B 1 143 ? -5.941  69.176 92.480  1.00 62.21 ? 177 LEU B CA  1 
ATOM   3050 C C   . LEU B 1 143 ? -6.980  70.261 92.281  1.00 63.20 ? 177 LEU B C   1 
ATOM   3051 O O   . LEU B 1 143 ? -8.050  70.208 92.882  1.00 63.41 ? 177 LEU B O   1 
ATOM   3052 C CB  . LEU B 1 143 ? -6.526  67.862 91.966  1.00 61.99 ? 177 LEU B CB  1 
ATOM   3053 C CG  . LEU B 1 143 ? -5.736  66.815 91.183  1.00 61.15 ? 177 LEU B CG  1 
ATOM   3054 C CD1 . LEU B 1 143 ? -4.252  66.795 91.503  1.00 60.24 ? 177 LEU B CD1 1 
ATOM   3055 C CD2 . LEU B 1 143 ? -6.380  65.466 91.441  1.00 60.46 ? 177 LEU B CD2 1 
ATOM   3056 N N   . CYS B 1 144 ? -6.666  71.229 91.421  1.00 64.42 ? 178 CYS B N   1 
ATOM   3057 C CA  . CYS B 1 144 ? -7.607  72.285 91.031  1.00 65.59 ? 178 CYS B CA  1 
ATOM   3058 C C   . CYS B 1 144 ? -8.599  71.728 90.017  1.00 66.30 ? 178 CYS B C   1 
ATOM   3059 O O   . CYS B 1 144 ? -8.277  70.785 89.289  1.00 66.51 ? 178 CYS B O   1 
ATOM   3060 C CB  . CYS B 1 144 ? -6.850  73.457 90.413  1.00 65.59 ? 178 CYS B CB  1 
ATOM   3061 S SG  . CYS B 1 144 ? -5.215  73.750 91.141  1.00 66.52 ? 178 CYS B SG  1 
ATOM   3062 N N   . GLU B 1 145 ? -9.805  72.286 89.967  1.00 67.16 ? 179 GLU B N   1 
ATOM   3063 C CA  . GLU B 1 145 ? -10.771 71.820 88.968  1.00 68.12 ? 179 GLU B CA  1 
ATOM   3064 C C   . GLU B 1 145 ? -10.757 72.694 87.715  1.00 68.35 ? 179 GLU B C   1 
ATOM   3065 O O   . GLU B 1 145 ? -11.202 72.264 86.646  1.00 68.28 ? 179 GLU B O   1 
ATOM   3066 C CB  . GLU B 1 145 ? -12.186 71.626 89.555  1.00 68.15 ? 179 GLU B CB  1 
ATOM   3067 C CG  . GLU B 1 145 ? -12.940 72.891 89.979  1.00 68.68 ? 179 GLU B CG  1 
ATOM   3068 C CD  . GLU B 1 145 ? -14.230 72.586 90.755  1.00 68.79 ? 179 GLU B CD  1 
ATOM   3069 O OE1 . GLU B 1 145 ? -15.291 73.140 90.378  1.00 69.28 ? 179 GLU B OE1 1 
ATOM   3070 O OE2 . GLU B 1 145 ? -14.183 71.801 91.739  1.00 69.26 ? 179 GLU B OE2 1 
ATOM   3071 N N   . SER B 1 146 ? -10.208 73.902 87.857  1.00 68.81 ? 180 SER B N   1 
ATOM   3072 C CA  . SER B 1 146 ? -10.099 74.859 86.753  1.00 69.21 ? 180 SER B CA  1 
ATOM   3073 C C   . SER B 1 146 ? -8.631  75.216 86.444  1.00 69.48 ? 180 SER B C   1 
ATOM   3074 O O   . SER B 1 146 ? -7.842  75.445 87.375  1.00 69.36 ? 180 SER B O   1 
ATOM   3075 C CB  . SER B 1 146 ? -10.916 76.119 87.066  1.00 69.25 ? 180 SER B CB  1 
ATOM   3076 O OG  . SER B 1 146 ? -11.042 76.959 85.931  1.00 69.19 ? 180 SER B OG  1 
ATOM   3077 N N   . PRO B 1 147 ? -8.262  75.246 85.137  1.00 69.77 ? 181 PRO B N   1 
ATOM   3078 C CA  . PRO B 1 147 ? -6.895  75.551 84.664  1.00 70.04 ? 181 PRO B CA  1 
ATOM   3079 C C   . PRO B 1 147 ? -6.348  76.967 84.948  1.00 70.42 ? 181 PRO B C   1 
ATOM   3080 O O   . PRO B 1 147 ? -5.153  77.103 85.224  1.00 70.54 ? 181 PRO B O   1 
ATOM   3081 C CB  . PRO B 1 147 ? -6.969  75.289 83.152  1.00 69.91 ? 181 PRO B CB  1 
ATOM   3082 C CG  . PRO B 1 147 ? -8.404  75.383 82.807  1.00 69.78 ? 181 PRO B CG  1 
ATOM   3083 C CD  . PRO B 1 147 ? -9.166  74.929 84.012  1.00 69.76 ? 181 PRO B CD  1 
ATOM   3084 N N   . GLU B 1 148 ? -7.189  78.000 84.876  1.00 70.77 ? 182 GLU B N   1 
ATOM   3085 C CA  . GLU B 1 148 ? -6.738  79.382 85.139  1.00 71.16 ? 182 GLU B CA  1 
ATOM   3086 C C   . GLU B 1 148 ? -6.879  79.803 86.611  1.00 71.18 ? 182 GLU B C   1 
ATOM   3087 O O   . GLU B 1 148 ? -5.875  80.095 87.273  1.00 71.30 ? 182 GLU B O   1 
ATOM   3088 C CB  . GLU B 1 148 ? -7.416  80.397 84.205  1.00 71.33 ? 182 GLU B CB  1 
ATOM   3089 C CG  . GLU B 1 148 ? -8.923  80.219 84.043  1.00 72.33 ? 182 GLU B CG  1 
ATOM   3090 C CD  . GLU B 1 148 ? -9.299  79.418 82.808  1.00 73.46 ? 182 GLU B CD  1 
ATOM   3091 O OE1 . GLU B 1 148 ? -9.006  79.881 81.680  1.00 73.92 ? 182 GLU B OE1 1 
ATOM   3092 O OE2 . GLU B 1 148 ? -9.906  78.334 82.966  1.00 73.79 ? 182 GLU B OE2 1 
ATOM   3093 N N   . LYS B 1 149 ? -8.116  79.839 87.111  1.00 71.06 ? 183 LYS B N   1 
ATOM   3094 C CA  . LYS B 1 149 ? -8.378  80.052 88.538  1.00 70.81 ? 183 LYS B CA  1 
ATOM   3095 C C   . LYS B 1 149 ? -8.183  78.741 89.315  1.00 70.45 ? 183 LYS B C   1 
ATOM   3096 O O   . LYS B 1 149 ? -8.702  77.691 88.929  1.00 70.47 ? 183 LYS B O   1 
ATOM   3097 C CB  . LYS B 1 149 ? -9.781  80.669 88.754  1.00 70.90 ? 183 LYS B CB  1 
ATOM   3098 C CG  . LYS B 1 149 ? -10.412 80.521 90.168  1.00 71.24 ? 183 LYS B CG  1 
ATOM   3099 C CD  . LYS B 1 149 ? -9.654  81.235 91.309  1.00 71.22 ? 183 LYS B CD  1 
ATOM   3100 C CE  . LYS B 1 149 ? -10.251 82.586 91.656  0.50 71.21 ? 183 LYS B CE  1 
ATOM   3101 N NZ  . LYS B 1 149 ? -10.084 83.574 90.556  1.00 71.86 ? 183 LYS B NZ  1 
ATOM   3102 N N   . VAL B 1 150 ? -7.413  78.815 90.398  1.00 70.00 ? 184 VAL B N   1 
ATOM   3103 C CA  . VAL B 1 150 ? -7.190  77.675 91.302  1.00 69.51 ? 184 VAL B CA  1 
ATOM   3104 C C   . VAL B 1 150 ? -8.514  77.071 91.832  1.00 69.00 ? 184 VAL B C   1 
ATOM   3105 O O   . VAL B 1 150 ? -8.661  75.840 91.868  1.00 69.04 ? 184 VAL B O   1 
ATOM   3106 C CB  . VAL B 1 150 ? -6.215  78.051 92.454  1.00 69.58 ? 184 VAL B CB  1 
ATOM   3107 C CG1 . VAL B 1 150 ? -6.088  76.923 93.457  1.00 69.61 ? 184 VAL B CG1 1 
ATOM   3108 C CG2 . VAL B 1 150 ? -4.842  78.414 91.886  1.00 69.56 ? 184 VAL B CG2 1 
ATOM   3109 N N   . SER B 1 151 ? -9.453  77.940 92.234  1.00 68.09 ? 185 SER B N   1 
ATOM   3110 C CA  . SER B 1 151 ? -10.875 77.587 92.438  1.00 67.11 ? 185 SER B CA  1 
ATOM   3111 C C   . SER B 1 151 ? -11.082 76.362 93.335  1.00 66.14 ? 185 SER B C   1 
ATOM   3112 O O   . SER B 1 151 ? -10.112 75.861 93.898  1.00 66.32 ? 185 SER B O   1 
ATOM   3113 C CB  . SER B 1 151 ? -11.568 77.395 91.078  1.00 67.30 ? 185 SER B CB  1 
ATOM   3114 O OG  . SER B 1 151 ? -11.105 76.230 90.410  1.00 67.90 ? 185 SER B OG  1 
ATOM   3115 N N   . PRO B 1 152 ? -12.342 75.889 93.496  1.00 65.09 ? 186 PRO B N   1 
ATOM   3116 C CA  . PRO B 1 152 ? -12.620 74.660 94.275  1.00 64.16 ? 186 PRO B CA  1 
ATOM   3117 C C   . PRO B 1 152 ? -11.680 73.464 94.004  1.00 62.96 ? 186 PRO B C   1 
ATOM   3118 O O   . PRO B 1 152 ? -11.808 72.784 92.984  1.00 62.91 ? 186 PRO B O   1 
ATOM   3119 C CB  . PRO B 1 152 ? -14.077 74.313 93.903  1.00 64.23 ? 186 PRO B CB  1 
ATOM   3120 C CG  . PRO B 1 152 ? -14.495 75.323 92.864  1.00 64.64 ? 186 PRO B CG  1 
ATOM   3121 C CD  . PRO B 1 152 ? -13.593 76.500 93.017  1.00 65.04 ? 186 PRO B CD  1 
ATOM   3122 N N   . VAL B 1 153 ? -10.749 73.220 94.925  1.00 61.37 ? 187 VAL B N   1 
ATOM   3123 C CA  . VAL B 1 153 ? -9.811  72.110 94.783  1.00 59.86 ? 187 VAL B CA  1 
ATOM   3124 C C   . VAL B 1 153 ? -10.331 70.828 95.416  1.00 58.86 ? 187 VAL B C   1 
ATOM   3125 O O   . VAL B 1 153 ? -11.339 70.826 96.122  1.00 58.85 ? 187 VAL B O   1 
ATOM   3126 C CB  . VAL B 1 153 ? -8.397  72.426 95.343  1.00 59.81 ? 187 VAL B CB  1 
ATOM   3127 C CG1 . VAL B 1 153 ? -7.730  73.523 94.528  1.00 59.85 ? 187 VAL B CG1 1 
ATOM   3128 C CG2 . VAL B 1 153 ? -8.447  72.785 96.819  1.00 59.78 ? 187 VAL B CG2 1 
ATOM   3129 N N   . LYS B 1 154 ? -9.630  69.738 95.136  1.00 57.51 ? 188 LYS B N   1 
ATOM   3130 C CA  . LYS B 1 154 ? -9.951  68.436 95.679  1.00 56.14 ? 188 LYS B CA  1 
ATOM   3131 C C   . LYS B 1 154 ? -8.644  67.774 96.083  1.00 55.50 ? 188 LYS B C   1 
ATOM   3132 O O   . LYS B 1 154 ? -7.622  67.956 95.415  1.00 55.45 ? 188 LYS B O   1 
ATOM   3133 C CB  . LYS B 1 154 ? -10.676 67.579 94.638  1.00 56.00 ? 188 LYS B CB  1 
ATOM   3134 C CG  . LYS B 1 154 ? -11.967 68.176 94.116  1.00 55.13 ? 188 LYS B CG  1 
ATOM   3135 C CD  . LYS B 1 154 ? -12.863 67.115 93.520  1.00 54.62 ? 188 LYS B CD  1 
ATOM   3136 C CE  . LYS B 1 154 ? -14.095 67.741 92.888  1.00 54.64 ? 188 LYS B CE  1 
ATOM   3137 N NZ  . LYS B 1 154 ? -15.218 66.770 92.797  1.00 54.80 ? 188 LYS B NZ  1 
ATOM   3138 N N   . ILE B 1 155 ? -8.670  67.027 97.184  1.00 54.48 ? 189 ILE B N   1 
ATOM   3139 C CA  . ILE B 1 155 ? -7.516  66.226 97.573  1.00 53.51 ? 189 ILE B CA  1 
ATOM   3140 C C   . ILE B 1 155 ? -7.615  64.831 96.957  1.00 52.93 ? 189 ILE B C   1 
ATOM   3141 O O   . ILE B 1 155 ? -8.713  64.340 96.672  1.00 52.73 ? 189 ILE B O   1 
ATOM   3142 C CB  . ILE B 1 155 ? -7.291  66.163 99.121  1.00 53.69 ? 189 ILE B CB  1 
ATOM   3143 C CG1 . ILE B 1 155 ? -8.510  65.588 99.848  1.00 53.50 ? 189 ILE B CG1 1 
ATOM   3144 C CG2 . ILE B 1 155 ? -6.901  67.541 99.678  1.00 53.47 ? 189 ILE B CG2 1 
ATOM   3145 C CD1 . ILE B 1 155 ? -8.249  65.296 101.295 1.00 53.26 ? 189 ILE B CD1 1 
ATOM   3146 N N   . CYS B 1 156 ? -6.459  64.208 96.746  1.00 52.31 ? 190 CYS B N   1 
ATOM   3147 C CA  . CYS B 1 156 ? -6.374  62.930 96.043  1.00 51.78 ? 190 CYS B CA  1 
ATOM   3148 C C   . CYS B 1 156 ? -5.166  62.099 96.475  1.00 51.33 ? 190 CYS B C   1 
ATOM   3149 O O   . CYS B 1 156 ? -4.326  62.566 97.239  1.00 51.18 ? 190 CYS B O   1 
ATOM   3150 C CB  . CYS B 1 156 ? -6.289  63.189 94.536  1.00 51.93 ? 190 CYS B CB  1 
ATOM   3151 S SG  . CYS B 1 156 ? -4.823  64.114 94.041  1.00 51.33 ? 190 CYS B SG  1 
ATOM   3152 N N   . ASP B 1 157 ? -5.082  60.868 95.978  1.00 50.91 ? 191 ASP B N   1 
ATOM   3153 C CA  . ASP B 1 157 ? -3.870  60.082 96.134  1.00 50.58 ? 191 ASP B CA  1 
ATOM   3154 C C   . ASP B 1 157 ? -3.188  59.876 94.796  1.00 50.81 ? 191 ASP B C   1 
ATOM   3155 O O   . ASP B 1 157 ? -3.453  58.892 94.090  1.00 50.77 ? 191 ASP B O   1 
ATOM   3156 C CB  . ASP B 1 157 ? -4.141  58.729 96.775  1.00 50.44 ? 191 ASP B CB  1 
ATOM   3157 C CG  . ASP B 1 157 ? -2.868  57.908 96.951  1.00 49.97 ? 191 ASP B CG  1 
ATOM   3158 O OD1 . ASP B 1 157 ? -1.765  58.493 96.899  1.00 49.36 ? 191 ASP B OD1 1 
ATOM   3159 O OD2 . ASP B 1 157 ? -2.960  56.679 97.145  1.00 49.27 ? 191 ASP B OD2 1 
ATOM   3160 N N   . PHE B 1 158 ? -2.300  60.806 94.459  1.00 50.87 ? 192 PHE B N   1 
ATOM   3161 C CA  . PHE B 1 158 ? -1.527  60.712 93.232  1.00 50.97 ? 192 PHE B CA  1 
ATOM   3162 C C   . PHE B 1 158 ? -0.060  60.382 93.507  1.00 51.13 ? 192 PHE B C   1 
ATOM   3163 O O   . PHE B 1 158 ? 0.849   60.926 92.870  1.00 51.33 ? 192 PHE B O   1 
ATOM   3164 C CB  . PHE B 1 158 ? -1.710  61.973 92.379  1.00 50.95 ? 192 PHE B CB  1 
ATOM   3165 C CG  . PHE B 1 158 ? -2.970  61.960 91.545  1.00 50.93 ? 192 PHE B CG  1 
ATOM   3166 C CD1 . PHE B 1 158 ? -3.135  62.860 90.499  1.00 51.33 ? 192 PHE B CD1 1 
ATOM   3167 C CD2 . PHE B 1 158 ? -3.983  61.026 91.788  1.00 50.62 ? 192 PHE B CD2 1 
ATOM   3168 C CE1 . PHE B 1 158 ? -4.297  62.845 89.722  1.00 51.21 ? 192 PHE B CE1 1 
ATOM   3169 C CE2 . PHE B 1 158 ? -5.143  61.002 91.027  1.00 50.71 ? 192 PHE B CE2 1 
ATOM   3170 C CZ  . PHE B 1 158 ? -5.302  61.913 89.989  1.00 51.10 ? 192 PHE B CZ  1 
ATOM   3171 N N   . ASP B 1 159 ? 0.151   59.480 94.464  1.00 51.10 ? 193 ASP B N   1 
ATOM   3172 C CA  . ASP B 1 159 ? 1.472   58.963 94.779  1.00 51.17 ? 193 ASP B CA  1 
ATOM   3173 C C   . ASP B 1 159 ? 1.763   57.793 93.869  1.00 51.04 ? 193 ASP B C   1 
ATOM   3174 O O   . ASP B 1 159 ? 0.962   56.850 93.795  1.00 51.08 ? 193 ASP B O   1 
ATOM   3175 C CB  . ASP B 1 159 ? 1.537   58.507 96.231  1.00 51.33 ? 193 ASP B CB  1 
ATOM   3176 C CG  . ASP B 1 159 ? 1.839   59.637 97.181  1.00 52.42 ? 193 ASP B CG  1 
ATOM   3177 O OD1 . ASP B 1 159 ? 2.611   60.552 96.814  1.00 54.44 ? 193 ASP B OD1 1 
ATOM   3178 O OD2 . ASP B 1 159 ? 1.310   59.607 98.307  1.00 52.96 ? 193 ASP B OD2 1 
ATOM   3179 N N   . LEU B 1 160 ? 2.908   57.848 93.188  1.00 50.83 ? 194 LEU B N   1 
ATOM   3180 C CA  . LEU B 1 160 ? 3.201   56.888 92.122  1.00 50.56 ? 194 LEU B CA  1 
ATOM   3181 C C   . LEU B 1 160 ? 4.544   56.175 92.268  1.00 50.74 ? 194 LEU B C   1 
ATOM   3182 O O   . LEU B 1 160 ? 4.838   55.252 91.507  1.00 50.50 ? 194 LEU B O   1 
ATOM   3183 C CB  . LEU B 1 160 ? 3.092   57.569 90.753  1.00 50.27 ? 194 LEU B CB  1 
ATOM   3184 C CG  . LEU B 1 160 ? 1.893   58.495 90.530  1.00 49.54 ? 194 LEU B CG  1 
ATOM   3185 C CD1 . LEU B 1 160 ? 2.166   59.430 89.391  1.00 49.49 ? 194 LEU B CD1 1 
ATOM   3186 C CD2 . LEU B 1 160 ? 0.614   57.712 90.291  1.00 49.30 ? 194 LEU B CD2 1 
ATOM   3187 N N   . GLY B 1 161 ? 5.348   56.592 93.245  1.00 51.04 ? 195 GLY B N   1 
ATOM   3188 C CA  . GLY B 1 161 ? 6.658   55.983 93.469  1.00 51.94 ? 195 GLY B CA  1 
ATOM   3189 C C   . GLY B 1 161 ? 7.829   56.838 93.015  1.00 52.54 ? 195 GLY B C   1 
ATOM   3190 O O   . GLY B 1 161 ? 8.111   57.874 93.616  1.00 53.24 ? 195 GLY B O   1 
ATOM   3191 N N   . SER B 1 162 ? 8.519   56.398 91.962  1.00 52.91 ? 196 SER B N   1 
ATOM   3192 C CA  . SER B 1 162 ? 9.672   57.120 91.379  1.00 53.25 ? 196 SER B CA  1 
ATOM   3193 C C   . SER B 1 162 ? 10.632  57.693 92.436  1.00 53.36 ? 196 SER B C   1 
ATOM   3194 O O   . SER B 1 162 ? 11.030  57.000 93.375  1.00 53.32 ? 196 SER B O   1 
ATOM   3195 C CB  . SER B 1 162 ? 9.204   58.229 90.409  1.00 53.32 ? 196 SER B CB  1 
ATOM   3196 O OG  . SER B 1 162 ? 10.184  58.532 89.421  1.00 52.66 ? 196 SER B OG  1 
ATOM   3197 N N   . TYR B 1 187 ? 18.397  50.576 92.444  1.00 65.50 ? 221 TYR B N   1 
ATOM   3198 C CA  . TYR B 1 187 ? 17.568  51.110 93.523  1.00 65.39 ? 221 TYR B CA  1 
ATOM   3199 C C   . TYR B 1 187 ? 17.127  49.991 94.483  1.00 64.78 ? 221 TYR B C   1 
ATOM   3200 O O   . TYR B 1 187 ? 17.746  48.922 94.534  1.00 64.75 ? 221 TYR B O   1 
ATOM   3201 C CB  . TYR B 1 187 ? 16.340  51.827 92.943  1.00 65.96 ? 221 TYR B CB  1 
ATOM   3202 C CG  . TYR B 1 187 ? 16.571  53.218 92.359  1.00 66.72 ? 221 TYR B CG  1 
ATOM   3203 C CD1 . TYR B 1 187 ? 17.493  53.436 91.317  1.00 67.07 ? 221 TYR B CD1 1 
ATOM   3204 C CD2 . TYR B 1 187 ? 15.823  54.314 92.821  1.00 67.43 ? 221 TYR B CD2 1 
ATOM   3205 C CE1 . TYR B 1 187 ? 17.681  54.719 90.771  1.00 67.48 ? 221 TYR B CE1 1 
ATOM   3206 C CE2 . TYR B 1 187 ? 15.996  55.597 92.285  1.00 67.67 ? 221 TYR B CE2 1 
ATOM   3207 C CZ  . TYR B 1 187 ? 16.924  55.795 91.261  1.00 67.66 ? 221 TYR B CZ  1 
ATOM   3208 O OH  . TYR B 1 187 ? 17.090  57.066 90.742  1.00 67.33 ? 221 TYR B OH  1 
ATOM   3209 N N   . MET B 1 188 ? 16.051  50.249 95.229  1.00 63.89 ? 222 MET B N   1 
ATOM   3210 C CA  . MET B 1 188 ? 15.491  49.289 96.192  1.00 63.07 ? 222 MET B CA  1 
ATOM   3211 C C   . MET B 1 188 ? 14.285  48.495 95.630  1.00 61.80 ? 222 MET B C   1 
ATOM   3212 O O   . MET B 1 188 ? 14.484  47.464 94.977  1.00 61.85 ? 222 MET B O   1 
ATOM   3213 C CB  . MET B 1 188 ? 15.205  49.955 97.564  1.00 63.53 ? 222 MET B CB  1 
ATOM   3214 C CG  . MET B 1 188 ? 14.704  51.433 97.558  1.00 65.17 ? 222 MET B CG  1 
ATOM   3215 S SD  . MET B 1 188 ? 15.731  52.747 96.782  1.00 69.01 ? 222 MET B SD  1 
ATOM   3216 C CE  . MET B 1 188 ? 17.384  52.480 97.462  1.00 68.70 ? 222 MET B CE  1 
ATOM   3217 N N   . ALA B 1 189 ? 13.059  48.960 95.887  1.00 60.01 ? 223 ALA B N   1 
ATOM   3218 C CA  . ALA B 1 189 ? 11.827  48.370 95.327  1.00 58.35 ? 223 ALA B CA  1 
