data_2HZD
# 
_entry.id   2HZD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HZD         
RCSB  RCSB038942   
WWPDB D_1000038942 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HZD 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Anbanandam, A.'    1 
'Veeraraghavan, S.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Insights into transcription enhancer factor 1 (TEF-1) activity from the solution structure of the TEA domain.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            103 
_citation.page_first                17225 
_citation.page_last                 17230 
_citation.year                      2006 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17085591 
_citation.pdbx_database_id_DOI      10.1073/pnas.0607171103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Anbanandam, A.'    1 
primary 'Albarado, D.C.'    2 
primary 'Nguyen, C.T.'      3 
primary 'Halder, G.'        4 
primary 'Gao, X.'           5 
primary 'Veeraraghavan, S.' 6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Transcriptional enhancer factor TEF-1' 
_entity.formula_weight             9548.997 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'N-TERMINAL TEA DOMAIN' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TEA domain family member 1, TEAD-1, Protein GT-IIC, Transcription factor 13, NTEF-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDNDAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDLV
PR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDNDAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDLV
PR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  ASN n 
1 4  ASP n 
1 5  ALA n 
1 6  GLU n 
1 7  GLY n 
1 8  VAL n 
1 9  TRP n 
1 10 SER n 
1 11 PRO n 
1 12 ASP n 
1 13 ILE n 
1 14 GLU n 
1 15 GLN n 
1 16 SER n 
1 17 PHE n 
1 18 GLN n 
1 19 GLU n 
1 20 ALA n 
1 21 LEU n 
1 22 SER n 
1 23 ILE n 
1 24 TYR n 
1 25 PRO n 
1 26 PRO n 
1 27 CYS n 
1 28 GLY n 
1 29 ARG n 
1 30 ARG n 
1 31 LYS n 
1 32 ILE n 
1 33 ILE n 
1 34 LEU n 
1 35 SER n 
1 36 ASP n 
1 37 GLU n 
1 38 GLY n 
1 39 LYS n 
1 40 MET n 
1 41 TYR n 
1 42 GLY n 
1 43 ARG n 
1 44 ASN n 
1 45 GLU n 
1 46 LEU n 
1 47 ILE n 
1 48 ALA n 
1 49 ARG n 
1 50 TYR n 
1 51 ILE n 
1 52 LYS n 
1 53 LEU n 
1 54 ARG n 
1 55 THR n 
1 56 GLY n 
1 57 LYS n 
1 58 THR n 
1 59 ARG n 
1 60 THR n 
1 61 ARG n 
1 62 LYS n 
1 63 GLN n 
1 64 VAL n 
1 65 SER n 
1 66 SER n 
1 67 HIS n 
1 68 ILE n 
1 69 GLN n 
1 70 VAL n 
1 71 LEU n 
1 72 ALA n 
1 73 ARG n 
1 74 ARG n 
1 75 LYS n 
1 76 SER n 
1 77 ARG n 
1 78 ASP n 
1 79 LEU n 
1 80 VAL n 
1 81 PRO n 
1 82 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'TEAD1, TCF13, TEF1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21D 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TEAD1_HUMAN 
_struct_ref.pdbx_db_accession          P28347 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   IDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRD 
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2HZD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 78 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P28347 
_struct_ref_seq.db_align_beg                  28 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  104 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       78 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2HZD MET A 1  ? UNP P28347 ?   ?  'INITIATING METHIONINE' 1  1 
1 2HZD SER A 22 ? UNP P28347 ALA 48 CONFLICT                22 2 
1 2HZD LEU A 79 ? UNP P28347 ?   ?  'CLONING ARTIFACT'      79 3 
1 2HZD VAL A 80 ? UNP P28347 ?   ?  'CLONING ARTIFACT'      80 4 
1 2HZD PRO A 81 ? UNP P28347 ?   ?  'CLONING ARTIFACT'      81 5 
1 2HZD ARG A 82 ? UNP P28347 ?   ?  'CLONING ARTIFACT'      82 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         285 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  5.85 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100 mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.3 mM TEA U-15N, 13C, 100 mM phosphate buffer, 95% H2O, 5% D2O' 
_pdbx_nmr_sample_details.solvent_system   '100 mM phosphate buffer, 95% H2O, 5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 Avance Bruker 600 ? 
2 Avance Bruker 800 ? 
# 
_pdbx_nmr_refine.entry_id           2HZD 
_pdbx_nmr_refine.method             'torsion angle dynamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2HZD 
_pdbx_nmr_details.text       '3D TRIPLE RESONANCE EXPERIMENTS' 
# 
_pdbx_nmr_ensemble.entry_id                                      2HZD 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             25 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2HZD 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             CNS 
_pdbx_nmr_software.version          1.1 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          2HZD 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2HZD 
_struct.title                     'NMR structure of the DNA-binding TEA domain and insights into TEF-1 function' 
_struct.pdbx_descriptor           'Transcriptional enhancer factor TEF-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HZD 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            'DNA-BINDING, HELIX-TURN-HELIX, GENE REGULATION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 2  ? GLU A 6  ? ASP A 2  GLU A 6  5 ? 5  
HELX_P HELX_P2 2 SER A 10 ? TYR A 24 ? SER A 10 TYR A 24 1 ? 15 
HELX_P HELX_P3 3 ILE A 33 ? GLY A 38 ? ILE A 33 GLY A 38 1 ? 6  
HELX_P HELX_P4 4 ARG A 43 ? GLY A 56 ? ARG A 43 GLY A 56 1 ? 14 
HELX_P HELX_P5 5 ARG A 61 ? SER A 76 ? ARG A 61 SER A 76 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2HZD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HZD 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? 26.176  7.299   3.199   1.00 0.00 ? 1  MET A N    1  
ATOM 2     C CA   . MET A 1 1  ? 25.404  6.210   3.854   1.00 0.00 ? 1  MET A CA   1  
ATOM 3     C C    . MET A 1 1  ? 25.211  6.489   5.341   1.00 0.00 ? 1  MET A C    1  
ATOM 4     O O    . MET A 1 1  ? 25.921  5.939   6.183   1.00 0.00 ? 1  MET A O    1  
ATOM 5     C CB   . MET A 1 1  ? 26.157  4.893   3.657   1.00 0.00 ? 1  MET A CB   1  
ATOM 6     C CG   . MET A 1 1  ? 25.731  4.129   2.414   1.00 0.00 ? 1  MET A CG   1  
ATOM 7     S SD   . MET A 1 1  ? 26.481  2.492   2.314   1.00 0.00 ? 1  MET A SD   1  
ATOM 8     C CE   . MET A 1 1  ? 26.962  2.445   0.589   1.00 0.00 ? 1  MET A CE   1  
ATOM 9     H H1   . MET A 1 1  ? 27.017  7.485   3.780   1.00 0.00 ? 1  MET A H1   1  
ATOM 10    H H2   . MET A 1 1  ? 25.560  8.136   3.148   1.00 0.00 ? 1  MET A H2   1  
ATOM 11    H H3   . MET A 1 1  ? 26.443  6.971   2.249   1.00 0.00 ? 1  MET A H3   1  
ATOM 12    H HA   . MET A 1 1  ? 24.437  6.141   3.380   1.00 0.00 ? 1  MET A HA   1  
