data_2HWK
# 
_entry.id   2HWK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HWK         
RCSB  RCSB038842   
WWPDB D_1000038842 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HWK 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Russo, A.T.'    1 
'White, M.A.'    2 
'Watowich, S.J.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The Crystal Structure of the Venezuelan Equine Encephalitis Alphavirus nsP2 Protease.'     Structure         14 1449 1458 
2006 STRUE6 UK 0969-2126 2005 ? 16962975 10.1016/j.str.2006.07.010 
1       'Structural Basis of Substrate Specificity in Venezuelan Equine Encephalitis nsP2 Protease' 'To be Published' ?  ?    ?    
?    ?      ?  ?         0353 ? ?        ?                         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Russo, A.T.'    1 
primary 'White, M.A.'    2 
primary 'Watowich, S.J.' 3 
1       'Russo, A.T.'    4 
1       'White, M.A.'    5 
1       'Malmstrom, R.'  6 
1       'Watowich, S.J.' 7 
# 
_cell.entry_id           2HWK 
_cell.length_a           47.470 
_cell.length_b           72.580 
_cell.length_c           106.660 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HWK 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'helicase nsP2' 36239.410 1  3.4.22.- ? nsP2pro ? 
2 non-polymer syn 'FORMIC ACID'   46.025    3  ?        ? ?       ? 
3 water       nat water           18.015    25 ?        ? ?       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protease, triphosphatase, NTPase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHW
DNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVS
KLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKA
CLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHW
DNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVS
KLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKA
CLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   PHE n 
1 4   GLN n 
1 5   ASN n 
1 6   LYS n 
1 7   ALA n 
1 8   ASN n 
1 9   VAL n 
1 10  CYS n 
1 11  TRP n 
1 12  ALA n 
1 13  LYS n 
1 14  ALA n 
1 15  LEU n 
1 16  VAL n 
1 17  PRO n 
1 18  VAL n 
1 19  LEU n 
1 20  LYS n 
1 21  THR n 
1 22  ALA n 
1 23  GLY n 
1 24  ILE n 
1 25  ASP n 
1 26  MET n 
1 27  THR n 
1 28  THR n 
1 29  GLU n 
1 30  GLN n 
1 31  TRP n 
1 32  ASN n 
1 33  THR n 
1 34  VAL n 
1 35  ASP n 
1 36  TYR n 
1 37  PHE n 
1 38  GLU n 
1 39  THR n 
1 40  ASP n 
1 41  LYS n 
1 42  ALA n 
1 43  HIS n 
1 44  SER n 
1 45  ALA n 
1 46  GLU n 
1 47  ILE n 
1 48  VAL n 
1 49  LEU n 
1 50  ASN n 
1 51  GLN n 
1 52  LEU n 
1 53  CYS n 
1 54  VAL n 
1 55  ARG n 
1 56  PHE n 
1 57  PHE n 
1 58  GLY n 
1 59  LEU n 
1 60  ASP n 
1 61  LEU n 
1 62  ASP n 
1 63  SER n 
1 64  GLY n 
1 65  LEU n 
1 66  PHE n 
1 67  SER n 
1 68  ALA n 
1 69  PRO n 
1 70  THR n 
1 71  VAL n 
1 72  PRO n 
1 73  LEU n 
1 74  SER n 
1 75  ILE n 
1 76  ARG n 
1 77  ASN n 
1 78  ASN n 
1 79  HIS n 
1 80  TRP n 
1 81  ASP n 
1 82  ASN n 
1 83  SER n 
1 84  PRO n 
1 85  SER n 
1 86  PRO n 
1 87  ASN n 
1 88  MET n 
1 89  TYR n 
1 90  GLY n 
1 91  LEU n 
1 92  ASN n 
1 93  LYS n 
1 94  GLU n 
1 95  VAL n 
1 96  VAL n 
1 97  ARG n 
1 98  GLN n 
1 99  LEU n 
1 100 SER n 
1 101 ARG n 
1 102 ARG n 
1 103 TYR n 
1 104 PRO n 
1 105 GLN n 
1 106 LEU n 
1 107 PRO n 
1 108 ARG n 
1 109 ALA n 
1 110 VAL n 
1 111 ALA n 
1 112 THR n 
1 113 GLY n 
1 114 ARG n 
1 115 VAL n 
1 116 TYR n 
1 117 ASP n 
1 118 MET n 
1 119 ASN n 
1 120 THR n 
1 121 GLY n 
1 122 THR n 
1 123 LEU n 
1 124 ARG n 
1 125 ASN n 
1 126 TYR n 
1 127 ASP n 
1 128 PRO n 
1 129 ARG n 
1 130 ILE n 
1 131 ASN n 
1 132 LEU n 
1 133 VAL n 
1 134 PRO n 
1 135 VAL n 
1 136 ASN n 
1 137 ARG n 
1 138 ARG n 
1 139 LEU n 
1 140 PRO n 
1 141 HIS n 
1 142 ALA n 
1 143 LEU n 
1 144 VAL n 
1 145 LEU n 
1 146 HIS n 
1 147 HIS n 
1 148 ASN n 
1 149 GLU n 
1 150 HIS n 
1 151 PRO n 
1 152 GLN n 
1 153 SER n 
1 154 ASP n 
1 155 PHE n 
1 156 SER n 
1 157 SER n 
1 158 PHE n 
1 159 VAL n 
1 160 SER n 
1 161 LYS n 
1 162 LEU n 
1 163 LYS n 
1 164 GLY n 
1 165 ARG n 
1 166 THR n 
1 167 VAL n 
1 168 LEU n 
1 169 VAL n 
1 170 VAL n 
1 171 GLY n 
1 172 GLU n 
1 173 LYS n 
1 174 LEU n 
1 175 SER n 
1 176 VAL n 
1 177 PRO n 
1 178 GLY n 
1 179 LYS n 
1 180 MET n 
1 181 VAL n 
1 182 ASP n 
1 183 TRP n 
1 184 LEU n 
1 185 SER n 
1 186 ASP n 
1 187 ARG n 
1 188 PRO n 
1 189 GLU n 
1 190 ALA n 
1 191 THR n 
1 192 PHE n 
1 193 ARG n 
1 194 ALA n 
1 195 ARG n 
1 196 LEU n 
1 197 ASP n 
1 198 LEU n 
1 199 GLY n 
1 200 ILE n 
1 201 PRO n 
1 202 GLY n 
1 203 ASP n 
1 204 VAL n 
1 205 PRO n 
1 206 LYS n 
1 207 TYR n 
1 208 ASP n 
1 209 ILE n 
1 210 ILE n 
1 211 PHE n 
1 212 VAL n 
1 213 ASN n 
1 214 VAL n 
1 215 ARG n 
1 216 THR n 
1 217 PRO n 
1 218 TYR n 
1 219 LYS n 
1 220 TYR n 
1 221 HIS n 
1 222 HIS n 
1 223 TYR n 
1 224 GLN n 
1 225 GLN n 
1 226 CYS n 
1 227 GLU n 
1 228 ASP n 
1 229 HIS n 
1 230 ALA n 
1 231 ILE n 
1 232 LYS n 
1 233 LEU n 
1 234 SER n 
1 235 MET n 
1 236 LEU n 
1 237 THR n 
1 238 LYS n 
1 239 LYS n 
1 240 ALA n 
1 241 CYS n 
1 242 LEU n 
1 243 HIS n 
1 244 LEU n 
1 245 ASN n 
1 246 PRO n 
1 247 GLY n 
1 248 GLY n 
1 249 THR n 
1 250 CYS n 
1 251 VAL n 
1 252 SER n 
1 253 ILE n 
1 254 GLY n 
1 255 TYR n 
1 256 GLY n 
1 257 TYR n 
1 258 ALA n 
1 259 ASP n 
1 260 ARG n 
1 261 ALA n 
1 262 SER n 
1 263 GLU n 
1 264 SER n 
1 265 ILE n 
1 266 ILE n 
1 267 GLY n 
1 268 ALA n 
1 269 ILE n 
1 270 ALA n 
1 271 ARG n 
1 272 GLN n 
1 273 PHE n 
1 274 LYS n 
1 275 PHE n 
1 276 SER n 
1 277 ARG n 
1 278 VAL n 
1 279 CYS n 
1 280 LYS n 
1 281 PRO n 
1 282 LYS n 
1 283 SER n 
1 284 SER n 
1 285 LEU n 
1 286 GLU n 
1 287 GLU n 
1 288 THR n 
1 289 GLU n 
1 290 VAL n 
1 291 LEU n 
1 292 PHE n 
1 293 VAL n 
1 294 PHE n 
1 295 ILE n 
1 296 GLY n 
1 297 TYR n 
1 298 ASP n 
1 299 ARG n 
1 300 LYS n 
1 301 ALA n 
1 302 ARG n 
1 303 THR n 
1 304 HIS n 
1 305 ASN n 
1 306 PRO n 
1 307 TYR n 
1 308 LYS n 
1 309 LEU n 
1 310 SER n 
1 311 SER n 
1 312 THR n 
1 313 LEU n 
1 314 THR n 
1 315 ASN n 
1 316 ILE n 
1 317 TYR n 
1 318 THR n 
1 319 GLY n 
1 320 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Alphavirus 
_entity_src_gen.pdbx_gene_src_gene                 NS 
_entity_src_gen.gene_src_species                   'Venezuelan equine encephalitis virus' 
_entity_src_gen.gene_src_strain                    TC-83 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Venezuelan equine encephalitis virus (strain TC-83)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11037 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Tuner(DE3)pLacI' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pETBlue1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    POLN_EEVVT 
_struct_ref.pdbx_db_accession          P27282 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHW
DNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVS
KLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKA
CLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS

;
_struct_ref.pdbx_align_begin           1003 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2HWK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 320 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P27282 
_struct_ref_seq.db_align_beg                  1003 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1322 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       468 
_struct_ref_seq.pdbx_auth_seq_align_end       787 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'   ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2HWK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.53 
_exptl_crystal.density_percent_sol   51.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
;3.0 M Ammonium Formate,  
2% 2-Methyl-2, 4-pentanediol,  
1% glycerol,  
200 uM Zinc Acetate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 290K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2005-12-02 
_diffrn_detector.details                
;Vertical collimating mirror, Toroidal focusing mirror,   
monochromator
;
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) Channel Cut Crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.3808 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CAMD BEAMLINE GCPCC' 
_diffrn_source.pdbx_synchrotron_site       CAMD 
_diffrn_source.pdbx_synchrotron_beamline   GCPCC 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.3808 
# 
_reflns.entry_id                     2HWK 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             43.37 
_reflns.d_resolution_high            2.45 
_reflns.number_obs                   14092 
_reflns.number_all                   14092 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.094 
_reflns.pdbx_Rsym_value              0.094 
_reflns.pdbx_netI_over_sigmaI        14.2 
_reflns.B_iso_Wilson_estimate        29.3 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   98.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.286 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      653 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2HWK 
_refine.ls_number_reflns_obs                     14090 
_refine.ls_number_reflns_all                     14090 
_refine.pdbx_ls_sigma_I                          -3 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1698628.21 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.37 
_refine.ls_d_res_high                            2.45 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_all                          0.208 
_refine.ls_R_factor_R_work                       0.192 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  662 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               35.3 
_refine.aniso_B[1][1]                            -0.60 
_refine.aniso_B[2][2]                            -0.77 
_refine.aniso_B[3][3]                            1.37 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.376216 
_refine.solvent_model_param_bsol                 35.5126 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'PMB was used in the refinement. http://xray.utmb.edu/PMB.' 
_refine.pdbx_starting_model                      None 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             variable 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'THICK SHELLS' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2HWK 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2552 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             34 
_refine_hist.number_atoms_total               2586 
_refine_hist.d_res_high                       2.45 
_refine_hist.d_res_low                        43.37 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 19.3  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.78  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.45 
_refine_ls_shell.d_res_low                        2.49 
_refine_ls_shell.number_reflns_R_work             653 
_refine_ls_shell.R_factor_R_work                  0.286 
_refine_ls_shell.percent_reflns_obs               98.6 
_refine_ls_shell.R_factor_R_free                  0.306 
_refine_ls_shell.R_factor_R_free_error            0.046 
_refine_ls_shell.percent_reflns_R_free            6.4 
_refine_ls_shell.number_reflns_R_free             45 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                698 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
4 ligand.param      ligand.top  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HWK 
_struct.title                     'Crystal Structure of Venezuelan Equine Encephalitis Alphavirus nsP2 Protease Domain' 
_struct.pdbx_descriptor           'Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HWK 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Rossmann fold, alpha/beta/alpha, multi-domain, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 9   ? THR A 21  ? VAL A 476 THR A 488 1 ? 13 
HELX_P HELX_P2  2  THR A 27  ? ASN A 32  ? THR A 494 ASN A 499 1 ? 6  
HELX_P HELX_P3  3  VAL A 34  ? THR A 39  ? VAL A 501 THR A 506 1 ? 6  
HELX_P HELX_P4  4  SER A 44  ? GLY A 58  ? SER A 511 GLY A 525 1 ? 15 
HELX_P HELX_P5  5  ASP A 60  ? GLY A 64  ? ASP A 527 GLY A 531 5 ? 5  
HELX_P HELX_P6  6  ASN A 92  ? ARG A 101 ? ASN A 559 ARG A 568 1 ? 10 
HELX_P HELX_P7  7  GLN A 105 ? GLY A 113 ? GLN A 572 GLY A 580 1 ? 9  
HELX_P HELX_P8  8  PHE A 155 ? LYS A 161 ? PHE A 622 LYS A 628 1 ? 7  
HELX_P HELX_P9  9  ARG A 195 ? GLY A 199 ? ARG A 662 GLY A 666 5 ? 5  
HELX_P HELX_P10 10 HIS A 221 ? LEU A 236 ? HIS A 688 LEU A 703 1 ? 16 
HELX_P HELX_P11 11 LEU A 236 ? CYS A 241 ? LEU A 703 CYS A 708 1 ? 6  
HELX_P HELX_P12 12 ASP A 259 ? ARG A 271 ? ASP A 726 ARG A 738 1 ? 13 
HELX_P HELX_P13 13 ASN A 305 ? GLY A 319 ? ASN A 772 GLY A 786 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 71  ? PRO A 72  ? VAL A 538 PRO A 539 
A 2 MET A 88  ? TYR A 89  ? MET A 555 TYR A 556 
B 1 SER A 74  ? ARG A 76  ? SER A 541 ARG A 543 
B 2 HIS A 79  ? ASP A 81  ? HIS A 546 ASP A 548 
C 1 VAL A 115 ? TYR A 116 ? VAL A 582 TYR A 583 
C 2 LEU A 123 ? ARG A 124 ? LEU A 590 ARG A 591 
D 1 PHE A 192 ? ARG A 193 ? PHE A 659 ARG A 660 
D 2 MET A 180 ? SER A 185 ? MET A 647 SER A 652 
D 3 THR A 166 ? GLY A 171 ? THR A 633 GLY A 638 
D 4 TYR A 207 ? ASN A 213 ? TYR A 674 ASN A 680 
D 5 LEU A 244 ? GLY A 254 ? LEU A 711 GLY A 721 
D 6 VAL A 290 ? TYR A 297 ? VAL A 757 TYR A 764 
D 7 PHE A 273 ? CYS A 279 ? PHE A 740 CYS A 746 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 71  ? N VAL A 538 O TYR A 89  ? O TYR A 556 
B 1 2 N SER A 74  ? N SER A 541 O ASP A 81  ? O ASP A 548 
C 1 2 N VAL A 115 ? N VAL A 582 O ARG A 124 ? O ARG A 591 
D 1 2 O PHE A 192 ? O PHE A 659 N SER A 185 ? N SER A 652 
D 2 3 O MET A 180 ? O MET A 647 N VAL A 167 ? N VAL A 634 
D 3 4 N VAL A 170 ? N VAL A 637 O PHE A 211 ? O PHE A 678 
D 4 5 N VAL A 212 ? N VAL A 679 O VAL A 251 ? O VAL A 718 
D 5 6 N GLY A 247 ? N GLY A 714 O TYR A 297 ? O TYR A 764 
D 6 7 O LEU A 291 ? O LEU A 758 N CYS A 279 ? N CYS A 746 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT A 101' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FMT A 102' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT A 103' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 LEU A 91  ? LEU A 558 . ? 1_555 ? 
2  AC1 4 ASN A 92  ? ASN A 559 . ? 1_555 ? 
3  AC1 4 LYS A 93  ? LYS A 560 . ? 1_555 ? 
4  AC1 4 ASN A 125 ? ASN A 592 . ? 4_456 ? 
5  AC2 3 HIS A 43  ? HIS A 510 . ? 1_555 ? 
6  AC2 3 SER A 44  ? SER A 511 . ? 1_555 ? 
7  AC2 3 TRP A 80  ? TRP A 547 . ? 1_555 ? 
8  AC3 4 ASN A 119 ? ASN A 586 . ? 1_555 ? 
9  AC3 4 ILE A 130 ? ILE A 597 . ? 1_555 ? 
10 AC3 4 LEU A 132 ? LEU A 599 . ? 1_555 ? 
11 AC3 4 VAL A 133 ? VAL A 600 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2HWK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HWK 
_atom_sites.fract_transf_matrix[1][1]   0.021066 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013778 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009376 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 6.102   -4.116  45.674 1.00 31.56  ? 468 ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 7.572   -4.007  46.034 1.00 62.22  ? 468 ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 7.756   -3.604  47.508 1.00 62.84  ? 468 ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 8.272   -4.371  48.338 1.00 39.82  ? 468 ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 8.275   -3.031  45.085 1.00 47.91  ? 468 ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 9.644   -2.633  45.569 1.00 74.98  ? 468 ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 10.213  -3.376  46.409 1.00 55.18  ? 468 ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 10.140  -1.573  45.105 1.00 51.25  ? 468 ASP A OD2 1 
ATOM   9    N N   . VAL A 1 2   ? 7.338   -2.385  47.826 1.00 37.53  ? 469 VAL A N   1 
ATOM   10   C CA  . VAL A 1 2   ? 6.923   -2.088  49.185 1.00 35.03  ? 469 VAL A CA  1 
ATOM   11   C C   . VAL A 1 2   ? 5.965   -3.208  49.627 1.00 35.18  ? 469 VAL A C   1 
ATOM   12   O O   . VAL A 1 2   ? 5.806   -3.473  50.828 1.00 31.48  ? 469 VAL A O   1 
ATOM   13   C CB  . VAL A 1 2   ? 6.104   -0.788  49.205 1.00 34.68  ? 469 VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 2   ? 5.541   -0.547  50.595 1.00 37.56  ? 469 VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 2   ? 6.967   0.366   48.759 1.00 33.04  ? 469 VAL A CG2 1 
ATOM   16   N N   . PHE A 1 3   ? 5.342   -3.852  48.633 1.00 28.14  ? 470 PHE A N   1 
ATOM   17   C CA  . PHE A 1 3   ? 4.249   -4.790  48.852 1.00 29.95  ? 470 PHE A CA  1 
ATOM   18   C C   . PHE A 1 3   ? 4.584   -6.251  48.660 1.00 29.83  ? 470 PHE A C   1 
ATOM   19   O O   . PHE A 1 3   ? 3.693   -7.097  48.676 1.00 36.25  ? 470 PHE A O   1 
ATOM   20   C CB  . PHE A 1 3   ? 3.091   -4.438  47.936 1.00 29.82  ? 470 PHE A CB  1 
ATOM   21   C CG  . PHE A 1 3   ? 2.640   -3.024  48.085 1.00 30.92  ? 470 PHE A CG  1 
ATOM   22   C CD1 . PHE A 1 3   ? 2.867   -2.102  47.062 1.00 27.71  ? 470 PHE A CD1 1 
ATOM   23   C CD2 . PHE A 1 3   ? 1.993   -2.608  49.256 1.00 27.56  ? 470 PHE A CD2 1 
ATOM   24   C CE1 . PHE A 1 3   ? 2.470   -0.791  47.193 1.00 27.44  ? 470 PHE A CE1 1 
ATOM   25   C CE2 . PHE A 1 3   ? 1.583   -1.284  49.405 1.00 33.72  ? 470 PHE A CE2 1 
ATOM   26   C CZ  . PHE A 1 3   ? 1.825   -0.364  48.363 1.00 29.84  ? 470 PHE A CZ  1 
ATOM   27   N N   . GLN A 1 4   ? 5.856   -6.559  48.477 1.00 26.89  ? 471 GLN A N   1 
ATOM   28   C CA  . GLN A 1 4   ? 6.260   -7.947  48.373 1.00 33.56  ? 471 GLN A CA  1 
ATOM   29   C C   . GLN A 1 4   ? 5.737   -8.799  49.553 1.00 35.66  ? 471 GLN A C   1 
ATOM   30   O O   . GLN A 1 4   ? 5.779   -8.366  50.710 1.00 35.93  ? 471 GLN A O   1 
ATOM   31   C CB  . GLN A 1 4   ? 7.778   -8.020  48.237 1.00 31.84  ? 471 GLN A CB  1 
ATOM   32   C CG  . GLN A 1 4   ? 8.344   -9.389  48.005 1.00 31.78  ? 471 GLN A CG  1 
ATOM   33   C CD  . GLN A 1 4   ? 9.773   -9.300  47.512 1.00 35.01  ? 471 GLN A CD  1 
ATOM   34   O OE1 . GLN A 1 4   ? 10.031  -9.484  46.328 1.00 29.96  ? 471 GLN A OE1 1 
ATOM   35   N NE2 . GLN A 1 4   ? 10.708  -8.987  48.414 1.00 35.90  ? 471 GLN A NE2 1 
ATOM   36   N N   . ASN A 1 5   ? 5.232   -9.994  49.223 1.00 31.37  ? 472 ASN A N   1 
ATOM   37   C CA  . ASN A 1 5   ? 4.708   -10.989 50.182 1.00 33.97  ? 472 ASN A CA  1 
ATOM   38   C C   . ASN A 1 5   ? 3.313   -10.656 50.719 1.00 31.29  ? 472 ASN A C   1 
ATOM   39   O O   . ASN A 1 5   ? 2.849   -11.252 51.681 1.00 30.18  ? 472 ASN A O   1 
ATOM   40   C CB  . ASN A 1 5   ? 5.679   -11.248 51.352 1.00 30.62  ? 472 ASN A CB  1 
ATOM   41   C CG  . ASN A 1 5   ? 7.051   -11.695 50.884 1.00 32.94  ? 472 ASN A CG  1 
ATOM   42   O OD1 . ASN A 1 5   ? 7.176   -12.543 50.007 1.00 42.76  ? 472 ASN A OD1 1 
ATOM   43   N ND2 . ASN A 1 5   ? 8.088   -11.119 51.469 1.00 35.86  ? 472 ASN A ND2 1 
ATOM   44   N N   . LYS A 1 6   ? 2.643   -9.696  50.097 1.00 32.24  ? 473 LYS A N   1 
ATOM   45   C CA  . LYS A 1 6   ? 1.353   -9.259  50.605 1.00 30.24  ? 473 LYS A CA  1 
ATOM   46   C C   . LYS A 1 6   ? 0.279   -9.662  49.618 1.00 31.05  ? 473 LYS A C   1 
ATOM   47   O O   . LYS A 1 6   ? 0.401   -9.456  48.418 1.00 36.56  ? 473 LYS A O   1 
ATOM   48   C CB  . LYS A 1 6   ? 1.348   -7.742  50.849 1.00 28.87  ? 473 LYS A CB  1 
ATOM   49   C CG  . LYS A 1 6   ? 2.441   -7.243  51.813 1.00 25.89  ? 473 LYS A CG  1 
ATOM   50   C CD  . LYS A 1 6   ? 2.287   -7.821  53.218 1.00 26.28  ? 473 LYS A CD  1 
ATOM   51   C CE  . LYS A 1 6   ? 3.365   -7.308  54.164 1.00 23.79  ? 473 LYS A CE  1 
ATOM   52   N NZ  . LYS A 1 6   ? 3.184   -7.783  55.556 1.00 24.16  ? 473 LYS A NZ  1 
ATOM   53   N N   . ALA A 1 7   ? -0.778  -10.260 50.124 1.00 30.10  ? 474 ALA A N   1 
ATOM   54   C CA  . ALA A 1 7   ? -1.799  -10.753 49.238 1.00 31.38  ? 474 ALA A CA  1 
ATOM   55   C C   . ALA A 1 7   ? -3.030  -9.897  49.297 1.00 28.07  ? 474 ALA A C   1 
ATOM   56   O O   . ALA A 1 7   ? -3.735  -9.818  48.316 1.00 28.07  ? 474 ALA A O   1 
ATOM   57   C CB  . ALA A 1 7   ? -2.151  -12.191 49.590 1.00 37.22  ? 474 ALA A CB  1 
ATOM   58   N N   . ASN A 1 8   ? -3.268  -9.251  50.444 1.00 27.36  ? 475 ASN A N   1 
ATOM   59   C CA  . ASN A 1 8   ? -4.575  -8.666  50.769 1.00 24.20  ? 475 ASN A CA  1 
ATOM   60   C C   . ASN A 1 8   ? -4.478  -7.163  51.045 1.00 26.95  ? 475 ASN A C   1 
ATOM   61   O O   . ASN A 1 8   ? -5.356  -6.602  51.692 1.00 42.04  ? 475 ASN A O   1 
ATOM   62   C CB  . ASN A 1 8   ? -5.137  -9.340  52.032 1.00 25.25  ? 475 ASN A CB  1 
ATOM   63   C CG  . ASN A 1 8   ? -5.101  -10.899 51.956 1.00 30.51  ? 475 ASN A CG  1 
ATOM   64   O OD1 . ASN A 1 8   ? -5.659  -11.506 51.049 1.00 28.55  ? 475 ASN A OD1 1 
ATOM   65   N ND2 . ASN A 1 8   ? -4.431  -11.526 52.920 1.00 25.94  ? 475 ASN A ND2 1 
ATOM   66   N N   . VAL A 1 9   ? -3.426  -6.509  50.559 1.00 24.25  ? 476 VAL A N   1 
ATOM   67   C CA  . VAL A 1 9   ? -3.205  -5.091  50.831 1.00 24.28  ? 476 VAL A CA  1 
ATOM   68   C C   . VAL A 1 9   ? -3.475  -4.176  49.634 1.00 24.41  ? 476 VAL A C   1 
ATOM   69   O O   . VAL A 1 9   ? -2.943  -3.071  49.538 1.00 24.46  ? 476 VAL A O   1 
ATOM   70   C CB  . VAL A 1 9   ? -1.775  -4.827  51.425 1.00 25.11  ? 476 VAL A CB  1 
ATOM   71   C CG1 . VAL A 1 9   ? -1.615  -5.551  52.752 1.00 25.12  ? 476 VAL A CG1 1 
ATOM   72   C CG2 . VAL A 1 9   ? -0.656  -5.272  50.450 1.00 22.39  ? 476 VAL A CG2 1 
ATOM   73   N N   . CYS A 1 10  ? -4.300  -4.647  48.714 1.00 27.15  ? 477 CYS A N   1 
ATOM   74   C CA  . CYS A 1 10  ? -4.671  -3.857  47.534 1.00 28.32  ? 477 CYS A CA  1 
ATOM   75   C C   . CYS A 1 10  ? -5.231  -2.489  47.964 1.00 25.09  ? 477 CYS A C   1 
ATOM   76   O O   . CYS A 1 10  ? -5.150  -1.517  47.219 1.00 23.91  ? 477 CYS A O   1 
ATOM   77   C CB  . CYS A 1 10  ? -5.668  -4.652  46.671 1.00 35.13  ? 477 CYS A CB  1 
ATOM   78   S SG  . CYS A 1 10  ? -7.125  -5.230  47.657 1.00 64.34  ? 477 CYS A SG  1 
ATOM   79   N N   . TRP A 1 11  ? -5.790  -2.434  49.173 1.00 25.02  ? 478 TRP A N   1 
ATOM   80   C CA  . TRP A 1 11  ? -6.217  -1.172  49.805 1.00 23.95  ? 478 TRP A CA  1 
ATOM   81   C C   . TRP A 1 11  ? -5.038  -0.239  50.068 1.00 24.16  ? 478 TRP A C   1 
ATOM   82   O O   . TRP A 1 11  ? -5.190  0.980   49.983 1.00 26.05  ? 478 TRP A O   1 
ATOM   83   C CB  . TRP A 1 11  ? -7.015  -1.400  51.105 1.00 21.48  ? 478 TRP A CB  1 
ATOM   84   C CG  . TRP A 1 11  ? -6.295  -2.268  52.115 1.00 23.41  ? 478 TRP A CG  1 
ATOM   85   C CD1 . TRP A 1 11  ? -6.385  -3.635  52.240 1.00 22.17  ? 478 TRP A CD1 1 
ATOM   86   C CD2 . TRP A 1 11  ? -5.366  -1.838  53.137 1.00 23.74  ? 478 TRP A CD2 1 
ATOM   87   N NE1 . TRP A 1 11  ? -5.581  -4.069  53.257 1.00 21.83  ? 478 TRP A NE1 1 
ATOM   88   C CE2 . TRP A 1 11  ? -4.944  -2.998  53.828 1.00 21.86  ? 478 TRP A CE2 1 
ATOM   89   C CE3 . TRP A 1 11  ? -4.854  -0.582  53.534 1.00 23.07  ? 478 TRP A CE3 1 
ATOM   90   C CZ2 . TRP A 1 11  ? -4.033  -2.947  54.902 1.00 23.23  ? 478 TRP A CZ2 1 
ATOM   91   C CZ3 . TRP A 1 11  ? -3.952  -0.528  54.595 1.00 22.64  ? 478 TRP A CZ3 1 
ATOM   92   C CH2 . TRP A 1 11  ? -3.549  -1.707  55.272 1.00 22.53  ? 478 TRP A CH2 1 
ATOM   93   N N   . ALA A 1 12  ? -3.866  -0.795  50.380 1.00 21.84  ? 479 ALA A N   1 
ATOM   94   C CA  . ALA A 1 12  ? -2.712  0.055   50.588 1.00 22.75  ? 479 ALA A CA  1 
ATOM   95   C C   . ALA A 1 12  ? -2.190  0.510   49.235 1.00 24.74  ? 479 ALA A C   1 
ATOM   96   O O   . ALA A 1 12  ? -1.660  1.609   49.111 1.00 26.41  ? 479 ALA A O   1 
ATOM   97   C CB  . ALA A 1 12  ? -1.622  -0.645  51.384 1.00 21.36  ? 479 ALA A CB  1 
ATOM   98   N N   . LYS A 1 13  ? -2.352  -0.328  48.218 1.00 24.73  ? 480 LYS A N   1 
ATOM   99   C CA  . LYS A 1 13  ? -1.876  0.029   46.885 1.00 26.82  ? 480 LYS A CA  1 
ATOM   100  C C   . LYS A 1 13  ? -2.720  1.146   46.283 1.00 26.19  ? 480 LYS A C   1 
ATOM   101  O O   . LYS A 1 13  ? -2.215  2.033   45.615 1.00 30.11  ? 480 LYS A O   1 
ATOM   102  C CB  . LYS A 1 13  ? -1.905  -1.198  45.968 1.00 28.87  ? 480 LYS A CB  1 
ATOM   103  C CG  . LYS A 1 13  ? -1.001  -2.337  46.438 1.00 39.58  ? 480 LYS A CG  1 
ATOM   104  C CD  . LYS A 1 13  ? -1.178  -3.578  45.570 1.00 42.22  ? 480 LYS A CD  1 
ATOM   105  C CE  . LYS A 1 13  ? -0.351  -4.742  46.054 1.00 33.77  ? 480 LYS A CE  1 
ATOM   106  N NZ  . LYS A 1 13  ? -0.500  -5.865  45.102 1.00 37.50  ? 480 LYS A NZ  1 
ATOM   107  N N   . ALA A 1 14  ? -4.021  1.091   46.526 1.00 29.54  ? 481 ALA A N   1 
ATOM   108  C CA  . ALA A 1 14  ? -4.951  2.055   45.960 1.00 26.71  ? 481 ALA A CA  1 
ATOM   109  C C   . ALA A 1 14  ? -4.630  3.404   46.534 1.00 28.42  ? 481 ALA A C   1 
ATOM   110  O O   . ALA A 1 14  ? -4.800  4.414   45.846 1.00 31.58  ? 481 ALA A O   1 
ATOM   111  C CB  . ALA A 1 14  ? -6.382  1.681   46.291 1.00 24.57  ? 481 ALA A CB  1 
ATOM   112  N N   . LEU A 1 15  ? -4.157  3.410   47.789 1.00 27.89  ? 482 LEU A N   1 
ATOM   113  C CA  . LEU A 1 15  ? -3.851  4.658   48.517 1.00 23.89  ? 482 LEU A CA  1 
ATOM   114  C C   . LEU A 1 15  ? -2.611  5.354   48.068 1.00 23.37  ? 482 LEU A C   1 
ATOM   115  O O   . LEU A 1 15  ? -2.560  6.566   48.135 1.00 25.55  ? 482 LEU A O   1 
ATOM   116  C CB  . LEU A 1 15  ? -3.807  4.481   50.040 1.00 21.29  ? 482 LEU A CB  1 
ATOM   117  C CG  . LEU A 1 15  ? -5.132  4.172   50.743 1.00 20.17  ? 482 LEU A CG  1 
ATOM   118  C CD1 . LEU A 1 15  ? -4.913  3.825   52.205 1.00 19.56  ? 482 LEU A CD1 1 
ATOM   119  C CD2 . LEU A 1 15  ? -6.095  5.340   50.574 1.00 19.47  ? 482 LEU A CD2 1 
ATOM   120  N N   . VAL A 1 16  ? -1.618  4.598   47.605 1.00 22.68  ? 483 VAL A N   1 
ATOM   121  C CA  . VAL A 1 16  ? -0.360  5.199   47.179 1.00 24.19  ? 483 VAL A CA  1 
ATOM   122  C C   . VAL A 1 16  ? -0.501  6.541   46.416 1.00 26.46  ? 483 VAL A C   1 
ATOM   123  O O   . VAL A 1 16  ? 0.080   7.551   46.828 1.00 29.78  ? 483 VAL A O   1 
ATOM   124  C CB  . VAL A 1 16  ? 0.557   4.194   46.437 1.00 24.16  ? 483 VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 16  ? 1.771   4.909   45.887 1.00 20.35  ? 483 VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 16  ? 0.997   3.063   47.399 1.00 22.23  ? 483 VAL A CG2 1 
ATOM   127  N N   . PRO A 1 17  ? -1.270  6.564   45.300 1.00 27.22  ? 484 PRO A N   1 
ATOM   128  C CA  . PRO A 1 17  ? -1.461  7.803   44.540 1.00 26.52  ? 484 PRO A CA  1 
ATOM   129  C C   . PRO A 1 17  ? -2.279  8.887   45.263 1.00 29.90  ? 484 PRO A C   1 
ATOM   130  O O   . PRO A 1 17  ? -2.080  10.093  45.005 1.00 27.01  ? 484 PRO A O   1 
ATOM   131  C CB  . PRO A 1 17  ? -2.126  7.304   43.244 1.00 27.11  ? 484 PRO A CB  1 
ATOM   132  C CG  . PRO A 1 17  ? -2.960  6.170   43.712 1.00 26.75  ? 484 PRO A CG  1 
ATOM   133  C CD  . PRO A 1 17  ? -2.009  5.450   44.665 1.00 26.21  ? 484 PRO A CD  1 
ATOM   134  N N   . VAL A 1 18  ? -3.178  8.472   46.169 1.00 27.44  ? 485 VAL A N   1 
ATOM   135  C CA  . VAL A 1 18  ? -3.872  9.441   47.035 1.00 26.08  ? 485 VAL A CA  1 
ATOM   136  C C   . VAL A 1 18  ? -2.900  10.174  47.990 1.00 25.40  ? 485 VAL A C   1 
ATOM   137  O O   . VAL A 1 18  ? -2.901  11.409  48.075 1.00 22.79  ? 485 VAL A O   1 
ATOM   138  C CB  . VAL A 1 18  ? -5.019  8.802   47.860 1.00 24.16  ? 485 VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 18  ? -5.653  9.842   48.754 1.00 23.32  ? 485 VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 18  ? -6.048  8.196   46.952 1.00 21.85  ? 485 VAL A CG2 1 
ATOM   141  N N   . LEU A 1 19  ? -2.074  9.406   48.697 1.00 24.16  ? 486 LEU A N   1 
ATOM   142  C CA  . LEU A 1 19  ? -1.116  9.962   49.666 1.00 24.89  ? 486 LEU A CA  1 
ATOM   143  C C   . LEU A 1 19  ? -0.075  10.830  48.947 1.00 24.69  ? 486 LEU A C   1 
ATOM   144  O O   . LEU A 1 19  ? 0.467   11.776  49.498 1.00 25.03  ? 486 LEU A O   1 
ATOM   145  C CB  . LEU A 1 19  ? -0.400  8.810   50.404 1.00 22.46  ? 486 LEU A CB  1 
ATOM   146  C CG  . LEU A 1 19  ? -1.333  7.890   51.195 1.00 22.35  ? 486 LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 19  ? -0.675  6.602   51.657 1.00 20.00  ? 486 LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 19  ? -1.998  8.670   52.359 1.00 20.74  ? 486 LEU A CD2 1 
ATOM   149  N N   . LYS A 1 20  ? 0.206   10.475  47.706 1.00 24.02  ? 487 LYS A N   1 
ATOM   150  C CA  . LYS A 1 20  ? 1.240   11.141  46.964 1.00 25.84  ? 487 LYS A CA  1 
ATOM   151  C C   . LYS A 1 20  ? 0.860   12.624  46.743 1.00 27.54  ? 487 LYS A C   1 
ATOM   152  O O   . LYS A 1 20  ? 1.745   13.493  46.679 1.00 26.74  ? 487 LYS A O   1 
ATOM   153  C CB  . LYS A 1 20  ? 1.519   10.338  45.692 1.00 26.11  ? 487 LYS A CB  1 
ATOM   154  C CG  . LYS A 1 20  ? 2.645   10.803  44.852 1.00 31.44  ? 487 LYS A CG  1 
ATOM   155  C CD  . LYS A 1 20  ? 3.227   9.621   44.078 1.00 44.41  ? 487 LYS A CD  1 
ATOM   156  C CE  . LYS A 1 20  ? 3.809   8.574   45.071 1.00 55.26  ? 487 LYS A CE  1 
ATOM   157  N NZ  . LYS A 1 20  ? 4.435   7.362   44.443 1.00 41.26  ? 487 LYS A NZ  1 
ATOM   158  N N   . THR A 1 21  ? -0.448  12.913  46.695 1.00 26.16  ? 488 THR A N   1 
ATOM   159  C CA  . THR A 1 21  ? -0.939  14.285  46.565 1.00 26.16  ? 488 THR A CA  1 
ATOM   160  C C   . THR A 1 21  ? -0.625  15.165  47.782 1.00 28.47  ? 488 THR A C   1 
ATOM   161  O O   . THR A 1 21  ? -0.565  16.388  47.668 1.00 31.54  ? 488 THR A O   1 
ATOM   162  C CB  . THR A 1 21  ? -2.459  14.373  46.286 1.00 26.30  ? 488 THR A CB  1 
ATOM   163  O OG1 . THR A 1 21  ? -3.207  13.957  47.440 1.00 26.83  ? 488 THR A OG1 1 
ATOM   164  C CG2 . THR A 1 21  ? -2.837  13.528  45.056 1.00 22.90  ? 488 THR A CG2 1 
ATOM   165  N N   . ALA A 1 22  ? -0.444  14.548  48.946 1.00 30.04  ? 489 ALA A N   1 
ATOM   166  C CA  . ALA A 1 22  ? -0.027  15.281  50.141 1.00 28.90  ? 489 ALA A CA  1 
ATOM   167  C C   . ALA A 1 22  ? 1.471   15.089  50.364 1.00 30.30  ? 489 ALA A C   1 
ATOM   168  O O   . ALA A 1 22  ? 1.959   15.259  51.483 1.00 29.37  ? 489 ALA A O   1 
ATOM   169  C CB  . ALA A 1 22  ? -0.801  14.812  51.352 1.00 28.83  ? 489 ALA A CB  1 
ATOM   170  N N   . GLY A 1 23  ? 2.179   14.721  49.290 1.00 29.55  ? 490 GLY A N   1 
ATOM   171  C CA  . GLY A 1 23  ? 3.630   14.582  49.320 1.00 28.09  ? 490 GLY A CA  1 
ATOM   172  C C   . GLY A 1 23  ? 4.126   13.318  49.995 1.00 28.67  ? 490 GLY A C   1 
ATOM   173  O O   . GLY A 1 23  ? 5.309   13.184  50.295 1.00 27.69  ? 490 GLY A O   1 
ATOM   174  N N   . ILE A 1 24  ? 3.208   12.388  50.233 1.00 29.60  ? 491 ILE A N   1 
ATOM   175  C CA  . ILE A 1 24  ? 3.496   11.194  51.015 1.00 32.86  ? 491 ILE A CA  1 
ATOM   176  C C   . ILE A 1 24  ? 3.889   9.969   50.210 1.00 29.24  ? 491 ILE A C   1 
ATOM   177  O O   . ILE A 1 24  ? 3.184   9.564   49.290 1.00 26.41  ? 491 ILE A O   1 
ATOM   178  C CB  . ILE A 1 24  ? 2.325   10.850  51.928 1.00 31.29  ? 491 ILE A CB  1 
ATOM   179  C CG1 . ILE A 1 24  ? 2.141   11.954  52.973 1.00 27.44  ? 491 ILE A CG1 1 
ATOM   180  C CG2 . ILE A 1 24  ? 2.475   9.431   52.501 1.00 28.02  ? 491 ILE A CG2 1 
ATOM   181  C CD1 . ILE A 1 24  ? 0.881   11.781  53.838 1.00 25.22  ? 491 ILE A CD1 1 
ATOM   182  N N   . ASP A 1 25  ? 5.016   9.381   50.595 1.00 32.09  ? 492 ASP A N   1 
ATOM   183  C CA  . ASP A 1 25  ? 5.545   8.182   49.940 1.00 35.10  ? 492 ASP A CA  1 
ATOM   184  C C   . ASP A 1 25  ? 5.883   7.106   51.004 1.00 28.80  ? 492 ASP A C   1 
ATOM   185  O O   . ASP A 1 25  ? 6.997   7.045   51.488 1.00 28.15  ? 492 ASP A O   1 
ATOM   186  C CB  . ASP A 1 25  ? 6.794   8.570   49.115 1.00 34.09  ? 492 ASP A CB  1 
ATOM   187  C CG  . ASP A 1 25  ? 7.326   7.426   48.273 1.00 35.55  ? 492 ASP A CG  1 
ATOM   188  O OD1 . ASP A 1 25  ? 6.554   6.899   47.440 1.00 137.79 ? 492 ASP A OD1 1 
ATOM   189  O OD2 . ASP A 1 25  ? 8.508   7.054   48.438 1.00 201.55 ? 492 ASP A OD2 1 
ATOM   190  N N   . MET A 1 26  ? 4.920   6.271   51.374 1.00 27.38  ? 493 MET A N   1 
ATOM   191  C CA  . MET A 1 26  ? 5.139   5.299   52.448 1.00 26.57  ? 493 MET A CA  1 
ATOM   192  C C   . MET A 1 26  ? 6.191   4.224   52.111 1.00 28.47  ? 493 MET A C   1 
ATOM   193  O O   . MET A 1 26  ? 6.116   3.557   51.063 1.00 28.97  ? 493 MET A O   1 
ATOM   194  C CB  . MET A 1 26  ? 3.834   4.562   52.752 1.00 27.88  ? 493 MET A CB  1 