ATOM   3219 C C   . ALA B 1 189 ? 10.620  49.207 95.760  1.00 57.13 ? 223 ALA B C   1 
ATOM   3220 O O   . ALA B 1 189 ? 10.496  49.537 96.940  1.00 57.31 ? 223 ALA B O   1 
ATOM   3221 C CB  . ALA B 1 189 ? 11.650  46.902 95.751  1.00 58.21 ? 223 ALA B CB  1 
ATOM   3222 N N   . PRO B 1 190 ? 9.729   49.558 94.813  1.00 55.68 ? 224 PRO B N   1 
ATOM   3223 C CA  . PRO B 1 190 ? 8.636   50.468 95.126  1.00 54.63 ? 224 PRO B CA  1 
ATOM   3224 C C   . PRO B 1 190 ? 7.636   49.897 96.123  1.00 53.69 ? 224 PRO B C   1 
ATOM   3225 O O   . PRO B 1 190 ? 7.186   48.769 95.970  1.00 53.78 ? 224 PRO B O   1 
ATOM   3226 C CB  . PRO B 1 190 ? 7.962   50.680 93.769  1.00 54.62 ? 224 PRO B CB  1 
ATOM   3227 C CG  . PRO B 1 190 ? 8.309   49.488 92.987  1.00 54.95 ? 224 PRO B CG  1 
ATOM   3228 C CD  . PRO B 1 190 ? 9.689   49.137 93.403  1.00 55.63 ? 224 PRO B CD  1 
ATOM   3229 N N   . GLU B 1 191 ? 7.303   50.682 97.139  1.00 52.60 ? 225 GLU B N   1 
ATOM   3230 C CA  . GLU B 1 191 ? 6.238   50.344 98.072  1.00 51.90 ? 225 GLU B CA  1 
ATOM   3231 C C   . GLU B 1 191 ? 5.069   51.275 97.846  1.00 50.66 ? 225 GLU B C   1 
ATOM   3232 O O   . GLU B 1 191 ? 5.273   52.478 97.709  1.00 50.56 ? 225 GLU B O   1 
ATOM   3233 C CB  . GLU B 1 191 ? 6.711   50.537 99.511  1.00 52.06 ? 225 GLU B CB  1 
ATOM   3234 C CG  . GLU B 1 191 ? 7.532   49.400 100.110 1.00 52.92 ? 225 GLU B CG  1 
ATOM   3235 C CD  . GLU B 1 191 ? 7.817   49.630 101.593 1.00 53.08 ? 225 GLU B CD  1 
ATOM   3236 O OE1 . GLU B 1 191 ? 8.634   48.863 102.163 1.00 54.69 ? 225 GLU B OE1 1 
ATOM   3237 O OE2 . GLU B 1 191 ? 7.223   50.577 102.180 1.00 53.37 ? 225 GLU B OE2 1 
ATOM   3238 N N   . VAL B 1 192 ? 3.854   50.734 97.827  1.00 49.50 ? 226 VAL B N   1 
ATOM   3239 C CA  . VAL B 1 192 ? 2.652   51.563 97.738  1.00 48.67 ? 226 VAL B CA  1 
ATOM   3240 C C   . VAL B 1 192 ? 2.522   52.360 99.032  1.00 48.61 ? 226 VAL B C   1 
ATOM   3241 O O   . VAL B 1 192 ? 2.448   51.765 100.101 1.00 48.69 ? 226 VAL B O   1 
ATOM   3242 C CB  . VAL B 1 192 ? 1.380   50.718 97.512  1.00 48.32 ? 226 VAL B CB  1 
ATOM   3243 C CG1 . VAL B 1 192 ? 0.180   51.608 97.293  1.00 47.81 ? 226 VAL B CG1 1 
ATOM   3244 C CG2 . VAL B 1 192 ? 1.550   49.829 96.327  1.00 48.05 ? 226 VAL B CG2 1 
ATOM   3245 N N   . VAL B 1 193 ? 2.520   53.694 98.951  1.00 48.52 ? 227 VAL B N   1 
ATOM   3246 C CA  . VAL B 1 193 ? 2.417   54.514 100.172 1.00 48.46 ? 227 VAL B CA  1 
ATOM   3247 C C   . VAL B 1 193 ? 0.981   54.503 100.703 1.00 48.62 ? 227 VAL B C   1 
ATOM   3248 O O   . VAL B 1 193 ? 0.033   54.325 99.931  1.00 48.50 ? 227 VAL B O   1 
ATOM   3249 C CB  . VAL B 1 193 ? 2.986   55.976 100.037 1.00 48.20 ? 227 VAL B CB  1 
ATOM   3250 C CG1 . VAL B 1 193 ? 4.104   56.051 99.016  1.00 48.00 ? 227 VAL B CG1 1 
ATOM   3251 C CG2 . VAL B 1 193 ? 1.913   56.947 99.687  1.00 48.08 ? 227 VAL B CG2 1 
ATOM   3252 N N   . GLU B 1 194 ? 0.833   54.651 102.019 1.00 48.77 ? 228 GLU B N   1 
ATOM   3253 C CA  . GLU B 1 194 ? -0.479  54.609 102.649 1.00 49.08 ? 228 GLU B CA  1 
ATOM   3254 C C   . GLU B 1 194 ? -1.169  55.966 102.675 1.00 49.08 ? 228 GLU B C   1 
ATOM   3255 O O   . GLU B 1 194 ? -0.691  56.904 103.320 1.00 49.24 ? 228 GLU B O   1 
ATOM   3256 C CB  . GLU B 1 194 ? -0.365  54.078 104.062 1.00 49.38 ? 228 GLU B CB  1 
ATOM   3257 C CG  . GLU B 1 194 ? -0.499  52.590 104.163 1.00 50.57 ? 228 GLU B CG  1 
ATOM   3258 C CD  . GLU B 1 194 ? -0.617  52.153 105.597 1.00 52.09 ? 228 GLU B CD  1 
ATOM   3259 O OE1 . GLU B 1 194 ? 0.379   52.286 106.352 1.00 52.13 ? 228 GLU B OE1 1 
ATOM   3260 O OE2 . GLU B 1 194 ? -1.717  51.690 105.967 1.00 53.47 ? 228 GLU B OE2 1 
ATOM   3261 N N   . VAL B 1 195 ? -2.293  56.056 101.965 1.00 48.85 ? 229 VAL B N   1 
ATOM   3262 C CA  . VAL B 1 195 ? -3.088  57.284 101.864 1.00 48.43 ? 229 VAL B CA  1 
ATOM   3263 C C   . VAL B 1 195 ? -4.552  56.923 102.128 1.00 48.55 ? 229 VAL B C   1 
ATOM   3264 O O   . VAL B 1 195 ? -4.983  55.814 101.780 1.00 48.74 ? 229 VAL B O   1 
ATOM   3265 C CB  . VAL B 1 195 ? -2.932  57.948 100.472 1.00 48.09 ? 229 VAL B CB  1 
ATOM   3266 C CG1 . VAL B 1 195 ? -3.713  59.232 100.399 1.00 48.17 ? 229 VAL B CG1 1 
ATOM   3267 C CG2 . VAL B 1 195 ? -1.476  58.239 100.178 1.00 47.22 ? 229 VAL B CG2 1 
ATOM   3268 N N   . PHE B 1 196 ? -5.306  57.842 102.740 1.00 48.25 ? 230 PHE B N   1 
ATOM   3269 C CA  . PHE B 1 196 ? -6.694  57.579 103.141 1.00 48.09 ? 230 PHE B CA  1 
ATOM   3270 C C   . PHE B 1 196 ? -6.780  56.298 103.988 1.00 48.38 ? 230 PHE B C   1 
ATOM   3271 O O   . PHE B 1 196 ? -7.219  55.243 103.511 1.00 48.37 ? 230 PHE B O   1 
ATOM   3272 C CB  . PHE B 1 196 ? -7.634  57.469 101.926 1.00 47.71 ? 230 PHE B CB  1 
ATOM   3273 C CG  . PHE B 1 196 ? -7.672  58.690 101.050 1.00 47.06 ? 230 PHE B CG  1 
ATOM   3274 C CD1 . PHE B 1 196 ? -7.190  58.637 99.748  1.00 47.57 ? 230 PHE B CD1 1 
ATOM   3275 C CD2 . PHE B 1 196 ? -8.219  59.879 101.505 1.00 46.56 ? 230 PHE B CD2 1 
ATOM   3276 C CE1 . PHE B 1 196 ? -7.228  59.761 98.920  1.00 47.28 ? 230 PHE B CE1 1 
ATOM   3277 C CE2 . PHE B 1 196 ? -8.264  61.005 100.686 1.00 46.15 ? 230 PHE B CE2 1 
ATOM   3278 C CZ  . PHE B 1 196 ? -7.771  60.945 99.393  1.00 47.12 ? 230 PHE B CZ  1 
ATOM   3279 N N   . THR B 1 197 ? -6.340  56.396 105.239 1.00 48.77 ? 231 THR B N   1 
ATOM   3280 C CA  . THR B 1 197 ? -6.321  55.245 106.149 1.00 48.92 ? 231 THR B CA  1 
ATOM   3281 C C   . THR B 1 197 ? -7.352  55.388 107.265 1.00 49.01 ? 231 THR B C   1 
ATOM   3282 O O   . THR B 1 197 ? -7.275  56.326 108.064 1.00 48.85 ? 231 THR B O   1 
ATOM   3283 C CB  . THR B 1 197 ? -4.937  55.053 106.792 1.00 49.00 ? 231 THR B CB  1 
ATOM   3284 O OG1 . THR B 1 197 ? -4.446  56.322 107.250 1.00 48.59 ? 231 THR B OG1 1 
ATOM   3285 C CG2 . THR B 1 197 ? -3.957  54.445 105.793 1.00 48.74 ? 231 THR B CG2 1 
ATOM   3286 N N   . ASP B 1 198 ? -8.307  54.454 107.298 1.00 49.17 ? 232 ASP B N   1 
ATOM   3287 C CA  . ASP B 1 198 ? -9.282  54.339 108.378 1.00 49.48 ? 232 ASP B CA  1 
ATOM   3288 C C   . ASP B 1 198 ? -8.531  54.033 109.670 1.00 49.49 ? 232 ASP B C   1 
ATOM   3289 O O   . ASP B 1 198 ? -7.311  53.802 109.640 1.00 49.72 ? 232 ASP B O   1 
ATOM   3290 C CB  . ASP B 1 198 ? -10.336 53.256 108.076 1.00 49.75 ? 232 ASP B CB  1 
ATOM   3291 C CG  . ASP B 1 198 ? -9.732  51.825 107.940 1.00 51.90 ? 232 ASP B CG  1 
ATOM   3292 O OD1 . ASP B 1 198 ? -8.737  51.641 107.193 1.00 54.35 ? 232 ASP B OD1 1 
ATOM   3293 O OD2 . ASP B 1 198 ? -10.275 50.868 108.557 1.00 52.76 ? 232 ASP B OD2 1 
ATOM   3294 N N   . GLN B 1 199 ? -9.247  54.050 110.796 1.00 49.20 ? 233 GLN B N   1 
ATOM   3295 C CA  . GLN B 1 199 ? -8.654  53.810 112.114 1.00 49.01 ? 233 GLN B CA  1 
ATOM   3296 C C   . GLN B 1 199 ? -7.491  54.763 112.395 1.00 48.69 ? 233 GLN B C   1 
ATOM   3297 O O   . GLN B 1 199 ? -6.549  54.416 113.109 1.00 48.75 ? 233 GLN B O   1 
ATOM   3298 C CB  . GLN B 1 199 ? -8.187  52.358 112.246 1.00 48.92 ? 233 GLN B CB  1 
ATOM   3299 C CG  . GLN B 1 199 ? -9.301  51.336 112.237 1.00 49.37 ? 233 GLN B CG  1 
ATOM   3300 C CD  . GLN B 1 199 ? -8.776  49.908 112.231 1.00 49.50 ? 233 GLN B CD  1 
ATOM   3301 O OE1 . GLN B 1 199 ? -9.105  49.111 113.112 1.00 50.70 ? 233 GLN B OE1 1 
ATOM   3302 N NE2 . GLN B 1 199 ? -7.951  49.579 111.242 1.00 50.06 ? 233 GLN B NE2 1 
ATOM   3303 N N   . ALA B 1 200 ? -7.557  55.960 111.820 1.00 48.31 ? 234 ALA B N   1 
ATOM   3304 C CA  . ALA B 1 200 ? -6.541  56.969 112.053 1.00 47.96 ? 234 ALA B CA  1 
ATOM   3305 C C   . ALA B 1 200 ? -6.475  57.273 113.539 1.00 48.02 ? 234 ALA B C   1 
ATOM   3306 O O   . ALA B 1 200 ? -7.509  57.366 114.219 1.00 48.06 ? 234 ALA B O   1 
ATOM   3307 C CB  . ALA B 1 200 ? -6.855  58.224 111.274 1.00 47.86 ? 234 ALA B CB  1 
ATOM   3308 N N   . THR B 1 201 ? -5.255  57.398 114.051 1.00 47.85 ? 235 THR B N   1 
ATOM   3309 C CA  . THR B 1 201 ? -5.070  57.857 115.409 1.00 47.41 ? 235 THR B CA  1 
ATOM   3310 C C   . THR B 1 201 ? -5.176  59.378 115.428 1.00 47.70 ? 235 THR B C   1 
ATOM   3311 O O   . THR B 1 201 ? -5.052  60.039 114.393 1.00 47.28 ? 235 THR B O   1 
ATOM   3312 C CB  . THR B 1 201 ? -3.746  57.360 116.037 1.00 47.22 ? 235 THR B CB  1 
ATOM   3313 O OG1 . THR B 1 201 ? -2.650  58.177 115.613 1.00 46.75 ? 235 THR B OG1 1 
ATOM   3314 C CG2 . THR B 1 201 ? -3.489  55.918 115.655 1.00 47.15 ? 235 THR B CG2 1 
ATOM   3315 N N   . PHE B 1 202 ? -5.445  59.917 116.615 1.00 48.22 ? 236 PHE B N   1 
ATOM   3316 C CA  . PHE B 1 202 ? -5.510  61.349 116.845 1.00 48.57 ? 236 PHE B CA  1 
ATOM   3317 C C   . PHE B 1 202 ? -4.237  62.037 116.343 1.00 49.05 ? 236 PHE B C   1 
ATOM   3318 O O   . PHE B 1 202 ? -4.304  63.119 115.767 1.00 49.12 ? 236 PHE B O   1 
ATOM   3319 C CB  . PHE B 1 202 ? -5.727  61.616 118.337 1.00 48.57 ? 236 PHE B CB  1 
ATOM   3320 C CG  . PHE B 1 202 ? -5.758  63.070 118.697 1.00 48.43 ? 236 PHE B CG  1 
ATOM   3321 C CD1 . PHE B 1 202 ? -4.598  63.723 119.098 1.00 48.16 ? 236 PHE B CD1 1 
ATOM   3322 C CD2 . PHE B 1 202 ? -6.949  63.786 118.642 1.00 48.93 ? 236 PHE B CD2 1 
ATOM   3323 C CE1 . PHE B 1 202 ? -4.621  65.069 119.429 1.00 48.82 ? 236 PHE B CE1 1 
ATOM   3324 C CE2 . PHE B 1 202 ? -6.984  65.140 118.968 1.00 49.17 ? 236 PHE B CE2 1 
ATOM   3325 C CZ  . PHE B 1 202 ? -5.817  65.781 119.364 1.00 48.90 ? 236 PHE B CZ  1 
ATOM   3326 N N   . TYR B 1 203 ? -3.085  61.407 116.555 1.00 49.66 ? 237 TYR B N   1 
ATOM   3327 C CA  . TYR B 1 203 ? -1.817  61.955 116.088 1.00 50.33 ? 237 TYR B CA  1 
ATOM   3328 C C   . TYR B 1 203 ? -1.740  62.030 114.560 1.00 50.79 ? 237 TYR B C   1 
ATOM   3329 O O   . TYR B 1 203 ? -1.361  63.068 114.005 1.00 51.08 ? 237 TYR B O   1 
ATOM   3330 C CB  . TYR B 1 203 ? -0.645  61.148 116.627 1.00 50.48 ? 237 TYR B CB  1 
ATOM   3331 C CG  . TYR B 1 203 ? 0.692   61.700 116.199 1.00 50.80 ? 237 TYR B CG  1 
ATOM   3332 C CD1 . TYR B 1 203 ? 1.343   61.203 115.071 1.00 50.83 ? 237 TYR B CD1 1 
ATOM   3333 C CD2 . TYR B 1 203 ? 1.306   62.726 116.918 1.00 51.58 ? 237 TYR B CD2 1 
ATOM   3334 C CE1 . TYR B 1 203 ? 2.575   61.708 114.670 1.00 51.27 ? 237 TYR B CE1 1 
ATOM   3335 C CE2 . TYR B 1 203 ? 2.541   63.239 116.529 1.00 51.78 ? 237 TYR B CE2 1 
ATOM   3336 C CZ  . TYR B 1 203 ? 3.169   62.723 115.403 1.00 51.54 ? 237 TYR B CZ  1 
ATOM   3337 O OH  . TYR B 1 203 ? 4.390   63.221 115.013 1.00 51.63 ? 237 TYR B OH  1 
ATOM   3338 N N   . ASP B 1 204 ? -2.084  60.927 113.895 1.00 51.06 ? 238 ASP B N   1 
ATOM   3339 C CA  . ASP B 1 204 ? -2.149  60.883 112.439 1.00 51.41 ? 238 ASP B CA  1 
ATOM   3340 C C   . ASP B 1 204 ? -3.002  62.024 111.894 1.00 51.65 ? 238 ASP B C   1 
ATOM   3341 O O   . ASP B 1 204 ? -2.562  62.773 111.019 1.00 51.86 ? 238 ASP B O   1 
ATOM   3342 C CB  . ASP B 1 204 ? -2.721  59.543 111.965 1.00 51.43 ? 238 ASP B CB  1 
ATOM   3343 C CG  . ASP B 1 204 ? -1.767  58.382 112.188 1.00 51.75 ? 238 ASP B CG  1 
ATOM   3344 O OD1 . ASP B 1 204 ? -2.255  57.266 112.485 1.00 51.58 ? 238 ASP B OD1 1 
ATOM   3345 O OD2 . ASP B 1 204 ? -0.535  58.579 112.059 1.00 52.24 ? 238 ASP B OD2 1 
ATOM   3346 N N   . LYS B 1 205 ? -4.215  62.159 112.429 1.00 51.94 ? 239 LYS B N   1 
ATOM   3347 C CA  . LYS B 1 205 ? -5.165  63.171 111.965 1.00 52.11 ? 239 LYS B CA  1 
ATOM   3348 C C   . LYS B 1 205 ? -4.579  64.574 112.052 1.00 52.49 ? 239 LYS B C   1 
ATOM   3349 O O   . LYS B 1 205 ? -4.740  65.368 111.134 1.00 52.29 ? 239 LYS B O   1 
ATOM   3350 C CB  . LYS B 1 205 ? -6.467  63.099 112.759 1.00 51.99 ? 239 LYS B CB  1 
ATOM   3351 C CG  . LYS B 1 205 ? -7.264  61.817 112.601 1.00 51.15 ? 239 LYS B CG  1 
ATOM   3352 C CD  . LYS B 1 205 ? -8.525  61.933 113.417 1.00 51.20 ? 239 LYS B CD  1 
ATOM   3353 C CE  . LYS B 1 205 ? -9.298  60.644 113.461 1.00 51.88 ? 239 LYS B CE  1 
ATOM   3354 N NZ  . LYS B 1 205 ? -10.449 60.764 114.404 1.00 51.54 ? 239 LYS B NZ  1 
ATOM   3355 N N   . ARG B 1 206 ? -3.885  64.859 113.153 1.00 53.23 ? 240 ARG B N   1 
ATOM   3356 C CA  . ARG B 1 206 ? -3.252  66.162 113.366 1.00 54.08 ? 240 ARG B CA  1 
ATOM   3357 C C   . ARG B 1 206 ? -2.100  66.427 112.408 1.00 54.76 ? 240 ARG B C   1 
ATOM   3358 O O   . ARG B 1 206 ? -1.894  67.568 111.989 1.00 54.96 ? 240 ARG B O   1 
ATOM   3359 C CB  . ARG B 1 206 ? -2.787  66.334 114.819 1.00 53.92 ? 240 ARG B CB  1 
ATOM   3360 C CG  . ARG B 1 206 ? -3.917  66.579 115.810 1.00 53.87 ? 240 ARG B CG  1 
ATOM   3361 C CD  . ARG B 1 206 ? -4.623  67.897 115.561 1.00 53.84 ? 240 ARG B CD  1 
ATOM   3362 N NE  . ARG B 1 206 ? -6.015  67.854 116.002 1.00 54.89 ? 240 ARG B NE  1 
ATOM   3363 C CZ  . ARG B 1 206 ? -6.463  68.344 117.157 1.00 55.76 ? 240 ARG B CZ  1 
ATOM   3364 N NH1 . ARG B 1 206 ? -7.751  68.248 117.457 1.00 56.00 ? 240 ARG B NH1 1 
ATOM   3365 N NH2 . ARG B 1 206 ? -5.634  68.929 118.018 1.00 55.81 ? 240 ARG B NH2 1 
ATOM   3366 N N   . CYS B 1 207 ? -1.351  65.383 112.058 1.00 55.51 ? 241 CYS B N   1 
ATOM   3367 C CA  . CYS B 1 207 ? -0.280  65.529 111.075 1.00 56.28 ? 241 CYS B CA  1 
ATOM   3368 C C   . CYS B 1 207 ? -0.790  66.031 109.737 1.00 56.25 ? 241 CYS B C   1 
ATOM   3369 O O   . CYS B 1 207 ? -0.069  66.733 109.030 1.00 56.47 ? 241 CYS B O   1 
ATOM   3370 C CB  . CYS B 1 207 ? 0.511   64.239 110.893 1.00 56.52 ? 241 CYS B CB  1 
ATOM   3371 S SG  . CYS B 1 207 ? 2.111   64.308 111.696 1.00 58.38 ? 241 CYS B SG  1 
ATOM   3372 N N   . ASP B 1 208 ? -2.027  65.675 109.394 1.00 56.34 ? 242 ASP B N   1 
ATOM   3373 C CA  . ASP B 1 208 ? -2.685  66.238 108.212 1.00 56.35 ? 242 ASP B CA  1 
ATOM   3374 C C   . ASP B 1 208 ? -2.742  67.764 108.323 1.00 56.41 ? 242 ASP B C   1 
ATOM   3375 O O   . ASP B 1 208 ? -2.505  68.480 107.346 1.00 56.41 ? 242 ASP B O   1 
ATOM   3376 C CB  . ASP B 1 208 ? -4.093  65.658 108.024 1.00 56.14 ? 242 ASP B CB  1 
ATOM   3377 C CG  . ASP B 1 208 ? -4.083  64.230 107.476 1.00 56.33 ? 242 ASP B CG  1 
ATOM   3378 O OD1 . ASP B 1 208 ? -5.174  63.620 107.426 1.00 56.27 ? 242 ASP B OD1 1 
ATOM   3379 O OD2 . ASP B 1 208 ? -3.005  63.713 107.095 1.00 55.94 ? 242 ASP B OD2 1 
ATOM   3380 N N   . LEU B 1 209 ? -3.027  68.253 109.527 1.00 56.52 ? 243 LEU B N   1 
ATOM   3381 C CA  . LEU B 1 209 ? -3.137  69.686 109.757 1.00 56.64 ? 243 LEU B CA  1 
ATOM   3382 C C   . LEU B 1 209 ? -1.783  70.386 109.766 1.00 56.97 ? 243 LEU B C   1 
ATOM   3383 O O   . LEU B 1 209 ? -1.671  71.496 109.247 1.00 57.04 ? 243 LEU B O   1 
ATOM   3384 C CB  . LEU B 1 209 ? -3.951  69.999 111.018 1.00 56.40 ? 243 LEU B CB  1 
ATOM   3385 C CG  . LEU B 1 209 ? -5.489  69.951 110.926 1.00 55.97 ? 243 LEU B CG  1 
ATOM   3386 C CD1 . LEU B 1 209 ? -6.068  70.750 109.753 1.00 55.18 ? 243 LEU B CD1 1 
ATOM   3387 C CD2 . LEU B 1 209 ? -6.026  68.533 110.905 1.00 55.44 ? 243 LEU B CD2 1 
ATOM   3388 N N   . TRP B 1 210 ? -0.759  69.744 110.329 1.00 57.41 ? 244 TRP B N   1 
ATOM   3389 C CA  . TRP B 1 210 ? 0.613   70.249 110.191 1.00 57.94 ? 244 TRP B CA  1 