ATOM 13    H HB2  . MET A 1 1  ? 27.214  5.104   3.579   1.00 0.00 ? 1  MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1  ? 25.987  4.262   4.517   1.00 0.00 ? 1  MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1  ? 24.657  4.016   2.428   1.00 0.00 ? 1  MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1  ? 26.021  4.696   1.542   1.00 0.00 ? 1  MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1  ? 26.780  1.458   0.192   1.00 0.00 ? 1  MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1  ? 28.012  2.681   0.502   1.00 0.00 ? 1  MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1  ? 26.383  3.169   0.035   1.00 0.00 ? 1  MET A HE3  1  
ATOM 20    N N    . ASP A 1 2  ? 24.247  7.347   5.657   1.00 0.00 ? 2  ASP A N    1  
ATOM 21    C CA   . ASP A 1 2  ? 23.957  7.702   7.033   1.00 0.00 ? 2  ASP A CA   1  
ATOM 22    C C    . ASP A 1 2  ? 23.540  6.475   7.837   1.00 0.00 ? 2  ASP A C    1  
ATOM 23    O O    . ASP A 1 2  ? 23.132  5.460   7.273   1.00 0.00 ? 2  ASP A O    1  
ATOM 24    C CB   . ASP A 1 2  ? 22.851  8.754   7.068   1.00 0.00 ? 2  ASP A CB   1  
ATOM 25    C CG   . ASP A 1 2  ? 21.681  8.403   6.168   1.00 0.00 ? 2  ASP A CG   1  
ATOM 26    O OD1  . ASP A 1 2  ? 20.775  7.678   6.629   1.00 0.00 ? 2  ASP A OD1  1  
ATOM 27    O OD2  . ASP A 1 2  ? 21.672  8.853   5.003   1.00 0.00 ? 2  ASP A OD2  1  
ATOM 28    H H    . ASP A 1 2  ? 23.714  7.755   4.947   1.00 0.00 ? 2  ASP A H    1  
ATOM 29    H HA   . ASP A 1 2  ? 24.853  8.118   7.467   1.00 0.00 ? 2  ASP A HA   1  
ATOM 30    H HB2  . ASP A 1 2  ? 22.489  8.842   8.071   1.00 0.00 ? 2  ASP A HB2  1  
ATOM 31    H HB3  . ASP A 1 2  ? 23.255  9.704   6.749   1.00 0.00 ? 2  ASP A HB3  1  
ATOM 32    N N    . ASN A 1 3  ? 23.645  6.576   9.158   1.00 0.00 ? 3  ASN A N    1  
ATOM 33    C CA   . ASN A 1 3  ? 23.283  5.484   10.042  1.00 0.00 ? 3  ASN A CA   1  
ATOM 34    C C    . ASN A 1 3  ? 21.809  5.119   9.896   1.00 0.00 ? 3  ASN A C    1  
ATOM 35    O O    . ASN A 1 3  ? 21.399  4.006   10.223  1.00 0.00 ? 3  ASN A O    1  
ATOM 36    C CB   . ASN A 1 3  ? 23.587  5.872   11.487  1.00 0.00 ? 3  ASN A CB   1  
ATOM 37    C CG   . ASN A 1 3  ? 23.092  7.263   11.836  1.00 0.00 ? 3  ASN A CG   1  
ATOM 38    O OD1  . ASN A 1 3  ? 23.802  8.251   11.654  1.00 0.00 ? 3  ASN A OD1  1  
ATOM 39    N ND2  . ASN A 1 3  ? 21.867  7.345   12.341  1.00 0.00 ? 3  ASN A ND2  1  
ATOM 40    H H    . ASN A 1 3  ? 23.976  7.406   9.552   1.00 0.00 ? 3  ASN A H    1  
ATOM 41    H HA   . ASN A 1 3  ? 23.881  4.629   9.775   1.00 0.00 ? 3  ASN A HA   1  
ATOM 42    H HB2  . ASN A 1 3  ? 23.110  5.172   12.141  1.00 0.00 ? 3  ASN A HB2  1  
ATOM 43    H HB3  . ASN A 1 3  ? 24.655  5.839   11.646  1.00 0.00 ? 3  ASN A HB3  1  
ATOM 44    H HD21 . ASN A 1 3  ? 21.358  6.515   12.458  1.00 0.00 ? 3  ASN A HD21 1  
ATOM 45    H HD22 . ASN A 1 3  ? 21.521  8.231   12.576  1.00 0.00 ? 3  ASN A HD22 1  
ATOM 46    N N    . ASP A 1 4  ? 21.017  6.064   9.402   1.00 0.00 ? 4  ASP A N    1  
ATOM 47    C CA   . ASP A 1 4  ? 19.589  5.842   9.212   1.00 0.00 ? 4  ASP A CA   1  
ATOM 48    C C    . ASP A 1 4  ? 19.332  4.747   8.180   1.00 0.00 ? 4  ASP A C    1  
ATOM 49    O O    . ASP A 1 4  ? 18.257  4.147   8.152   1.00 0.00 ? 4  ASP A O    1  
ATOM 50    C CB   . ASP A 1 4  ? 18.904  7.138   8.784   1.00 0.00 ? 4  ASP A CB   1  
ATOM 51    C CG   . ASP A 1 4  ? 17.869  7.606   9.789   1.00 0.00 ? 4  ASP A CG   1  
ATOM 52    O OD1  . ASP A 1 4  ? 16.746  7.061   9.782   1.00 0.00 ? 4  ASP A OD1  1  
ATOM 53    O OD2  . ASP A 1 4  ? 18.183  8.518   10.583  1.00 0.00 ? 4  ASP A OD2  1  
ATOM 54    H H    . ASP A 1 4  ? 21.402  6.930   9.160   1.00 0.00 ? 4  ASP A H    1  
ATOM 55    H HA   . ASP A 1 4  ? 19.178  5.530   10.154  1.00 0.00 ? 4  ASP A HA   1  
ATOM 56    H HB2  . ASP A 1 4  ? 19.649  7.910   8.679   1.00 0.00 ? 4  ASP A HB2  1  
ATOM 57    H HB3  . ASP A 1 4  ? 18.414  6.983   7.837   1.00 0.00 ? 4  ASP A HB3  1  
ATOM 58    N N    . ALA A 1 5  ? 20.323  4.494   7.332   1.00 0.00 ? 5  ALA A N    1  
ATOM 59    C CA   . ALA A 1 5  ? 20.206  3.478   6.300   1.00 0.00 ? 5  ALA A CA   1  
ATOM 60    C C    . ALA A 1 5  ? 20.767  2.138   6.768   1.00 0.00 ? 5  ALA A C    1  
ATOM 61    O O    . ALA A 1 5  ? 21.167  1.305   5.954   1.00 0.00 ? 5  ALA A O    1  
ATOM 62    C CB   . ALA A 1 5  ? 20.911  3.933   5.031   1.00 0.00 ? 5  ALA A CB   1  
ATOM 63    H H    . ALA A 1 5  ? 21.149  5.003   7.400   1.00 0.00 ? 5  ALA A H    1  
ATOM 64    H HA   . ALA A 1 5  ? 19.161  3.362   6.078   1.00 0.00 ? 5  ALA A HA   1  
ATOM 65    H HB1  . ALA A 1 5  ? 20.689  4.974   4.850   1.00 0.00 ? 5  ALA A HB1  1  
ATOM 66    H HB2  . ALA A 1 5  ? 20.567  3.340   4.196   1.00 0.00 ? 5  ALA A HB2  1  
ATOM 67    H HB3  . ALA A 1 5  ? 21.977  3.807   5.147   1.00 0.00 ? 5  ALA A HB3  1  
ATOM 68    N N    . GLU A 1 6  ? 20.799  1.933   8.082   1.00 0.00 ? 6  GLU A N    1  
ATOM 69    C CA   . GLU A 1 6  ? 21.313  0.697   8.651   1.00 0.00 ? 6  GLU A CA   1  
ATOM 70    C C    . GLU A 1 6  ? 20.194  -0.277  8.973   1.00 0.00 ? 6  GLU A C    1  
ATOM 71    O O    . GLU A 1 6  ? 20.359  -1.207  9.763   1.00 0.00 ? 6  GLU A O    1  
ATOM 72    C CB   . GLU A 1 6  ? 22.105  0.993   9.911   1.00 0.00 ? 6  GLU A CB   1  
ATOM 73    C CG   . GLU A 1 6  ? 23.538  1.426   9.650   1.00 0.00 ? 6  GLU A CG   1  
ATOM 74    C CD   . GLU A 1 6  ? 24.246  1.885   10.910  1.00 0.00 ? 6  GLU A CD   1  
ATOM 75    O OE1  . GLU A 1 6  ? 24.115  1.201   11.947  1.00 0.00 ? 6  GLU A OE1  1  
ATOM 76    O OE2  . GLU A 1 6  ? 24.932  2.928   10.859  1.00 0.00 ? 6  GLU A OE2  1  
ATOM 77    H H    . GLU A 1 6  ? 20.473  2.627   8.681   1.00 0.00 ? 6  GLU A H    1  
ATOM 78    H HA   . GLU A 1 6  ? 21.950  0.254   7.921   1.00 0.00 ? 6  GLU A HA   1  
ATOM 79    H HB2  . GLU A 1 6  ? 21.600  1.781   10.446  1.00 0.00 ? 6  GLU A HB2  1  
ATOM 80    H HB3  . GLU A 1 6  ? 22.120  0.106   10.523  1.00 0.00 ? 6  GLU A HB3  1  
ATOM 81    H HG2  . GLU A 1 6  ? 24.083  0.593   9.233   1.00 0.00 ? 6  GLU A HG2  1  
ATOM 82    H HG3  . GLU A 1 6  ? 23.531  2.242   8.941   1.00 0.00 ? 6  GLU A HG3  1  
ATOM 83    N N    . GLY A 1 7  ? 19.063  -0.047  8.351   1.00 0.00 ? 7  GLY A N    1  
ATOM 84    C CA   . GLY A 1 7  ? 17.901  -0.893  8.555   1.00 0.00 ? 7  GLY A CA   1  
ATOM 85    C C    . GLY A 1 7  ? 17.494  -0.982  10.014  1.00 0.00 ? 7  GLY A C    1  
ATOM 86    O O    . GLY A 1 7  ? 17.129  -2.053  10.498  1.00 0.00 ? 7  GLY A O    1  
ATOM 87    H H    . GLY A 1 7  ? 19.021  0.710   7.744   1.00 0.00 ? 7  GLY A H    1  
ATOM 88    H HA2  . GLY A 1 7  ? 17.074  -0.493  7.987   1.00 0.00 ? 7  GLY A HA2  1  
ATOM 89    H HA3  . GLY A 1 7  ? 18.125  -1.886  8.194   1.00 0.00 ? 7  GLY A HA3  1  