ATOM   195  C CG  . MET A 1 26  ? 2.653   5.425   53.127 1.00 33.02  ? 493 MET A CG  1 
ATOM   196  S SD  . MET A 1 26  ? 2.695   6.125   54.766 1.00 28.66  ? 493 MET A SD  1 
ATOM   197  C CE  . MET A 1 26  ? 2.040   4.724   55.671 1.00 28.29  ? 493 MET A CE  1 
ATOM   198  N N   . THR A 1 27  ? 7.151   4.030   53.012 1.00 26.67  ? 494 THR A N   1 
ATOM   199  C CA  . THR A 1 27  ? 8.036   2.865   52.939 1.00 25.49  ? 494 THR A CA  1 
ATOM   200  C C   . THR A 1 27  ? 7.328   1.673   53.561 1.00 27.49  ? 494 THR A C   1 
ATOM   201  O O   . THR A 1 27  ? 6.289   1.840   54.232 1.00 25.06  ? 494 THR A O   1 
ATOM   202  C CB  . THR A 1 27  ? 9.288   3.077   53.786 1.00 26.85  ? 494 THR A CB  1 
ATOM   203  O OG1 . THR A 1 27  ? 8.892   3.350   55.145 1.00 28.06  ? 494 THR A OG1 1 
ATOM   204  C CG2 . THR A 1 27  ? 10.159  4.203   53.214 1.00 22.18  ? 494 THR A CG2 1 
ATOM   205  N N   . THR A 1 28  ? 7.901   0.482   53.351 1.00 26.82  ? 495 THR A N   1 
ATOM   206  C CA  . THR A 1 28  ? 7.375   -0.739  53.944 1.00 23.55  ? 495 THR A CA  1 
ATOM   207  C C   . THR A 1 28  ? 7.329   -0.569  55.438 1.00 25.22  ? 495 THR A C   1 
ATOM   208  O O   . THR A 1 28  ? 6.372   -1.011  56.086 1.00 23.41  ? 495 THR A O   1 
ATOM   209  C CB  . THR A 1 28  ? 8.253   -1.980  53.646 1.00 24.48  ? 495 THR A CB  1 
ATOM   210  O OG1 . THR A 1 28  ? 8.315   -2.197  52.237 1.00 29.58  ? 495 THR A OG1 1 
ATOM   211  C CG2 . THR A 1 28  ? 7.669   -3.252  54.303 1.00 21.12  ? 495 THR A CG2 1 
ATOM   212  N N   . GLU A 1 29  ? 8.363   0.071   55.990 1.00 25.46  ? 496 GLU A N   1 
ATOM   213  C CA  . GLU A 1 29  ? 8.413   0.242   57.436 1.00 25.66  ? 496 GLU A CA  1 
ATOM   214  C C   . GLU A 1 29  ? 7.273   1.127   57.943 1.00 26.30  ? 496 GLU A C   1 
ATOM   215  O O   . GLU A 1 29  ? 6.720   0.906   59.016 1.00 25.69  ? 496 GLU A O   1 
ATOM   216  C CB  . GLU A 1 29  ? 9.777   0.700   57.923 1.00 24.34  ? 496 GLU A CB  1 
ATOM   217  C CG  . GLU A 1 29  ? 10.951  -0.286  57.615 1.00 32.26  ? 496 GLU A CG  1 
ATOM   218  C CD  . GLU A 1 29  ? 11.345  -0.331  56.140 1.00 37.06  ? 496 GLU A CD  1 
ATOM   219  O OE1 . GLU A 1 29  ? 11.522  0.745   55.542 1.00 36.88  ? 496 GLU A OE1 1 
ATOM   220  O OE2 . GLU A 1 29  ? 11.489  -1.439  55.581 1.00 54.87  ? 496 GLU A OE2 1 
ATOM   221  N N   . GLN A 1 30  ? 6.891   2.109   57.140 1.00 26.39  ? 497 GLN A N   1 
ATOM   222  C CA  . GLN A 1 30  ? 5.758   2.939   57.482 1.00 23.97  ? 497 GLN A CA  1 
ATOM   223  C C   . GLN A 1 30  ? 4.421   2.222   57.326 1.00 22.39  ? 497 GLN A C   1 
ATOM   224  O O   . GLN A 1 30  ? 3.544   2.376   58.163 1.00 24.16  ? 497 GLN A O   1 
ATOM   225  C CB  . GLN A 1 30  ? 5.818   4.273   56.727 1.00 25.02  ? 497 GLN A CB  1 
ATOM   226  C CG  . GLN A 1 30  ? 7.098   5.015   57.050 1.00 27.44  ? 497 GLN A CG  1 
ATOM   227  C CD  . GLN A 1 30  ? 7.248   6.329   56.324 1.00 30.76  ? 497 GLN A CD  1 
ATOM   228  O OE1 . GLN A 1 30  ? 6.955   6.432   55.141 1.00 30.10  ? 497 GLN A OE1 1 
ATOM   229  N NE2 . GLN A 1 30  ? 7.741   7.336   57.032 1.00 38.08  ? 497 GLN A NE2 1 
ATOM   230  N N   . TRP A 1 31  ? 4.251   1.442   56.267 1.00 21.66  ? 498 TRP A N   1 
ATOM   231  C CA  . TRP A 1 31  ? 3.058   0.605   56.168 1.00 20.96  ? 498 TRP A CA  1 
ATOM   232  C C   . TRP A 1 31  ? 2.924   -0.391  57.308 1.00 23.31  ? 498 TRP A C   1 
ATOM   233  O O   . TRP A 1 31  ? 1.807   -0.696  57.705 1.00 27.33  ? 498 TRP A O   1 
ATOM   234  C CB  . TRP A 1 31  ? 2.938   -0.116  54.824 1.00 21.66  ? 498 TRP A CB  1 
ATOM   235  C CG  . TRP A 1 31  ? 2.555   0.748   53.664 1.00 22.27  ? 498 TRP A CG  1 
ATOM   236  C CD1 . TRP A 1 31  ? 3.332   1.089   52.597 1.00 21.97  ? 498 TRP A CD1 1 
ATOM   237  C CD2 . TRP A 1 31  ? 1.283   1.376   53.452 1.00 25.46  ? 498 TRP A CD2 1 
ATOM   238  N NE1 . TRP A 1 31  ? 2.628   1.882   51.723 1.00 22.37  ? 498 TRP A NE1 1 
ATOM   239  C CE2 . TRP A 1 31  ? 1.366   2.080   52.218 1.00 25.39  ? 498 TRP A CE2 1 
ATOM   240  C CE3 . TRP A 1 31  ? 0.075   1.410   54.178 1.00 23.73  ? 498 TRP A CE3 1 
ATOM   241  C CZ2 . TRP A 1 31  ? 0.279   2.816   51.689 1.00 24.69  ? 498 TRP A CZ2 1 
ATOM   242  C CZ3 . TRP A 1 31  ? -1.008  2.139   53.653 1.00 24.19  ? 498 TRP A CZ3 1 
ATOM   243  C CH2 . TRP A 1 31  ? -0.897  2.832   52.420 1.00 23.91  ? 498 TRP A CH2 1 
ATOM   244  N N   . ASN A 1 32  ? 4.048   -0.907  57.824 1.00 24.69  ? 499 ASN A N   1 
ATOM   245  C CA  . ASN A 1 32  ? 4.024   -1.828  58.963 1.00 23.48  ? 499 ASN A CA  1 
ATOM   246  C C   . ASN A 1 32  ? 3.369   -1.316  60.222 1.00 23.05  ? 499 ASN A C   1 
ATOM   247  O O   . ASN A 1 32  ? 3.072   -2.107  61.108 1.00 21.36  ? 499 ASN A O   1 
ATOM   248  C CB  . ASN A 1 32  ? 5.413   -2.394  59.326 1.00 25.05  ? 499 ASN A CB  1 
ATOM   249  C CG  . ASN A 1 32  ? 5.897   -3.443  58.352 1.00 22.86  ? 499 ASN A CG  1 
ATOM   250  O OD1 . ASN A 1 32  ? 5.101   -4.105  57.709 1.00 23.99  ? 499 ASN A OD1 1 
ATOM   251  N ND2 . ASN A 1 32  ? 7.195   -3.619  58.266 1.00 21.69  ? 499 ASN A ND2 1 
ATOM   252  N N   . THR A 1 33  ? 3.167   -0.002  60.317 1.00 23.16  ? 500 THR A N   1 
ATOM   253  C CA  . THR A 1 33  ? 2.504   0.561   61.487 1.00 22.84  ? 500 THR A CA  1 
ATOM   254  C C   . THR A 1 33  ? 1.004   0.540   61.309 1.00 22.24  ? 500 THR A C   1 
ATOM   255  O O   . THR A 1 33  ? 0.271   0.979   62.170 1.00 24.08  ? 500 THR A O   1 
ATOM   256  C CB  . THR A 1 33  ? 2.937   1.994   61.797 1.00 24.81  ? 500 THR A CB  1 
ATOM   257  O OG1 . THR A 1 33  ? 2.478   2.863   60.764 1.00 24.86  ? 500 THR A OG1 1 
ATOM   258  C CG2 . THR A 1 33  ? 4.455   2.085   61.890 1.00 22.46  ? 500 THR A CG2 1 
ATOM   259  N N   . VAL A 1 34  ? 0.537   0.032   60.181 1.00 23.52  ? 501 VAL A N   1 
ATOM   260  C CA  . VAL A 1 34  ? -0.883  -0.235  60.033 1.00 23.06  ? 501 VAL A CA  1 
ATOM   261  C C   . VAL A 1 34  ? -1.019  -1.738  60.237 1.00 25.97  ? 501 VAL A C   1 
ATOM   262  O O   . VAL A 1 34  ? -0.450  -2.527  59.484 1.00 28.61  ? 501 VAL A O   1 
ATOM   263  C CB  . VAL A 1 34  ? -1.422  0.192   58.643 1.00 21.80  ? 501 VAL A CB  1 
ATOM   264  C CG1 . VAL A 1 34  ? -2.917  -0.091  58.546 1.00 20.10  ? 501 VAL A CG1 1 
ATOM   265  C CG2 . VAL A 1 34  ? -1.146  1.672   58.382 1.00 19.99  ? 501 VAL A CG2 1 
ATOM   266  N N   . ASP A 1 35  ? -1.741  -2.146  61.274 1.00 31.70  ? 502 ASP A N   1 
ATOM   267  C CA  . ASP A 1 35  ? -1.732  -3.564  61.617 1.00 32.57  ? 502 ASP A CA  1 
ATOM   268  C C   . ASP A 1 35  ? -2.176  -4.543  60.556 1.00 31.32  ? 502 ASP A C   1 
ATOM   269  O O   . ASP A 1 35  ? -1.540  -5.586  60.392 1.00 35.90  ? 502 ASP A O   1 
ATOM   270  C CB  . ASP A 1 35  ? -2.216  -3.888  63.042 1.00 34.60  ? 502 ASP A CB  1 
ATOM   271  C CG  . ASP A 1 35  ? -1.213  -3.450  64.123 1.00 144.37 ? 502 ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 35  ? -1.545  -3.595  65.328 1.00 46.40  ? 502 ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 35  ? -0.092  -2.983  63.769 1.00 68.33  ? 502 ASP A OD2 1 
ATOM   274  N N   . TYR A 1 36  ? -3.243  -4.213  59.823 1.00 27.37  ? 503 TYR A N   1 
ATOM   275  C CA  . TYR A 1 36  ? -3.644  -5.049  58.699 1.00 25.01  ? 503 TYR A CA  1 
ATOM   276  C C   . TYR A 1 36  ? -2.631  -5.114  57.564 1.00 26.35  ? 503 TYR A C   1 
ATOM   277  O O   . TYR A 1 36  ? -2.718  -5.994  56.719 1.00 28.03  ? 503 TYR A O   1 
ATOM   278  C CB  . TYR A 1 36  ? -5.047  -4.729  58.188 1.00 24.55  ? 503 TYR A CB  1 
ATOM   279  C CG  . TYR A 1 36  ? -6.186  -5.275  59.021 1.00 23.89  ? 503 TYR A CG  1 
ATOM   280  C CD1 . TYR A 1 36  ? -5.999  -5.753  60.325 1.00 24.43  ? 503 TYR A CD1 1 
ATOM   281  C CD2 . TYR A 1 36  ? -7.461  -5.326  58.488 1.00 24.04  ? 503 TYR A CD2 1 
ATOM   282  C CE1 . TYR A 1 36  ? -7.088  -6.287  61.059 1.00 22.73  ? 503 TYR A CE1 1 
ATOM   283  C CE2 . TYR A 1 36  ? -8.524  -5.836  59.194 1.00 25.68  ? 503 TYR A CE2 1 
ATOM   284  C CZ  . TYR A 1 36  ? -8.345  -6.316  60.475 1.00 25.57  ? 503 TYR A CZ  1 
ATOM   285  O OH  . TYR A 1 36  ? -9.461  -6.808  61.120 1.00 28.22  ? 503 TYR A OH  1 
ATOM   286  N N   . PHE A 1 37  ? -1.654  -4.209  57.546 1.00 25.50  ? 504 PHE A N   1 
ATOM   287  C CA  . PHE A 1 37  ? -0.552  -4.358  56.595 1.00 27.12  ? 504 PHE A CA  1 
ATOM   288  C C   . PHE A 1 37  ? 0.452   -5.398  57.118 1.00 28.97  ? 504 PHE A C   1 
ATOM   289  O O   . PHE A 1 37  ? 0.894   -6.301  56.392 1.00 25.22  ? 504 PHE A O   1 
ATOM   290  C CB  . PHE A 1 37  ? 0.151   -3.021  56.319 1.00 26.22  ? 504 PHE A CB  1 
ATOM   291  C CG  . PHE A 1 37  ? 1.230   -3.112  55.277 1.00 25.97  ? 504 PHE A CG  1 
ATOM   292  C CD1 . PHE A 1 37  ? 2.532   -3.500  55.623 1.00 25.02  ? 504 PHE A CD1 1 
ATOM   293  C CD2 . PHE A 1 37  ? 0.947   -2.815  53.942 1.00 23.17  ? 504 PHE A CD2 1 
ATOM   294  C CE1 . PHE A 1 37  ? 3.544   -3.589  54.643 1.00 27.35  ? 504 PHE A CE1 1 
ATOM   295  C CE2 . PHE A 1 37  ? 1.944   -2.900  52.957 1.00 23.46  ? 504 PHE A CE2 1 
ATOM   296  C CZ  . PHE A 1 37  ? 3.252   -3.288  53.306 1.00 24.51  ? 504 PHE A CZ  1 
ATOM   297  N N   . GLU A 1 38  ? 0.796   -5.265  58.392 1.00 29.84  ? 505 GLU A N   1 
ATOM   298  C CA  . GLU A 1 38  ? 1.751   -6.168  59.011 1.00 32.35  ? 505 GLU A CA  1 
ATOM   299  C C   . GLU A 1 38  ? 1.238   -7.611  58.899 1.00 32.00  ? 505 GLU A C   1 
ATOM   300  O O   . GLU A 1 38  ? 1.970   -8.489  58.459 1.00 26.29  ? 505 GLU A O   1 
ATOM   301  C CB  . GLU A 1 38  ? 2.007   -5.739  60.468 1.00 31.68  ? 505 GLU A CB  1 
ATOM   302  C CG  . GLU A 1 38  ? 2.963   -6.626  61.287 1.00 39.64  ? 505 GLU A CG  1 
ATOM   303  C CD  . GLU A 1 38  ? 3.042   -6.207  62.770 1.00 60.43  ? 505 GLU A CD  1 
ATOM   304  O OE1 . GLU A 1 38  ? 2.001   -5.786  63.353 1.00 45.82  ? 505 GLU A OE1 1 
ATOM   305  O OE2 . GLU A 1 38  ? 4.144   -6.316  63.357 1.00 107.02 ? 505 GLU A OE2 1 
ATOM   306  N N   . THR A 1 39  ? -0.027  -7.838  59.264 1.00 34.66  ? 506 THR A N   1 
ATOM   307  C CA  . THR A 1 39  ? -0.624  -9.187  59.241 1.00 33.29  ? 506 THR A CA  1 
ATOM   308  C C   . THR A 1 39  ? -1.256  -9.543  57.877 1.00 37.27  ? 506 THR A C   1 
ATOM   309  O O   . THR A 1 39  ? -1.872  -10.591 57.719 1.00 28.35  ? 506 THR A O   1 
ATOM   310  C CB  . THR A 1 39  ? -1.683  -9.404  60.399 1.00 33.09  ? 506 THR A CB  1 
ATOM   311  O OG1 . THR A 1 39  ? -2.771  -8.474  60.291 1.00 28.55  ? 506 THR A OG1 1 
ATOM   312  C CG2 . THR A 1 39  ? -1.045  -9.246  61.766 1.00 31.58  ? 506 THR A CG2 1 
ATOM   313  N N   . ASP A 1 40  ? -1.104  -8.648  56.903 1.00 38.48  ? 507 ASP A N   1 
ATOM   314  C CA  . ASP A 1 40  ? -1.610  -8.865  55.555 1.00 28.33  ? 507 ASP A CA  1 
ATOM   315  C C   . ASP A 1 40  ? -3.077  -9.298  55.557 1.00 29.97  ? 507 ASP A C   1 
ATOM   316  O O   . ASP A 1 40  ? -3.383  -10.429 55.182 1.00 31.23  ? 507 ASP A O   1 
ATOM   317  C CB  . ASP A 1 40  ? -0.753  -9.907  54.831 1.00 25.79  ? 507 ASP A CB  1 
ATOM   318  C CG  . ASP A 1 40  ? -1.084  -10.029 53.347 1.00 28.30  ? 507 ASP A CG  1 
ATOM   319  O OD1 . ASP A 1 40  ? -1.944  -9.294  52.834 1.00 30.16  ? 507 ASP A OD1 1 
ATOM   320  O OD2 . ASP A 1 40  ? -0.462  -10.864 52.666 1.00 40.16  ? 507 ASP A OD2 1 
ATOM   321  N N   . LYS A 1 41  ? -3.975  -8.391  55.957 1.00 28.27  ? 508 LYS A N   1 
ATOM   322  C CA  . LYS A 1 41  ? -5.422  -8.618  55.915 1.00 25.13  ? 508 LYS A CA  1 
ATOM   323  C C   . LYS A 1 41  ? -6.179  -7.579  55.082 1.00 29.32  ? 508 LYS A C   1 
ATOM   324  O O   . LYS A 1 41  ? -5.691  -6.457  54.902 1.00 27.24  ? 508 LYS A O   1 
ATOM   325  C CB  . LYS A 1 41  ? -5.990  -8.640  57.326 1.00 27.96  ? 508 LYS A CB  1 
ATOM   326  C CG  . LYS A 1 41  ? -5.462  -9.767  58.193 1.00 28.83  ? 508 LYS A CG  1 
ATOM   327  C CD  . LYS A 1 41  ? -6.044  -9.683  59.593 1.00 47.02  ? 508 LYS A CD  1 
ATOM   328  C CE  . LYS A 1 41  ? -5.524  -10.803 60.504 1.00 47.22  ? 508 LYS A CE  1 
ATOM   329  N NZ  . LYS A 1 41  ? -6.032  -10.644 61.902 1.00 49.97  ? 508 LYS A NZ  1 
ATOM   330  N N   . ALA A 1 42  ? -7.365  -7.959  54.579 1.00 27.47  ? 509 ALA A N   1 
ATOM   331  C CA  . ALA A 1 42  ? -8.247  -7.064  53.816 1.00 25.63  ? 509 ALA A CA  1 
ATOM   332  C C   . ALA A 1 42  ? -8.761  -5.940  54.718 1.00 27.70  ? 509 ALA A C   1 
ATOM   333  O O   . ALA A 1 42  ? -9.007  -6.160  55.905 1.00 31.17  ? 509 ALA A O   1 
ATOM   334  C CB  . ALA A 1 42  ? -9.428  -7.840  53.214 1.00 20.66  ? 509 ALA A CB  1 
ATOM   335  N N   . HIS A 1 43  ? -8.943  -4.746  54.158 1.00 27.66  ? 510 HIS A N   1 
ATOM   336  C CA  . HIS A 1 43  ? -9.303  -3.591  54.975 1.00 27.19  ? 510 HIS A CA  1 
ATOM   337  C C   . HIS A 1 43  ? -9.995  -2.553  54.059 1.00 27.02  ? 510 HIS A C   1 
ATOM   338  O O   . HIS A 1 43  ? -9.992  -2.687  52.833 1.00 29.28  ? 510 HIS A O   1 
ATOM   339  C CB  . HIS A 1 43  ? -8.011  -2.991  55.582 1.00 25.52  ? 510 HIS A CB  1 
ATOM   340  C CG  . HIS A 1 43  ? -8.231  -2.148  56.809 1.00 25.91  ? 510 HIS A CG  1 
ATOM   341  N ND1 . HIS A 1 43  ? -9.418  -1.491  57.077 1.00 25.78  ? 510 HIS A ND1 1 
ATOM   342  C CD2 . HIS A 1 43  ? -7.408  -1.865  57.849 1.00 22.56  ? 510 HIS A CD2 1 
ATOM   343  C CE1 . HIS A 1 43  ? -9.316  -0.851  58.230 1.00 21.33  ? 510 HIS A CE1 1 
ATOM   344  N NE2 . HIS A 1 43  ? -8.108  -1.064  58.717 1.00 20.72  ? 510 HIS A NE2 1 
ATOM   345  N N   . SER A 1 44  ? -10.586 -1.529  54.659 1.00 23.48  ? 511 SER A N   1 
ATOM   346  C CA  . SER A 1 44  ? -11.176 -0.425  53.909 1.00 23.51  ? 511 SER A CA  1 
ATOM   347  C C   . SER A 1 44  ? -10.119 0.636   53.587 1.00 23.27  ? 511 SER A C   1 
ATOM   348  O O   . SER A 1 44  ? -9.434  1.117   54.492 1.00 24.33  ? 511 SER A O   1 
ATOM   349  C CB  . SER A 1 44  ? -12.258 0.234   54.758 1.00 22.58  ? 511 SER A CB  1 
ATOM   350  O OG  . SER A 1 44  ? -12.815 1.330   54.074 1.00 23.81  ? 511 SER A OG  1 
ATOM   351  N N   . ALA A 1 45  ? -9.984  1.025   52.321 1.00 22.08  ? 512 ALA A N   1 
ATOM   352  C CA  . ALA A 1 45  ? -9.018  2.094   52.007 1.00 22.85  ? 512 ALA A CA  1 
ATOM   353  C C   . ALA A 1 45  ? -9.452  3.450   52.576 1.00 23.49  ? 512 ALA A C   1 
ATOM   354  O O   . ALA A 1 45  ? -8.633  4.327   52.794 1.00 25.66  ? 512 ALA A O   1 
ATOM   355  C CB  . ALA A 1 45  ? -8.746  2.196   50.518 1.00 20.58  ? 512 ALA A CB  1 
ATOM   356  N N   . GLU A 1 46  ? -10.746 3.608   52.831 1.00 26.03  ? 513 GLU A N   1 
ATOM   357  C CA  . GLU A 1 46  ? -11.280 4.860   53.351 1.00 23.92  ? 513 GLU A CA  1 
ATOM   358  C C   . GLU A 1 46  ? -11.029 5.029   54.834 1.00 23.41  ? 513 GLU A C   1 
ATOM   359  O O   . GLU A 1 46  ? -10.647 6.097   55.283 1.00 24.12  ? 513 GLU A O   1 
ATOM   360  C CB  . GLU A 1 46  ? -12.764 4.944   53.050 1.00 27.11  ? 513 GLU A CB  1 
ATOM   361  C CG  . GLU A 1 46  ? -13.058 4.867   51.564 1.00 38.91  ? 513 GLU A CG  1 
ATOM   362  C CD  . GLU A 1 46  ? -14.516 5.133   51.214 1.00 46.84  ? 513 GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 46  ? -15.410 4.579   51.889 1.00 41.92  ? 513 GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 46  ? -14.756 5.893   50.248 1.00 50.47  ? 513 GLU A OE2 1 
ATOM   365  N N   . ILE A 1 47  ? -11.253 3.976   55.604 1.00 22.45  ? 514 ILE A N   1 
ATOM   366  C CA  . ILE A 1 47  ? -10.888 4.001   57.010 1.00 21.71  ? 514 ILE A CA  1 
ATOM   367  C C   . ILE A 1 47  ? -9.382  4.194   57.159 1.00 22.41  ? 514 ILE A C   1 
ATOM   368  O O   . ILE A 1 47  ? -8.943  5.043   57.918 1.00 26.62  ? 514 ILE A O   1 
ATOM   369  C CB  . ILE A 1 47  ? -11.324 2.719   57.713 1.00 22.59  ? 514 ILE A CB  1 
ATOM   370  C CG1 . ILE A 1 47  ? -12.851 2.621   57.706 1.00 21.74  ? 514 ILE A CG1 1 
ATOM   371  C CG2 . ILE A 1 47  ? -10.668 2.594   59.094 1.00 21.38  ? 514 ILE A CG2 1 
ATOM   372  C CD1 . ILE A 1 47  ? -13.380 1.350   58.305 1.00 21.67  ? 514 ILE A CD1 1 
ATOM   373  N N   . VAL A 1 48  ? -8.586  3.414   56.435 1.00 22.17  ? 515 VAL A N   1 
ATOM   374  C CA  . VAL A 1 48  ? -7.141  3.617   56.439 1.00 20.94  ? 515 VAL A CA  1 
ATOM   375  C C   . VAL A 1 48  ? -6.673  5.041   56.077 1.00 21.29  ? 515 VAL A C   1 
ATOM   376  O O   . VAL A 1 48  ? -5.844  5.632   56.784 1.00 21.93  ? 515 VAL A O   1 
ATOM   377  C CB  . VAL A 1 48  ? -6.398  2.512   55.672 1.00 19.86  ? 515 VAL A CB  1 
ATOM   378  C CG1 . VAL A 1 48  ? -4.901  2.815   55.558 1.00 18.45  ? 515 VAL A CG1 1 
ATOM   379  C CG2 . VAL A 1 48  ? -6.575  1.222   56.430 1.00 20.68  ? 515 VAL A CG2 1 
ATOM   380  N N   . LEU A 1 49  ? -7.196  5.587   54.986 1.00 20.43  ? 516 LEU A N   1 
ATOM   381  C CA  . LEU A 1 49  ? -6.974  7.000   54.667 1.00 20.83  ? 516 LEU A CA  1 
ATOM   382  C C   . LEU A 1 49  ? -7.309  7.936   55.851 1.00 22.00  ? 516 LEU A C   1 
ATOM   383  O O   . LEU A 1 49  ? -6.558  8.868   56.126 1.00 23.88  ? 516 LEU A O   1 
ATOM   384  C CB  . LEU A 1 49  ? -7.797  7.416   53.449 1.00 20.07  ? 516 LEU A CB  1 
ATOM   385  C CG  . LEU A 1 49  ? -7.608  8.852   52.963 1.00 21.44  ? 516 LEU A CG  1 
ATOM   386  C CD1 . LEU A 1 49  ? -6.113  9.085   52.677 1.00 22.23  ? 516 LEU A CD1 1 
ATOM   387  C CD2 . LEU A 1 49  ? -8.478  9.177   51.717 1.00 19.50  ? 516 LEU A CD2 1 
ATOM   388  N N   . ASN A 1 50  ? -8.421  7.687   56.548 1.00 21.89  ? 517 ASN A N   1 
ATOM   389  C CA  . ASN A 1 50  ? -8.849  8.574   57.629 1.00 21.95  ? 517 ASN A CA  1 
ATOM   390  C C   . ASN A 1 50  ? -7.790  8.505   58.704 1.00 22.42  ? 517 ASN A C   1 
ATOM   391  O O   . ASN A 1 50  ? -7.396  9.502   59.306 1.00 21.08  ? 517 ASN A O   1 
ATOM   392  C CB  . ASN A 1 50  ? -10.183 8.114   58.231 1.00 22.68  ? 517 ASN A CB  1 
ATOM   393  C CG  . ASN A 1 50  ? -10.713 9.091   59.280 1.00 23.52  ? 517 ASN A CG  1 
ATOM   394  O OD1 . ASN A 1 50  ? -11.055 10.208  58.942 1.00 23.46  ? 517 ASN A OD1 1 
ATOM   395  N ND2 . ASN A 1 50  ? -10.765 8.677   60.548 1.00 21.21  ? 517 ASN A ND2 1 
ATOM   396  N N   . GLN A 1 51  ? -7.329  7.289   58.926 1.00 23.51  ? 518 GLN A N   1 
ATOM   397  C CA  . GLN A 1 51  ? -6.410  7.003   59.999 1.00 23.97  ? 518 GLN A CA  1 
ATOM   398  C C   . GLN A 1 51  ? -5.035  7.633   59.716 1.00 24.57  ? 518 GLN A C   1 
ATOM   399  O O   . GLN A 1 51  ? -4.395  8.213   60.607 1.00 22.92  ? 518 GLN A O   1 
ATOM   400  C CB  . GLN A 1 51  ? -6.351  5.501   60.164 1.00 23.16  ? 518 GLN A CB  1 
ATOM   401  C CG  . GLN A 1 51  ? -5.464  5.026   61.256 1.00 35.97  ? 518 GLN A CG  1 
ATOM   402  C CD  . GLN A 1 51  ? -5.602  3.538   61.440 1.00 55.84  ? 518 GLN A CD  1 
ATOM   403  O OE1 . GLN A 1 51  ? -6.725  3.019   61.570 1.00 58.18  ? 518 GLN A OE1 1 
ATOM   404  N NE2 . GLN A 1 51  ? -4.473  2.833   61.449 1.00 51.29  ? 518 GLN A NE2 1 
ATOM   405  N N   . LEU A 1 52  ? -4.596  7.546   58.465 1.00 24.13  ? 519 LEU A N   1 
ATOM   406  C CA  . LEU A 1 52  ? -3.344  8.177   58.077 1.00 24.00  ? 519 LEU A CA  1 
ATOM   407  C C   . LEU A 1 52  ? -3.450  9.711   58.120 1.00 26.55  ? 519 LEU A C   1 
ATOM   408  O O   . LEU A 1 52  ? -2.479  10.404  58.448 1.00 24.21  ? 519 LEU A O   1 
ATOM   409  C CB  . LEU A 1 52  ? -2.847  7.660   56.716 1.00 21.77  ? 519 LEU A CB  1 
ATOM   410  C CG  . LEU A 1 52  ? -2.475  6.169   56.700 1.00 23.11  ? 519 LEU A CG  1 
ATOM   411  C CD1 . LEU A 1 52  ? -2.196  5.647   55.280 1.00 19.26  ? 519 LEU A CD1 1 
ATOM   412  C CD2 . LEU A 1 52  ? -1.316  5.883   57.678 1.00 20.02  ? 519 LEU A CD2 1 
ATOM   413  N N   . CYS A 1 53  ? -4.635  10.234  57.810 1.00 24.90  ? 520 CYS A N   1 
ATOM   414  C CA  . CYS A 1 53  ? -4.826  11.671  57.806 1.00 24.56  ? 520 CYS A CA  1 
ATOM   415  C C   . CYS A 1 53  ? -4.654  12.207  59.241 1.00 24.98  ? 520 CYS A C   1 
ATOM   416  O O   . CYS A 1 53  ? -4.076  13.262  59.449 1.00 25.51  ? 520 CYS A O   1 
ATOM   417  C CB  . CYS A 1 53  ? -6.204  12.019  57.226 1.00 23.60  ? 520 CYS A CB  1 
ATOM   418  S SG  . CYS A 1 53  ? -6.507  13.785  56.937 1.00 27.12  ? 520 CYS A SG  1 
ATOM   419  N N   . VAL A 1 54  ? -5.156  11.458  60.219 1.00 24.72  ? 521 VAL A N   1 
ATOM   420  C CA  . VAL A 1 54  ? -5.045  11.810  61.622 1.00 23.47  ? 521 VAL A CA  1 
ATOM   421  C C   . VAL A 1 54  ? -3.571  11.767  61.997 1.00 26.12  ? 521 VAL A C   1 
ATOM   422  O O   . VAL A 1 54  ? -2.998  12.775  62.417 1.00 29.29  ? 521 VAL A O   1 
ATOM   423  C CB  . VAL A 1 54  ? -5.879  10.827  62.498 1.00 26.18  ? 521 VAL A CB  1 
ATOM   424  C CG1 . VAL A 1 54  ? -5.704  11.109  63.995 1.00 26.31  ? 521 VAL A CG1 1 
ATOM   425  C CG2 . VAL A 1 54  ? -7.362  10.909  62.118 1.00 25.95  ? 521 VAL A CG2 1 
ATOM   426  N N   . ARG A 1 55  ? -2.948  10.603  61.837 1.00 25.51  ? 522 ARG A N   1 
ATOM   427  C CA  . ARG A 1 55  ? -1.520  10.488  62.084 1.00 25.92  ? 522 ARG A CA  1 
ATOM   428  C C   . ARG A 1 55  ? -0.674  11.581  61.420 1.00 23.92  ? 522 ARG A C   1 
ATOM   429  O O   . ARG A 1 55  ? 0.051   12.284  62.081 1.00 23.69  ? 522 ARG A O   1 
ATOM   430  C CB  . ARG A 1 55  ? -1.018  9.095   61.741 1.00 26.09  ? 522 ARG A CB  1 
ATOM   431  C CG  . ARG A 1 55  ? -1.608  8.043   62.630 1.00 26.91  ? 522 ARG A CG  1 
ATOM   432  C CD  . ARG A 1 55  ? -1.218  6.666   62.172 1.00 26.49  ? 522 ARG A CD  1 
ATOM   433  N NE  . ARG A 1 55  ? -1.864  5.633   62.974 1.00 29.17  ? 522 ARG A NE  1 
ATOM   434  C CZ  . ARG A 1 55  ? -1.660  4.331   62.797 1.00 35.22  ? 522 ARG A CZ  1 
ATOM   435  N NH1 . ARG A 1 55  ? -0.835  3.913   61.843 1.00 33.27  ? 522 ARG A NH1 1 
ATOM   436  N NH2 . ARG A 1 55  ? -2.269  3.446   63.578 1.00 64.57  ? 522 ARG A NH2 1 
ATOM   437  N N   . PHE A 1 56  ? -0.772  11.739  60.117 1.00 24.98  ? 523 PHE A N   1 
ATOM   438  C CA  . PHE A 1 56  ? -0.056  12.840  59.476 1.00 25.95  ? 523 PHE A CA  1 
ATOM   439  C C   . PHE A 1 56  ? -0.364  14.269  59.896 1.00 26.51  ? 523 PHE A C   1 
ATOM   440  O O   . PHE A 1 56  ? 0.569   15.023  60.167 1.00 30.90  ? 523 PHE A O   1 
ATOM   441  C CB  . PHE A 1 56  ? 0.042   12.719  57.944 1.00 21.96  ? 523 PHE A CB  1 
ATOM   442  C CG  . PHE A 1 56  ? 1.063   11.694  57.462 1.00 21.66  ? 523 PHE A CG  1 
ATOM   443  C CD1 . PHE A 1 56  ? 2.385   12.086  57.182 1.00 21.10  ? 523 PHE A CD1 1 
ATOM   444  C CD2 . PHE A 1 56  ? 0.714   10.353  57.275 1.00 21.05  ? 523 PHE A CD2 1 
ATOM   445  C CE1 . PHE A 1 56  ? 3.345   11.167  56.709 1.00 20.09  ? 523 PHE A CE1 1 
ATOM   446  C CE2 . PHE A 1 56  ? 1.661   9.427   56.806 1.00 21.22  ? 523 PHE A CE2 1 
ATOM   447  C CZ  . PHE A 1 56  ? 2.984   9.844   56.519 1.00 21.59  ? 523 PHE A CZ  1 
ATOM   448  N N   . PHE A 1 57  ? -1.645  14.636  59.964 1.00 24.04  ? 524 PHE A N   1 
ATOM   449  C CA  . PHE A 1 57  ? -2.030  16.046  60.020 1.00 22.99  ? 524 PHE A CA  1 
ATOM   450  C C   . PHE A 1 57  ? -2.962  16.419  61.198 1.00 25.26  ? 524 PHE A C   1 
ATOM   451  O O   . PHE A 1 57  ? -3.431  17.561  61.283 1.00 27.18  ? 524 PHE A O   1 
ATOM   452  C CB  . PHE A 1 57  ? -2.655  16.453  58.675 1.00 21.92  ? 524 PHE A CB  1 
ATOM   453  C CG  . PHE A 1 57  ? -1.795  16.109  57.486 1.00 22.73  ? 524 PHE A CG  1 
ATOM   454  C CD1 . PHE A 1 57  ? -2.317  15.383  56.420 1.00 22.74  ? 524 PHE A CD1 1 
ATOM   455  C CD2 . PHE A 1 57  ? -0.455  16.491  57.436 1.00 22.69  ? 524 PHE A CD2 1 
ATOM   456  C CE1 . PHE A 1 57  ? -1.504  15.016  55.313 1.00 24.40  ? 524 PHE A CE1 1 
ATOM   457  C CE2 . PHE A 1 57  ? 0.355   16.131  56.342 1.00 25.65  ? 524 PHE A CE2 1 
ATOM   458  C CZ  . PHE A 1 57  ? -0.180  15.379  55.270 1.00 23.02  ? 524 PHE A CZ  1 
ATOM   459  N N   . GLY A 1 58  ? -3.219  15.466  62.097 1.00 23.90  ? 525 GLY A N   1 
ATOM   460  C CA  . GLY A 1 58  ? -4.041  15.726  63.267 1.00 23.80  ? 525 GLY A CA  1 
ATOM   461  C C   . GLY A 1 58  ? -5.495  16.080  62.989 1.00 26.90  ? 525 GLY A C   1 
ATOM   462  O O   . GLY A 1 58  ? -6.178  16.637  63.871 1.00 26.65  ? 525 GLY A O   1 
ATOM   463  N N   . LEU A 1 59  ? -5.967  15.743  61.780 1.00 25.65  ? 526 LEU A N   1 
ATOM   464  C CA  . LEU A 1 59  ? -7.347  16.017  61.339 1.00 26.05  ? 526 LEU A CA  1 
ATOM   465  C C   . LEU A 1 59  ? -7.910  14.745  60.688 1.00 25.38  ? 526 LEU A C   1 
ATOM   466  O O   . LEU A 1 59  ? -7.159  13.994  60.083 1.00 25.36  ? 526 LEU A O   1 
ATOM   467  C CB  . LEU A 1 59  ? -7.330  17.152  60.309 1.00 25.29  ? 526 LEU A CB  1 
ATOM   468  C CG  . LEU A 1 59  ? -6.770  18.500  60.788 1.00 28.02  ? 526 LEU A CG  1 
ATOM   469  C CD1 . LEU A 1 59  ? -6.388  19.390  59.631 1.00 30.32  ? 526 LEU A CD1 1 
ATOM   470  C CD2 . LEU A 1 59  ? -7.698  19.215  61.785 1.00 27.70  ? 526 LEU A CD2 1 
ATOM   471  N N   . ASP A 1 60  ? -9.216  14.489  60.804 1.00 24.23  ? 527 ASP A N   1 
ATOM   472  C CA  . ASP A 1 60  ? -9.792  13.360  60.066 1.00 24.27  ? 527 ASP A CA  1 
ATOM   473  C C   . ASP A 1 60  ? -10.398 13.875  58.761 1.00 25.00  ? 527 ASP A C   1 
ATOM   474  O O   . ASP A 1 60  ? -10.450 15.088  58.549 1.00 23.43  ? 527 ASP A O   1 
ATOM   475  C CB  . ASP A 1 60  ? -10.789 12.522  60.892 1.00 22.13  ? 527 ASP A CB  1 
ATOM   476  C CG  . ASP A 1 60  ? -12.118 13.251  61.185 1.00 28.74  ? 527 ASP A CG  1 
ATOM   477  O OD1 . ASP A 1 60  ? -12.823 12.780  62.106 1.00 28.72  ? 527 ASP A OD1 1 
ATOM   478  O OD2 . ASP A 1 60  ? -12.490 14.257  60.501 1.00 27.07  ? 527 ASP A OD2 1 
ATOM   479  N N   . LEU A 1 61  ? -10.847 12.963  57.896 1.00 26.24  ? 528 LEU A N   1 
ATOM   480  C CA  . LEU A 1 61  ? -11.442 13.340  56.606 1.00 27.50  ? 528 LEU A CA  1 
ATOM   481  C C   . LEU A 1 61  ? -12.573 14.364  56.602 1.00 26.17  ? 528 LEU A C   1 
ATOM   482  O O   . LEU A 1 61  ? -12.725 15.085  55.628 1.00 25.47  ? 528 LEU A O   1 
ATOM   483  C CB  . LEU A 1 61  ? -11.799 12.129  55.729 1.00 27.05  ? 528 LEU A CB  1 
ATOM   484  C CG  . LEU A 1 61  ? -10.646 11.222  55.267 1.00 26.85  ? 528 LEU A CG  1 
ATOM   485  C CD1 . LEU A 1 61  ? -11.217 10.102  54.378 1.00 25.49  ? 528 LEU A CD1 1 
ATOM   486  C CD2 . LEU A 1 61  ? -9.570  12.002  54.514 1.00 21.98  ? 528 LEU A CD2 1 
ATOM   487  N N   . ASP A 1 62  ? -13.358 14.436  57.674 1.00 27.31  ? 529 ASP A N   1 
ATOM   488  C CA  . ASP A 1 62  ? -14.434 15.423  57.731 1.00 28.96  ? 529 ASP A CA  1 
ATOM   489  C C   . ASP A 1 62  ? -13.937 16.854  57.557 1.00 27.09  ? 529 ASP A C   1 
ATOM   490  O O   . ASP A 1 62  ? -14.731 17.759  57.332 1.00 29.61  ? 529 ASP A O   1 
ATOM   491  C CB  . ASP A 1 62  ? -15.218 15.312  59.035 1.00 29.40  ? 529 ASP A CB  1 
ATOM   492  C CG  . ASP A 1 62  ? -15.892 13.988  59.179 1.00 32.46  ? 529 ASP A CG  1 
ATOM   493  O OD1 . ASP A 1 62  ? -16.341 13.484  58.134 1.00 30.25  ? 529 ASP A OD1 1 
ATOM   494  O OD2 . ASP A 1 62  ? -15.982 13.461  60.319 1.00 40.13  ? 529 ASP A OD2 1 
ATOM   495  N N   . SER A 1 63  ? -12.626 17.056  57.663 1.00 24.78  ? 530 SER A N   1 
ATOM   496  C CA  . SER A 1 63  ? -12.055 18.390  57.554 1.00 23.48  ? 530 SER A CA  1 
ATOM   497  C C   . SER A 1 63  ? -12.008 18.758  56.097 1.00 23.66  ? 530 SER A C   1 
ATOM   498  O O   . SER A 1 63  ? -11.800 19.909  55.757 1.00 25.05  ? 530 SER A O   1 
ATOM   499  C CB  . SER A 1 63  ? -10.621 18.398  58.061 1.00 23.85  ? 530 SER A CB  1 
ATOM   500  O OG  . SER A 1 63  ? -9.808  17.582  57.230 1.00 30.45  ? 530 SER A OG  1 
ATOM   501  N N   . GLY A 1 64  ? -12.148 17.764  55.227 1.00 22.73  ? 531 GLY A N   1 
ATOM   502  C CA  . GLY A 1 64  ? -12.099 18.035  53.800 1.00 21.64  ? 531 GLY A CA  1 
ATOM   503  C C   . GLY A 1 64  ? -10.700 18.118  53.209 1.00 21.88  ? 531 GLY A C   1 
ATOM   504  O O   . GLY A 1 64  ? -10.523 18.358  52.016 1.00 21.48  ? 531 GLY A O   1 
ATOM   505  N N   . LEU A 1 65  ? -9.700  17.876  54.039 1.00 21.17  ? 532 LEU A N   1 
ATOM   506  C CA  . LEU A 1 65  ? -8.326  17.942  53.602 1.00 22.27  ? 532 LEU A CA  1 
ATOM   507  C C   . LEU A 1 65  ? -7.975  17.077  52.370 1.00 22.71  ? 532 LEU A C   1 
ATOM   508  O O   . LEU A 1 65  ? -7.119  17.456  51.596 1.00 24.96  ? 532 LEU A O   1 
ATOM   509  C CB  . LEU A 1 65  ? -7.444  17.609  54.791 1.00 23.20  ? 532 LEU A CB  1 
ATOM   510  C CG  . LEU A 1 65  ? -5.945  17.775  54.653 1.00 23.37  ? 532 LEU A CG  1 
ATOM   511  C CD1 . LEU A 1 65  ? -5.638  19.217  54.300 1.00 21.23  ? 532 LEU A CD1 1 
ATOM   512  C CD2 . LEU A 1 65  ? -5.334  17.393  55.987 1.00 24.64  ? 532 LEU A CD2 1 
ATOM   513  N N   . PHE A 1 66  ? -8.616  15.918  52.206 1.00 23.34  ? 533 PHE A N   1 
ATOM   514  C CA  . PHE A 1 66  ? -8.486  15.085  50.998 1.00 22.29  ? 533 PHE A CA  1 
ATOM   515  C C   . PHE A 1 66  ? -9.703  15.039  50.086 1.00 23.83  ? 533 PHE A C   1 
ATOM   516  O O   . PHE A 1 66  ? -9.909  14.030  49.390 1.00 23.90  ? 533 PHE A O   1 
ATOM   517  C CB  . PHE A 1 66  ? -8.086  13.635  51.304 1.00 22.46  ? 533 PHE A CB  1 
ATOM   518  C CG  . PHE A 1 66  ? -6.660  13.469  51.754 1.00 23.99  ? 533 PHE A CG  1 
ATOM   519  C CD1 . PHE A 1 66  ? -6.315  13.588  53.098 1.00 22.29  ? 533 PHE A CD1 1 
ATOM   520  C CD2 . PHE A 1 66  ? -5.646  13.188  50.806 1.00 23.02  ? 533 PHE A CD2 1 
ATOM   521  C CE1 . PHE A 1 66  ? -4.971  13.434  53.509 1.00 22.21  ? 533 PHE A CE1 1 
ATOM   522  C CE2 . PHE A 1 66  ? -4.307  13.029  51.198 1.00 21.80  ? 533 PHE A CE2 1 
ATOM   523  C CZ  . PHE A 1 66  ? -3.963  13.153  52.553 1.00 21.86  ? 533 PHE A CZ  1 
ATOM   524  N N   . SER A 1 67  ? -10.494 16.116  50.073 1.00 22.07  ? 534 SER A N   1 
ATOM   525  C CA  . SER A 1 67  ? -11.746 16.120  49.329 1.00 21.15  ? 534 SER A CA  1 
ATOM   526  C C   . SER A 1 67  ? -11.622 16.455  47.835 1.00 21.11  ? 534 SER A C   1 
ATOM   527  O O   . SER A 1 67  ? -12.607 16.382  47.098 1.00 20.53  ? 534 SER A O   1 
ATOM   528  C CB  . SER A 1 67  ? -12.814 16.986  50.011 1.00 20.69  ? 534 SER A CB  1 
ATOM   529  O OG  . SER A 1 67  ? -12.419 18.348  50.062 1.00 21.28  ? 534 SER A OG  1 
ATOM   530  N N   . ALA A 1 68  ? -10.420 16.784  47.377 1.00 20.85  ? 535 ALA A N   1 
ATOM   531  C CA  . ALA A 1 68  ? -10.234 17.073  45.952 1.00 22.32  ? 535 ALA A CA  1 
ATOM   532  C C   . ALA A 1 68  ? -10.506 15.832  45.103 1.00 23.08  ? 535 ALA A C   1 
ATOM   533  O O   . ALA A 1 68  ? -10.124 14.720  45.466 1.00 21.48  ? 535 ALA A O   1 
ATOM   534  C CB  . ALA A 1 68  ? -8.829  17.627  45.669 1.00 20.64  ? 535 ALA A CB  1 
ATOM   535  N N   . PRO A 1 69  ? -11.191 16.009  43.960 1.00 24.14  ? 536 PRO A N   1 
ATOM   536  C CA  . PRO A 1 69  ? -11.493 14.868  43.082 1.00 24.86  ? 536 PRO A CA  1 
ATOM   537  C C   . PRO A 1 69  ? -10.305 14.553  42.149 1.00 26.24  ? 536 PRO A C   1 
ATOM   538  O O   . PRO A 1 69  ? -10.335 14.810  40.936 1.00 26.04  ? 536 PRO A O   1 
ATOM   539  C CB  . PRO A 1 69  ? -12.736 15.368  42.326 1.00 21.92  ? 536 PRO A CB  1 
ATOM   540  C CG  . PRO A 1 69  ? -12.364 16.795  42.039 1.00 20.77  ? 536 PRO A CG  1 
ATOM   541  C CD  . PRO A 1 69  ? -11.766 17.256  43.410 1.00 21.84  ? 536 PRO A CD  1 
ATOM   542  N N   . THR A 1 70  ? -9.258  13.990  42.737 1.00 27.86  ? 537 THR A N   1 
ATOM   543  C CA  . THR A 1 70  ? -8.021  13.775  42.012 1.00 28.46  ? 537 THR A CA  1 
ATOM   544  C C   . THR A 1 70  ? -7.828  12.303  41.646 1.00 31.09  ? 537 THR A C   1 
ATOM   545  O O   . THR A 1 70  ? -7.582  11.990  40.487 1.00 33.37  ? 537 THR A O   1 
ATOM   546  C CB  . THR A 1 70  ? -6.817  14.331  42.794 1.00 25.88  ? 537 THR A CB  1 
ATOM   547  O OG1 . THR A 1 70  ? -6.648  13.577  43.998 1.00 135.11 ? 537 THR A OG1 1 
ATOM   548  C CG2 . THR A 1 70  ? -7.112  15.763  43.203 1.00 28.34  ? 537 THR A CG2 1 
ATOM   549  N N   . VAL A 1 71  ? -7.967  11.400  42.620 1.00 29.98  ? 538 VAL A N   1 
ATOM   550  C CA  . VAL A 1 71  ? -7.710  9.973   42.386 1.00 26.92  ? 538 VAL A CA  1 
ATOM   551  C C   . VAL A 1 71  ? -8.888  9.137   42.902 1.00 29.64  ? 538 VAL A C   1 
ATOM   552  O O   . VAL A 1 71  ? -9.321  9.329   44.039 1.00 31.78  ? 538 VAL A O   1 
ATOM   553  C CB  . VAL A 1 71  ? -6.440  9.521   43.170 1.00 26.30  ? 538 VAL A CB  1 
ATOM   554  C CG1 . VAL A 1 71  ? -6.108  8.046   42.909 1.00 24.98  ? 538 VAL A CG1 1 
ATOM   555  C CG2 . VAL A 1 71  ? -5.254  10.421  42.870 1.00 22.97  ? 538 VAL A CG2 1 
ATOM   556  N N   . PRO A 1 72  ? -9.451  8.228   42.070 1.00 32.36  ? 539 PRO A N   1 
ATOM   557  C CA  . PRO A 1 72  ? -10.557 7.426   42.620 1.00 30.97  ? 539 PRO A CA  1 
ATOM   558  C C   . PRO A 1 72  ? -10.072 6.271   43.513 1.00 28.94  ? 539 PRO A C   1 
ATOM   559  O O   . PRO A 1 72  ? -8.993  5.723   43.304 1.00 37.23  ? 539 PRO A O   1 