ATOM   3390 C C   . TRP B 1 210 ? 0.945   70.446 108.706 1.00 58.33 ? 244 TRP B C   1 
ATOM   3391 O O   . TRP B 1 210 ? 1.499   71.481 108.310 1.00 58.38 ? 244 TRP B O   1 
ATOM   3392 C CB  . TRP B 1 210 ? 1.633   69.306 110.851 1.00 58.07 ? 244 TRP B CB  1 
ATOM   3393 C CG  . TRP B 1 210 ? 3.027   69.369 110.232 1.00 58.34 ? 244 TRP B CG  1 
ATOM   3394 C CD1 . TRP B 1 210 ? 3.431   68.804 109.044 1.00 58.76 ? 244 TRP B CD1 1 
ATOM   3395 C CD2 . TRP B 1 210 ? 4.181   70.026 110.766 1.00 58.22 ? 244 TRP B CD2 1 
ATOM   3396 N NE1 . TRP B 1 210 ? 4.757   69.076 108.809 1.00 58.40 ? 244 TRP B NE1 1 
ATOM   3397 C CE2 . TRP B 1 210 ? 5.244   69.821 109.849 1.00 58.44 ? 244 TRP B CE2 1 
ATOM   3398 C CE3 . TRP B 1 210 ? 4.423   70.771 111.927 1.00 58.66 ? 244 TRP B CE3 1 
ATOM   3399 C CZ2 . TRP B 1 210 ? 6.527   70.331 110.060 1.00 58.55 ? 244 TRP B CZ2 1 
ATOM   3400 C CZ3 . TRP B 1 210 ? 5.702   71.280 112.139 1.00 58.88 ? 244 TRP B CZ3 1 
ATOM   3401 C CH2 . TRP B 1 210 ? 6.738   71.056 111.207 1.00 58.89 ? 244 TRP B CH2 1 
ATOM   3402 N N   . SER B 1 211 ? 0.591   69.445 107.897 1.00 58.59 ? 245 SER B N   1 
ATOM   3403 C CA  . SER B 1 211 ? 0.900   69.436 106.478 1.00 58.88 ? 245 SER B CA  1 
ATOM   3404 C C   . SER B 1 211 ? 0.178   70.538 105.725 1.00 59.14 ? 245 SER B C   1 
ATOM   3405 O O   . SER B 1 211 ? 0.720   71.081 104.761 1.00 59.36 ? 245 SER B O   1 
ATOM   3406 C CB  . SER B 1 211 ? 0.575   68.080 105.866 1.00 58.96 ? 245 SER B CB  1 
ATOM   3407 O OG  . SER B 1 211 ? 1.641   67.175 106.079 1.00 59.49 ? 245 SER B OG  1 
ATOM   3408 N N   . LEU B 1 212 ? -1.041  70.864 106.164 1.00 59.27 ? 246 LEU B N   1 
ATOM   3409 C CA  . LEU B 1 212 ? -1.817  71.961 105.569 1.00 59.32 ? 246 LEU B CA  1 
ATOM   3410 C C   . LEU B 1 212 ? -1.136  73.294 105.855 1.00 59.48 ? 246 LEU B C   1 
ATOM   3411 O O   . LEU B 1 212 ? -1.300  74.257 105.109 1.00 59.47 ? 246 LEU B O   1 
ATOM   3412 C CB  . LEU B 1 212 ? -3.264  71.960 106.084 1.00 59.20 ? 246 LEU B CB  1 
ATOM   3413 C CG  . LEU B 1 212 ? -4.257  73.008 105.565 1.00 58.96 ? 246 LEU B CG  1 
ATOM   3414 C CD1 . LEU B 1 212 ? -4.444  72.899 104.064 1.00 58.91 ? 246 LEU B CD1 1 
ATOM   3415 C CD2 . LEU B 1 212 ? -5.594  72.872 106.271 1.00 59.05 ? 246 LEU B CD2 1 
ATOM   3416 N N   . GLY B 1 213 ? -0.366  73.329 106.940 1.00 59.71 ? 247 GLY B N   1 
ATOM   3417 C CA  . GLY B 1 213 ? 0.446   74.487 107.284 1.00 60.10 ? 247 GLY B CA  1 
ATOM   3418 C C   . GLY B 1 213 ? 1.584   74.652 106.302 1.00 60.29 ? 247 GLY B C   1 
ATOM   3419 O O   . GLY B 1 213 ? 1.738   75.714 105.699 1.00 60.43 ? 247 GLY B O   1 
ATOM   3420 N N   . VAL B 1 214 ? 2.367   73.588 106.135 1.00 60.43 ? 248 VAL B N   1 
ATOM   3421 C CA  . VAL B 1 214 ? 3.506   73.571 105.216 1.00 60.76 ? 248 VAL B CA  1 
ATOM   3422 C C   . VAL B 1 214 ? 3.085   73.973 103.795 1.00 61.09 ? 248 VAL B C   1 
ATOM   3423 O O   . VAL B 1 214 ? 3.814   74.691 103.110 1.00 61.26 ? 248 VAL B O   1 
ATOM   3424 C CB  . VAL B 1 214 ? 4.203   72.179 105.205 1.00 60.73 ? 248 VAL B CB  1 
ATOM   3425 C CG1 . VAL B 1 214 ? 5.488   72.210 104.394 1.00 60.42 ? 248 VAL B CG1 1 
ATOM   3426 C CG2 . VAL B 1 214 ? 4.505   71.724 106.625 1.00 60.95 ? 248 VAL B CG2 1 
ATOM   3427 N N   . VAL B 1 215 ? 1.903   73.519 103.373 1.00 61.37 ? 249 VAL B N   1 
ATOM   3428 C CA  . VAL B 1 215 ? 1.354   73.842 102.053 1.00 61.45 ? 249 VAL B CA  1 
ATOM   3429 C C   . VAL B 1 215 ? 0.991   75.325 101.958 1.00 61.75 ? 249 VAL B C   1 
ATOM   3430 O O   . VAL B 1 215 ? 1.364   75.992 100.987 1.00 62.04 ? 249 VAL B O   1 
ATOM   3431 C CB  . VAL B 1 215 ? 0.134   72.950 101.694 1.00 61.33 ? 249 VAL B CB  1 
ATOM   3432 C CG1 . VAL B 1 215 ? -0.547  73.432 100.426 1.00 61.22 ? 249 VAL B CG1 1 
ATOM   3433 C CG2 . VAL B 1 215 ? 0.565   71.505 101.528 1.00 61.24 ? 249 VAL B CG2 1 
ATOM   3434 N N   . LEU B 1 216 ? 0.281   75.837 102.965 1.00 61.88 ? 250 LEU B N   1 
ATOM   3435 C CA  . LEU B 1 216 ? -0.049  77.261 103.030 1.00 61.95 ? 250 LEU B CA  1 
ATOM   3436 C C   . LEU B 1 216 ? 1.233   78.070 102.915 1.00 62.05 ? 250 LEU B C   1 
ATOM   3437 O O   . LEU B 1 216 ? 1.308   79.016 102.135 1.00 61.91 ? 250 LEU B O   1 
ATOM   3438 C CB  . LEU B 1 216 ? -0.771  77.603 104.340 1.00 61.97 ? 250 LEU B CB  1 
ATOM   3439 C CG  . LEU B 1 216 ? -1.910  78.637 104.342 1.00 61.77 ? 250 LEU B CG  1 
ATOM   3440 C CD1 . LEU B 1 216 ? -2.232  79.100 105.757 1.00 60.94 ? 250 LEU B CD1 1 
ATOM   3441 C CD2 . LEU B 1 216 ? -1.607  79.835 103.468 1.00 62.01 ? 250 LEU B CD2 1 
ATOM   3442 N N   . TYR B 1 217 ? 2.242   77.664 103.682 1.00 62.38 ? 251 TYR B N   1 
ATOM   3443 C CA  . TYR B 1 217 ? 3.549   78.301 103.676 1.00 62.94 ? 251 TYR B CA  1 
ATOM   3444 C C   . TYR B 1 217 ? 4.137   78.335 102.275 1.00 63.34 ? 251 TYR B C   1 
ATOM   3445 O O   . TYR B 1 217 ? 4.557   79.385 101.800 1.00 63.39 ? 251 TYR B O   1 
ATOM   3446 C CB  . TYR B 1 217 ? 4.502   77.567 104.616 1.00 63.06 ? 251 TYR B CB  1 
ATOM   3447 C CG  . TYR B 1 217 ? 5.803   78.297 104.851 1.00 63.48 ? 251 TYR B CG  1 
ATOM   3448 C CD1 . TYR B 1 217 ? 6.834   78.244 103.914 1.00 63.99 ? 251 TYR B CD1 1 
ATOM   3449 C CD2 . TYR B 1 217 ? 6.008   79.042 106.013 1.00 63.82 ? 251 TYR B CD2 1 
ATOM   3450 C CE1 . TYR B 1 217 ? 8.037   78.916 104.121 1.00 64.21 ? 251 TYR B CE1 1 
ATOM   3451 C CE2 . TYR B 1 217 ? 7.210   79.717 106.234 1.00 63.99 ? 251 TYR B CE2 1 
ATOM   3452 C CZ  . TYR B 1 217 ? 8.220   79.648 105.280 1.00 64.07 ? 251 TYR B CZ  1 
ATOM   3453 O OH  . TYR B 1 217 ? 9.414   80.305 105.475 1.00 63.99 ? 251 TYR B OH  1 
ATOM   3454 N N   . ILE B 1 218 ? 4.167   77.178 101.623 1.00 63.87 ? 252 ILE B N   1 
ATOM   3455 C CA  . ILE B 1 218 ? 4.674   77.073 100.262 1.00 64.39 ? 252 ILE B CA  1 
ATOM   3456 C C   . ILE B 1 218 ? 3.876   77.982 99.325  1.00 64.99 ? 252 ILE B C   1 
ATOM   3457 O O   . ILE B 1 218 ? 4.460   78.711 98.518  1.00 65.12 ? 252 ILE B O   1 
ATOM   3458 C CB  . ILE B 1 218 ? 4.664   75.607 99.769  1.00 64.23 ? 252 ILE B CB  1 
ATOM   3459 C CG1 . ILE B 1 218 ? 5.744   74.808 100.496 1.00 63.99 ? 252 ILE B CG1 1 
ATOM   3460 C CG2 . ILE B 1 218 ? 4.901   75.534 98.266  1.00 64.14 ? 252 ILE B CG2 1 
ATOM   3461 C CD1 . ILE B 1 218 ? 5.465   73.327 100.601 1.00 63.85 ? 252 ILE B CD1 1 
ATOM   3462 N N   . MET B 1 219 ? 2.550   77.956 99.460  1.00 65.68 ? 253 MET B N   1 
ATOM   3463 C CA  . MET B 1 219 ? 1.664   78.719 98.582  1.00 66.34 ? 253 MET B CA  1 
ATOM   3464 C C   . MET B 1 219 ? 1.990   80.215 98.525  1.00 67.37 ? 253 MET B C   1 
ATOM   3465 O O   . MET B 1 219 ? 2.073   80.792 97.438  1.00 67.45 ? 253 MET B O   1 
ATOM   3466 C CB  . MET B 1 219 ? 0.196   78.493 98.949  1.00 66.21 ? 253 MET B CB  1 
ATOM   3467 C CG  . MET B 1 219 ? -0.368  77.178 98.440  1.00 65.66 ? 253 MET B CG  1 
ATOM   3468 S SD  . MET B 1 219 ? -2.173  77.125 98.458  1.00 65.49 ? 253 MET B SD  1 
ATOM   3469 C CE  . MET B 1 219 ? -2.537  76.951 100.204 1.00 65.66 ? 253 MET B CE  1 
ATOM   3470 N N   . LEU B 1 220 ? 2.198   80.836 99.682  1.00 68.52 ? 254 LEU B N   1 
ATOM   3471 C CA  . LEU B 1 220 ? 2.492   82.272 99.718  1.00 69.68 ? 254 LEU B CA  1 
ATOM   3472 C C   . LEU B 1 220 ? 3.983   82.652 99.736  1.00 70.63 ? 254 LEU B C   1 
ATOM   3473 O O   . LEU B 1 220 ? 4.318   83.823 99.564  1.00 70.78 ? 254 LEU B O   1 
ATOM   3474 C CB  . LEU B 1 220 ? 1.713   82.976 100.841 1.00 69.53 ? 254 LEU B CB  1 
ATOM   3475 C CG  . LEU B 1 220 ? 1.551   82.359 102.233 1.00 69.61 ? 254 LEU B CG  1 
ATOM   3476 C CD1 . LEU B 1 220 ? 2.785   82.575 103.111 1.00 69.50 ? 254 LEU B CD1 1 
ATOM   3477 C CD2 . LEU B 1 220 ? 0.312   82.939 102.898 1.00 69.54 ? 254 LEU B CD2 1 
ATOM   3478 N N   . SER B 1 221 ? 4.865   81.669 99.915  1.00 71.93 ? 255 SER B N   1 
ATOM   3479 C CA  . SER B 1 221 ? 6.314   81.918 99.956  1.00 73.15 ? 255 SER B CA  1 
ATOM   3480 C C   . SER B 1 221 ? 7.062   81.433 98.710  1.00 74.10 ? 255 SER B C   1 
ATOM   3481 O O   . SER B 1 221 ? 8.157   81.912 98.415  1.00 74.07 ? 255 SER B O   1 
ATOM   3482 C CB  . SER B 1 221 ? 6.935   81.296 101.213 1.00 73.14 ? 255 SER B CB  1 
ATOM   3483 O OG  . SER B 1 221 ? 8.306   81.639 101.345 1.00 73.22 ? 255 SER B OG  1 
ATOM   3484 N N   . GLY B 1 222 ? 6.477   80.482 97.986  1.00 75.34 ? 256 GLY B N   1 
ATOM   3485 C CA  . GLY B 1 222 ? 7.142   79.882 96.830  1.00 76.94 ? 256 GLY B CA  1 
ATOM   3486 C C   . GLY B 1 222 ? 8.048   78.716 97.193  1.00 78.15 ? 256 GLY B C   1 
ATOM   3487 O O   . GLY B 1 222 ? 8.446   77.934 96.323  1.00 78.16 ? 256 GLY B O   1 
ATOM   3488 N N   . TYR B 1 223 ? 8.382   78.608 98.480  1.00 79.36 ? 257 TYR B N   1 
ATOM   3489 C CA  . TYR B 1 223 ? 9.169   77.490 99.013  1.00 80.53 ? 257 TYR B CA  1 
ATOM   3490 C C   . TYR B 1 223 ? 8.742   77.142 100.449 1.00 81.14 ? 257 TYR B C   1 
ATOM   3491 O O   . TYR B 1 223 ? 8.138   77.981 101.125 1.00 81.03 ? 257 TYR B O   1 
ATOM   3492 C CB  . TYR B 1 223 ? 10.684  77.769 98.924  1.00 80.74 ? 257 TYR B CB  1 
ATOM   3493 C CG  . TYR B 1 223 ? 11.109  79.190 99.248  1.00 81.24 ? 257 TYR B CG  1 
ATOM   3494 C CD1 . TYR B 1 223 ? 11.154  79.650 100.572 1.00 81.54 ? 257 TYR B CD1 1 
ATOM   3495 C CD2 . TYR B 1 223 ? 11.488  80.070 98.228  1.00 81.61 ? 257 TYR B CD2 1 
ATOM   3496 C CE1 . TYR B 1 223 ? 11.554  80.961 100.867 1.00 81.69 ? 257 TYR B CE1 1 
ATOM   3497 C CE2 . TYR B 1 223 ? 11.892  81.378 98.510  1.00 81.60 ? 257 TYR B CE2 1 
ATOM   3498 C CZ  . TYR B 1 223 ? 11.923  81.817 99.828  1.00 81.63 ? 257 TYR B CZ  1 
ATOM   3499 O OH  . TYR B 1 223 ? 12.322  83.109 100.100 1.00 81.55 ? 257 TYR B OH  1 
ATOM   3500 N N   . PRO B 1 224 ? 9.040   75.902 100.905 1.00 81.86 ? 258 PRO B N   1 
ATOM   3501 C CA  . PRO B 1 224 ? 8.683   75.409 102.245 1.00 82.41 ? 258 PRO B CA  1 
ATOM   3502 C C   . PRO B 1 224 ? 9.494   76.021 103.404 1.00 82.93 ? 258 PRO B C   1 
ATOM   3503 O O   . PRO B 1 224 ? 10.478  76.735 103.155 1.00 82.93 ? 258 PRO B O   1 
ATOM   3504 C CB  . PRO B 1 224 ? 8.954   73.899 102.140 1.00 82.43 ? 258 PRO B CB  1 
ATOM   3505 C CG  . PRO B 1 224 ? 10.027  73.784 101.131 1.00 82.26 ? 258 PRO B CG  1 
ATOM   3506 C CD  . PRO B 1 224 ? 9.740   74.863 100.121 1.00 81.99 ? 258 PRO B CD  1 
ATOM   3507 N N   . PRO B 1 225 ? 9.061   75.766 104.665 1.00 83.36 ? 259 PRO B N   1 
ATOM   3508 C CA  . PRO B 1 225 ? 9.821   76.169 105.859 1.00 83.77 ? 259 PRO B CA  1 
ATOM   3509 C C   . PRO B 1 225 ? 11.011  75.254 106.218 1.00 84.20 ? 259 PRO B C   1 
ATOM   3510 O O   . PRO B 1 225 ? 11.993  75.724 106.800 1.00 84.21 ? 259 PRO B O   1 
ATOM   3511 C CB  . PRO B 1 225 ? 8.765   76.146 106.972 1.00 83.73 ? 259 PRO B CB  1 
ATOM   3512 C CG  . PRO B 1 225 ? 7.738   75.173 106.517 1.00 83.42 ? 259 PRO B CG  1 
ATOM   3513 C CD  . PRO B 1 225 ? 7.786   75.106 105.019 1.00 83.29 ? 259 PRO B CD  1 
ATOM   3514 N N   . PHE B 1 226 ? 10.916  73.968 105.876 1.00 84.72 ? 260 PHE B N   1 
ATOM   3515 C CA  . PHE B 1 226 ? 11.957  72.984 106.195 1.00 85.16 ? 260 PHE B CA  1 
ATOM   3516 C C   . PHE B 1 226 ? 12.322  72.149 104.966 1.00 85.26 ? 260 PHE B C   1 
ATOM   3517 O O   . PHE B 1 226 ? 13.285  72.450 104.256 1.00 85.37 ? 260 PHE B O   1 
ATOM   3518 C CB  . PHE B 1 226 ? 11.503  72.063 107.341 1.00 85.36 ? 260 PHE B CB  1 
ATOM   3519 C CG  . PHE B 1 226 ? 10.885  72.797 108.506 1.00 85.75 ? 260 PHE B CG  1 
ATOM   3520 C CD1 . PHE B 1 226 ? 11.689  73.373 109.492 1.00 86.10 ? 260 PHE B CD1 1 
ATOM   3521 C CD2 . PHE B 1 226 ? 9.499   72.916 108.612 1.00 85.82 ? 260 PHE B CD2 1 
ATOM   3522 C CE1 . PHE B 1 226 ? 11.119  74.059 110.569 1.00 86.30 ? 260 PHE B CE1 1 
ATOM   3523 C CE2 . PHE B 1 226 ? 8.919   73.601 109.681 1.00 86.00 ? 260 PHE B CE2 1 
ATOM   3524 C CZ  . PHE B 1 226 ? 9.731   74.172 110.662 1.00 86.07 ? 260 PHE B CZ  1 
ATOM   3525 N N   . TRP B 1 265 ? 10.776  87.910 103.789 1.00 94.38 ? 299 TRP B N   1 
ATOM   3526 C CA  . TRP B 1 265 ? 9.404   88.252 104.145 1.00 94.35 ? 299 TRP B CA  1 
ATOM   3527 C C   . TRP B 1 265 ? 9.074   89.684 103.762 1.00 94.12 ? 299 TRP B C   1 
ATOM   3528 O O   . TRP B 1 265 ? 9.771   90.617 104.166 1.00 94.09 ? 299 TRP B O   1 
ATOM   3529 C CB  . TRP B 1 265 ? 9.156   88.024 105.640 1.00 94.56 ? 299 TRP B CB  1 
ATOM   3530 C CG  . TRP B 1 265 ? 9.164   86.573 106.014 1.00 94.94 ? 299 TRP B CG  1 
ATOM   3531 C CD1 . TRP B 1 265 ? 10.060  85.939 106.830 1.00 95.00 ? 299 TRP B CD1 1 
ATOM   3532 C CD2 . TRP B 1 265 ? 8.240   85.564 105.568 1.00 95.46 ? 299 TRP B CD2 1 
ATOM   3533 N NE1 . TRP B 1 265 ? 9.746   84.602 106.928 1.00 95.31 ? 299 TRP B NE1 1 
ATOM   3534 C CE2 . TRP B 1 265 ? 8.635   84.345 106.163 1.00 95.60 ? 299 TRP B CE2 1 
ATOM   3535 C CE3 . TRP B 1 265 ? 7.113   85.572 104.726 1.00 95.33 ? 299 TRP B CE3 1 
ATOM   3536 C CZ2 . TRP B 1 265 ? 7.941   83.142 105.942 1.00 95.31 ? 299 TRP B CZ2 1 
ATOM   3537 C CZ3 . TRP B 1 265 ? 6.423   84.374 104.509 1.00 94.91 ? 299 TRP B CZ3 1 
ATOM   3538 C CH2 . TRP B 1 265 ? 6.842   83.179 105.113 1.00 94.88 ? 299 TRP B CH2 1 
ATOM   3539 N N   . ALA B 1 266 ? 8.004   89.844 102.984 1.00 93.85 ? 300 ALA B N   1 
ATOM   3540 C CA  . ALA B 1 266 ? 7.604   91.149 102.445 1.00 93.54 ? 300 ALA B CA  1 
ATOM   3541 C C   . ALA B 1 266 ? 6.338   91.725 103.122 1.00 93.21 ? 300 ALA B C   1 
ATOM   3542 O O   . ALA B 1 266 ? 6.250   91.765 104.359 1.00 93.21 ? 300 ALA B O   1 
ATOM   3543 C CB  . ALA B 1 266 ? 7.437   91.060 100.917 1.00 93.57 ? 300 ALA B CB  1 
ATOM   3544 N N   . HIS B 1 267 ? 5.379   92.183 102.309 1.00 92.62 ? 301 HIS B N   1 
ATOM   3545 C CA  . HIS B 1 267 ? 4.063   92.634 102.786 1.00 91.85 ? 301 HIS B CA  1 
ATOM   3546 C C   . HIS B 1 267 ? 3.177   91.418 103.081 1.00 91.29 ? 301 HIS B C   1 
ATOM   3547 O O   . HIS B 1 267 ? 2.133   91.220 102.446 1.00 91.23 ? 301 HIS B O   1 
ATOM   3548 C CB  . HIS B 1 267 ? 3.387   93.539 101.745 1.00 91.89 ? 301 HIS B CB  1 
ATOM   3549 C CG  . HIS B 1 267 ? 4.095   94.836 101.509 1.00 91.60 ? 301 HIS B CG  1 
ATOM   3550 N ND1 . HIS B 1 267 ? 5.271   94.925 100.798 1.00 91.38 ? 301 HIS B ND1 1 
ATOM   3551 C CD2 . HIS B 1 267 ? 3.780   96.101 101.876 1.00 91.59 ? 301 HIS B CD2 1 
ATOM   3552 C CE1 . HIS B 1 267 ? 5.657   96.187 100.746 1.00 91.68 ? 301 HIS B CE1 1 
ATOM   3553 N NE2 . HIS B 1 267 ? 4.769   96.922 101.391 1.00 91.70 ? 301 HIS B NE2 1 
ATOM   3554 N N   . ILE B 1 268 ? 3.613   90.610 104.047 1.00 90.51 ? 302 ILE B N   1 
ATOM   3555 C CA  . ILE B 1 268 ? 2.968   89.339 104.384 1.00 89.60 ? 302 ILE B CA  1 
ATOM   3556 C C   . ILE B 1 268 ? 2.096   89.469 105.643 1.00 89.06 ? 302 ILE B C   1 
ATOM   3557 O O   . ILE B 1 268 ? 2.591   89.800 106.726 1.00 89.10 ? 302 ILE B O   1 
ATOM   3558 C CB  . ILE B 1 268 ? 4.007   88.172 104.479 1.00 89.58 ? 302 ILE B CB  1 
ATOM   3559 C CG1 . ILE B 1 268 ? 5.297   88.613 105.187 1.00 89.34 ? 302 ILE B CG1 1 