ATOM 90    N N    . VAL A 1 8  ? 17.557  0.145   10.715  1.00 0.00 ? 8  VAL A N    1  
ATOM 91    C CA   . VAL A 1 8  ? 17.193  0.188   12.125  1.00 0.00 ? 8  VAL A CA   1  
ATOM 92    C C    . VAL A 1 8  ? 15.735  -0.212  12.331  1.00 0.00 ? 8  VAL A C    1  
ATOM 93    O O    . VAL A 1 8  ? 15.355  -0.685  13.402  1.00 0.00 ? 8  VAL A O    1  
ATOM 94    C CB   . VAL A 1 8  ? 17.426  1.590   12.724  1.00 0.00 ? 8  VAL A CB   1  
ATOM 95    C CG1  . VAL A 1 8  ? 16.566  2.627   12.017  1.00 0.00 ? 8  VAL A CG1  1  
ATOM 96    C CG2  . VAL A 1 8  ? 17.149  1.587   14.221  1.00 0.00 ? 8  VAL A CG2  1  
ATOM 97    H H    . VAL A 1 8  ? 17.856  0.967   10.273  1.00 0.00 ? 8  VAL A H    1  
ATOM 98    H HA   . VAL A 1 8  ? 17.821  -0.513  12.649  1.00 0.00 ? 8  VAL A HA   1  
ATOM 99    H HB   . VAL A 1 8  ? 18.463  1.854   12.574  1.00 0.00 ? 8  VAL A HB   1  
ATOM 100   H HG11 . VAL A 1 8  ? 16.996  2.853   11.052  1.00 0.00 ? 8  VAL A HG11 1  
ATOM 101   H HG12 . VAL A 1 8  ? 16.525  3.527   12.613  1.00 0.00 ? 8  VAL A HG12 1  
ATOM 102   H HG13 . VAL A 1 8  ? 15.568  2.237   11.884  1.00 0.00 ? 8  VAL A HG13 1  
ATOM 103   H HG21 . VAL A 1 8  ? 16.129  1.892   14.399  1.00 0.00 ? 8  VAL A HG21 1  
ATOM 104   H HG22 . VAL A 1 8  ? 17.822  2.274   14.713  1.00 0.00 ? 8  VAL A HG22 1  
ATOM 105   H HG23 . VAL A 1 8  ? 17.301  0.592   14.613  1.00 0.00 ? 8  VAL A HG23 1  
ATOM 106   N N    . TRP A 1 9  ? 14.926  -0.018  11.298  1.00 0.00 ? 9  TRP A N    1  
ATOM 107   C CA   . TRP A 1 9  ? 13.512  -0.356  11.360  1.00 0.00 ? 9  TRP A CA   1  
ATOM 108   C C    . TRP A 1 9  ? 13.312  -1.868  11.384  1.00 0.00 ? 9  TRP A C    1  
ATOM 109   O O    . TRP A 1 9  ? 14.015  -2.608  10.696  1.00 0.00 ? 9  TRP A O    1  
ATOM 110   C CB   . TRP A 1 9  ? 12.770  0.253   10.171  1.00 0.00 ? 9  TRP A CB   1  
ATOM 111   C CG   . TRP A 1 9  ? 11.719  1.243   10.570  1.00 0.00 ? 9  TRP A CG   1  
ATOM 112   C CD1  . TRP A 1 9  ? 10.494  1.415   9.992   1.00 0.00 ? 9  TRP A CD1  1  
ATOM 113   C CD2  . TRP A 1 9  ? 11.800  2.200   11.633  1.00 0.00 ? 9  TRP A CD2  1  
ATOM 114   N NE1  . TRP A 1 9  ? 9.808   2.419   10.631  1.00 0.00 ? 9  TRP A NE1  1  
ATOM 115   C CE2  . TRP A 1 9  ? 10.588  2.917   11.641  1.00 0.00 ? 9  TRP A CE2  1  
ATOM 116   C CE3  . TRP A 1 9  ? 12.779  2.519   12.578  1.00 0.00 ? 9  TRP A CE3  1  
ATOM 117   C CZ2  . TRP A 1 9  ? 10.331  3.933   12.559  1.00 0.00 ? 9  TRP A CZ2  1  
ATOM 118   C CZ3  . TRP A 1 9  ? 12.522  3.528   13.488  1.00 0.00 ? 9  TRP A CZ3  1  
ATOM 119   C CH2  . TRP A 1 9  ? 11.307  4.224   13.473  1.00 0.00 ? 9  TRP A CH2  1  
ATOM 120   H H    . TRP A 1 9  ? 15.290  0.362   10.476  1.00 0.00 ? 9  TRP A H    1  
ATOM 121   H HA   . TRP A 1 9  ? 13.114  0.062   12.265  1.00 0.00 ? 9  TRP A HA   1  
ATOM 122   H HB2  . TRP A 1 9  ? 13.480  0.759   9.538   1.00 0.00 ? 9  TRP A HB2  1  
ATOM 123   H HB3  . TRP A 1 9  ? 12.292  -0.536  9.613   1.00 0.00 ? 9  TRP A HB3  1  
ATOM 124   H HD1  . TRP A 1 9  ? 10.130  0.838   9.155   1.00 0.00 ? 9  TRP A HD1  1  
ATOM 125   H HE1  . TRP A 1 9  ? 8.907   2.729   10.401  1.00 0.00 ? 9  TRP A HE1  1  
ATOM 126   H HE3  . TRP A 1 9  ? 13.721  1.994   12.605  1.00 0.00 ? 9  TRP A HE3  1  
ATOM 127   H HZ2  . TRP A 1 9  ? 9.399   4.479   12.561  1.00 0.00 ? 9  TRP A HZ2  1  
ATOM 128   H HZ3  . TRP A 1 9  ? 13.266  3.789   14.225  1.00 0.00 ? 9  TRP A HZ3  1  
ATOM 129   H HH2  . TRP A 1 9  ? 11.150  5.005   14.202  1.00 0.00 ? 9  TRP A HH2  1  
ATOM 130   N N    . SER A 1 10 ? 12.349  -2.321  12.180  1.00 0.00 ? 10 SER A N    1  
ATOM 131   C CA   . SER A 1 10 ? 12.058  -3.746  12.291  1.00 0.00 ? 10 SER A CA   1  
ATOM 132   C C    . SER A 1 10 ? 11.648  -4.323  10.938  1.00 0.00 ? 10 SER A C    1  
ATOM 133   O O    . SER A 1 10 ? 10.967  -3.662  10.154  1.00 0.00 ? 10 SER A O    1  
ATOM 134   C CB   . SER A 1 10 ? 10.949  -3.983  13.317  1.00 0.00 ? 10 SER A CB   1  
ATOM 135   O OG   . SER A 1 10 ? 10.409  -5.288  13.193  1.00 0.00 ? 10 SER A OG   1  
ATOM 136   H H    . SER A 1 10 ? 11.821  -1.683  12.704  1.00 0.00 ? 10 SER A H    1  
ATOM 137   H HA   . SER A 1 10 ? 12.957  -4.241  12.625  1.00 0.00 ? 10 SER A HA   1  
ATOM 138   H HB2  . SER A 1 10 ? 11.351  -3.867  14.313  1.00 0.00 ? 10 SER A HB2  1  
ATOM 139   H HB3  . SER A 1 10 ? 10.158  -3.263  13.162  1.00 0.00 ? 10 SER A HB3  1  
ATOM 140   H HG   . SER A 1 10 ? 9.482   -5.276  13.441  1.00 0.00 ? 10 SER A HG   1  
ATOM 141   N N    . PRO A 1 11 ? 12.060  -5.569  10.643  1.00 0.00 ? 11 PRO A N    1  
ATOM 142   C CA   . PRO A 1 11 ? 11.731  -6.229  9.375   1.00 0.00 ? 11 PRO A CA   1  
ATOM 143   C C    . PRO A 1 11 ? 10.262  -6.620  9.282   1.00 0.00 ? 11 PRO A C    1  
ATOM 144   O O    . PRO A 1 11 ? 9.730   -6.821  8.190   1.00 0.00 ? 11 PRO A O    1  
ATOM 145   C CB   . PRO A 1 11 ? 12.618  -7.472  9.382   1.00 0.00 ? 11 PRO A CB   1  
ATOM 146   C CG   . PRO A 1 11 ? 12.833  -7.765  10.822  1.00 0.00 ? 11 PRO A CG   1  
ATOM 147   C CD   . PRO A 1 11 ? 12.877  -6.432  11.516  1.00 0.00 ? 11 PRO A CD   1  
ATOM 148   H HA   . PRO A 1 11 ? 11.987  -5.611  8.538   1.00 0.00 ? 11 PRO A HA   1  
ATOM 149   H HB2  . PRO A 1 11 ? 12.109  -8.284  8.882   1.00 0.00 ? 11 PRO A HB2  1  
ATOM 150   H HB3  . PRO A 1 11 ? 13.549  -7.257  8.880   1.00 0.00 ? 11 PRO A HB3  1  
ATOM 151   H HG2  . PRO A 1 11 ? 12.012  -8.355  11.198  1.00 0.00 ? 11 PRO A HG2  1  
ATOM 152   H HG3  . PRO A 1 11 ? 13.766  -8.288  10.954  1.00 0.00 ? 11 PRO A HG3  1  
ATOM 153   H HD2  . PRO A 1 11 ? 12.443  -6.505  12.502  1.00 0.00 ? 11 PRO A HD2  1  
ATOM 154   H HD3  . PRO A 1 11 ? 13.892  -6.070  11.574  1.00 0.00 ? 11 PRO A HD3  1  
ATOM 155   N N    . ASP A 1 12 ? 9.612   -6.726  10.433  1.00 0.00 ? 12 ASP A N    1  
ATOM 156   C CA   . ASP A 1 12 ? 8.204   -7.093  10.484  1.00 0.00 ? 12 ASP A CA   1  
ATOM 157   C C    . ASP A 1 12 ? 7.324   -5.963  9.966   1.00 0.00 ? 12 ASP A C    1  
ATOM 158   O O    . ASP A 1 12 ? 6.208   -6.193  9.502   1.00 0.00 ? 12 ASP A O    1  
ATOM 159   C CB   . ASP A 1 12 ? 7.802   -7.460  11.911  1.00 0.00 ? 12 ASP A CB   1  
ATOM 160   C CG   . ASP A 1 12 ? 7.480   -8.934  12.062  1.00 0.00 ? 12 ASP A CG   1  
ATOM 161   O OD1  . ASP A 1 12 ? 6.320   -9.318  11.806  1.00 0.00 ? 12 ASP A OD1  1  
ATOM 162   O OD2  . ASP A 1 12 ? 8.389   -9.704  12.437  1.00 0.00 ? 12 ASP A OD2  1  
ATOM 163   H H    . ASP A 1 12 ? 10.091  -6.554  11.266  1.00 0.00 ? 12 ASP A H    1  
ATOM 164   H HA   . ASP A 1 12 ? 8.070   -7.949  9.855   1.00 0.00 ? 12 ASP A HA   1  
ATOM 165   H HB2  . ASP A 1 12 ? 8.614   -7.219  12.573  1.00 0.00 ? 12 ASP A HB2  1  
ATOM 166   H HB3  . ASP A 1 12 ? 6.930   -6.888  12.193  1.00 0.00 ? 12 ASP A HB3  1  
ATOM 167   N N    . ILE A 1 13 ? 7.837   -4.743  10.044  1.00 0.00 ? 13 ILE A N    1  