ATOM   560  C CB  . PRO A 1 72  ? -11.293 6.940   41.352 1.00 29.16  ? 539 PRO A CB  1 
ATOM   561  C CG  . PRO A 1 72  ? -10.168 6.699   40.398 1.00 29.26  ? 539 PRO A CG  1 
ATOM   562  C CD  . PRO A 1 72  ? -9.292  7.968   40.622 1.00 28.64  ? 539 PRO A CD  1 
ATOM   563  N N   . LEU A 1 73  ? -10.849 5.967   44.551 1.00 27.55  ? 540 LEU A N   1 
ATOM   564  C CA  . LEU A 1 73  ? -10.707 4.734   45.313 1.00 26.88  ? 540 LEU A CA  1 
ATOM   565  C C   . LEU A 1 73  ? -11.991 3.959   45.007 1.00 31.01  ? 540 LEU A C   1 
ATOM   566  O O   . LEU A 1 73  ? -13.099 4.401   45.339 1.00 26.30  ? 540 LEU A O   1 
ATOM   567  C CB  . LEU A 1 73  ? -10.575 4.997   46.825 1.00 25.90  ? 540 LEU A CB  1 
ATOM   568  C CG  . LEU A 1 73  ? -9.338  5.745   47.337 1.00 25.32  ? 540 LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 73  ? -9.453  6.203   48.794 1.00 21.80  ? 540 LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 73  ? -8.096  4.924   47.094 1.00 24.40  ? 540 LEU A CD2 1 
ATOM   571  N N   . SER A 1 74  ? -11.841 2.808   44.357 1.00 39.33  ? 541 SER A N   1 
ATOM   572  C CA  . SER A 1 74  ? -13.001 2.038   43.908 1.00 43.26  ? 541 SER A CA  1 
ATOM   573  C C   . SER A 1 74  ? -12.913 0.610   44.399 1.00 40.90  ? 541 SER A C   1 
ATOM   574  O O   . SER A 1 74  ? -11.822 0.112   44.695 1.00 41.64  ? 541 SER A O   1 
ATOM   575  C CB  . SER A 1 74  ? -13.037 2.030   42.381 1.00 45.23  ? 541 SER A CB  1 
ATOM   576  O OG  . SER A 1 74  ? -13.038 3.352   41.878 1.00 52.76  ? 541 SER A OG  1 
ATOM   577  N N   . ILE A 1 75  ? -14.058 -0.058  44.475 1.00 46.57  ? 542 ILE A N   1 
ATOM   578  C CA  . ILE A 1 75  ? -14.067 -1.483  44.794 1.00 53.79  ? 542 ILE A CA  1 
ATOM   579  C C   . ILE A 1 75  ? -14.587 -2.327  43.634 1.00 61.04  ? 542 ILE A C   1 
ATOM   580  O O   . ILE A 1 75  ? -15.783 -2.570  43.534 1.00 64.45  ? 542 ILE A O   1 
ATOM   581  C CB  . ILE A 1 75  ? -14.937 -1.807  46.014 1.00 59.75  ? 542 ILE A CB  1 
ATOM   582  C CG1 . ILE A 1 75  ? -14.502 -0.982  47.226 1.00 68.34  ? 542 ILE A CG1 1 
ATOM   583  C CG2 . ILE A 1 75  ? -14.794 -3.288  46.358 1.00 77.84  ? 542 ILE A CG2 1 
ATOM   584  C CD1 . ILE A 1 75  ? -15.322 -1.258  48.477 1.00 48.75  ? 542 ILE A CD1 1 
ATOM   585  N N   . ARG A 1 76  ? -13.692 -2.766  42.757 1.00 65.44  ? 543 ARG A N   1 
ATOM   586  C CA  . ARG A 1 76  ? -14.058 -3.718  41.710 1.00 69.15  ? 543 ARG A CA  1 
ATOM   587  C C   . ARG A 1 76  ? -13.930 -5.128  42.245 1.00 75.35  ? 543 ARG A C   1 
ATOM   588  O O   . ARG A 1 76  ? -12.827 -5.571  42.572 1.00 62.88  ? 543 ARG A O   1 
ATOM   589  C CB  . ARG A 1 76  ? -13.159 -3.555  40.488 1.00 79.99  ? 543 ARG A CB  1 
ATOM   590  C CG  . ARG A 1 76  ? -13.328 -2.240  39.757 1.00 103.76 ? 543 ARG A CG  1 
ATOM   591  C CD  . ARG A 1 76  ? -12.266 -2.090  38.689 1.00 72.55  ? 543 ARG A CD  1 
ATOM   592  N NE  . ARG A 1 76  ? -12.193 -3.252  37.813 1.00 184.92 ? 543 ARG A NE  1 
ATOM   593  C CZ  . ARG A 1 76  ? -11.246 -3.421  36.898 1.00 115.32 ? 543 ARG A CZ  1 
ATOM   594  N NH1 . ARG A 1 76  ? -10.308 -2.493  36.750 1.00 57.28  ? 543 ARG A NH1 1 
ATOM   595  N NH2 . ARG A 1 76  ? -11.228 -4.518  36.147 1.00 66.27  ? 543 ARG A NH2 1 
ATOM   596  N N   . ASN A 1 77  ? -15.061 -5.827  42.318 1.00 85.53  ? 544 ASN A N   1 
ATOM   597  C CA  . ASN A 1 77  ? -15.130 -7.165  42.903 1.00 123.51 ? 544 ASN A CA  1 
ATOM   598  C C   . ASN A 1 77  ? -15.234 -6.975  44.408 1.00 110.34 ? 544 ASN A C   1 
ATOM   599  O O   . ASN A 1 77  ? -16.231 -6.433  44.898 1.00 71.80  ? 544 ASN A O   1 
ATOM   600  C CB  . ASN A 1 77  ? -13.872 -7.981  42.582 1.00 171.37 ? 544 ASN A CB  1 
ATOM   601  C CG  . ASN A 1 77  ? -13.586 -8.063  41.096 1.00 201.47 ? 544 ASN A CG  1 
ATOM   602  O OD1 . ASN A 1 77  ? -14.434 -7.730  40.268 1.00 58.97  ? 544 ASN A OD1 1 
ATOM   603  N ND2 . ASN A 1 77  ? -12.380 -8.514  40.749 1.00 65.73  ? 544 ASN A ND2 1 
ATOM   604  N N   . ASN A 1 78  ? -14.199 -7.427  45.121 1.00 60.66  ? 545 ASN A N   1 
ATOM   605  C CA  . ASN A 1 78  ? -14.032 -7.187  46.561 1.00 60.41  ? 545 ASN A CA  1 
ATOM   606  C C   . ASN A 1 78  ? -12.629 -6.693  46.912 1.00 72.22  ? 545 ASN A C   1 
ATOM   607  O O   . ASN A 1 78  ? -12.140 -6.917  48.025 1.00 63.58  ? 545 ASN A O   1 
ATOM   608  C CB  . ASN A 1 78  ? -14.359 -8.429  47.408 1.00 52.40  ? 545 ASN A CB  1 
ATOM   609  C CG  . ASN A 1 78  ? -15.829 -8.793  47.377 1.00 143.94 ? 545 ASN A CG  1 
ATOM   610  O OD1 . ASN A 1 78  ? -16.665 -8.085  47.940 1.00 87.16  ? 545 ASN A OD1 1 
ATOM   611  N ND2 . ASN A 1 78  ? -16.153 -9.900  46.720 1.00 144.44 ? 545 ASN A ND2 1 
ATOM   612  N N   . HIS A 1 79  ? -11.969 -6.032  45.968 1.00 50.60  ? 546 HIS A N   1 
ATOM   613  C CA  . HIS A 1 79  ? -10.708 -5.392  46.300 1.00 52.44  ? 546 HIS A CA  1 
ATOM   614  C C   . HIS A 1 79  ? -10.678 -3.928  45.863 1.00 41.84  ? 546 HIS A C   1 
ATOM   615  O O   . HIS A 1 79  ? -11.398 -3.519  44.966 1.00 43.74  ? 546 HIS A O   1 
ATOM   616  C CB  . HIS A 1 79  ? -9.510  -6.165  45.732 1.00 141.08 ? 546 HIS A CB  1 
ATOM   617  C CG  . HIS A 1 79  ? -9.444  -6.178  44.238 1.00 46.31  ? 546 HIS A CG  1 
ATOM   618  N ND1 . HIS A 1 79  ? -9.059  -5.077  43.502 1.00 128.43 ? 546 HIS A ND1 1 
ATOM   619  C CD2 . HIS A 1 79  ? -9.711  -7.156  43.341 1.00 104.96 ? 546 HIS A CD2 1 
ATOM   620  C CE1 . HIS A 1 79  ? -9.093  -5.376  42.216 1.00 109.75 ? 546 HIS A CE1 1 
ATOM   621  N NE2 . HIS A 1 79  ? -9.485  -6.631  42.091 1.00 178.84 ? 546 HIS A NE2 1 
ATOM   622  N N   . TRP A 1 80  ? -9.828  -3.144  46.503 1.00 40.84  ? 547 TRP A N   1 
ATOM   623  C CA  . TRP A 1 80  ? -9.677  -1.748  46.137 1.00 35.11  ? 547 TRP A CA  1 
ATOM   624  C C   . TRP A 1 80  ? -8.718  -1.485  44.960 1.00 29.85  ? 547 TRP A C   1 
ATOM   625  O O   . TRP A 1 80  ? -7.669  -2.110  44.847 1.00 31.50  ? 547 TRP A O   1 
ATOM   626  C CB  . TRP A 1 80  ? -9.267  -0.933  47.367 1.00 33.69  ? 547 TRP A CB  1 
ATOM   627  C CG  . TRP A 1 80  ? -10.305 -0.905  48.459 1.00 30.23  ? 547 TRP A CG  1 
ATOM   628  C CD1 . TRP A 1 80  ? -10.493 -1.832  49.458 1.00 28.58  ? 547 TRP A CD1 1 
ATOM   629  C CD2 . TRP A 1 80  ? -11.301 0.113   48.660 1.00 28.51  ? 547 TRP A CD2 1 
ATOM   630  N NE1 . TRP A 1 80  ? -11.543 -1.444  50.271 1.00 29.69  ? 547 TRP A NE1 1 
ATOM   631  C CE2 . TRP A 1 80  ? -12.055 -0.257  49.807 1.00 28.53  ? 547 TRP A CE2 1 
ATOM   632  C CE3 . TRP A 1 80  ? -11.628 1.300   47.984 1.00 25.10  ? 547 TRP A CE3 1 
ATOM   633  C CZ2 . TRP A 1 80  ? -13.120 0.524   50.295 1.00 28.90  ? 547 TRP A CZ2 1 
ATOM   634  C CZ3 . TRP A 1 80  ? -12.690 2.078   48.467 1.00 29.04  ? 547 TRP A CZ3 1 
ATOM   635  C CH2 . TRP A 1 80  ? -13.425 1.683   49.618 1.00 29.61  ? 547 TRP A CH2 1 
ATOM   636  N N   . ASP A 1 81  ? -9.109  -0.570  44.075 1.00 31.33  ? 548 ASP A N   1 
ATOM   637  C CA  . ASP A 1 81  ? -8.198  -0.020  43.068 1.00 29.98  ? 548 ASP A CA  1 
ATOM   638  C C   . ASP A 1 81  ? -8.494  1.452   42.739 1.00 28.58  ? 548 ASP A C   1 
ATOM   639  O O   . ASP A 1 81  ? -9.303  2.097   43.408 1.00 35.95  ? 548 ASP A O   1 
ATOM   640  C CB  . ASP A 1 81  ? -8.146  -0.870  41.795 1.00 29.42  ? 548 ASP A CB  1 
ATOM   641  C CG  . ASP A 1 81  ? -9.484  -0.954  41.078 1.00 43.26  ? 548 ASP A CG  1 
ATOM   642  O OD1 . ASP A 1 81  ? -10.093 0.106   40.820 1.00 55.92  ? 548 ASP A OD1 1 
ATOM   643  O OD2 . ASP A 1 81  ? -9.918  -2.082  40.754 1.00 59.40  ? 548 ASP A OD2 1 
ATOM   644  N N   . ASN A 1 82  ? -7.844  1.963   41.698 1.00 26.67  ? 549 ASN A N   1 
ATOM   645  C CA  . ASN A 1 82  ? -7.975  3.355   41.268 1.00 25.80  ? 549 ASN A CA  1 
ATOM   646  C C   . ASN A 1 82  ? -8.763  3.465   39.965 1.00 28.68  ? 549 ASN A C   1 
ATOM   647  O O   . ASN A 1 82  ? -8.595  4.446   39.218 1.00 26.74  ? 549 ASN A O   1 
ATOM   648  C CB  . ASN A 1 82  ? -6.591  3.953   41.002 1.00 26.22  ? 549 ASN A CB  1 
ATOM   649  C CG  . ASN A 1 82  ? -5.698  3.960   42.226 1.00 27.97  ? 549 ASN A CG  1 
ATOM   650  O OD1 . ASN A 1 82  ? -4.492  3.774   42.104 1.00 42.41  ? 549 ASN A OD1 1 
ATOM   651  N ND2 . ASN A 1 82  ? -6.273  4.198   43.406 1.00 26.14  ? 549 ASN A ND2 1 
ATOM   652  N N   . SER A 1 83  ? -9.594  2.458   39.675 1.00 27.75  ? 550 SER A N   1 
ATOM   653  C CA  . SER A 1 83  ? -10.425 2.478   38.474 1.00 27.99  ? 550 SER A CA  1 
ATOM   654  C C   . SER A 1 83  ? -11.401 3.674   38.525 1.00 42.06  ? 550 SER A C   1 
ATOM   655  O O   . SER A 1 83  ? -11.920 4.022   39.601 1.00 38.38  ? 550 SER A O   1 
ATOM   656  C CB  . SER A 1 83  ? -11.143 1.145   38.304 1.00 27.63  ? 550 SER A CB  1 
ATOM   657  O OG  . SER A 1 83  ? -11.940 0.818   39.432 1.00 36.81  ? 550 SER A OG  1 
ATOM   658  N N   . PRO A 1 84  ? -11.673 4.308   37.364 1.00 47.41  ? 551 PRO A N   1 
ATOM   659  C CA  . PRO A 1 84  ? -12.564 5.475   37.302 1.00 44.21  ? 551 PRO A CA  1 
ATOM   660  C C   . PRO A 1 84  ? -13.859 5.349   38.096 1.00 37.49  ? 551 PRO A C   1 
ATOM   661  O O   . PRO A 1 84  ? -14.494 4.298   38.117 1.00 40.89  ? 551 PRO A O   1 
ATOM   662  C CB  . PRO A 1 84  ? -12.785 5.637   35.799 1.00 43.53  ? 551 PRO A CB  1 
ATOM   663  C CG  . PRO A 1 84  ? -12.887 4.227   35.355 1.00 63.73  ? 551 PRO A CG  1 
ATOM   664  C CD  . PRO A 1 84  ? -11.634 3.651   36.043 1.00 53.02  ? 551 PRO A CD  1 
ATOM   665  N N   . SER A 1 85  ? -14.228 6.432   38.773 1.00 33.28  ? 552 SER A N   1 
ATOM   666  C CA  . SER A 1 85  ? -15.291 6.371   39.757 1.00 34.20  ? 552 SER A CA  1 
ATOM   667  C C   . SER A 1 85  ? -15.571 7.724   40.385 1.00 35.78  ? 552 SER A C   1 
ATOM   668  O O   . SER A 1 85  ? -14.687 8.559   40.505 1.00 37.30  ? 552 SER A O   1 
ATOM   669  C CB  . SER A 1 85  ? -14.891 5.405   40.865 1.00 34.93  ? 552 SER A CB  1 
ATOM   670  O OG  . SER A 1 85  ? -15.852 5.406   41.891 1.00 39.00  ? 552 SER A OG  1 
ATOM   671  N N   . PRO A 1 86  ? -16.815 7.961   40.807 1.00 36.59  ? 553 PRO A N   1 
ATOM   672  C CA  . PRO A 1 86  ? -17.033 9.272   41.420 1.00 44.22  ? 553 PRO A CA  1 
ATOM   673  C C   . PRO A 1 86  ? -16.419 9.411   42.838 1.00 41.94  ? 553 PRO A C   1 
ATOM   674  O O   . PRO A 1 86  ? -16.270 10.521  43.349 1.00 38.87  ? 553 PRO A O   1 
ATOM   675  C CB  . PRO A 1 86  ? -18.565 9.397   41.382 1.00 31.43  ? 553 PRO A CB  1 
ATOM   676  C CG  . PRO A 1 86  ? -18.982 8.005   41.725 1.00 39.47  ? 553 PRO A CG  1 
ATOM   677  C CD  . PRO A 1 86  ? -18.056 7.163   40.813 1.00 33.68  ? 553 PRO A CD  1 
ATOM   678  N N   . ASN A 1 87  ? -16.026 8.293   43.448 1.00 30.39  ? 554 ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? -15.534 8.312   44.829 1.00 26.96  ? 554 ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? -14.076 8.746   44.854 1.00 25.39  ? 554 ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? -13.170 7.938   45.044 1.00 24.73  ? 554 ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? -15.717 6.929   45.478 1.00 26.93  ? 554 ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? -15.401 6.926   46.945 1.00 26.46  ? 554 ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? -15.745 7.870   47.661 1.00 23.93  ? 554 ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? -14.756 5.854   47.416 1.00 26.66  ? 554 ASN A ND2 1 
ATOM   686  N N   . MET A 1 88  ? -13.862 10.041  44.664 1.00 25.54  ? 555 MET A N   1 
ATOM   687  C CA  . MET A 1 88  ? -12.523 10.576  44.468 1.00 24.78  ? 555 MET A CA  1 
ATOM   688  C C   . MET A 1 88  ? -11.932 11.360  45.630 1.00 25.19  ? 555 MET A C   1 
ATOM   689  O O   . MET A 1 88  ? -12.658 12.038  46.362 1.00 24.56  ? 555 MET A O   1 
ATOM   690  C CB  . MET A 1 88  ? -12.463 11.371  43.178 1.00 26.17  ? 555 MET A CB  1 
ATOM   691  C CG  . MET A 1 88  ? -12.692 10.503  41.938 1.00 29.95  ? 555 MET A CG  1 
ATOM   692  S SD  . MET A 1 88  ? -12.658 11.482  40.428 1.00 44.29  ? 555 MET A SD  1 
ATOM   693  C CE  . MET A 1 88  ? -10.874 11.584  40.127 1.00 36.16  ? 555 MET A CE  1 
ATOM   694  N N   . TYR A 1 89  ? -10.611 11.233  45.796 1.00 22.89  ? 556 TYR A N   1 
ATOM   695  C CA  . TYR A 1 89  ? -9.873  11.851  46.900 1.00 22.86  ? 556 TYR A CA  1 
ATOM   696  C C   . TYR A 1 89  ? -8.570  12.490  46.419 1.00 24.17  ? 556 TYR A C   1 
ATOM   697  O O   . TYR A 1 89  ? -8.050  12.157  45.346 1.00 27.77  ? 556 TYR A O   1 
ATOM   698  C CB  . TYR A 1 89  ? -9.544  10.838  48.010 1.00 21.91  ? 556 TYR A CB  1 
ATOM   699  C CG  . TYR A 1 89  ? -10.735 10.212  48.715 1.00 22.64  ? 556 TYR A CG  1 
ATOM   700  C CD1 . TYR A 1 89  ? -11.457 9.156   48.132 1.00 22.79  ? 556 TYR A CD1 1 
ATOM   701  C CD2 . TYR A 1 89  ? -11.146 10.673  49.970 1.00 23.09  ? 556 TYR A CD2 1 
ATOM   702  C CE1 . TYR A 1 89  ? -12.550 8.582   48.787 1.00 23.65  ? 556 TYR A CE1 1 
ATOM   703  C CE2 . TYR A 1 89  ? -12.247 10.104  50.632 1.00 22.26  ? 556 TYR A CE2 1 
ATOM   704  C CZ  . TYR A 1 89  ? -12.941 9.066   50.043 1.00 24.86  ? 556 TYR A CZ  1 
ATOM   705  O OH  . TYR A 1 89  ? -14.029 8.512   50.712 1.00 30.67  ? 556 TYR A OH  1 
ATOM   706  N N   . GLY A 1 90  ? -8.052  13.416  47.216 1.00 22.59  ? 557 GLY A N   1 
ATOM   707  C CA  . GLY A 1 90  ? -6.820  14.095  46.868 1.00 23.12  ? 557 GLY A CA  1 
ATOM   708  C C   . GLY A 1 90  ? -6.682  15.331  47.730 1.00 23.88  ? 557 GLY A C   1 
ATOM   709  O O   . GLY A 1 90  ? -7.685  15.971  48.034 1.00 24.63  ? 557 GLY A O   1 
ATOM   710  N N   . LEU A 1 91  ? -5.454  15.648  48.135 1.00 23.94  ? 558 LEU A N   1 
ATOM   711  C CA  . LEU A 1 91  ? -5.154  16.882  48.850 1.00 23.37  ? 558 LEU A CA  1 
ATOM   712  C C   . LEU A 1 91  ? -5.897  18.050  48.197 1.00 25.40  ? 558 LEU A C   1 
ATOM   713  O O   . LEU A 1 91  ? -5.789  18.284  46.982 1.00 25.90  ? 558 LEU A O   1 
ATOM   714  C CB  . LEU A 1 91  ? -3.650  17.190  48.816 1.00 23.34  ? 558 LEU A CB  1 
ATOM   715  C CG  . LEU A 1 91  ? -3.277  18.467  49.606 1.00 25.57  ? 558 LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 91  ? -3.455  18.207  51.097 1.00 22.84  ? 558 LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 91  ? -1.829  18.953  49.372 1.00 24.67  ? 558 LEU A CD2 1 
ATOM   718  N N   . ASN A 1 92  ? -6.644  18.778  49.021 1.00 25.02  ? 559 ASN A N   1 
ATOM   719  C CA  . ASN A 1 92  ? -7.446  19.913  48.587 1.00 24.46  ? 559 ASN A CA  1 
ATOM   720  C C   . ASN A 1 92  ? -6.746  21.185  49.086 1.00 26.06  ? 559 ASN A C   1 
ATOM   721  O O   . ASN A 1 92  ? -6.732  21.463  50.296 1.00 26.07  ? 559 ASN A O   1 
ATOM   722  C CB  . ASN A 1 92  ? -8.834  19.796  49.214 1.00 23.84  ? 559 ASN A CB  1 
ATOM   723  C CG  . ASN A 1 92  ? -9.769  20.929  48.807 1.00 28.60  ? 559 ASN A CG  1 
ATOM   724  O OD1 . ASN A 1 92  ? -9.340  22.067  48.623 1.00 27.84  ? 559 ASN A OD1 1 
ATOM   725  N ND2 . ASN A 1 92  ? -11.067 20.620  48.689 1.00 25.13  ? 559 ASN A ND2 1 
ATOM   726  N N   . LYS A 1 93  ? -6.165  21.943  48.151 1.00 26.94  ? 560 LYS A N   1 
ATOM   727  C CA  . LYS A 1 93  ? -5.400  23.157  48.459 1.00 26.28  ? 560 LYS A CA  1 
ATOM   728  C C   . LYS A 1 93  ? -6.191  24.326  49.024 1.00 27.35  ? 560 LYS A C   1 
ATOM   729  O O   . LYS A 1 93  ? -5.657  25.110  49.787 1.00 28.84  ? 560 LYS A O   1 
ATOM   730  C CB  . LYS A 1 93  ? -4.583  23.623  47.244 1.00 29.50  ? 560 LYS A CB  1 
ATOM   731  C CG  . LYS A 1 93  ? -3.554  22.598  46.763 1.00 50.08  ? 560 LYS A CG  1 
ATOM   732  C CD  . LYS A 1 93  ? -2.751  23.081  45.556 1.00 104.81 ? 560 LYS A CD  1 
ATOM   733  C CE  . LYS A 1 93  ? -1.729  22.034  45.103 1.00 68.21  ? 560 LYS A CE  1 
ATOM   734  N NZ  . LYS A 1 93  ? -0.934  22.494  43.925 1.00 84.05  ? 560 LYS A NZ  1 
ATOM   735  N N   . GLU A 1 94  ? -7.452  24.467  48.637 1.00 26.67  ? 561 GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? -8.260  25.525  49.200 1.00 25.83  ? 561 GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? -8.453  25.277  50.706 1.00 27.49  ? 561 GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? -8.371  26.210  51.514 1.00 26.41  ? 561 GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? -9.613  25.622  48.499 1.00 26.73  ? 561 GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? -10.487 26.750  49.076 1.00 36.75  ? 561 GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? -11.879 26.830  48.455 1.00 45.05  ? 561 GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? -11.976 26.911  47.211 1.00 156.80 ? 561 GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? -12.874 26.827  49.221 1.00 60.81  ? 561 GLU A OE2 1 
ATOM   744  N N   . VAL A 1 95  ? -8.717  24.023  51.072 1.00 24.21  ? 562 VAL A N   1 
ATOM   745  C CA  . VAL A 1 95  ? -8.880  23.644  52.474 1.00 24.11  ? 562 VAL A CA  1 
ATOM   746  C C   . VAL A 1 95  ? -7.592  23.845  53.278 1.00 26.23  ? 562 VAL A C   1 
ATOM   747  O O   . VAL A 1 95  ? -7.619  24.241  54.452 1.00 24.78  ? 562 VAL A O   1 
ATOM   748  C CB  . VAL A 1 95  ? -9.317  22.166  52.610 1.00 24.88  ? 562 VAL A CB  1 
ATOM   749  C CG1 . VAL A 1 95  ? -9.355  21.747  54.071 1.00 22.94  ? 562 VAL A CG1 1 
ATOM   750  C CG2 . VAL A 1 95  ? -10.682 21.943  51.941 1.00 24.29  ? 562 VAL A CG2 1 
ATOM   751  N N   . VAL A 1 96  ? -6.463  23.564  52.644 1.00 24.94  ? 563 VAL A N   1 
ATOM   752  C CA  . VAL A 1 96  ? -5.182  23.762  53.293 1.00 24.61  ? 563 VAL A CA  1 
ATOM   753  C C   . VAL A 1 96  ? -5.027  25.264  53.595 1.00 28.10  ? 563 VAL A C   1 
ATOM   754  O O   . VAL A 1 96  ? -4.721  25.652  54.738 1.00 26.52  ? 563 VAL A O   1 
ATOM   755  C CB  . VAL A 1 96  ? -4.029  23.192  52.420 1.00 24.01  ? 563 VAL A CB  1 
ATOM   756  C CG1 . VAL A 1 96  ? -2.672  23.430  53.065 1.00 20.97  ? 563 VAL A CG1 1 
ATOM   757  C CG2 . VAL A 1 96  ? -4.260  21.684  52.167 1.00 20.99  ? 563 VAL A CG2 1 
ATOM   758  N N   . ARG A 1 97  ? -5.254  26.101  52.580 1.00 29.29  ? 564 ARG A N   1 
ATOM   759  C CA  . ARG A 1 97  ? -5.296  27.549  52.786 1.00 35.69  ? 564 ARG A CA  1 
ATOM   760  C C   . ARG A 1 97  ? -6.182  27.972  53.967 1.00 36.87  ? 564 ARG A C   1 
ATOM   761  O O   . ARG A 1 97  ? -5.725  28.677  54.873 1.00 36.87  ? 564 ARG A O   1 
ATOM   762  C CB  . ARG A 1 97  ? -5.595  28.348  51.485 1.00 45.80  ? 564 ARG A CB  1 
ATOM   763  C CG  . ARG A 1 97  ? -4.402  28.572  50.487 1.00 39.68  ? 564 ARG A CG  1 
ATOM   764  C CD  . ARG A 1 97  ? -4.605  28.033  49.063 1.00 57.99  ? 564 ARG A CD  1 
ATOM   765  N NE  . ARG A 1 97  ? -5.909  28.348  48.489 1.00 61.44  ? 564 ARG A NE  1 
ATOM   766  C CZ  . ARG A 1 97  ? -6.342  27.875  47.322 1.00 67.37  ? 564 ARG A CZ  1 
ATOM   767  N NH1 . ARG A 1 97  ? -7.557  28.177  46.883 1.00 60.81  ? 564 ARG A NH1 1 
ATOM   768  N NH2 . ARG A 1 97  ? -5.550  27.114  46.579 1.00 49.45  ? 564 ARG A NH2 1 
ATOM   769  N N   . GLN A 1 98  ? -7.432  27.519  53.975 1.00 30.99  ? 565 GLN A N   1 
ATOM   770  C CA  . GLN A 1 98  ? -8.357  27.873  55.048 1.00 30.37  ? 565 GLN A CA  1 
ATOM   771  C C   . GLN A 1 98  ? -7.822  27.442  56.412 1.00 29.14  ? 565 GLN A C   1 
ATOM   772  O O   . GLN A 1 98  ? -7.947  28.181  57.389 1.00 31.33  ? 565 GLN A O   1 
ATOM   773  C CB  . GLN A 1 98  ? -9.719  27.207  54.829 1.00 29.67  ? 565 GLN A CB  1 
ATOM   774  C CG  . GLN A 1 98  ? -10.373 27.475  53.493 1.00 31.86  ? 565 GLN A CG  1 
ATOM   775  C CD  . GLN A 1 98  ? -10.783 28.914  53.280 1.00 115.97 ? 565 GLN A CD  1 
ATOM   776  O OE1 . GLN A 1 98  ? -9.944  29.826  53.195 1.00 51.57  ? 565 GLN A OE1 1 
ATOM   777  N NE2 . GLN A 1 98  ? -12.092 29.129  53.183 1.00 81.10  ? 565 GLN A NE2 1 
ATOM   778  N N   . LEU A 1 99  ? -7.262  26.232  56.484 1.00 29.70  ? 566 LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? -6.772  25.666  57.754 1.00 29.13  ? 566 LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? -5.464  26.311  58.220 1.00 33.11  ? 566 LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? -5.125  26.275  59.409 1.00 36.98  ? 566 LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? -6.576  24.144  57.642 1.00 29.90  ? 566 LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? -7.761  23.186  57.475 1.00 31.91  ? 566 LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? -7.341  21.792  57.038 1.00 37.91  ? 566 LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? -8.611  23.143  58.726 1.00 30.91  ? 566 LEU A CD2 1 
ATOM   786  N N   . SER A 1 100 ? -4.724  26.891  57.282 1.00 31.44  ? 567 SER A N   1 
ATOM   787  C CA  . SER A 1 100 ? -3.425  27.461  57.608 1.00 32.30  ? 567 SER A CA  1 
ATOM   788  C C   . SER A 1 100 ? -3.593  28.678  58.489 1.00 28.56  ? 567 SER A C   1 
ATOM   789  O O   . SER A 1 100 ? -2.650  29.091  59.157 1.00 28.97  ? 567 SER A O   1 
ATOM   790  C CB  . SER A 1 100 ? -2.646  27.832  56.348 1.00 32.11  ? 567 SER A CB  1 
ATOM   791  O OG  . SER A 1 100 ? -3.341  28.814  55.613 1.00 35.39  ? 567 SER A OG  1 
ATOM   792  N N   . ARG A 1 101 ? -4.788  29.256  58.479 1.00 29.49  ? 568 ARG A N   1 
ATOM   793  C CA  . ARG A 1 101 ? -5.125  30.335  59.409 1.00 30.61  ? 568 ARG A CA  1 
ATOM   794  C C   . ARG A 1 101 ? -4.926  29.867  60.857 1.00 34.29  ? 568 ARG A C   1 
ATOM   795  O O   . ARG A 1 101 ? -4.252  30.528  61.638 1.00 49.23  ? 568 ARG A O   1 
ATOM   796  C CB  . ARG A 1 101 ? -6.557  30.820  59.178 1.00 29.27  ? 568 ARG A CB  1 
ATOM   797  C CG  . ARG A 1 101 ? -7.037  31.856  60.186 1.00 71.04  ? 568 ARG A CG  1 
ATOM   798  C CD  . ARG A 1 101 ? -8.505  32.215  59.946 1.00 201.27 ? 568 ARG A CD  1 
ATOM   799  N NE  . ARG A 1 101 ? -9.053  33.115  60.963 1.00 73.25  ? 568 ARG A NE  1 
ATOM   800  C CZ  . ARG A 1 101 ? -9.195  32.796  62.246 1.00 105.72 ? 568 ARG A CZ  1 
ATOM   801  N NH1 . ARG A 1 101 ? -8.830  31.597  62.686 1.00 95.38  ? 568 ARG A NH1 1 
ATOM   802  N NH2 . ARG A 1 101 ? -9.706  33.678  63.093 1.00 105.85 ? 568 ARG A NH2 1 
ATOM   803  N N   . ARG A 1 102 ? -5.480  28.711  61.207 1.00 36.93  ? 569 ARG A N   1 
ATOM   804  C CA  . ARG A 1 102 ? -5.318  28.168  62.558 1.00 39.24  ? 569 ARG A CA  1 
ATOM   805  C C   . ARG A 1 102 ? -4.008  27.401  62.730 1.00 32.35  ? 569 ARG A C   1 
ATOM   806  O O   . ARG A 1 102 ? -3.487  27.317  63.843 1.00 29.53  ? 569 ARG A O   1 
ATOM   807  C CB  . ARG A 1 102 ? -6.491  27.248  62.915 1.00 35.87  ? 569 ARG A CB  1 
ATOM   808  C CG  . ARG A 1 102 ? -7.820  27.944  62.779 1.00 53.15  ? 569 ARG A CG  1 
ATOM   809  C CD  . ARG A 1 102 ? -9.003  27.024  63.061 1.00 58.91  ? 569 ARG A CD  1 
ATOM   810  N NE  . ARG A 1 102 ? -10.244 27.670  62.644 1.00 99.44  ? 569 ARG A NE  1 
ATOM   811  C CZ  . ARG A 1 102 ? -10.475 28.107  61.406 1.00 184.26 ? 569 ARG A CZ  1 
ATOM   812  N NH1 . ARG A 1 102 ? -9.554  27.966  60.457 1.00 104.11 ? 569 ARG A NH1 1 
ATOM   813  N NH2 . ARG A 1 102 ? -11.625 28.697  61.112 1.00 198.41 ? 569 ARG A NH2 1 
ATOM   814  N N   . TYR A 1 103 ? -3.494  26.836  61.634 1.00 30.17  ? 570 TYR A N   1 
ATOM   815  C CA  . TYR A 1 103 ? -2.291  25.984  61.666 1.00 27.78  ? 570 TYR A CA  1 
ATOM   816  C C   . TYR A 1 103 ? -1.329  26.475  60.620 1.00 27.20  ? 570 TYR A C   1 
ATOM   817  O O   . TYR A 1 103 ? -1.172  25.844  59.570 1.00 29.48  ? 570 TYR A O   1 
ATOM   818  C CB  . TYR A 1 103 ? -2.680  24.575  61.305 1.00 27.11  ? 570 TYR A CB  1 
ATOM   819  C CG  . TYR A 1 103 ? -3.847  24.116  62.126 1.00 31.45  ? 570 TYR A CG  1 
ATOM   820  C CD1 . TYR A 1 103 ? -3.726  23.930  63.505 1.00 27.80  ? 570 TYR A CD1 1 
ATOM   821  C CD2 . TYR A 1 103 ? -5.084  23.884  61.526 1.00 31.16  ? 570 TYR A CD2 1 
ATOM   822  C CE1 . TYR A 1 103 ? -4.810  23.541  64.271 1.00 27.82  ? 570 TYR A CE1 1 
ATOM   823  C CE2 . TYR A 1 103 ? -6.182  23.493  62.282 1.00 32.64  ? 570 TYR A CE2 1 
ATOM   824  C CZ  . TYR A 1 103 ? -6.038  23.331  63.649 1.00 31.76  ? 570 TYR A CZ  1 
ATOM   825  O OH  . TYR A 1 103 ? -7.123  22.969  64.383 1.00 29.52  ? 570 TYR A OH  1 
ATOM   826  N N   . PRO A 1 104 ? -0.663  27.609  60.888 1.00 24.85  ? 571 PRO A N   1 
ATOM   827  C CA  . PRO A 1 104 ? 0.264   28.152  59.897 1.00 25.37  ? 571 PRO A CA  1 
ATOM   828  C C   . PRO A 1 104 ? 1.313   27.255  59.271 1.00 23.46  ? 571 PRO A C   1 
ATOM   829  O O   . PRO A 1 104 ? 1.760   27.536  58.180 1.00 28.64  ? 571 PRO A O   1 
ATOM   830  C CB  . PRO A 1 104 ? 0.827   29.396  60.601 1.00 22.25  ? 571 PRO A CB  1 
ATOM   831  C CG  . PRO A 1 104 ? 0.889   28.978  61.979 1.00 24.39  ? 571 PRO A CG  1 
ATOM   832  C CD  . PRO A 1 104 ? -0.507  28.327  62.160 1.00 23.40  ? 571 PRO A CD  1 
ATOM   833  N N   . GLN A 1 105 ? 1.701   26.180  59.930 1.00 23.66  ? 572 GLN A N   1 
ATOM   834  C CA  . GLN A 1 105 ? 2.718   25.305  59.363 1.00 25.02  ? 572 GLN A CA  1 
ATOM   835  C C   . GLN A 1 105 ? 2.179   24.115  58.559 1.00 26.79  ? 572 GLN A C   1 
ATOM   836  O O   . GLN A 1 105 ? 2.953   23.353  57.953 1.00 26.49  ? 572 GLN A O   1 
ATOM   837  C CB  . GLN A 1 105 ? 3.687   24.840  60.441 1.00 27.33  ? 572 GLN A CB  1 
ATOM   838  C CG  . GLN A 1 105 ? 4.424   25.978  61.081 1.00 28.62  ? 572 GLN A CG  1 
ATOM   839  C CD  . GLN A 1 105 ? 5.255   26.701  60.070 1.00 37.58  ? 572 GLN A CD  1 
ATOM   840  O OE1 . GLN A 1 105 ? 6.184   26.125  59.520 1.00 53.93  ? 572 GLN A OE1 1 
ATOM   841  N NE2 . GLN A 1 105 ? 4.925   27.965  59.799 1.00 36.21  ? 572 GLN A NE2 1 
ATOM   842  N N   . LEU A 1 106 ? 0.855   23.962  58.532 1.00 24.91  ? 573 LEU A N   1 
ATOM   843  C CA  . LEU A 1 106 ? 0.250   22.847  57.808 1.00 22.62  ? 573 LEU A CA  1 
ATOM   844  C C   . LEU A 1 106 ? 0.568   22.878  56.294 1.00 22.66  ? 573 LEU A C   1 
ATOM   845  O O   . LEU A 1 106 ? 0.691   21.838  55.654 1.00 23.67  ? 573 LEU A O   1 
ATOM   846  C CB  . LEU A 1 106 ? -1.248  22.776  58.081 1.00 20.91  ? 573 LEU A CB  1 
ATOM   847  C CG  . LEU A 1 106 ? -2.031  21.633  57.443 1.00 21.51  ? 573 LEU A CG  1 
ATOM   848  C CD1 . LEU A 1 106 ? -1.510  20.298  57.990 1.00 19.95  ? 573 LEU A CD1 1 
ATOM   849  C CD2 . LEU A 1 106 ? -3.540  21.800  57.703 1.00 21.57  ? 573 LEU A CD2 1 
ATOM   850  N N   . PRO A 1 107 ? 0.702   24.075  55.700 1.00 24.04  ? 574 PRO A N   1 
ATOM   851  C CA  . PRO A 1 107 ? 1.015   24.039  54.261 1.00 23.12  ? 574 PRO A CA  1 
ATOM   852  C C   . PRO A 1 107 ? 2.356   23.350  54.000 1.00 23.94  ? 574 PRO A C   1 
ATOM   853  O O   . PRO A 1 107 ? 2.495   22.600  53.036 1.00 25.35  ? 574 PRO A O   1 
ATOM   854  C CB  . PRO A 1 107 ? 1.090   25.525  53.911 1.00 19.88  ? 574 PRO A CB  1 
ATOM   855  C CG  . PRO A 1 107 ? -0.096  26.041  54.703 1.00 20.49  ? 574 PRO A CG  1 
ATOM   856  C CD  . PRO A 1 107 ? 0.166   25.405  56.076 1.00 21.29  ? 574 PRO A CD  1 
ATOM   857  N N   . ARG A 1 108 ? 3.339   23.607  54.859 1.00 23.94  ? 575 ARG A N   1 
ATOM   858  C CA  . ARG A 1 108 ? 4.628   22.971  54.725 1.00 23.04  ? 575 ARG A CA  1 
ATOM   859  C C   . ARG A 1 108 ? 4.519   21.452  54.834 1.00 26.53  ? 575 ARG A C   1 
ATOM   860  O O   . ARG A 1 108 ? 5.100   20.741  54.015 1.00 31.37  ? 575 ARG A O   1 
ATOM   861  C CB  . ARG A 1 108 ? 5.643   23.537  55.716 1.00 22.65  ? 575 ARG A CB  1 
ATOM   862  C CG  . ARG A 1 108 ? 6.079   24.990  55.469 1.00 22.14  ? 575 ARG A CG  1 
ATOM   863  C CD  . ARG A 1 108 ? 7.084   25.415  56.532 1.00 22.45  ? 575 ARG A CD  1 
ATOM   864  N NE  . ARG A 1 108 ? 8.184   24.443  56.686 1.00 23.68  ? 575 ARG A NE  1 
ATOM   865  C CZ  . ARG A 1 108 ? 8.977   24.359  57.756 1.00 21.50  ? 575 ARG A CZ  1 
ATOM   866  N NH1 . ARG A 1 108 ? 8.814   25.159  58.795 1.00 20.36  ? 575 ARG A NH1 1 
ATOM   867  N NH2 . ARG A 1 108 ? 9.966   23.492  57.774 1.00 22.34  ? 575 ARG A NH2 1 
ATOM   868  N N   . ALA A 1 109 ? 3.763   20.957  55.818 1.00 24.27  ? 576 ALA A N   1 
ATOM   869  C CA  . ALA A 1 109 ? 3.635   19.521  56.033 1.00 24.05  ? 576 ALA A CA  1 
ATOM   870  C C   . ALA A 1 109 ? 3.032   18.775  54.842 1.00 28.70  ? 576 ALA A C   1 
ATOM   871  O O   . ALA A 1 109 ? 3.530   17.699  54.462 1.00 30.00  ? 576 ALA A O   1 
ATOM   872  C CB  . ALA A 1 109 ? 2.860   19.218  57.307 1.00 23.85  ? 576 ALA A CB  1 
ATOM   873  N N   . VAL A 1 110 ? 1.965   19.328  54.256 1.00 27.18  ? 577 VAL A N   1 
ATOM   874  C CA  . VAL A 1 110 ? 1.303   18.665  53.136 1.00 23.98  ? 577 VAL A CA  1 
ATOM   875  C C   . VAL A 1 110 ? 2.103   18.808  51.852 1.00 25.28  ? 577 VAL A C   1 
ATOM   876  O O   . VAL A 1 110 ? 1.827   18.143  50.865 1.00 28.99  ? 577 VAL A O   1 
ATOM   877  C CB  . VAL A 1 110 ? -0.178  19.132  52.925 1.00 23.74  ? 577 VAL A CB  1 
ATOM   878  C CG1 . VAL A 1 110 ? -0.988  18.889  54.162 1.00 21.97  ? 577 VAL A CG1 1 
ATOM   879  C CG2 . VAL A 1 110 ? -0.272  20.568  52.490 1.00 22.18  ? 577 VAL A CG2 1 
ATOM   880  N N   . ALA A 1 111 ? 3.100   19.683  51.868 1.00 26.64  ? 578 ALA A N   1 
ATOM   881  C CA  . ALA A 1 111 ? 4.000   19.836  50.728 1.00 26.74  ? 578 ALA A CA  1 
ATOM   882  C C   . ALA A 1 111 ? 5.176   18.872  50.864 1.00 27.69  ? 578 ALA A C   1 
ATOM   883  O O   . ALA A 1 111 ? 5.714   18.394  49.876 1.00 31.14  ? 578 ALA A O   1 
ATOM   884  C CB  . ALA A 1 111 ? 4.502   21.276  50.628 1.00 22.92  ? 578 ALA A CB  1 
ATOM   885  N N   . THR A 1 112 ? 5.560   18.586  52.099 1.00 27.30  ? 579 THR A N   1 
ATOM   886  C CA  . THR A 1 112 ? 6.735   17.775  52.377 1.00 25.65  ? 579 THR A CA  1 
ATOM   887  C C   . THR A 1 112 ? 6.433   16.304  52.547 1.00 29.34  ? 579 THR A C   1 
ATOM   888  O O   . THR A 1 112 ? 7.306   15.467  52.381 1.00 29.42  ? 579 THR A O   1 
ATOM   889  C CB  . THR A 1 112 ? 7.399   18.248  53.664 1.00 24.86  ? 579 THR A CB  1 
ATOM   890  O OG1 . THR A 1 112 ? 7.944   19.560  53.457 1.00 31.07  ? 579 THR A OG1 1 
ATOM   891  C CG2 . THR A 1 112 ? 8.514   17.312  54.045 1.00 101.33 ? 579 THR A CG2 1 
ATOM   892  N N   . GLY A 1 113 ? 5.190   15.991  52.897 1.00 34.08  ? 580 GLY A N   1 
ATOM   893  C CA  . GLY A 1 113 ? 4.874   14.637  53.290 1.00 32.11  ? 580 GLY A CA  1 
ATOM   894  C C   . GLY A 1 113 ? 5.364   14.395  54.705 1.00 34.02  ? 580 GLY A C   1 
ATOM   895  O O   . GLY A 1 113 ? 5.586   13.258  55.108 1.00 37.18  ? 580 GLY A O   1 
ATOM   896  N N   . ARG A 1 114 ? 5.541   15.461  55.472 1.00 28.88  ? 581 ARG A N   1 
ATOM   897  C CA  . ARG A 1 114 ? 5.867   15.297  56.876 1.00 29.64  ? 581 ARG A CA  1 
ATOM   898  C C   . ARG A 1 114 ? 4.633   15.394  57.807 1.00 30.38  ? 581 ARG A C   1 
ATOM   899  O O   . ARG A 1 114 ? 3.520   15.663  57.350 1.00 31.14  ? 581 ARG A O   1 
ATOM   900  C CB  . ARG A 1 114 ? 7.110   16.137  57.286 1.00 31.26  ? 581 ARG A CB  1 
ATOM   901  C CG  . ARG A 1 114 ? 8.425   15.658  56.539 1.00 28.16  ? 581 ARG A CG  1 
ATOM   902  C CD  . ARG A 1 114 ? 8.619   14.123  56.748 1.00 36.62  ? 581 ARG A CD  1 
ATOM   903  N NE  . ARG A 1 114 ? 9.534   13.397  55.848 1.00 29.89  ? 581 ARG A NE  1 
ATOM   904  C CZ  . ARG A 1 114 ? 9.642   12.058  55.828 1.00 140.97 ? 581 ARG A CZ  1 
ATOM   905  N NH1 . ARG A 1 114 ? 8.888   11.323  56.658 1.00 53.32  ? 581 ARG A NH1 1 
ATOM   906  N NH2 . ARG A 1 114 ? 10.495  11.442  54.990 1.00 44.05  ? 581 ARG A NH2 1 
ATOM   907  N N   . VAL A 1 115 ? 4.822   15.104  59.089 1.00 26.04  ? 582 VAL A N   1 
ATOM   908  C CA  . VAL A 1 115 ? 3.760   15.192  60.079 1.00 24.35  ? 582 VAL A CA  1 
ATOM   909  C C   . VAL A 1 115 ? 3.595   16.613  60.563 1.00 24.52  ? 582 VAL A C   1 
ATOM   910  O O   . VAL A 1 115 ? 4.574   17.305  60.837 1.00 26.63  ? 582 VAL A O   1 
ATOM   911  C CB  . VAL A 1 115 ? 4.055   14.296  61.343 1.00 24.70  ? 582 VAL A CB  1 
ATOM   912  C CG1 . VAL A 1 115 ? 3.024   14.594  62.463 1.00 22.83  ? 582 VAL A CG1 1 
ATOM   913  C CG2 . VAL A 1 115 ? 3.987   12.779  60.968 1.00 20.95  ? 582 VAL A CG2 1 
ATOM   914  N N   . TYR A 1 116 ? 2.350   17.052  60.654 1.00 24.83  ? 583 TYR A N   1 
ATOM   915  C CA  . TYR A 1 116 ? 2.047   18.300  61.326 1.00 25.20  ? 583 TYR A CA  1 
ATOM   916  C C   . TYR A 1 116 ? 1.726   17.955  62.785 1.00 27.53  ? 583 TYR A C   1 
ATOM   917  O O   . TYR A 1 116 ? 0.718   17.314  63.076 1.00 28.89  ? 583 TYR A O   1 
ATOM   918  C CB  . TYR A 1 116 ? 0.878   19.020  60.665 1.00 23.93  ? 583 TYR A CB  1 
ATOM   919  C CG  . TYR A 1 116 ? 0.568   20.329  61.336 1.00 24.77  ? 583 TYR A CG  1 
ATOM   920  C CD1 . TYR A 1 116 ? 1.321   21.483  61.063 1.00 26.51  ? 583 TYR A CD1 1 
ATOM   921  C CD2 . TYR A 1 116 ? -0.471  20.422  62.268 1.00 26.11  ? 583 TYR A CD2 1 