ATOM   3560 C CG2 . ILE B 1 268 ? 4.363   87.670 103.086 1.00 89.31 ? 302 ILE B CG2 1 
ATOM   3561 C CD1 . ILE B 1 268 ? 5.376   88.252 106.661 1.00 89.29 ? 302 ILE B CD1 1 
ATOM   3562 N N   . SER B 1 269 ? 0.796   89.218 105.478 1.00 88.20 ? 303 SER B N   1 
ATOM   3563 C CA  . SER B 1 269 ? -0.221  89.512 106.502 1.00 87.37 ? 303 SER B CA  1 
ATOM   3564 C C   . SER B 1 269 ? 0.013   88.845 107.860 1.00 86.93 ? 303 SER B C   1 
ATOM   3565 O O   . SER B 1 269 ? 0.789   87.891 107.980 1.00 86.92 ? 303 SER B O   1 
ATOM   3566 C CB  . SER B 1 269 ? -1.621  89.172 105.973 1.00 87.29 ? 303 SER B CB  1 
ATOM   3567 O OG  . SER B 1 269 ? -2.594  89.194 107.002 1.00 86.78 ? 303 SER B OG  1 
ATOM   3568 N N   . SER B 1 270 ? -0.663  89.365 108.882 1.00 86.32 ? 304 SER B N   1 
ATOM   3569 C CA  . SER B 1 270 ? -0.605  88.776 110.215 1.00 85.82 ? 304 SER B CA  1 
ATOM   3570 C C   . SER B 1 270 ? -1.472  87.519 110.307 1.00 85.43 ? 304 SER B C   1 
ATOM   3571 O O   . SER B 1 270 ? -0.941  86.432 110.550 1.00 85.47 ? 304 SER B O   1 
ATOM   3572 C CB  . SER B 1 270 ? -0.970  89.797 111.298 1.00 85.81 ? 304 SER B CB  1 
ATOM   3573 O OG  . SER B 1 270 ? -2.167  90.480 110.979 1.00 85.97 ? 304 SER B OG  1 
ATOM   3574 N N   . GLU B 1 271 ? -2.785  87.657 110.085 1.00 84.80 ? 305 GLU B N   1 
ATOM   3575 C CA  . GLU B 1 271 ? -3.719  86.511 110.116 1.00 84.12 ? 305 GLU B CA  1 
ATOM   3576 C C   . GLU B 1 271 ? -3.304  85.415 109.140 1.00 83.53 ? 305 GLU B C   1 
ATOM   3577 O O   . GLU B 1 271 ? -3.702  84.259 109.292 1.00 83.49 ? 305 GLU B O   1 
ATOM   3578 C CB  . GLU B 1 271 ? -5.166  86.926 109.820 1.00 84.17 ? 305 GLU B CB  1 
ATOM   3579 C CG  . GLU B 1 271 ? -5.673  88.115 110.607 1.00 84.39 ? 305 GLU B CG  1 
ATOM   3580 C CD  . GLU B 1 271 ? -5.279  89.436 109.972 1.00 85.04 ? 305 GLU B CD  1 
ATOM   3581 O OE1 . GLU B 1 271 ? -5.437  90.481 110.640 1.00 85.35 ? 305 GLU B OE1 1 
ATOM   3582 O OE2 . GLU B 1 271 ? -4.808  89.433 108.809 1.00 84.85 ? 305 GLU B OE2 1 
ATOM   3583 N N   . ALA B 1 272 ? -2.521  85.798 108.132 1.00 82.82 ? 306 ALA B N   1 
ATOM   3584 C CA  . ALA B 1 272 ? -1.860  84.843 107.258 1.00 82.07 ? 306 ALA B CA  1 
ATOM   3585 C C   . ALA B 1 272 ? -0.853  84.051 108.084 1.00 81.60 ? 306 ALA B C   1 
ATOM   3586 O O   . ALA B 1 272 ? -1.095  82.878 108.381 1.00 81.63 ? 306 ALA B O   1 
ATOM   3587 C CB  . ALA B 1 272 ? -1.179  85.545 106.089 1.00 82.07 ? 306 ALA B CB  1 
ATOM   3588 N N   . LYS B 1 273 ? 0.245   84.689 108.497 1.00 80.84 ? 307 LYS B N   1 
ATOM   3589 C CA  . LYS B 1 273 ? 1.282   83.965 109.243 1.00 80.10 ? 307 LYS B CA  1 
ATOM   3590 C C   . LYS B 1 273 ? 0.866   83.592 110.677 1.00 79.48 ? 307 LYS B C   1 
ATOM   3591 O O   . LYS B 1 273 ? 1.643   82.980 111.417 1.00 79.47 ? 307 LYS B O   1 
ATOM   3592 C CB  . LYS B 1 273 ? 2.657   84.664 109.191 1.00 80.16 ? 307 LYS B CB  1 
ATOM   3593 C CG  . LYS B 1 273 ? 3.826   83.661 109.349 1.00 80.23 ? 307 LYS B CG  1 
ATOM   3594 C CD  . LYS B 1 273 ? 5.218   84.267 109.168 1.00 80.11 ? 307 LYS B CD  1 
ATOM   3595 C CE  . LYS B 1 273 ? 6.296   83.218 109.473 1.00 79.63 ? 307 LYS B CE  1 
ATOM   3596 N NZ  . LYS B 1 273 ? 7.686   83.725 109.294 1.00 79.10 ? 307 LYS B NZ  1 
ATOM   3597 N N   . ASP B 1 274 ? -0.363  83.942 111.056 1.00 78.60 ? 308 ASP B N   1 
ATOM   3598 C CA  . ASP B 1 274 ? -0.941  83.449 112.302 1.00 77.82 ? 308 ASP B CA  1 
ATOM   3599 C C   . ASP B 1 274 ? -1.432  82.014 112.118 1.00 77.27 ? 308 ASP B C   1 
ATOM   3600 O O   . ASP B 1 274 ? -1.021  81.110 112.857 1.00 77.21 ? 308 ASP B O   1 
ATOM   3601 C CB  . ASP B 1 274 ? -2.085  84.341 112.787 1.00 77.86 ? 308 ASP B CB  1 
ATOM   3602 C CG  . ASP B 1 274 ? -2.647  83.893 114.131 1.00 77.91 ? 308 ASP B CG  1 
ATOM   3603 O OD1 . ASP B 1 274 ? -1.853  83.588 115.049 1.00 77.62 ? 308 ASP B OD1 1 
ATOM   3604 O OD2 . ASP B 1 274 ? -3.888  83.848 114.269 1.00 78.17 ? 308 ASP B OD2 1 
ATOM   3605 N N   . LEU B 1 275 ? -2.299  81.808 111.125 1.00 76.34 ? 309 LEU B N   1 
ATOM   3606 C CA  . LEU B 1 275 ? -2.824  80.478 110.825 1.00 75.57 ? 309 LEU B CA  1 
ATOM   3607 C C   . LEU B 1 275 ? -1.697  79.479 110.649 1.00 74.88 ? 309 LEU B C   1 
ATOM   3608 O O   . LEU B 1 275 ? -1.841  78.322 111.010 1.00 74.90 ? 309 LEU B O   1 
ATOM   3609 C CB  . LEU B 1 275 ? -3.717  80.497 109.581 1.00 75.61 ? 309 LEU B CB  1 
ATOM   3610 C CG  . LEU B 1 275 ? -4.422  79.201 109.143 1.00 75.95 ? 309 LEU B CG  1 
ATOM   3611 C CD1 . LEU B 1 275 ? -5.163  78.518 110.293 1.00 75.75 ? 309 LEU B CD1 1 
ATOM   3612 C CD2 . LEU B 1 275 ? -5.377  79.464 107.977 1.00 75.65 ? 309 LEU B CD2 1 
ATOM   3613 N N   . ILE B 1 276 ? -0.573  79.942 110.113 1.00 74.16 ? 310 ILE B N   1 
ATOM   3614 C CA  . ILE B 1 276 ? 0.586   79.086 109.880 1.00 73.57 ? 310 ILE B CA  1 
ATOM   3615 C C   . ILE B 1 276 ? 1.289   78.666 111.177 1.00 73.30 ? 310 ILE B C   1 
ATOM   3616 O O   . ILE B 1 276 ? 1.616   77.491 111.352 1.00 73.41 ? 310 ILE B O   1 
ATOM   3617 C CB  . ILE B 1 276 ? 1.573   79.721 108.866 1.00 73.45 ? 310 ILE B CB  1 
ATOM   3618 C CG1 . ILE B 1 276 ? 0.947   79.701 107.468 1.00 73.28 ? 310 ILE B CG1 1 
ATOM   3619 C CG2 . ILE B 1 276 ? 2.918   78.988 108.867 1.00 73.16 ? 310 ILE B CG2 1 
ATOM   3620 C CD1 . ILE B 1 276 ? 1.738   80.429 106.400 1.00 73.60 ? 310 ILE B CD1 1 
ATOM   3621 N N   . SER B 1 277 ? 1.507   79.611 112.085 1.00 72.88 ? 311 SER B N   1 
ATOM   3622 C CA  . SER B 1 277 ? 2.159   79.291 113.355 1.00 72.56 ? 311 SER B CA  1 
ATOM   3623 C C   . SER B 1 277 ? 1.247   78.480 114.281 1.00 72.29 ? 311 SER B C   1 
ATOM   3624 O O   . SER B 1 277 ? 1.728   77.780 115.175 1.00 72.32 ? 311 SER B O   1 
ATOM   3625 C CB  . SER B 1 277 ? 2.670   80.557 114.045 1.00 72.59 ? 311 SER B CB  1 
ATOM   3626 O OG  . SER B 1 277 ? 1.681   81.571 114.046 1.00 72.86 ? 311 SER B OG  1 
ATOM   3627 N N   . LYS B 1 278 ? -0.064  78.566 114.052 1.00 71.88 ? 312 LYS B N   1 
ATOM   3628 C CA  . LYS B 1 278 ? -1.040  77.745 114.774 1.00 71.49 ? 312 LYS B CA  1 
ATOM   3629 C C   . LYS B 1 278 ? -1.088  76.311 114.241 1.00 71.21 ? 312 LYS B C   1 
ATOM   3630 O O   . LYS B 1 278 ? -1.700  75.433 114.854 1.00 71.20 ? 312 LYS B O   1 
ATOM   3631 C CB  . LYS B 1 278 ? -2.431  78.380 114.709 1.00 71.53 ? 312 LYS B CB  1 
ATOM   3632 C CG  . LYS B 1 278 ? -2.780  79.253 115.910 1.00 71.57 ? 312 LYS B CG  1 
ATOM   3633 C CD  . LYS B 1 278 ? -4.178  79.867 115.773 1.00 71.46 ? 312 LYS B CD  1 
ATOM   3634 C CE  . LYS B 1 278 ? -4.626  80.587 117.045 1.00 70.76 ? 312 LYS B CE  1 
ATOM   3635 N NZ  . LYS B 1 278 ? -3.814  81.798 117.331 1.00 70.24 ? 312 LYS B NZ  1 
ATOM   3636 N N   . LEU B 1 279 ? -0.437  76.089 113.100 1.00 70.83 ? 313 LEU B N   1 
ATOM   3637 C CA  . LEU B 1 279 ? -0.370  74.775 112.469 1.00 70.37 ? 313 LEU B CA  1 
ATOM   3638 C C   . LEU B 1 279 ? 1.017   74.152 112.601 1.00 70.34 ? 313 LEU B C   1 
ATOM   3639 O O   . LEU B 1 279 ? 1.130   72.977 112.920 1.00 70.43 ? 313 LEU B O   1 
ATOM   3640 C CB  . LEU B 1 279 ? -0.793  74.851 110.995 1.00 70.17 ? 313 LEU B CB  1 
ATOM   3641 C CG  . LEU B 1 279 ? -2.260  75.189 110.682 1.00 69.55 ? 313 LEU B CG  1 
ATOM   3642 C CD1 . LEU B 1 279 ? -2.456  75.536 109.210 1.00 68.41 ? 313 LEU B CD1 1 
ATOM   3643 C CD2 . LEU B 1 279 ? -3.210  74.074 111.103 1.00 68.95 ? 313 LEU B CD2 1 
ATOM   3644 N N   . LEU B 1 280 ? 2.067   74.937 112.378 1.00 70.34 ? 314 LEU B N   1 
ATOM   3645 C CA  . LEU B 1 280 ? 3.440   74.426 112.467 1.00 70.53 ? 314 LEU B CA  1 
ATOM   3646 C C   . LEU B 1 280 ? 3.992   74.240 113.894 1.00 70.98 ? 314 LEU B C   1 
ATOM   3647 O O   . LEU B 1 280 ? 5.214   74.171 114.076 1.00 71.18 ? 314 LEU B O   1 
ATOM   3648 C CB  . LEU B 1 280 ? 4.408   75.305 111.663 1.00 70.35 ? 314 LEU B CB  1 
ATOM   3649 C CG  . LEU B 1 280 ? 4.317   75.416 110.144 1.00 69.77 ? 314 LEU B CG  1 
ATOM   3650 C CD1 . LEU B 1 280 ? 5.628   75.974 109.611 1.00 68.97 ? 314 LEU B CD1 1 
ATOM   3651 C CD2 . LEU B 1 280 ? 4.006   74.079 109.506 1.00 69.34 ? 314 LEU B CD2 1 
ATOM   3652 N N   . VAL B 1 281 ? 3.114   74.161 114.897 1.00 71.32 ? 315 VAL B N   1 
ATOM   3653 C CA  . VAL B 1 281 ? 3.543   73.883 116.282 1.00 71.48 ? 315 VAL B CA  1 
ATOM   3654 C C   . VAL B 1 281 ? 3.946   72.423 116.493 1.00 71.68 ? 315 VAL B C   1 
ATOM   3655 O O   . VAL B 1 281 ? 3.365   71.519 115.891 1.00 71.84 ? 315 VAL B O   1 
ATOM   3656 C CB  . VAL B 1 281 ? 2.477   74.281 117.339 1.00 71.40 ? 315 VAL B CB  1 
ATOM   3657 C CG1 . VAL B 1 281 ? 2.629   75.744 117.710 1.00 71.82 ? 315 VAL B CG1 1 
ATOM   3658 C CG2 . VAL B 1 281 ? 1.057   73.965 116.863 1.00 71.12 ? 315 VAL B CG2 1 
ATOM   3659 N N   . ARG B 1 282 ? 4.940   72.206 117.353 1.00 71.90 ? 316 ARG B N   1 
ATOM   3660 C CA  . ARG B 1 282 ? 5.446   70.865 117.668 1.00 72.03 ? 316 ARG B CA  1 
ATOM   3661 C C   . ARG B 1 282 ? 4.356   69.969 118.280 1.00 71.76 ? 316 ARG B C   1 
ATOM   3662 O O   . ARG B 1 282 ? 4.197   68.817 117.872 1.00 71.77 ? 316 ARG B O   1 
ATOM   3663 C CB  . ARG B 1 282 ? 6.667   70.961 118.605 1.00 72.33 ? 316 ARG B CB  1 
ATOM   3664 C CG  . ARG B 1 282 ? 7.764   69.906 118.385 1.00 73.45 ? 316 ARG B CG  1 
ATOM   3665 C CD  . ARG B 1 282 ? 8.713   70.266 117.227 1.00 76.26 ? 316 ARG B CD  1 
ATOM   3666 N NE  . ARG B 1 282 ? 9.791   71.197 117.599 1.00 78.57 ? 316 ARG B NE  1 
ATOM   3667 C CZ  . ARG B 1 282 ? 9.864   72.484 117.238 1.00 79.39 ? 316 ARG B CZ  1 
ATOM   3668 N NH1 . ARG B 1 282 ? 8.916   73.040 116.487 1.00 79.99 ? 316 ARG B NH1 1 
ATOM   3669 N NH2 . ARG B 1 282 ? 10.895  73.226 117.630 1.00 79.33 ? 316 ARG B NH2 1 
ATOM   3670 N N   . ASP B 1 283 ? 3.599   70.514 119.234 1.00 71.52 ? 317 ASP B N   1 
ATOM   3671 C CA  . ASP B 1 283 ? 2.577   69.760 119.974 1.00 71.22 ? 317 ASP B CA  1 
ATOM   3672 C C   . ASP B 1 283 ? 1.262   69.606 119.209 1.00 71.05 ? 317 ASP B C   1 
ATOM   3673 O O   . ASP B 1 283 ? 0.627   70.590 118.833 1.00 71.12 ? 317 ASP B O   1 
ATOM   3674 C CB  . ASP B 1 283 ? 2.325   70.409 121.341 1.00 71.17 ? 317 ASP B CB  1 
ATOM   3675 C CG  . ASP B 1 283 ? 1.361   69.611 122.216 1.00 71.00 ? 317 ASP B CG  1 
ATOM   3676 O OD1 . ASP B 1 283 ? 0.823   68.574 121.776 1.00 70.22 ? 317 ASP B OD1 1 
ATOM   3677 O OD2 . ASP B 1 283 ? 1.138   70.033 123.369 1.00 71.41 ? 317 ASP B OD2 1 
ATOM   3678 N N   . ALA B 1 284 ? 0.857   68.353 119.012 1.00 70.87 ? 318 ALA B N   1 
ATOM   3679 C CA  . ALA B 1 284 ? -0.391  68.007 118.329 1.00 70.73 ? 318 ALA B CA  1 
ATOM   3680 C C   . ALA B 1 284 ? -1.625  68.529 119.053 1.00 70.70 ? 318 ALA B C   1 
ATOM   3681 O O   . ALA B 1 284 ? -2.603  68.921 118.410 1.00 70.54 ? 318 ALA B O   1 
ATOM   3682 C CB  . ALA B 1 284 ? -0.489  66.501 118.150 1.00 70.76 ? 318 ALA B CB  1 
ATOM   3683 N N   . LYS B 1 285 ? -1.565  68.522 120.387 1.00 70.74 ? 319 LYS B N   1 
ATOM   3684 C CA  . LYS B 1 285 ? -2.654  68.989 121.246 1.00 70.77 ? 319 LYS B CA  1 
ATOM   3685 C C   . LYS B 1 285 ? -2.928  70.477 121.034 1.00 70.79 ? 319 LYS B C   1 
ATOM   3686 O O   . LYS B 1 285 ? -4.085  70.901 121.041 1.00 70.83 ? 319 LYS B O   1 
ATOM   3687 C CB  . LYS B 1 285 ? -2.329  68.710 122.717 1.00 70.80 ? 319 LYS B CB  1 
ATOM   3688 C CG  . LYS B 1 285 ? -3.538  68.613 123.647 1.00 71.03 ? 319 LYS B CG  1 
ATOM   3689 C CD  . LYS B 1 285 ? -4.224  67.252 123.559 1.00 71.82 ? 319 LYS B CD  1 
ATOM   3690 C CE  . LYS B 1 285 ? -3.272  66.087 123.881 1.00 72.66 ? 319 LYS B CE  1 
ATOM   3691 N NZ  . LYS B 1 285 ? -2.794  66.072 125.301 1.00 73.29 ? 319 LYS B NZ  1 
ATOM   3692 N N   . GLN B 1 286 ? -1.859  71.255 120.840 1.00 70.79 ? 320 GLN B N   1 
ATOM   3693 C CA  . GLN B 1 286 ? -1.955  72.686 120.519 1.00 70.76 ? 320 GLN B CA  1 
ATOM   3694 C C   . GLN B 1 286 ? -2.566  72.916 119.140 1.00 70.48 ? 320 GLN B C   1 
ATOM   3695 O O   . GLN B 1 286 ? -3.482  73.725 118.989 1.00 70.40 ? 320 GLN B O   1 
ATOM   3696 C CB  . GLN B 1 286 ? -0.571  73.352 120.554 1.00 70.98 ? 320 GLN B CB  1 
ATOM   3697 C CG  . GLN B 1 286 ? 0.183   73.250 121.874 1.00 71.91 ? 320 GLN B CG  1 
ATOM   3698 C CD  . GLN B 1 286 ? -0.531  73.941 123.020 1.00 73.10 ? 320 GLN B CD  1 
ATOM   3699 O OE1 . GLN B 1 286 ? -1.127  73.278 123.873 1.00 73.76 ? 320 GLN B OE1 1 
ATOM   3700 N NE2 . GLN B 1 286 ? -0.485  75.278 123.043 1.00 72.97 ? 320 GLN B NE2 1 
ATOM   3701 N N   . ARG B 1 287 ? -2.042  72.190 118.150 1.00 70.27 ? 321 ARG B N   1 
ATOM   3702 C CA  . ARG B 1 287 ? -2.403  72.344 116.741 1.00 69.88 ? 321 ARG B CA  1 
ATOM   3703 C C   . ARG B 1 287 ? -3.913  72.305 116.507 1.00 69.78 ? 321 ARG B C   1 
ATOM   3704 O O   . ARG B 1 287 ? -4.631  71.537 117.145 1.00 69.64 ? 321 ARG B O   1 
ATOM   3705 C CB  . ARG B 1 287 ? -1.700  71.270 115.906 1.00 69.99 ? 321 ARG B CB  1 
ATOM   3706 C CG  . ARG B 1 287 ? -1.408  71.671 114.459 1.00 69.63 ? 321 ARG B CG  1 
ATOM   3707 C CD  . ARG B 1 287 ? -0.710  70.555 113.674 1.00 69.53 ? 321 ARG B CD  1 
ATOM   3708 N NE  . ARG B 1 287 ? 0.610   70.196 114.211 1.00 69.07 ? 321 ARG B NE  1 
ATOM   3709 C CZ  . ARG B 1 287 ? 1.015   68.952 114.488 1.00 69.11 ? 321 ARG B CZ  1 
ATOM   3710 N NH1 . ARG B 1 287 ? 2.233   68.739 114.973 1.00 68.29 ? 321 ARG B NH1 1 
ATOM   3711 N NH2 . ARG B 1 287 ? 0.217   67.909 114.274 1.00 69.41 ? 321 ARG B NH2 1 
ATOM   3712 N N   . LEU B 1 288 ? -4.372  73.147 115.586 1.00 69.79 ? 322 LEU B N   1 
ATOM   3713 C CA  . LEU B 1 288 ? -5.792  73.315 115.277 1.00 69.94 ? 322 LEU B CA  1 
ATOM   3714 C C   . LEU B 1 288 ? -6.399  72.070 114.657 1.00 70.16 ? 322 LEU B C   1 
ATOM   3715 O O   . LEU B 1 288 ? -5.736  71.375 113.894 1.00 70.22 ? 322 LEU B O   1 
ATOM   3716 C CB  . LEU B 1 288 ? -5.978  74.484 114.307 1.00 69.80 ? 322 LEU B CB  1 
ATOM   3717 C CG  . LEU B 1 288 ? -6.027  75.937 114.788 1.00 69.69 ? 322 LEU B CG  1 
ATOM   3718 C CD1 . LEU B 1 288 ? -5.188  76.210 116.035 1.00 69.71 ? 322 LEU B CD1 1 
ATOM   3719 C CD2 . LEU B 1 288 ? -5.597  76.841 113.646 1.00 69.58 ? 322 LEU B CD2 1 
ATOM   3720 N N   . SER B 1 289 ? -7.658  71.793 114.987 1.00 70.51 ? 323 SER B N   1 
ATOM   3721 C CA  . SER B 1 289 ? -8.392  70.702 114.347 1.00 70.91 ? 323 SER B CA  1 
ATOM   3722 C C   . SER B 1 289 ? -8.896  71.178 112.989 1.00 71.27 ? 323 SER B C   1 
ATOM   3723 O O   . SER B 1 289 ? -8.751  72.356 112.643 1.00 71.23 ? 323 SER B O   1 
ATOM   3724 C CB  . SER B 1 289 ? -9.549  70.207 115.226 1.00 70.86 ? 323 SER B CB  1 
ATOM   3725 O OG  . SER B 1 289 ? -10.659 71.087 115.191 1.00 70.58 ? 323 SER B OG  1 
ATOM   3726 N N   . ALA B 1 290 ? -9.480  70.266 112.217 1.00 71.68 ? 324 ALA B N   1 
ATOM   3727 C CA  . ALA B 1 290 ? -9.962  70.623 110.890 1.00 72.06 ? 324 ALA B CA  1 
ATOM   3728 C C   . ALA B 1 290 ? -11.056 71.683 110.976 1.00 72.28 ? 324 ALA B C   1 
ATOM   3729 O O   . ALA B 1 290 ? -11.007 72.682 110.259 1.00 72.38 ? 324 ALA B O   1 