ATOM 168   C CA   . ILE A 1 13 ? 7.104   -3.578  9.579   1.00 0.00 ? 13 ILE A CA   1  
ATOM 169   C C    . ILE A 1 13 ? 7.162   -3.482  8.068   1.00 0.00 ? 13 ILE A C    1  
ATOM 170   O O    . ILE A 1 13 ? 6.147   -3.276  7.402   1.00 0.00 ? 13 ILE A O    1  
ATOM 171   C CB   . ILE A 1 13 ? 7.644   -2.282  10.192  1.00 0.00 ? 13 ILE A CB   1  
ATOM 172   C CG1  . ILE A 1 13 ? 7.882   -2.453  11.693  1.00 0.00 ? 13 ILE A CG1  1  
ATOM 173   C CG2  . ILE A 1 13 ? 6.686   -1.130  9.926   1.00 0.00 ? 13 ILE A CG2  1  
ATOM 174   C CD1  . ILE A 1 13 ? 6.633   -2.820  12.465  1.00 0.00 ? 13 ILE A CD1  1  
ATOM 175   H H    . ILE A 1 13 ? 8.730   -4.626  10.417  1.00 0.00 ? 13 ILE A H    1  
ATOM 176   H HA   . ILE A 1 13 ? 6.092   -3.689  9.876   1.00 0.00 ? 13 ILE A HA   1  
ATOM 177   H HB   . ILE A 1 13 ? 8.571   -2.061  9.711   1.00 0.00 ? 13 ILE A HB   1  
ATOM 178   H HG12 . ILE A 1 13 ? 8.608   -3.236  11.849  1.00 0.00 ? 13 ILE A HG12 1  
ATOM 179   H HG13 . ILE A 1 13 ? 8.263   -1.528  12.099  1.00 0.00 ? 13 ILE A HG13 1  
ATOM 180   H HG21 . ILE A 1 13 ? 5.728   -1.348  10.375  1.00 0.00 ? 13 ILE A HG21 1  
ATOM 181   H HG22 . ILE A 1 13 ? 6.564   -1.002  8.861   1.00 0.00 ? 13 ILE A HG22 1  
ATOM 182   H HG23 . ILE A 1 13 ? 7.087   -0.223  10.354  1.00 0.00 ? 13 ILE A HG23 1  
ATOM 183   H HD11 . ILE A 1 13 ? 6.633   -3.881  12.667  1.00 0.00 ? 13 ILE A HD11 1  
ATOM 184   H HD12 . ILE A 1 13 ? 5.761   -2.565  11.880  1.00 0.00 ? 13 ILE A HD12 1  
ATOM 185   H HD13 . ILE A 1 13 ? 6.613   -2.276  13.397  1.00 0.00 ? 13 ILE A HD13 1  
ATOM 186   N N    . GLU A 1 14 ? 8.358   -3.653  7.535   1.00 0.00 ? 14 GLU A N    1  
ATOM 187   C CA   . GLU A 1 14 ? 8.565   -3.611  6.098   1.00 0.00 ? 14 GLU A CA   1  
ATOM 188   C C    . GLU A 1 14 ? 7.907   -4.815  5.440   1.00 0.00 ? 14 GLU A C    1  
ATOM 189   O O    . GLU A 1 14 ? 7.556   -4.780  4.261   1.00 0.00 ? 14 GLU A O    1  
ATOM 190   C CB   . GLU A 1 14 ? 10.059  -3.579  5.771   1.00 0.00 ? 14 GLU A CB   1  
ATOM 191   C CG   . GLU A 1 14 ? 10.695  -2.211  5.960   1.00 0.00 ? 14 GLU A CG   1  
ATOM 192   C CD   . GLU A 1 14 ? 11.789  -1.932  4.949   1.00 0.00 ? 14 GLU A CD   1  
ATOM 193   O OE1  . GLU A 1 14 ? 12.939  -2.358  5.186   1.00 0.00 ? 14 GLU A OE1  1  
ATOM 194   O OE2  . GLU A 1 14 ? 11.496  -1.288  3.920   1.00 0.00 ? 14 GLU A OE2  1  
ATOM 195   H H    . GLU A 1 14 ? 9.116   -3.827  8.124   1.00 0.00 ? 14 GLU A H    1  
ATOM 196   H HA   . GLU A 1 14 ? 8.100   -2.715  5.726   1.00 0.00 ? 14 GLU A HA   1  
ATOM 197   H HB2  . GLU A 1 14 ? 10.571  -4.282  6.411   1.00 0.00 ? 14 GLU A HB2  1  
ATOM 198   H HB3  . GLU A 1 14 ? 10.197  -3.877  4.742   1.00 0.00 ? 14 GLU A HB3  1  
ATOM 199   H HG2  . GLU A 1 14 ? 9.930   -1.456  5.857   1.00 0.00 ? 14 GLU A HG2  1  
ATOM 200   H HG3  . GLU A 1 14 ? 11.119  -2.160  6.952   1.00 0.00 ? 14 GLU A HG3  1  
ATOM 201   N N    . GLN A 1 15 ? 7.735   -5.879  6.218   1.00 0.00 ? 15 GLN A N    1  
ATOM 202   C CA   . GLN A 1 15 ? 7.111   -7.091  5.726   1.00 0.00 ? 15 GLN A CA   1  
ATOM 203   C C    . GLN A 1 15 ? 5.610   -6.910  5.616   1.00 0.00 ? 15 GLN A C    1  
ATOM 204   O O    . GLN A 1 15 ? 4.987   -7.325  4.639   1.00 0.00 ? 15 GLN A O    1  
ATOM 205   C CB   . GLN A 1 15 ? 7.440   -8.254  6.637   1.00 0.00 ? 15 GLN A CB   1  
ATOM 206   C CG   . GLN A 1 15 ? 8.632   -9.051  6.156   1.00 0.00 ? 15 GLN A CG   1  
ATOM 207   C CD   . GLN A 1 15 ? 8.263   -10.087 5.112   1.00 0.00 ? 15 GLN A CD   1  
ATOM 208   O OE1  . GLN A 1 15 ? 7.643   -9.769  4.097   1.00 0.00 ? 15 GLN A OE1  1  
ATOM 209   N NE2  . GLN A 1 15 ? 8.643   -11.336 5.358   1.00 0.00 ? 15 GLN A NE2  1  
ATOM 210   H H    . GLN A 1 15 ? 8.029   -5.843  7.149   1.00 0.00 ? 15 GLN A H    1  
ATOM 211   H HA   . GLN A 1 15 ? 7.512   -7.293  4.763   1.00 0.00 ? 15 GLN A HA   1  
ATOM 212   H HB2  . GLN A 1 15 ? 7.662   -7.869  7.615   1.00 0.00 ? 15 GLN A HB2  1  
ATOM 213   H HB3  . GLN A 1 15 ? 6.588   -8.912  6.697   1.00 0.00 ? 15 GLN A HB3  1  
ATOM 214   H HG2  . GLN A 1 15 ? 9.353   -8.370  5.729   1.00 0.00 ? 15 GLN A HG2  1  
ATOM 215   H HG3  . GLN A 1 15 ? 9.070   -9.548  6.997   1.00 0.00 ? 15 GLN A HG3  1  
ATOM 216   H HE21 . GLN A 1 15 ? 9.133   -11.516 6.187   1.00 0.00 ? 15 GLN A HE21 1  
ATOM 217   H HE22 . GLN A 1 15 ? 8.417   -12.026 4.699   1.00 0.00 ? 15 GLN A HE22 1  
ATOM 218   N N    . SER A 1 16 ? 5.043   -6.268  6.623   1.00 0.00 ? 16 SER A N    1  
ATOM 219   C CA   . SER A 1 16 ? 3.615   -6.002  6.650   1.00 0.00 ? 16 SER A CA   1  
ATOM 220   C C    . SER A 1 16 ? 3.239   -5.035  5.534   1.00 0.00 ? 16 SER A C    1  
ATOM 221   O O    . SER A 1 16 ? 2.087   -4.982  5.103   1.00 0.00 ? 16 SER A O    1  
ATOM 222   C CB   . SER A 1 16 ? 3.203   -5.425  8.005   1.00 0.00 ? 16 SER A CB   1  
ATOM 223   O OG   . SER A 1 16 ? 3.756   -6.180  9.070   1.00 0.00 ? 16 SER A OG   1  
ATOM 224   H H    . SER A 1 16 ? 5.604   -5.955  7.359   1.00 0.00 ? 16 SER A H    1  
ATOM 225   H HA   . SER A 1 16 ? 3.102   -6.935  6.491   1.00 0.00 ? 16 SER A HA   1  
ATOM 226   H HB2  . SER A 1 16 ? 3.556   -4.407  8.083   1.00 0.00 ? 16 SER A HB2  1  
ATOM 227   H HB3  . SER A 1 16 ? 2.127   -5.441  8.089   1.00 0.00 ? 16 SER A HB3  1  
ATOM 228   H HG   . SER A 1 16 ? 3.465   -5.812  9.908   1.00 0.00 ? 16 SER A HG   1  
ATOM 229   N N    . PHE A 1 17 ? 4.225   -4.273  5.069   1.00 0.00 ? 17 PHE A N    1  
ATOM 230   C CA   . PHE A 1 17 ? 4.010   -3.310  4.002   1.00 0.00 ? 17 PHE A CA   1  
ATOM 231   C C    . PHE A 1 17 ? 3.785   -4.014  2.676   1.00 0.00 ? 17 PHE A C    1  
ATOM 232   O O    . PHE A 1 17 ? 2.907   -3.637  1.900   1.00 0.00 ? 17 PHE A O    1  
ATOM 233   C CB   . PHE A 1 17 ? 5.197   -2.355  3.902   1.00 0.00 ? 17 PHE A CB   1  
ATOM 234   C CG   . PHE A 1 17 ? 4.880   -0.952  4.335   1.00 0.00 ? 17 PHE A CG   1  
ATOM 235   C CD1  . PHE A 1 17 ? 4.387   -0.700  5.605   1.00 0.00 ? 17 PHE A CD1  1  
ATOM 236   C CD2  . PHE A 1 17 ? 5.078   0.115   3.473   1.00 0.00 ? 17 PHE A CD2  1  
ATOM 237   C CE1  . PHE A 1 17 ? 4.098   0.589   6.008   1.00 0.00 ? 17 PHE A CE1  1  
ATOM 238   C CE2  . PHE A 1 17 ? 4.790   1.407   3.870   1.00 0.00 ? 17 PHE A CE2  1  
ATOM 239   C CZ   . PHE A 1 17 ? 4.299   1.644   5.140   1.00 0.00 ? 17 PHE A CZ   1  
ATOM 240   H H    . PHE A 1 17 ? 5.120   -4.364  5.452   1.00 0.00 ? 17 PHE A H    1  
ATOM 241   H HA   . PHE A 1 17 ? 3.133   -2.753  4.245   1.00 0.00 ? 17 PHE A HA   1  
ATOM 242   H HB2  . PHE A 1 17 ? 5.989   -2.721  4.530   1.00 0.00 ? 17 PHE A HB2  1  
ATOM 243   H HB3  . PHE A 1 17 ? 5.541   -2.319  2.878   1.00 0.00 ? 17 PHE A HB3  1  
ATOM 244   H HD1  . PHE A 1 17 ? 4.230   -1.524  6.285   1.00 0.00 ? 17 PHE A HD1  1  