ATOM   922  C CE1 . TYR A 1 116 ? 1.048   22.709  61.731 1.00 27.56  ? 583 TYR A CE1 1 
ATOM   923  C CE2 . TYR A 1 116 ? -0.745  21.621  62.938 1.00 26.08  ? 583 TYR A CE2 1 
ATOM   924  C CZ  . TYR A 1 116 ? 0.015   22.752  62.676 1.00 26.57  ? 583 TYR A CZ  1 
ATOM   925  O OH  . TYR A 1 116 ? -0.265  23.902  63.369 1.00 27.21  ? 583 TYR A OH  1 
ATOM   926  N N   . ASP A 1 117 ? 2.608   18.350  63.693 1.00 25.52  ? 584 ASP A N   1 
ATOM   927  C CA  . ASP A 1 117 ? 2.463   18.020  65.099 1.00 27.18  ? 584 ASP A CA  1 
ATOM   928  C C   . ASP A 1 117 ? 1.461   19.004  65.710 1.00 29.25  ? 584 ASP A C   1 
ATOM   929  O O   . ASP A 1 117 ? 1.800   20.171  65.941 1.00 35.19  ? 584 ASP A O   1 
ATOM   930  C CB  . ASP A 1 117 ? 3.832   18.166  65.791 1.00 28.31  ? 584 ASP A CB  1 
ATOM   931  C CG  . ASP A 1 117 ? 3.822   17.727  67.249 1.00 29.27  ? 584 ASP A CG  1 
ATOM   932  O OD1 . ASP A 1 117 ? 2.747   17.723  67.891 1.00 27.06  ? 584 ASP A OD1 1 
ATOM   933  O OD2 . ASP A 1 117 ? 4.919   17.389  67.752 1.00 42.13  ? 584 ASP A OD2 1 
ATOM   934  N N   . MET A 1 118 ? 0.234   18.543  65.946 1.00 25.86  ? 585 MET A N   1 
ATOM   935  C CA  . MET A 1 118 ? -0.786  19.362  66.595 1.00 27.72  ? 585 MET A CA  1 
ATOM   936  C C   . MET A 1 118 ? -0.418  19.936  67.964 1.00 35.99  ? 585 MET A C   1 
ATOM   937  O O   . MET A 1 118 ? -0.908  21.010  68.350 1.00 37.57  ? 585 MET A O   1 
ATOM   938  C CB  . MET A 1 118 ? -2.137  18.639  66.674 1.00 23.84  ? 585 MET A CB  1 
ATOM   939  C CG  . MET A 1 118 ? -2.921  18.625  65.386 1.00 25.87  ? 585 MET A CG  1 
ATOM   940  S SD  . MET A 1 118 ? -3.460  20.317  64.890 1.00 28.16  ? 585 MET A SD  1 
ATOM   941  C CE  . MET A 1 118 ? -4.137  19.968  63.273 1.00 28.67  ? 585 MET A CE  1 
ATOM   942  N N   . ASN A 1 119 ? 0.437   19.224  68.693 1.00 30.60  ? 586 ASN A N   1 
ATOM   943  C CA  . ASN A 1 119 ? 0.801   19.636  70.031 1.00 30.74  ? 586 ASN A CA  1 
ATOM   944  C C   . ASN A 1 119 ? 1.734   20.865  69.913 1.00 38.37  ? 586 ASN A C   1 
ATOM   945  O O   . ASN A 1 119 ? 1.601   21.824  70.661 1.00 40.37  ? 586 ASN A O   1 
ATOM   946  C CB  . ASN A 1 119 ? 1.524   18.489  70.756 1.00 51.16  ? 586 ASN A CB  1 
ATOM   947  C CG  . ASN A 1 119 ? 0.760   17.156  70.684 1.00 177.50 ? 586 ASN A CG  1 
ATOM   948  O OD1 . ASN A 1 119 ? 1.185   16.219  69.988 1.00 61.94  ? 586 ASN A OD1 1 
ATOM   949  N ND2 . ASN A 1 119 ? -0.362  17.067  71.397 1.00 78.98  ? 586 ASN A ND2 1 
ATOM   950  N N   . THR A 1 120 ? 2.659   20.843  68.958 1.00 36.44  ? 587 THR A N   1 
ATOM   951  C CA  . THR A 1 120 ? 3.685   21.878  68.878 1.00 34.71  ? 587 THR A CA  1 
ATOM   952  C C   . THR A 1 120 ? 3.583   22.844  67.706 1.00 39.11  ? 587 THR A C   1 
ATOM   953  O O   . THR A 1 120 ? 4.284   23.862  67.694 1.00 40.44  ? 587 THR A O   1 
ATOM   954  C CB  . THR A 1 120 ? 5.079   21.268  68.803 1.00 37.17  ? 587 THR A CB  1 
ATOM   955  O OG1 . THR A 1 120 ? 5.144   20.387  67.674 1.00 36.73  ? 587 THR A OG1 1 
ATOM   956  C CG2 . THR A 1 120 ? 5.437   20.541  70.098 1.00 30.26  ? 587 THR A CG2 1 
ATOM   957  N N   . GLY A 1 121 ? 2.742   22.522  66.721 1.00 34.16  ? 588 GLY A N   1 
ATOM   958  C CA  . GLY A 1 121 ? 2.635   23.350  65.530 1.00 30.25  ? 588 GLY A CA  1 
ATOM   959  C C   . GLY A 1 121 ? 3.787   23.195  64.535 1.00 36.07  ? 588 GLY A C   1 
ATOM   960  O O   . GLY A 1 121 ? 3.806   23.865  63.497 1.00 38.00  ? 588 GLY A O   1 
ATOM   961  N N   . THR A 1 122 ? 4.743   22.315  64.832 1.00 28.77  ? 589 THR A N   1 
ATOM   962  C CA  . THR A 1 122 ? 5.884   22.115  63.952 1.00 33.24  ? 589 THR A CA  1 
ATOM   963  C C   . THR A 1 122 ? 5.783   20.845  63.098 1.00 33.79  ? 589 THR A C   1 
ATOM   964  O O   . THR A 1 122 ? 4.901   20.017  63.275 1.00 37.98  ? 589 THR A O   1 
ATOM   965  C CB  . THR A 1 122 ? 7.187   21.974  64.745 1.00 36.39  ? 589 THR A CB  1 
ATOM   966  O OG1 . THR A 1 122 ? 7.189   20.712  65.434 1.00 39.08  ? 589 THR A OG1 1 
ATOM   967  C CG2 . THR A 1 122 ? 7.303   23.115  65.763 1.00 30.78  ? 589 THR A CG2 1 
ATOM   968  N N   . LEU A 1 123 ? 6.706   20.723  62.155 1.00 34.50  ? 590 LEU A N   1 
ATOM   969  C CA  . LEU A 1 123 ? 6.894   19.508  61.397 1.00 28.81  ? 590 LEU A CA  1 
ATOM   970  C C   . LEU A 1 123 ? 7.587   18.425  62.211 1.00 32.84  ? 590 LEU A C   1 
ATOM   971  O O   . LEU A 1 123 ? 8.242   18.704  63.221 1.00 30.99  ? 590 LEU A O   1 
ATOM   972  C CB  . LEU A 1 123 ? 7.631   19.794  60.086 1.00 26.92  ? 590 LEU A CB  1 
ATOM   973  C CG  . LEU A 1 123 ? 6.778   20.321  58.924 1.00 34.13  ? 590 LEU A CG  1 
ATOM   974  C CD1 . LEU A 1 123 ? 5.617   21.229  59.312 1.00 31.63  ? 590 LEU A CD1 1 
ATOM   975  C CD2 . LEU A 1 123 ? 7.561   20.769  57.657 1.00 32.42  ? 590 LEU A CD2 1 
ATOM   976  N N   . ARG A 1 124 ? 7.400   17.185  61.773 1.00 30.44  ? 591 ARG A N   1 
ATOM   977  C CA  . ARG A 1 124 ? 8.062   16.038  62.367 1.00 31.13  ? 591 ARG A CA  1 
ATOM   978  C C   . ARG A 1 124 ? 8.139   14.875  61.380 1.00 30.47  ? 591 ARG A C   1 
ATOM   979  O O   . ARG A 1 124 ? 7.395   14.837  60.393 1.00 33.92  ? 591 ARG A O   1 
ATOM   980  C CB  . ARG A 1 124 ? 7.403   15.638  63.702 1.00 29.92  ? 591 ARG A CB  1 
ATOM   981  C CG  . ARG A 1 124 ? 7.579   16.723  64.775 1.00 41.73  ? 591 ARG A CG  1 
ATOM   982  C CD  . ARG A 1 124 ? 7.385   16.201  66.168 1.00 47.06  ? 591 ARG A CD  1 
ATOM   983  N NE  . ARG A 1 124 ? 8.314   15.108  66.416 1.00 38.81  ? 591 ARG A NE  1 
ATOM   984  C CZ  . ARG A 1 124 ? 8.069   14.105  67.256 1.00 59.12  ? 591 ARG A CZ  1 
ATOM   985  N NH1 . ARG A 1 124 ? 8.954   13.126  67.417 1.00 58.14  ? 591 ARG A NH1 1 
ATOM   986  N NH2 . ARG A 1 124 ? 6.934   14.080  67.940 1.00 89.47  ? 591 ARG A NH2 1 
ATOM   987  N N   . ASN A 1 125 ? 9.057   13.943  61.614 1.00 26.87  ? 592 ASN A N   1 
ATOM   988  C CA  . ASN A 1 125 ? 9.049   12.705  60.832 1.00 27.14  ? 592 ASN A CA  1 
ATOM   989  C C   . ASN A 1 125 ? 7.959   11.782  61.294 1.00 23.83  ? 592 ASN A C   1 
ATOM   990  O O   . ASN A 1 125 ? 7.512   11.872  62.421 1.00 25.18  ? 592 ASN A O   1 
ATOM   991  C CB  . ASN A 1 125 ? 10.400  11.995  60.814 1.00 24.81  ? 592 ASN A CB  1 
ATOM   992  C CG  . ASN A 1 125 ? 11.445  12.796  60.098 1.00 28.17  ? 592 ASN A CG  1 
ATOM   993  O OD1 . ASN A 1 125 ? 11.158  13.405  59.064 1.00 32.95  ? 592 ASN A OD1 1 
ATOM   994  N ND2 . ASN A 1 125 ? 12.666  12.799  60.622 1.00 29.83  ? 592 ASN A ND2 1 
ATOM   995  N N   . TYR A 1 126 ? 7.530   10.903  60.414 1.00 23.96  ? 593 TYR A N   1 
ATOM   996  C CA  . TYR A 1 126 ? 6.437   10.001  60.719 1.00 25.89  ? 593 TYR A CA  1 
ATOM   997  C C   . TYR A 1 126 ? 6.628   9.137   61.974 1.00 27.78  ? 593 TYR A C   1 
ATOM   998  O O   . TYR A 1 126 ? 7.690   8.581   62.200 1.00 29.43  ? 593 TYR A O   1 
ATOM   999  C CB  . TYR A 1 126 ? 6.139   9.097   59.520 1.00 26.12  ? 593 TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 126 ? 5.001   8.157   59.808 1.00 30.22  ? 593 TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 126 ? 3.684   8.628   59.866 1.00 28.65  ? 593 TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 126 ? 5.228   6.794   60.036 1.00 28.84  ? 593 TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 126 ? 2.632   7.777   60.151 1.00 27.99  ? 593 TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 126 ? 4.171   5.934   60.322 1.00 28.06  ? 593 TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 126 ? 2.879   6.439   60.385 1.00 27.64  ? 593 TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 126 ? 1.830   5.615   60.692 1.00 28.82  ? 593 TYR A OH  1 
ATOM   1007 N N   . ASP A 1 127 ? 5.566   9.043   62.772 1.00 30.34  ? 594 ASP A N   1 
ATOM   1008 C CA  . ASP A 1 127 ? 5.424   8.101   63.896 1.00 28.33  ? 594 ASP A CA  1 
ATOM   1009 C C   . ASP A 1 127 ? 3.922   8.120   64.197 1.00 23.88  ? 594 ASP A C   1 
ATOM   1010 O O   . ASP A 1 127 ? 3.336   9.178   64.266 1.00 24.14  ? 594 ASP A O   1 
ATOM   1011 C CB  . ASP A 1 127 ? 6.247   8.539   65.127 1.00 28.06  ? 594 ASP A CB  1 
ATOM   1012 C CG  . ASP A 1 127 ? 6.078   7.587   66.315 1.00 28.11  ? 594 ASP A CG  1 
ATOM   1013 O OD1 . ASP A 1 127 ? 7.080   7.160   66.904 1.00 33.20  ? 594 ASP A OD1 1 
ATOM   1014 O OD2 . ASP A 1 127 ? 4.937   7.272   66.676 1.00 28.17  ? 594 ASP A OD2 1 
ATOM   1015 N N   . PRO A 1 128 ? 3.285   6.954   64.378 1.00 22.60  ? 595 PRO A N   1 
ATOM   1016 C CA  . PRO A 1 128 ? 1.851   6.974   64.638 1.00 22.28  ? 595 PRO A CA  1 
ATOM   1017 C C   . PRO A 1 128 ? 1.338   7.471   65.987 1.00 23.55  ? 595 PRO A C   1 
ATOM   1018 O O   . PRO A 1 128 ? 0.131   7.418   66.236 1.00 23.86  ? 595 PRO A O   1 
ATOM   1019 C CB  . PRO A 1 128 ? 1.460   5.536   64.341 1.00 21.71  ? 595 PRO A CB  1 
ATOM   1020 C CG  . PRO A 1 128 ? 2.596   4.809   64.917 1.00 22.54  ? 595 PRO A CG  1 
ATOM   1021 C CD  . PRO A 1 128 ? 3.775   5.563   64.356 1.00 23.30  ? 595 PRO A CD  1 
ATOM   1022 N N   . ARG A 1 129 ? 2.223   8.005   66.825 1.00 23.57  ? 596 ARG A N   1 
ATOM   1023 C CA  . ARG A 1 129 ? 1.841   8.398   68.187 1.00 27.74  ? 596 ARG A CA  1 
ATOM   1024 C C   . ARG A 1 129 ? 1.848   9.886   68.481 1.00 28.99  ? 596 ARG A C   1 
ATOM   1025 O O   . ARG A 1 129 ? 1.594   10.314  69.610 1.00 35.26  ? 596 ARG A O   1 
ATOM   1026 C CB  . ARG A 1 129 ? 2.699   7.652   69.200 1.00 32.31  ? 596 ARG A CB  1 
ATOM   1027 C CG  . ARG A 1 129 ? 2.515   6.132   69.081 1.00 42.16  ? 596 ARG A CG  1 
ATOM   1028 C CD  . ARG A 1 129 ? 3.460   5.363   69.958 1.00 39.27  ? 596 ARG A CD  1 
ATOM   1029 N NE  . ARG A 1 129 ? 4.844   5.738   69.674 1.00 50.69  ? 596 ARG A NE  1 
ATOM   1030 C CZ  . ARG A 1 129 ? 5.869   4.892   69.662 1.00 51.10  ? 596 ARG A CZ  1 
ATOM   1031 N NH1 . ARG A 1 129 ? 7.090   5.340   69.397 1.00 50.59  ? 596 ARG A NH1 1 
ATOM   1032 N NH2 . ARG A 1 129 ? 5.671   3.600   69.889 1.00 54.81  ? 596 ARG A NH2 1 
ATOM   1033 N N   . ILE A 1 130 ? 2.129   10.673  67.451 1.00 28.70  ? 597 ILE A N   1 
ATOM   1034 C CA  . ILE A 1 130 ? 2.212   12.130  67.563 1.00 25.20  ? 597 ILE A CA  1 
ATOM   1035 C C   . ILE A 1 130 ? 0.810   12.787  67.615 1.00 26.16  ? 597 ILE A C   1 
ATOM   1036 O O   . ILE A 1 130 ? 0.480   13.525  68.528 1.00 32.02  ? 597 ILE A O   1 
ATOM   1037 C CB  . ILE A 1 130 ? 3.031   12.660  66.399 1.00 21.50  ? 597 ILE A CB  1 
ATOM   1038 C CG1 . ILE A 1 130 ? 4.453   12.065  66.449 1.00 20.17  ? 597 ILE A CG1 1 
ATOM   1039 C CG2 . ILE A 1 130 ? 2.966   14.170  66.341 1.00 22.42  ? 597 ILE A CG2 1 
ATOM   1040 C CD1 . ILE A 1 130 ? 5.340   12.377  65.217 1.00 17.47  ? 597 ILE A CD1 1 
ATOM   1041 N N   . ASN A 1 131 ? -0.012  12.504  66.621 1.00 27.30  ? 598 ASN A N   1 
ATOM   1042 C CA  . ASN A 1 131 ? -1.384  12.959  66.624 1.00 27.15  ? 598 ASN A CA  1 
ATOM   1043 C C   . ASN A 1 131 ? -2.251  11.753  66.928 1.00 26.92  ? 598 ASN A C   1 
ATOM   1044 O O   . ASN A 1 131 ? -2.515  10.930  66.065 1.00 28.71  ? 598 ASN A O   1 
ATOM   1045 C CB  . ASN A 1 131 ? -1.738  13.573  65.270 1.00 26.05  ? 598 ASN A CB  1 
ATOM   1046 C CG  . ASN A 1 131 ? -0.874  14.762  64.949 1.00 26.48  ? 598 ASN A CG  1 
ATOM   1047 O OD1 . ASN A 1 131 ? -0.726  15.660  65.773 1.00 30.54  ? 598 ASN A OD1 1 
ATOM   1048 N ND2 . ASN A 1 131 ? -0.289  14.779  63.760 1.00 24.57  ? 598 ASN A ND2 1 
ATOM   1049 N N   . LEU A 1 132 ? -2.651  11.656  68.188 1.00 29.14  ? 599 LEU A N   1 
ATOM   1050 C CA  . LEU A 1 132 ? -3.458  10.562  68.700 1.00 26.30  ? 599 LEU A CA  1 
ATOM   1051 C C   . LEU A 1 132 ? -4.942  10.723  68.384 1.00 25.94  ? 599 LEU A C   1 
ATOM   1052 O O   . LEU A 1 132 ? -5.648  9.731   68.245 1.00 29.85  ? 599 LEU A O   1 
ATOM   1053 C CB  . LEU A 1 132 ? -3.246  10.440  70.211 1.00 25.12  ? 599 LEU A CB  1 
ATOM   1054 C CG  . LEU A 1 132 ? -1.785  10.115  70.563 1.00 28.40  ? 599 LEU A CG  1 
ATOM   1055 C CD1 . LEU A 1 132 ? -1.534  10.068  72.077 1.00 23.96  ? 599 LEU A CD1 1 
ATOM   1056 C CD2 . LEU A 1 132 ? -1.400  8.789   69.918 1.00 26.01  ? 599 LEU A CD2 1 
ATOM   1057 N N   . VAL A 1 133 ? -5.414  11.962  68.261 1.00 24.56  ? 600 VAL A N   1 
ATOM   1058 C CA  . VAL A 1 133 ? -6.848  12.203  68.123 1.00 27.50  ? 600 VAL A CA  1 
ATOM   1059 C C   . VAL A 1 133 ? -7.073  13.368  67.155 1.00 26.93  ? 600 VAL A C   1 
ATOM   1060 O O   . VAL A 1 133 ? -6.349  14.354  67.207 1.00 40.19  ? 600 VAL A O   1 
ATOM   1061 C CB  . VAL A 1 133 ? -7.475  12.480  69.526 1.00 28.79  ? 600 VAL A CB  1 
ATOM   1062 C CG1 . VAL A 1 133 ? -6.859  13.721  70.146 1.00 39.32  ? 600 VAL A CG1 1 
ATOM   1063 C CG2 . VAL A 1 133 ? -8.957  12.609  69.451 1.00 30.63  ? 600 VAL A CG2 1 
ATOM   1064 N N   . PRO A 1 134 ? -8.051  13.255  66.232 1.00 26.18  ? 601 PRO A N   1 
ATOM   1065 C CA  . PRO A 1 134 ? -8.297  14.352  65.289 1.00 25.03  ? 601 PRO A CA  1 
ATOM   1066 C C   . PRO A 1 134 ? -8.912  15.564  65.978 1.00 28.46  ? 601 PRO A C   1 
ATOM   1067 O O   . PRO A 1 134 ? -9.914  15.437  66.700 1.00 26.13  ? 601 PRO A O   1 
ATOM   1068 C CB  . PRO A 1 134 ? -9.291  13.718  64.314 1.00 24.80  ? 601 PRO A CB  1 
ATOM   1069 C CG  . PRO A 1 134 ? -10.143 12.891  65.230 1.00 22.81  ? 601 PRO A CG  1 
ATOM   1070 C CD  . PRO A 1 134 ? -9.068  12.194  66.059 1.00 24.45  ? 601 PRO A CD  1 
ATOM   1071 N N   . VAL A 1 135 ? -8.313  16.737  65.755 1.00 25.46  ? 602 VAL A N   1 
ATOM   1072 C CA  . VAL A 1 135 ? -8.729  17.935  66.476 1.00 25.07  ? 602 VAL A CA  1 
ATOM   1073 C C   . VAL A 1 135 ? -9.952  18.630  65.862 1.00 26.05  ? 602 VAL A C   1 
ATOM   1074 O O   . VAL A 1 135 ? -10.546 19.489  66.506 1.00 23.75  ? 602 VAL A O   1 
ATOM   1075 C CB  . VAL A 1 135 ? -7.599  18.991  66.586 1.00 26.71  ? 602 VAL A CB  1 
ATOM   1076 C CG1 . VAL A 1 135 ? -6.333  18.411  67.174 1.00 27.15  ? 602 VAL A CG1 1 
ATOM   1077 C CG2 . VAL A 1 135 ? -7.354  19.683  65.262 1.00 27.19  ? 602 VAL A CG2 1 
ATOM   1078 N N   . ASN A 1 136 ? -10.314 18.292  64.623 1.00 25.08  ? 603 ASN A N   1 
ATOM   1079 C CA  . ASN A 1 136 ? -11.492 18.913  63.987 1.00 25.24  ? 603 ASN A CA  1 
ATOM   1080 C C   . ASN A 1 136 ? -12.804 18.261  64.452 1.00 27.25  ? 603 ASN A C   1 
ATOM   1081 O O   . ASN A 1 136 ? -13.870 18.790  64.209 1.00 29.18  ? 603 ASN A O   1 
ATOM   1082 C CB  . ASN A 1 136 ? -11.419 18.765  62.478 1.00 24.13  ? 603 ASN A CB  1 
ATOM   1083 C CG  . ASN A 1 136 ? -11.354 17.291  62.043 1.00 27.96  ? 603 ASN A CG  1 
ATOM   1084 O OD1 . ASN A 1 136 ? -10.453 16.549  62.465 1.00 26.31  ? 603 ASN A OD1 1 
ATOM   1085 N ND2 . ASN A 1 136 ? -12.312 16.863  61.213 1.00 26.64  ? 603 ASN A ND2 1 
ATOM   1086 N N   . ARG A 1 137 ? -12.711 17.109  65.106 1.00 27.64  ? 604 ARG A N   1 
ATOM   1087 C CA  . ARG A 1 137 ? -13.875 16.286  65.413 1.00 30.15  ? 604 ARG A CA  1 
ATOM   1088 C C   . ARG A 1 137 ? -14.255 16.404  66.877 1.00 33.41  ? 604 ARG A C   1 
ATOM   1089 O O   . ARG A 1 137 ? -13.413 16.216  67.758 1.00 30.10  ? 604 ARG A O   1 
ATOM   1090 C CB  . ARG A 1 137 ? -13.599 14.806  65.064 1.00 29.74  ? 604 ARG A CB  1 
ATOM   1091 C CG  . ARG A 1 137 ? -14.658 13.785  65.505 1.00 24.58  ? 604 ARG A CG  1 
ATOM   1092 C CD  . ARG A 1 137 ? -14.238 12.383  65.061 1.00 23.61  ? 604 ARG A CD  1 
ATOM   1093 N NE  . ARG A 1 137 ? -15.124 11.315  65.506 1.00 22.57  ? 604 ARG A NE  1 
ATOM   1094 C CZ  . ARG A 1 137 ? -16.366 11.134  65.069 1.00 24.05  ? 604 ARG A CZ  1 
ATOM   1095 N NH1 . ARG A 1 137 ? -16.869 11.954  64.158 1.00 24.64  ? 604 ARG A NH1 1 
ATOM   1096 N NH2 . ARG A 1 137 ? -17.111 10.144  65.551 1.00 21.94  ? 604 ARG A NH2 1 
ATOM   1097 N N   . ARG A 1 138 ? -15.527 16.719  67.115 1.00 30.13  ? 605 ARG A N   1 
ATOM   1098 C CA  . ARG A 1 138 ? -16.089 16.688  68.446 1.00 31.41  ? 605 ARG A CA  1 
ATOM   1099 C C   . ARG A 1 138 ? -16.346 15.213  68.725 1.00 29.91  ? 605 ARG A C   1 
ATOM   1100 O O   . ARG A 1 138 ? -17.210 14.610  68.080 1.00 32.87  ? 605 ARG A O   1 
ATOM   1101 C CB  . ARG A 1 138 ? -17.416 17.455  68.456 1.00 32.41  ? 605 ARG A CB  1 
ATOM   1102 C CG  . ARG A 1 138 ? -18.086 17.605  69.842 1.00 41.85  ? 605 ARG A CG  1 
ATOM   1103 C CD  . ARG A 1 138 ? -19.386 18.430  69.722 1.00 37.78  ? 605 ARG A CD  1 
ATOM   1104 N NE  . ARG A 1 138 ? -19.965 18.822  71.004 1.00 183.16 ? 605 ARG A NE  1 
ATOM   1105 C CZ  . ARG A 1 138 ? -20.602 19.974  71.203 1.00 201.59 ? 605 ARG A CZ  1 
ATOM   1106 N NH1 . ARG A 1 138 ? -20.732 20.845  70.205 1.00 62.87  ? 605 ARG A NH1 1 
ATOM   1107 N NH2 . ARG A 1 138 ? -21.110 20.259  72.397 1.00 201.59 ? 605 ARG A NH2 1 
ATOM   1108 N N   . LEU A 1 139 ? -15.593 14.613  69.643 1.00 25.73  ? 606 LEU A N   1 
ATOM   1109 C CA  . LEU A 1 139 ? -15.861 13.213  69.969 1.00 29.08  ? 606 LEU A CA  1 
ATOM   1110 C C   . LEU A 1 139 ? -17.287 13.142  70.522 1.00 29.59  ? 606 LEU A C   1 
ATOM   1111 O O   . LEU A 1 139 ? -17.750 14.077  71.164 1.00 30.93  ? 606 LEU A O   1 
ATOM   1112 C CB  . LEU A 1 139 ? -14.815 12.630  70.926 1.00 29.78  ? 606 LEU A CB  1 
ATOM   1113 C CG  . LEU A 1 139 ? -13.374 12.584  70.384 1.00 30.10  ? 606 LEU A CG  1 
ATOM   1114 C CD1 . LEU A 1 139 ? -12.420 11.996  71.396 1.00 32.58  ? 606 LEU A CD1 1 
ATOM   1115 C CD2 . LEU A 1 139 ? -13.264 11.802  69.087 1.00 33.49  ? 606 LEU A CD2 1 
ATOM   1116 N N   . PRO A 1 140 ? -18.029 12.065  70.223 1.00 25.89  ? 607 PRO A N   1 
ATOM   1117 C CA  . PRO A 1 140 ? -19.392 12.012  70.749 1.00 24.66  ? 607 PRO A CA  1 
ATOM   1118 C C   . PRO A 1 140 ? -19.533 11.469  72.181 1.00 25.25  ? 607 PRO A C   1 
ATOM   1119 O O   . PRO A 1 140 ? -20.610 11.495  72.754 1.00 30.61  ? 607 PRO A O   1 
ATOM   1120 C CB  . PRO A 1 140 ? -20.102 11.165  69.701 1.00 21.82  ? 607 PRO A CB  1 
ATOM   1121 C CG  . PRO A 1 140 ? -19.088 10.156  69.428 1.00 23.26  ? 607 PRO A CG  1 
ATOM   1122 C CD  . PRO A 1 140 ? -17.846 11.021  69.206 1.00 23.80  ? 607 PRO A CD  1 
ATOM   1123 N N   . HIS A 1 141 ? -18.442 11.002  72.770 1.00 24.61  ? 608 HIS A N   1 
ATOM   1124 C CA  . HIS A 1 141 ? -18.448 10.620  74.170 1.00 22.94  ? 608 HIS A CA  1 
ATOM   1125 C C   . HIS A 1 141 ? -17.051 10.732  74.691 1.00 23.33  ? 608 HIS A C   1 
ATOM   1126 O O   . HIS A 1 141 ? -16.126 10.889  73.919 1.00 28.12  ? 608 HIS A O   1 
ATOM   1127 C CB  . HIS A 1 141 ? -19.006 9.213   74.381 1.00 23.30  ? 608 HIS A CB  1 
ATOM   1128 C CG  . HIS A 1 141 ? -18.279 8.152   73.621 1.00 25.34  ? 608 HIS A CG  1 
ATOM   1129 N ND1 . HIS A 1 141 ? -17.071 7.635   74.034 1.00 25.54  ? 608 HIS A ND1 1 
ATOM   1130 C CD2 . HIS A 1 141 ? -18.593 7.511   72.468 1.00 24.96  ? 608 HIS A CD2 1 
ATOM   1131 C CE1 . HIS A 1 141 ? -16.674 6.719   73.170 1.00 26.69  ? 608 HIS A CE1 1 
ATOM   1132 N NE2 . HIS A 1 141 ? -17.581 6.624   72.212 1.00 26.44  ? 608 HIS A NE2 1 
ATOM   1133 N N   . ALA A 1 142 ? -16.906 10.667  76.007 1.00 24.27  ? 609 ALA A N   1 
ATOM   1134 C CA  . ALA A 1 142 ? -15.599 10.714  76.652 1.00 25.09  ? 609 ALA A CA  1 
ATOM   1135 C C   . ALA A 1 142 ? -14.795 9.417   76.414 1.00 29.42  ? 609 ALA A C   1 
ATOM   1136 O O   . ALA A 1 142 ? -15.367 8.354   76.103 1.00 28.98  ? 609 ALA A O   1 
ATOM   1137 C CB  . ALA A 1 142 ? -15.772 10.962  78.153 1.00 21.41  ? 609 ALA A CB  1 
ATOM   1138 N N   . LEU A 1 143 ? -13.477 9.525   76.571 1.00 27.35  ? 610 LEU A N   1 
ATOM   1139 C CA  . LEU A 1 143 ? -12.558 8.388   76.462 1.00 32.22  ? 610 LEU A CA  1 
ATOM   1140 C C   . LEU A 1 143 ? -11.871 8.168   77.816 1.00 30.29  ? 610 LEU A C   1 
ATOM   1141 O O   . LEU A 1 143 ? -11.764 9.086   78.610 1.00 32.33  ? 610 LEU A O   1 
ATOM   1142 C CB  . LEU A 1 143 ? -11.499 8.682   75.394 1.00 27.60  ? 610 LEU A CB  1 
ATOM   1143 C CG  . LEU A 1 143 ? -12.062 9.010   74.006 1.00 25.01  ? 610 LEU A CG  1 
ATOM   1144 C CD1 . LEU A 1 143 ? -10.894 9.361   73.113 1.00 26.88  ? 610 LEU A CD1 1 
ATOM   1145 C CD2 . LEU A 1 143 ? -12.882 7.865   73.424 1.00 21.90  ? 610 LEU A CD2 1 
ATOM   1146 N N   . VAL A 1 144 ? -11.409 6.957   78.083 1.00 29.05  ? 611 VAL A N   1 
ATOM   1147 C CA  . VAL A 1 144 ? -10.803 6.674   79.383 1.00 31.23  ? 611 VAL A CA  1 
ATOM   1148 C C   . VAL A 1 144 ? -9.607  7.570   79.684 1.00 34.59  ? 611 VAL A C   1 
ATOM   1149 O O   . VAL A 1 144 ? -8.912  8.019   78.774 1.00 32.02  ? 611 VAL A O   1 
ATOM   1150 C CB  . VAL A 1 144 ? -10.307 5.223   79.479 1.00 26.60  ? 611 VAL A CB  1 
ATOM   1151 C CG1 . VAL A 1 144 ? -11.475 4.248   79.299 1.00 25.09  ? 611 VAL A CG1 1 
ATOM   1152 C CG2 . VAL A 1 144 ? -9.179  4.994   78.473 1.00 23.66  ? 611 VAL A CG2 1 
ATOM   1153 N N   . LEU A 1 145 ? -9.368  7.808   80.971 1.00 40.84  ? 612 LEU A N   1 
ATOM   1154 C CA  . LEU A 1 145 ? -8.122  8.441   81.402 1.00 57.00  ? 612 LEU A CA  1 
ATOM   1155 C C   . LEU A 1 145 ? -6.952  7.457   81.417 1.00 53.97  ? 612 LEU A C   1 
ATOM   1156 O O   . LEU A 1 145 ? -5.850  7.791   80.967 1.00 59.69  ? 612 LEU A O   1 
ATOM   1157 C CB  . LEU A 1 145 ? -8.268  9.101   82.778 1.00 76.75  ? 612 LEU A CB  1 
ATOM   1158 C CG  . LEU A 1 145 ? -6.968  9.671   83.367 1.00 201.53 ? 612 LEU A CG  1 
ATOM   1159 C CD1 . LEU A 1 145 ? -6.244  10.602  82.402 1.00 130.91 ? 612 LEU A CD1 1 
ATOM   1160 C CD2 . LEU A 1 145 ? -7.201  10.340  84.716 1.00 184.95 ? 612 LEU A CD2 1 
ATOM   1161 N N   . HIS A 1 146 ? -7.209  6.248   81.922 1.00 47.67  ? 613 HIS A N   1 
ATOM   1162 C CA  . HIS A 1 146 ? -6.187  5.205   82.057 1.00 41.10  ? 613 HIS A CA  1 
ATOM   1163 C C   . HIS A 1 146 ? -6.553  3.896   81.344 1.00 46.22  ? 613 HIS A C   1 
ATOM   1164 O O   . HIS A 1 146 ? -7.722  3.518   81.278 1.00 86.47  ? 613 HIS A O   1 
ATOM   1165 C CB  . HIS A 1 146 ? -5.969  4.898   83.540 1.00 46.97  ? 613 HIS A CB  1 
ATOM   1166 C CG  . HIS A 1 146 ? -5.559  6.087   84.348 1.00 60.99  ? 613 HIS A CG  1 
ATOM   1167 N ND1 . HIS A 1 146 ? -4.292  6.631   84.285 1.00 57.64  ? 613 HIS A ND1 1 
ATOM   1168 C CD2 . HIS A 1 146 ? -6.252  6.845   85.231 1.00 38.64  ? 613 HIS A CD2 1 
ATOM   1169 C CE1 . HIS A 1 146 ? -4.226  7.677   85.090 1.00 201.59 ? 613 HIS A CE1 1 
ATOM   1170 N NE2 . HIS A 1 146 ? -5.401  7.830   85.674 1.00 64.46  ? 613 HIS A NE2 1 
ATOM   1171 N N   . HIS A 1 147 ? -5.543  3.210   80.814 1.00 46.65  ? 614 HIS A N   1 
ATOM   1172 C CA  . HIS A 1 147 ? -5.707  1.848   80.316 1.00 42.59  ? 614 HIS A CA  1 
ATOM   1173 C C   . HIS A 1 147 ? -4.635  0.957   80.925 1.00 44.79  ? 614 HIS A C   1 
ATOM   1174 O O   . HIS A 1 147 ? -3.447  1.285   80.912 1.00 50.40  ? 614 HIS A O   1 
ATOM   1175 C CB  . HIS A 1 147 ? -5.633  1.789   78.788 1.00 40.95  ? 614 HIS A CB  1 
ATOM   1176 C CG  . HIS A 1 147 ? -5.784  0.405   78.228 1.00 46.36  ? 614 HIS A CG  1 
ATOM   1177 N ND1 . HIS A 1 147 ? -4.815  -0.568  78.371 1.00 48.21  ? 614 HIS A ND1 1 
ATOM   1178 C CD2 . HIS A 1 147 ? -6.791  -0.166  77.521 1.00 40.26  ? 614 HIS A CD2 1 
ATOM   1179 C CE1 . HIS A 1 147 ? -5.215  -1.677  77.771 1.00 40.35  ? 614 HIS A CE1 1 
ATOM   1180 N NE2 . HIS A 1 147 ? -6.409  -1.459  77.247 1.00 49.87  ? 614 HIS A NE2 1 
ATOM   1181 N N   . ASN A 1 148 ? -5.065  -0.176  81.457 1.00 51.88  ? 615 ASN A N   1 
ATOM   1182 C CA  . ASN A 1 148 ? -4.151  -1.088  82.118 1.00 50.12  ? 615 ASN A CA  1 
ATOM   1183 C C   . ASN A 1 148 ? -4.204  -2.470  81.524 1.00 44.93  ? 615 ASN A C   1 
ATOM   1184 O O   . ASN A 1 148 ? -4.968  -2.729  80.602 1.00 46.68  ? 615 ASN A O   1 
ATOM   1185 C CB  . ASN A 1 148 ? -4.416  -1.135  83.622 1.00 39.70  ? 615 ASN A CB  1 
ATOM   1186 C CG  . ASN A 1 148 ? -4.220  0.221   84.284 1.00 44.60  ? 615 ASN A CG  1 
ATOM   1187 O OD1 . ASN A 1 148 ? -5.183  0.854   84.720 1.00 40.82  ? 615 ASN A OD1 1 
ATOM   1188 N ND2 . ASN A 1 148 ? -2.965  0.681   84.348 1.00 34.02  ? 615 ASN A ND2 1 
ATOM   1189 N N   . GLU A 1 149 ? -3.378  -3.351  82.069 1.00 60.06  ? 616 GLU A N   1 
ATOM   1190 C CA  . GLU A 1 149 ? -3.234  -4.706  81.571 1.00 54.52  ? 616 GLU A CA  1 
ATOM   1191 C C   . GLU A 1 149 ? -3.996  -5.674  82.474 1.00 47.12  ? 616 GLU A C   1 
ATOM   1192 O O   . GLU A 1 149 ? -3.532  -6.030  83.555 1.00 97.12  ? 616 GLU A O   1 
ATOM   1193 C CB  . GLU A 1 149 ? -1.749  -5.050  81.508 1.00 62.10  ? 616 GLU A CB  1 
ATOM   1194 C CG  . GLU A 1 149 ? -0.958  -4.037  80.683 1.00 105.41 ? 616 GLU A CG  1 
ATOM   1195 C CD  . GLU A 1 149 ? 0.536   -4.285  80.715 1.00 201.33 ? 616 GLU A CD  1 
ATOM   1196 O OE1 . GLU A 1 149 ? 1.303   -3.351  80.375 1.00 84.89  ? 616 GLU A OE1 1 
ATOM   1197 O OE2 . GLU A 1 149 ? 0.937   -5.413  81.078 1.00 72.12  ? 616 GLU A OE2 1 
ATOM   1198 N N   . HIS A 1 150 ? -5.174  -6.082  82.008 1.00 57.03  ? 617 HIS A N   1 
ATOM   1199 C CA  . HIS A 1 150 ? -6.074  -6.976  82.736 1.00 45.82  ? 617 HIS A CA  1 
ATOM   1200 C C   . HIS A 1 150 ? -6.215  -8.303  81.992 1.00 43.61  ? 617 HIS A C   1 
ATOM   1201 O O   . HIS A 1 150 ? -5.850  -8.422  80.830 1.00 46.39  ? 617 HIS A O   1 
ATOM   1202 C CB  . HIS A 1 150 ? -7.472  -6.341  82.836 1.00 41.93  ? 617 HIS A CB  1 
ATOM   1203 C CG  . HIS A 1 150 ? -7.516  -5.050  83.599 1.00 45.70  ? 617 HIS A CG  1 
ATOM   1204 N ND1 . HIS A 1 150 ? -7.900  -4.981  84.921 1.00 67.36  ? 617 HIS A ND1 1 
ATOM   1205 C CD2 . HIS A 1 150 ? -7.228  -3.779  83.225 1.00 51.52  ? 617 HIS A CD2 1 
ATOM   1206 C CE1 . HIS A 1 150 ? -7.850  -3.724  85.329 1.00 61.79  ? 617 HIS A CE1 1 
ATOM   1207 N NE2 . HIS A 1 150 ? -7.444  -2.976  84.319 1.00 63.60  ? 617 HIS A NE2 1 
ATOM   1208 N N   . PRO A 1 151 ? -6.749  -9.327  82.660 1.00 60.84  ? 618 PRO A N   1 
ATOM   1209 C CA  . PRO A 1 151 ? -6.933  -10.621 81.988 1.00 57.48  ? 618 PRO A CA  1 
ATOM   1210 C C   . PRO A 1 151 ? -8.081  -10.472 80.972 1.00 58.62  ? 618 PRO A C   1 
ATOM   1211 O O   . PRO A 1 151 ? -9.036  -9.728  81.212 1.00 62.70  ? 618 PRO A O   1 
ATOM   1212 C CB  . PRO A 1 151 ? -7.439  -11.497 83.137 1.00 43.63  ? 618 PRO A CB  1 
ATOM   1213 C CG  . PRO A 1 151 ? -6.655  -10.972 84.308 1.00 52.53  ? 618 PRO A CG  1 
ATOM   1214 C CD  . PRO A 1 151 ? -6.863  -9.475  84.123 1.00 49.94  ? 618 PRO A CD  1 
ATOM   1215 N N   . GLN A 1 152 ? -8.010  -11.180 79.854 1.00 49.39  ? 619 GLN A N   1 
ATOM   1216 C CA  . GLN A 1 152 ? -9.111  -11.161 78.890 1.00 39.04  ? 619 GLN A CA  1 
ATOM   1217 C C   . GLN A 1 152 ? -10.482 -11.468 79.515 1.00 34.17  ? 619 GLN A C   1 
ATOM   1218 O O   . GLN A 1 152 ? -10.616 -12.301 80.402 1.00 35.51  ? 619 GLN A O   1 
ATOM   1219 C CB  . GLN A 1 152 ? -8.818  -12.095 77.723 1.00 39.00  ? 619 GLN A CB  1 
ATOM   1220 C CG  . GLN A 1 152 ? -9.925  -12.154 76.702 1.00 64.54  ? 619 GLN A CG  1 
ATOM   1221 C CD  . GLN A 1 152 ? -9.578  -13.034 75.516 1.00 119.82 ? 619 GLN A CD  1 
ATOM   1222 O OE1 . GLN A 1 152 ? -8.754  -12.663 74.675 1.00 44.70  ? 619 GLN A OE1 1 
ATOM   1223 N NE2 . GLN A 1 152 ? -10.203 -14.212 75.445 1.00 52.79  ? 619 GLN A NE2 1 
ATOM   1224 N N   . SER A 1 153 ? -11.499 -10.770 79.045 1.00 37.61  ? 620 SER A N   1 
ATOM   1225 C CA  . SER A 1 153 ? -12.845 -10.922 79.572 1.00 35.85  ? 620 SER A CA  1 
ATOM   1226 C C   . SER A 1 153 ? -13.476 -12.233 79.104 1.00 35.35  ? 620 SER A C   1 
ATOM   1227 O O   . SER A 1 153 ? -13.126 -12.763 78.042 1.00 38.46  ? 620 SER A O   1 
ATOM   1228 C CB  . SER A 1 153 ? -13.696 -9.742  79.099 1.00 32.47  ? 620 SER A CB  1 
ATOM   1229 O OG  . SER A 1 153 ? -13.086 -8.525  79.485 1.00 52.76  ? 620 SER A OG  1 
ATOM   1230 N N   . ASP A 1 154 ? -14.405 -12.748 79.903 1.00 37.67  ? 621 ASP A N   1 
ATOM   1231 C CA  . ASP A 1 154 ? -15.213 -13.918 79.534 1.00 39.22  ? 621 ASP A CA  1 
ATOM   1232 C C   . ASP A 1 154 ? -16.707 -13.615 79.570 1.00 38.51  ? 621 ASP A C   1 
ATOM   1233 O O   . ASP A 1 154 ? -17.244 -13.260 80.621 1.00 33.58  ? 621 ASP A O   1 
ATOM   1234 C CB  . ASP A 1 154 ? -14.956 -15.098 80.472 1.00 58.21  ? 621 ASP A CB  1 
ATOM   1235 C CG  . ASP A 1 154 ? -15.949 -16.239 80.252 1.00 71.01  ? 621 ASP A CG  1 
ATOM   1236 O OD1 . ASP A 1 154 ? -15.832 -16.936 79.227 1.00 55.33  ? 621 ASP A OD1 1 
ATOM   1237 O OD2 . ASP A 1 154 ? -16.861 -16.416 81.097 1.00 81.82  ? 621 ASP A OD2 1 
ATOM   1238 N N   . PHE A 1 155 ? -17.376 -13.793 78.433 1.00 32.72  ? 622 PHE A N   1 
ATOM   1239 C CA  . PHE A 1 155 ? -18.781 -13.443 78.313 1.00 28.17  ? 622 PHE A CA  1 
ATOM   1240 C C   . PHE A 1 155 ? -19.742 -14.622 78.231 1.00 28.90  ? 622 PHE A C   1 
ATOM   1241 O O   . PHE A 1 155 ? -20.910 -14.454 77.898 1.00 32.35  ? 622 PHE A O   1 
ATOM   1242 C CB  . PHE A 1 155 ? -18.979 -12.495 77.142 1.00 27.56  ? 622 PHE A CB  1 
ATOM   1243 C CG  . PHE A 1 155 ? -18.222 -11.202 77.282 1.00 28.86  ? 622 PHE A CG  1 
ATOM   1244 C CD1 . PHE A 1 155 ? -17.148 -10.906 76.441 1.00 25.83  ? 622 PHE A CD1 1 
ATOM   1245 C CD2 . PHE A 1 155 ? -18.579 -10.274 78.257 1.00 26.85  ? 622 PHE A CD2 1 
ATOM   1246 C CE1 . PHE A 1 155 ? -16.444 -9.697  76.574 1.00 26.21  ? 622 PHE A CE1 1 
ATOM   1247 C CE2 . PHE A 1 155 ? -17.869 -9.062  78.384 1.00 27.29  ? 622 PHE A CE2 1 
ATOM   1248 C CZ  . PHE A 1 155 ? -16.801 -8.783  77.537 1.00 22.64  ? 622 PHE A CZ  1 
ATOM   1249 N N   . SER A 1 156 ? -19.256 -15.813 78.540 1.00 31.29  ? 623 SER A N   1 
ATOM   1250 C CA  . SER A 1 156 ? -20.130 -16.980 78.583 1.00 35.15  ? 623 SER A CA  1 
ATOM   1251 C C   . SER A 1 156 ? -21.424 -16.679 79.309 1.00 31.40  ? 623 SER A C   1 
ATOM   1252 O O   . SER A 1 156 ? -22.497 -16.885 78.757 1.00 38.60  ? 623 SER A O   1 
ATOM   1253 C CB  . SER A 1 156 ? -19.441 -18.158 79.272 1.00 32.95  ? 623 SER A CB  1 
ATOM   1254 O OG  . SER A 1 156 ? -18.284 -18.544 78.564 1.00 65.56  ? 623 SER A OG  1 
ATOM   1255 N N   . SER A 1 157 ? -21.313 -16.188 80.542 1.00 30.30  ? 624 SER A N   1 
ATOM   1256 C CA  . SER A 1 157 ? -22.469 -16.033 81.427 1.00 30.76  ? 624 SER A CA  1 
ATOM   1257 C C   . SER A 1 157 ? -23.474 -15.037 80.865 1.00 34.95  ? 624 SER A C   1 
ATOM   1258 O O   . SER A 1 157 ? -24.696 -15.237 80.939 1.00 46.33  ? 624 SER A O   1 
ATOM   1259 C CB  . SER A 1 157 ? -22.035 -15.622 82.842 1.00 25.23  ? 624 SER A CB  1 
ATOM   1260 O OG  . SER A 1 157 ? -21.307 -14.408 82.814 1.00 114.83 ? 624 SER A OG  1 
ATOM   1261 N N   . PHE A 1 158 ? -22.936 -13.975 80.283 1.00 34.33  ? 625 PHE A N   1 
ATOM   1262 C CA  . PHE A 1 158 ? -23.724 -12.901 79.724 1.00 31.17  ? 625 PHE A CA  1 
ATOM   1263 C C   . PHE A 1 158 ? -24.546 -13.373 78.514 1.00 36.60  ? 625 PHE A C   1 
ATOM   1264 O O   . PHE A 1 158 ? -25.723 -13.030 78.383 1.00 41.90  ? 625 PHE A O   1 
ATOM   1265 C CB  . PHE A 1 158 ? -22.779 -11.767 79.344 1.00 29.15  ? 625 PHE A CB  1 
ATOM   1266 C CG  . PHE A 1 158 ? -23.473 -10.561 78.823 1.00 29.87  ? 625 PHE A CG  1 
ATOM   1267 C CD1 . PHE A 1 158 ? -23.854 -10.486 77.490 1.00 25.51  ? 625 PHE A CD1 1 
ATOM   1268 C CD2 . PHE A 1 158 ? -23.756 -9.489  79.676 1.00 32.59  ? 625 PHE A CD2 1 
ATOM   1269 C CE1 . PHE A 1 158 ? -24.510 -9.365  77.012 1.00 28.18  ? 625 PHE A CE1 1 
ATOM   1270 C CE2 . PHE A 1 158 ? -24.413 -8.354  79.208 1.00 29.95  ? 625 PHE A CE2 1 
ATOM   1271 C CZ  . PHE A 1 158 ? -24.792 -8.293  77.869 1.00 29.27  ? 625 PHE A CZ  1 
ATOM   1272 N N   . VAL A 1 159 ? -23.926 -14.164 77.639 1.00 35.28  ? 626 VAL A N   1 
ATOM   1273 C CA  . VAL A 1 159 ? -24.619 -14.740 76.482 1.00 32.67  ? 626 VAL A CA  1 
ATOM   1274 C C   . VAL A 1 159 ? -25.683 -15.780 76.913 1.00 32.45  ? 626 VAL A C   1 
ATOM   1275 O O   . VAL A 1 159 ? -26.783 -15.804 76.366 1.00 37.26  ? 626 VAL A O   1 
ATOM   1276 C CB  . VAL A 1 159 ? -23.592 -15.324 75.427 1.00 29.72  ? 626 VAL A CB  1 
ATOM   1277 C CG1 . VAL A 1 159 ? -24.294 -15.885 74.202 1.00 23.03  ? 626 VAL A CG1 1 
ATOM   1278 C CG2 . VAL A 1 159 ? -22.612 -14.238 74.992 1.00 27.54  ? 626 VAL A CG2 1 
ATOM   1279 N N   . SER A 1 160 ? -25.356 -16.616 77.898 1.00 31.01  ? 627 SER A N   1 
ATOM   1280 C CA  . SER A 1 160 ? -26.307 -17.594 78.449 1.00 35.70  ? 627 SER A CA  1 
ATOM   1281 C C   . SER A 1 160 ? -27.588 -16.931 78.890 1.00 32.84  ? 627 SER A C   1 
ATOM   1282 O O   . SER A 1 160 ? -28.671 -17.482 78.713 1.00 31.38  ? 627 SER A O   1 
ATOM   1283 C CB  . SER A 1 160 ? -25.715 -18.297 79.670 1.00 33.58  ? 627 SER A CB  1 
ATOM   1284 O OG  . SER A 1 160 ? -24.527 -18.969 79.315 1.00 59.44  ? 627 SER A OG  1 
ATOM   1285 N N   . LYS A 1 161 ? -27.438 -15.740 79.467 1.00 31.20  ? 628 LYS A N   1 
ATOM   1286 C CA  . LYS A 1 161 ? -28.546 -14.996 80.041 1.00 36.49  ? 628 LYS A CA  1 