ATOM   3730 C CB  . ALA B 1 290 ? -10.447 69.403 110.155 1.00 72.10 ? 324 ALA B CB  1 
ATOM   3731 N N   . ALA B 1 291 ? -12.015 71.477 111.878 1.00 72.50 ? 325 ALA B N   1 
ATOM   3732 C CA  . ALA B 1 291 ? -13.139 72.399 112.048 1.00 72.80 ? 325 ALA B CA  1 
ATOM   3733 C C   . ALA B 1 291 ? -12.705 73.798 112.496 1.00 73.09 ? 325 ALA B C   1 
ATOM   3734 O O   . ALA B 1 291 ? -13.399 74.786 112.235 1.00 72.97 ? 325 ALA B O   1 
ATOM   3735 C CB  . ALA B 1 291 ? -14.159 71.819 113.015 1.00 72.67 ? 325 ALA B CB  1 
ATOM   3736 N N   . GLN B 1 292 ? -11.549 73.868 113.154 1.00 73.55 ? 326 GLN B N   1 
ATOM   3737 C CA  . GLN B 1 292 ? -11.018 75.118 113.706 1.00 74.04 ? 326 GLN B CA  1 
ATOM   3738 C C   . GLN B 1 292 ? -10.329 75.971 112.659 1.00 74.07 ? 326 GLN B C   1 
ATOM   3739 O O   . GLN B 1 292 ? -10.358 77.201 112.741 1.00 73.93 ? 326 GLN B O   1 
ATOM   3740 C CB  . GLN B 1 292 ? -10.042 74.822 114.842 1.00 74.18 ? 326 GLN B CB  1 
ATOM   3741 C CG  . GLN B 1 292 ? -10.720 74.340 116.114 1.00 75.37 ? 326 GLN B CG  1 
ATOM   3742 C CD  . GLN B 1 292 ? -9.771  73.620 117.052 1.00 77.15 ? 326 GLN B CD  1 
ATOM   3743 O OE1 . GLN B 1 292 ? -10.102 72.560 117.587 1.00 78.21 ? 326 GLN B OE1 1 
ATOM   3744 N NE2 . GLN B 1 292 ? -8.584  74.190 117.257 1.00 77.85 ? 326 GLN B NE2 1 
ATOM   3745 N N   . VAL B 1 293 ? -9.699  75.303 111.692 1.00 74.37 ? 327 VAL B N   1 
ATOM   3746 C CA  . VAL B 1 293 ? -9.072  75.954 110.539 1.00 74.60 ? 327 VAL B CA  1 
ATOM   3747 C C   . VAL B 1 293 ? -10.138 76.675 109.714 1.00 74.94 ? 327 VAL B C   1 
ATOM   3748 O O   . VAL B 1 293 ? -9.888  77.748 109.155 1.00 74.88 ? 327 VAL B O   1 
ATOM   3749 C CB  . VAL B 1 293 ? -8.303  74.932 109.665 1.00 74.42 ? 327 VAL B CB  1 
ATOM   3750 C CG1 . VAL B 1 293 ? -7.810  75.570 108.379 1.00 74.37 ? 327 VAL B CG1 1 
ATOM   3751 C CG2 . VAL B 1 293 ? -7.135  74.348 110.440 1.00 74.25 ? 327 VAL B CG2 1 
ATOM   3752 N N   . LEU B 1 294 ? -11.328 76.079 109.671 1.00 75.44 ? 328 LEU B N   1 
ATOM   3753 C CA  . LEU B 1 294 ? -12.494 76.671 109.024 1.00 76.01 ? 328 LEU B CA  1 
ATOM   3754 C C   . LEU B 1 294 ? -13.049 77.867 109.802 1.00 76.61 ? 328 LEU B C   1 
ATOM   3755 O O   . LEU B 1 294 ? -13.793 78.682 109.250 1.00 76.77 ? 328 LEU B O   1 
ATOM   3756 C CB  . LEU B 1 294 ? -13.584 75.614 108.824 1.00 75.82 ? 328 LEU B CB  1 
ATOM   3757 C CG  . LEU B 1 294 ? -13.308 74.541 107.764 1.00 75.51 ? 328 LEU B CG  1 
ATOM   3758 C CD1 . LEU B 1 294 ? -14.163 73.306 107.998 1.00 74.82 ? 328 LEU B CD1 1 
ATOM   3759 C CD2 . LEU B 1 294 ? -13.517 75.089 106.355 1.00 75.29 ? 328 LEU B CD2 1 
ATOM   3760 N N   . GLN B 1 295 ? -12.681 77.974 111.077 1.00 77.30 ? 329 GLN B N   1 
ATOM   3761 C CA  . GLN B 1 295 ? -13.163 79.062 111.926 1.00 77.87 ? 329 GLN B CA  1 
ATOM   3762 C C   . GLN B 1 295 ? -12.303 80.315 111.829 1.00 78.00 ? 329 GLN B C   1 
ATOM   3763 O O   . GLN B 1 295 ? -12.820 81.423 111.946 1.00 78.08 ? 329 GLN B O   1 
ATOM   3764 C CB  . GLN B 1 295 ? -13.287 78.613 113.390 1.00 78.14 ? 329 GLN B CB  1 
ATOM   3765 C CG  . GLN B 1 295 ? -14.352 77.538 113.664 1.00 78.93 ? 329 GLN B CG  1 
ATOM   3766 C CD  . GLN B 1 295 ? -15.616 77.710 112.825 1.00 80.17 ? 329 GLN B CD  1 
ATOM   3767 O OE1 . GLN B 1 295 ? -15.876 76.919 111.917 1.00 81.10 ? 329 GLN B OE1 1 
ATOM   3768 N NE2 . GLN B 1 295 ? -16.397 78.750 113.117 1.00 80.22 ? 329 GLN B NE2 1 
ATOM   3769 N N   . HIS B 1 296 ? -11.000 80.125 111.619 1.00 78.31 ? 330 HIS B N   1 
ATOM   3770 C CA  . HIS B 1 296 ? -10.018 81.213 111.522 1.00 78.64 ? 330 HIS B CA  1 
ATOM   3771 C C   . HIS B 1 296 ? -10.485 82.357 110.604 1.00 79.11 ? 330 HIS B C   1 
ATOM   3772 O O   . HIS B 1 296 ? -10.958 82.096 109.493 1.00 78.97 ? 330 HIS B O   1 
ATOM   3773 C CB  . HIS B 1 296 ? -8.678  80.655 111.030 1.00 78.55 ? 330 HIS B CB  1 
ATOM   3774 C CG  . HIS B 1 296 ? -7.495  81.512 111.364 1.00 78.01 ? 330 HIS B CG  1 
ATOM   3775 N ND1 . HIS B 1 296 ? -7.230  82.704 110.722 1.00 77.53 ? 330 HIS B ND1 1 
ATOM   3776 C CD2 . HIS B 1 296 ? -6.490  81.336 112.255 1.00 77.42 ? 330 HIS B CD2 1 
ATOM   3777 C CE1 . HIS B 1 296 ? -6.123  83.231 111.213 1.00 77.26 ? 330 HIS B CE1 1 
ATOM   3778 N NE2 . HIS B 1 296 ? -5.653  82.419 112.143 1.00 77.07 ? 330 HIS B NE2 1 
ATOM   3779 N N   . PRO B 1 297 ? -10.363 83.625 111.077 1.00 79.64 ? 331 PRO B N   1 
ATOM   3780 C CA  . PRO B 1 297 ? -10.784 84.845 110.360 1.00 79.95 ? 331 PRO B CA  1 
ATOM   3781 C C   . PRO B 1 297 ? -10.233 84.964 108.941 1.00 80.32 ? 331 PRO B C   1 
ATOM   3782 O O   . PRO B 1 297 ? -10.806 85.676 108.113 1.00 80.29 ? 331 PRO B O   1 
ATOM   3783 C CB  . PRO B 1 297 ? -10.202 85.970 111.219 1.00 79.92 ? 331 PRO B CB  1 
ATOM   3784 C CG  . PRO B 1 297 ? -10.131 85.403 112.580 1.00 79.79 ? 331 PRO B CG  1 
ATOM   3785 C CD  . PRO B 1 297 ? -9.802  83.953 112.405 1.00 79.68 ? 331 PRO B CD  1 
ATOM   3786 N N   . TRP B 1 298 ? -9.129  84.268 108.680 1.00 80.80 ? 332 TRP B N   1 
ATOM   3787 C CA  . TRP B 1 298 ? -8.455  84.288 107.388 1.00 81.22 ? 332 TRP B CA  1 
ATOM   3788 C C   . TRP B 1 298 ? -9.221  83.494 106.318 1.00 81.42 ? 332 TRP B C   1 
ATOM   3789 O O   . TRP B 1 298 ? -9.020  83.703 105.119 1.00 81.45 ? 332 TRP B O   1 
ATOM   3790 C CB  . TRP B 1 298 ? -7.033  83.746 107.558 1.00 81.38 ? 332 TRP B CB  1 
ATOM   3791 C CG  . TRP B 1 298 ? -6.064  84.204 106.522 1.00 81.58 ? 332 TRP B CG  1 
ATOM   3792 C CD1 . TRP B 1 298 ? -5.579  85.467 106.357 1.00 81.79 ? 332 TRP B CD1 1 
ATOM   3793 C CD2 . TRP B 1 298 ? -5.439  83.398 105.517 1.00 81.93 ? 332 TRP B CD2 1 
ATOM   3794 N NE1 . TRP B 1 298 ? -4.700  85.505 105.301 1.00 81.96 ? 332 TRP B NE1 1 
ATOM   3795 C CE2 . TRP B 1 298 ? -4.593  84.247 104.767 1.00 82.04 ? 332 TRP B CE2 1 
ATOM   3796 C CE3 . TRP B 1 298 ? -5.518  82.040 105.169 1.00 81.91 ? 332 TRP B CE3 1 
ATOM   3797 C CZ2 . TRP B 1 298 ? -3.826  83.785 103.689 1.00 81.92 ? 332 TRP B CZ2 1 
ATOM   3798 C CZ3 . TRP B 1 298 ? -4.755  81.579 104.096 1.00 81.83 ? 332 TRP B CZ3 1 
ATOM   3799 C CH2 . TRP B 1 298 ? -3.922  82.453 103.368 1.00 81.76 ? 332 TRP B CH2 1 
ATOM   3800 N N   . VAL B 1 299 ? -10.101 82.595 106.759 1.00 81.66 ? 333 VAL B N   1 
ATOM   3801 C CA  . VAL B 1 299 ? -10.907 81.765 105.852 1.00 81.85 ? 333 VAL B CA  1 
ATOM   3802 C C   . VAL B 1 299 ? -12.416 82.104 105.902 1.00 82.02 ? 333 VAL B C   1 
ATOM   3803 O O   . VAL B 1 299 ? -13.195 81.630 105.067 1.00 82.00 ? 333 VAL B O   1 
ATOM   3804 C CB  . VAL B 1 299 ? -10.677 80.238 106.110 1.00 81.85 ? 333 VAL B CB  1 
ATOM   3805 C CG1 . VAL B 1 299 ? -9.198  79.937 106.356 1.00 81.74 ? 333 VAL B CG1 1 
ATOM   3806 C CG2 . VAL B 1 299 ? -11.508 79.750 107.274 1.00 81.53 ? 333 VAL B CG2 1 
ATOM   3807 N N   . GLN B 1 300 ? -12.801 82.934 106.877 1.00 82.26 ? 334 GLN B N   1 
ATOM   3808 C CA  . GLN B 1 300 ? -14.204 83.303 107.168 1.00 82.37 ? 334 GLN B CA  1 
ATOM   3809 C C   . GLN B 1 300 ? -15.029 82.137 107.719 1.00 82.34 ? 334 GLN B C   1 
ATOM   3810 O O   . GLN B 1 300 ? -15.199 82.001 108.934 1.00 82.11 ? 334 GLN B O   1 
ATOM   3811 C CB  . GLN B 1 300 ? -14.904 83.943 105.957 1.00 82.34 ? 334 GLN B CB  1 
ATOM   3812 C CG  . GLN B 1 300 ? -14.499 85.388 105.678 1.00 82.79 ? 334 GLN B CG  1 
ATOM   3813 C CD  . GLN B 1 300 ? -13.218 85.508 104.857 1.00 83.61 ? 334 GLN B CD  1 
ATOM   3814 O OE1 . GLN B 1 300 ? -12.128 85.181 105.329 1.00 83.85 ? 334 GLN B OE1 1 
ATOM   3815 N NE2 . GLN B 1 300 ? -13.348 85.996 103.626 1.00 83.67 ? 334 GLN B NE2 1 
HETATM 3816 S S   . SO4 C 2 .   ? 21.246  49.650 51.196  1.00 86.18 ? 342 SO4 A S   1 
HETATM 3817 O O1  . SO4 C 2 .   ? 22.563  49.136 50.559  1.00 86.32 ? 342 SO4 A O1  1 
HETATM 3818 O O2  . SO4 C 2 .   ? 20.295  49.731 50.077  1.00 86.71 ? 342 SO4 A O2  1 
HETATM 3819 O O3  . SO4 C 2 .   ? 20.640  48.628 52.220  1.00 85.72 ? 342 SO4 A O3  1 
HETATM 3820 O O4  . SO4 C 2 .   ? 21.480  51.086 51.858  1.00 85.38 ? 342 SO4 A O4  1 
HETATM 3821 S S   . SO4 D 2 .   ? 0.486   46.773 105.254 1.00 39.85 ? 342 SO4 B S   1 
HETATM 3822 O O1  . SO4 D 2 .   ? 0.465   45.699 104.277 1.00 40.48 ? 342 SO4 B O1  1 
HETATM 3823 O O2  . SO4 D 2 .   ? 0.157   48.040 104.635 1.00 40.71 ? 342 SO4 B O2  1 
HETATM 3824 O O3  . SO4 D 2 .   ? -0.527  46.506 106.266 1.00 39.75 ? 342 SO4 B O3  1 
HETATM 3825 O O4  . SO4 D 2 .   ? 1.835   46.885 105.793 1.00 39.66 ? 342 SO4 B O4  1 
HETATM 3826 O O   . HOH E 3 .   ? 15.297  48.354 72.111  1.00 21.21 ? 343 HOH A O   1 
HETATM 3827 O O   . HOH E 3 .   ? 5.086   35.136 76.996  1.00 40.11 ? 344 HOH A O   1 
HETATM 3828 O O   . HOH E 3 .   ? 19.502  49.725 79.261  1.00 28.28 ? 345 HOH A O   1 
HETATM 3829 O O   . HOH E 3 .   ? 22.140  42.952 81.784  1.00 29.61 ? 346 HOH A O   1 
HETATM 3830 O O   . HOH E 3 .   ? 38.238  61.883 73.248  1.00 45.65 ? 347 HOH A O   1 
HETATM 3831 O O   . HOH E 3 .   ? 12.820  60.050 63.442  1.00 35.31 ? 348 HOH A O   1 
HETATM 3832 O O   . HOH E 3 .   ? 16.988  36.254 82.891  1.00 32.05 ? 349 HOH A O   1 
HETATM 3833 O O   . HOH E 3 .   ? 4.930   53.509 62.998  1.00 32.39 ? 350 HOH A O   1 
HETATM 3834 O O   . HOH E 3 .   ? 7.273   47.923 66.298  1.00 26.68 ? 351 HOH A O   1 
HETATM 3835 O O   . HOH E 3 .   ? 8.437   45.867 64.047  1.00 30.34 ? 352 HOH A O   1 
HETATM 3836 O O   . HOH E 3 .   ? 12.523  48.752 47.913  1.00 25.81 ? 353 HOH A O   1 
HETATM 3837 O O   . HOH E 3 .   ? 8.145   46.024 92.144  1.00 22.71 ? 354 HOH A O   1 
HETATM 3838 O O   . HOH E 3 .   ? 18.634  41.951 70.305  1.00 20.45 ? 355 HOH A O   1 
HETATM 3839 O O   . HOH E 3 .   ? 16.573  46.846 70.730  1.00 33.60 ? 356 HOH A O   1 
HETATM 3840 O O   . HOH E 3 .   ? 7.903   40.877 91.166  1.00 43.29 ? 357 HOH A O   1 
HETATM 3841 O O   . HOH E 3 .   ? -6.351  46.463 79.094  1.00 24.91 ? 358 HOH A O   1 
HETATM 3842 O O   . HOH E 3 .   ? 21.110  31.279 89.994  1.00 33.88 ? 359 HOH A O   1 
HETATM 3843 O O   . HOH E 3 .   ? 7.539   51.505 69.612  1.00 24.50 ? 360 HOH A O   1 
HETATM 3844 O O   . HOH E 3 .   ? 3.256   40.739 87.456  1.00 25.94 ? 361 HOH A O   1 
HETATM 3845 O O   . HOH E 3 .   ? -2.755  38.466 83.119  1.00 21.85 ? 362 HOH A O   1 
HETATM 3846 O O   . HOH E 3 .   ? 22.959  50.803 54.349  1.00 20.88 ? 363 HOH A O   1 
HETATM 3847 O O   . HOH E 3 .   ? 8.000   54.306 62.275  1.00 30.37 ? 364 HOH A O   1 
HETATM 3848 O O   . HOH E 3 .   ? -2.906  45.852 64.022  1.00 29.62 ? 365 HOH A O   1 
HETATM 3849 O O   . HOH E 3 .   ? 13.123  34.802 86.190  1.00 25.63 ? 366 HOH A O   1 
HETATM 3850 O O   . HOH E 3 .   ? 31.459  49.287 65.260  1.00 45.19 ? 367 HOH A O   1 
HETATM 3851 O O   . HOH E 3 .   ? 24.170  41.818 58.172  1.00 49.45 ? 368 HOH A O   1 
HETATM 3852 O O   . HOH E 3 .   ? -3.537  47.043 78.033  1.00 20.20 ? 369 HOH A O   1 
HETATM 3853 O O   . HOH E 3 .   ? 6.700   45.164 60.226  1.00 37.81 ? 370 HOH A O   1 
HETATM 3854 O O   . HOH E 3 .   ? -2.357  44.606 66.577  1.00 28.55 ? 371 HOH A O   1 
HETATM 3855 O O   . HOH E 3 .   ? 7.709   57.933 70.609  1.00 23.71 ? 372 HOH A O   1 
HETATM 3856 O O   . HOH E 3 .   ? 10.065  40.513 61.755  1.00 45.87 ? 373 HOH A O   1 
HETATM 3857 O O   . HOH E 3 .   ? 15.605  56.260 61.225  1.00 44.10 ? 374 HOH A O   1 
HETATM 3858 O O   . HOH E 3 .   ? 10.759  44.644 50.592  1.00 31.58 ? 375 HOH A O   1 
HETATM 3859 O O   . HOH E 3 .   ? 4.669   57.431 69.976  1.00 44.32 ? 376 HOH A O   1 
HETATM 3860 O O   . HOH E 3 .   ? 22.276  38.170 81.010  1.00 47.43 ? 377 HOH A O   1 
HETATM 3861 O O   . HOH E 3 .   ? -0.440  35.742 92.239  1.00 38.10 ? 378 HOH A O   1 
HETATM 3862 O O   . HOH E 3 .   ? -1.650  52.627 76.051  1.00 27.04 ? 379 HOH A O   1 
HETATM 3863 O O   . HOH E 3 .   ? 12.804  35.989 64.736  1.00 42.31 ? 380 HOH A O   1 
HETATM 3864 O O   . HOH E 3 .   ? 31.961  49.430 54.709  1.00 40.97 ? 381 HOH A O   1 
HETATM 3865 O O   . HOH E 3 .   ? -4.036  55.062 67.078  1.00 40.48 ? 382 HOH A O   1 
HETATM 3866 O O   . HOH E 3 .   ? 19.160  34.016 73.374  1.00 35.38 ? 383 HOH A O   1 
HETATM 3867 O O   . HOH E 3 .   ? 3.042   32.605 80.490  1.00 38.87 ? 384 HOH A O   1 
HETATM 3868 O O   . HOH E 3 .   ? 23.940  42.684 71.999  1.00 46.43 ? 385 HOH A O   1 
HETATM 3869 O O   . HOH E 3 .   ? -3.774  44.781 70.045  1.00 59.35 ? 386 HOH A O   1 
HETATM 3870 O O   . HOH E 3 .   ? 13.797  34.852 83.725  1.00 48.29 ? 387 HOH A O   1 
HETATM 3871 O O   . HOH E 3 .   ? 7.599   42.622 60.147  1.00 49.07 ? 388 HOH A O   1 
HETATM 3872 O O   . HOH E 3 .   ? 0.306   58.526 71.809  1.00 51.87 ? 389 HOH A O   1 
HETATM 3873 O O   . HOH E 3 .   ? 19.510  67.926 48.207  1.00 38.16 ? 390 HOH A O   1 
HETATM 3874 O O   . HOH E 3 .   ? 9.555   56.207 56.280  1.00 59.09 ? 391 HOH A O   1 
HETATM 3875 O O   . HOH E 3 .   ? 37.464  67.889 68.415  1.00 48.97 ? 392 HOH A O   1 
HETATM 3876 O O   . HOH E 3 .   ? 21.097  42.731 70.045  1.00 37.01 ? 393 HOH A O   1 
HETATM 3877 O O   . HOH E 3 .   ? -7.591  40.660 82.134  1.00 25.73 ? 394 HOH A O   1 
HETATM 3878 O O   . HOH E 3 .   ? 13.274  69.728 53.663  1.00 61.02 ? 395 HOH A O   1 
HETATM 3879 O O   . HOH E 3 .   ? 36.009  65.114 53.053  1.00 50.33 ? 396 HOH A O   1 
HETATM 3880 O O   . HOH E 3 .   ? 17.551  61.828 63.839  1.00 56.16 ? 397 HOH A O   1 
HETATM 3881 O O   . HOH E 3 .   ? 0.502   34.542 83.632  1.00 30.03 ? 398 HOH A O   1 
HETATM 3882 O O   . HOH E 3 .   ? 20.442  71.278 51.515  1.00 57.37 ? 399 HOH A O   1 
HETATM 3883 O O   . HOH E 3 .   ? 4.668   34.865 74.083  1.00 47.86 ? 400 HOH A O   1 
HETATM 3884 O O   . HOH E 3 .   ? -6.093  51.255 70.252  1.00 46.02 ? 401 HOH A O   1 
HETATM 3885 O O   . HOH E 3 .   ? 35.116  52.167 73.526  1.00 73.53 ? 402 HOH A O   1 
HETATM 3886 O O   . HOH E 3 .   ? 22.973  68.000 51.425  1.00 44.86 ? 403 HOH A O   1 
HETATM 3887 O O   . HOH E 3 .   ? 7.209   43.863 57.764  1.00 46.43 ? 404 HOH A O   1 
HETATM 3888 O O   . HOH E 3 .   ? 28.789  75.746 73.855  1.00 68.33 ? 405 HOH A O   1 
HETATM 3889 O O   . HOH E 3 .   ? 2.064   38.489 84.881  1.00 33.73 ? 406 HOH A O   1 
HETATM 3890 O O   . HOH E 3 .   ? 19.082  35.419 61.519  1.00 52.07 ? 407 HOH A O   1 
HETATM 3891 O O   . HOH E 3 .   ? 2.875   50.741 79.869  1.00 48.46 ? 408 HOH A O   1 
HETATM 3892 O O   . HOH E 3 .   ? 8.024   58.476 73.108  1.00 67.16 ? 409 HOH A O   1 
HETATM 3893 O O   . HOH E 3 .   ? 3.196   60.038 76.559  1.00 53.54 ? 410 HOH A O   1 
HETATM 3894 O O   . HOH E 3 .   ? 9.386   34.445 78.889  1.00 57.64 ? 411 HOH A O   1 
HETATM 3895 O O   . HOH E 3 .   ? 7.482   34.517 75.363  1.00 40.48 ? 412 HOH A O   1 
HETATM 3896 O O   . HOH E 3 .   ? 18.706  51.811 43.745  1.00 38.58 ? 413 HOH A O   1 
HETATM 3897 O O   . HOH E 3 .   ? 3.845   32.067 88.018  1.00 43.72 ? 414 HOH A O   1 
HETATM 3898 O O   . HOH E 3 .   ? 12.283  61.988 55.426  1.00 54.85 ? 415 HOH A O   1 
HETATM 3899 O O   . HOH E 3 .   ? 9.357   44.179 62.179  1.00 55.31 ? 416 HOH A O   1 