ATOM 245   H HD2  . PHE A 1 17 ? 5.462   -0.070  2.481   1.00 0.00 ? 17 PHE A HD2  1  
ATOM 246   H HE1  . PHE A 1 17 ? 3.714   0.772   7.001   1.00 0.00 ? 17 PHE A HE1  1  
ATOM 247   H HE2  . PHE A 1 17 ? 4.949   2.229   3.189   1.00 0.00 ? 17 PHE A HE2  1  
ATOM 248   H HZ   . PHE A 1 17 ? 4.074   2.653   5.452   1.00 0.00 ? 17 PHE A HZ   1  
ATOM 249   N N    . GLN A 1 18 ? 4.575   -5.046  2.427   1.00 0.00 ? 18 GLN A N    1  
ATOM 250   C CA   . GLN A 1 18 ? 4.449   -5.809  1.196   1.00 0.00 ? 18 GLN A CA   1  
ATOM 251   C C    . GLN A 1 18 ? 3.145   -6.588  1.192   1.00 0.00 ? 18 GLN A C    1  
ATOM 252   O O    . GLN A 1 18 ? 2.559   -6.838  0.141   1.00 0.00 ? 18 GLN A O    1  
ATOM 253   C CB   . GLN A 1 18 ? 5.627   -6.767  1.016   1.00 0.00 ? 18 GLN A CB   1  
ATOM 254   C CG   . GLN A 1 18 ? 5.406   -7.791  -0.089  1.00 0.00 ? 18 GLN A CG   1  
ATOM 255   C CD   . GLN A 1 18 ? 6.688   -8.478  -0.517  1.00 0.00 ? 18 GLN A CD   1  
ATOM 256   O OE1  . GLN A 1 18 ? 7.679   -8.480  0.213   1.00 0.00 ? 18 GLN A OE1  1  
ATOM 257   N NE2  . GLN A 1 18 ? 6.675   -9.066  -1.707  1.00 0.00 ? 18 GLN A NE2  1  
ATOM 258   H H    . GLN A 1 18 ? 5.248   -5.301  3.089   1.00 0.00 ? 18 GLN A H    1  
ATOM 259   H HA   . GLN A 1 18 ? 4.435   -5.110  0.381   1.00 0.00 ? 18 GLN A HA   1  
ATOM 260   H HB2  . GLN A 1 18 ? 6.511   -6.194  0.776   1.00 0.00 ? 18 GLN A HB2  1  
ATOM 261   H HB3  . GLN A 1 18 ? 5.791   -7.298  1.942   1.00 0.00 ? 18 GLN A HB3  1  
ATOM 262   H HG2  . GLN A 1 18 ? 4.713   -8.541  0.267   1.00 0.00 ? 18 GLN A HG2  1  
ATOM 263   H HG3  . GLN A 1 18 ? 4.977   -7.290  -0.945  1.00 0.00 ? 18 GLN A HG3  1  
ATOM 264   H HE21 . GLN A 1 18 ? 5.850   -9.025  -2.235  1.00 0.00 ? 18 GLN A HE21 1  
ATOM 265   H HE22 . GLN A 1 18 ? 7.490   -9.518  -2.009  1.00 0.00 ? 18 GLN A HE22 1  
ATOM 266   N N    . GLU A 1 19 ? 2.699   -6.970  2.378   1.00 0.00 ? 19 GLU A N    1  
ATOM 267   C CA   . GLU A 1 19 ? 1.465   -7.720  2.515   1.00 0.00 ? 19 GLU A CA   1  
ATOM 268   C C    . GLU A 1 19 ? 0.273   -6.853  2.153   1.00 0.00 ? 19 GLU A C    1  
ATOM 269   O O    . GLU A 1 19 ? -0.720  -7.338  1.615   1.00 0.00 ? 19 GLU A O    1  
ATOM 270   C CB   . GLU A 1 19 ? 1.321   -8.266  3.933   1.00 0.00 ? 19 GLU A CB   1  
ATOM 271   C CG   . GLU A 1 19 ? 1.254   -9.783  3.998   1.00 0.00 ? 19 GLU A CG   1  
ATOM 272   C CD   . GLU A 1 19 ? 0.019   -10.341 3.318   1.00 0.00 ? 19 GLU A CD   1  
ATOM 273   O OE1  . GLU A 1 19 ? -0.432  -9.740  2.320   1.00 0.00 ? 19 GLU A OE1  1  
ATOM 274   O OE2  . GLU A 1 19 ? -0.497  -11.379 3.783   1.00 0.00 ? 19 GLU A OE2  1  
ATOM 275   H H    . GLU A 1 19 ? 3.212   -6.741  3.176   1.00 0.00 ? 19 GLU A H    1  
ATOM 276   H HA   . GLU A 1 19 ? 1.507   -8.539  1.828   1.00 0.00 ? 19 GLU A HA   1  
ATOM 277   H HB2  . GLU A 1 19 ? 2.167   -7.940  4.517   1.00 0.00 ? 19 GLU A HB2  1  
ATOM 278   H HB3  . GLU A 1 19 ? 0.419   -7.869  4.368   1.00 0.00 ? 19 GLU A HB3  1  
ATOM 279   H HG2  . GLU A 1 19 ? 2.128   -10.190 3.512   1.00 0.00 ? 19 GLU A HG2  1  
ATOM 280   H HG3  . GLU A 1 19 ? 1.244   -10.086 5.035   1.00 0.00 ? 19 GLU A HG3  1  
ATOM 281   N N    . ALA A 1 20 ? 0.385   -5.566  2.437   1.00 0.00 ? 20 ALA A N    1  
ATOM 282   C CA   . ALA A 1 20 ? -0.678  -4.630  2.125   1.00 0.00 ? 20 ALA A CA   1  
ATOM 283   C C    . ALA A 1 20 ? -0.572  -4.173  0.680   1.00 0.00 ? 20 ALA A C    1  
ATOM 284   O O    . ALA A 1 20 ? -1.577  -3.878  0.032   1.00 0.00 ? 20 ALA A O    1  
ATOM 285   C CB   . ALA A 1 20 ? -0.643  -3.442  3.074   1.00 0.00 ? 20 ALA A CB   1  
ATOM 286   H H    . ALA A 1 20 ? 1.203   -5.239  2.855   1.00 0.00 ? 20 ALA A H    1  
ATOM 287   H HA   . ALA A 1 20 ? -1.609  -5.145  2.256   1.00 0.00 ? 20 ALA A HA   1  
ATOM 288   H HB1  . ALA A 1 20 ? -0.170  -2.603  2.585   1.00 0.00 ? 20 ALA A HB1  1  
ATOM 289   H HB2  . ALA A 1 20 ? -0.083  -3.704  3.960   1.00 0.00 ? 20 ALA A HB2  1  
ATOM 290   H HB3  . ALA A 1 20 ? -1.652  -3.174  3.353   1.00 0.00 ? 20 ALA A HB3  1  
ATOM 291   N N    . LEU A 1 21 ? 0.653   -4.134  0.180   1.00 0.00 ? 21 LEU A N    1  
ATOM 292   C CA   . LEU A 1 21 ? 0.904   -3.735  -1.192  1.00 0.00 ? 21 LEU A CA   1  
ATOM 293   C C    . LEU A 1 21 ? 0.680   -4.911  -2.131  1.00 0.00 ? 21 LEU A C    1  
ATOM 294   O O    . LEU A 1 21 ? 0.309   -4.734  -3.292  1.00 0.00 ? 21 LEU A O    1  
ATOM 295   C CB   . LEU A 1 21 ? 2.324   -3.193  -1.341  1.00 0.00 ? 21 LEU A CB   1  
ATOM 296   C CG   . LEU A 1 21 ? 2.415   -1.721  -1.746  1.00 0.00 ? 21 LEU A CG   1  
ATOM 297   C CD1  . LEU A 1 21 ? 1.935   -1.530  -3.177  1.00 0.00 ? 21 LEU A CD1  1  
ATOM 298   C CD2  . LEU A 1 21 ? 1.607   -0.855  -0.791  1.00 0.00 ? 21 LEU A CD2  1  
ATOM 299   H H    . LEU A 1 21 ? 1.404   -4.391  0.744   1.00 0.00 ? 21 LEU A H    1  
ATOM 300   H HA   . LEU A 1 21 ? 0.208   -2.961  -1.434  1.00 0.00 ? 21 LEU A HA   1  
ATOM 301   H HB2  . LEU A 1 21 ? 2.831   -3.317  -0.398  1.00 0.00 ? 21 LEU A HB2  1  
ATOM 302   H HB3  . LEU A 1 21 ? 2.836   -3.780  -2.087  1.00 0.00 ? 21 LEU A HB3  1  
ATOM 303   H HG   . LEU A 1 21 ? 3.446   -1.403  -1.695  1.00 0.00 ? 21 LEU A HG   1  
ATOM 304   H HD11 . LEU A 1 21 ? 2.781   -1.561  -3.847  1.00 0.00 ? 21 LEU A HD11 1  
ATOM 305   H HD12 . LEU A 1 21 ? 1.440   -0.574  -3.266  1.00 0.00 ? 21 LEU A HD12 1  
ATOM 306   H HD13 . LEU A 1 21 ? 1.243   -2.319  -3.433  1.00 0.00 ? 21 LEU A HD13 1  
ATOM 307   H HD21 . LEU A 1 21 ? 0.565   -0.881  -1.075  1.00 0.00 ? 21 LEU A HD21 1  
ATOM 308   H HD22 . LEU A 1 21 ? 1.967   0.162   -0.834  1.00 0.00 ? 21 LEU A HD22 1  
ATOM 309   H HD23 . LEU A 1 21 ? 1.714   -1.232  0.216   1.00 0.00 ? 21 LEU A HD23 1  
ATOM 310   N N    . SER A 1 22 ? 0.895   -6.116  -1.613  1.00 0.00 ? 22 SER A N    1  
ATOM 311   C CA   . SER A 1 22 ? 0.705   -7.325  -2.392  1.00 0.00 ? 22 SER A CA   1  
ATOM 312   C C    . SER A 1 22 ? -0.775  -7.657  -2.482  1.00 0.00 ? 22 SER A C    1  
ATOM 313   O O    . SER A 1 22 ? -1.256  -8.159  -3.497  1.00 0.00 ? 22 SER A O    1  
ATOM 314   C CB   . SER A 1 22 ? 1.472   -8.493  -1.769  1.00 0.00 ? 22 SER A CB   1  
ATOM 315   O OG   . SER A 1 22 ? 1.268   -9.688  -2.503  1.00 0.00 ? 22 SER A OG   1  
ATOM 316   H H    . SER A 1 22 ? 1.179   -6.191  -0.681  1.00 0.00 ? 22 SER A H    1  
ATOM 317   H HA   . SER A 1 22 ? 1.080   -7.141  -3.378  1.00 0.00 ? 22 SER A HA   1  
ATOM 318   H HB2  . SER A 1 22 ? 2.527   -8.266  -1.763  1.00 0.00 ? 22 SER A HB2  1  
ATOM 319   H HB3  . SER A 1 22 ? 1.131   -8.645  -0.755  1.00 0.00 ? 22 SER A HB3  1  
ATOM 320   H HG   . SER A 1 22 ? 1.983   -9.803  -3.132  1.00 0.00 ? 22 SER A HG   1  
ATOM 321   N N    . ILE A 1 23 ? -1.490  -7.360  -1.406  1.00 0.00 ? 23 ILE A N    1  
ATOM 322   C CA   . ILE A 1 23 ? -2.922  -7.610  -1.346  1.00 0.00 ? 23 ILE A CA   1  