ATOM   1287 C C   . LYS A 1 161 ? -29.444 -14.321 79.005 1.00 35.46  ? 628 LYS A C   1 
ATOM   1288 O O   . LYS A 1 161 ? -30.504 -13.824 79.343 1.00 41.19  ? 628 LYS A O   1 
ATOM   1289 C CB  . LYS A 1 161 ? -28.034 -13.971 81.066 1.00 44.19  ? 628 LYS A CB  1 
ATOM   1290 C CG  . LYS A 1 161 ? -27.284 -14.589 82.259 1.00 48.50  ? 628 LYS A CG  1 
ATOM   1291 C CD  . LYS A 1 161 ? -26.705 -13.505 83.179 1.00 63.93  ? 628 LYS A CD  1 
ATOM   1292 C CE  . LYS A 1 161 ? -25.881 -14.113 84.314 1.00 86.38  ? 628 LYS A CE  1 
ATOM   1293 N NZ  . LYS A 1 161 ? -25.207 -13.090 85.173 1.00 89.20  ? 628 LYS A NZ  1 
ATOM   1294 N N   . LEU A 1 162 ? -29.029 -14.304 77.748 1.00 32.08  ? 629 LEU A N   1 
ATOM   1295 C CA  . LEU A 1 162 ? -29.849 -13.719 76.687 1.00 27.14  ? 629 LEU A CA  1 
ATOM   1296 C C   . LEU A 1 162 ? -30.967 -14.644 76.186 1.00 29.92  ? 629 LEU A C   1 
ATOM   1297 O O   . LEU A 1 162 ? -30.791 -15.859 76.037 1.00 29.64  ? 629 LEU A O   1 
ATOM   1298 C CB  . LEU A 1 162 ? -28.954 -13.347 75.514 1.00 25.14  ? 629 LEU A CB  1 
ATOM   1299 C CG  . LEU A 1 162 ? -27.898 -12.258 75.721 1.00 22.70  ? 629 LEU A CG  1 
ATOM   1300 C CD1 . LEU A 1 162 ? -26.849 -12.331 74.621 1.00 22.11  ? 629 LEU A CD1 1 
ATOM   1301 C CD2 . LEU A 1 162 ? -28.529 -10.874 75.855 1.00 18.97  ? 629 LEU A CD2 1 
ATOM   1302 N N   . LYS A 1 163 ? -32.125 -14.055 75.924 1.00 29.69  ? 630 LYS A N   1 
ATOM   1303 C CA  . LYS A 1 163 ? -33.205 -14.790 75.294 1.00 31.05  ? 630 LYS A CA  1 
ATOM   1304 C C   . LYS A 1 163 ? -32.821 -15.233 73.884 1.00 27.58  ? 630 LYS A C   1 
ATOM   1305 O O   . LYS A 1 163 ? -32.418 -14.433 73.040 1.00 29.95  ? 630 LYS A O   1 
ATOM   1306 C CB  . LYS A 1 163 ? -34.501 -13.964 75.273 1.00 28.83  ? 630 LYS A CB  1 
ATOM   1307 C CG  . LYS A 1 163 ? -35.009 -13.588 76.662 1.00 201.14 ? 630 LYS A CG  1 
ATOM   1308 C CD  . LYS A 1 163 ? -36.341 -12.852 76.605 1.00 153.67 ? 630 LYS A CD  1 
ATOM   1309 C CE  . LYS A 1 163 ? -36.847 -12.517 78.003 1.00 70.28  ? 630 LYS A CE  1 
ATOM   1310 N NZ  . LYS A 1 163 ? -38.185 -11.855 77.968 1.00 98.78  ? 630 LYS A NZ  1 
ATOM   1311 N N   . GLY A 1 164 ? -32.955 -16.519 73.630 1.00 27.83  ? 631 GLY A N   1 
ATOM   1312 C CA  . GLY A 1 164 ? -32.666 -17.027 72.306 1.00 27.30  ? 631 GLY A CA  1 
ATOM   1313 C C   . GLY A 1 164 ? -32.282 -18.488 72.320 1.00 25.35  ? 631 GLY A C   1 
ATOM   1314 O O   . GLY A 1 164 ? -31.662 -18.979 73.246 1.00 24.52  ? 631 GLY A O   1 
ATOM   1315 N N   . ARG A 1 165 ? -32.656 -19.185 71.267 1.00 26.13  ? 632 ARG A N   1 
ATOM   1316 C CA  . ARG A 1 165 ? -32.345 -20.597 71.146 1.00 33.01  ? 632 ARG A CA  1 
ATOM   1317 C C   . ARG A 1 165 ? -30.980 -20.815 70.481 1.00 33.81  ? 632 ARG A C   1 
ATOM   1318 O O   . ARG A 1 165 ? -30.076 -21.430 71.056 1.00 37.08  ? 632 ARG A O   1 
ATOM   1319 C CB  . ARG A 1 165 ? -33.463 -21.281 70.355 1.00 34.16  ? 632 ARG A CB  1 
ATOM   1320 C CG  . ARG A 1 165 ? -33.190 -22.697 70.000 1.00 44.52  ? 632 ARG A CG  1 
ATOM   1321 C CD  . ARG A 1 165 ? -32.879 -23.496 71.220 1.00 56.34  ? 632 ARG A CD  1 
ATOM   1322 N NE  . ARG A 1 165 ? -32.665 -24.894 70.887 1.00 74.73  ? 632 ARG A NE  1 
ATOM   1323 C CZ  . ARG A 1 165 ? -32.201 -25.783 71.751 1.00 108.54 ? 632 ARG A CZ  1 
ATOM   1324 N NH1 . ARG A 1 165 ? -31.904 -25.394 72.987 1.00 72.57  ? 632 ARG A NH1 1 
ATOM   1325 N NH2 . ARG A 1 165 ? -32.046 -27.050 71.384 1.00 44.30  ? 632 ARG A NH2 1 
ATOM   1326 N N   . THR A 1 166 ? -30.837 -20.272 69.277 1.00 29.93  ? 633 THR A N   1 
ATOM   1327 C CA  . THR A 1 166 ? -29.661 -20.500 68.451 1.00 26.20  ? 633 THR A CA  1 
ATOM   1328 C C   . THR A 1 166 ? -28.662 -19.342 68.552 1.00 25.66  ? 633 THR A C   1 
ATOM   1329 O O   . THR A 1 166 ? -29.041 -18.168 68.511 1.00 26.72  ? 633 THR A O   1 
ATOM   1330 C CB  . THR A 1 166 ? -30.093 -20.731 66.988 1.00 28.13  ? 633 THR A CB  1 
ATOM   1331 O OG1 . THR A 1 166 ? -30.837 -19.590 66.535 1.00 32.51  ? 633 THR A OG1 1 
ATOM   1332 C CG2 . THR A 1 166 ? -31.007 -22.000 66.867 1.00 25.28  ? 633 THR A CG2 1 
ATOM   1333 N N   . VAL A 1 167 ? -27.389 -19.682 68.704 1.00 23.70  ? 634 VAL A N   1 
ATOM   1334 C CA  . VAL A 1 167 ? -26.329 -18.694 68.842 1.00 24.49  ? 634 VAL A CA  1 
ATOM   1335 C C   . VAL A 1 167 ? -25.184 -18.881 67.844 1.00 26.43  ? 634 VAL A C   1 
ATOM   1336 O O   . VAL A 1 167 ? -24.622 -19.982 67.721 1.00 27.57  ? 634 VAL A O   1 
ATOM   1337 C CB  . VAL A 1 167 ? -25.755 -18.710 70.265 1.00 25.97  ? 634 VAL A CB  1 
ATOM   1338 C CG1 . VAL A 1 167 ? -24.618 -17.714 70.417 1.00 25.68  ? 634 VAL A CG1 1 
ATOM   1339 C CG2 . VAL A 1 167 ? -26.847 -18.417 71.258 1.00 29.48  ? 634 VAL A CG2 1 
ATOM   1340 N N   . LEU A 1 168 ? -24.857 -17.805 67.125 1.00 24.02  ? 635 LEU A N   1 
ATOM   1341 C CA  . LEU A 1 168 ? -23.637 -17.764 66.328 1.00 22.76  ? 635 LEU A CA  1 
ATOM   1342 C C   . LEU A 1 168 ? -22.582 -16.931 67.071 1.00 22.01  ? 635 LEU A C   1 
ATOM   1343 O O   . LEU A 1 168 ? -22.763 -15.730 67.296 1.00 22.88  ? 635 LEU A O   1 
ATOM   1344 C CB  . LEU A 1 168 ? -23.890 -17.109 64.958 1.00 23.55  ? 635 LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 168 ? -22.633 -17.060 64.065 1.00 21.14  ? 635 LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 168 ? -22.244 -18.493 63.682 1.00 20.19  ? 635 LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 168 ? -22.877 -16.267 62.802 1.00 20.44  ? 635 LEU A CD2 1 
ATOM   1348 N N   . VAL A 1 169 ? -21.493 -17.573 67.456 1.00 20.85  ? 636 VAL A N   1 
ATOM   1349 C CA  . VAL A 1 169 ? -20.353 -16.897 68.069 1.00 20.93  ? 636 VAL A CA  1 
ATOM   1350 C C   . VAL A 1 169 ? -19.353 -16.611 66.942 1.00 21.75  ? 636 VAL A C   1 
ATOM   1351 O O   . VAL A 1 169 ? -18.975 -17.519 66.203 1.00 22.67  ? 636 VAL A O   1 
ATOM   1352 C CB  . VAL A 1 169 ? -19.686 -17.804 69.157 1.00 21.70  ? 636 VAL A CB  1 
ATOM   1353 C CG1 . VAL A 1 169 ? -18.378 -17.188 69.690 1.00 23.39  ? 636 VAL A CG1 1 
ATOM   1354 C CG2 . VAL A 1 169 ? -20.634 -18.027 70.308 1.00 22.15  ? 636 VAL A CG2 1 
ATOM   1355 N N   . VAL A 1 170 ? -18.929 -15.360 66.805 1.00 20.59  ? 637 VAL A N   1 
ATOM   1356 C CA  . VAL A 1 170 ? -18.025 -15.006 65.729 1.00 20.88  ? 637 VAL A CA  1 
ATOM   1357 C C   . VAL A 1 170 ? -16.681 -14.634 66.315 1.00 23.49  ? 637 VAL A C   1 
ATOM   1358 O O   . VAL A 1 170 ? -16.601 -13.813 67.240 1.00 25.88  ? 637 VAL A O   1 
ATOM   1359 C CB  . VAL A 1 170 ? -18.568 -13.828 64.882 1.00 21.64  ? 637 VAL A CB  1 
ATOM   1360 C CG1 . VAL A 1 170 ? -17.563 -13.470 63.782 1.00 20.72  ? 637 VAL A CG1 1 
ATOM   1361 C CG2 . VAL A 1 170 ? -19.945 -14.174 64.270 1.00 19.88  ? 637 VAL A CG2 1 
ATOM   1362 N N   . GLY A 1 171 ? -15.626 -15.252 65.792 1.00 23.10  ? 638 GLY A N   1 
ATOM   1363 C CA  . GLY A 1 171 ? -14.285 -14.943 66.255 1.00 23.11  ? 638 GLY A CA  1 
ATOM   1364 C C   . GLY A 1 171 ? -13.707 -15.965 67.218 1.00 25.98  ? 638 GLY A C   1 
ATOM   1365 O O   . GLY A 1 171 ? -13.448 -17.133 66.872 1.00 27.82  ? 638 GLY A O   1 
ATOM   1366 N N   . GLU A 1 172 ? -13.482 -15.517 68.439 1.00 26.00  ? 639 GLU A N   1 
ATOM   1367 C CA  . GLU A 1 172 ? -12.978 -16.397 69.471 1.00 27.10  ? 639 GLU A CA  1 
ATOM   1368 C C   . GLU A 1 172 ? -14.035 -17.352 70.009 1.00 32.46  ? 639 GLU A C   1 
ATOM   1369 O O   . GLU A 1 172 ? -15.228 -17.001 70.130 1.00 27.87  ? 639 GLU A O   1 
ATOM   1370 C CB  . GLU A 1 172 ? -12.315 -15.593 70.576 1.00 28.04  ? 639 GLU A CB  1 
ATOM   1371 C CG  . GLU A 1 172 ? -11.063 -14.858 70.092 1.00 38.32  ? 639 GLU A CG  1 
ATOM   1372 C CD  . GLU A 1 172 ? -10.401 -14.057 71.192 1.00 63.26  ? 639 GLU A CD  1 
ATOM   1373 O OE1 . GLU A 1 172 ? -10.590 -12.813 71.245 1.00 46.70  ? 639 GLU A OE1 1 
ATOM   1374 O OE2 . GLU A 1 172 ? -9.702  -14.685 72.013 1.00 70.99  ? 639 GLU A OE2 1 
ATOM   1375 N N   . LYS A 1 173 ? -13.582 -18.573 70.304 1.00 32.89  ? 640 LYS A N   1 
ATOM   1376 C CA  . LYS A 1 173 ? -14.443 -19.624 70.821 1.00 37.96  ? 640 LYS A CA  1 
ATOM   1377 C C   . LYS A 1 173 ? -15.089 -19.218 72.152 1.00 40.81  ? 640 LYS A C   1 
ATOM   1378 O O   . LYS A 1 173 ? -14.445 -18.598 72.999 1.00 36.83  ? 640 LYS A O   1 
ATOM   1379 C CB  . LYS A 1 173 ? -13.663 -20.930 70.991 1.00 34.49  ? 640 LYS A CB  1 
ATOM   1380 C CG  . LYS A 1 173 ? -14.536 -22.094 71.450 1.00 46.61  ? 640 LYS A CG  1 
ATOM   1381 C CD  . LYS A 1 173 ? -13.776 -23.420 71.479 1.00 56.21  ? 640 LYS A CD  1 
ATOM   1382 C CE  . LYS A 1 173 ? -14.698 -24.575 71.892 1.00 120.28 ? 640 LYS A CE  1 
ATOM   1383 N NZ  . LYS A 1 173 ? -13.999 -25.900 71.968 1.00 67.21  ? 640 LYS A NZ  1 
ATOM   1384 N N   . LEU A 1 174 ? -16.361 -19.568 72.322 1.00 32.86  ? 641 LEU A N   1 
ATOM   1385 C CA  . LEU A 1 174 ? -17.070 -19.291 73.563 1.00 34.74  ? 641 LEU A CA  1 
ATOM   1386 C C   . LEU A 1 174 ? -18.088 -20.430 73.815 1.00 40.30  ? 641 LEU A C   1 
ATOM   1387 O O   . LEU A 1 174 ? -18.943 -20.718 72.964 1.00 46.37  ? 641 LEU A O   1 
ATOM   1388 C CB  . LEU A 1 174 ? -17.794 -17.948 73.443 1.00 29.12  ? 641 LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 174 ? -18.375 -17.327 74.707 1.00 31.15  ? 641 LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 174 ? -17.248 -16.953 75.657 1.00 23.46  ? 641 LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 174 ? -19.151 -16.071 74.361 1.00 39.39  ? 641 LEU A CD2 1 
ATOM   1392 N N   . SER A 1 175 ? -17.994 -21.095 74.963 1.00 40.92  ? 642 SER A N   1 
ATOM   1393 C CA  . SER A 1 175 ? -18.989 -22.118 75.314 1.00 41.70  ? 642 SER A CA  1 
ATOM   1394 C C   . SER A 1 175 ? -20.201 -21.491 75.995 1.00 36.10  ? 642 SER A C   1 
ATOM   1395 O O   . SER A 1 175 ? -20.064 -20.724 76.956 1.00 40.77  ? 642 SER A O   1 
ATOM   1396 C CB  . SER A 1 175 ? -18.393 -23.216 76.196 1.00 37.38  ? 642 SER A CB  1 
ATOM   1397 O OG  . SER A 1 175 ? -17.368 -23.911 75.509 1.00 71.81  ? 642 SER A OG  1 
ATOM   1398 N N   . VAL A 1 176 ? -21.386 -21.815 75.495 1.00 27.24  ? 643 VAL A N   1 
ATOM   1399 C CA  . VAL A 1 176 ? -22.583 -21.169 75.984 1.00 29.39  ? 643 VAL A CA  1 
ATOM   1400 C C   . VAL A 1 176 ? -23.582 -22.255 76.297 1.00 33.29  ? 643 VAL A C   1 
ATOM   1401 O O   . VAL A 1 176 ? -24.303 -22.734 75.417 1.00 38.26  ? 643 VAL A O   1 
ATOM   1402 C CB  . VAL A 1 176 ? -23.181 -20.170 74.955 1.00 29.64  ? 643 VAL A CB  1 
ATOM   1403 C CG1 . VAL A 1 176 ? -24.359 -19.406 75.567 1.00 29.90  ? 643 VAL A CG1 1 
ATOM   1404 C CG2 . VAL A 1 176 ? -22.108 -19.203 74.435 1.00 27.50  ? 643 VAL A CG2 1 
ATOM   1405 N N   . PRO A 1 177 ? -23.624 -22.672 77.571 1.00 46.64  ? 644 PRO A N   1 
ATOM   1406 C CA  . PRO A 1 177 ? -24.506 -23.714 78.109 1.00 38.01  ? 644 PRO A CA  1 
ATOM   1407 C C   . PRO A 1 177 ? -25.984 -23.357 77.894 1.00 39.31  ? 644 PRO A C   1 
ATOM   1408 O O   . PRO A 1 177 ? -26.408 -22.230 78.205 1.00 31.23  ? 644 PRO A O   1 
ATOM   1409 C CB  . PRO A 1 177 ? -24.195 -23.629 79.603 1.00 42.02  ? 644 PRO A CB  1 
ATOM   1410 C CG  . PRO A 1 177 ? -22.709 -23.386 79.601 1.00 45.60  ? 644 PRO A CG  1 
ATOM   1411 C CD  . PRO A 1 177 ? -22.658 -22.235 78.603 1.00 39.43  ? 644 PRO A CD  1 
ATOM   1412 N N   . GLY A 1 178 ? -26.760 -24.316 77.377 1.00 36.47  ? 645 GLY A N   1 
ATOM   1413 C CA  . GLY A 1 178 ? -28.198 -24.133 77.267 1.00 35.37  ? 645 GLY A CA  1 
ATOM   1414 C C   . GLY A 1 178 ? -28.613 -23.599 75.911 1.00 37.53  ? 645 GLY A C   1 
ATOM   1415 O O   . GLY A 1 178 ? -29.801 -23.495 75.587 1.00 32.98  ? 645 GLY A O   1 
ATOM   1416 N N   . LYS A 1 179 ? -27.619 -23.266 75.103 1.00 30.69  ? 646 LYS A N   1 
ATOM   1417 C CA  . LYS A 1 179 ? -27.892 -22.782 73.773 1.00 32.50  ? 646 LYS A CA  1 
ATOM   1418 C C   . LYS A 1 179 ? -27.209 -23.625 72.713 1.00 28.62  ? 646 LYS A C   1 
ATOM   1419 O O   . LYS A 1 179 ? -26.173 -24.242 72.965 1.00 28.58  ? 646 LYS A O   1 
ATOM   1420 C CB  . LYS A 1 179 ? -27.539 -21.295 73.667 1.00 37.41  ? 646 LYS A CB  1 
ATOM   1421 C CG  . LYS A 1 179 ? -28.369 -20.464 74.642 1.00 30.11  ? 646 LYS A CG  1 
ATOM   1422 C CD  . LYS A 1 179 ? -28.121 -18.995 74.509 1.00 29.59  ? 646 LYS A CD  1 
ATOM   1423 C CE  . LYS A 1 179 ? -28.897 -18.226 75.566 1.00 25.87  ? 646 LYS A CE  1 
ATOM   1424 N NZ  . LYS A 1 179 ? -30.314 -18.519 75.448 1.00 24.25  ? 646 LYS A NZ  1 
ATOM   1425 N N   . MET A 1 180 ? -27.841 -23.672 71.546 1.00 26.34  ? 647 MET A N   1 
ATOM   1426 C CA  . MET A 1 180 ? -27.291 -24.304 70.351 1.00 24.34  ? 647 MET A CA  1 
ATOM   1427 C C   . MET A 1 180 ? -26.318 -23.315 69.718 1.00 22.89  ? 647 MET A C   1 
ATOM   1428 O O   . MET A 1 180 ? -26.728 -22.285 69.200 1.00 20.46  ? 647 MET A O   1 
ATOM   1429 C CB  . MET A 1 180 ? -28.427 -24.601 69.370 1.00 28.83  ? 647 MET A CB  1 
ATOM   1430 C CG  . MET A 1 180 ? -29.435 -25.650 69.840 1.00 55.01  ? 647 MET A CG  1 
ATOM   1431 S SD  . MET A 1 180 ? -28.828 -27.339 69.579 1.00 107.17 ? 647 MET A SD  1 
ATOM   1432 C CE  . MET A 1 180 ? -27.371 -27.389 70.603 1.00 201.59 ? 647 MET A CE  1 
ATOM   1433 N N   . VAL A 1 181 ? -25.035 -23.647 69.770 1.00 22.88  ? 648 VAL A N   1 
ATOM   1434 C CA  . VAL A 1 181 ? -23.961 -22.747 69.362 1.00 23.61  ? 648 VAL A CA  1 
ATOM   1435 C C   . VAL A 1 181 ? -23.221 -23.140 68.079 1.00 23.88  ? 648 VAL A C   1 
ATOM   1436 O O   . VAL A 1 181 ? -22.569 -24.178 68.029 1.00 20.08  ? 648 VAL A O   1 
ATOM   1437 C CB  . VAL A 1 181 ? -22.885 -22.656 70.460 1.00 22.72  ? 648 VAL A CB  1 
ATOM   1438 C CG1 . VAL A 1 181 ? -21.745 -21.734 69.991 1.00 23.18  ? 648 VAL A CG1 1 
ATOM   1439 C CG2 . VAL A 1 181 ? -23.504 -22.162 71.762 1.00 21.12  ? 648 VAL A CG2 1 
ATOM   1440 N N   . ASP A 1 182 ? -23.311 -22.291 67.057 1.00 27.63  ? 649 ASP A N   1 
ATOM   1441 C CA  . ASP A 1 182 ? -22.404 -22.380 65.898 1.00 30.85  ? 649 ASP A CA  1 
ATOM   1442 C C   . ASP A 1 182 ? -21.242 -21.410 66.080 1.00 31.10  ? 649 ASP A C   1 
ATOM   1443 O O   . ASP A 1 182 ? -21.407 -20.318 66.615 1.00 36.51  ? 649 ASP A O   1 
ATOM   1444 C CB  . ASP A 1 182 ? -23.106 -22.108 64.555 1.00 29.19  ? 649 ASP A CB  1 
ATOM   1445 C CG  . ASP A 1 182 ? -24.071 -23.215 64.148 1.00 30.71  ? 649 ASP A CG  1 
ATOM   1446 O OD1 . ASP A 1 182 ? -24.925 -22.967 63.265 1.00 34.02  ? 649 ASP A OD1 1 
ATOM   1447 O OD2 . ASP A 1 182 ? -23.964 -24.331 64.692 1.00 28.03  ? 649 ASP A OD2 1 
ATOM   1448 N N   . TRP A 1 183 ? -20.068 -21.823 65.628 1.00 26.49  ? 650 TRP A N   1 
ATOM   1449 C CA  . TRP A 1 183 ? -18.877 -21.024 65.796 1.00 24.02  ? 650 TRP A CA  1 
ATOM   1450 C C   . TRP A 1 183 ? -18.305 -20.670 64.433 1.00 23.02  ? 650 TRP A C   1 
ATOM   1451 O O   . TRP A 1 183 ? -17.998 -21.556 63.634 1.00 23.86  ? 650 TRP A O   1 
ATOM   1452 C CB  . TRP A 1 183 ? -17.864 -21.803 66.652 1.00 24.36  ? 650 TRP A CB  1 
ATOM   1453 C CG  . TRP A 1 183 ? -16.580 -21.095 66.887 1.00 24.65  ? 650 TRP A CG  1 
ATOM   1454 C CD1 . TRP A 1 183 ? -16.373 -19.732 66.922 1.00 24.10  ? 650 TRP A CD1 1 
ATOM   1455 C CD2 . TRP A 1 183 ? -15.313 -21.700 67.122 1.00 25.62  ? 650 TRP A CD2 1 
ATOM   1456 N NE1 . TRP A 1 183 ? -15.051 -19.464 67.159 1.00 24.83  ? 650 TRP A NE1 1 
ATOM   1457 C CE2 . TRP A 1 183 ? -14.373 -20.653 67.281 1.00 26.16  ? 650 TRP A CE2 1 
ATOM   1458 C CE3 . TRP A 1 183 ? -14.873 -23.031 67.227 1.00 26.28  ? 650 TRP A CE3 1 
ATOM   1459 C CZ2 . TRP A 1 183 ? -13.015 -20.900 67.529 1.00 24.98  ? 650 TRP A CZ2 1 
ATOM   1460 C CZ3 . TRP A 1 183 ? -13.525 -23.272 67.481 1.00 26.63  ? 650 TRP A CZ3 1 
ATOM   1461 C CH2 . TRP A 1 183 ? -12.613 -22.209 67.626 1.00 26.80  ? 650 TRP A CH2 1 
ATOM   1462 N N   . LEU A 1 184 ? -18.209 -19.372 64.160 1.00 21.76  ? 651 LEU A N   1 
ATOM   1463 C CA  . LEU A 1 184 ? -17.654 -18.865 62.901 1.00 22.49  ? 651 LEU A CA  1 
ATOM   1464 C C   . LEU A 1 184 ? -16.267 -18.292 63.127 1.00 22.57  ? 651 LEU A C   1 
ATOM   1465 O O   . LEU A 1 184 ? -16.088 -17.357 63.891 1.00 24.14  ? 651 LEU A O   1 
ATOM   1466 C CB  . LEU A 1 184 ? -18.564 -17.788 62.318 1.00 21.47  ? 651 LEU A CB  1 
ATOM   1467 C CG  . LEU A 1 184 ? -17.955 -16.906 61.200 1.00 21.37  ? 651 LEU A CG  1 
ATOM   1468 C CD1 . LEU A 1 184 ? -17.457 -17.695 60.003 1.00 20.10  ? 651 LEU A CD1 1 
ATOM   1469 C CD2 . LEU A 1 184 ? -18.933 -15.801 60.774 1.00 20.01  ? 651 LEU A CD2 1 
ATOM   1470 N N   . SER A 1 185 ? -15.272 -18.842 62.465 1.00 26.10  ? 652 SER A N   1 
ATOM   1471 C CA  . SER A 1 185 ? -13.899 -18.453 62.786 1.00 27.53  ? 652 SER A CA  1 
ATOM   1472 C C   . SER A 1 185 ? -12.927 -19.008 61.746 1.00 27.88  ? 652 SER A C   1 
ATOM   1473 O O   . SER A 1 185 ? -13.286 -19.894 60.964 1.00 31.49  ? 652 SER A O   1 
ATOM   1474 C CB  . SER A 1 185 ? -13.563 -19.009 64.179 1.00 29.62  ? 652 SER A CB  1 
ATOM   1475 O OG  . SER A 1 185 ? -12.267 -18.648 64.613 1.00 39.35  ? 652 SER A OG  1 
ATOM   1476 N N   . ASP A 1 186 ? -11.703 -18.496 61.719 1.00 28.31  ? 653 ASP A N   1 
ATOM   1477 C CA  . ASP A 1 186 ? -10.692 -19.100 60.856 1.00 30.78  ? 653 ASP A CA  1 
ATOM   1478 C C   . ASP A 1 186 ? -9.980  -20.254 61.551 1.00 34.44  ? 653 ASP A C   1 
ATOM   1479 O O   . ASP A 1 186 ? -9.139  -20.918 60.956 1.00 36.26  ? 653 ASP A O   1 
ATOM   1480 C CB  . ASP A 1 186 ? -9.693  -18.079 60.328 1.00 39.20  ? 653 ASP A CB  1 
ATOM   1481 C CG  . ASP A 1 186 ? -8.962  -17.358 61.436 1.00 65.80  ? 653 ASP A CG  1 
ATOM   1482 O OD1 . ASP A 1 186 ? -9.641  -16.752 62.298 1.00 78.09  ? 653 ASP A OD1 1 
ATOM   1483 O OD2 . ASP A 1 186 ? -7.712  -17.394 61.440 1.00 167.36 ? 653 ASP A OD2 1 
ATOM   1484 N N   . ARG A 1 187 ? -10.332 -20.499 62.810 1.00 36.62  ? 654 ARG A N   1 
ATOM   1485 C CA  . ARG A 1 187 ? -9.821  -21.663 63.521 1.00 35.50  ? 654 ARG A CA  1 
ATOM   1486 C C   . ARG A 1 187 ? -10.320 -22.956 62.873 1.00 38.98  ? 654 ARG A C   1 
ATOM   1487 O O   . ARG A 1 187 ? -11.498 -23.099 62.541 1.00 46.04  ? 654 ARG A O   1 
ATOM   1488 C CB  . ARG A 1 187 ? -10.230 -21.603 64.995 1.00 41.14  ? 654 ARG A CB  1 
ATOM   1489 C CG  . ARG A 1 187 ? -9.622  -20.445 65.736 1.00 33.11  ? 654 ARG A CG  1 
ATOM   1490 C CD  . ARG A 1 187 ? -8.141  -20.652 65.805 1.00 35.08  ? 654 ARG A CD  1 
ATOM   1491 N NE  . ARG A 1 187 ? -7.856  -21.848 66.599 1.00 120.31 ? 654 ARG A NE  1 
ATOM   1492 C CZ  . ARG A 1 187 ? -6.706  -22.517 66.591 1.00 160.49 ? 654 ARG A CZ  1 
ATOM   1493 N NH1 . ARG A 1 187 ? -5.700  -22.121 65.816 1.00 54.64  ? 654 ARG A NH1 1 
ATOM   1494 N NH2 . ARG A 1 187 ? -6.564  -23.589 67.364 1.00 65.78  ? 654 ARG A NH2 1 
ATOM   1495 N N   . PRO A 1 188 ? -9.427  -23.926 62.696 1.00 41.34  ? 655 PRO A N   1 
ATOM   1496 C CA  . PRO A 1 188 ? -9.832  -25.189 62.074 1.00 37.19  ? 655 PRO A CA  1 
ATOM   1497 C C   . PRO A 1 188 ? -10.885 -26.009 62.827 1.00 37.48  ? 655 PRO A C   1 
ATOM   1498 O O   . PRO A 1 188 ? -11.510 -26.896 62.255 1.00 29.09  ? 655 PRO A O   1 
ATOM   1499 C CB  . PRO A 1 188 ? -8.491  -25.917 61.942 1.00 47.00  ? 655 PRO A CB  1 
ATOM   1500 C CG  . PRO A 1 188 ? -7.786  -25.519 63.210 1.00 44.36  ? 655 PRO A CG  1 
ATOM   1501 C CD  . PRO A 1 188 ? -8.054  -24.014 63.241 1.00 40.35  ? 655 PRO A CD  1 
ATOM   1502 N N   . GLU A 1 189 ? -11.094 -25.712 64.106 1.00 42.44  ? 656 GLU A N   1 
ATOM   1503 C CA  . GLU A 1 189 ? -12.159 -26.374 64.861 1.00 37.05  ? 656 GLU A CA  1 
ATOM   1504 C C   . GLU A 1 189 ? -13.536 -25.762 64.528 1.00 32.50  ? 656 GLU A C   1 
ATOM   1505 O O   . GLU A 1 189 ? -14.575 -26.322 64.880 1.00 33.28  ? 656 GLU A O   1 
ATOM   1506 C CB  . GLU A 1 189 ? -11.933 -26.231 66.372 1.00 51.41  ? 656 GLU A CB  1 
ATOM   1507 C CG  . GLU A 1 189 ? -10.624 -26.758 66.944 1.00 58.43  ? 656 GLU A CG  1 
ATOM   1508 C CD  . GLU A 1 189 ? -9.417  -25.947 66.516 1.00 64.85  ? 656 GLU A CD  1 
ATOM   1509 O OE1 . GLU A 1 189 ? -9.545  -24.712 66.378 1.00 54.74  ? 656 GLU A OE1 1 
ATOM   1510 O OE2 . GLU A 1 189 ? -8.332  -26.545 66.340 1.00 65.66  ? 656 GLU A OE2 1 
ATOM   1511 N N   . ALA A 1 190 ? -13.537 -24.613 63.859 1.00 27.46  ? 657 ALA A N   1 
ATOM   1512 C CA  . ALA A 1 190 ? -14.764 -23.865 63.616 1.00 28.03  ? 657 ALA A CA  1 
ATOM   1513 C C   . ALA A 1 190 ? -15.873 -24.666 62.940 1.00 31.14  ? 657 ALA A C   1 
ATOM   1514 O O   . ALA A 1 190 ? -15.602 -25.564 62.139 1.00 33.17  ? 657 ALA A O   1 
ATOM   1515 C CB  . ALA A 1 190 ? -14.468 -22.617 62.819 1.00 28.27  ? 657 ALA A CB  1 
ATOM   1516 N N   . THR A 1 191 ? -17.118 -24.326 63.273 1.00 25.82  ? 658 THR A N   1 
ATOM   1517 C CA  . THR A 1 191 ? -18.282 -24.911 62.630 1.00 25.46  ? 658 THR A CA  1 
ATOM   1518 C C   . THR A 1 191 ? -18.277 -24.464 61.166 1.00 25.92  ? 658 THR A C   1 
ATOM   1519 O O   . THR A 1 191 ? -18.513 -25.258 60.255 1.00 25.25  ? 658 THR A O   1 
ATOM   1520 C CB  . THR A 1 191 ? -19.604 -24.358 63.237 1.00 26.43  ? 658 THR A CB  1 
ATOM   1521 O OG1 . THR A 1 191 ? -19.606 -24.495 64.665 1.00 24.84  ? 658 THR A OG1 1 
ATOM   1522 C CG2 . THR A 1 191 ? -20.796 -25.125 62.664 1.00 21.06  ? 658 THR A CG2 1 
ATOM   1523 N N   . PHE A 1 192 ? -18.054 -23.168 60.963 1.00 24.93  ? 659 PHE A N   1 
ATOM   1524 C CA  . PHE A 1 192 ? -17.926 -22.596 59.627 1.00 23.74  ? 659 PHE A CA  1 
ATOM   1525 C C   . PHE A 1 192 ? -16.565 -21.961 59.641 1.00 25.02  ? 659 PHE A C   1 
ATOM   1526 O O   . PHE A 1 192 ? -16.279 -21.097 60.484 1.00 26.91  ? 659 PHE A O   1 
ATOM   1527 C CB  . PHE A 1 192 ? -18.974 -21.517 59.377 1.00 22.61  ? 659 PHE A CB  1 
ATOM   1528 C CG  . PHE A 1 192 ? -20.390 -21.986 59.561 1.00 29.33  ? 659 PHE A CG  1 
ATOM   1529 C CD1 . PHE A 1 192 ? -21.138 -21.570 60.660 1.00 27.58  ? 659 PHE A CD1 1 
ATOM   1530 C CD2 . PHE A 1 192 ? -20.986 -22.850 58.635 1.00 35.61  ? 659 PHE A CD2 1 
ATOM   1531 C CE1 . PHE A 1 192 ? -22.446 -22.003 60.838 1.00 28.50  ? 659 PHE A CE1 1 
ATOM   1532 C CE2 . PHE A 1 192 ? -22.304 -23.291 58.806 1.00 30.48  ? 659 PHE A CE2 1 
ATOM   1533 C CZ  . PHE A 1 192 ? -23.034 -22.869 59.907 1.00 29.03  ? 659 PHE A CZ  1 
ATOM   1534 N N   . ARG A 1 193 ? -15.705 -22.393 58.732 1.00 25.53  ? 660 ARG A N   1 
ATOM   1535 C CA  . ARG A 1 193 ? -14.339 -21.923 58.775 1.00 25.98  ? 660 ARG A CA  1 
ATOM   1536 C C   . ARG A 1 193 ? -14.086 -20.926 57.657 1.00 26.52  ? 660 ARG A C   1 
ATOM   1537 O O   . ARG A 1 193 ? -14.257 -21.248 56.500 1.00 28.56  ? 660 ARG A O   1 
ATOM   1538 C CB  . ARG A 1 193 ? -13.378 -23.090 58.706 1.00 27.95  ? 660 ARG A CB  1 
ATOM   1539 C CG  . ARG A 1 193 ? -11.956 -22.640 58.851 1.00 30.16  ? 660 ARG A CG  1 
ATOM   1540 C CD  . ARG A 1 193 ? -10.999 -23.784 58.732 1.00 29.77  ? 660 ARG A CD  1 
ATOM   1541 N NE  . ARG A 1 193 ? -9.657  -23.306 59.037 1.00 50.22  ? 660 ARG A NE  1 
ATOM   1542 C CZ  . ARG A 1 193 ? -8.570  -24.065 59.050 1.00 91.52  ? 660 ARG A CZ  1 
ATOM   1543 N NH1 . ARG A 1 193 ? -8.655  -25.360 58.757 1.00 65.85  ? 660 ARG A NH1 1 
ATOM   1544 N NH2 . ARG A 1 193 ? -7.402  -23.526 59.386 1.00 52.63  ? 660 ARG A NH2 1 
ATOM   1545 N N   . ALA A 1 194 ? -13.693 -19.707 58.013 1.00 27.86  ? 661 ALA A N   1 
ATOM   1546 C CA  . ALA A 1 194 ? -13.625 -18.623 57.043 1.00 25.73  ? 661 ALA A CA  1 
ATOM   1547 C C   . ALA A 1 194 ? -12.660 -17.549 57.484 1.00 27.29  ? 661 ALA A C   1 
ATOM   1548 O O   . ALA A 1 194 ? -12.440 -17.384 58.680 1.00 30.02  ? 661 ALA A O   1 
ATOM   1549 C CB  . ALA A 1 194 ? -14.997 -18.019 56.872 1.00 27.60  ? 661 ALA A CB  1 
ATOM   1550 N N   . ARG A 1 195 ? -12.088 -16.822 56.516 1.00 33.17  ? 662 ARG A N   1 
ATOM   1551 C CA  . ARG A 1 195 ? -11.298 -15.611 56.805 1.00 33.20  ? 662 ARG A CA  1 
ATOM   1552 C C   . ARG A 1 195 ? -12.198 -14.489 57.262 1.00 31.43  ? 662 ARG A C   1 
ATOM   1553 O O   . ARG A 1 195 ? -13.066 -14.057 56.511 1.00 34.05  ? 662 ARG A O   1 
ATOM   1554 C CB  . ARG A 1 195 ? -10.540 -15.082 55.591 1.00 39.09  ? 662 ARG A CB  1 
ATOM   1555 C CG  . ARG A 1 195 ? -9.357  -15.860 55.122 1.00 36.75  ? 662 ARG A CG  1 
ATOM   1556 C CD  . ARG A 1 195 ? -8.419  -14.850 54.420 1.00 51.02  ? 662 ARG A CD  1 
ATOM   1557 N NE  . ARG A 1 195 ? -8.977  -14.294 53.187 1.00 53.64  ? 662 ARG A NE  1 
ATOM   1558 C CZ  . ARG A 1 195 ? -8.693  -13.089 52.696 1.00 51.65  ? 662 ARG A CZ  1 
ATOM   1559 N NH1 . ARG A 1 195 ? -7.880  -12.261 53.333 1.00 41.62  ? 662 ARG A NH1 1 
ATOM   1560 N NH2 . ARG A 1 195 ? -9.192  -12.725 51.530 1.00 55.44  ? 662 ARG A NH2 1 
ATOM   1561 N N   . LEU A 1 196 ? -11.983 -14.003 58.477 1.00 30.69  ? 663 LEU A N   1 
ATOM   1562 C CA  . LEU A 1 196 ? -12.900 -13.021 59.040 1.00 31.66  ? 663 LEU A CA  1 
ATOM   1563 C C   . LEU A 1 196 ? -12.801 -11.600 58.465 1.00 31.43  ? 663 LEU A C   1 
ATOM   1564 O O   . LEU A 1 196 ? -13.777 -10.839 58.477 1.00 28.38  ? 663 LEU A O   1 
ATOM   1565 C CB  . LEU A 1 196 ? -12.893 -13.064 60.572 1.00 30.44  ? 663 LEU A CB  1 
ATOM   1566 C CG  . LEU A 1 196 ? -13.382 -14.378 61.221 1.00 33.22  ? 663 LEU A CG  1 
ATOM   1567 C CD1 . LEU A 1 196 ? -13.343 -14.300 62.764 1.00 28.39  ? 663 LEU A CD1 1 
ATOM   1568 C CD2 . LEU A 1 196 ? -14.810 -14.722 60.777 1.00 26.57  ? 663 LEU A CD2 1 
ATOM   1569 N N   . ASP A 1 197 ? -11.623 -11.259 57.951 1.00 28.35  ? 664 ASP A N   1 
ATOM   1570 C CA  . ASP A 1 197 ? -11.416 -9.982  57.292 1.00 26.77  ? 664 ASP A CA  1 
ATOM   1571 C C   . ASP A 1 197 ? -12.295 -9.861  56.044 1.00 28.72  ? 664 ASP A C   1 
ATOM   1572 O O   . ASP A 1 197 ? -12.562 -8.767  55.571 1.00 32.41  ? 664 ASP A O   1 
ATOM   1573 C CB  . ASP A 1 197 ? -9.932  -9.768  56.975 1.00 26.52  ? 664 ASP A CB  1 
ATOM   1574 C CG  . ASP A 1 197 ? -9.368  -10.825 56.035 1.00 38.49  ? 664 ASP A CG  1 
ATOM   1575 O OD1 . ASP A 1 197 ? -9.923  -11.957 55.951 1.00 41.27  ? 664 ASP A OD1 1 
ATOM   1576 O OD2 . ASP A 1 197 ? -8.344  -10.523 55.384 1.00 34.72  ? 664 ASP A OD2 1 
ATOM   1577 N N   . LEU A 1 198 ? -12.754 -10.996 55.522 1.00 32.55  ? 665 LEU A N   1 
ATOM   1578 C CA  . LEU A 1 198 ? -13.785 -11.018 54.468 1.00 31.42  ? 665 LEU A CA  1 
ATOM   1579 C C   . LEU A 1 198 ? -15.214 -10.824 54.950 1.00 28.08  ? 665 LEU A C   1 
ATOM   1580 O O   . LEU A 1 198 ? -16.117 -10.624 54.147 1.00 28.09  ? 665 LEU A O   1 
ATOM   1581 C CB  . LEU A 1 198 ? -13.665 -12.265 53.579 1.00 30.19  ? 665 LEU A CB  1 
ATOM   1582 C CG  . LEU A 1 198 ? -12.652 -12.249 52.421 1.00 31.32  ? 665 LEU A CG  1 
ATOM   1583 C CD1 . LEU A 1 198 ? -11.688 -11.061 52.277 1.00 27.28  ? 665 LEU A CD1 1 
ATOM   1584 C CD2 . LEU A 1 198 ? -12.059 -13.609 52.105 1.00 29.59  ? 665 LEU A CD2 1 
ATOM   1585 N N   . GLY A 1 199 ? -15.413 -10.866 56.259 1.00 27.68  ? 666 GLY A N   1 
ATOM   1586 C CA  . GLY A 1 199 ? -16.738 -10.622 56.796 1.00 28.07  ? 666 GLY A CA  1 
ATOM   1587 C C   . GLY A 1 199 ? -17.563 -11.881 56.943 1.00 26.94  ? 666 GLY A C   1 
ATOM   1588 O O   . GLY A 1 199 ? -17.070 -12.992 56.717 1.00 32.21  ? 666 GLY A O   1 
ATOM   1589 N N   . ILE A 1 200 ? -18.819 -11.724 57.331 1.00 24.35  ? 667 ILE A N   1 
ATOM   1590 C CA  . ILE A 1 200 ? -19.648 -12.886 57.530 1.00 23.39  ? 667 ILE A CA  1 
ATOM   1591 C C   . ILE A 1 200 ? -20.016 -13.488 56.179 1.00 24.04  ? 667 ILE A C   1 
ATOM   1592 O O   . ILE A 1 200 ? -20.533 -12.799 55.315 1.00 24.64  ? 667 ILE A O   1 
ATOM   1593 C CB  . ILE A 1 200 ? -20.859 -12.579 58.424 1.00 23.79  ? 667 ILE A CB  1 
ATOM   1594 C CG1 . ILE A 1 200 ? -20.336 -12.105 59.784 1.00 22.86  ? 667 ILE A CG1 1 
ATOM   1595 C CG2 . ILE A 1 200 ? -21.776 -13.833 58.566 1.00 20.94  ? 667 ILE A CG2 1 
ATOM   1596 C CD1 . ILE A 1 200 ? -21.396 -11.851 60.766 1.00 22.89  ? 667 ILE A CD1 1 
ATOM   1597 N N   . PRO A 1 201 ? -19.726 -14.788 55.983 1.00 24.57  ? 668 PRO A N   1 
ATOM   1598 C CA  . PRO A 1 201 ? -20.026 -15.455 54.718 1.00 24.60  ? 668 PRO A CA  1 
ATOM   1599 C C   . PRO A 1 201 ? -21.520 -15.421 54.476 1.00 24.90  ? 668 PRO A C   1 
ATOM   1600 O O   . PRO A 1 201 ? -22.305 -15.651 55.404 1.00 25.14  ? 668 PRO A O   1 
ATOM   1601 C CB  . PRO A 1 201 ? -19.567 -16.893 55.004 1.00 25.18  ? 668 PRO A CB  1 
ATOM   1602 C CG  . PRO A 1 201 ? -18.294 -16.676 55.796 1.00 22.85  ? 668 PRO A CG  1 
ATOM   1603 C CD  . PRO A 1 201 ? -18.855 -15.652 56.820 1.00 24.86  ? 668 PRO A CD  1 
ATOM   1604 N N   . GLY A 1 202 ? -21.900 -15.117 53.233 1.00 25.12  ? 669 GLY A N   1 
ATOM   1605 C CA  . GLY A 1 202 ? -23.297 -15.025 52.864 1.00 23.07  ? 669 GLY A CA  1 
ATOM   1606 C C   . GLY A 1 202 ? -24.023 -16.335 53.096 1.00 30.90  ? 669 GLY A C   1 
ATOM   1607 O O   . GLY A 1 202 ? -25.224 -16.339 53.337 1.00 45.29  ? 669 GLY A O   1 
ATOM   1608 N N   . ASP A 1 203 ? -23.292 -17.445 53.040 1.00 31.28  ? 670 ASP A N   1 
ATOM   1609 C CA  . ASP A 1 203 ? -23.864 -18.777 53.222 1.00 35.29  ? 670 ASP A CA  1 
ATOM   1610 C C   . ASP A 1 203 ? -24.160 -19.218 54.664 1.00 35.54  ? 670 ASP A C   1 
ATOM   1611 O O   . ASP A 1 203 ? -24.710 -20.295 54.871 1.00 36.21  ? 670 ASP A O   1 
ATOM   1612 C CB  . ASP A 1 203 ? -23.025 -19.853 52.486 1.00 39.93  ? 670 ASP A CB  1 
ATOM   1613 C CG  . ASP A 1 203 ? -21.567 -19.932 52.978 1.00 67.70  ? 670 ASP A CG  1 
ATOM   1614 O OD1 . ASP A 1 203 ? -20.884 -18.879 53.007 1.00 55.50  ? 670 ASP A OD1 1 
ATOM   1615 O OD2 . ASP A 1 203 ? -21.098 -21.053 53.318 1.00 59.56  ? 670 ASP A OD2 1 
ATOM   1616 N N   . VAL A 1 204 ? -23.795 -18.423 55.667 1.00 33.20  ? 671 VAL A N   1 
ATOM   1617 C CA  . VAL A 1 204 ? -24.137 -18.825 57.027 1.00 31.61  ? 671 VAL A CA  1 
ATOM   1618 C C   . VAL A 1 204 ? -25.625 -18.538 57.230 1.00 26.76  ? 671 VAL A C   1 
ATOM   1619 O O   . VAL A 1 204 ? -26.189 -17.655 56.596 1.00 26.11  ? 671 VAL A O   1 
ATOM   1620 C CB  . VAL A 1 204 ? -23.323 -18.115 58.124 1.00 27.56  ? 671 VAL A CB  1 
ATOM   1621 C CG1 . VAL A 1 204 ? -21.861 -18.100 57.810 1.00 27.85  ? 671 VAL A CG1 1 
ATOM   1622 C CG2 . VAL A 1 204 ? -23.909 -16.817 58.519 1.00 32.31  ? 671 VAL A CG2 1 
ATOM   1623 N N   . PRO A 1 205 ? -26.273 -19.286 58.122 1.00 23.99  ? 672 PRO A N   1 
ATOM   1624 C CA  . PRO A 1 205 ? -27.703 -19.113 58.381 1.00 25.82  ? 672 PRO A CA  1 
ATOM   1625 C C   . PRO A 1 205 ? -28.157 -18.003 59.335 1.00 27.22  ? 672 PRO A C   1 
ATOM   1626 O O   . PRO A 1 205 ? -27.422 -17.062 59.602 1.00 31.23  ? 672 PRO A O   1 
ATOM   1627 C CB  . PRO A 1 205 ? -28.118 -20.514 58.830 1.00 24.63  ? 672 PRO A CB  1 
ATOM   1628 C CG  . PRO A 1 205 ? -26.992 -20.916 59.652 1.00 23.22  ? 672 PRO A CG  1 
ATOM   1629 C CD  . PRO A 1 205 ? -25.761 -20.467 58.831 1.00 22.51  ? 672 PRO A CD  1 
ATOM   1630 N N   . LYS A 1 206 ? -29.394 -18.102 59.810 1.00 28.47  ? 673 LYS A N   1 
ATOM   1631 C CA  . LYS A 1 206 ? -29.957 -17.089 60.686 1.00 24.45  ? 673 LYS A CA  1 
ATOM   1632 C C   . LYS A 1 206 ? -30.062 -17.607 62.098 1.00 23.36  ? 673 LYS A C   1 
ATOM   1633 O O   . LYS A 1 206 ? -30.238 -18.799 62.298 1.00 22.38  ? 673 LYS A O   1 
ATOM   1634 C CB  . LYS A 1 206 ? -31.299 -16.590 60.154 1.00 25.34  ? 673 LYS A CB  1 
ATOM   1635 C CG  . LYS A 1 206 ? -31.124 -15.867 58.848 1.00 31.41  ? 673 LYS A CG  1 
ATOM   1636 C CD  . LYS A 1 206 ? -32.397 -15.260 58.326 1.00 33.46  ? 673 LYS A CD  1 
ATOM   1637 C CE  . LYS A 1 206 ? -32.082 -14.292 57.190 1.00 30.08  ? 673 LYS A CE  1 
ATOM   1638 N NZ  . LYS A 1 206 ? -33.327 -13.700 56.641 1.00 50.52  ? 673 LYS A NZ  1 
ATOM   1639 N N   . TYR A 1 207 ? -29.951 -16.693 63.059 1.00 22.06  ? 674 TYR A N   1 
ATOM   1640 C CA  . TYR A 1 207 ? -29.826 -17.017 64.468 1.00 21.67  ? 674 TYR A CA  1 
ATOM   1641 C C   . TYR A 1 207 ? -30.712 -16.120 65.318 1.00 23.97  ? 674 TYR A C   1 
ATOM   1642 O O   . TYR A 1 207 ? -31.146 -15.067 64.865 1.00 24.88  ? 674 TYR A O   1 
ATOM   1643 C CB  . TYR A 1 207 ? -28.367 -16.859 64.889 1.00 22.42  ? 674 TYR A CB  1 
ATOM   1644 C CG  . TYR A 1 207 ? -27.463 -17.857 64.200 1.00 26.27  ? 674 TYR A CG  1 
ATOM   1645 C CD1 . TYR A 1 207 ? -26.893 -17.590 62.946 1.00 25.47  ? 674 TYR A CD1 1 
ATOM   1646 C CD2 . TYR A 1 207 ? -27.190 -19.099 64.796 1.00 25.45  ? 674 TYR A CD2 1 
ATOM   1647 C CE1 . TYR A 1 207 ? -26.095 -18.552 62.300 1.00 23.60  ? 674 TYR A CE1 1 
ATOM   1648 C CE2 . TYR A 1 207 ? -26.406 -20.049 64.163 1.00 23.92  ? 674 TYR A CE2 1 
ATOM   1649 C CZ  . TYR A 1 207 ? -25.865 -19.782 62.914 1.00 24.78  ? 674 TYR A CZ  1 
ATOM   1650 O OH  . TYR A 1 207 ? -25.104 -20.767 62.295 1.00 23.03  ? 674 TYR A OH  1 