HETATM 3900 O O   . HOH F 3 .   ? 1.766   51.066 86.796  1.00 27.93 ? 343 HOH B O   1 
HETATM 3901 O O   . HOH F 3 .   ? -18.146 54.595 84.172  1.00 48.55 ? 344 HOH B O   1 
HETATM 3902 O O   . HOH F 3 .   ? -8.218  66.835 114.826 1.00 27.40 ? 345 HOH B O   1 
HETATM 3903 O O   . HOH F 3 .   ? -9.736  65.058 115.130 1.00 20.12 ? 346 HOH B O   1 
HETATM 3904 O O   . HOH F 3 .   ? -7.658  43.575 82.014  1.00 17.27 ? 347 HOH B O   1 
HETATM 3905 O O   . HOH F 3 .   ? -5.313  52.733 102.796 1.00 25.54 ? 348 HOH B O   1 
HETATM 3906 O O   . HOH F 3 .   ? 2.158   43.853 88.391  1.00 25.76 ? 349 HOH B O   1 
HETATM 3907 O O   . HOH F 3 .   ? -2.761  41.001 83.551  1.00 36.94 ? 350 HOH B O   1 
HETATM 3908 O O   . HOH F 3 .   ? -0.086  55.636 96.987  1.00 30.08 ? 351 HOH B O   1 
HETATM 3909 O O   . HOH F 3 .   ? 6.342   47.831 91.043  1.00 34.51 ? 352 HOH B O   1 
HETATM 3910 O O   . HOH F 3 .   ? 4.166   52.830 86.409  1.00 20.76 ? 353 HOH B O   1 
HETATM 3911 O O   . HOH F 3 .   ? -5.351  39.725 83.668  1.00 18.97 ? 354 HOH B O   1 
HETATM 3912 O O   . HOH F 3 .   ? 5.418   59.182 95.661  1.00 31.00 ? 355 HOH B O   1 
HETATM 3913 O O   . HOH F 3 .   ? -0.242  37.294 84.511  1.00 14.21 ? 356 HOH B O   1 
HETATM 3914 O O   . HOH F 3 .   ? 2.733   53.534 80.281  1.00 41.42 ? 357 HOH B O   1 
HETATM 3915 O O   . HOH F 3 .   ? -7.714  60.177 94.777  1.00 39.15 ? 358 HOH B O   1 
HETATM 3916 O O   . HOH F 3 .   ? -3.444  39.186 91.144  1.00 27.13 ? 359 HOH B O   1 
HETATM 3917 O O   . HOH F 3 .   ? -6.645  43.704 78.274  1.00 37.45 ? 360 HOH B O   1 
HETATM 3918 O O   . HOH F 3 .   ? -0.839  64.406 105.647 1.00 43.24 ? 361 HOH B O   1 
HETATM 3919 O O   . HOH F 3 .   ? -10.678 66.703 81.079  1.00 55.75 ? 362 HOH B O   1 
HETATM 3920 O O   . HOH F 3 .   ? -14.869 62.107 84.621  1.00 47.49 ? 363 HOH B O   1 
HETATM 3921 O O   . HOH F 3 .   ? 0.900   39.296 88.539  1.00 47.01 ? 364 HOH B O   1 
HETATM 3922 O O   . HOH F 3 .   ? -9.537  49.490 75.409  1.00 29.07 ? 365 HOH B O   1 
HETATM 3923 O O   . HOH F 3 .   ? -8.189  64.508 87.274  1.00 32.39 ? 366 HOH B O   1 
HETATM 3924 O O   . HOH F 3 .   ? -2.094  54.201 95.811  1.00 44.89 ? 367 HOH B O   1 
HETATM 3925 O O   . HOH F 3 .   ? -11.985 63.843 114.749 1.00 36.97 ? 368 HOH B O   1 
HETATM 3926 O O   . HOH F 3 .   ? -16.045 43.202 79.158  1.00 40.54 ? 369 HOH B O   1 
HETATM 3927 O O   . HOH F 3 .   ? -18.941 59.973 85.523  1.00 48.69 ? 370 HOH B O   1 
HETATM 3928 O O   . HOH F 3 .   ? 1.502   42.909 96.633  1.00 39.00 ? 371 HOH B O   1 
HETATM 3929 O O   . HOH F 3 .   ? 0.136   86.882 112.924 1.00 78.96 ? 372 HOH B O   1 
HETATM 3930 O O   . HOH F 3 .   ? -3.889  53.686 112.762 1.00 43.52 ? 373 HOH B O   1 
HETATM 3931 O O   . HOH F 3 .   ? -5.605  62.669 73.717  1.00 52.78 ? 374 HOH B O   1 
HETATM 3932 O O   . HOH F 3 .   ? -12.147 43.899 92.573  1.00 49.53 ? 375 HOH B O   1 
HETATM 3933 O O   . HOH F 3 .   ? -7.142  38.907 89.793  1.00 42.00 ? 376 HOH B O   1 
HETATM 3934 O O   . HOH F 3 .   ? 0.036   43.442 100.323 1.00 37.98 ? 377 HOH B O   1 
HETATM 3935 O O   . HOH F 3 .   ? 6.564   60.255 90.256  1.00 36.00 ? 378 HOH B O   1 
HETATM 3936 O O   . HOH F 3 .   ? 4.116   42.108 96.664  1.00 28.74 ? 379 HOH B O   1 
HETATM 3937 O O   . HOH F 3 .   ? -3.301  52.724 101.103 1.00 46.45 ? 380 HOH B O   1 
HETATM 3938 O O   . HOH F 3 .   ? -10.551 40.699 86.590  1.00 50.78 ? 381 HOH B O   1 
HETATM 3939 O O   . HOH F 3 .   ? -17.816 40.548 79.211  1.00 48.31 ? 382 HOH B O   1 
HETATM 3940 O O   . HOH F 3 .   ? -16.644 49.736 91.379  1.00 38.74 ? 383 HOH B O   1 
HETATM 3941 O O   . HOH F 3 .   ? -5.643  58.130 118.942 1.00 55.48 ? 384 HOH B O   1 
HETATM 3942 O O   . HOH F 3 .   ? -17.751 62.582 107.943 1.00 58.53 ? 385 HOH B O   1 
HETATM 3943 O O   . HOH F 3 .   ? 1.875   62.699 91.524  1.00 49.71 ? 386 HOH B O   1 
HETATM 3944 O O   . HOH F 3 .   ? 3.633   63.064 93.992  1.00 64.37 ? 387 HOH B O   1 
HETATM 3945 O O   . HOH F 3 .   ? 1.712   49.942 83.191  1.00 42.77 ? 388 HOH B O   1 
HETATM 3946 O O   . HOH F 3 .   ? -14.692 40.905 78.912  1.00 61.11 ? 389 HOH B O   1 
HETATM 3947 O O   . HOH F 3 .   ? 2.064   57.568 104.036 1.00 31.65 ? 390 HOH B O   1 
HETATM 3948 O O   . HOH F 3 .   ? 1.562   39.125 97.868  1.00 38.14 ? 391 HOH B O   1 
HETATM 3949 O O   . HOH F 3 .   ? 10.463  73.834 114.367 1.00 68.04 ? 392 HOH B O   1 
HETATM 3950 O O   . HOH F 3 .   ? 3.520   54.938 103.246 1.00 48.12 ? 393 HOH B O   1 
HETATM 3951 O O   . HOH F 3 .   ? 1.972   60.457 109.453 1.00 58.53 ? 394 HOH B O   1 
HETATM 3952 O O   . HOH F 3 .   ? 9.098   53.911 94.454  1.00 56.67 ? 395 HOH B O   1 
HETATM 3953 O O   . HOH F 3 .   ? -7.480  52.350 104.788 1.00 42.32 ? 396 HOH B O   1 
HETATM 3954 O O   . HOH F 3 .   ? -7.573  46.749 108.330 1.00 44.99 ? 397 HOH B O   1 
HETATM 3955 O O   . HOH F 3 .   ? -0.514  61.836 108.936 1.00 61.07 ? 398 HOH B O   1 
HETATM 3956 O O   . HOH F 3 .   ? -7.441  37.946 74.423  1.00 53.12 ? 399 HOH B O   1 
HETATM 3957 O O   . HOH F 3 .   ? -7.832  54.278 116.044 1.00 35.28 ? 400 HOH B O   1 
HETATM 3958 O O   . HOH F 3 .   ? -2.836  44.595 84.248  1.00 34.72 ? 401 HOH B O   1 
HETATM 3959 O O   . HOH F 3 .   ? -16.061 40.930 85.405  1.00 59.20 ? 402 HOH B O   1 
HETATM 3960 O O   . HOH F 3 .   ? -5.352  51.422 106.296 1.00 54.70 ? 403 HOH B O   1 
HETATM 3961 O O   . HOH F 3 .   ? -13.117 58.299 114.620 1.00 33.91 ? 404 HOH B O   1 
HETATM 3962 O O   . HOH F 3 .   ? -5.844  44.440 103.645 1.00 45.37 ? 405 HOH B O   1 
HETATM 3963 O O   . HOH F 3 .   ? -6.018  42.096 102.100 1.00 43.62 ? 406 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   35  ?   ?   ?   A . n 
A 1 2   SER 2   36  ?   ?   ?   A . n 
A 1 3   THR 3   37  ?   ?   ?   A . n 
A 1 4   ASP 4   38  ?   ?   ?   A . n 
A 1 5   SER 5   39  39  SER SER A . n 
A 1 6   LEU 6   40  40  LEU LEU A . n 
A 1 7   PRO 7   41  41  PRO PRO A . n 
A 1 8   GLY 8   42  42  GLY GLY A . n 
A 1 9   LYS 9   43  43  LYS LYS A . n 
A 1 10  PHE 10  44  44  PHE PHE A . n 
A 1 11  GLU 11  45  45  GLU GLU A . n 
A 1 12  ASP 12  46  46  ASP ASP A . n 
A 1 13  MET 13  47  47  MET MET A . n 
A 1 14  TYR 14  48  48  TYR TYR A . n 
A 1 15  LYS 15  49  49  LYS LYS A . n 
A 1 16  LEU 16  50  50  LEU LEU A . n 
A 1 17  THR 17  51  51  THR THR A . n 
A 1 18  SER 18  52  52  SER SER A . n 
A 1 19  GLU 19  53  53  GLU GLU A . n 
A 1 20  LEU 20  54  54  LEU LEU A . n 
A 1 21  LEU 21  55  55  LEU LEU A . n 
A 1 22  GLY 22  56  56  GLY GLY A . n 
A 1 23  GLU 23  57  57  GLU GLU A . n 
A 1 24  GLY 24  58  58  GLY GLY A . n 
A 1 25  ALA 25  59  59  ALA ALA A . n 
A 1 26  TYR 26  60  60  TYR TYR A . n 
A 1 27  ALA 27  61  61  ALA ALA A . n 
A 1 28  LYS 28  62  62  LYS LYS A . n 
A 1 29  VAL 29  63  63  VAL VAL A . n 
A 1 30  GLN 30  64  64  GLN GLN A . n 
A 1 31  GLY 31  65  65  GLY GLY A . n 
A 1 32  ALA 32  66  66  ALA ALA A . n 
A 1 33  VAL 33  67  67  VAL VAL A . n 
A 1 34  SER 34  68  68  SER SER A . n 
A 1 35  LEU 35  69  69  LEU LEU A . n 
A 1 36  GLN 36  70  70  GLN GLN A . n 
A 1 37  ASN 37  71  71  ASN ASN A . n 
A 1 38  GLY 38  72  72  GLY GLY A . n 
A 1 39  LYS 39  73  73  LYS LYS A . n 
A 1 40  GLU 40  74  74  GLU GLU A . n 
A 1 41  TYR 41  75  75  TYR TYR A . n 
A 1 42  ALA 42  76  76  ALA ALA A . n 
A 1 43  VAL 43  77  77  VAL VAL A . n 
A 1 44  LYS 44  78  78  LYS LYS A . n 
A 1 45  ILE 45  79  79  ILE ILE A . n 
A 1 46  ILE 46  80  80  ILE ILE A . n 
A 1 47  GLU 47  81  81  GLU GLU A . n 
A 1 48  LYS 48  82  82  LYS LYS A . n 
A 1 49  GLN 49  83  83  GLN GLN A . n 
A 1 50  ALA 50  84  84  ALA ALA A . n 
A 1 51  GLY 51  85  85  GLY GLY A . n 
A 1 52  HIS 52  86  86  HIS HIS A . n 
A 1 53  SER 53  87  87  SER SER A . n 
A 1 54  ARG 54  88  88  ARG ARG A . n 
A 1 55  SER 55  89  89  SER SER A . n 
A 1 56  ARG 56  90  90  ARG ARG A . n 
A 1 57  VAL 57  91  91  VAL VAL A . n 
A 1 58  PHE 58  92  92  PHE PHE A . n 
A 1 59  ARG 59  93  93  ARG ARG A . n 
A 1 60  GLU 60  94  94  GLU GLU A . n 
A 1 61  VAL 61  95  95  VAL VAL A . n 
A 1 62  GLU 62  96  96  GLU GLU A . n 
A 1 63  THR 63  97  97  THR THR A . n 
A 1 64  LEU 64  98  98  LEU LEU A . n 
A 1 65  TYR 65  99  99  TYR TYR A . n 
A 1 66  GLN 66  100 100 GLN GLN A . n 
A 1 67  CYS 67  101 101 CYS CYS A . n 
A 1 68  GLN 68  102 102 GLN GLN A . n 
A 1 69  GLY 69  103 103 GLY GLY A . n 
A 1 70  ASN 70  104 104 ASN ASN A . n 
A 1 71  LYS 71  105 105 LYS LYS A . n 
A 1 72  ASN 72  106 106 ASN ASN A . n 
A 1 73  ILE 73  107 107 ILE ILE A . n 
A 1 74  LEU 74  108 108 LEU LEU A . n 
A 1 75  GLU 75  109 109 GLU GLU A . n 
A 1 76  LEU 76  110 110 LEU LEU A . n 
A 1 77  ILE 77  111 111 ILE ILE A . n 
A 1 78  GLU 78  112 112 GLU GLU A . n 
A 1 79  PHE 79  113 113 PHE PHE A . n 
A 1 80  PHE 80  114 114 PHE PHE A . n 
A 1 81  GLU 81  115 115 GLU GLU A . n 
A 1 82  ASP 82  116 116 ASP ASP A . n 
A 1 83  ASP 83  117 117 ASP ASP A . n 
A 1 84  THR 84  118 118 THR THR A . n 
A 1 85  ARG 85  119 119 ARG ARG A . n 
A 1 86  PHE 86  120 120 PHE PHE A . n 
A 1 87  TYR 87  121 121 TYR TYR A . n 
A 1 88  LEU 88  122 122 LEU LEU A . n 
A 1 89  VAL 89  123 123 VAL VAL A . n 
A 1 90  PHE 90  124 124 PHE PHE A . n 
A 1 91  GLU 91  125 125 GLU GLU A . n 
A 1 92  LYS 92  126 126 LYS LYS A . n 
A 1 93  LEU 93  127 127 LEU LEU A . n 
A 1 94  GLN 94  128 128 GLN GLN A . n 
A 1 95  GLY 95  129 129 GLY GLY A . n 
A 1 96  GLY 96  130 130 GLY GLY A . n 
A 1 97  SER 97  131 131 SER SER A . n 
A 1 98  ILE 98  132 132 ILE ILE A . n 
A 1 99  LEU 99  133 133 LEU LEU A . n 
A 1 100 ALA 100 134 134 ALA ALA A . n 
A 1 101 HIS 101 135 135 HIS HIS A . n 
A 1 102 ILE 102 136 136 ILE ILE A . n 
A 1 103 GLN 103 137 137 GLN GLN A . n 
A 1 104 LYS 104 138 138 LYS LYS A . n 
A 1 105 GLN 105 139 139 GLN GLN A . n 
A 1 106 LYS 106 140 140 LYS LYS A . n 
A 1 107 HIS 107 141 141 HIS HIS A . n 
A 1 108 PHE 108 142 142 PHE PHE A . n 
A 1 109 ASN 109 143 143 ASN ASN A . n 
A 1 110 GLU 110 144 144 GLU GLU A . n 
A 1 111 ARG 111 145 145 ARG ARG A . n 
A 1 112 GLU 112 146 146 GLU GLU A . n 
A 1 113 ALA 113 147 147 ALA ALA A . n 
A 1 114 SER 114 148 148 SER SER A . n 
A 1 115 ARG 115 149 149 ARG ARG A . n 
A 1 116 VAL 116 150 150 VAL VAL A . n 
A 1 117 VAL 117 151 151 VAL VAL A . n 
A 1 118 ARG 118 152 152 ARG ARG A . n 
A 1 119 ASP 119 153 153 ASP ASP A . n 
A 1 120 VAL 120 154 154 VAL VAL A . n 
A 1 121 ALA 121 155 155 ALA ALA A . n 
A 1 122 ALA 122 156 156 ALA ALA A . n 
A 1 123 ALA 123 157 157 ALA ALA A . n 
A 1 124 LEU 124 158 158 LEU LEU A . n 
A 1 125 ASP 125 159 159 ASP ASP A . n 
A 1 126 PHE 126 160 160 PHE PHE A . n 
A 1 127 LEU 127 161 161 LEU LEU A . n 
A 1 128 HIS 128 162 162 HIS HIS A . n 
A 1 129 THR 129 163 163 THR THR A . n 
A 1 130 LYS 130 164 164 LYS LYS A . n 
A 1 131 GLY 131 165 165 GLY GLY A . n 
A 1 132 ILE 132 166 166 ILE ILE A . n 
A 1 133 ALA 133 167 167 ALA ALA A . n 
A 1 134 HIS 134 168 168 HIS HIS A . n 
A 1 135 ARG 135 169 169 ARG ARG A . n 
A 1 136 ASP 136 170 170 ASP ASP A . n 
A 1 137 LEU 137 171 171 LEU LEU A . n 
A 1 138 LYS 138 172 172 LYS LYS A . n 
A 1 139 PRO 139 173 173 PRO PRO A . n 
A 1 140 GLU 140 174 174 GLU GLU A . n 
A 1 141 ASN 141 175 175 ASN ASN A . n 
A 1 142 ILE 142 176 176 ILE ILE A . n 
A 1 143 LEU 143 177 177 LEU LEU A . n 
A 1 144 CYS 144 178 178 CYS CYS A . n 
A 1 145 GLU 145 179 179 GLU GLU A . n 
A 1 146 SER 146 180 180 SER SER A . n 
A 1 147 PRO 147 181 181 PRO PRO A . n 
A 1 148 GLU 148 182 182 GLU GLU A . n 
A 1 149 LYS 149 183 183 LYS LYS A . n 
A 1 150 VAL 150 184 184 VAL VAL A . n 
A 1 151 SER 151 185 185 SER SER A . n 
A 1 152 PRO 152 186 186 PRO PRO A . n 
A 1 153 VAL 153 187 187 VAL VAL A . n 
A 1 154 LYS 154 188 188 LYS LYS A . n 
A 1 155 ILE 155 189 189 ILE ILE A . n 
A 1 156 CYS 156 190 190 CYS CYS A . n 
A 1 157 ASP 157 191 191 ASP ASP A . n 
A 1 158 PHE 158 192 192 PHE PHE A . n 
A 1 159 ASP 159 193 193 ASP ASP A . n 
A 1 160 LEU 160 194 194 LEU LEU A . n 
A 1 161 GLY 161 195 195 GLY GLY A . n 
A 1 162 SER 162 196 196 SER SER A . n 
A 1 163 GLY 163 197 ?   ?   ?   A . n 
A 1 164 MET 164 198 ?   ?   ?   A . n 
A 1 165 LYS 165 199 ?   ?   ?   A . n 
A 1 166 LEU 166 200 ?   ?   ?   A . n 
A 1 167 ASN 167 201 ?   ?   ?   A . n 
A 1 168 ASN 168 202 ?   ?   ?   A . n 
A 1 169 SER 169 203 ?   ?   ?   A . n 
A 1 170 CYS 170 204 ?   ?   ?   A . n 
A 1 171 THR 171 205 ?   ?   ?   A . n 
A 1 172 PRO 172 206 ?   ?   ?   A . n 
A 1 173 ILE 173 207 ?   ?   ?   A . n 
A 1 174 THR 174 208 ?   ?   ?   A . n 
A 1 175 THR 175 209 ?   ?   ?   A . n 
A 1 176 PRO 176 210 ?   ?   ?   A . n 
A 1 177 GLU 177 211 ?   ?   ?   A . n 
A 1 178 LEU 178 212 ?   ?   ?   A . n 
A 1 179 THR 179 213 ?   ?   ?   A . n 
A 1 180 THR 180 214 ?   ?   ?   A . n 
A 1 181 PRO 181 215 ?   ?   ?   A . n 
A 1 182 CYS 182 216 ?   ?   ?   A . n 
A 1 183 GLY 183 217 ?   ?   ?   A . n 
A 1 184 SER 184 218 ?   ?   ?   A . n 
A 1 185 ALA 185 219 ?   ?   ?   A . n 
A 1 186 GLU 186 220 ?   ?   ?   A . n 
A 1 187 TYR 187 221 ?   ?   ?   A . n 
A 1 188 MET 188 222 ?   ?   ?   A . n 
A 1 189 ALA 189 223 223 ALA ALA A . n 
A 1 190 PRO 190 224 224 PRO PRO A . n 
A 1 191 GLU 191 225 225 GLU GLU A . n 
A 1 192 VAL 192 226 226 VAL VAL A . n 
A 1 193 VAL 193 227 227 VAL VAL A . n 
A 1 194 GLU 194 228 228 GLU GLU A . n 
A 1 195 VAL 195 229 229 VAL VAL A . n 
A 1 196 PHE 196 230 230 PHE PHE A . n 
A 1 197 THR 197 231 231 THR THR A . n 
A 1 198 ASP 198 232 232 ASP ASP A . n 
A 1 199 GLN 199 233 233 GLN GLN A . n 
A 1 200 ALA 200 234 234 ALA ALA A . n 
A 1 201 THR 201 235 235 THR THR A . n 
A 1 202 PHE 202 236 236 PHE PHE A . n 
A 1 203 TYR 203 237 237 TYR TYR A . n 
A 1 204 ASP 204 238 238 ASP ASP A . n 
A 1 205 LYS 205 239 239 LYS LYS A . n 
A 1 206 ARG 206 240 240 ARG ARG A . n 
A 1 207 CYS 207 241 241 CYS CYS A . n 
A 1 208 ASP 208 242 242 ASP ASP A . n 
A 1 209 LEU 209 243 243 LEU LEU A . n 
A 1 210 TRP 210 244 244 TRP TRP A . n 
A 1 211 SER 211 245 245 SER SER A . n 
A 1 212 LEU 212 246 246 LEU LEU A . n 
A 1 213 GLY 213 247 247 GLY GLY A . n 
A 1 214 VAL 214 248 248 VAL VAL A . n 
A 1 215 VAL 215 249 249 VAL VAL A . n 
A 1 216 LEU 216 250 250 LEU LEU A . n 
A 1 217 TYR 217 251 251 TYR TYR A . n 
A 1 218 ILE 218 252 252 ILE ILE A . n 
A 1 219 MET 219 253 253 MET MET A . n 
A 1 220 LEU 220 254 254 LEU LEU A . n 
A 1 221 SER 221 255 255 SER SER A . n 
A 1 222 GLY 222 256 256 GLY GLY A . n 
A 1 223 TYR 223 257 257 TYR TYR A . n 
A 1 224 PRO 224 258 258 PRO PRO A . n 
A 1 225 PRO 225 259 259 PRO PRO A . n 
A 1 226 PHE 226 260 260 PHE PHE A . n 
A 1 227 VAL 227 261 ?   ?   ?   A . n 
A 1 228 GLY 228 262 ?   ?   ?   A . n 
A 1 229 HIS 229 263 ?   ?   ?   A . n 
A 1 230 CYS 230 264 ?   ?   ?   A . n 
A 1 231 GLY 231 265 ?   ?   ?   A . n 
A 1 232 ALA 232 266 ?   ?   ?   A . n 
A 1 233 ASP 233 267 ?   ?   ?   A . n 
A 1 234 CYS 234 268 ?   ?   ?   A . n 
A 1 235 GLY 235 269 ?   ?   ?   A . n 
A 1 236 TRP 236 270 ?   ?   ?   A . n 