ATOM 323   C C    . ILE A 1 23 ? -3.687  -6.523  -2.088  1.00 0.00 ? 23 ILE A C    1  
ATOM 324   O O    . ILE A 1 23 ? -4.701  -6.783  -2.736  1.00 0.00 ? 23 ILE A O    1  
ATOM 325   C CB   . ILE A 1 23 ? -3.414  -7.700  0.117   1.00 0.00 ? 23 ILE A CB   1  
ATOM 326   C CG1  . ILE A 1 23 ? -4.398  -8.860  0.278   1.00 0.00 ? 23 ILE A CG1  1  
ATOM 327   C CG2  . ILE A 1 23 ? -4.047  -6.393  0.579   1.00 0.00 ? 23 ILE A CG2  1  
ATOM 328   C CD1  . ILE A 1 23 ? -3.729  -10.180 0.593   1.00 0.00 ? 23 ILE A CD1  1  
ATOM 329   H H    . ILE A 1 23 ? -1.040  -6.957  -0.635  1.00 0.00 ? 23 ILE A H    1  
ATOM 330   H HA   . ILE A 1 23 ? -3.106  -8.551  -1.825  1.00 0.00 ? 23 ILE A HA   1  
ATOM 331   H HB   . ILE A 1 23 ? -2.556  -7.882  0.738   1.00 0.00 ? 23 ILE A HB   1  
ATOM 332   H HG12 . ILE A 1 23 ? -5.082  -8.635  1.082   1.00 0.00 ? 23 ILE A HG12 1  
ATOM 333   H HG13 . ILE A 1 23 ? -4.955  -8.980  -0.640  1.00 0.00 ? 23 ILE A HG13 1  
ATOM 334   H HG21 . ILE A 1 23 ? -4.199  -6.424  1.648   1.00 0.00 ? 23 ILE A HG21 1  
ATOM 335   H HG22 . ILE A 1 23 ? -4.997  -6.259  0.084   1.00 0.00 ? 23 ILE A HG22 1  
ATOM 336   H HG23 . ILE A 1 23 ? -3.393  -5.570  0.332   1.00 0.00 ? 23 ILE A HG23 1  
ATOM 337   H HD11 . ILE A 1 23 ? -4.477  -10.902 0.887   1.00 0.00 ? 23 ILE A HD11 1  
ATOM 338   H HD12 . ILE A 1 23 ? -3.024  -10.043 1.399   1.00 0.00 ? 23 ILE A HD12 1  
ATOM 339   H HD13 . ILE A 1 23 ? -3.209  -10.539 -0.283  1.00 0.00 ? 23 ILE A HD13 1  
ATOM 340   N N    . TYR A 1 24 ? -3.180  -5.305  -1.981  1.00 0.00 ? 24 TYR A N    1  
ATOM 341   C CA   . TYR A 1 24 ? -3.784  -4.153  -2.629  1.00 0.00 ? 24 TYR A CA   1  
ATOM 342   C C    . TYR A 1 24 ? -2.845  -3.555  -3.675  1.00 0.00 ? 24 TYR A C    1  
ATOM 343   O O    . TYR A 1 24 ? -2.110  -2.609  -3.391  1.00 0.00 ? 24 TYR A O    1  
ATOM 344   C CB   . TYR A 1 24 ? -4.155  -3.091  -1.605  1.00 0.00 ? 24 TYR A CB   1  
ATOM 345   C CG   . TYR A 1 24 ? -4.988  -3.608  -0.455  1.00 0.00 ? 24 TYR A CG   1  
ATOM 346   C CD1  . TYR A 1 24 ? -6.201  -4.245  -0.681  1.00 0.00 ? 24 TYR A CD1  1  
ATOM 347   C CD2  . TYR A 1 24 ? -4.560  -3.457  0.858   1.00 0.00 ? 24 TYR A CD2  1  
ATOM 348   C CE1  . TYR A 1 24 ? -6.965  -4.718  0.370   1.00 0.00 ? 24 TYR A CE1  1  
ATOM 349   C CE2  . TYR A 1 24 ? -5.316  -3.927  1.914   1.00 0.00 ? 24 TYR A CE2  1  
ATOM 350   C CZ   . TYR A 1 24 ? -6.518  -4.557  1.665   1.00 0.00 ? 24 TYR A CZ   1  
ATOM 351   O OH   . TYR A 1 24 ? -7.275  -5.027  2.713   1.00 0.00 ? 24 TYR A OH   1  
ATOM 352   H H    . TYR A 1 24 ? -2.377  -5.183  -1.449  1.00 0.00 ? 24 TYR A H    1  
ATOM 353   H HA   . TYR A 1 24 ? -4.670  -4.484  -3.110  1.00 0.00 ? 24 TYR A HA   1  
ATOM 354   H HB2  . TYR A 1 24 ? -3.255  -2.683  -1.201  1.00 0.00 ? 24 TYR A HB2  1  
ATOM 355   H HB3  . TYR A 1 24 ? -4.712  -2.307  -2.094  1.00 0.00 ? 24 TYR A HB3  1  
ATOM 356   H HD1  . TYR A 1 24 ? -6.547  -4.370  -1.696  1.00 0.00 ? 24 TYR A HD1  1  
ATOM 357   H HD2  . TYR A 1 24 ? -3.618  -2.963  1.049   1.00 0.00 ? 24 TYR A HD2  1  
ATOM 358   H HE1  . TYR A 1 24 ? -7.905  -5.211  0.174   1.00 0.00 ? 24 TYR A HE1  1  
ATOM 359   H HE2  . TYR A 1 24 ? -4.966  -3.799  2.927   1.00 0.00 ? 24 TYR A HE2  1  
ATOM 360   H HH   . TYR A 1 24 ? -7.201  -4.426  3.458   1.00 0.00 ? 24 TYR A HH   1  
ATOM 361   N N    . PRO A 1 25 ? -2.858  -4.098  -4.905  1.00 0.00 ? 25 PRO A N    1  
ATOM 362   C CA   . PRO A 1 25 ? -2.014  -3.620  -5.990  1.00 0.00 ? 25 PRO A CA   1  
ATOM 363   C C    . PRO A 1 25 ? -2.636  -2.436  -6.728  1.00 0.00 ? 25 PRO A C    1  
ATOM 364   O O    . PRO A 1 25 ? -3.775  -2.056  -6.459  1.00 0.00 ? 25 PRO A O    1  
ATOM 365   C CB   . PRO A 1 25 ? -1.897  -4.834  -6.922  1.00 0.00 ? 25 PRO A CB   1  
ATOM 366   C CG   . PRO A 1 25 ? -2.894  -5.847  -6.443  1.00 0.00 ? 25 PRO A CG   1  
ATOM 367   C CD   . PRO A 1 25 ? -3.695  -5.217  -5.336  1.00 0.00 ? 25 PRO A CD   1  
ATOM 368   H HA   . PRO A 1 25 ? -1.034  -3.344  -5.634  1.00 0.00 ? 25 PRO A HA   1  
ATOM 369   H HB2  . PRO A 1 25 ? -2.108  -4.530  -7.935  1.00 0.00 ? 25 PRO A HB2  1  
ATOM 370   H HB3  . PRO A 1 25 ? -0.894  -5.225  -6.867  1.00 0.00 ? 25 PRO A HB3  1  
ATOM 371   H HG2  . PRO A 1 25 ? -3.547  -6.125  -7.256  1.00 0.00 ? 25 PRO A HG2  1  
ATOM 372   H HG3  . PRO A 1 25 ? -2.373  -6.719  -6.074  1.00 0.00 ? 25 PRO A HG3  1  
ATOM 373   H HD2  . PRO A 1 25 ? -4.644  -4.866  -5.710  1.00 0.00 ? 25 PRO A HD2  1  
ATOM 374   H HD3  . PRO A 1 25 ? -3.839  -5.920  -4.532  1.00 0.00 ? 25 PRO A HD3  1  
ATOM 375   N N    . PRO A 1 26 ? -1.891  -1.836  -7.673  1.00 0.00 ? 26 PRO A N    1  
ATOM 376   C CA   . PRO A 1 26 ? -2.373  -0.689  -8.450  1.00 0.00 ? 26 PRO A CA   1  
ATOM 377   C C    . PRO A 1 26 ? -3.507  -1.057  -9.403  1.00 0.00 ? 26 PRO A C    1  
ATOM 378   O O    . PRO A 1 26 ? -4.155  -0.181  -9.977  1.00 0.00 ? 26 PRO A O    1  
ATOM 379   C CB   . PRO A 1 26 ? -1.140  -0.244  -9.235  1.00 0.00 ? 26 PRO A CB   1  
ATOM 380   C CG   . PRO A 1 26 ? -0.300  -1.465  -9.334  1.00 0.00 ? 26 PRO A CG   1  
ATOM 381   C CD   . PRO A 1 26 ? -0.522  -2.223  -8.057  1.00 0.00 ? 26 PRO A CD   1  
ATOM 382   H HA   . PRO A 1 26 ? -2.694  0.111   -7.807  1.00 0.00 ? 26 PRO A HA   1  
ATOM 383   H HB2  . PRO A 1 26 ? -1.439  0.112   -10.211 1.00 0.00 ? 26 PRO A HB2  1  
ATOM 384   H HB3  . PRO A 1 26 ? -0.631  0.542   -8.699  1.00 0.00 ? 26 PRO A HB3  1  
ATOM 385   H HG2  . PRO A 1 26 ? -0.615  -2.056  -10.179 1.00 0.00 ? 26 PRO A HG2  1  
ATOM 386   H HG3  . PRO A 1 26 ? 0.738   -1.189  -9.431  1.00 0.00 ? 26 PRO A HG3  1  
ATOM 387   H HD2  . PRO A 1 26 ? -0.456  -3.287  -8.232  1.00 0.00 ? 26 PRO A HD2  1  
ATOM 388   H HD3  . PRO A 1 26 ? 0.190   -1.917  -7.306  1.00 0.00 ? 26 PRO A HD3  1  
ATOM 389   N N    . CYS A 1 27 ? -3.744  -2.355  -9.570  1.00 0.00 ? 27 CYS A N    1  
ATOM 390   C CA   . CYS A 1 27 ? -4.796  -2.831  -10.450 1.00 0.00 ? 27 CYS A CA   1  
ATOM 391   C C    . CYS A 1 27 ? -5.366  -4.157  -9.956  1.00 0.00 ? 27 CYS A C    1  
ATOM 392   O O    . CYS A 1 27 ? -4.870  -4.736  -8.989  1.00 0.00 ? 27 CYS A O    1  
ATOM 393   C CB   . CYS A 1 27 ? -4.266  -2.983  -11.873 1.00 0.00 ? 27 CYS A CB   1  
ATOM 394   S SG   . CYS A 1 27 ? -5.171  -2.018  -13.106 1.00 0.00 ? 27 CYS A SG   1  
ATOM 395   H H    . CYS A 1 27 ? -3.202  -3.006  -9.091  1.00 0.00 ? 27 CYS A H    1  
ATOM 396   H HA   . CYS A 1 27 ? -5.577  -2.098  -10.448 1.00 0.00 ? 27 CYS A HA   1  
ATOM 397   H HB2  . CYS A 1 27 ? -3.235  -2.665  -11.901 1.00 0.00 ? 27 CYS A HB2  1  
ATOM 398   H HB3  . CYS A 1 27 ? -4.326  -4.019  -12.158 1.00 0.00 ? 27 CYS A HB3  1  
ATOM 399   H HG   . CYS A 1 27 ? -4.692  -1.200  -13.252 1.00 0.00 ? 27 CYS A HG   1  
ATOM 400   N N    . GLY A 1 28 ? -6.411  -4.632  -10.626 1.00 0.00 ? 28 GLY A N    1  