ATOM   1651 N N   . ASP A 1 208 ? -30.983 -16.537 66.551 1.00 24.86  ? 675 ASP A N   1 
ATOM   1652 C CA  . ASP A 1 208 ? -31.728 -15.690 67.470 1.00 26.02  ? 675 ASP A CA  1 
ATOM   1653 C C   . ASP A 1 208 ? -30.737 -14.734 68.119 1.00 24.96  ? 675 ASP A C   1 
ATOM   1654 O O   . ASP A 1 208 ? -31.093 -13.646 68.546 1.00 25.78  ? 675 ASP A O   1 
ATOM   1655 C CB  . ASP A 1 208 ? -32.414 -16.497 68.576 1.00 26.80  ? 675 ASP A CB  1 
ATOM   1656 C CG  . ASP A 1 208 ? -33.369 -17.559 68.046 1.00 30.43  ? 675 ASP A CG  1 
ATOM   1657 O OD1 . ASP A 1 208 ? -33.944 -17.365 66.955 1.00 25.61  ? 675 ASP A OD1 1 
ATOM   1658 O OD2 . ASP A 1 208 ? -33.549 -18.588 68.746 1.00 29.23  ? 675 ASP A OD2 1 
ATOM   1659 N N   . ILE A 1 209 ? -29.489 -15.166 68.203 1.00 24.18  ? 676 ILE A N   1 
ATOM   1660 C CA  . ILE A 1 209 ? -28.450 -14.396 68.867 1.00 22.85  ? 676 ILE A CA  1 
ATOM   1661 C C   . ILE A 1 209 ? -27.145 -14.535 68.098 1.00 24.01  ? 676 ILE A C   1 
ATOM   1662 O O   . ILE A 1 209 ? -26.729 -15.642 67.743 1.00 24.49  ? 676 ILE A O   1 
ATOM   1663 C CB  . ILE A 1 209 ? -28.203 -14.895 70.319 1.00 24.50  ? 676 ILE A CB  1 
ATOM   1664 C CG1 . ILE A 1 209 ? -29.459 -14.730 71.187 1.00 23.52  ? 676 ILE A CG1 1 
ATOM   1665 C CG2 . ILE A 1 209 ? -26.949 -14.191 70.947 1.00 22.50  ? 676 ILE A CG2 1 
ATOM   1666 C CD1 . ILE A 1 209 ? -29.302 -15.284 72.558 1.00 25.80  ? 676 ILE A CD1 1 
ATOM   1667 N N   . ILE A 1 210 ? -26.501 -13.407 67.838 1.00 23.48  ? 677 ILE A N   1 
ATOM   1668 C CA  . ILE A 1 210 ? -25.159 -13.429 67.294 1.00 24.44  ? 677 ILE A CA  1 
ATOM   1669 C C   . ILE A 1 210 ? -24.241 -12.686 68.258 1.00 25.29  ? 677 ILE A C   1 
ATOM   1670 O O   . ILE A 1 210 ? -24.551 -11.569 68.699 1.00 24.48  ? 677 ILE A O   1 
ATOM   1671 C CB  . ILE A 1 210 ? -25.098 -12.867 65.829 1.00 25.49  ? 677 ILE A CB  1 
ATOM   1672 C CG1 . ILE A 1 210 ? -25.927 -13.786 64.912 1.00 26.05  ? 677 ILE A CG1 1 
ATOM   1673 C CG2 . ILE A 1 210 ? -23.612 -12.711 65.345 1.00 20.53  ? 677 ILE A CG2 1 
ATOM   1674 C CD1 . ILE A 1 210 ? -26.059 -13.337 63.481 1.00 26.06  ? 677 ILE A CD1 1 
ATOM   1675 N N   . PHE A 1 211 ? -23.127 -13.329 68.599 1.00 22.50  ? 678 PHE A N   1 
ATOM   1676 C CA  . PHE A 1 211 ? -22.126 -12.700 69.436 1.00 23.16  ? 678 PHE A CA  1 
ATOM   1677 C C   . PHE A 1 211 ? -20.784 -12.507 68.687 1.00 23.32  ? 678 PHE A C   1 
ATOM   1678 O O   . PHE A 1 211 ? -20.138 -13.463 68.240 1.00 23.92  ? 678 PHE A O   1 
ATOM   1679 C CB  . PHE A 1 211 ? -21.944 -13.452 70.775 1.00 24.90  ? 678 PHE A CB  1 
ATOM   1680 C CG  . PHE A 1 211 ? -20.923 -12.814 71.697 1.00 28.70  ? 678 PHE A CG  1 
ATOM   1681 C CD1 . PHE A 1 211 ? -21.081 -11.508 72.131 1.00 33.87  ? 678 PHE A CD1 1 
ATOM   1682 C CD2 . PHE A 1 211 ? -19.802 -13.510 72.113 1.00 35.62  ? 678 PHE A CD2 1 
ATOM   1683 C CE1 . PHE A 1 211 ? -20.134 -10.903 72.949 1.00 39.60  ? 678 PHE A CE1 1 
ATOM   1684 C CE2 . PHE A 1 211 ? -18.837 -12.899 72.945 1.00 35.50  ? 678 PHE A CE2 1 
ATOM   1685 C CZ  . PHE A 1 211 ? -19.010 -11.603 73.352 1.00 37.22  ? 678 PHE A CZ  1 
ATOM   1686 N N   . VAL A 1 212 ? -20.376 -11.259 68.547 1.00 19.97  ? 679 VAL A N   1 
ATOM   1687 C CA  . VAL A 1 212 ? -19.122 -10.983 67.901 1.00 19.72  ? 679 VAL A CA  1 
ATOM   1688 C C   . VAL A 1 212 ? -18.023 -10.915 68.971 1.00 21.31  ? 679 VAL A C   1 
ATOM   1689 O O   . VAL A 1 212 ? -17.806 -9.882  69.603 1.00 21.11  ? 679 VAL A O   1 
ATOM   1690 C CB  . VAL A 1 212 ? -19.220 -9.679  67.095 1.00 19.07  ? 679 VAL A CB  1 
ATOM   1691 C CG1 . VAL A 1 212 ? -17.944 -9.423  66.357 1.00 18.49  ? 679 VAL A CG1 1 
ATOM   1692 C CG2 . VAL A 1 212 ? -20.382 -9.753  66.122 1.00 17.39  ? 679 VAL A CG2 1 
ATOM   1693 N N   . ASN A 1 213 ? -17.328 -12.035 69.160 1.00 23.49  ? 680 ASN A N   1 
ATOM   1694 C CA  . ASN A 1 213 ? -16.364 -12.206 70.255 1.00 21.44  ? 680 ASN A CA  1 
ATOM   1695 C C   . ASN A 1 213 ? -14.984 -11.935 69.663 1.00 22.50  ? 680 ASN A C   1 
ATOM   1696 O O   . ASN A 1 213 ? -14.118 -12.821 69.597 1.00 22.85  ? 680 ASN A O   1 
ATOM   1697 C CB  . ASN A 1 213 ? -16.484 -13.638 70.773 1.00 21.78  ? 680 ASN A CB  1 
ATOM   1698 C CG  . ASN A 1 213 ? -15.718 -13.888 72.062 1.00 20.97  ? 680 ASN A CG  1 
ATOM   1699 O OD1 . ASN A 1 213 ? -15.642 -13.032 72.921 1.00 22.40  ? 680 ASN A OD1 1 
ATOM   1700 N ND2 . ASN A 1 213 ? -15.193 -15.096 72.211 1.00 19.53  ? 680 ASN A ND2 1 
ATOM   1701 N N   . VAL A 1 214 ? -14.817 -10.690 69.221 1.00 21.78  ? 681 VAL A N   1 
ATOM   1702 C CA  . VAL A 1 214 ? -13.616 -10.203 68.572 1.00 21.95  ? 681 VAL A CA  1 
ATOM   1703 C C   . VAL A 1 214 ? -13.062 -8.968  69.289 1.00 21.55  ? 681 VAL A C   1 
ATOM   1704 O O   . VAL A 1 214 ? -13.791 -8.031  69.587 1.00 24.64  ? 681 VAL A O   1 
ATOM   1705 C CB  . VAL A 1 214 ? -13.922 -9.834  67.087 1.00 22.54  ? 681 VAL A CB  1 
ATOM   1706 C CG1 . VAL A 1 214 ? -12.661 -9.277  66.403 1.00 22.15  ? 681 VAL A CG1 1 
ATOM   1707 C CG2 . VAL A 1 214 ? -14.420 -11.085 66.330 1.00 21.33  ? 681 VAL A CG2 1 
ATOM   1708 N N   . ARG A 1 215 ? -11.769 -8.966  69.549 1.00 20.71  ? 682 ARG A N   1 
ATOM   1709 C CA  . ARG A 1 215 ? -11.133 -7.850  70.227 1.00 22.93  ? 682 ARG A CA  1 
ATOM   1710 C C   . ARG A 1 215 ? -10.067 -7.238  69.334 1.00 26.51  ? 682 ARG A C   1 
ATOM   1711 O O   . ARG A 1 215 ? -9.617  -7.856  68.361 1.00 26.99  ? 682 ARG A O   1 
ATOM   1712 C CB  . ARG A 1 215 ? -10.476 -8.348  71.501 1.00 24.30  ? 682 ARG A CB  1 
ATOM   1713 C CG  . ARG A 1 215 ? -11.448 -9.006  72.419 1.00 27.99  ? 682 ARG A CG  1 
ATOM   1714 C CD  . ARG A 1 215 ? -10.764 -9.955  73.393 1.00 28.87  ? 682 ARG A CD  1 
ATOM   1715 N NE  . ARG A 1 215 ? -11.750 -10.958 73.815 1.00 47.12  ? 682 ARG A NE  1 
ATOM   1716 C CZ  . ARG A 1 215 ? -12.527 -10.846 74.885 1.00 54.19  ? 682 ARG A CZ  1 
ATOM   1717 N NH1 . ARG A 1 215 ? -12.409 -9.777  75.672 1.00 55.79  ? 682 ARG A NH1 1 
ATOM   1718 N NH2 . ARG A 1 215 ? -13.438 -11.782 75.144 1.00 31.63  ? 682 ARG A NH2 1 
ATOM   1719 N N   . THR A 1 216 ? -9.676  -6.012  69.671 1.00 29.04  ? 683 THR A N   1 
ATOM   1720 C CA  . THR A 1 216 ? -8.637  -5.273  68.945 1.00 29.14  ? 683 THR A CA  1 
ATOM   1721 C C   . THR A 1 216 ? -7.648  -4.823  70.023 1.00 28.65  ? 683 THR A C   1 
ATOM   1722 O O   . THR A 1 216 ? -8.053  -4.379  71.090 1.00 26.59  ? 683 THR A O   1 
ATOM   1723 C CB  . THR A 1 216 ? -9.257  -4.047  68.208 1.00 29.39  ? 683 THR A CB  1 
ATOM   1724 O OG1 . THR A 1 216 ? -10.217 -4.505  67.253 1.00 28.71  ? 683 THR A OG1 1 
ATOM   1725 C CG2 . THR A 1 216 ? -8.189  -3.181  67.514 1.00 26.77  ? 683 THR A CG2 1 
ATOM   1726 N N   . PRO A 1 217 ? -6.341  -4.952  69.764 1.00 32.96  ? 684 PRO A N   1 
ATOM   1727 C CA  . PRO A 1 217 ? -5.276  -4.581  70.715 1.00 33.86  ? 684 PRO A CA  1 
ATOM   1728 C C   . PRO A 1 217 ? -5.322  -3.092  71.079 1.00 37.46  ? 684 PRO A C   1 
ATOM   1729 O O   . PRO A 1 217 ? -5.439  -2.236  70.195 1.00 35.19  ? 684 PRO A O   1 
ATOM   1730 C CB  . PRO A 1 217 ? -4.003  -4.794  69.877 1.00 31.68  ? 684 PRO A CB  1 
ATOM   1731 C CG  . PRO A 1 217 ? -4.353  -5.953  69.019 1.00 36.44  ? 684 PRO A CG  1 
ATOM   1732 C CD  . PRO A 1 217 ? -5.761  -5.539  68.541 1.00 37.17  ? 684 PRO A CD  1 
ATOM   1733 N N   . TYR A 1 218 ? -5.219  -2.782  72.367 1.00 35.43  ? 685 TYR A N   1 
ATOM   1734 C CA  . TYR A 1 218 ? -4.887  -1.422  72.769 1.00 34.92  ? 685 TYR A CA  1 
ATOM   1735 C C   . TYR A 1 218 ? -3.380  -1.294  72.581 1.00 35.36  ? 685 TYR A C   1 
ATOM   1736 O O   . TYR A 1 218 ? -2.620  -2.084  73.131 1.00 36.39  ? 685 TYR A O   1 
ATOM   1737 C CB  . TYR A 1 218 ? -5.228  -1.162  74.237 1.00 31.02  ? 685 TYR A CB  1 
ATOM   1738 C CG  . TYR A 1 218 ? -4.898  0.255   74.699 1.00 38.04  ? 685 TYR A CG  1 
ATOM   1739 C CD1 . TYR A 1 218 ? -5.888  1.244   74.744 1.00 38.65  ? 685 TYR A CD1 1 
ATOM   1740 C CD2 . TYR A 1 218 ? -3.599  0.609   75.095 1.00 33.75  ? 685 TYR A CD2 1 
ATOM   1741 C CE1 . TYR A 1 218 ? -5.607  2.545   75.180 1.00 40.32  ? 685 TYR A CE1 1 
ATOM   1742 C CE2 . TYR A 1 218 ? -3.305  1.911   75.533 1.00 37.84  ? 685 TYR A CE2 1 
ATOM   1743 C CZ  . TYR A 1 218 ? -4.317  2.875   75.577 1.00 46.71  ? 685 TYR A CZ  1 
ATOM   1744 O OH  . TYR A 1 218 ? -4.056  4.158   76.016 1.00 38.10  ? 685 TYR A OH  1 
ATOM   1745 N N   . LYS A 1 219 ? -2.949  -0.303  71.808 1.00 34.49  ? 686 LYS A N   1 
ATOM   1746 C CA  . LYS A 1 219 ? -1.523  -0.074  71.591 1.00 35.66  ? 686 LYS A CA  1 
ATOM   1747 C C   . LYS A 1 219 ? -1.003  1.185   72.298 1.00 32.92  ? 686 LYS A C   1 
ATOM   1748 O O   . LYS A 1 219 ? -0.025  1.132   73.026 1.00 42.02  ? 686 LYS A O   1 
ATOM   1749 C CB  . LYS A 1 219 ? -1.210  -0.069  70.090 1.00 39.50  ? 686 LYS A CB  1 
ATOM   1750 C CG  . LYS A 1 219 ? -1.484  -1.423  69.397 1.00 36.64  ? 686 LYS A CG  1 
ATOM   1751 C CD  . LYS A 1 219 ? -1.493  -1.307  67.854 1.00 40.59  ? 686 LYS A CD  1 
ATOM   1752 C CE  . LYS A 1 219 ? -0.195  -0.728  67.294 1.00 66.53  ? 686 LYS A CE  1 
ATOM   1753 N NZ  . LYS A 1 219 ? -0.239  -0.521  65.809 1.00 56.08  ? 686 LYS A NZ  1 
ATOM   1754 N N   . TYR A 1 220 ? -1.680  2.305   72.107 1.00 34.33  ? 687 TYR A N   1 
ATOM   1755 C CA  . TYR A 1 220 ? -1.234  3.579   72.658 1.00 37.30  ? 687 TYR A CA  1 
ATOM   1756 C C   . TYR A 1 220 ? -2.342  4.626   72.921 1.00 41.25  ? 687 TYR A C   1 
ATOM   1757 O O   . TYR A 1 220 ? -2.087  5.687   73.518 1.00 35.55  ? 687 TYR A O   1 
ATOM   1758 C CB  . TYR A 1 220 ? -0.097  4.150   71.794 1.00 47.61  ? 687 TYR A CB  1 
ATOM   1759 C CG  . TYR A 1 220 ? -0.431  4.200   70.315 1.00 48.06  ? 687 TYR A CG  1 
ATOM   1760 C CD1 . TYR A 1 220 ? 0.193   3.326   69.407 1.00 42.63  ? 687 TYR A CD1 1 
ATOM   1761 C CD2 . TYR A 1 220 ? -1.373  5.108   69.820 1.00 38.62  ? 687 TYR A CD2 1 
ATOM   1762 C CE1 . TYR A 1 220 ? -0.121  3.347   68.040 1.00 41.36  ? 687 TYR A CE1 1 
ATOM   1763 C CE2 . TYR A 1 220 ? -1.696  5.138   68.450 1.00 42.55  ? 687 TYR A CE2 1 
ATOM   1764 C CZ  . TYR A 1 220 ? -1.071  4.253   67.574 1.00 39.49  ? 687 TYR A CZ  1 
ATOM   1765 O OH  . TYR A 1 220 ? -1.407  4.276   66.243 1.00 51.97  ? 687 TYR A OH  1 
ATOM   1766 N N   . HIS A 1 221 ? -3.575  4.335   72.508 1.00 37.62  ? 688 HIS A N   1 
ATOM   1767 C CA  . HIS A 1 221 ? -4.664  5.250   72.837 1.00 30.33  ? 688 HIS A CA  1 
ATOM   1768 C C   . HIS A 1 221 ? -6.041  4.645   72.561 1.00 28.89  ? 688 HIS A C   1 
ATOM   1769 O O   . HIS A 1 221 ? -6.208  3.825   71.655 1.00 27.98  ? 688 HIS A O   1 
ATOM   1770 C CB  . HIS A 1 221 ? -4.468  6.570   72.091 1.00 25.35  ? 688 HIS A CB  1 
ATOM   1771 C CG  . HIS A 1 221 ? -5.301  7.692   72.617 1.00 25.87  ? 688 HIS A CG  1 
ATOM   1772 N ND1 . HIS A 1 221 ? -6.672  7.737   72.484 1.00 26.42  ? 688 HIS A ND1 1 
ATOM   1773 C CD2 . HIS A 1 221 ? -4.948  8.817   73.281 1.00 22.79  ? 688 HIS A CD2 1 
ATOM   1774 C CE1 . HIS A 1 221 ? -7.127  8.844   73.042 1.00 24.56  ? 688 HIS A CE1 1 
ATOM   1775 N NE2 . HIS A 1 221 ? -6.100  9.518   73.530 1.00 23.50  ? 688 HIS A NE2 1 
ATOM   1776 N N   . HIS A 1 222 ? -7.015  5.047   73.371 1.00 27.25  ? 689 HIS A N   1 
ATOM   1777 C CA  . HIS A 1 222 ? -8.387  4.586   73.234 1.00 27.59  ? 689 HIS A CA  1 
ATOM   1778 C C   . HIS A 1 222 ? -8.873  4.866   71.813 1.00 30.26  ? 689 HIS A C   1 
ATOM   1779 O O   . HIS A 1 222 ? -9.470  4.005   71.158 1.00 33.39  ? 689 HIS A O   1 
ATOM   1780 C CB  . HIS A 1 222 ? -9.284  5.320   74.241 1.00 27.26  ? 689 HIS A CB  1 
ATOM   1781 C CG  . HIS A 1 222 ? -10.695 4.819   74.288 1.00 27.55  ? 689 HIS A CG  1 
ATOM   1782 N ND1 . HIS A 1 222 ? -11.527 5.061   75.360 1.00 27.43  ? 689 HIS A ND1 1 
ATOM   1783 C CD2 . HIS A 1 222 ? -11.421 4.087   73.405 1.00 27.66  ? 689 HIS A CD2 1 
ATOM   1784 C CE1 . HIS A 1 222 ? -12.704 4.494   75.143 1.00 27.28  ? 689 HIS A CE1 1 
ATOM   1785 N NE2 . HIS A 1 222 ? -12.665 3.895   73.964 1.00 28.84  ? 689 HIS A NE2 1 
ATOM   1786 N N   . TYR A 1 223 ? -8.602  6.074   71.331 1.00 28.43  ? 690 TYR A N   1 
ATOM   1787 C CA  . TYR A 1 223 ? -9.003  6.444   69.987 1.00 25.02  ? 690 TYR A CA  1 
ATOM   1788 C C   . TYR A 1 223 ? -8.413  5.463   68.957 1.00 26.03  ? 690 TYR A C   1 
ATOM   1789 O O   . TYR A 1 223 ? -9.105  4.993   68.066 1.00 27.68  ? 690 TYR A O   1 
ATOM   1790 C CB  . TYR A 1 223 ? -8.636  7.909   69.676 1.00 25.48  ? 690 TYR A CB  1 
ATOM   1791 C CG  . TYR A 1 223 ? -9.102  8.305   68.295 1.00 25.52  ? 690 TYR A CG  1 
ATOM   1792 C CD1 . TYR A 1 223 ? -8.331  8.011   67.165 1.00 23.88  ? 690 TYR A CD1 1 
ATOM   1793 C CD2 . TYR A 1 223 ? -10.333 8.933   68.117 1.00 22.29  ? 690 TYR A CD2 1 
ATOM   1794 C CE1 . TYR A 1 223 ? -8.797  8.294   65.901 1.00 23.97  ? 690 TYR A CE1 1 
ATOM   1795 C CE2 . TYR A 1 223 ? -10.806 9.220   66.861 1.00 23.26  ? 690 TYR A CE2 1 
ATOM   1796 C CZ  . TYR A 1 223 ? -10.044 8.889   65.754 1.00 25.01  ? 690 TYR A CZ  1 
ATOM   1797 O OH  . TYR A 1 223 ? -10.536 9.143   64.499 1.00 27.72  ? 690 TYR A OH  1 
ATOM   1798 N N   . GLN A 1 224 ? -7.128  5.161   69.093 1.00 27.92  ? 691 GLN A N   1 
ATOM   1799 C CA  . GLN A 1 224 ? -6.454  4.187   68.247 1.00 24.47  ? 691 GLN A CA  1 
ATOM   1800 C C   . GLN A 1 224 ? -7.186  2.841   68.203 1.00 27.98  ? 691 GLN A C   1 
ATOM   1801 O O   . GLN A 1 224 ? -7.429  2.292   67.120 1.00 24.03  ? 691 GLN A O   1 
ATOM   1802 C CB  . GLN A 1 224 ? -4.996  4.053   68.708 1.00 23.94  ? 691 GLN A CB  1 
ATOM   1803 C CG  . GLN A 1 224 ? -4.207  2.837   68.219 1.00 25.72  ? 691 GLN A CG  1 
ATOM   1804 C CD  . GLN A 1 224 ? -4.470  1.586   69.076 1.00 31.81  ? 691 GLN A CD  1 
ATOM   1805 O OE1 . GLN A 1 224 ? -4.380  1.649   70.302 1.00 38.48  ? 691 GLN A OE1 1 
ATOM   1806 N NE2 . GLN A 1 224 ? -4.781  0.456   68.437 1.00 25.99  ? 691 GLN A NE2 1 
ATOM   1807 N N   . GLN A 1 225 ? -7.550  2.326   69.380 1.00 26.44  ? 692 GLN A N   1 
ATOM   1808 C CA  . GLN A 1 225 ? -8.162  1.005   69.484 1.00 26.62  ? 692 GLN A CA  1 
ATOM   1809 C C   . GLN A 1 225 ? -9.574  1.018   68.911 1.00 26.84  ? 692 GLN A C   1 
ATOM   1810 O O   . GLN A 1 225 ? -10.020 0.067   68.263 1.00 26.82  ? 692 GLN A O   1 
ATOM   1811 C CB  . GLN A 1 225 ? -8.153  0.538   70.946 1.00 26.96  ? 692 GLN A CB  1 
ATOM   1812 C CG  . GLN A 1 225 ? -8.785  -0.807  71.227 1.00 26.62  ? 692 GLN A CG  1 
ATOM   1813 C CD  . GLN A 1 225 ? -8.698  -1.197  72.711 1.00 31.57  ? 692 GLN A CD  1 
ATOM   1814 O OE1 . GLN A 1 225 ? -8.926  -0.375  73.607 1.00 36.37  ? 692 GLN A OE1 1 
ATOM   1815 N NE2 . GLN A 1 225 ? -8.381  -2.453  72.969 1.00 28.20  ? 692 GLN A NE2 1 
ATOM   1816 N N   . CYS A 1 226 ? -10.274 2.120   69.117 1.00 25.33  ? 693 CYS A N   1 
ATOM   1817 C CA  . CYS A 1 226 ? -11.616 2.187   68.618 1.00 24.93  ? 693 CYS A CA  1 
ATOM   1818 C C   . CYS A 1 226 ? -11.586 2.259   67.095 1.00 24.77  ? 693 CYS A C   1 
ATOM   1819 O O   . CYS A 1 226 ? -12.346 1.577   66.433 1.00 24.56  ? 693 CYS A O   1 
ATOM   1820 C CB  . CYS A 1 226 ? -12.357 3.364   69.241 1.00 28.30  ? 693 CYS A CB  1 
ATOM   1821 S SG  . CYS A 1 226 ? -14.067 3.461   68.786 1.00 36.40  ? 693 CYS A SG  1 
ATOM   1822 N N   . GLU A 1 227 ? -10.689 3.050   66.524 1.00 25.65  ? 694 GLU A N   1 
ATOM   1823 C CA  . GLU A 1 227 ? -10.628 3.122   65.063 1.00 29.66  ? 694 GLU A CA  1 
ATOM   1824 C C   . GLU A 1 227 ? -10.117 1.843   64.373 1.00 29.47  ? 694 GLU A C   1 
ATOM   1825 O O   . GLU A 1 227 ? -10.510 1.535   63.246 1.00 30.86  ? 694 GLU A O   1 
ATOM   1826 C CB  . GLU A 1 227 ? -9.856  4.345   64.575 1.00 31.79  ? 694 GLU A CB  1 
ATOM   1827 C CG  . GLU A 1 227 ? -9.961  4.511   63.068 1.00 40.52  ? 694 GLU A CG  1 
ATOM   1828 C CD  . GLU A 1 227 ? -9.366  5.815   62.559 1.00 70.41  ? 694 GLU A CD  1 
ATOM   1829 O OE1 . GLU A 1 227 ? -9.852  6.303   61.508 1.00 53.93  ? 694 GLU A OE1 1 
ATOM   1830 O OE2 . GLU A 1 227 ? -8.420  6.338   63.196 1.00 92.30  ? 694 GLU A OE2 1 
ATOM   1831 N N   . ASP A 1 228 ? -9.245  1.096   65.044 1.00 30.54  ? 695 ASP A N   1 
ATOM   1832 C CA  . ASP A 1 228 ? -8.782  -0.183  64.508 1.00 27.66  ? 695 ASP A CA  1 
ATOM   1833 C C   . ASP A 1 228 ? -9.848  -1.248  64.537 1.00 28.67  ? 695 ASP A C   1 
ATOM   1834 O O   . ASP A 1 228 ? -9.808  -2.197  63.759 1.00 27.01  ? 695 ASP A O   1 
ATOM   1835 C CB  . ASP A 1 228 ? -7.544  -0.692  65.230 1.00 29.20  ? 695 ASP A CB  1 
ATOM   1836 C CG  . ASP A 1 228 ? -6.306  0.089   64.883 1.00 28.54  ? 695 ASP A CG  1 
ATOM   1837 O OD1 . ASP A 1 228 ? -5.459  0.291   65.776 1.00 33.22  ? 695 ASP A OD1 1 
ATOM   1838 O OD2 . ASP A 1 228 ? -6.173  0.474   63.710 1.00 28.73  ? 695 ASP A OD2 1 
ATOM   1839 N N   . HIS A 1 229 ? -10.804 -1.074  65.438 1.00 26.52  ? 696 HIS A N   1 
ATOM   1840 C CA  . HIS A 1 229 ? -11.870 -2.030  65.599 1.00 25.66  ? 696 HIS A CA  1 
ATOM   1841 C C   . HIS A 1 229 ? -12.991 -1.770  64.582 1.00 24.64  ? 696 HIS A C   1 
ATOM   1842 O O   . HIS A 1 229 ? -13.888 -2.605  64.401 1.00 29.75  ? 696 HIS A O   1 
ATOM   1843 C CB  . HIS A 1 229 ? -12.431 -1.909  67.008 1.00 25.78  ? 696 HIS A CB  1 
ATOM   1844 C CG  . HIS A 1 229 ? -13.325 -3.038  67.393 1.00 26.11  ? 696 HIS A CG  1 
ATOM   1845 N ND1 . HIS A 1 229 ? -12.869 -4.338  67.493 1.00 26.13  ? 696 HIS A ND1 1 
ATOM   1846 C CD2 . HIS A 1 229 ? -14.641 -3.073  67.709 1.00 25.69  ? 696 HIS A CD2 1 
ATOM   1847 C CE1 . HIS A 1 229 ? -13.868 -5.124  67.857 1.00 24.95  ? 696 HIS A CE1 1 
ATOM   1848 N NE2 . HIS A 1 229 ? -14.953 -4.380  67.996 1.00 25.02  ? 696 HIS A NE2 1 
ATOM   1849 N N   . ALA A 1 230 ? -12.941 -0.623  63.920 1.00 19.84  ? 697 ALA A N   1 
ATOM   1850 C CA  . ALA A 1 230 ? -14.052 -0.195  63.091 1.00 19.33  ? 697 ALA A CA  1 
ATOM   1851 C C   . ALA A 1 230 ? -14.307 -1.146  61.945 1.00 20.46  ? 697 ALA A C   1 
ATOM   1852 O O   . ALA A 1 230 ? -15.464 -1.517  61.677 1.00 22.78  ? 697 ALA A O   1 
ATOM   1853 C CB  . ALA A 1 230 ? -13.853 1.227   62.589 1.00 17.87  ? 697 ALA A CB  1 
ATOM   1854 N N   . ILE A 1 231 ? -13.230 -1.567  61.285 1.00 21.96  ? 698 ILE A N   1 
ATOM   1855 C CA  . ILE A 1 231 ? -13.348 -2.470  60.142 1.00 21.29  ? 698 ILE A CA  1 
ATOM   1856 C C   . ILE A 1 231 ? -14.030 -3.769  60.582 1.00 22.52  ? 698 ILE A C   1 
ATOM   1857 O O   . ILE A 1 231 ? -14.782 -4.375  59.832 1.00 26.28  ? 698 ILE A O   1 
ATOM   1858 C CB  . ILE A 1 231 ? -11.977 -2.761  59.463 1.00 20.29  ? 698 ILE A CB  1 
ATOM   1859 C CG1 . ILE A 1 231 ? -12.187 -3.538  58.156 1.00 19.73  ? 698 ILE A CG1 1 
ATOM   1860 C CG2 . ILE A 1 231 ? -11.047 -3.584  60.378 1.00 18.37  ? 698 ILE A CG2 1 
ATOM   1861 C CD1 . ILE A 1 231 ? -13.028 -2.811  57.122 1.00 18.44  ? 698 ILE A CD1 1 
ATOM   1862 N N   . LYS A 1 232 ? -13.787 -4.172  61.820 1.00 24.24  ? 699 LYS A N   1 
ATOM   1863 C CA  . LYS A 1 232 ? -14.410 -5.370  62.359 1.00 23.71  ? 699 LYS A CA  1 
ATOM   1864 C C   . LYS A 1 232 ? -15.877 -5.109  62.647 1.00 24.07  ? 699 LYS A C   1 
ATOM   1865 O O   . LYS A 1 232 ? -16.706 -5.976  62.381 1.00 26.18  ? 699 LYS A O   1 
ATOM   1866 C CB  . LYS A 1 232 ? -13.651 -5.857  63.602 1.00 25.86  ? 699 LYS A CB  1 
ATOM   1867 C CG  . LYS A 1 232 ? -12.161 -6.040  63.314 1.00 26.20  ? 699 LYS A CG  1 
ATOM   1868 C CD  . LYS A 1 232 ? -11.332 -6.480  64.508 1.00 30.35  ? 699 LYS A CD  1 
ATOM   1869 C CE  . LYS A 1 232 ? -9.860  -6.118  64.270 1.00 28.26  ? 699 LYS A CE  1 
ATOM   1870 N NZ  . LYS A 1 232 ? -8.973  -6.531  65.398 1.00 40.54  ? 699 LYS A NZ  1 
ATOM   1871 N N   . LEU A 1 233 ? -16.218 -3.911  63.140 1.00 23.82  ? 700 LEU A N   1 
ATOM   1872 C CA  . LEU A 1 233 ? -17.644 -3.556  63.303 1.00 23.75  ? 700 LEU A CA  1 
ATOM   1873 C C   . LEU A 1 233 ? -18.402 -3.625  61.996 1.00 23.58  ? 700 LEU A C   1 
ATOM   1874 O O   . LEU A 1 233 ? -19.549 -4.013  61.961 1.00 23.86  ? 700 LEU A O   1 
ATOM   1875 C CB  . LEU A 1 233 ? -17.842 -2.143  63.846 1.00 22.67  ? 700 LEU A CB  1 
ATOM   1876 C CG  . LEU A 1 233 ? -17.384 -1.847  65.267 1.00 22.83  ? 700 LEU A CG  1 
ATOM   1877 C CD1 . LEU A 1 233 ? -17.672 -0.393  65.623 1.00 19.49  ? 700 LEU A CD1 1 
ATOM   1878 C CD2 . LEU A 1 233 ? -18.103 -2.801  66.206 1.00 22.04  ? 700 LEU A CD2 1 
ATOM   1879 N N   . SER A 1 234 ? -17.746 -3.210  60.927 1.00 24.54  ? 701 SER A N   1 
ATOM   1880 C CA  . SER A 1 234 ? -18.364 -3.146  59.620 1.00 26.21  ? 701 SER A CA  1 
ATOM   1881 C C   . SER A 1 234 ? -18.486 -4.510  58.960 1.00 27.01  ? 701 SER A C   1 
ATOM   1882 O O   . SER A 1 234 ? -19.508 -4.834  58.372 1.00 27.67  ? 701 SER A O   1 
ATOM   1883 C CB  . SER A 1 234 ? -17.558 -2.222  58.704 1.00 25.24  ? 701 SER A CB  1 
ATOM   1884 O OG  . SER A 1 234 ? -18.155 -2.208  57.427 1.00 26.92  ? 701 SER A OG  1 
ATOM   1885 N N   . MET A 1 235 ? -17.417 -5.288  59.048 1.00 28.29  ? 702 MET A N   1 
ATOM   1886 C CA  . MET A 1 235 ? -17.344 -6.587  58.391 1.00 30.00  ? 702 MET A CA  1 
ATOM   1887 C C   . MET A 1 235 ? -18.089 -7.705  59.134 1.00 29.85  ? 702 MET A C   1 
ATOM   1888 O O   . MET A 1 235 ? -18.537 -8.677  58.524 1.00 25.56  ? 702 MET A O   1 
ATOM   1889 C CB  . MET A 1 235 ? -15.874 -6.993  58.206 1.00 27.50  ? 702 MET A CB  1 
ATOM   1890 C CG  . MET A 1 235 ? -15.087 -6.147  57.223 1.00 26.26  ? 702 MET A CG  1 
ATOM   1891 S SD  . MET A 1 235 ? -15.727 -6.297  55.544 1.00 32.95  ? 702 MET A SD  1 
ATOM   1892 C CE  . MET A 1 235 ? -16.729 -4.927  55.459 1.00 37.00  ? 702 MET A CE  1 
ATOM   1893 N N   . LEU A 1 236 ? -18.196 -7.575  60.452 1.00 25.20  ? 703 LEU A N   1 
ATOM   1894 C CA  . LEU A 1 236 ? -18.793 -8.638  61.238 1.00 22.41  ? 703 LEU A CA  1 
ATOM   1895 C C   . LEU A 1 236 ? -20.105 -8.192  61.852 1.00 25.13  ? 703 LEU A C   1 
ATOM   1896 O O   . LEU A 1 236 ? -21.168 -8.788  61.592 1.00 25.53  ? 703 LEU A O   1 
ATOM   1897 C CB  . LEU A 1 236 ? -17.814 -9.143  62.311 1.00 18.52  ? 703 LEU A CB  1 
ATOM   1898 C CG  . LEU A 1 236 ? -16.502 -9.688  61.733 1.00 17.91  ? 703 LEU A CG  1 
ATOM   1899 C CD1 . LEU A 1 236 ? -15.488 -10.048 62.800 1.00 16.48  ? 703 LEU A CD1 1 
ATOM   1900 C CD2 . LEU A 1 236 ? -16.743 -10.873 60.758 1.00 16.76  ? 703 LEU A CD2 1 
ATOM   1901 N N   . THR A 1 237 ? -20.034 -7.134  62.655 1.00 22.92  ? 704 THR A N   1 
ATOM   1902 C CA  . THR A 1 237 ? -21.182 -6.732  63.432 1.00 22.97  ? 704 THR A CA  1 
ATOM   1903 C C   . THR A 1 237 ? -22.296 -6.221  62.521 1.00 27.43  ? 704 THR A C   1 
ATOM   1904 O O   . THR A 1 237 ? -23.461 -6.604  62.679 1.00 28.48  ? 704 THR A O   1 
ATOM   1905 C CB  . THR A 1 237 ? -20.814 -5.667  64.446 1.00 24.01  ? 704 THR A CB  1 
ATOM   1906 O OG1 . THR A 1 237 ? -19.684 -6.118  65.191 1.00 22.74  ? 704 THR A OG1 1 
ATOM   1907 C CG2 . THR A 1 237 ? -21.962 -5.478  65.413 1.00 23.76  ? 704 THR A CG2 1 
ATOM   1908 N N   . LYS A 1 238 ? -21.946 -5.366  61.565 1.00 26.14  ? 705 LYS A N   1 
ATOM   1909 C CA  . LYS A 1 238 ? -22.943 -4.843  60.650 1.00 26.65  ? 705 LYS A CA  1 
ATOM   1910 C C   . LYS A 1 238 ? -23.555 -5.956  59.796 1.00 26.25  ? 705 LYS A C   1 
ATOM   1911 O O   . LYS A 1 238 ? -24.765 -6.000  59.627 1.00 25.89  ? 705 LYS A O   1 
ATOM   1912 C CB  . LYS A 1 238 ? -22.372 -3.733  59.777 1.00 27.29  ? 705 LYS A CB  1 
ATOM   1913 C CG  . LYS A 1 238 ? -23.414 -3.094  58.875 1.00 33.13  ? 705 LYS A CG  1 
ATOM   1914 C CD  . LYS A 1 238 ? -22.828 -1.940  58.053 1.00 38.06  ? 705 LYS A CD  1 
ATOM   1915 C CE  . LYS A 1 238 ? -23.905 -1.256  57.217 1.00 42.65  ? 705 LYS A CE  1 
ATOM   1916 N NZ  . LYS A 1 238 ? -23.358 -0.139  56.400 1.00 68.15  ? 705 LYS A NZ  1 
ATOM   1917 N N   . LYS A 1 239 ? -22.730 -6.865  59.280 1.00 27.28  ? 706 LYS A N   1 
ATOM   1918 C CA  . LYS A 1 239 ? -23.244 -7.941  58.437 1.00 27.48  ? 706 LYS A CA  1 
ATOM   1919 C C   . LYS A 1 239 ? -24.058 -8.940  59.240 1.00 29.73  ? 706 LYS A C   1 
ATOM   1920 O O   . LYS A 1 239 ? -24.895 -9.652  58.697 1.00 29.63  ? 706 LYS A O   1 
ATOM   1921 C CB  . LYS A 1 239 ? -22.135 -8.668  57.674 1.00 27.65  ? 706 LYS A CB  1 
ATOM   1922 C CG  . LYS A 1 239 ? -21.380 -7.813  56.679 1.00 28.28  ? 706 LYS A CG  1 
ATOM   1923 C CD  . LYS A 1 239 ? -20.373 -8.650  55.913 1.00 35.72  ? 706 LYS A CD  1 
ATOM   1924 C CE  . LYS A 1 239 ? -19.576 -7.811  54.931 1.00 39.04  ? 706 LYS A CE  1 
ATOM   1925 N NZ  . LYS A 1 239 ? -20.426 -7.159  53.896 1.00 57.35  ? 706 LYS A NZ  1 
ATOM   1926 N N   . ALA A 1 240 ? -23.817 -8.991  60.541 1.00 30.58  ? 707 ALA A N   1 
ATOM   1927 C CA  . ALA A 1 240 ? -24.546 -9.914  61.383 1.00 27.28  ? 707 ALA A CA  1 
ATOM   1928 C C   . ALA A 1 240 ? -26.048 -9.654  61.278 1.00 29.09  ? 707 ALA A C   1 
ATOM   1929 O O   . ALA A 1 240 ? -26.861 -10.569 61.492 1.00 31.12  ? 707 ALA A O   1 
ATOM   1930 C CB  . ALA A 1 240 ? -24.083 -9.800  62.807 1.00 28.43  ? 707 ALA A CB  1 
ATOM   1931 N N   . CYS A 1 241 ? -26.425 -8.424  60.933 1.00 24.84  ? 708 CYS A N   1 
ATOM   1932 C CA  . CYS A 1 241 ? -27.850 -8.098  60.822 1.00 28.31  ? 708 CYS A CA  1 
ATOM   1933 C C   . CYS A 1 241 ? -28.597 -8.911  59.784 1.00 28.34  ? 708 CYS A C   1 
ATOM   1934 O O   . CYS A 1 241 ? -29.794 -9.134  59.914 1.00 39.65  ? 708 CYS A O   1 
ATOM   1935 C CB  . CYS A 1 241 ? -28.091 -6.593  60.642 1.00 34.61  ? 708 CYS A CB  1 
ATOM   1936 S SG  . CYS A 1 241 ? -27.555 -5.601  62.082 1.00 44.80  ? 708 CYS A SG  1 
ATOM   1937 N N   . LEU A 1 242 ? -27.876 -9.383  58.771 1.00 27.81  ? 709 LEU A N   1 
ATOM   1938 C CA  . LEU A 1 242 ? -28.467 -10.175 57.705 1.00 26.52  ? 709 LEU A CA  1 
ATOM   1939 C C   . LEU A 1 242 ? -28.613 -11.632 58.112 1.00 27.32  ? 709 LEU A C   1 
ATOM   1940 O O   . LEU A 1 242 ? -29.105 -12.451 57.333 1.00 33.29  ? 709 LEU A O   1 
ATOM   1941 C CB  . LEU A 1 242 ? -27.572 -10.115 56.473 1.00 29.52  ? 709 LEU A CB  1 
ATOM   1942 C CG  . LEU A 1 242 ? -27.219 -8.718  55.958 1.00 39.63  ? 709 LEU A CG  1 
ATOM   1943 C CD1 . LEU A 1 242 ? -26.191 -8.839  54.838 1.00 37.19  ? 709 LEU A CD1 1 
ATOM   1944 C CD2 . LEU A 1 242 ? -28.441 -7.890  55.532 1.00 29.25  ? 709 LEU A CD2 1 
ATOM   1945 N N   . HIS A 1 243 ? -28.174 -11.965 59.322 1.00 26.21  ? 710 HIS A N   1 
ATOM   1946 C CA  . HIS A 1 243 ? -28.233 -13.339 59.798 1.00 23.69  ? 710 HIS A CA  1 
ATOM   1947 C C   . HIS A 1 243 ? -29.005 -13.509 61.103 1.00 26.65  ? 710 HIS A C   1 
ATOM   1948 O O   . HIS A 1 243 ? -28.798 -14.490 61.831 1.00 28.16  ? 710 HIS A O   1 
ATOM   1949 C CB  . HIS A 1 243 ? -26.831 -13.884 59.940 1.00 25.12  ? 710 HIS A CB  1 
ATOM   1950 C CG  . HIS A 1 243 ? -26.084 -13.936 58.648 1.00 28.52  ? 710 HIS A CG  1 
ATOM   1951 N ND1 . HIS A 1 243 ? -26.163 -15.010 57.783 1.00 28.75  ? 710 HIS A ND1 1 
ATOM   1952 C CD2 . HIS A 1 243 ? -25.244 -13.047 58.072 1.00 26.57  ? 710 HIS A CD2 1 
ATOM   1953 C CE1 . HIS A 1 243 ? -25.395 -14.780 56.734 1.00 29.25  ? 710 HIS A CE1 1 
ATOM   1954 N NE2 . HIS A 1 243 ? -24.827 -13.596 56.885 1.00 30.49  ? 710 HIS A NE2 1 
ATOM   1955 N N   . LEU A 1 244 ? -29.879 -12.542 61.395 1.00 24.82  ? 711 LEU A N   1 
ATOM   1956 C CA  . LEU A 1 244 ? -30.768 -12.607 62.549 1.00 25.21  ? 711 LEU A CA  1 
ATOM   1957 C C   . LEU A 1 244 ? -32.178 -13.001 62.158 1.00 25.04  ? 711 LEU A C   1 
ATOM   1958 O O   . LEU A 1 244 ? -32.706 -12.539 61.155 1.00 25.62  ? 711 LEU A O   1 
ATOM   1959 C CB  . LEU A 1 244 ? -30.825 -11.260 63.266 1.00 24.35  ? 711 LEU A CB  1 
ATOM   1960 C CG  . LEU A 1 244 ? -29.504 -10.812 63.881 1.00 24.78  ? 711 LEU A CG  1 
ATOM   1961 C CD1 . LEU A 1 244 ? -29.695 -9.444  64.583 1.00 22.62  ? 711 LEU A CD1 1 
ATOM   1962 C CD2 . LEU A 1 244 ? -29.078 -11.911 64.884 1.00 23.08  ? 711 LEU A CD2 1 
ATOM   1963 N N   . ASN A 1 245 ? -32.790 -13.864 62.952 1.00 25.18  ? 712 ASN A N   1 
ATOM   1964 C CA  . ASN A 1 245 ? -34.209 -14.138 62.776 1.00 26.39  ? 712 ASN A CA  1 
ATOM   1965 C C   . ASN A 1 245 ? -34.938 -12.921 63.277 1.00 28.99  ? 712 ASN A C   1 
ATOM   1966 O O   . ASN A 1 245 ? -34.378 -12.100 64.029 1.00 31.20  ? 712 ASN A O   1 
ATOM   1967 C CB  . ASN A 1 245 ? -34.681 -15.328 63.626 1.00 27.78  ? 712 ASN A CB  1 
ATOM   1968 C CG  . ASN A 1 245 ? -34.011 -16.625 63.252 1.00 30.36  ? 712 ASN A CG  1 
ATOM   1969 O OD1 . ASN A 1 245 ? -33.919 -16.972 62.070 1.00 32.15  ? 712 ASN A OD1 1 
ATOM   1970 N ND2 . ASN A 1 245 ? -33.539 -17.357 64.259 1.00 27.60  ? 712 ASN A ND2 1 
ATOM   1971 N N   . PRO A 1 246 ? -36.208 -12.787 62.883 1.00 29.45  ? 713 PRO A N   1 
ATOM   1972 C CA  . PRO A 1 246 ? -37.021 -11.650 63.327 1.00 29.78  ? 713 PRO A CA  1 
ATOM   1973 C C   . PRO A 1 246 ? -36.940 -11.556 64.853 1.00 28.80  ? 713 PRO A C   1 
ATOM   1974 O O   . PRO A 1 246 ? -37.081 -12.567 65.559 1.00 28.56  ? 713 PRO A O   1 
ATOM   1975 C CB  . PRO A 1 246 ? -38.430 -12.103 62.918 1.00 32.16  ? 713 PRO A CB  1 
ATOM   1976 C CG  . PRO A 1 246 ? -38.158 -12.727 61.549 1.00 28.63  ? 713 PRO A CG  1 
ATOM   1977 C CD  . PRO A 1 246 ? -36.936 -13.605 61.888 1.00 27.74  ? 713 PRO A CD  1 
ATOM   1978 N N   . GLY A 1 247 ? -36.705 -10.346 65.353 1.00 27.02  ? 714 GLY A N   1 
ATOM   1979 C CA  . GLY A 1 247 ? -36.660 -10.133 66.787 1.00 23.90  ? 714 GLY A CA  1 
ATOM   1980 C C   . GLY A 1 247 ? -35.398 -10.671 67.444 1.00 26.26  ? 714 GLY A C   1 
ATOM   1981 O O   . GLY A 1 247 ? -35.294 -10.628 68.658 1.00 24.55  ? 714 GLY A O   1 
ATOM   1982 N N   . GLY A 1 248 ? -34.446 -11.174 66.655 1.00 22.68  ? 715 GLY A N   1 
ATOM   1983 C CA  . GLY A 1 248 ? -33.184 -11.610 67.219 1.00 22.13  ? 715 GLY A CA  1 
ATOM   1984 C C   . GLY A 1 248 ? -32.344 -10.502 67.844 1.00 23.19  ? 715 GLY A C   1 
ATOM   1985 O O   . GLY A 1 248 ? -32.683 -9.320  67.758 1.00 24.85  ? 715 GLY A O   1 
ATOM   1986 N N   . THR A 1 249 ? -31.239 -10.902 68.463 1.00 22.75  ? 716 THR A N   1 
ATOM   1987 C CA  . THR A 1 249 ? -30.316 -10.013 69.176 1.00 26.00  ? 716 THR A CA  1 
ATOM   1988 C C   . THR A 1 249 ? -28.874 -10.058 68.637 1.00 26.68  ? 716 THR A C   1 
ATOM   1989 O O   . THR A 1 249 ? -28.331 -11.145 68.407 1.00 27.82  ? 716 THR A O   1 
ATOM   1990 C CB  . THR A 1 249 ? -30.238 -10.424 70.674 1.00 27.60  ? 716 THR A CB  1 
ATOM   1991 O OG1 . THR A 1 249 ? -31.473 -10.134 71.334 1.00 33.22  ? 716 THR A OG1 1 
ATOM   1992 C CG2 . THR A 1 249 ? -29.089 -9.733  71.383 1.00 27.75  ? 716 THR A CG2 1 
ATOM   1993 N N   . CYS A 1 250 ? -28.247 -8.894  68.455 1.00 26.65  ? 717 CYS A N   1 
ATOM   1994 C CA  . CYS A 1 250 ? -26.811 -8.858  68.131 1.00 24.83  ? 717 CYS A CA  1 
ATOM   1995 C C   . CYS A 1 250 ? -25.952 -8.279  69.262 1.00 23.23  ? 717 CYS A C   1 
ATOM   1996 O O   . CYS A 1 250 ? -26.242 -7.206  69.764 1.00 25.68  ? 717 CYS A O   1 
ATOM   1997 C CB  . CYS A 1 250 ? -26.536 -8.095  66.831 1.00 25.46  ? 717 CYS A CB  1 
ATOM   1998 S SG  . CYS A 1 250 ? -24.769 -8.074  66.420 1.00 34.29  ? 717 CYS A SG  1 
ATOM   1999 N N   . VAL A 1 251 ? -24.899 -8.990  69.659 1.00 22.59  ? 718 VAL A N   1 
ATOM   2000 C CA  . VAL A 1 251 ? -23.996 -8.525  70.708 1.00 22.64  ? 718 VAL A CA  1 
ATOM   2001 C C   . VAL A 1 251 ? -22.538 -8.481  70.232 1.00 24.55  ? 718 VAL A C   1 
ATOM   2002 O O   . VAL A 1 251 ? -22.069 -9.410  69.560 1.00 25.90  ? 718 VAL A O   1 
ATOM   2003 C CB  . VAL A 1 251 ? -24.112 -9.366  71.983 1.00 24.67  ? 718 VAL A CB  1 
ATOM   2004 C CG1 . VAL A 1 251 ? -23.067 -8.928  73.013 1.00 25.85  ? 718 VAL A CG1 1 
ATOM   2005 C CG2 . VAL A 1 251 ? -25.505 -9.217  72.584 1.00 25.82  ? 718 VAL A CG2 1 
ATOM   2006 N N   . SER A 1 252 ? -21.829 -7.403  70.580 1.00 21.58  ? 719 SER A N   1 
ATOM   2007 C CA  . SER A 1 252 ? -20.525 -7.167  69.997 1.00 20.99  ? 719 SER A CA  1 
ATOM   2008 C C   . SER A 1 252 ? -19.553 -6.502  70.956 1.00 20.51  ? 719 SER A C   1 
ATOM   2009 O O   . SER A 1 252 ? -19.872 -5.511  71.600 1.00 21.17  ? 719 SER A O   1 
ATOM   2010 C CB  . SER A 1 252 ? -20.667 -6.327  68.719 1.00 22.31  ? 719 SER A CB  1 
ATOM   2011 O OG  . SER A 1 252 ? -19.419 -6.142  68.075 1.00 22.77  ? 719 SER A OG  1 
ATOM   2012 N N   . ILE A 1 253 ? -18.361 -7.053  71.059 1.00 19.44  ? 720 ILE A N   1 
ATOM   2013 C CA  . ILE A 1 253 ? -17.327 -6.381  71.799 1.00 21.54  ? 720 ILE A CA  1 
ATOM   2014 C C   . ILE A 1 253 ? -17.080 -5.051  71.082 1.00 24.23  ? 720 ILE A C   1 
ATOM   2015 O O   . ILE A 1 253 ? -17.301 -4.947  69.861 1.00 25.07  ? 720 ILE A O   1 