A 1 237 ASP 237 271 ?   ?   ?   A . n 
A 1 238 ARG 238 272 ?   ?   ?   A . n 
A 1 239 GLY 239 273 ?   ?   ?   A . n 
A 1 240 GLU 240 274 ?   ?   ?   A . n 
A 1 241 VAL 241 275 ?   ?   ?   A . n 
A 1 242 CYS 242 276 ?   ?   ?   A . n 
A 1 243 ARG 243 277 ?   ?   ?   A . n 
A 1 244 VAL 244 278 ?   ?   ?   A . n 
A 1 245 CYS 245 279 ?   ?   ?   A . n 
A 1 246 GLN 246 280 ?   ?   ?   A . n 
A 1 247 ASN 247 281 ?   ?   ?   A . n 
A 1 248 LYS 248 282 ?   ?   ?   A . n 
A 1 249 LEU 249 283 ?   ?   ?   A . n 
A 1 250 PHE 250 284 ?   ?   ?   A . n 
A 1 251 GLU 251 285 ?   ?   ?   A . n 
A 1 252 SER 252 286 ?   ?   ?   A . n 
A 1 253 ILE 253 287 ?   ?   ?   A . n 
A 1 254 GLN 254 288 ?   ?   ?   A . n 
A 1 255 GLU 255 289 ?   ?   ?   A . n 
A 1 256 GLY 256 290 290 GLY GLY A . n 
A 1 257 LYS 257 291 291 LYS LYS A . n 
A 1 258 TYR 258 292 292 TYR TYR A . n 
A 1 259 GLU 259 293 293 GLU GLU A . n 
A 1 260 PHE 260 294 294 PHE PHE A . n 
A 1 261 PRO 261 295 295 PRO PRO A . n 
A 1 262 ASP 262 296 296 ASP ASP A . n 
A 1 263 LYS 263 297 297 LYS LYS A . n 
A 1 264 ASP 264 298 298 ASP ASP A . n 
A 1 265 TRP 265 299 299 TRP TRP A . n 
A 1 266 ALA 266 300 300 ALA ALA A . n 
A 1 267 HIS 267 301 301 HIS HIS A . n 
A 1 268 ILE 268 302 302 ILE ILE A . n 
A 1 269 SER 269 303 303 SER SER A . n 
A 1 270 SER 270 304 304 SER SER A . n 
A 1 271 GLU 271 305 305 GLU GLU A . n 
A 1 272 ALA 272 306 306 ALA ALA A . n 
A 1 273 LYS 273 307 307 LYS LYS A . n 
A 1 274 ASP 274 308 308 ASP ASP A . n 
A 1 275 LEU 275 309 309 LEU LEU A . n 
A 1 276 ILE 276 310 310 ILE ILE A . n 
A 1 277 SER 277 311 311 SER SER A . n 
A 1 278 LYS 278 312 312 LYS LYS A . n 
A 1 279 LEU 279 313 313 LEU LEU A . n 
A 1 280 LEU 280 314 314 LEU LEU A . n 
A 1 281 VAL 281 315 315 VAL VAL A . n 
A 1 282 ARG 282 316 316 ARG ARG A . n 
A 1 283 ASP 283 317 317 ASP ASP A . n 
A 1 284 ALA 284 318 318 ALA ALA A . n 
A 1 285 LYS 285 319 319 LYS LYS A . n 
A 1 286 GLN 286 320 320 GLN GLN A . n 
A 1 287 ARG 287 321 321 ARG ARG A . n 
A 1 288 LEU 288 322 322 LEU LEU A . n 
A 1 289 SER 289 323 323 SER SER A . n 
A 1 290 ALA 290 324 324 ALA ALA A . n 
A 1 291 ALA 291 325 325 ALA ALA A . n 
A 1 292 GLN 292 326 326 GLN GLN A . n 
A 1 293 VAL 293 327 327 VAL VAL A . n 
A 1 294 LEU 294 328 328 LEU LEU A . n 
A 1 295 GLN 295 329 329 GLN GLN A . n 
A 1 296 HIS 296 330 330 HIS HIS A . n 
A 1 297 PRO 297 331 331 PRO PRO A . n 
A 1 298 TRP 298 332 332 TRP TRP A . n 
A 1 299 VAL 299 333 333 VAL VAL A . n 
A 1 300 GLN 300 334 334 GLN GLN A . n 
A 1 301 GLY 301 335 335 GLY GLY A . n 
A 1 302 GLN 302 336 ?   ?   ?   A . n 
A 1 303 ALA 303 337 ?   ?   ?   A . n 
A 1 304 PRO 304 338 ?   ?   ?   A . n 
A 1 305 GLU 305 339 ?   ?   ?   A . n 
A 1 306 LYS 306 340 ?   ?   ?   A . n 
A 1 307 GLY 307 341 ?   ?   ?   A . n 
B 1 1   GLY 1   35  ?   ?   ?   B . n 
B 1 2   SER 2   36  ?   ?   ?   B . n 
B 1 3   THR 3   37  ?   ?   ?   B . n 
B 1 4   ASP 4   38  ?   ?   ?   B . n 
B 1 5   SER 5   39  ?   ?   ?   B . n 
B 1 6   LEU 6   40  40  LEU LEU B . n 
B 1 7   PRO 7   41  41  PRO PRO B . n 
B 1 8   GLY 8   42  42  GLY GLY B . n 
B 1 9   LYS 9   43  43  LYS LYS B . n 
B 1 10  PHE 10  44  44  PHE PHE B . n 
B 1 11  GLU 11  45  45  GLU GLU B . n 
B 1 12  ASP 12  46  46  ASP ASP B . n 
B 1 13  MET 13  47  47  MET MET B . n 
B 1 14  TYR 14  48  48  TYR TYR B . n 
B 1 15  LYS 15  49  49  LYS LYS B . n 
B 1 16  LEU 16  50  50  LEU LEU B . n 
B 1 17  THR 17  51  51  THR THR B . n 
B 1 18  SER 18  52  52  SER SER B . n 
B 1 19  GLU 19  53  53  GLU GLU B . n 
B 1 20  LEU 20  54  54  LEU LEU B . n 
B 1 21  LEU 21  55  55  LEU LEU B . n 
B 1 22  GLY 22  56  56  GLY GLY B . n 
B 1 23  GLU 23  57  57  GLU GLU B . n 
B 1 24  GLY 24  58  58  GLY GLY B . n 
B 1 25  ALA 25  59  59  ALA ALA B . n 
B 1 26  TYR 26  60  60  TYR TYR B . n 
B 1 27  ALA 27  61  61  ALA ALA B . n 
B 1 28  LYS 28  62  62  LYS LYS B . n 
B 1 29  VAL 29  63  63  VAL VAL B . n 
B 1 30  GLN 30  64  64  GLN GLN B . n 
B 1 31  GLY 31  65  65  GLY GLY B . n 
B 1 32  ALA 32  66  66  ALA ALA B . n 
B 1 33  VAL 33  67  67  VAL VAL B . n 
B 1 34  SER 34  68  68  SER SER B . n 
B 1 35  LEU 35  69  69  LEU LEU B . n 
B 1 36  GLN 36  70  70  GLN GLN B . n 
B 1 37  ASN 37  71  71  ASN ASN B . n 
B 1 38  GLY 38  72  72  GLY GLY B . n 
B 1 39  LYS 39  73  73  LYS LYS B . n 
B 1 40  GLU 40  74  74  GLU GLU B . n 
B 1 41  TYR 41  75  75  TYR TYR B . n 
B 1 42  ALA 42  76  76  ALA ALA B . n 
B 1 43  VAL 43  77  77  VAL VAL B . n 
B 1 44  LYS 44  78  78  LYS LYS B . n 
B 1 45  ILE 45  79  79  ILE ILE B . n 
B 1 46  ILE 46  80  80  ILE ILE B . n 
B 1 47  GLU 47  81  81  GLU GLU B . n 
B 1 48  LYS 48  82  82  LYS LYS B . n 
B 1 49  GLN 49  83  83  GLN GLN B . n 
B 1 50  ALA 50  84  84  ALA ALA B . n 
B 1 51  GLY 51  85  85  GLY GLY B . n 
B 1 52  HIS 52  86  86  HIS HIS B . n 
B 1 53  SER 53  87  87  SER SER B . n 
B 1 54  ARG 54  88  88  ARG ARG B . n 
B 1 55  SER 55  89  89  SER SER B . n 
B 1 56  ARG 56  90  90  ARG ARG B . n 
B 1 57  VAL 57  91  91  VAL VAL B . n 
B 1 58  PHE 58  92  92  PHE PHE B . n 
B 1 59  ARG 59  93  93  ARG ARG B . n 
B 1 60  GLU 60  94  94  GLU GLU B . n 
B 1 61  VAL 61  95  95  VAL VAL B . n 
B 1 62  GLU 62  96  96  GLU GLU B . n 
B 1 63  THR 63  97  97  THR THR B . n 
B 1 64  LEU 64  98  98  LEU LEU B . n 
B 1 65  TYR 65  99  99  TYR TYR B . n 
B 1 66  GLN 66  100 100 GLN GLN B . n 
B 1 67  CYS 67  101 101 CYS CYS B . n 
B 1 68  GLN 68  102 102 GLN GLN B . n 
B 1 69  GLY 69  103 103 GLY GLY B . n 
B 1 70  ASN 70  104 104 ASN ASN B . n 
B 1 71  LYS 71  105 105 LYS LYS B . n 
B 1 72  ASN 72  106 106 ASN ASN B . n 
B 1 73  ILE 73  107 107 ILE ILE B . n 
B 1 74  LEU 74  108 108 LEU LEU B . n 
B 1 75  GLU 75  109 109 GLU GLU B . n 
B 1 76  LEU 76  110 110 LEU LEU B . n 
B 1 77  ILE 77  111 111 ILE ILE B . n 
B 1 78  GLU 78  112 112 GLU GLU B . n 
B 1 79  PHE 79  113 113 PHE PHE B . n 
B 1 80  PHE 80  114 114 PHE PHE B . n 
B 1 81  GLU 81  115 115 GLU GLU B . n 
B 1 82  ASP 82  116 116 ASP ASP B . n 
B 1 83  ASP 83  117 117 ASP ASP B . n 
B 1 84  THR 84  118 118 THR THR B . n 
B 1 85  ARG 85  119 119 ARG ARG B . n 
B 1 86  PHE 86  120 120 PHE PHE B . n 
B 1 87  TYR 87  121 121 TYR TYR B . n 
B 1 88  LEU 88  122 122 LEU LEU B . n 
B 1 89  VAL 89  123 123 VAL VAL B . n 
B 1 90  PHE 90  124 124 PHE PHE B . n 
B 1 91  GLU 91  125 125 GLU GLU B . n 
B 1 92  LYS 92  126 126 LYS LYS B . n 
B 1 93  LEU 93  127 127 LEU LEU B . n 
B 1 94  GLN 94  128 128 GLN GLN B . n 
B 1 95  GLY 95  129 129 GLY GLY B . n 
B 1 96  GLY 96  130 130 GLY GLY B . n 
B 1 97  SER 97  131 131 SER SER B . n 
B 1 98  ILE 98  132 132 ILE ILE B . n 
B 1 99  LEU 99  133 133 LEU LEU B . n 
B 1 100 ALA 100 134 134 ALA ALA B . n 
B 1 101 HIS 101 135 135 HIS HIS B . n 
B 1 102 ILE 102 136 136 ILE ILE B . n 
B 1 103 GLN 103 137 137 GLN GLN B . n 
B 1 104 LYS 104 138 138 LYS LYS B . n 
B 1 105 GLN 105 139 139 GLN GLN B . n 
B 1 106 LYS 106 140 140 LYS LYS B . n 
B 1 107 HIS 107 141 141 HIS HIS B . n 
B 1 108 PHE 108 142 142 PHE PHE B . n 
B 1 109 ASN 109 143 143 ASN ASN B . n 
B 1 110 GLU 110 144 144 GLU GLU B . n 
B 1 111 ARG 111 145 145 ARG ARG B . n 
B 1 112 GLU 112 146 146 GLU GLU B . n 
B 1 113 ALA 113 147 147 ALA ALA B . n 
B 1 114 SER 114 148 148 SER SER B . n 
B 1 115 ARG 115 149 149 ARG ARG B . n 
B 1 116 VAL 116 150 150 VAL VAL B . n 
B 1 117 VAL 117 151 151 VAL VAL B . n 
B 1 118 ARG 118 152 152 ARG ARG B . n 
B 1 119 ASP 119 153 153 ASP ASP B . n 
B 1 120 VAL 120 154 154 VAL VAL B . n 
B 1 121 ALA 121 155 155 ALA ALA B . n 
B 1 122 ALA 122 156 156 ALA ALA B . n 
B 1 123 ALA 123 157 157 ALA ALA B . n 
B 1 124 LEU 124 158 158 LEU LEU B . n 
B 1 125 ASP 125 159 159 ASP ASP B . n 
B 1 126 PHE 126 160 160 PHE PHE B . n 
B 1 127 LEU 127 161 161 LEU LEU B . n 
B 1 128 HIS 128 162 162 HIS HIS B . n 
B 1 129 THR 129 163 163 THR THR B . n 
B 1 130 LYS 130 164 164 LYS LYS B . n 
B 1 131 GLY 131 165 165 GLY GLY B . n 
B 1 132 ILE 132 166 166 ILE ILE B . n 
B 1 133 ALA 133 167 167 ALA ALA B . n 
B 1 134 HIS 134 168 168 HIS HIS B . n 
B 1 135 ARG 135 169 169 ARG ARG B . n 
B 1 136 ASP 136 170 170 ASP ASP B . n 
B 1 137 LEU 137 171 171 LEU LEU B . n 
B 1 138 LYS 138 172 172 LYS LYS B . n 
B 1 139 PRO 139 173 173 PRO PRO B . n 
B 1 140 GLU 140 174 174 GLU GLU B . n 
B 1 141 ASN 141 175 175 ASN ASN B . n 
B 1 142 ILE 142 176 176 ILE ILE B . n 
B 1 143 LEU 143 177 177 LEU LEU B . n 
B 1 144 CYS 144 178 178 CYS CYS B . n 
B 1 145 GLU 145 179 179 GLU GLU B . n 
B 1 146 SER 146 180 180 SER SER B . n 
B 1 147 PRO 147 181 181 PRO PRO B . n 
B 1 148 GLU 148 182 182 GLU GLU B . n 
B 1 149 LYS 149 183 183 LYS LYS B . n 
B 1 150 VAL 150 184 184 VAL VAL B . n 
B 1 151 SER 151 185 185 SER SER B . n 
B 1 152 PRO 152 186 186 PRO PRO B . n 
B 1 153 VAL 153 187 187 VAL VAL B . n 
B 1 154 LYS 154 188 188 LYS LYS B . n 
B 1 155 ILE 155 189 189 ILE ILE B . n 
B 1 156 CYS 156 190 190 CYS CYS B . n 
B 1 157 ASP 157 191 191 ASP ASP B . n 
B 1 158 PHE 158 192 192 PHE PHE B . n 
B 1 159 ASP 159 193 193 ASP ASP B . n 
B 1 160 LEU 160 194 194 LEU LEU B . n 
B 1 161 GLY 161 195 195 GLY GLY B . n 
B 1 162 SER 162 196 196 SER SER B . n 
B 1 163 GLY 163 197 ?   ?   ?   B . n 
B 1 164 MET 164 198 ?   ?   ?   B . n 
B 1 165 LYS 165 199 ?   ?   ?   B . n 
B 1 166 LEU 166 200 ?   ?   ?   B . n 
B 1 167 ASN 167 201 ?   ?   ?   B . n 
B 1 168 ASN 168 202 ?   ?   ?   B . n 
B 1 169 SER 169 203 ?   ?   ?   B . n 
B 1 170 CYS 170 204 ?   ?   ?   B . n 
B 1 171 THR 171 205 ?   ?   ?   B . n 
B 1 172 PRO 172 206 ?   ?   ?   B . n 
B 1 173 ILE 173 207 ?   ?   ?   B . n 
B 1 174 THR 174 208 ?   ?   ?   B . n 
B 1 175 THR 175 209 ?   ?   ?   B . n 
B 1 176 PRO 176 210 ?   ?   ?   B . n 
B 1 177 GLU 177 211 ?   ?   ?   B . n 
B 1 178 LEU 178 212 ?   ?   ?   B . n 
B 1 179 THR 179 213 ?   ?   ?   B . n 
B 1 180 THR 180 214 ?   ?   ?   B . n 
B 1 181 PRO 181 215 ?   ?   ?   B . n 
B 1 182 CYS 182 216 ?   ?   ?   B . n 
B 1 183 GLY 183 217 ?   ?   ?   B . n 
B 1 184 SER 184 218 ?   ?   ?   B . n 
B 1 185 ALA 185 219 ?   ?   ?   B . n 
B 1 186 GLU 186 220 ?   ?   ?   B . n 
B 1 187 TYR 187 221 221 TYR TYR B . n 
B 1 188 MET 188 222 222 MET MET B . n 
B 1 189 ALA 189 223 223 ALA ALA B . n 
B 1 190 PRO 190 224 224 PRO PRO B . n 
B 1 191 GLU 191 225 225 GLU GLU B . n 
B 1 192 VAL 192 226 226 VAL VAL B . n 
B 1 193 VAL 193 227 227 VAL VAL B . n 
B 1 194 GLU 194 228 228 GLU GLU B . n 
B 1 195 VAL 195 229 229 VAL VAL B . n 
B 1 196 PHE 196 230 230 PHE PHE B . n 
B 1 197 THR 197 231 231 THR THR B . n 
B 1 198 ASP 198 232 232 ASP ASP B . n 
B 1 199 GLN 199 233 233 GLN GLN B . n 
B 1 200 ALA 200 234 234 ALA ALA B . n 
B 1 201 THR 201 235 235 THR THR B . n 
B 1 202 PHE 202 236 236 PHE PHE B . n 
B 1 203 TYR 203 237 237 TYR TYR B . n 
B 1 204 ASP 204 238 238 ASP ASP B . n 
B 1 205 LYS 205 239 239 LYS LYS B . n 
B 1 206 ARG 206 240 240 ARG ARG B . n 
B 1 207 CYS 207 241 241 CYS CYS B . n 
B 1 208 ASP 208 242 242 ASP ASP B . n 
B 1 209 LEU 209 243 243 LEU LEU B . n 
B 1 210 TRP 210 244 244 TRP TRP B . n 
B 1 211 SER 211 245 245 SER SER B . n 
B 1 212 LEU 212 246 246 LEU LEU B . n 
B 1 213 GLY 213 247 247 GLY GLY B . n 
B 1 214 VAL 214 248 248 VAL VAL B . n 
B 1 215 VAL 215 249 249 VAL VAL B . n 
B 1 216 LEU 216 250 250 LEU LEU B . n 
B 1 217 TYR 217 251 251 TYR TYR B . n 
B 1 218 ILE 218 252 252 ILE ILE B . n 
B 1 219 MET 219 253 253 MET MET B . n 
B 1 220 LEU 220 254 254 LEU LEU B . n 
B 1 221 SER 221 255 255 SER SER B . n 
B 1 222 GLY 222 256 256 GLY GLY B . n 
B 1 223 TYR 223 257 257 TYR TYR B . n 
B 1 224 PRO 224 258 258 PRO PRO B . n 
B 1 225 PRO 225 259 259 PRO PRO B . n 
B 1 226 PHE 226 260 260 PHE PHE B . n 
B 1 227 VAL 227 261 ?   ?   ?   B . n 
B 1 228 GLY 228 262 ?   ?   ?   B . n 
B 1 229 HIS 229 263 ?   ?   ?   B . n 
B 1 230 CYS 230 264 ?   ?   ?   B . n 
B 1 231 GLY 231 265 ?   ?   ?   B . n 
B 1 232 ALA 232 266 ?   ?   ?   B . n 
B 1 233 ASP 233 267 ?   ?   ?   B . n 
B 1 234 CYS 234 268 ?   ?   ?   B . n 
B 1 235 GLY 235 269 ?   ?   ?   B . n 
B 1 236 TRP 236 270 ?   ?   ?   B . n 
B 1 237 ASP 237 271 ?   ?   ?   B . n 
B 1 238 ARG 238 272 ?   ?   ?   B . n 
B 1 239 GLY 239 273 ?   ?   ?   B . n 
B 1 240 GLU 240 274 ?   ?   ?   B . n 
B 1 241 VAL 241 275 ?   ?   ?   B . n 
B 1 242 CYS 242 276 ?   ?   ?   B . n 
B 1 243 ARG 243 277 ?   ?   ?   B . n 
B 1 244 VAL 244 278 ?   ?   ?   B . n 
B 1 245 CYS 245 279 ?   ?   ?   B . n 
B 1 246 GLN 246 280 ?   ?   ?   B . n 
B 1 247 ASN 247 281 ?   ?   ?   B . n 
B 1 248 LYS 248 282 ?   ?   ?   B . n 
B 1 249 LEU 249 283 ?   ?   ?   B . n 
B 1 250 PHE 250 284 ?   ?   ?   B . n 
B 1 251 GLU 251 285 ?   ?   ?   B . n 
B 1 252 SER 252 286 ?   ?   ?   B . n 
B 1 253 ILE 253 287 ?   ?   ?   B . n 
B 1 254 GLN 254 288 ?   ?   ?   B . n 
B 1 255 GLU 255 289 ?   ?   ?   B . n 
B 1 256 GLY 256 290 ?   ?   ?   B . n 
B 1 257 LYS 257 291 ?   ?   ?   B . n 
B 1 258 TYR 258 292 ?   ?   ?   B . n 
B 1 259 GLU 259 293 ?   ?   ?   B . n 
B 1 260 PHE 260 294 ?   ?   ?   B . n 
B 1 261 PRO 261 295 ?   ?   ?   B . n 
B 1 262 ASP 262 296 ?   ?   ?   B . n 
B 1 263 LYS 263 297 ?   ?   ?   B . n 
B 1 264 ASP 264 298 ?   ?   ?   B . n 
B 1 265 TRP 265 299 299 TRP TRP B . n 
B 1 266 ALA 266 300 300 ALA ALA B . n 
B 1 267 HIS 267 301 301 HIS HIS B . n 
B 1 268 ILE 268 302 302 ILE ILE B . n 
B 1 269 SER 269 303 303 SER SER B . n 
B 1 270 SER 270 304 304 SER SER B . n 
B 1 271 GLU 271 305 305 GLU GLU B . n 
B 1 272 ALA 272 306 306 ALA ALA B . n 
B 1 273 LYS 273 307 307 LYS LYS B . n 
B 1 274 ASP 274 308 308 ASP ASP B . n 
B 1 275 LEU 275 309 309 LEU LEU B . n 
B 1 276 ILE 276 310 310 ILE ILE B . n 
B 1 277 SER 277 311 311 SER SER B . n 
B 1 278 LYS 278 312 312 LYS LYS B . n 
B 1 279 LEU 279 313 313 LEU LEU B . n 
B 1 280 LEU 280 314 314 LEU LEU B . n 
B 1 281 VAL 281 315 315 VAL VAL B . n 
B 1 282 ARG 282 316 316 ARG ARG B . n 
B 1 283 ASP 283 317 317 ASP ASP B . n 
B 1 284 ALA 284 318 318 ALA ALA B . n 
B 1 285 LYS 285 319 319 LYS LYS B . n 
B 1 286 GLN 286 320 320 GLN GLN B . n 
B 1 287 ARG 287 321 321 ARG ARG B . n 
B 1 288 LEU 288 322 322 LEU LEU B . n 
B 1 289 SER 289 323 323 SER SER B . n 
B 1 290 ALA 290 324 324 ALA ALA B . n 
B 1 291 ALA 291 325 325 ALA ALA B . n 
B 1 292 GLN 292 326 326 GLN GLN B . n 
B 1 293 VAL 293 327 327 VAL VAL B . n 
B 1 294 LEU 294 328 328 LEU LEU B . n 
B 1 295 GLN 295 329 329 GLN GLN B . n 
B 1 296 HIS 296 330 330 HIS HIS B . n 
B 1 297 PRO 297 331 331 PRO PRO B . n 
B 1 298 TRP 298 332 332 TRP TRP B . n 
B 1 299 VAL 299 333 333 VAL VAL B . n 
B 1 300 GLN 300 334 334 GLN GLN B . n 
B 1 301 GLY 301 335 ?   ?   ?   B . n 
B 1 302 GLN 302 336 ?   ?   ?   B . n 
B 1 303 ALA 303 337 ?   ?   ?   B . n 
B 1 304 PRO 304 338 ?   ?   ?   B . n 
B 1 305 GLU 305 339 ?   ?   ?   B . n 
B 1 306 LYS 306 340 ?   ?   ?   B . n 
B 1 307 GLY 307 341 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1  342 1   SO4 SUL A . 