ATOM 401   C CA   . GLY A 1 28 ? -7.033  -5.886  -10.242 1.00 0.00 ? 28 GLY A CA   1  
ATOM 402   C C    . GLY A 1 28 ? -8.502  -5.725  -9.907  1.00 0.00 ? 28 GLY A C    1  
ATOM 403   O O    . GLY A 1 28 ? -9.323  -6.570  -10.264 1.00 0.00 ? 28 GLY A O    1  
ATOM 404   H H    . GLY A 1 28 ? -6.763  -4.126  -11.388 1.00 0.00 ? 28 GLY A H    1  
ATOM 405   H HA2  . GLY A 1 28 ? -6.935  -6.588  -11.057 1.00 0.00 ? 28 GLY A HA2  1  
ATOM 406   H HA3  . GLY A 1 28 ? -6.519  -6.280  -9.377  1.00 0.00 ? 28 GLY A HA3  1  
ATOM 407   N N    . ARG A 1 29 ? -8.835  -4.636  -9.222  1.00 0.00 ? 29 ARG A N    1  
ATOM 408   C CA   . ARG A 1 29 ? -10.212 -4.364  -8.840  1.00 0.00 ? 29 ARG A CA   1  
ATOM 409   C C    . ARG A 1 29 ? -10.411 -2.882  -8.537  1.00 0.00 ? 29 ARG A C    1  
ATOM 410   O O    . ARG A 1 29 ? -9.632  -2.280  -7.798  1.00 0.00 ? 29 ARG A O    1  
ATOM 411   C CB   . ARG A 1 29 ? -10.606 -5.205  -7.625  1.00 0.00 ? 29 ARG A CB   1  
ATOM 412   C CG   . ARG A 1 29 ? -9.549  -5.227  -6.533  1.00 0.00 ? 29 ARG A CG   1  
ATOM 413   C CD   . ARG A 1 29 ? -8.700  -6.486  -6.604  1.00 0.00 ? 29 ARG A CD   1  
ATOM 414   N NE   . ARG A 1 29 ? -9.167  -7.515  -5.679  1.00 0.00 ? 29 ARG A NE   1  
ATOM 415   C CZ   . ARG A 1 29 ? -8.578  -8.699  -5.527  1.00 0.00 ? 29 ARG A CZ   1  
ATOM 416   N NH1  . ARG A 1 29 ? -7.499  -9.007  -6.237  1.00 0.00 ? 29 ARG A NH1  1  
ATOM 417   N NH2  . ARG A 1 29 ? -9.068  -9.578  -4.663  1.00 0.00 ? 29 ARG A NH2  1  
ATOM 418   H H    . ARG A 1 29 ? -8.139  -4.000  -8.969  1.00 0.00 ? 29 ARG A H    1  
ATOM 419   H HA   . ARG A 1 29 ? -10.839 -4.634  -9.672  1.00 0.00 ? 29 ARG A HA   1  
ATOM 420   H HB2  . ARG A 1 29 ? -11.517 -4.805  -7.205  1.00 0.00 ? 29 ARG A HB2  1  
ATOM 421   H HB3  . ARG A 1 29 ? -10.783 -6.221  -7.946  1.00 0.00 ? 29 ARG A HB3  1  
ATOM 422   H HG2  . ARG A 1 29 ? -8.907  -4.366  -6.650  1.00 0.00 ? 29 ARG A HG2  1  
ATOM 423   H HG3  . ARG A 1 29 ? -10.038 -5.187  -5.571  1.00 0.00 ? 29 ARG A HG3  1  
ATOM 424   H HD2  . ARG A 1 29 ? -8.740  -6.876  -7.611  1.00 0.00 ? 29 ARG A HD2  1  
ATOM 425   H HD3  . ARG A 1 29 ? -7.679  -6.231  -6.359  1.00 0.00 ? 29 ARG A HD3  1  
ATOM 426   H HE   . ARG A 1 29 ? -9.963  -7.314  -5.143  1.00 0.00 ? 29 ARG A HE   1  
ATOM 427   H HH11 . ARG A 1 29 ? -7.124  -8.349  -6.890  1.00 0.00 ? 29 ARG A HH11 1  
ATOM 428   H HH12 . ARG A 1 29 ? -7.061  -9.898  -6.118  1.00 0.00 ? 29 ARG A HH12 1  
ATOM 429   H HH21 . ARG A 1 29 ? -9.881  -9.351  -4.126  1.00 0.00 ? 29 ARG A HH21 1  
ATOM 430   H HH22 . ARG A 1 29 ? -8.626  -10.467 -4.549  1.00 0.00 ? 29 ARG A HH22 1  
ATOM 431   N N    . ARG A 1 30 ? -11.458 -2.300  -9.111  1.00 0.00 ? 30 ARG A N    1  
ATOM 432   C CA   . ARG A 1 30 ? -11.760 -0.895  -8.902  1.00 0.00 ? 30 ARG A CA   1  
ATOM 433   C C    . ARG A 1 30 ? -13.264 -0.670  -8.782  1.00 0.00 ? 30 ARG A C    1  
ATOM 434   O O    . ARG A 1 30 ? -13.939 -0.377  -9.769  1.00 0.00 ? 30 ARG A O    1  
ATOM 435   C CB   . ARG A 1 30 ? -11.193 -0.051  -10.045 1.00 0.00 ? 30 ARG A CB   1  
ATOM 436   C CG   . ARG A 1 30 ? -11.068 1.426   -9.708  1.00 0.00 ? 30 ARG A CG   1  
ATOM 437   C CD   . ARG A 1 30 ? -9.824  2.037   -10.332 1.00 0.00 ? 30 ARG A CD   1  
ATOM 438   N NE   . ARG A 1 30 ? -9.707  3.462   -10.036 1.00 0.00 ? 30 ARG A NE   1  
ATOM 439   C CZ   . ARG A 1 30 ? -9.318  3.945   -8.858  1.00 0.00 ? 30 ARG A CZ   1  
ATOM 440   N NH1  . ARG A 1 30 ? -9.008  3.121   -7.864  1.00 0.00 ? 30 ARG A NH1  1  
ATOM 441   N NH2  . ARG A 1 30 ? -9.239  5.256   -8.672  1.00 0.00 ? 30 ARG A NH2  1  
ATOM 442   H H    . ARG A 1 30 ? -12.042 -2.827  -9.684  1.00 0.00 ? 30 ARG A H    1  
ATOM 443   H HA   . ARG A 1 30 ? -11.292 -0.599  -7.983  1.00 0.00 ? 30 ARG A HA   1  
ATOM 444   H HB2  . ARG A 1 30 ? -10.213 -0.425  -10.301 1.00 0.00 ? 30 ARG A HB2  1  
ATOM 445   H HB3  . ARG A 1 30 ? -11.841 -0.148  -10.904 1.00 0.00 ? 30 ARG A HB3  1  
ATOM 446   H HG2  . ARG A 1 30 ? -11.938 1.945   -10.080 1.00 0.00 ? 30 ARG A HG2  1  
ATOM 447   H HG3  . ARG A 1 30 ? -11.013 1.536   -8.634  1.00 0.00 ? 30 ARG A HG3  1  
ATOM 448   H HD2  . ARG A 1 30 ? -8.955  1.526   -9.946  1.00 0.00 ? 30 ARG A HD2  1  
ATOM 449   H HD3  . ARG A 1 30 ? -9.872  1.904   -11.403 1.00 0.00 ? 30 ARG A HD3  1  
ATOM 450   H HE   . ARG A 1 30 ? -9.929  4.093   -10.752 1.00 0.00 ? 30 ARG A HE   1  
ATOM 451   H HH11 . ARG A 1 30 ? -9.065  2.132   -7.998  1.00 0.00 ? 30 ARG A HH11 1  
ATOM 452   H HH12 . ARG A 1 30 ? -8.716  3.490   -6.982  1.00 0.00 ? 30 ARG A HH12 1  
ATOM 453   H HH21 . ARG A 1 30 ? -9.471  5.881   -9.417  1.00 0.00 ? 30 ARG A HH21 1  
ATOM 454   H HH22 . ARG A 1 30 ? -8.948  5.619   -7.787  1.00 0.00 ? 30 ARG A HH22 1  
ATOM 455   N N    . LYS A 1 31 ? -13.782 -0.807  -7.566  1.00 0.00 ? 31 LYS A N    1  
ATOM 456   C CA   . LYS A 1 31 ? -15.200 -0.617  -7.313  1.00 0.00 ? 31 LYS A CA   1  
ATOM 457   C C    . LYS A 1 31 ? -15.438 -0.113  -5.893  1.00 0.00 ? 31 LYS A C    1  
ATOM 458   O O    . LYS A 1 31 ? -14.677 -0.426  -4.978  1.00 0.00 ? 31 LYS A O    1  
ATOM 459   C CB   . LYS A 1 31 ? -15.963 -1.924  -7.541  1.00 0.00 ? 31 LYS A CB   1  
ATOM 460   C CG   . LYS A 1 31 ? -15.970 -2.380  -8.990  1.00 0.00 ? 31 LYS A CG   1  
ATOM 461   C CD   . LYS A 1 31 ? -16.653 -3.729  -9.147  1.00 0.00 ? 31 LYS A CD   1  
ATOM 462   C CE   . LYS A 1 31 ? -15.649 -4.869  -9.110  1.00 0.00 ? 31 LYS A CE   1  
ATOM 463   N NZ   . LYS A 1 31 ? -14.907 -4.998  -10.394 1.00 0.00 ? 31 LYS A NZ   1  
ATOM 464   H H    . LYS A 1 31 ? -13.196 -1.037  -6.821  1.00 0.00 ? 31 LYS A H    1  
ATOM 465   H HA   . LYS A 1 31 ? -15.556 0.122   -8.007  1.00 0.00 ? 31 LYS A HA   1  
ATOM 466   H HB2  . LYS A 1 31 ? -15.509 -2.701  -6.943  1.00 0.00 ? 31 LYS A HB2  1  
ATOM 467   H HB3  . LYS A 1 31 ? -16.987 -1.789  -7.223  1.00 0.00 ? 31 LYS A HB3  1  
ATOM 468   H HG2  . LYS A 1 31 ? -16.497 -1.649  -9.585  1.00 0.00 ? 31 LYS A HG2  1  
ATOM 469   H HG3  . LYS A 1 31 ? -14.950 -2.460  -9.337  1.00 0.00 ? 31 LYS A HG3  1  
ATOM 470   H HD2  . LYS A 1 31 ? -17.360 -3.859  -8.341  1.00 0.00 ? 31 LYS A HD2  1  
ATOM 471   H HD3  . LYS A 1 31 ? -17.174 -3.749  -10.093 1.00 0.00 ? 31 LYS A HD3  1  
ATOM 472   H HE2  . LYS A 1 31 ? -14.943 -4.685  -8.314  1.00 0.00 ? 31 LYS A HE2  1  
ATOM 473   H HE3  . LYS A 1 31 ? -16.177 -5.791  -8.915  1.00 0.00 ? 31 LYS A HE3  1  
ATOM 474   H HZ1  . LYS A 1 31 ? -13.935 -5.321  -10.215 1.00 0.00 ? 31 LYS A HZ1  1  
ATOM 475   H HZ2  . LYS A 1 31 ? -14.871 -4.080  -10.881 1.00 0.00 ? 31 LYS A HZ2  1  
ATOM 476   H HZ3  . LYS A 1 31 ? -15.381 -5.687  -11.013 1.00 0.00 ? 31 LYS A HZ3  1  
ATOM 477   N N    . ILE A 1 32 ? -16.498 0.669   -5.717  1.00 0.00 ? 32 ILE A N    1  