ATOM   2016 C CB  . ILE A 1 253 ? -16.063 -7.244  71.857 1.00 21.61  ? 720 ILE A CB  1 
ATOM   2017 C CG1 . ILE A 1 253 ? -16.350 -8.511  72.695 1.00 21.99  ? 720 ILE A CG1 1 
ATOM   2018 C CG2 . ILE A 1 253 ? -14.883 -6.412  72.307 1.00 20.22  ? 720 ILE A CG2 1 
ATOM   2019 C CD1 . ILE A 1 253 ? -15.172 -9.484  72.836 1.00 22.14  ? 720 ILE A CD1 1 
ATOM   2020 N N   . GLY A 1 254 ? -16.640 -4.039  71.826 1.00 22.33  ? 721 GLY A N   1 
ATOM   2021 C CA  . GLY A 1 254 ? -16.454 -2.736  71.234 1.00 20.70  ? 721 GLY A CA  1 
ATOM   2022 C C   . GLY A 1 254 ? -15.684 -1.830  72.151 1.00 22.85  ? 721 GLY A C   1 
ATOM   2023 O O   . GLY A 1 254 ? -15.340 -2.215  73.257 1.00 23.95  ? 721 GLY A O   1 
ATOM   2024 N N   . TYR A 1 255 ? -15.422 -0.613  71.696 1.00 23.00  ? 722 TYR A N   1 
ATOM   2025 C CA  . TYR A 1 255 ? -14.586 0.318   72.434 1.00 22.44  ? 722 TYR A CA  1 
ATOM   2026 C C   . TYR A 1 255 ? -15.208 1.703   72.286 1.00 24.58  ? 722 TYR A C   1 
ATOM   2027 O O   . TYR A 1 255 ? -14.571 2.730   72.504 1.00 27.43  ? 722 TYR A O   1 
ATOM   2028 C CB  . TYR A 1 255 ? -13.147 0.246   71.896 1.00 23.12  ? 722 TYR A CB  1 
ATOM   2029 C CG  . TYR A 1 255 ? -12.625 -1.184  71.932 1.00 24.96  ? 722 TYR A CG  1 
ATOM   2030 C CD1 . TYR A 1 255 ? -12.175 -1.773  73.128 1.00 25.05  ? 722 TYR A CD1 1 
ATOM   2031 C CD2 . TYR A 1 255 ? -12.607 -1.961  70.767 1.00 23.68  ? 722 TYR A CD2 1 
ATOM   2032 C CE1 . TYR A 1 255 ? -11.746 -3.118  73.156 1.00 25.29  ? 722 TYR A CE1 1 
ATOM   2033 C CE2 . TYR A 1 255 ? -12.182 -3.274  70.782 1.00 25.43  ? 722 TYR A CE2 1 
ATOM   2034 C CZ  . TYR A 1 255 ? -11.760 -3.860  71.975 1.00 26.93  ? 722 TYR A CZ  1 
ATOM   2035 O OH  . TYR A 1 255 ? -11.369 -5.181  71.952 1.00 28.06  ? 722 TYR A OH  1 
ATOM   2036 N N   . GLY A 1 256 ? -16.491 1.710   71.946 1.00 25.21  ? 723 GLY A N   1 
ATOM   2037 C CA  . GLY A 1 256 ? -17.205 2.951   71.728 1.00 24.79  ? 723 GLY A CA  1 
ATOM   2038 C C   . GLY A 1 256 ? -17.328 3.318   70.262 1.00 25.57  ? 723 GLY A C   1 
ATOM   2039 O O   . GLY A 1 256 ? -17.319 2.457   69.375 1.00 26.87  ? 723 GLY A O   1 
ATOM   2040 N N   . TYR A 1 257 ? -17.457 4.611   70.002 1.00 23.41  ? 724 TYR A N   1 
ATOM   2041 C CA  . TYR A 1 257 ? -17.354 5.114   68.647 1.00 22.04  ? 724 TYR A CA  1 
ATOM   2042 C C   . TYR A 1 257 ? -16.670 6.465   68.512 1.00 22.03  ? 724 TYR A C   1 
ATOM   2043 O O   . TYR A 1 257 ? -17.215 7.418   67.941 1.00 20.95  ? 724 TYR A O   1 
ATOM   2044 C CB  . TYR A 1 257 ? -18.658 4.971   67.880 1.00 21.35  ? 724 TYR A CB  1 
ATOM   2045 C CG  . TYR A 1 257 ? -19.868 5.428   68.645 1.00 21.60  ? 724 TYR A CG  1 
ATOM   2046 C CD1 . TYR A 1 257 ? -20.207 6.771   68.729 1.00 21.53  ? 724 TYR A CD1 1 
ATOM   2047 C CD2 . TYR A 1 257 ? -20.686 4.499   69.285 1.00 21.28  ? 724 TYR A CD2 1 
ATOM   2048 C CE1 . TYR A 1 257 ? -21.339 7.173   69.423 1.00 21.49  ? 724 TYR A CE1 1 
ATOM   2049 C CE2 . TYR A 1 257 ? -21.806 4.885   69.974 1.00 21.52  ? 724 TYR A CE2 1 
ATOM   2050 C CZ  . TYR A 1 257 ? -22.134 6.222   70.042 1.00 22.55  ? 724 TYR A CZ  1 
ATOM   2051 O OH  . TYR A 1 257 ? -23.262 6.602   70.728 1.00 26.76  ? 724 TYR A OH  1 
ATOM   2052 N N   . ALA A 1 258 ? -15.453 6.517   69.042 1.00 20.93  ? 725 ALA A N   1 
ATOM   2053 C CA  . ALA A 1 258 ? -14.635 7.702   68.962 1.00 22.22  ? 725 ALA A CA  1 
ATOM   2054 C C   . ALA A 1 258 ? -14.444 8.174   67.521 1.00 24.69  ? 725 ALA A C   1 
ATOM   2055 O O   . ALA A 1 258 ? -14.502 9.376   67.251 1.00 32.04  ? 725 ALA A O   1 
ATOM   2056 C CB  . ALA A 1 258 ? -13.293 7.468   69.634 1.00 22.71  ? 725 ALA A CB  1 
ATOM   2057 N N   . ASP A 1 259 ? -14.228 7.245   66.594 1.00 22.95  ? 726 ASP A N   1 
ATOM   2058 C CA  . ASP A 1 259 ? -13.956 7.627   65.201 1.00 23.96  ? 726 ASP A CA  1 
ATOM   2059 C C   . ASP A 1 259 ? -15.231 7.680   64.378 1.00 23.20  ? 726 ASP A C   1 
ATOM   2060 O O   . ASP A 1 259 ? -16.260 7.108   64.734 1.00 23.77  ? 726 ASP A O   1 
ATOM   2061 C CB  . ASP A 1 259 ? -13.012 6.627   64.562 1.00 23.08  ? 726 ASP A CB  1 
ATOM   2062 C CG  . ASP A 1 259 ? -13.592 5.248   64.602 1.00 29.08  ? 726 ASP A CG  1 
ATOM   2063 O OD1 . ASP A 1 259 ? -14.179 4.838   63.577 1.00 29.77  ? 726 ASP A OD1 1 
ATOM   2064 O OD2 . ASP A 1 259 ? -13.507 4.607   65.681 1.00 30.26  ? 726 ASP A OD2 1 
ATOM   2065 N N   . ARG A 1 260 ? -15.151 8.348   63.246 1.00 22.72  ? 727 ARG A N   1 
ATOM   2066 C CA  . ARG A 1 260 ? -16.346 8.585   62.476 1.00 22.78  ? 727 ARG A CA  1 
ATOM   2067 C C   . ARG A 1 260 ? -16.970 7.320   61.852 1.00 23.09  ? 727 ARG A C   1 
ATOM   2068 O O   . ARG A 1 260 ? -18.193 7.216   61.715 1.00 22.94  ? 727 ARG A O   1 
ATOM   2069 C CB  . ARG A 1 260 ? -16.085 9.661   61.447 1.00 21.26  ? 727 ARG A CB  1 
ATOM   2070 C CG  . ARG A 1 260 ? -14.988 9.297   60.513 1.00 27.23  ? 727 ARG A CG  1 
ATOM   2071 C CD  . ARG A 1 260 ? -14.841 10.311  59.379 1.00 31.78  ? 727 ARG A CD  1 
ATOM   2072 N NE  . ARG A 1 260 ? -14.288 9.569   58.256 1.00 42.06  ? 727 ARG A NE  1 
ATOM   2073 C CZ  . ARG A 1 260 ? -14.717 9.682   57.009 1.00 34.32  ? 727 ARG A CZ  1 
ATOM   2074 N NH1 . ARG A 1 260 ? -15.686 10.536  56.732 1.00 23.96  ? 727 ARG A NH1 1 
ATOM   2075 N NH2 . ARG A 1 260 ? -14.207 8.904   56.058 1.00 43.66  ? 727 ARG A NH2 1 
ATOM   2076 N N   . ALA A 1 261 ? -16.144 6.355   61.482 1.00 22.23  ? 728 ALA A N   1 
ATOM   2077 C CA  . ALA A 1 261 ? -16.689 5.172   60.844 1.00 23.84  ? 728 ALA A CA  1 
ATOM   2078 C C   . ALA A 1 261 ? -17.545 4.414   61.842 1.00 24.88  ? 728 ALA A C   1 
ATOM   2079 O O   . ALA A 1 261 ? -18.671 4.019   61.524 1.00 24.97  ? 728 ALA A O   1 
ATOM   2080 C CB  . ALA A 1 261 ? -15.560 4.262   60.291 1.00 25.51  ? 728 ALA A CB  1 
ATOM   2081 N N   . SER A 1 262 ? -16.989 4.216   63.045 1.00 24.26  ? 729 SER A N   1 
ATOM   2082 C CA  . SER A 1 262 ? -17.640 3.444   64.096 1.00 22.17  ? 729 SER A CA  1 
ATOM   2083 C C   . SER A 1 262 ? -18.943 4.068   64.423 1.00 21.95  ? 729 SER A C   1 
ATOM   2084 O O   . SER A 1 262 ? -19.946 3.366   64.536 1.00 24.31  ? 729 SER A O   1 
ATOM   2085 C CB  . SER A 1 262 ? -16.804 3.362   65.374 1.00 20.82  ? 729 SER A CB  1 
ATOM   2086 O OG  . SER A 1 262 ? -15.595 2.700   65.131 1.00 22.41  ? 729 SER A OG  1 
ATOM   2087 N N   . GLU A 1 263 ? -18.914 5.382   64.614 1.00 22.61  ? 730 GLU A N   1 
ATOM   2088 C CA  . GLU A 1 263 ? -20.130 6.148   64.857 1.00 25.17  ? 730 GLU A CA  1 
ATOM   2089 C C   . GLU A 1 263 ? -21.184 5.955   63.765 1.00 24.99  ? 730 GLU A C   1 
ATOM   2090 O O   . GLU A 1 263 ? -22.339 5.760   64.059 1.00 25.56  ? 730 GLU A O   1 
ATOM   2091 C CB  . GLU A 1 263 ? -19.837 7.630   65.054 1.00 25.38  ? 730 GLU A CB  1 
ATOM   2092 C CG  . GLU A 1 263 ? -21.110 8.434   65.182 1.00 29.42  ? 730 GLU A CG  1 
ATOM   2093 C CD  . GLU A 1 263 ? -20.908 9.892   65.575 1.00 30.41  ? 730 GLU A CD  1 
ATOM   2094 O OE1 . GLU A 1 263 ? -19.839 10.483  65.306 1.00 33.44  ? 730 GLU A OE1 1 
ATOM   2095 O OE2 . GLU A 1 263 ? -21.859 10.453  66.146 1.00 37.89  ? 730 GLU A OE2 1 
ATOM   2096 N N   . SER A 1 264 ? -20.765 5.993   62.509 1.00 26.24  ? 731 SER A N   1 
ATOM   2097 C CA  . SER A 1 264 ? -21.656 5.722   61.387 1.00 24.84  ? 731 SER A CA  1 
ATOM   2098 C C   . SER A 1 264 ? -22.215 4.285   61.399 1.00 26.56  ? 731 SER A C   1 
ATOM   2099 O O   . SER A 1 264 ? -23.433 4.076   61.231 1.00 29.86  ? 731 SER A O   1 
ATOM   2100 C CB  . SER A 1 264 ? -20.929 6.006   60.068 1.00 25.18  ? 731 SER A CB  1 
ATOM   2101 O OG  . SER A 1 264 ? -21.750 5.699   58.958 1.00 33.06  ? 731 SER A OG  1 
ATOM   2102 N N   . ILE A 1 265 ? -21.334 3.304   61.592 1.00 21.49  ? 732 ILE A N   1 
ATOM   2103 C CA  . ILE A 1 265 ? -21.729 1.886   61.643 1.00 21.65  ? 732 ILE A CA  1 
ATOM   2104 C C   . ILE A 1 265 ? -22.702 1.526   62.791 1.00 22.94  ? 732 ILE A C   1 
ATOM   2105 O O   . ILE A 1 265 ? -23.729 0.866   62.571 1.00 24.18  ? 732 ILE A O   1 
ATOM   2106 C CB  . ILE A 1 265 ? -20.475 1.012   61.737 1.00 20.46  ? 732 ILE A CB  1 
ATOM   2107 C CG1 . ILE A 1 265 ? -19.594 1.268   60.505 1.00 19.15  ? 732 ILE A CG1 1 
ATOM   2108 C CG2 . ILE A 1 265 ? -20.858 -0.449  61.951 1.00 19.37  ? 732 ILE A CG2 1 
ATOM   2109 C CD1 . ILE A 1 265 ? -18.222 0.748   60.619 1.00 19.74  ? 732 ILE A CD1 1 
ATOM   2110 N N   . ILE A 1 266 ? -22.368 1.959   64.008 1.00 22.61  ? 733 ILE A N   1 
ATOM   2111 C CA  . ILE A 1 266 ? -23.222 1.739   65.169 1.00 21.03  ? 733 ILE A CA  1 
ATOM   2112 C C   . ILE A 1 266 ? -24.605 2.354   64.968 1.00 23.57  ? 733 ILE A C   1 
ATOM   2113 O O   . ILE A 1 266 ? -25.623 1.735   65.314 1.00 25.00  ? 733 ILE A O   1 
ATOM   2114 C CB  . ILE A 1 266 ? -22.569 2.262   66.467 1.00 19.33  ? 733 ILE A CB  1 
ATOM   2115 C CG1 . ILE A 1 266 ? -21.287 1.480   66.769 1.00 18.26  ? 733 ILE A CG1 1 
ATOM   2116 C CG2 . ILE A 1 266 ? -23.538 2.216   67.630 1.00 18.64  ? 733 ILE A CG2 1 
ATOM   2117 C CD1 . ILE A 1 266 ? -21.496 -0.013  66.980 1.00 17.06  ? 733 ILE A CD1 1 
ATOM   2118 N N   . GLY A 1 267 ? -24.650 3.558   64.397 1.00 22.66  ? 734 GLY A N   1 
ATOM   2119 C CA  . GLY A 1 267 ? -25.932 4.183   64.132 1.00 22.33  ? 734 GLY A CA  1 
ATOM   2120 C C   . GLY A 1 267 ? -26.749 3.389   63.119 1.00 25.60  ? 734 GLY A C   1 
ATOM   2121 O O   . GLY A 1 267 ? -27.953 3.204   63.276 1.00 26.67  ? 734 GLY A O   1 
ATOM   2122 N N   . ALA A 1 268 ? -26.089 2.912   62.069 1.00 25.62  ? 735 ALA A N   1 
ATOM   2123 C CA  . ALA A 1 268 ? -26.748 2.117   61.044 1.00 26.33  ? 735 ALA A CA  1 
ATOM   2124 C C   . ALA A 1 268 ? -27.363 0.845   61.647 1.00 27.57  ? 735 ALA A C   1 
ATOM   2125 O O   . ALA A 1 268 ? -28.500 0.489   61.329 1.00 26.34  ? 735 ALA A O   1 
ATOM   2126 C CB  . ALA A 1 268 ? -25.746 1.752   59.957 1.00 25.48  ? 735 ALA A CB  1 
ATOM   2127 N N   . ILE A 1 269 ? -26.597 0.169   62.510 1.00 27.03  ? 736 ILE A N   1 
ATOM   2128 C CA  . ILE A 1 269 ? -27.066 -1.018  63.237 1.00 25.22  ? 736 ILE A CA  1 
ATOM   2129 C C   . ILE A 1 269 ? -28.164 -0.711  64.277 1.00 27.89  ? 736 ILE A C   1 
ATOM   2130 O O   . ILE A 1 269 ? -29.190 -1.393  64.332 1.00 25.90  ? 736 ILE A O   1 
ATOM   2131 C CB  . ILE A 1 269 ? -25.918 -1.679  64.000 1.00 24.56  ? 736 ILE A CB  1 
ATOM   2132 C CG1 . ILE A 1 269 ? -24.732 -1.972  63.054 1.00 24.77  ? 736 ILE A CG1 1 
ATOM   2133 C CG2 . ILE A 1 269 ? -26.448 -2.911  64.743 1.00 21.13  ? 736 ILE A CG2 1 
ATOM   2134 C CD1 . ILE A 1 269 ? -23.497 -2.653  63.714 1.00 22.37  ? 736 ILE A CD1 1 
ATOM   2135 N N   . ALA A 1 270 ? -27.938 0.314   65.101 1.00 27.76  ? 737 ALA A N   1 
ATOM   2136 C CA  . ALA A 1 270 ? -28.876 0.645   66.163 1.00 28.27  ? 737 ALA A CA  1 
ATOM   2137 C C   . ALA A 1 270 ? -30.264 0.914   65.624 1.00 30.74  ? 737 ALA A C   1 
ATOM   2138 O O   . ALA A 1 270 ? -31.272 0.524   66.230 1.00 34.64  ? 737 ALA A O   1 
ATOM   2139 C CB  . ALA A 1 270 ? -28.397 1.820   66.969 1.00 23.24  ? 737 ALA A CB  1 
ATOM   2140 N N   . ARG A 1 271 ? -30.333 1.571   64.481 1.00 29.58  ? 738 ARG A N   1 
ATOM   2141 C CA  . ARG A 1 271 ? -31.638 1.999   64.026 1.00 33.48  ? 738 ARG A CA  1 
ATOM   2142 C C   . ARG A 1 271 ? -32.477 0.843   63.438 1.00 31.61  ? 738 ARG A C   1 
ATOM   2143 O O   . ARG A 1 271 ? -33.546 1.083   62.897 1.00 38.32  ? 738 ARG A O   1 
ATOM   2144 C CB  . ARG A 1 271 ? -31.558 3.240   63.096 1.00 33.15  ? 738 ARG A CB  1 
ATOM   2145 C CG  . ARG A 1 271 ? -31.018 3.020   61.698 1.00 33.62  ? 738 ARG A CG  1 
ATOM   2146 C CD  . ARG A 1 271 ? -31.086 4.325   60.861 1.00 37.80  ? 738 ARG A CD  1 
ATOM   2147 N NE  . ARG A 1 271 ? -30.064 5.290   61.267 1.00 37.34  ? 738 ARG A NE  1 
ATOM   2148 C CZ  . ARG A 1 271 ? -28.832 5.318   60.762 1.00 37.69  ? 738 ARG A CZ  1 
ATOM   2149 N NH1 . ARG A 1 271 ? -28.475 4.461   59.808 1.00 43.74  ? 738 ARG A NH1 1 
ATOM   2150 N NH2 . ARG A 1 271 ? -27.935 6.149   61.252 1.00 32.70  ? 738 ARG A NH2 1 
ATOM   2151 N N   . GLN A 1 272 ? -31.991 -0.400  63.564 1.00 31.80  ? 739 GLN A N   1 
ATOM   2152 C CA  . GLN A 1 272 ? -32.684 -1.607  63.076 1.00 27.12  ? 739 GLN A CA  1 
ATOM   2153 C C   . GLN A 1 272 ? -33.356 -2.437  64.182 1.00 29.50  ? 739 GLN A C   1 
ATOM   2154 O O   . GLN A 1 272 ? -34.100 -3.375  63.888 1.00 31.55  ? 739 GLN A O   1 
ATOM   2155 C CB  . GLN A 1 272 ? -31.718 -2.527  62.337 1.00 26.14  ? 739 GLN A CB  1 
ATOM   2156 C CG  . GLN A 1 272 ? -31.122 -1.978  61.067 1.00 28.21  ? 739 GLN A CG  1 
ATOM   2157 C CD  . GLN A 1 272 ? -32.108 -2.004  59.918 1.00 128.98 ? 739 GLN A CD  1 
ATOM   2158 O OE1 . GLN A 1 272 ? -32.210 -3.003  59.201 1.00 143.26 ? 739 GLN A OE1 1 
ATOM   2159 N NE2 . GLN A 1 272 ? -32.855 -0.914  59.743 1.00 38.87  ? 739 GLN A NE2 1 
ATOM   2160 N N   . PHE A 1 273 ? -33.092 -2.086  65.439 1.00 26.20  ? 740 PHE A N   1 
ATOM   2161 C CA  . PHE A 1 273 ? -33.541 -2.862  66.593 1.00 24.15  ? 740 PHE A CA  1 
ATOM   2162 C C   . PHE A 1 273 ? -34.488 -2.071  67.457 1.00 24.21  ? 740 PHE A C   1 
ATOM   2163 O O   . PHE A 1 273 ? -34.353 -0.859  67.563 1.00 23.93  ? 740 PHE A O   1 
ATOM   2164 C CB  . PHE A 1 273 ? -32.329 -3.281  67.453 1.00 23.15  ? 740 PHE A CB  1 
ATOM   2165 C CG  . PHE A 1 273 ? -31.406 -4.234  66.760 1.00 24.29  ? 740 PHE A CG  1 
ATOM   2166 C CD1 . PHE A 1 273 ? -31.457 -5.600  67.043 1.00 21.79  ? 740 PHE A CD1 1 
ATOM   2167 C CD2 . PHE A 1 273 ? -30.491 -3.775  65.807 1.00 24.02  ? 740 PHE A CD2 1 
ATOM   2168 C CE1 . PHE A 1 273 ? -30.629 -6.476  66.389 1.00 21.44  ? 740 PHE A CE1 1 
ATOM   2169 C CE2 . PHE A 1 273 ? -29.652 -4.656  65.143 1.00 21.17  ? 740 PHE A CE2 1 
ATOM   2170 C CZ  . PHE A 1 273 ? -29.720 -6.004  65.432 1.00 22.18  ? 740 PHE A CZ  1 
ATOM   2171 N N   . LYS A 1 274 ? -35.431 -2.749  68.104 1.00 26.33  ? 741 LYS A N   1 
ATOM   2172 C CA  . LYS A 1 274 ? -36.238 -2.042  69.079 1.00 32.49  ? 741 LYS A CA  1 
ATOM   2173 C C   . LYS A 1 274 ? -35.445 -1.380  70.218 1.00 32.68  ? 741 LYS A C   1 
ATOM   2174 O O   . LYS A 1 274 ? -35.829 -0.311  70.697 1.00 41.11  ? 741 LYS A O   1 
ATOM   2175 C CB  . LYS A 1 274 ? -37.514 -2.798  69.523 1.00 30.25  ? 741 LYS A CB  1 
ATOM   2176 C CG  . LYS A 1 274 ? -37.370 -4.192  70.115 1.00 51.60  ? 741 LYS A CG  1 
ATOM   2177 C CD  . LYS A 1 274 ? -38.779 -4.783  70.415 1.00 60.08  ? 741 LYS A CD  1 
ATOM   2178 C CE  . LYS A 1 274 ? -38.773 -6.157  71.150 1.00 97.68  ? 741 LYS A CE  1 
ATOM   2179 N NZ  . LYS A 1 274 ? -38.208 -7.354  70.442 1.00 58.44  ? 741 LYS A NZ  1 
ATOM   2180 N N   . PHE A 1 275 ? -34.336 -1.994  70.632 1.00 28.37  ? 742 PHE A N   1 
ATOM   2181 C CA  . PHE A 1 275 ? -33.567 -1.479  71.770 1.00 29.65  ? 742 PHE A CA  1 
ATOM   2182 C C   . PHE A 1 275 ? -32.093 -1.479  71.439 1.00 26.55  ? 742 PHE A C   1 
ATOM   2183 O O   . PHE A 1 275 ? -31.592 -2.380  70.793 1.00 29.63  ? 742 PHE A O   1 
ATOM   2184 C CB  . PHE A 1 275 ? -33.732 -2.349  73.037 1.00 30.39  ? 742 PHE A CB  1 
ATOM   2185 C CG  . PHE A 1 275 ? -35.153 -2.553  73.473 1.00 32.06  ? 742 PHE A CG  1 
ATOM   2186 C CD1 . PHE A 1 275 ? -35.910 -1.497  73.960 1.00 37.71  ? 742 PHE A CD1 1 
ATOM   2187 C CD2 . PHE A 1 275 ? -35.737 -3.819  73.392 1.00 39.20  ? 742 PHE A CD2 1 
ATOM   2188 C CE1 . PHE A 1 275 ? -37.233 -1.696  74.358 1.00 41.85  ? 742 PHE A CE1 1 
ATOM   2189 C CE2 . PHE A 1 275 ? -37.060 -4.035  73.788 1.00 36.84  ? 742 PHE A CE2 1 
ATOM   2190 C CZ  . PHE A 1 275 ? -37.809 -2.974  74.271 1.00 37.27  ? 742 PHE A CZ  1 
ATOM   2191 N N   . SER A 1 276 ? -31.392 -0.474  71.928 1.00 28.37  ? 743 SER A N   1 
ATOM   2192 C CA  . SER A 1 276 ? -29.958 -0.433  71.795 1.00 30.66  ? 743 SER A CA  1 
ATOM   2193 C C   . SER A 1 276 ? -29.365 -0.043  73.152 1.00 32.59  ? 743 SER A C   1 
ATOM   2194 O O   . SER A 1 276 ? -29.699 1.009   73.703 1.00 33.43  ? 743 SER A O   1 
ATOM   2195 C CB  . SER A 1 276 ? -29.582 0.557   70.692 1.00 30.61  ? 743 SER A CB  1 
ATOM   2196 O OG  . SER A 1 276 ? -30.215 0.175   69.471 1.00 49.48  ? 743 SER A OG  1 
ATOM   2197 N N   . ARG A 1 277 ? -28.504 -0.919  73.676 1.00 29.52  ? 744 ARG A N   1 
ATOM   2198 C CA  . ARG A 1 277 ? -27.816 -0.744  74.961 1.00 29.23  ? 744 ARG A CA  1 
ATOM   2199 C C   . ARG A 1 277 ? -26.317 -0.820  74.865 1.00 27.11  ? 744 ARG A C   1 
ATOM   2200 O O   . ARG A 1 277 ? -25.774 -1.468  73.986 1.00 24.48  ? 744 ARG A O   1 
ATOM   2201 C CB  . ARG A 1 277 ? -28.269 -1.804  75.976 1.00 31.87  ? 744 ARG A CB  1 
ATOM   2202 C CG  . ARG A 1 277 ? -29.620 -1.530  76.640 1.00 45.93  ? 744 ARG A CG  1 
ATOM   2203 C CD  . ARG A 1 277 ? -29.438 -0.448  77.700 1.00 74.25  ? 744 ARG A CD  1 
ATOM   2204 N NE  . ARG A 1 277 ? -28.527 -0.914  78.751 1.00 190.09 ? 744 ARG A NE  1 
ATOM   2205 C CZ  . ARG A 1 277 ? -27.883 -0.131  79.615 1.00 172.27 ? 744 ARG A CZ  1 
ATOM   2206 N NH1 . ARG A 1 277 ? -28.025 1.189   79.571 1.00 51.78  ? 744 ARG A NH1 1 
ATOM   2207 N NH2 . ARG A 1 277 ? -27.097 -0.677  80.537 1.00 84.61  ? 744 ARG A NH2 1 
ATOM   2208 N N   . VAL A 1 278 ? -25.642 -0.145  75.787 1.00 30.97  ? 745 VAL A N   1 
ATOM   2209 C CA  . VAL A 1 278 ? -24.232 -0.407  76.017 1.00 27.82  ? 745 VAL A CA  1 
ATOM   2210 C C   . VAL A 1 278 ? -24.101 -0.971  77.409 1.00 29.24  ? 745 VAL A C   1 
ATOM   2211 O O   . VAL A 1 278 ? -24.588 -0.380  78.372 1.00 30.99  ? 745 VAL A O   1 
ATOM   2212 C CB  . VAL A 1 278 ? -23.378 0.829   75.886 1.00 29.91  ? 745 VAL A CB  1 
ATOM   2213 C CG1 . VAL A 1 278 ? -21.921 0.480   76.206 1.00 31.64  ? 745 VAL A CG1 1 
ATOM   2214 C CG2 . VAL A 1 278 ? -23.496 1.388   74.478 1.00 29.38  ? 745 VAL A CG2 1 
ATOM   2215 N N   . CYS A 1 279 ? -23.475 -2.134  77.506 1.00 28.09  ? 746 CYS A N   1 
ATOM   2216 C CA  . CYS A 1 279 ? -23.274 -2.797  78.785 1.00 30.24  ? 746 CYS A CA  1 
ATOM   2217 C C   . CYS A 1 279 ? -21.796 -3.046  78.986 1.00 33.90  ? 746 CYS A C   1 
ATOM   2218 O O   . CYS A 1 279 ? -21.047 -3.197  78.017 1.00 34.29  ? 746 CYS A O   1 
ATOM   2219 C CB  . CYS A 1 279 ? -24.012 -4.137  78.815 1.00 30.68  ? 746 CYS A CB  1 
ATOM   2220 S SG  . CYS A 1 279 ? -25.815 -4.019  78.617 1.00 55.84  ? 746 CYS A SG  1 
ATOM   2221 N N   . LYS A 1 280 ? -21.374 -3.072  80.245 1.00 33.51  ? 747 LYS A N   1 
ATOM   2222 C CA  . LYS A 1 280 ? -20.025 -3.495  80.571 1.00 31.17  ? 747 LYS A CA  1 
ATOM   2223 C C   . LYS A 1 280 ? -20.145 -4.430  81.762 1.00 36.50  ? 747 LYS A C   1 
ATOM   2224 O O   . LYS A 1 280 ? -19.959 -4.016  82.903 1.00 35.84  ? 747 LYS A O   1 
ATOM   2225 C CB  . LYS A 1 280 ? -19.143 -2.320  80.964 1.00 30.64  ? 747 LYS A CB  1 
ATOM   2226 C CG  . LYS A 1 280 ? -17.644 -2.677  80.985 1.00 32.83  ? 747 LYS A CG  1 
ATOM   2227 C CD  . LYS A 1 280 ? -16.802 -1.518  81.490 1.00 27.34  ? 747 LYS A CD  1 
ATOM   2228 C CE  . LYS A 1 280 ? -15.357 -1.606  80.999 1.00 30.04  ? 747 LYS A CE  1 
ATOM   2229 N NZ  . LYS A 1 280 ? -14.654 -2.855  81.299 1.00 27.45  ? 747 LYS A NZ  1 
ATOM   2230 N N   . PRO A 1 281 ? -20.468 -5.706  81.512 1.00 34.10  ? 748 PRO A N   1 
ATOM   2231 C CA  . PRO A 1 281 ? -20.593 -6.663  82.613 1.00 43.26  ? 748 PRO A CA  1 
ATOM   2232 C C   . PRO A 1 281 ? -19.351 -6.779  83.511 1.00 40.89  ? 748 PRO A C   1 
ATOM   2233 O O   . PRO A 1 281 ? -18.233 -6.412  83.124 1.00 34.12  ? 748 PRO A O   1 
ATOM   2234 C CB  . PRO A 1 281 ? -20.927 -7.965  81.874 1.00 44.08  ? 748 PRO A CB  1 
ATOM   2235 C CG  . PRO A 1 281 ? -20.074 -7.858  80.666 1.00 46.81  ? 748 PRO A CG  1 
ATOM   2236 C CD  . PRO A 1 281 ? -20.388 -6.414  80.221 1.00 32.00  ? 748 PRO A CD  1 
ATOM   2237 N N   . LYS A 1 282 ? -19.561 -7.290  84.722 1.00 68.33  ? 749 LYS A N   1 
ATOM   2238 C CA  . LYS A 1 282 ? -18.526 -7.232  85.747 1.00 61.91  ? 749 LYS A CA  1 
ATOM   2239 C C   . LYS A 1 282 ? -17.363 -8.109  85.316 1.00 52.03  ? 749 LYS A C   1 
ATOM   2240 O O   . LYS A 1 282 ? -16.354 -8.218  86.003 1.00 62.05  ? 749 LYS A O   1 
ATOM   2241 C CB  . LYS A 1 282 ? -19.083 -7.614  87.130 1.00 41.30  ? 749 LYS A CB  1 
ATOM   2242 C CG  . LYS A 1 282 ? -18.138 -7.313  88.306 1.00 122.07 ? 749 LYS A CG  1 
ATOM   2243 C CD  . LYS A 1 282 ? -18.882 -7.334  89.655 1.00 117.79 ? 749 LYS A CD  1 
ATOM   2244 C CE  . LYS A 1 282 ? -17.997 -6.882  90.829 1.00 105.19 ? 749 LYS A CE  1 
ATOM   2245 N NZ  . LYS A 1 282 ? -18.742 -6.799  92.133 1.00 65.70  ? 749 LYS A NZ  1 
ATOM   2246 N N   . SER A 1 283 ? -17.512 -8.715  84.148 1.00 60.84  ? 750 SER A N   1 
ATOM   2247 C CA  . SER A 1 283 ? -16.464 -9.535  83.563 1.00 47.62  ? 750 SER A CA  1 
ATOM   2248 C C   . SER A 1 283 ? -15.547 -8.718  82.638 1.00 51.87  ? 750 SER A C   1 
ATOM   2249 O O   . SER A 1 283 ? -14.396 -9.099  82.414 1.00 40.19  ? 750 SER A O   1 
ATOM   2250 C CB  . SER A 1 283 ? -17.087 -10.699 82.786 1.00 47.27  ? 750 SER A CB  1 
ATOM   2251 O OG  . SER A 1 283 ? -16.070 -11.475 82.167 1.00 81.32  ? 750 SER A OG  1 
ATOM   2252 N N   . SER A 1 284 ? -16.062 -7.612  82.092 1.00 35.45  ? 751 SER A N   1 
ATOM   2253 C CA  . SER A 1 284 ? -15.252 -6.744  81.239 1.00 37.54  ? 751 SER A CA  1 
ATOM   2254 C C   . SER A 1 284 ? -14.296 -5.893  82.081 1.00 38.37  ? 751 SER A C   1 
ATOM   2255 O O   . SER A 1 284 ? -14.681 -4.889  82.684 1.00 37.00  ? 751 SER A O   1 
ATOM   2256 C CB  . SER A 1 284 ? -16.120 -5.847  80.355 1.00 37.26  ? 751 SER A CB  1 
ATOM   2257 O OG  . SER A 1 284 ? -15.301 -5.069  79.494 1.00 35.66  ? 751 SER A OG  1 
ATOM   2258 N N   . LEU A 1 285 ? -13.040 -6.314  82.090 1.00 40.41  ? 752 LEU A N   1 
ATOM   2259 C CA  . LEU A 1 285 ? -12.000 -5.747  82.929 1.00 41.64  ? 752 LEU A CA  1 
ATOM   2260 C C   . LEU A 1 285 ? -11.260 -4.622  82.212 1.00 43.10  ? 752 LEU A C   1 
ATOM   2261 O O   . LEU A 1 285 ? -11.003 -3.567  82.792 1.00 41.41  ? 752 LEU A O   1 
ATOM   2262 C CB  . LEU A 1 285 ? -11.024 -6.871  83.279 1.00 50.77  ? 752 LEU A CB  1 
ATOM   2263 C CG  . LEU A 1 285 ? -11.614 -8.037  84.088 1.00 69.48  ? 752 LEU A CG  1 
ATOM   2264 C CD1 . LEU A 1 285 ? -10.805 -9.354  83.992 1.00 43.73  ? 752 LEU A CD1 1 
ATOM   2265 C CD2 . LEU A 1 285 ? -11.915 -7.600  85.534 1.00 33.13  ? 752 LEU A CD2 1 
ATOM   2266 N N   . GLU A 1 286 ? -10.901 -4.854  80.954 1.00 33.60  ? 753 GLU A N   1 
ATOM   2267 C CA  . GLU A 1 286 ? -10.266 -3.811  80.172 1.00 33.48  ? 753 GLU A CA  1 
ATOM   2268 C C   . GLU A 1 286 ? -11.137 -2.528  80.159 1.00 30.92  ? 753 GLU A C   1 
ATOM   2269 O O   . GLU A 1 286 ? -12.359 -2.558  79.916 1.00 29.92  ? 753 GLU A O   1 
ATOM   2270 C CB  . GLU A 1 286 ? -9.932  -4.321  78.768 1.00 30.37  ? 753 GLU A CB  1 
ATOM   2271 C CG  . GLU A 1 286 ? -9.158  -3.330  77.930 1.00 29.50  ? 753 GLU A CG  1 
ATOM   2272 C CD  . GLU A 1 286 ? -8.799  -3.882  76.567 1.00 32.00  ? 753 GLU A CD  1 
ATOM   2273 O OE1 . GLU A 1 286 ? -8.165  -3.155  75.778 1.00 41.30  ? 753 GLU A OE1 1 
ATOM   2274 O OE2 . GLU A 1 286 ? -9.139  -5.047  76.280 1.00 42.65  ? 753 GLU A OE2 1 
ATOM   2275 N N   . GLU A 1 287 ? -10.496 -1.406  80.459 1.00 32.55  ? 754 GLU A N   1 
ATOM   2276 C CA  . GLU A 1 287 ? -11.209 -0.137  80.679 1.00 31.70  ? 754 GLU A CA  1 
ATOM   2277 C C   . GLU A 1 287 ? -11.938 0.401   79.452 1.00 26.85  ? 754 GLU A C   1 
ATOM   2278 O O   . GLU A 1 287 ? -12.957 1.068   79.588 1.00 24.98  ? 754 GLU A O   1 
ATOM   2279 C CB  . GLU A 1 287 ? -10.284 0.968   81.222 1.00 31.25  ? 754 GLU A CB  1 
ATOM   2280 C CG  . GLU A 1 287 ? -9.641  0.769   82.608 1.00 43.38  ? 754 GLU A CG  1 
ATOM   2281 C CD  . GLU A 1 287 ? -8.551  -0.306  82.677 1.00 46.14  ? 754 GLU A CD  1 
ATOM   2282 O OE1 . GLU A 1 287 ? -7.844  -0.550  81.670 1.00 41.07  ? 754 GLU A OE1 1 
ATOM   2283 O OE2 . GLU A 1 287 ? -8.393  -0.887  83.768 1.00 49.65  ? 754 GLU A OE2 1 
ATOM   2284 N N   . THR A 1 288 ? -11.399 0.113   78.271 1.00 24.23  ? 755 THR A N   1 
ATOM   2285 C CA  . THR A 1 288 ? -11.908 0.651   77.017 1.00 24.86  ? 755 THR A CA  1 
ATOM   2286 C C   . THR A 1 288 ? -12.969 -0.253  76.396 1.00 26.07  ? 755 THR A C   1 
ATOM   2287 O O   . THR A 1 288 ? -13.595 0.095   75.395 1.00 23.92  ? 755 THR A O   1 
ATOM   2288 C CB  . THR A 1 288 ? -10.772 0.807   76.009 1.00 23.81  ? 755 THR A CB  1 
ATOM   2289 O OG1 . THR A 1 288 ? -10.089 -0.447  75.890 1.00 21.91  ? 755 THR A OG1 1 
ATOM   2290 C CG2 . THR A 1 288 ? -9.804  1.922   76.430 1.00 22.78  ? 755 THR A CG2 1 
ATOM   2291 N N   . GLU A 1 289 ? -13.165 -1.408  77.012 1.00 23.95  ? 756 GLU A N   1 
ATOM   2292 C CA  . GLU A 1 289 ? -14.033 -2.416  76.460 1.00 24.58  ? 756 GLU A CA  1 
ATOM   2293 C C   . GLU A 1 289 ? -15.480 -2.280  76.893 1.00 24.57  ? 756 GLU A C   1 
ATOM   2294 O O   . GLU A 1 289 ? -15.759 -2.014  78.049 1.00 29.50  ? 756 GLU A O   1 
ATOM   2295 C CB  . GLU A 1 289 ? -13.498 -3.791  76.809 1.00 25.58  ? 756 GLU A CB  1 
ATOM   2296 C CG  . GLU A 1 289 ? -14.347 -4.929  76.329 1.00 27.24  ? 756 GLU A CG  1 
ATOM   2297 C CD  . GLU A 1 289 ? -13.778 -6.258  76.776 1.00 31.12  ? 756 GLU A CD  1 
ATOM   2298 O OE1 . GLU A 1 289 ? -12.893 -6.807  76.078 1.00 29.85  ? 756 GLU A OE1 1 
ATOM   2299 O OE2 . GLU A 1 289 ? -14.198 -6.735  77.851 1.00 30.37  ? 756 GLU A OE2 1 
ATOM   2300 N N   . VAL A 1 290 ? -16.393 -2.450  75.941 1.00 22.74  ? 757 VAL A N   1 
ATOM   2301 C CA  . VAL A 1 290 ? -17.819 -2.486  76.225 1.00 22.89  ? 757 VAL A CA  1 
ATOM   2302 C C   . VAL A 1 290 ? -18.492 -3.546  75.340 1.00 24.51  ? 757 VAL A C   1 
ATOM   2303 O O   . VAL A 1 290 ? -17.916 -4.028  74.361 1.00 25.84  ? 757 VAL A O   1 
ATOM   2304 C CB  . VAL A 1 290 ? -18.519 -1.113  75.934 1.00 24.08  ? 757 VAL A CB  1 
ATOM   2305 C CG1 . VAL A 1 290 ? -17.926 0.011   76.783 1.00 22.76  ? 757 VAL A CG1 1 
ATOM   2306 C CG2 . VAL A 1 290 ? -18.464 -0.786  74.433 1.00 22.36  ? 757 VAL A CG2 1 
ATOM   2307 N N   . LEU A 1 291 ? -19.714 -3.915  75.706 1.00 25.60  ? 758 LEU A N   1 
ATOM   2308 C CA  . LEU A 1 291 ? -20.572 -4.671  74.805 1.00 25.73  ? 758 LEU A CA  1 
ATOM   2309 C C   . LEU A 1 291 ? -21.636 -3.771  74.211 1.00 25.05  ? 758 LEU A C   1 
ATOM   2310 O O   . LEU A 1 291 ? -22.297 -3.007  74.914 1.00 30.40  ? 758 LEU A O   1 
ATOM   2311 C CB  . LEU A 1 291 ? -21.247 -5.847  75.503 1.00 25.03  ? 758 LEU A CB  1 
ATOM   2312 C CG  . LEU A 1 291 ? -20.381 -6.964  76.088 1.00 23.26  ? 758 LEU A CG  1 
ATOM   2313 C CD1 . LEU A 1 291 ? -21.321 -8.012  76.656 1.00 21.93  ? 758 LEU A CD1 1 
ATOM   2314 C CD2 . LEU A 1 291 ? -19.501 -7.566  75.001 1.00 21.41  ? 758 LEU A CD2 1 
ATOM   2315 N N   . PHE A 1 292 ? -21.771 -3.827  72.900 1.00 24.16  ? 759 PHE A N   1 
ATOM   2316 C CA  . PHE A 1 292 ? -22.912 -3.219  72.266 1.00 24.18  ? 759 PHE A CA  1 
ATOM   2317 C C   . PHE A 1 292 ? -23.968 -4.294  72.241 1.00 23.70  ? 759 PHE A C   1 
ATOM   2318 O O   . PHE A 1 292 ? -23.697 -5.434  71.833 1.00 25.44  ? 759 PHE A O   1 
ATOM   2319 C CB  . PHE A 1 292 ? -22.583 -2.723  70.868 1.00 24.12  ? 759 PHE A CB  1 
ATOM   2320 C CG  . PHE A 1 292 ? -21.663 -1.539  70.846 1.00 25.23  ? 759 PHE A CG  1 
ATOM   2321 C CD1 . PHE A 1 292 ? -22.119 -0.285  71.255 1.00 27.84  ? 759 PHE A CD1 1 
ATOM   2322 C CD2 . PHE A 1 292 ? -20.353 -1.663  70.414 1.00 25.84  ? 759 PHE A CD2 1 
ATOM   2323 C CE1 . PHE A 1 292 ? -21.278 0.831   71.228 1.00 30.56  ? 759 PHE A CE1 1 
ATOM   2324 C CE2 . PHE A 1 292 ? -19.489 -0.548  70.379 1.00 26.90  ? 759 PHE A CE2 1 
ATOM   2325 C CZ  . PHE A 1 292 ? -19.952 0.697   70.785 1.00 30.38  ? 759 PHE A CZ  1 
ATOM   2326 N N   . VAL A 1 293 ? -25.147 -3.945  72.733 1.00 20.86  ? 760 VAL A N   1 
ATOM   2327 C CA  . VAL A 1 293 ? -26.251 -4.870  72.723 1.00 22.33  ? 760 VAL A CA  1 
ATOM   2328 C C   . VAL A 1 293 ? -27.456 -4.343  71.958 1.00 24.24  ? 760 VAL A C   1 
ATOM   2329 O O   . VAL A 1 293 ? -28.062 -3.320  72.308 1.00 25.72  ? 760 VAL A O   1 
ATOM   2330 C CB  . VAL A 1 293 ? -26.649 -5.291  74.123 1.00 23.25  ? 760 VAL A CB  1 
ATOM   2331 C CG1 . VAL A 1 293 ? -27.741 -6.361  74.050 1.00 23.02  ? 760 VAL A CG1 1 
ATOM   2332 C CG2 . VAL A 1 293 ? -25.423 -5.792  74.874 1.00 22.72  ? 760 VAL A CG2 1 
ATOM   2333 N N   . PHE A 1 294 ? -27.791 -5.055  70.891 1.00 27.31  ? 761 PHE A N   1 
ATOM   2334 C CA  . PHE A 1 294 ? -28.930 -4.698  70.052 1.00 26.38  ? 761 PHE A CA  1 
ATOM   2335 C C   . PHE A 1 294 ? -29.966 -5.809  70.165 1.00 25.33  ? 761 PHE A C   1 
ATOM   2336 O O   . PHE A 1 294 ? -29.714 -6.969  69.797 1.00 23.25  ? 761 PHE A O   1 
ATOM   2337 C CB  . PHE A 1 294 ? -28.476 -4.589  68.609 1.00 25.97  ? 761 PHE A CB  1 
ATOM   2338 C CG  . PHE A 1 294 ? -27.354 -3.629  68.402 1.00 25.05  ? 761 PHE A CG  1 
ATOM   2339 C CD1 . PHE A 1 294 ? -27.565 -2.264  68.494 1.00 24.76  ? 761 PHE A CD1 1 
ATOM   2340 C CD2 . PHE A 1 294 ? -26.076 -4.098  68.104 1.00 26.24  ? 761 PHE A CD2 1 
ATOM   2341 C CE1 . PHE A 1 294 ? -26.527 -1.368  68.280 1.00 25.27  ? 761 PHE A CE1 1 
ATOM   2342 C CE2 . PHE A 1 294 ? -25.017 -3.213  67.885 1.00 29.53  ? 761 PHE A CE2 1 
ATOM   2343 C CZ  . PHE A 1 294 ? -25.243 -1.843  67.971 1.00 29.19  ? 761 PHE A CZ  1 
ATOM   2344 N N   . ILE A 1 295 ? -31.130 -5.443  70.670 1.00 23.13  ? 762 ILE A N   1 
ATOM   2345 C CA  . ILE A 1 295 ? -32.177 -6.411  70.881 1.00 24.76  ? 762 ILE A CA  1 
ATOM   2346 C C   . ILE A 1 295 ? -33.413 -6.076  70.086 1.00 23.05  ? 762 ILE A C   1 
ATOM   2347 O O   . ILE A 1 295 ? -33.814 -4.926  70.021 1.00 24.64  ? 762 ILE A O   1 
ATOM   2348 C CB  . ILE A 1 295 ? -32.562 -6.435  72.357 1.00 28.70  ? 762 ILE A CB  1 
ATOM   2349 C CG1 . ILE A 1 295 ? -31.321 -6.754  73.184 1.00 31.88  ? 762 ILE A CG1 1 
ATOM   2350 C CG2 . ILE A 1 295 ? -33.666 -7.472  72.599 1.00 29.28  ? 762 ILE A CG2 1 
ATOM   2351 C CD1 . ILE A 1 295 ? -31.559 -6.784  74.665 1.00 37.28  ? 762 ILE A CD1 1 
ATOM   2352 N N   . GLY A 1 296 ? -34.028 -7.089  69.496 1.00 23.71  ? 763 GLY A N   1 
ATOM   2353 C CA  . GLY A 1 296 ? -35.303 -6.873  68.837 1.00 23.93  ? 763 GLY A CA  1 
ATOM   2354 C C   . GLY A 1 296 ? -35.141 -6.360  67.421 1.00 26.32  ? 763 GLY A C   1 
ATOM   2355 O O   . GLY A 1 296 ? -35.526 -5.223  67.115 1.00 28.67  ? 763 GLY A O   1 
ATOM   2356 N N   . TYR A 1 297 ? -34.570 -7.209  66.567 1.00 25.49  ? 764 TYR A N   1 
ATOM   2357 C CA  . TYR A 1 297 ? -34.342 -6.907  65.159 1.00 24.91  ? 764 TYR A CA  1 
ATOM   2358 C C   . TYR A 1 297 ? -35.683 -6.841  64.435 1.00 25.94  ? 764 TYR A C   1 
ATOM   2359 O O   . TYR A 1 297 ? -36.263 -7.867  64.136 1.00 24.20  ? 764 TYR A O   1 
ATOM   2360 C CB  . TYR A 1 297 ? -33.475 -8.007  64.541 1.00 24.09  ? 764 TYR A CB  1 
ATOM   2361 C CG  . TYR A 1 297 ? -33.157 -7.794  63.072 1.00 26.42  ? 764 TYR A CG  1 
ATOM   2362 C CD1 . TYR A 1 297 ? -32.444 -6.665  62.646 1.00 25.08  ? 764 TYR A CD1 1 
ATOM   2363 C CD2 . TYR A 1 297 ? -33.570 -8.721  62.098 1.00 23.29  ? 764 TYR A CD2 1 
ATOM   2364 C CE1 . TYR A 1 297 ? -32.153 -6.468  61.289 1.00 26.17  ? 764 TYR A CE1 1 
ATOM   2365 C CE2 . TYR A 1 297 ? -33.282 -8.525  60.754 1.00 22.88  ? 764 TYR A CE2 1 
ATOM   2366 C CZ  . TYR A 1 297 ? -32.579 -7.403  60.354 1.00 26.24  ? 764 TYR A CZ  1 
ATOM   2367 O OH  . TYR A 1 297 ? -32.298 -7.207  59.018 1.00 31.22  ? 764 TYR A OH  1 
ATOM   2368 N N   . ASP A 1 298 ? -36.182 -5.637  64.170 1.00 27.71  ? 765 ASP A N   1 
ATOM   2369 C CA  . ASP A 1 298 ? -37.509 -5.506  63.600 1.00 29.96  ? 765 ASP A CA  1 
ATOM   2370 C C   . ASP A 1 298 ? -37.578 -4.525  62.453 1.00 33.70  ? 765 ASP A C   1 
ATOM   2371 O O   . ASP A 1 298 ? -38.606 -4.421  61.781 1.00 42.04  ? 765 ASP A O   1 
ATOM   2372 C CB  . ASP A 1 298 ? -38.584 -5.195  64.658 1.00 32.28  ? 765 ASP A CB  1 
ATOM   2373 C CG  . ASP A 1 298 ? -38.372 -3.849  65.364 1.00 55.83  ? 765 ASP A CG  1 
ATOM   2374 O OD1 . ASP A 1 298 ? -37.470 -3.065  64.964 1.00 49.09  ? 765 ASP A OD1 1 
ATOM   2375 O OD2 . ASP A 1 298 ? -39.136 -3.574  66.325 1.00 44.72  ? 765 ASP A OD2 1 
ATOM   2376 N N   . ARG A 1 299 ? -36.497 -3.798  62.216 1.00 33.17  ? 766 ARG A N   1 
ATOM   2377 C CA  . ARG A 1 299 ? -36.504 -2.868  61.092 1.00 40.01  ? 766 ARG A CA  1 
ATOM   2378 C C   . ARG A 1 299 ? -37.806 -2.073  60.957 1.00 32.30  ? 766 ARG A C   1 
ATOM   2379 O O   . ARG A 1 299 ? -38.390 -2.017  59.893 1.00 39.44  ? 766 ARG A O   1 
ATOM   2380 C CB  . ARG A 1 299 ? -36.191 -3.593  59.783 1.00 38.34  ? 766 ARG A CB  1 
ATOM   2381 C CG  . ARG A 1 299 ? -34.773 -4.148  59.681 1.00 49.14  ? 766 ARG A CG  1 