D 2 SO4 1  342 1   SO4 SUL B . 
E 3 HOH 1  343 3   HOH HOH A . 
E 3 HOH 2  344 4   HOH HOH A . 
E 3 HOH 3  345 5   HOH HOH A . 
E 3 HOH 4  346 6   HOH HOH A . 
E 3 HOH 5  347 7   HOH HOH A . 
E 3 HOH 6  348 8   HOH HOH A . 
E 3 HOH 7  349 9   HOH HOH A . 
E 3 HOH 8  350 12  HOH HOH A . 
E 3 HOH 9  351 13  HOH HOH A . 
E 3 HOH 10 352 15  HOH HOH A . 
E 3 HOH 11 353 16  HOH HOH A . 
E 3 HOH 12 354 17  HOH HOH A . 
E 3 HOH 13 355 18  HOH HOH A . 
E 3 HOH 14 356 19  HOH HOH A . 
E 3 HOH 15 357 21  HOH HOH A . 
E 3 HOH 16 358 22  HOH HOH A . 
E 3 HOH 17 359 27  HOH HOH A . 
E 3 HOH 18 360 28  HOH HOH A . 
E 3 HOH 19 361 30  HOH HOH A . 
E 3 HOH 20 362 31  HOH HOH A . 
E 3 HOH 21 363 34  HOH HOH A . 
E 3 HOH 22 364 36  HOH HOH A . 
E 3 HOH 23 365 37  HOH HOH A . 
E 3 HOH 24 366 38  HOH HOH A . 
E 3 HOH 25 367 39  HOH HOH A . 
E 3 HOH 26 368 45  HOH HOH A . 
E 3 HOH 27 369 47  HOH HOH A . 
E 3 HOH 28 370 48  HOH HOH A . 
E 3 HOH 29 371 49  HOH HOH A . 
E 3 HOH 30 372 50  HOH HOH A . 
E 3 HOH 31 373 51  HOH HOH A . 
E 3 HOH 32 374 52  HOH HOH A . 
E 3 HOH 33 375 53  HOH HOH A . 
E 3 HOH 34 376 54  HOH HOH A . 
E 3 HOH 35 377 55  HOH HOH A . 
E 3 HOH 36 378 57  HOH HOH A . 
E 3 HOH 37 379 59  HOH HOH A . 
E 3 HOH 38 380 64  HOH HOH A . 
E 3 HOH 39 381 65  HOH HOH A . 
E 3 HOH 40 382 66  HOH HOH A . 
E 3 HOH 41 383 70  HOH HOH A . 
E 3 HOH 42 384 72  HOH HOH A . 
E 3 HOH 43 385 73  HOH HOH A . 
E 3 HOH 44 386 77  HOH HOH A . 
E 3 HOH 45 387 81  HOH HOH A . 
E 3 HOH 46 388 85  HOH HOH A . 
E 3 HOH 47 389 86  HOH HOH A . 
E 3 HOH 48 390 88  HOH HOH A . 
E 3 HOH 49 391 89  HOH HOH A . 
E 3 HOH 50 392 90  HOH HOH A . 
E 3 HOH 51 393 92  HOH HOH A . 
E 3 HOH 52 394 93  HOH HOH A . 
E 3 HOH 53 395 94  HOH HOH A . 
E 3 HOH 54 396 95  HOH HOH A . 
E 3 HOH 55 397 96  HOH HOH A . 
E 3 HOH 56 398 97  HOH HOH A . 
E 3 HOH 57 399 99  HOH HOH A . 
E 3 HOH 58 400 102 HOH HOH A . 
E 3 HOH 59 401 104 HOH HOH A . 
E 3 HOH 60 402 105 HOH HOH A . 
E 3 HOH 61 403 107 HOH HOH A . 
E 3 HOH 62 404 108 HOH HOH A . 
E 3 HOH 63 405 111 HOH HOH A . 
E 3 HOH 64 406 112 HOH HOH A . 
E 3 HOH 65 407 114 HOH HOH A . 
E 3 HOH 66 408 116 HOH HOH A . 
E 3 HOH 67 409 119 HOH HOH A . 
E 3 HOH 68 410 120 HOH HOH A . 
E 3 HOH 69 411 122 HOH HOH A . 
E 3 HOH 70 412 124 HOH HOH A . 
E 3 HOH 71 413 129 HOH HOH A . 
E 3 HOH 72 414 131 HOH HOH A . 
E 3 HOH 73 415 132 HOH HOH A . 
E 3 HOH 74 416 134 HOH HOH A . 
F 3 HOH 1  343 1   HOH HOH B . 
F 3 HOH 2  344 2   HOH HOH B . 
F 3 HOH 3  345 10  HOH HOH B . 
F 3 HOH 4  346 11  HOH HOH B . 
F 3 HOH 5  347 14  HOH HOH B . 
F 3 HOH 6  348 20  HOH HOH B . 
F 3 HOH 7  349 23  HOH HOH B . 
F 3 HOH 8  350 24  HOH HOH B . 
F 3 HOH 9  351 25  HOH HOH B . 
F 3 HOH 10 352 26  HOH HOH B . 
F 3 HOH 11 353 29  HOH HOH B . 
F 3 HOH 12 354 32  HOH HOH B . 
F 3 HOH 13 355 33  HOH HOH B . 
F 3 HOH 14 356 35  HOH HOH B . 
F 3 HOH 15 357 40  HOH HOH B . 
F 3 HOH 16 358 41  HOH HOH B . 
F 3 HOH 17 359 42  HOH HOH B . 
F 3 HOH 18 360 43  HOH HOH B . 
F 3 HOH 19 361 44  HOH HOH B . 
F 3 HOH 20 362 46  HOH HOH B . 
F 3 HOH 21 363 56  HOH HOH B . 
F 3 HOH 22 364 58  HOH HOH B . 
F 3 HOH 23 365 60  HOH HOH B . 
F 3 HOH 24 366 61  HOH HOH B . 
F 3 HOH 25 367 62  HOH HOH B . 
F 3 HOH 26 368 63  HOH HOH B . 
F 3 HOH 27 369 67  HOH HOH B . 
F 3 HOH 28 370 68  HOH HOH B . 
F 3 HOH 29 371 69  HOH HOH B . 
F 3 HOH 30 372 71  HOH HOH B . 
F 3 HOH 31 373 74  HOH HOH B . 
F 3 HOH 32 374 75  HOH HOH B . 
F 3 HOH 33 375 76  HOH HOH B . 
F 3 HOH 34 376 78  HOH HOH B . 
F 3 HOH 35 377 79  HOH HOH B . 
F 3 HOH 36 378 80  HOH HOH B . 
F 3 HOH 37 379 82  HOH HOH B . 
F 3 HOH 38 380 83  HOH HOH B . 
F 3 HOH 39 381 84  HOH HOH B . 
F 3 HOH 40 382 87  HOH HOH B . 
F 3 HOH 41 383 91  HOH HOH B . 
F 3 HOH 42 384 98  HOH HOH B . 
F 3 HOH 43 385 100 HOH HOH B . 
F 3 HOH 44 386 101 HOH HOH B . 
F 3 HOH 45 387 103 HOH HOH B . 
F 3 HOH 46 388 106 HOH HOH B . 
F 3 HOH 47 389 109 HOH HOH B . 
F 3 HOH 48 390 110 HOH HOH B . 
F 3 HOH 49 391 113 HOH HOH B . 
F 3 HOH 50 392 115 HOH HOH B . 
F 3 HOH 51 393 117 HOH HOH B . 
F 3 HOH 52 394 118 HOH HOH B . 
F 3 HOH 53 395 121 HOH HOH B . 
F 3 HOH 54 396 123 HOH HOH B . 
F 3 HOH 55 397 125 HOH HOH B . 
F 3 HOH 56 398 126 HOH HOH B . 
F 3 HOH 57 399 127 HOH HOH B . 
F 3 HOH 58 400 128 HOH HOH B . 
F 3 HOH 59 401 130 HOH HOH B . 
F 3 HOH 60 402 133 HOH HOH B . 
F 3 HOH 61 403 135 HOH HOH B . 
F 3 HOH 62 404 136 HOH HOH B . 
F 3 HOH 63 405 137 HOH HOH B . 
F 3 HOH 64 406 138 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-08-29 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 10.0448 43.3138 77.9509  0.0155  -0.0522 -0.0741 -0.0066 -0.0036 0.0147 1.7003 1.1868 3.2541 -0.0818 -1.2718 -1.0153 
0.0028  -0.0257 -0.1363 0.0287  -0.1043 -0.0693 0.1897  -0.0293 0.1015  'X-RAY DIFFRACTION' 
2 ? refined 22.9884 59.5609 63.2522  0.0007  -0.0653 -0.0988 -0.0027 -0.0502 0.0313 2.2086 2.2740 2.5137 1.4335  -0.8081 -1.0307 
-0.0700 0.0797  0.0004  0.2016  -0.0659 -0.0610 -0.2285 0.1294  0.1358  'X-RAY DIFFRACTION' 
3 ? refined -8.2194 53.0245 88.7415  -0.0255 0.0680  -0.1338 0.0626  0.0230  0.0312 1.4476 2.3392 4.3925 -0.8851 0.1125  0.6332  
0.1021  -0.0007 -0.0003 -0.0230 -0.0876 0.1564  -0.1103 -0.5448 -0.0145 'X-RAY DIFFRACTION' 
4 ? refined -2.5848 71.5799 102.9145 0.3239  -0.1615 -0.1572 0.1479  0.0469  0.0451 1.7416 3.7947 4.2542 0.0016  -0.7416 1.2611  
0.0491  0.1853  0.2248  0.0868  -0.0196 -0.1527 -0.9273 -0.2387 -0.0295 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 39  A 5   A 127 A 93  ? 'X-RAY DIFFRACTION' ? 
2 2 A 128 A 94  A 196 A 162 ? 'X-RAY DIFFRACTION' ? 
3 2 A 223 A 189 A 260 A 226 ? 'X-RAY DIFFRACTION' ? 
4 2 A 290 A 256 A 335 A 301 ? 'X-RAY DIFFRACTION' ? 
5 3 B 40  B 6   B 127 B 93  ? 'X-RAY DIFFRACTION' ? 
6 4 B 128 B 94  B 196 B 162 ? 'X-RAY DIFFRACTION' ? 
7 4 B 221 B 187 B 260 B 226 ? 'X-RAY DIFFRACTION' ? 
8 4 B 299 B 265 B 334 B 300 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.2.0005 ? 1 
HKL-2000 'data reduction' .        ? 2 
HKL-2000 'data scaling'   .        ? 3 
MOLREP   phasing          .        ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
RESIDUES 165-205 IN UNP Q9BUB5 ARE VARIAN AND
ARE MISSING IN ISOFORM 2 AND ISOFORM 3.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 137 ? ? -68.74  7.86    
2  1 LYS A 140 ? ? 69.80   -53.80  
3  1 ARG A 169 ? ? 89.58   -4.50   
4  1 ASP A 170 ? ? -157.37 56.05   
5  1 SER A 185 ? ? -64.48  -79.44  
6  1 LYS A 291 ? ? 80.95   95.96   
7  1 HIS A 301 ? ? 64.32   -9.44   
8  1 GLN A 334 ? ? 70.35   49.28   
9  1 GLU B 53  ? ? -65.64  -84.77  
10 1 LEU B 54  ? ? 70.98   95.36   
11 1 ASN B 71  ? ? 57.07   78.61   
12 1 GLN B 102 ? ? -67.21  33.61   
13 1 ASP B 116 ? ? -111.82 -154.47 
14 1 LYS B 138 ? ? -77.25  21.23   
15 1 GLN B 139 ? ? -148.65 -146.47 
16 1 LYS B 140 ? ? -144.12 -64.78  
17 1 HIS B 141 ? ? -112.81 -166.22 
18 1 ARG B 169 ? ? 89.55   -16.06  
19 1 ASP B 170 ? ? -156.66 65.05   
20 1 GLU B 182 ? ? -90.73  -63.06  
21 1 SER B 185 ? ? 51.49   -174.66 
22 1 PRO B 186 ? ? -44.52  103.65  
23 1 PHE B 192 ? ? -108.38 40.51   
24 1 MET B 222 ? ? -98.26  -94.57  
25 1 ALA B 223 ? ? -176.45 132.13  
26 1 PHE B 230 ? ? 52.86   74.60   
27 1 ALA B 300 ? ? -107.59 -131.69 
28 1 ALA B 306 ? ? -64.98  -71.13  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 35  ? A GLY 1   
2   1 Y 1 A SER 36  ? A SER 2   
3   1 Y 1 A THR 37  ? A THR 3   
4   1 Y 1 A ASP 38  ? A ASP 4   
5   1 Y 1 A GLY 197 ? A GLY 163 
6   1 Y 1 A MET 198 ? A MET 164 
7   1 Y 1 A LYS 199 ? A LYS 165 
8   1 Y 1 A LEU 200 ? A LEU 166 
9   1 Y 1 A ASN 201 ? A ASN 167 
10  1 Y 1 A ASN 202 ? A ASN 168 
11  1 Y 1 A SER 203 ? A SER 169 
12  1 Y 1 A CYS 204 ? A CYS 170 
13  1 Y 1 A THR 205 ? A THR 171 
14  1 Y 1 A PRO 206 ? A PRO 172 
15  1 Y 1 A ILE 207 ? A ILE 173 
16  1 Y 1 A THR 208 ? A THR 174 
17  1 Y 1 A THR 209 ? A THR 175 
18  1 Y 1 A PRO 210 ? A PRO 176 
19  1 Y 1 A GLU 211 ? A GLU 177 
20  1 Y 1 A LEU 212 ? A LEU 178 
21  1 Y 1 A THR 213 ? A THR 179 
22  1 Y 1 A THR 214 ? A THR 180 
23  1 Y 1 A PRO 215 ? A PRO 181 
24  1 Y 1 A CYS 216 ? A CYS 182 
25  1 Y 1 A GLY 217 ? A GLY 183 
26  1 Y 1 A SER 218 ? A SER 184 
27  1 Y 1 A ALA 219 ? A ALA 185 
28  1 Y 1 A GLU 220 ? A GLU 186 
29  1 Y 1 A TYR 221 ? A TYR 187 
30  1 Y 1 A MET 222 ? A MET 188 
31  1 Y 1 A VAL 261 ? A VAL 227 
32  1 Y 1 A GLY 262 ? A GLY 228 
33  1 Y 1 A HIS 263 ? A HIS 229 
34  1 Y 1 A CYS 264 ? A CYS 230 
35  1 Y 1 A GLY 265 ? A GLY 231 
36  1 Y 1 A ALA 266 ? A ALA 232 
37  1 Y 1 A ASP 267 ? A ASP 233 
38  1 Y 1 A CYS 268 ? A CYS 234 
39  1 Y 1 A GLY 269 ? A GLY 235 
40  1 Y 1 A TRP 270 ? A TRP 236 
41  1 Y 1 A ASP 271 ? A ASP 237 
42  1 Y 1 A ARG 272 ? A ARG 238 
43  1 Y 1 A GLY 273 ? A GLY 239 
44  1 Y 1 A GLU 274 ? A GLU 240 
45  1 Y 1 A VAL 275 ? A VAL 241 
46  1 Y 1 A CYS 276 ? A CYS 242 
47  1 Y 1 A ARG 277 ? A ARG 243 
48  1 Y 1 A VAL 278 ? A VAL 244 
49  1 Y 1 A CYS 279 ? A CYS 245 
50  1 Y 1 A GLN 280 ? A GLN 246 
51  1 Y 1 A ASN 281 ? A ASN 247 
52  1 Y 1 A LYS 282 ? A LYS 248 
53  1 Y 1 A LEU 283 ? A LEU 249 
54  1 Y 1 A PHE 284 ? A PHE 250 
55  1 Y 1 A GLU 285 ? A GLU 251 
56  1 Y 1 A SER 286 ? A SER 252 
57  1 Y 1 A ILE 287 ? A ILE 253 
58  1 Y 1 A GLN 288 ? A GLN 254 
59  1 Y 1 A GLU 289 ? A GLU 255 
60  1 Y 1 A GLN 336 ? A GLN 302 
61  1 Y 1 A ALA 337 ? A ALA 303 
62  1 Y 1 A PRO 338 ? A PRO 304 
63  1 Y 1 A GLU 339 ? A GLU 305 
64  1 Y 1 A LYS 340 ? A LYS 306 
65  1 Y 1 A GLY 341 ? A GLY 307 
66  1 Y 1 B GLY 35  ? B GLY 1   
67  1 Y 1 B SER 36  ? B SER 2   
68  1 Y 1 B THR 37  ? B THR 3   
69  1 Y 1 B ASP 38  ? B ASP 4   
70  1 Y 1 B SER 39  ? B SER 5   
71  1 Y 1 B GLY 197 ? B GLY 163 
72  1 Y 1 B MET 198 ? B MET 164 
73  1 Y 1 B LYS 199 ? B LYS 165 
74  1 Y 1 B LEU 200 ? B LEU 166 
75  1 Y 1 B ASN 201 ? B ASN 167 
76  1 Y 1 B ASN 202 ? B ASN 168 
77  1 Y 1 B SER 203 ? B SER 169 
78  1 Y 1 B CYS 204 ? B CYS 170 
79  1 Y 1 B THR 205 ? B THR 171 
80  1 Y 1 B PRO 206 ? B PRO 172 
81  1 Y 1 B ILE 207 ? B ILE 173 
82  1 Y 1 B THR 208 ? B THR 174 
83  1 Y 1 B THR 209 ? B THR 175 
84  1 Y 1 B PRO 210 ? B PRO 176 
85  1 Y 1 B GLU 211 ? B GLU 177 
86  1 Y 1 B LEU 212 ? B LEU 178 
87  1 Y 1 B THR 213 ? B THR 179 
88  1 Y 1 B THR 214 ? B THR 180 
89  1 Y 1 B PRO 215 ? B PRO 181 
90  1 Y 1 B CYS 216 ? B CYS 182 
91  1 Y 1 B GLY 217 ? B GLY 183 
92  1 Y 1 B SER 218 ? B SER 184 
93  1 Y 1 B ALA 219 ? B ALA 185 
94  1 Y 1 B GLU 220 ? B GLU 186 
95  1 Y 1 B VAL 261 ? B VAL 227 
96  1 Y 1 B GLY 262 ? B GLY 228 
97  1 Y 1 B HIS 263 ? B HIS 229 
98  1 Y 1 B CYS 264 ? B CYS 230 
99  1 Y 1 B GLY 265 ? B GLY 231 
100 1 Y 1 B ALA 266 ? B ALA 232 
101 1 Y 1 B ASP 267 ? B ASP 233 
102 1 Y 1 B CYS 268 ? B CYS 234 
103 1 Y 1 B GLY 269 ? B GLY 235 
104 1 Y 1 B TRP 270 ? B TRP 236 
105 1 Y 1 B ASP 271 ? B ASP 237 
106 1 Y 1 B ARG 272 ? B ARG 238 
107 1 Y 1 B GLY 273 ? B GLY 239 
108 1 Y 1 B GLU 274 ? B GLU 240 
109 1 Y 1 B VAL 275 ? B VAL 241 
110 1 Y 1 B CYS 276 ? B CYS 242 
111 1 Y 1 B ARG 277 ? B ARG 243 
112 1 Y 1 B VAL 278 ? B VAL 244 
113 1 Y 1 B CYS 279 ? B CYS 245 
114 1 Y 1 B GLN 280 ? B GLN 246 
115 1 Y 1 B ASN 281 ? B ASN 247 
116 1 Y 1 B LYS 282 ? B LYS 248 
117 1 Y 1 B LEU 283 ? B LEU 249 
118 1 Y 1 B PHE 284 ? B PHE 250 
119 1 Y 1 B GLU 285 ? B GLU 251 
120 1 Y 1 B SER 286 ? B SER 252 
121 1 Y 1 B ILE 287 ? B ILE 253 
122 1 Y 1 B GLN 288 ? B GLN 254 
123 1 Y 1 B GLU 289 ? B GLU 255 
124 1 Y 1 B GLY 290 ? B GLY 256 
125 1 Y 1 B LYS 291 ? B LYS 257 
126 1 Y 1 B TYR 292 ? B TYR 258 
127 1 Y 1 B GLU 293 ? B GLU 259 
128 1 Y 1 B PHE 294 ? B PHE 260 
129 1 Y 1 B PRO 295 ? B PRO 261 
130 1 Y 1 B ASP 296 ? B ASP 262 
131 1 Y 1 B LYS 297 ? B LYS 263 
132 1 Y 1 B ASP 298 ? B ASP 264 
133 1 Y 1 B GLY 335 ? B GLY 301 
134 1 Y 1 B GLN 336 ? B GLN 302 
135 1 Y 1 B ALA 337 ? B ALA 303 
136 1 Y 1 B PRO 338 ? B PRO 304 
137 1 Y 1 B GLU 339 ? B GLU 305 
138 1 Y 1 B LYS 340 ? B LYS 306 
139 1 Y 1 B GLY 341 ? B GLY 307 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#