ATOM   2382 C CD  . ARG A 1 299 ? -34.616 -4.971  58.400 1.00 60.72  ? 766 ARG A CD  1 
ATOM   2383 N NE  . ARG A 1 299 ? -35.092 -4.237  57.230 1.00 181.29 ? 766 ARG A NE  1 
ATOM   2384 C CZ  . ARG A 1 299 ? -35.370 -4.798  56.057 1.00 127.17 ? 766 ARG A CZ  1 
ATOM   2385 N NH1 . ARG A 1 299 ? -35.811 -4.056  55.046 1.00 44.96  ? 766 ARG A NH1 1 
ATOM   2386 N NH2 . ARG A 1 299 ? -35.209 -6.105  55.896 1.00 103.23 ? 766 ARG A NH2 1 
ATOM   2387 N N   . LYS A 1 300 ? -38.250 -1.481  62.058 1.00 33.39  ? 767 LYS A N   1 
ATOM   2388 C CA  . LYS A 1 300 ? -39.334 -0.515  62.061 1.00 30.77  ? 767 LYS A CA  1 
ATOM   2389 C C   . LYS A 1 300 ? -38.759 0.875   62.298 1.00 39.80  ? 767 LYS A C   1 
ATOM   2390 O O   . LYS A 1 300 ? -37.894 1.068   63.151 1.00 46.22  ? 767 LYS A O   1 
ATOM   2391 C CB  . LYS A 1 300 ? -40.331 -0.816  63.166 1.00 28.26  ? 767 LYS A CB  1 
ATOM   2392 C CG  . LYS A 1 300 ? -41.060 -2.125  63.024 1.00 30.90  ? 767 LYS A CG  1 
ATOM   2393 C CD  . LYS A 1 300 ? -42.056 -2.247  64.158 1.00 31.32  ? 767 LYS A CD  1 
ATOM   2394 C CE  . LYS A 1 300 ? -42.845 -3.512  64.062 1.00 33.88  ? 767 LYS A CE  1 
ATOM   2395 N NZ  . LYS A 1 300 ? -43.852 -3.558  65.159 1.00 56.64  ? 767 LYS A NZ  1 
ATOM   2396 N N   . ALA A 1 301 ? -39.253 1.844   61.546 1.00 36.67  ? 768 ALA A N   1 
ATOM   2397 C CA  . ALA A 1 301 ? -38.766 3.203   61.640 1.00 36.71  ? 768 ALA A CA  1 
ATOM   2398 C C   . ALA A 1 301 ? -39.237 3.853   62.927 1.00 38.17  ? 768 ALA A C   1 
ATOM   2399 O O   . ALA A 1 301 ? -40.430 4.013   63.144 1.00 36.25  ? 768 ALA A O   1 
ATOM   2400 C CB  . ALA A 1 301 ? -39.231 4.019   60.434 1.00 33.89  ? 768 ALA A CB  1 
ATOM   2401 N N   . ARG A 1 302 ? -38.282 4.236   63.767 1.00 39.37  ? 769 ARG A N   1 
ATOM   2402 C CA  . ARG A 1 302 ? -38.566 4.922   65.020 1.00 40.39  ? 769 ARG A CA  1 
ATOM   2403 C C   . ARG A 1 302 ? -37.658 6.150   65.225 1.00 44.47  ? 769 ARG A C   1 
ATOM   2404 O O   . ARG A 1 302 ? -36.793 6.419   64.400 1.00 39.69  ? 769 ARG A O   1 
ATOM   2405 C CB  . ARG A 1 302 ? -38.523 3.918   66.173 1.00 34.74  ? 769 ARG A CB  1 
ATOM   2406 C CG  . ARG A 1 302 ? -37.297 3.024   66.126 1.00 48.06  ? 769 ARG A CG  1 
ATOM   2407 C CD  . ARG A 1 302 ? -37.206 2.095   67.324 1.00 66.18  ? 769 ARG A CD  1 
ATOM   2408 N NE  . ARG A 1 302 ? -38.316 1.153   67.447 1.00 57.74  ? 769 ARG A NE  1 
ATOM   2409 C CZ  . ARG A 1 302 ? -38.361 -0.036  66.855 1.00 55.16  ? 769 ARG A CZ  1 
ATOM   2410 N NH1 . ARG A 1 302 ? -37.359 -0.436  66.074 1.00 42.39  ? 769 ARG A NH1 1 
ATOM   2411 N NH2 . ARG A 1 302 ? -39.394 -0.839  67.078 1.00 46.06  ? 769 ARG A NH2 1 
ATOM   2412 N N   . THR A 1 303 ? -37.883 6.915   66.294 1.00 78.07  ? 770 THR A N   1 
ATOM   2413 C CA  . THR A 1 303 ? -37.057 8.094   66.601 1.00 49.04  ? 770 THR A CA  1 
ATOM   2414 C C   . THR A 1 303 ? -35.652 7.747   67.128 1.00 49.73  ? 770 THR A C   1 
ATOM   2415 O O   . THR A 1 303 ? -35.463 6.737   67.821 1.00 31.78  ? 770 THR A O   1 
ATOM   2416 C CB  . THR A 1 303 ? -37.768 9.073   67.590 1.00 69.54  ? 770 THR A CB  1 
ATOM   2417 O OG1 . THR A 1 303 ? -38.920 9.661   66.973 1.00 55.91  ? 770 THR A OG1 1 
ATOM   2418 C CG2 . THR A 1 303 ? -36.825 10.172  68.084 1.00 61.28  ? 770 THR A CG2 1 
ATOM   2419 N N   . HIS A 1 304 ? -34.706 8.640   66.818 1.00 118.28 ? 771 HIS A N   1 
ATOM   2420 C CA  . HIS A 1 304 ? -33.259 8.495   67.050 1.00 113.28 ? 771 HIS A CA  1 
ATOM   2421 C C   . HIS A 1 304 ? -32.851 8.495   68.558 1.00 45.89  ? 771 HIS A C   1 
ATOM   2422 O O   . HIS A 1 304 ? -32.988 9.516   69.237 1.00 69.17  ? 771 HIS A O   1 
ATOM   2423 C CB  . HIS A 1 304 ? -32.532 9.699   66.395 1.00 201.59 ? 771 HIS A CB  1 
ATOM   2424 C CG  . HIS A 1 304 ? -32.945 10.012  64.977 1.00 201.59 ? 771 HIS A CG  1 
ATOM   2425 N ND1 . HIS A 1 304 ? -34.161 10.583  64.659 1.00 200.61 ? 771 HIS A ND1 1 
ATOM   2426 C CD2 . HIS A 1 304 ? -32.293 9.852   63.799 1.00 191.55 ? 771 HIS A CD2 1 
ATOM   2427 C CE1 . HIS A 1 304 ? -34.236 10.773  63.352 1.00 29.35  ? 771 HIS A CE1 1 
ATOM   2428 N NE2 . HIS A 1 304 ? -33.114 10.337  62.807 1.00 138.63 ? 771 HIS A NE2 1 
ATOM   2429 N N   . ASN A 1 305 ? -32.332 7.384   69.083 1.00 201.51 ? 772 ASN A N   1 
ATOM   2430 C CA  . ASN A 1 305 ? -31.780 7.392   70.452 1.00 181.10 ? 772 ASN A CA  1 
ATOM   2431 C C   . ASN A 1 305 ? -30.252 7.488   70.347 1.00 149.41 ? 772 ASN A C   1 
ATOM   2432 O O   . ASN A 1 305 ? -29.543 6.494   70.514 1.00 201.48 ? 772 ASN A O   1 
ATOM   2433 C CB  . ASN A 1 305 ? -32.200 6.133   71.241 1.00 63.67  ? 772 ASN A CB  1 
ATOM   2434 C CG  . ASN A 1 305 ? -31.630 4.838   70.654 1.00 201.40 ? 772 ASN A CG  1 
ATOM   2435 O OD1 . ASN A 1 305 ? -31.870 4.500   69.491 1.00 134.31 ? 772 ASN A OD1 1 
ATOM   2436 N ND2 . ASN A 1 305 ? -30.872 4.106   71.471 1.00 74.06  ? 772 ASN A ND2 1 
ATOM   2437 N N   . PRO A 1 306 ? -29.723 8.699   70.091 1.00 45.78  ? 773 PRO A N   1 
ATOM   2438 C CA  . PRO A 1 306 ? -28.272 8.846   69.934 1.00 51.57  ? 773 PRO A CA  1 
ATOM   2439 C C   . PRO A 1 306 ? -27.476 9.291   71.157 1.00 61.00  ? 773 PRO A C   1 
ATOM   2440 O O   . PRO A 1 306 ? -26.381 8.771   71.415 1.00 51.28  ? 773 PRO A O   1 
ATOM   2441 C CB  . PRO A 1 306 ? -28.192 9.858   68.807 1.00 46.27  ? 773 PRO A CB  1 
ATOM   2442 C CG  . PRO A 1 306 ? -29.264 10.866  69.252 1.00 57.91  ? 773 PRO A CG  1 
ATOM   2443 C CD  . PRO A 1 306 ? -30.408 9.974   69.791 1.00 59.53  ? 773 PRO A CD  1 
ATOM   2444 N N   . TYR A 1 307 ? -28.013 10.244  71.910 1.00 41.87  ? 774 TYR A N   1 
ATOM   2445 C CA  . TYR A 1 307 ? -27.356 10.672  73.131 1.00 40.11  ? 774 TYR A CA  1 
ATOM   2446 C C   . TYR A 1 307 ? -27.447 9.641   74.229 1.00 40.61  ? 774 TYR A C   1 
ATOM   2447 O O   . TYR A 1 307 ? -26.658 9.693   75.171 1.00 54.50  ? 774 TYR A O   1 
ATOM   2448 C CB  . TYR A 1 307 ? -27.926 11.983  73.644 1.00 47.77  ? 774 TYR A CB  1 
ATOM   2449 C CG  . TYR A 1 307 ? -27.772 13.097  72.668 1.00 58.26  ? 774 TYR A CG  1 
ATOM   2450 C CD1 . TYR A 1 307 ? -28.661 13.240  71.607 1.00 95.54  ? 774 TYR A CD1 1 
ATOM   2451 C CD2 . TYR A 1 307 ? -26.735 14.015  72.796 1.00 72.26  ? 774 TYR A CD2 1 
ATOM   2452 C CE1 . TYR A 1 307 ? -28.524 14.274  70.694 1.00 103.85 ? 774 TYR A CE1 1 
ATOM   2453 C CE2 . TYR A 1 307 ? -26.584 15.052  71.887 1.00 78.34  ? 774 TYR A CE2 1 
ATOM   2454 C CZ  . TYR A 1 307 ? -27.483 15.178  70.839 1.00 83.64  ? 774 TYR A CZ  1 
ATOM   2455 O OH  . TYR A 1 307 ? -27.342 16.206  69.936 1.00 151.90 ? 774 TYR A OH  1 
ATOM   2456 N N   . LYS A 1 308 ? -28.403 8.713   74.144 1.00 34.22  ? 775 LYS A N   1 
ATOM   2457 C CA  . LYS A 1 308 ? -28.454 7.670   75.169 1.00 32.83  ? 775 LYS A CA  1 
ATOM   2458 C C   . LYS A 1 308 ? -27.194 6.841   75.202 1.00 30.04  ? 775 LYS A C   1 
ATOM   2459 O O   . LYS A 1 308 ? -26.544 6.742   76.240 1.00 47.62  ? 775 LYS A O   1 
ATOM   2460 C CB  . LYS A 1 308 ? -29.681 6.764   75.086 1.00 34.15  ? 775 LYS A CB  1 
ATOM   2461 C CG  . LYS A 1 308 ? -30.982 7.424   75.432 1.00 59.33  ? 775 LYS A CG  1 
ATOM   2462 C CD  . LYS A 1 308 ? -32.032 6.344   75.632 1.00 88.20  ? 775 LYS A CD  1 
ATOM   2463 C CE  . LYS A 1 308 ? -33.318 6.908   76.185 1.00 89.29  ? 775 LYS A CE  1 
ATOM   2464 N NZ  . LYS A 1 308 ? -34.244 5.800   76.499 1.00 66.23  ? 775 LYS A NZ  1 
ATOM   2465 N N   . LEU A 1 309 ? -26.834 6.257   74.067 1.00 28.15  ? 776 LEU A N   1 
ATOM   2466 C CA  . LEU A 1 309 ? -25.645 5.433   74.024 1.00 28.86  ? 776 LEU A CA  1 
ATOM   2467 C C   . LEU A 1 309 ? -24.387 6.242   74.335 1.00 28.86  ? 776 LEU A C   1 
ATOM   2468 O O   . LEU A 1 309 ? -23.455 5.735   74.948 1.00 30.85  ? 776 LEU A O   1 
ATOM   2469 C CB  . LEU A 1 309 ? -25.521 4.701   72.686 1.00 29.17  ? 776 LEU A CB  1 
ATOM   2470 C CG  . LEU A 1 309 ? -26.688 3.784   72.283 1.00 31.04  ? 776 LEU A CG  1 
ATOM   2471 C CD1 . LEU A 1 309 ? -26.294 3.005   71.000 1.00 25.94  ? 776 LEU A CD1 1 
ATOM   2472 C CD2 . LEU A 1 309 ? -27.019 2.779   73.397 1.00 28.94  ? 776 LEU A CD2 1 
ATOM   2473 N N   . SER A 1 310 ? -24.365 7.503   73.912 1.00 30.20  ? 777 SER A N   1 
ATOM   2474 C CA  . SER A 1 310 ? -23.222 8.379   74.178 1.00 30.86  ? 777 SER A CA  1 
ATOM   2475 C C   . SER A 1 310 ? -23.044 8.690   75.657 1.00 28.91  ? 777 SER A C   1 
ATOM   2476 O O   . SER A 1 310 ? -21.920 8.708   76.172 1.00 26.09  ? 777 SER A O   1 
ATOM   2477 C CB  . SER A 1 310 ? -23.338 9.683   73.392 1.00 26.95  ? 777 SER A CB  1 
ATOM   2478 O OG  . SER A 1 310 ? -23.278 9.441   72.002 1.00 26.43  ? 777 SER A OG  1 
ATOM   2479 N N   . SER A 1 311 ? -24.164 8.937   76.325 1.00 26.17  ? 778 SER A N   1 
ATOM   2480 C CA  . SER A 1 311 ? -24.164 9.250   77.742 1.00 25.99  ? 778 SER A CA  1 
ATOM   2481 C C   . SER A 1 311 ? -23.637 8.066   78.481 1.00 25.39  ? 778 SER A C   1 
ATOM   2482 O O   . SER A 1 311 ? -22.784 8.210   79.348 1.00 28.54  ? 778 SER A O   1 
ATOM   2483 C CB  . SER A 1 311 ? -25.579 9.551   78.228 1.00 26.22  ? 778 SER A CB  1 
ATOM   2484 O OG  . SER A 1 311 ? -26.084 10.662  77.526 1.00 33.48  ? 778 SER A OG  1 
ATOM   2485 N N   . THR A 1 312 ? -24.138 6.892   78.111 1.00 23.37  ? 779 THR A N   1 
ATOM   2486 C CA  . THR A 1 312 ? -23.768 5.654   78.775 1.00 22.88  ? 779 THR A CA  1 
ATOM   2487 C C   . THR A 1 312 ? -22.294 5.375   78.580 1.00 24.14  ? 779 THR A C   1 
ATOM   2488 O O   . THR A 1 312 ? -21.604 4.973   79.516 1.00 28.57  ? 779 THR A O   1 
ATOM   2489 C CB  . THR A 1 312 ? -24.564 4.459   78.228 1.00 24.47  ? 779 THR A CB  1 
ATOM   2490 O OG1 . THR A 1 312 ? -25.974 4.712   78.366 1.00 26.34  ? 779 THR A OG1 1 
ATOM   2491 C CG2 . THR A 1 312 ? -24.179 3.165   78.989 1.00 23.28  ? 779 THR A CG2 1 
ATOM   2492 N N   . LEU A 1 313 ? -21.802 5.574   77.361 1.00 23.32  ? 780 LEU A N   1 
ATOM   2493 C CA  . LEU A 1 313 ? -20.374 5.422   77.106 1.00 23.26  ? 780 LEU A CA  1 
ATOM   2494 C C   . LEU A 1 313 ? -19.558 6.411   77.926 1.00 24.08  ? 780 LEU A C   1 
ATOM   2495 O O   . LEU A 1 313 ? -18.607 6.022   78.599 1.00 24.01  ? 780 LEU A O   1 
ATOM   2496 C CB  . LEU A 1 313 ? -20.070 5.526   75.615 1.00 23.67  ? 780 LEU A CB  1 
ATOM   2497 C CG  . LEU A 1 313 ? -20.568 4.337   74.788 1.00 26.53  ? 780 LEU A CG  1 
ATOM   2498 C CD1 . LEU A 1 313 ? -20.585 4.704   73.316 1.00 30.11  ? 780 LEU A CD1 1 
ATOM   2499 C CD2 . LEU A 1 313 ? -19.717 3.060   75.072 1.00 22.09  ? 780 LEU A CD2 1 
ATOM   2500 N N   . THR A 1 314 ? -19.940 7.685   77.867 1.00 23.35  ? 781 THR A N   1 
ATOM   2501 C CA  . THR A 1 314 ? -19.334 8.699   78.709 1.00 25.47  ? 781 THR A CA  1 
ATOM   2502 C C   . THR A 1 314 ? -19.319 8.329   80.200 1.00 25.96  ? 781 THR A C   1 
ATOM   2503 O O   . THR A 1 314 ? -18.275 8.375   80.844 1.00 26.30  ? 781 THR A O   1 
ATOM   2504 C CB  . THR A 1 314 ? -19.995 10.056  78.484 1.00 28.04  ? 781 THR A CB  1 
ATOM   2505 O OG1 . THR A 1 314 ? -19.699 10.495  77.155 1.00 31.31  ? 781 THR A OG1 1 
ATOM   2506 C CG2 . THR A 1 314 ? -19.527 11.085  79.497 1.00 24.07  ? 781 THR A CG2 1 
ATOM   2507 N N   . ASN A 1 315 ? -20.460 7.951   80.756 1.00 25.73  ? 782 ASN A N   1 
ATOM   2508 C CA  . ASN A 1 315 ? -20.449 7.519   82.153 1.00 31.36  ? 782 ASN A CA  1 
ATOM   2509 C C   . ASN A 1 315 ? -19.506 6.330   82.389 1.00 33.58  ? 782 ASN A C   1 
ATOM   2510 O O   . ASN A 1 315 ? -18.692 6.365   83.309 1.00 32.07  ? 782 ASN A O   1 
ATOM   2511 C CB  . ASN A 1 315 ? -21.859 7.238   82.699 1.00 32.35  ? 782 ASN A CB  1 
ATOM   2512 C CG  . ASN A 1 315 ? -22.722 8.481   82.745 1.00 33.87  ? 782 ASN A CG  1 
ATOM   2513 O OD1 . ASN A 1 315 ? -22.220 9.583   82.998 1.00 44.37  ? 782 ASN A OD1 1 
ATOM   2514 N ND2 . ASN A 1 315 ? -24.031 8.314   82.521 1.00 28.43  ? 782 ASN A ND2 1 
ATOM   2515 N N   . ILE A 1 316 ? -19.606 5.295   81.553 1.00 27.20  ? 783 ILE A N   1 
ATOM   2516 C CA  . ILE A 1 316 ? -18.707 4.158   81.668 1.00 27.53  ? 783 ILE A CA  1 
ATOM   2517 C C   . ILE A 1 316 ? -17.241 4.604   81.658 1.00 27.31  ? 783 ILE A C   1 
ATOM   2518 O O   . ILE A 1 316 ? -16.481 4.290   82.568 1.00 30.01  ? 783 ILE A O   1 
ATOM   2519 C CB  . ILE A 1 316 ? -18.975 3.085   80.564 1.00 31.30  ? 783 ILE A CB  1 
ATOM   2520 C CG1 . ILE A 1 316 ? -20.386 2.497   80.707 1.00 32.39  ? 783 ILE A CG1 1 
ATOM   2521 C CG2 . ILE A 1 316 ? -17.941 1.981   80.613 1.00 30.94  ? 783 ILE A CG2 1 
ATOM   2522 C CD1 . ILE A 1 316 ? -20.739 1.433   79.706 1.00 28.54  ? 783 ILE A CD1 1 
ATOM   2523 N N   . TYR A 1 317 ? -16.843 5.348   80.639 1.00 26.03  ? 784 TYR A N   1 
ATOM   2524 C CA  . TYR A 1 317 ? -15.440 5.696   80.480 1.00 29.34  ? 784 TYR A CA  1 
ATOM   2525 C C   . TYR A 1 317 ? -14.826 6.683   81.484 1.00 33.71  ? 784 TYR A C   1 
ATOM   2526 O O   . TYR A 1 317 ? -13.603 6.722   81.675 1.00 32.82  ? 784 TYR A O   1 
ATOM   2527 C CB  . TYR A 1 317 ? -15.155 6.109   79.049 1.00 25.40  ? 784 TYR A CB  1 
ATOM   2528 C CG  . TYR A 1 317 ? -15.351 4.998   78.057 1.00 28.22  ? 784 TYR A CG  1 
ATOM   2529 C CD1 . TYR A 1 317 ? -14.877 3.710   78.337 1.00 27.43  ? 784 TYR A CD1 1 
ATOM   2530 C CD2 . TYR A 1 317 ? -15.986 5.221   76.830 1.00 25.23  ? 784 TYR A CD2 1 
ATOM   2531 C CE1 . TYR A 1 317 ? -15.008 2.682   77.426 1.00 25.00  ? 784 TYR A CE1 1 
ATOM   2532 C CE2 . TYR A 1 317 ? -16.121 4.193   75.905 1.00 22.87  ? 784 TYR A CE2 1 
ATOM   2533 C CZ  . TYR A 1 317 ? -15.626 2.923   76.209 1.00 24.19  ? 784 TYR A CZ  1 
ATOM   2534 O OH  . TYR A 1 317 ? -15.733 1.879   75.320 1.00 20.96  ? 784 TYR A OH  1 
ATOM   2535 N N   . THR A 1 318 ? -15.671 7.486   82.113 1.00 32.72  ? 785 THR A N   1 
ATOM   2536 C CA  . THR A 1 318 ? -15.205 8.390   83.158 1.00 32.58  ? 785 THR A CA  1 
ATOM   2537 C C   . THR A 1 318 ? -15.440 7.725   84.515 1.00 39.95  ? 785 THR A C   1 
ATOM   2538 O O   . THR A 1 318 ? -15.136 8.296   85.557 1.00 43.61  ? 785 THR A O   1 
ATOM   2539 C CB  . THR A 1 318 ? -15.978 9.739   83.129 1.00 27.89  ? 785 THR A CB  1 
ATOM   2540 O OG1 . THR A 1 318 ? -17.389 9.499   83.282 1.00 28.46  ? 785 THR A OG1 1 
ATOM   2541 C CG2 . THR A 1 318 ? -15.737 10.482  81.838 1.00 23.01  ? 785 THR A CG2 1 
ATOM   2542 N N   . GLY A 1 319 ? -15.985 6.515   84.495 1.00 38.21  ? 786 GLY A N   1 
ATOM   2543 C CA  . GLY A 1 319 ? -16.408 5.873   85.729 1.00 46.63  ? 786 GLY A CA  1 
ATOM   2544 C C   . GLY A 1 319 ? -17.496 6.621   86.493 1.00 44.10  ? 786 GLY A C   1 
ATOM   2545 O O   . GLY A 1 319 ? -17.225 7.209   87.525 1.00 51.87  ? 786 GLY A O   1 
ATOM   2546 N N   . SER A 1 320 ? -18.730 6.592   86.007 1.00 53.45  ? 787 SER A N   1 
ATOM   2547 C CA  . SER A 1 320 ? -19.816 7.307   86.665 1.00 34.44  ? 787 SER A CA  1 
ATOM   2548 C C   . SER A 1 320 ? -21.145 6.583   86.536 1.00 52.21  ? 787 SER A C   1 
ATOM   2549 O O   . SER A 1 320 ? -22.146 7.319   86.389 1.00 46.51  ? 787 SER A O   1 
ATOM   2550 C CB  . SER A 1 320 ? -19.978 8.701   86.046 1.00 55.13  ? 787 SER A CB  1 
ATOM   2551 O OG  . SER A 1 320 ? -18.804 9.483   86.176 1.00 63.64  ? 787 SER A OG  1 
ATOM   2552 O OXT . SER A 1 320 ? -21.182 5.327   86.592 1.00 56.18  ? 787 SER A OXT 1 
HETATM 2553 C C   . FMT B 2 .   ? -7.415  21.585  44.795 1.00 71.20  ? 101 FMT A C   1 
HETATM 2554 O O1  . FMT B 2 .   ? -7.806  22.674  45.201 1.00 62.25  ? 101 FMT A O1  1 
HETATM 2555 O O2  . FMT B 2 .   ? -6.337  20.970  45.358 1.00 39.50  ? 101 FMT A O2  1 
HETATM 2556 C C   . FMT C 2 .   ? -13.561 -3.918  52.739 1.00 75.08  ? 102 FMT A C   1 
HETATM 2557 O O1  . FMT C 2 .   ? -13.464 -2.774  52.306 1.00 43.13  ? 102 FMT A O1  1 
HETATM 2558 O O2  . FMT C 2 .   ? -13.005 -4.967  52.083 1.00 55.01  ? 102 FMT A O2  1 
HETATM 2559 C C   . FMT D 2 .   ? -2.781  15.427  69.977 1.00 76.87  ? 103 FMT A C   1 
HETATM 2560 O O1  . FMT D 2 .   ? -3.865  15.510  69.432 1.00 69.06  ? 103 FMT A O1  1 
HETATM 2561 O O2  . FMT D 2 .   ? -2.191  14.224  70.139 1.00 42.38  ? 103 FMT A O2  1 
HETATM 2562 O O   . HOH E 3 .   ? -16.317 0.030   69.070 1.00 20.58  ? 1   HOH A O   1 
HETATM 2563 O O   . HOH E 3 .   ? -14.788 0.491   66.636 1.00 21.09  ? 2   HOH A O   1 
HETATM 2564 O O   . HOH E 3 .   ? -11.133 -6.121  74.427 1.00 22.37  ? 3   HOH A O   1 
HETATM 2565 O O   . HOH E 3 .   ? -15.002 18.850  60.848 1.00 33.05  ? 4   HOH A O   1 
HETATM 2566 O O   . HOH E 3 .   ? -1.858  -7.179  47.677 1.00 24.65  ? 5   HOH A O   1 
HETATM 2567 O O   . HOH E 3 .   ? 7.648   15.160  49.205 1.00 35.23  ? 6   HOH A O   1 
HETATM 2568 O O   . HOH E 3 .   ? 4.013   3.052   49.411 1.00 29.74  ? 7   HOH A O   1 
HETATM 2569 O O   . HOH E 3 .   ? -12.416 10.120  62.707 1.00 37.22  ? 8   HOH A O   1 
HETATM 2570 O O   . HOH E 3 .   ? -6.125  6.795   76.112 1.00 32.58  ? 9   HOH A O   1 
HETATM 2571 O O   . HOH E 3 .   ? -4.542  7.070   67.837 1.00 26.84  ? 10  HOH A O   1 
HETATM 2572 O O   . HOH E 3 .   ? -3.216  0.145   63.115 1.00 30.93  ? 11  HOH A O   1 
HETATM 2573 O O   . HOH E 3 .   ? 1.918   18.253  48.150 1.00 34.58  ? 12  HOH A O   1 
HETATM 2574 O O   . HOH E 3 .   ? -17.515 -20.806 70.099 1.00 34.90  ? 13  HOH A O   1 
HETATM 2575 O O   . HOH E 3 .   ? 1.620   25.934  62.990 1.00 34.60  ? 14  HOH A O   1 
HETATM 2576 O O   . HOH E 3 .   ? -13.991 1.741   82.325 1.00 40.01  ? 15  HOH A O   1 
HETATM 2577 O O   . HOH E 3 .   ? -12.670 5.980   60.965 1.00 46.08  ? 16  HOH A O   1 
HETATM 2578 O O   . HOH E 3 .   ? -13.145 6.702   58.152 1.00 32.90  ? 17  HOH A O   1 
HETATM 2579 O O   . HOH E 3 .   ? -13.791 14.267  45.436 1.00 40.47  ? 18  HOH A O   1 
HETATM 2580 O O   . HOH E 3 .   ? -1.829  0.165   79.204 1.00 37.07  ? 19  HOH A O   1 
HETATM 2581 O O   . HOH E 3 .   ? 3.653   -10.884 55.124 1.00 34.74  ? 20  HOH A O   1 
HETATM 2582 O O   . HOH E 3 .   ? 1.642   -12.655 53.695 1.00 28.86  ? 21  HOH A O   1 
HETATM 2583 O O   . HOH E 3 .   ? -4.089  6.196   64.834 1.00 43.37  ? 22  HOH A O   1 
HETATM 2584 O O   . HOH E 3 .   ? -2.389  8.207   66.399 1.00 49.18  ? 23  HOH A O   1 
HETATM 2585 O O   . HOH E 3 .   ? -20.939 -3.954  55.409 1.00 52.23  ? 24  HOH A O   1 
HETATM 2586 O O   . HOH E 3 .   ? -15.118 9.490   53.265 1.00 49.16  ? 25  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   468 468 ASP ASP A . n 
A 1 2   VAL 2   469 469 VAL VAL A . n 
A 1 3   PHE 3   470 470 PHE PHE A . n 
A 1 4   GLN 4   471 471 GLN GLN A . n 
A 1 5   ASN 5   472 472 ASN ASN A . n 
A 1 6   LYS 6   473 473 LYS LYS A . n 
A 1 7   ALA 7   474 474 ALA ALA A . n 
A 1 8   ASN 8   475 475 ASN ASN A . n 
A 1 9   VAL 9   476 476 VAL VAL A . n 
A 1 10  CYS 10  477 477 CYS CYS A . n 
A 1 11  TRP 11  478 478 TRP TRP A . n 
A 1 12  ALA 12  479 479 ALA ALA A . n 
A 1 13  LYS 13  480 480 LYS LYS A . n 
A 1 14  ALA 14  481 481 ALA ALA A . n 
A 1 15  LEU 15  482 482 LEU LEU A . n 
A 1 16  VAL 16  483 483 VAL VAL A . n 
A 1 17  PRO 17  484 484 PRO PRO A . n 
A 1 18  VAL 18  485 485 VAL VAL A . n 
A 1 19  LEU 19  486 486 LEU LEU A . n 
A 1 20  LYS 20  487 487 LYS LYS A . n 
A 1 21  THR 21  488 488 THR THR A . n 
A 1 22  ALA 22  489 489 ALA ALA A . n 
A 1 23  GLY 23  490 490 GLY GLY A . n 
A 1 24  ILE 24  491 491 ILE ILE A . n 
A 1 25  ASP 25  492 492 ASP ASP A . n 
A 1 26  MET 26  493 493 MET MET A . n 
A 1 27  THR 27  494 494 THR THR A . n 
A 1 28  THR 28  495 495 THR THR A . n 
A 1 29  GLU 29  496 496 GLU GLU A . n 
A 1 30  GLN 30  497 497 GLN GLN A . n 
A 1 31  TRP 31  498 498 TRP TRP A . n 
A 1 32  ASN 32  499 499 ASN ASN A . n 
A 1 33  THR 33  500 500 THR THR A . n 
A 1 34  VAL 34  501 501 VAL VAL A . n 
A 1 35  ASP 35  502 502 ASP ASP A . n 
A 1 36  TYR 36  503 503 TYR TYR A . n 
A 1 37  PHE 37  504 504 PHE PHE A . n 
A 1 38  GLU 38  505 505 GLU GLU A . n 
A 1 39  THR 39  506 506 THR THR A . n 
A 1 40  ASP 40  507 507 ASP ASP A . n 
A 1 41  LYS 41  508 508 LYS LYS A . n 
A 1 42  ALA 42  509 509 ALA ALA A . n 
A 1 43  HIS 43  510 510 HIS HIS A . n 
A 1 44  SER 44  511 511 SER SER A . n 
A 1 45  ALA 45  512 512 ALA ALA A . n 
A 1 46  GLU 46  513 513 GLU GLU A . n 
A 1 47  ILE 47  514 514 ILE ILE A . n 
A 1 48  VAL 48  515 515 VAL VAL A . n 
A 1 49  LEU 49  516 516 LEU LEU A . n 
A 1 50  ASN 50  517 517 ASN ASN A . n 
A 1 51  GLN 51  518 518 GLN GLN A . n 
A 1 52  LEU 52  519 519 LEU LEU A . n 
A 1 53  CYS 53  520 520 CYS CYS A . n 
A 1 54  VAL 54  521 521 VAL VAL A . n 
A 1 55  ARG 55  522 522 ARG ARG A . n 
A 1 56  PHE 56  523 523 PHE PHE A . n 
A 1 57  PHE 57  524 524 PHE PHE A . n 
A 1 58  GLY 58  525 525 GLY GLY A . n 
A 1 59  LEU 59  526 526 LEU LEU A . n 
A 1 60  ASP 60  527 527 ASP ASP A . n 
A 1 61  LEU 61  528 528 LEU LEU A . n 
A 1 62  ASP 62  529 529 ASP ASP A . n 
A 1 63  SER 63  530 530 SER SER A . n 
A 1 64  GLY 64  531 531 GLY GLY A . n 
A 1 65  LEU 65  532 532 LEU LEU A . n 
A 1 66  PHE 66  533 533 PHE PHE A . n 
A 1 67  SER 67  534 534 SER SER A . n 
A 1 68  ALA 68  535 535 ALA ALA A . n 
A 1 69  PRO 69  536 536 PRO PRO A . n 
A 1 70  THR 70  537 537 THR THR A . n 
A 1 71  VAL 71  538 538 VAL VAL A . n 
A 1 72  PRO 72  539 539 PRO PRO A . n 
A 1 73  LEU 73  540 540 LEU LEU A . n 
A 1 74  SER 74  541 541 SER SER A . n 
A 1 75  ILE 75  542 542 ILE ILE A . n 
A 1 76  ARG 76  543 543 ARG ARG A . n 
A 1 77  ASN 77  544 544 ASN ASN A . n 
A 1 78  ASN 78  545 545 ASN ASN A . n 
A 1 79  HIS 79  546 546 HIS HIS A . n 
A 1 80  TRP 80  547 547 TRP TRP A . n 
A 1 81  ASP 81  548 548 ASP ASP A . n 
A 1 82  ASN 82  549 549 ASN ASN A . n 
A 1 83  SER 83  550 550 SER SER A . n 
A 1 84  PRO 84  551 551 PRO PRO A . n 
A 1 85  SER 85  552 552 SER SER A . n 
A 1 86  PRO 86  553 553 PRO PRO A . n 
A 1 87  ASN 87  554 554 ASN ASN A . n 
A 1 88  MET 88  555 555 MET MET A . n 
A 1 89  TYR 89  556 556 TYR TYR A . n 
A 1 90  GLY 90  557 557 GLY GLY A . n 
A 1 91  LEU 91  558 558 LEU LEU A . n 
A 1 92  ASN 92  559 559 ASN ASN A . n 
A 1 93  LYS 93  560 560 LYS LYS A . n 
A 1 94  GLU 94  561 561 GLU GLU A . n 
A 1 95  VAL 95  562 562 VAL VAL A . n 
A 1 96  VAL 96  563 563 VAL VAL A . n 
A 1 97  ARG 97  564 564 ARG ARG A . n 
A 1 98  GLN 98  565 565 GLN GLN A . n 
A 1 99  LEU 99  566 566 LEU LEU A . n 
A 1 100 SER 100 567 567 SER SER A . n 
A 1 101 ARG 101 568 568 ARG ARG A . n 
A 1 102 ARG 102 569 569 ARG ARG A . n 
A 1 103 TYR 103 570 570 TYR TYR A . n 
A 1 104 PRO 104 571 571 PRO PRO A . n 
A 1 105 GLN 105 572 572 GLN GLN A . n 
A 1 106 LEU 106 573 573 LEU LEU A . n 
A 1 107 PRO 107 574 574 PRO PRO A . n 
A 1 108 ARG 108 575 575 ARG ARG A . n 
A 1 109 ALA 109 576 576 ALA ALA A . n 
A 1 110 VAL 110 577 577 VAL VAL A . n 
A 1 111 ALA 111 578 578 ALA ALA A . n 
A 1 112 THR 112 579 579 THR THR A . n 
A 1 113 GLY 113 580 580 GLY GLY A . n 
A 1 114 ARG 114 581 581 ARG ARG A . n 
A 1 115 VAL 115 582 582 VAL VAL A . n 
A 1 116 TYR 116 583 583 TYR TYR A . n 
A 1 117 ASP 117 584 584 ASP ASP A . n 
A 1 118 MET 118 585 585 MET MET A . n 
A 1 119 ASN 119 586 586 ASN ASN A . n 
A 1 120 THR 120 587 587 THR THR A . n 
A 1 121 GLY 121 588 588 GLY GLY A . n 
A 1 122 THR 122 589 589 THR THR A . n 
A 1 123 LEU 123 590 590 LEU LEU A . n 
A 1 124 ARG 124 591 591 ARG ARG A . n 
A 1 125 ASN 125 592 592 ASN ASN A . n 
A 1 126 TYR 126 593 593 TYR TYR A . n 
A 1 127 ASP 127 594 594 ASP ASP A . n 
A 1 128 PRO 128 595 595 PRO PRO A . n 
A 1 129 ARG 129 596 596 ARG ARG A . n 
A 1 130 ILE 130 597 597 ILE ILE A . n 
A 1 131 ASN 131 598 598 ASN ASN A . n 
A 1 132 LEU 132 599 599 LEU LEU A . n 
A 1 133 VAL 133 600 600 VAL VAL A . n 
A 1 134 PRO 134 601 601 PRO PRO A . n 
A 1 135 VAL 135 602 602 VAL VAL A . n 
A 1 136 ASN 136 603 603 ASN ASN A . n 
A 1 137 ARG 137 604 604 ARG ARG A . n 
A 1 138 ARG 138 605 605 ARG ARG A . n 
A 1 139 LEU 139 606 606 LEU LEU A . n 
A 1 140 PRO 140 607 607 PRO PRO A . n 
A 1 141 HIS 141 608 608 HIS HIS A . n 
A 1 142 ALA 142 609 609 ALA ALA A . n 
A 1 143 LEU 143 610 610 LEU LEU A . n 
A 1 144 VAL 144 611 611 VAL VAL A . n 
A 1 145 LEU 145 612 612 LEU LEU A . n 
A 1 146 HIS 146 613 613 HIS HIS A . n 
A 1 147 HIS 147 614 614 HIS HIS A . n 
A 1 148 ASN 148 615 615 ASN ASN A . n 
A 1 149 GLU 149 616 616 GLU GLU A . n 
A 1 150 HIS 150 617 617 HIS HIS A . n 
A 1 151 PRO 151 618 618 PRO PRO A . n 
A 1 152 GLN 152 619 619 GLN GLN A . n 
A 1 153 SER 153 620 620 SER SER A . n 
A 1 154 ASP 154 621 621 ASP ASP A . n 
A 1 155 PHE 155 622 622 PHE PHE A . n 
A 1 156 SER 156 623 623 SER SER A . n 
A 1 157 SER 157 624 624 SER SER A . n 
A 1 158 PHE 158 625 625 PHE PHE A . n 
A 1 159 VAL 159 626 626 VAL VAL A . n 
A 1 160 SER 160 627 627 SER SER A . n 
A 1 161 LYS 161 628 628 LYS LYS A . n 
A 1 162 LEU 162 629 629 LEU LEU A . n 
A 1 163 LYS 163 630 630 LYS LYS A . n 
A 1 164 GLY 164 631 631 GLY GLY A . n 
A 1 165 ARG 165 632 632 ARG ARG A . n 
A 1 166 THR 166 633 633 THR THR A . n 
A 1 167 VAL 167 634 634 VAL VAL A . n 
A 1 168 LEU 168 635 635 LEU LEU A . n 
A 1 169 VAL 169 636 636 VAL VAL A . n 
A 1 170 VAL 170 637 637 VAL VAL A . n 
A 1 171 GLY 171 638 638 GLY GLY A . n 
A 1 172 GLU 172 639 639 GLU GLU A . n 
A 1 173 LYS 173 640 640 LYS LYS A . n 
A 1 174 LEU 174 641 641 LEU LEU A . n 
A 1 175 SER 175 642 642 SER SER A . n 
A 1 176 VAL 176 643 643 VAL VAL A . n 
A 1 177 PRO 177 644 644 PRO PRO A . n 
A 1 178 GLY 178 645 645 GLY GLY A . n 
A 1 179 LYS 179 646 646 LYS LYS A . n 
A 1 180 MET 180 647 647 MET MET A . n 
A 1 181 VAL 181 648 648 VAL VAL A . n 
A 1 182 ASP 182 649 649 ASP ASP A . n 
A 1 183 TRP 183 650 650 TRP TRP A . n 
A 1 184 LEU 184 651 651 LEU LEU A . n 
A 1 185 SER 185 652 652 SER SER A . n 
A 1 186 ASP 186 653 653 ASP ASP A . n 
A 1 187 ARG 187 654 654 ARG ARG A . n 
A 1 188 PRO 188 655 655 PRO PRO A . n 
A 1 189 GLU 189 656 656 GLU GLU A . n 
A 1 190 ALA 190 657 657 ALA ALA A . n 
A 1 191 THR 191 658 658 THR THR A . n 
A 1 192 PHE 192 659 659 PHE PHE A . n 
A 1 193 ARG 193 660 660 ARG ARG A . n 
A 1 194 ALA 194 661 661 ALA ALA A . n 
A 1 195 ARG 195 662 662 ARG ARG A . n 
A 1 196 LEU 196 663 663 LEU LEU A . n 
A 1 197 ASP 197 664 664 ASP ASP A . n 
A 1 198 LEU 198 665 665 LEU LEU A . n 
A 1 199 GLY 199 666 666 GLY GLY A . n 
A 1 200 ILE 200 667 667 ILE ILE A . n 
A 1 201 PRO 201 668 668 PRO PRO A . n 
A 1 202 GLY 202 669 669 GLY GLY A . n 
A 1 203 ASP 203 670 670 ASP ASP A . n 
A 1 204 VAL 204 671 671 VAL VAL A . n 
A 1 205 PRO 205 672 672 PRO PRO A . n 
A 1 206 LYS 206 673 673 LYS LYS A . n 
A 1 207 TYR 207 674 674 TYR TYR A . n 
A 1 208 ASP 208 675 675 ASP ASP A . n 
A 1 209 ILE 209 676 676 ILE ILE A . n 
A 1 210 ILE 210 677 677 ILE ILE A . n 
A 1 211 PHE 211 678 678 PHE PHE A . n 
A 1 212 VAL 212 679 679 VAL VAL A . n 
A 1 213 ASN 213 680 680 ASN ASN A . n 
A 1 214 VAL 214 681 681 VAL VAL A . n 
A 1 215 ARG 215 682 682 ARG ARG A . n 
A 1 216 THR 216 683 683 THR THR A . n 
A 1 217 PRO 217 684 684 PRO PRO A . n 
A 1 218 TYR 218 685 685 TYR TYR A . n 
A 1 219 LYS 219 686 686 LYS LYS A . n 
A 1 220 TYR 220 687 687 TYR TYR A . n 
A 1 221 HIS 221 688 688 HIS HIS A . n 
A 1 222 HIS 222 689 689 HIS HIS A . n 
A 1 223 TYR 223 690 690 TYR TYR A . n 
A 1 224 GLN 224 691 691 GLN GLN A . n 
A 1 225 GLN 225 692 692 GLN GLN A . n 
A 1 226 CYS 226 693 693 CYS CYS A . n 
A 1 227 GLU 227 694 694 GLU GLU A . n 
A 1 228 ASP 228 695 695 ASP ASP A . n 
A 1 229 HIS 229 696 696 HIS HIS A . n 
A 1 230 ALA 230 697 697 ALA ALA A . n 
A 1 231 ILE 231 698 698 ILE ILE A . n 
A 1 232 LYS 232 699 699 LYS LYS A . n 
A 1 233 LEU 233 700 700 LEU LEU A . n 
A 1 234 SER 234 701 701 SER SER A . n 
A 1 235 MET 235 702 702 MET MET A . n 
A 1 236 LEU 236 703 703 LEU LEU A . n 
A 1 237 THR 237 704 704 THR THR A . n 
A 1 238 LYS 238 705 705 LYS LYS A . n 
A 1 239 LYS 239 706 706 LYS LYS A . n 
A 1 240 ALA 240 707 707 ALA ALA A . n 
A 1 241 CYS 241 708 708 CYS CYS A . n 
A 1 242 LEU 242 709 709 LEU LEU A . n 
A 1 243 HIS 243 710 710 HIS HIS A . n 
A 1 244 LEU 244 711 711 LEU LEU A . n 
A 1 245 ASN 245 712 712 ASN ASN A . n 
A 1 246 PRO 246 713 713 PRO PRO A . n 
A 1 247 GLY 247 714 714 GLY GLY A . n 
A 1 248 GLY 248 715 715 GLY GLY A . n 
A 1 249 THR 249 716 716 THR THR A . n 
A 1 250 CYS 250 717 717 CYS CYS A . n 
A 1 251 VAL 251 718 718 VAL VAL A . n 
A 1 252 SER 252 719 719 SER SER A . n 
A 1 253 ILE 253 720 720 ILE ILE A . n 
A 1 254 GLY 254 721 721 GLY GLY A . n 
A 1 255 TYR 255 722 722 TYR TYR A . n 
A 1 256 GLY 256 723 723 GLY GLY A . n 
A 1 257 TYR 257 724 724 TYR TYR A . n 
A 1 258 ALA 258 725 725 ALA ALA A . n 
A 1 259 ASP 259 726 726 ASP ASP A . n 
A 1 260 ARG 260 727 727 ARG ARG A . n 
A 1 261 ALA 261 728 728 ALA ALA A . n 
A 1 262 SER 262 729 729 SER SER A . n 
A 1 263 GLU 263 730 730 GLU GLU A . n 
A 1 264 SER 264 731 731 SER SER A . n 
A 1 265 ILE 265 732 732 ILE ILE A . n 
A 1 266 ILE 266 733 733 ILE ILE A . n 
A 1 267 GLY 267 734 734 GLY GLY A . n 
A 1 268 ALA 268 735 735 ALA ALA A . n 
A 1 269 ILE 269 736 736 ILE ILE A . n 
A 1 270 ALA 270 737 737 ALA ALA A . n 
A 1 271 ARG 271 738 738 ARG ARG A . n 
A 1 272 GLN 272 739 739 GLN GLN A . n 
A 1 273 PHE 273 740 740 PHE PHE A . n 
A 1 274 LYS 274 741 741 LYS LYS A . n 
A 1 275 PHE 275 742 742 PHE PHE A . n 
A 1 276 SER 276 743 743 SER SER A . n 
A 1 277 ARG 277 744 744 ARG ARG A . n 
A 1 278 VAL 278 745 745 VAL VAL A . n 
A 1 279 CYS 279 746 746 CYS CYS A . n 
A 1 280 LYS 280 747 747 LYS LYS A . n 
A 1 281 PRO 281 748 748 PRO PRO A . n 
A 1 282 LYS 282 749 749 LYS LYS A . n 
A 1 283 SER 283 750 750 SER SER A . n 
A 1 284 SER 284 751 751 SER SER A . n 
A 1 285 LEU 285 752 752 LEU LEU A . n 
A 1 286 GLU 286 753 753 GLU GLU A . n 
A 1 287 GLU 287 754 754 GLU GLU A . n 
A 1 288 THR 288 755 755 THR THR A . n 
A 1 289 GLU 289 756 756 GLU GLU A . n 
A 1 290 VAL 290 757 757 VAL VAL A . n 
A 1 291 LEU 291 758 758 LEU LEU A . n 
A 1 292 PHE 292 759 759 PHE PHE A . n 
A 1 293 VAL 293 760 760 VAL VAL A . n 
A 1 294 PHE 294 761 761 PHE PHE A . n 
A 1 295 ILE 295 762 762 ILE ILE A . n 
A 1 296 GLY 296 763 763 GLY GLY A . n 
A 1 297 TYR 297 764 764 TYR TYR A . n 
A 1 298 ASP 298 765 765 ASP ASP A . n 
A 1 299 ARG 299 766 766 ARG ARG A . n 
A 1 300 LYS 300 767 767 LYS LYS A . n 
A 1 301 ALA 301 768 768 ALA ALA A . n 
A 1 302 ARG 302 769 769 ARG ARG A . n 
A 1 303 THR 303 770 770 THR THR A . n 
A 1 304 HIS 304 771 771 HIS HIS A . n 
A 1 305 ASN 305 772 772 ASN ASN A . n 
A 1 306 PRO 306 773 773 PRO PRO A . n 
A 1 307 TYR 307 774 774 TYR TYR A . n 
A 1 308 LYS 308 775 775 LYS LYS A . n 
A 1 309 LEU 309 776 776 LEU LEU A . n 
A 1 310 SER 310 777 777 SER SER A . n 
A 1 311 SER 311 778 778 SER SER A . n 
A 1 312 THR 312 779 779 THR THR A . n 
A 1 313 LEU 313 780 780 LEU LEU A . n 
A 1 314 THR 314 781 781 THR THR A . n 
A 1 315 ASN 315 782 782 ASN ASN A . n 
A 1 316 ILE 316 783 783 ILE ILE A . n 
A 1 317 TYR 317 784 784 TYR TYR A . n 
A 1 318 THR 318 785 785 THR THR A . n 
A 1 319 GLY 319 786 786 GLY GLY A . n 
A 1 320 SER 320 787 787 SER SER A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FMT 1  101 1  FMT FMT A . 
C 2 FMT 1  102 2  FMT FMT A . 
D 2 FMT 1  103 3  FMT FMT A . 
E 3 HOH 1  1   1  HOH HOH A . 
E 3 HOH 2  2   2  HOH HOH A . 
E 3 HOH 3  3   3  HOH HOH A . 
E 3 HOH 4  4   4  HOH HOH A . 
E 3 HOH 5  5   5  HOH HOH A . 
E 3 HOH 6  6   6  HOH HOH A . 
E 3 HOH 7  7   7  HOH HOH A . 
E 3 HOH 8  8   8  HOH HOH A . 
E 3 HOH 9  9   9  HOH HOH A . 
E 3 HOH 10 10  10 HOH HOH A . 
E 3 HOH 11 11  11 HOH HOH A . 
E 3 HOH 12 12  12 HOH HOH A . 
E 3 HOH 13 13  13 HOH HOH A . 
E 3 HOH 14 14  14 HOH HOH A . 
E 3 HOH 15 15  15 HOH HOH A . 
E 3 HOH 16 16  16 HOH HOH A . 
E 3 HOH 17 17  17 HOH HOH A . 
E 3 HOH 18 18  18 HOH HOH A . 
E 3 HOH 19 19  19 HOH HOH A . 
E 3 HOH 20 20  20 HOH HOH A . 
E 3 HOH 21 21  21 HOH HOH A . 
E 3 HOH 22 22  22 HOH HOH A . 
E 3 HOH 23 23  23 HOH HOH A . 
E 3 HOH 24 24  24 HOH HOH A . 
E 3 HOH 25 25  25 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-09-26 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2014-11-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Structure summary'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement       1.1 ? 1 
HKL-2000 'data reduction' .   ? 2 
HKL-2000 'data scaling'   .   ? 3 
SHARP    phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 544 ? ? 82.31   -114.87 
2 1 TYR A 687 ? ? -153.67 -6.37   
3 1 TYR A 722 ? ? -140.89 20.61   
4 1 TYR A 724 ? ? -143.30 55.41   
5 1 LYS A 749 ? ? -66.69  0.37    
6 1 ASN A 772 ? ? -100.67 78.59   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FORMIC ACID' FMT 
3 water         HOH 
#