ATOM 478   C CA   . ILE A 1 32 ? -16.835 1.214   -4.413  1.00 0.00 ? 32 ILE A CA   1  
ATOM 479   C C    . ILE A 1 32 ? -18.299 1.646   -4.356  1.00 0.00 ? 32 ILE A C    1  
ATOM 480   O O    . ILE A 1 32 ? -18.625 2.813   -4.572  1.00 0.00 ? 32 ILE A O    1  
ATOM 481   C CB   . ILE A 1 32 ? -15.929 2.410   -4.061  1.00 0.00 ? 32 ILE A CB   1  
ATOM 482   C CG1  . ILE A 1 32 ? -16.232 2.919   -2.650  1.00 0.00 ? 32 ILE A CG1  1  
ATOM 483   C CG2  . ILE A 1 32 ? -16.094 3.526   -5.082  1.00 0.00 ? 32 ILE A CG2  1  
ATOM 484   C CD1  . ILE A 1 32 ? -15.034 3.531   -1.959  1.00 0.00 ? 32 ILE A CD1  1  
ATOM 485   H H    . ILE A 1 32 ? -17.066 0.882   -6.480  1.00 0.00 ? 32 ILE A H    1  
ATOM 486   H HA   . ILE A 1 32 ? -16.673 0.439   -3.683  1.00 0.00 ? 32 ILE A HA   1  
ATOM 487   H HB   . ILE A 1 32 ? -14.905 2.073   -4.101  1.00 0.00 ? 32 ILE A HB   1  
ATOM 488   H HG12 . ILE A 1 32 ? -17.004 3.672   -2.704  1.00 0.00 ? 32 ILE A HG12 1  
ATOM 489   H HG13 . ILE A 1 32 ? -16.581 2.095   -2.045  1.00 0.00 ? 32 ILE A HG13 1  
ATOM 490   H HG21 . ILE A 1 32 ? -16.455 3.113   -6.012  1.00 0.00 ? 32 ILE A HG21 1  
ATOM 491   H HG22 . ILE A 1 32 ? -15.141 4.006   -5.248  1.00 0.00 ? 32 ILE A HG22 1  
ATOM 492   H HG23 . ILE A 1 32 ? -16.803 4.251   -4.711  1.00 0.00 ? 32 ILE A HG23 1  
ATOM 493   H HD11 . ILE A 1 32 ? -14.285 3.785   -2.694  1.00 0.00 ? 32 ILE A HD11 1  
ATOM 494   H HD12 . ILE A 1 32 ? -14.622 2.822   -1.256  1.00 0.00 ? 32 ILE A HD12 1  
ATOM 495   H HD13 . ILE A 1 32 ? -15.338 4.424   -1.433  1.00 0.00 ? 32 ILE A HD13 1  
ATOM 496   N N    . ILE A 1 33 ? -19.179 0.693   -4.065  1.00 0.00 ? 33 ILE A N    1  
ATOM 497   C CA   . ILE A 1 33 ? -20.599 0.960   -3.981  1.00 0.00 ? 33 ILE A CA   1  
ATOM 498   C C    . ILE A 1 33 ? -20.951 1.688   -2.686  1.00 0.00 ? 33 ILE A C    1  
ATOM 499   O O    . ILE A 1 33 ? -21.452 1.082   -1.739  1.00 0.00 ? 33 ILE A O    1  
ATOM 500   C CB   . ILE A 1 33 ? -21.406 -0.346  -4.061  1.00 0.00 ? 33 ILE A CB   1  
ATOM 501   C CG1  . ILE A 1 33 ? -20.805 -1.412  -3.141  1.00 0.00 ? 33 ILE A CG1  1  
ATOM 502   C CG2  . ILE A 1 33 ? -21.465 -0.848  -5.496  1.00 0.00 ? 33 ILE A CG2  1  
ATOM 503   C CD1  . ILE A 1 33 ? -21.777 -2.511  -2.773  1.00 0.00 ? 33 ILE A CD1  1  
ATOM 504   H H    . ILE A 1 33 ? -18.867 -0.216  -3.907  1.00 0.00 ? 33 ILE A H    1  
ATOM 505   H HA   . ILE A 1 33 ? -20.871 1.579   -4.820  1.00 0.00 ? 33 ILE A HA   1  
ATOM 506   H HB   . ILE A 1 33 ? -22.405 -0.135  -3.741  1.00 0.00 ? 33 ILE A HB   1  
ATOM 507   H HG12 . ILE A 1 33 ? -19.960 -1.869  -3.634  1.00 0.00 ? 33 ILE A HG12 1  
ATOM 508   H HG13 . ILE A 1 33 ? -20.472 -0.942  -2.227  1.00 0.00 ? 33 ILE A HG13 1  
ATOM 509   H HG21 . ILE A 1 33 ? -20.505 -1.257  -5.774  1.00 0.00 ? 33 ILE A HG21 1  
ATOM 510   H HG22 . ILE A 1 33 ? -21.712 -0.029  -6.154  1.00 0.00 ? 33 ILE A HG22 1  
ATOM 511   H HG23 . ILE A 1 33 ? -22.220 -1.616  -5.578  1.00 0.00 ? 33 ILE A HG23 1  
ATOM 512   H HD11 . ILE A 1 33 ? -22.612 -2.087  -2.234  1.00 0.00 ? 33 ILE A HD11 1  
ATOM 513   H HD12 . ILE A 1 33 ? -21.279 -3.239  -2.150  1.00 0.00 ? 33 ILE A HD12 1  
ATOM 514   H HD13 . ILE A 1 33 ? -22.136 -2.990  -3.672  1.00 0.00 ? 33 ILE A HD13 1  
ATOM 515   N N    . LEU A 1 34 ? -20.684 2.989   -2.652  1.00 0.00 ? 34 LEU A N    1  
ATOM 516   C CA   . LEU A 1 34 ? -20.972 3.796   -1.476  1.00 0.00 ? 34 LEU A CA   1  
ATOM 517   C C    . LEU A 1 34 ? -22.467 4.069   -1.346  1.00 0.00 ? 34 LEU A C    1  
ATOM 518   O O    . LEU A 1 34 ? -22.970 4.321   -0.252  1.00 0.00 ? 34 LEU A O    1  
ATOM 519   C CB   . LEU A 1 34 ? -20.199 5.112   -1.532  1.00 0.00 ? 34 LEU A CB   1  
ATOM 520   C CG   . LEU A 1 34 ? -19.195 5.323   -0.396  1.00 0.00 ? 34 LEU A CG   1  
ATOM 521   C CD1  . LEU A 1 34 ? -17.917 5.958   -0.922  1.00 0.00 ? 34 LEU A CD1  1  
ATOM 522   C CD2  . LEU A 1 34 ? -19.805 6.180   0.703   1.00 0.00 ? 34 LEU A CD2  1  
ATOM 523   H H    . LEU A 1 34 ? -20.284 3.416   -3.435  1.00 0.00 ? 34 LEU A H    1  
ATOM 524   H HA   . LEU A 1 34 ? -20.648 3.243   -0.618  1.00 0.00 ? 34 LEU A HA   1  
ATOM 525   H HB2  . LEU A 1 34 ? -19.665 5.147   -2.468  1.00 0.00 ? 34 LEU A HB2  1  
ATOM 526   H HB3  . LEU A 1 34 ? -20.908 5.924   -1.510  1.00 0.00 ? 34 LEU A HB3  1  
ATOM 527   H HG   . LEU A 1 34 ? -18.939 4.364   0.030   1.00 0.00 ? 34 LEU A HG   1  
ATOM 528   H HD11 . LEU A 1 34 ? -17.119 5.804   -0.211  1.00 0.00 ? 34 LEU A HD11 1  
ATOM 529   H HD12 . LEU A 1 34 ? -18.073 7.018   -1.064  1.00 0.00 ? 34 LEU A HD12 1  
ATOM 530   H HD13 . LEU A 1 34 ? -17.650 5.505   -1.865  1.00 0.00 ? 34 LEU A HD13 1  
ATOM 531   H HD21 . LEU A 1 34 ? -19.514 5.791   1.667   1.00 0.00 ? 34 LEU A HD21 1  
ATOM 532   H HD22 . LEU A 1 34 ? -20.882 6.162   0.618   1.00 0.00 ? 34 LEU A HD22 1  
ATOM 533   H HD23 . LEU A 1 34 ? -19.454 7.197   0.604   1.00 0.00 ? 34 LEU A HD23 1  
ATOM 534   N N    . SER A 1 35 ? -23.171 4.018   -2.469  1.00 0.00 ? 35 SER A N    1  
ATOM 535   C CA   . SER A 1 35 ? -24.609 4.259   -2.481  1.00 0.00 ? 35 SER A CA   1  
ATOM 536   C C    . SER A 1 35 ? -25.339 3.254   -1.595  1.00 0.00 ? 35 SER A C    1  
ATOM 537   O O    . SER A 1 35 ? -26.454 3.508   -1.140  1.00 0.00 ? 35 SER A O    1  
ATOM 538   C CB   . SER A 1 35 ? -25.148 4.187   -3.912  1.00 0.00 ? 35 SER A CB   1  
ATOM 539   O OG   . SER A 1 35 ? -24.210 3.579   -4.783  1.00 0.00 ? 35 SER A OG   1  
ATOM 540   H H    . SER A 1 35 ? -22.714 3.812   -3.310  1.00 0.00 ? 35 SER A H    1  
ATOM 541   H HA   . SER A 1 35 ? -24.778 5.249   -2.092  1.00 0.00 ? 35 SER A HA   1  
ATOM 542   H HB2  . SER A 1 35 ? -26.058 3.607   -3.924  1.00 0.00 ? 35 SER A HB2  1  
ATOM 543   H HB3  . SER A 1 35 ? -25.355 5.186   -4.266  1.00 0.00 ? 35 SER A HB3  1  
ATOM 544   H HG   . SER A 1 35 ? -24.642 2.884   -5.285  1.00 0.00 ? 35 SER A HG   1  
ATOM 545   N N    . ASP A 1 36 ? -24.704 2.112   -1.357  1.00 0.00 ? 36 ASP A N    1  
ATOM 546   C CA   . ASP A 1 36 ? -25.289 1.070   -0.532  1.00 0.00 ? 36 ASP A CA   1  
ATOM 547   C C    . ASP A 1 36 ? -24.754 1.132   0.896   1.00 0.00 ? 36 ASP A C    1  
ATOM 548   O O    . ASP A 1 36 ? -25.498 1.411   1.836   1.00 0.00 ? 36 ASP A O    1  
ATOM 549   C CB   . ASP A 1 36 ? -25.005 -0.307  -1.136  1.00 0.00 ? 36 ASP A CB   1  
ATOM 550   C CG   . ASP A 1 36 ? -26.168 -1.264  -0.965  1.00 0.00 ? 36 ASP A CG   1  
ATOM 551   O OD1  . ASP A 1 36 ? -27.130 -1.178  -1.757  1.00 0.00 ? 36 ASP A OD1  1  
ATOM 552   O OD2  . ASP A 1 36 ? -26.118 -2.099  -0.038  1.00 0.00 ? 36 ASP A OD2  1  
ATOM 553   H H    . ASP A 1 36 ? -23.826 1.967   -1.747  1.00 0.00 ? 36 ASP A H    1  
ATOM 554   H HA   . ASP A 1 36 ? -26.350 1.231   -0.514  1.00 0.00 ? 36 ASP A HA   1  
ATOM 555   H HB2  . ASP A 1 36 ? -24.808 -0.196  -2.192  1.00 0.00 ? 36 ASP A HB2  1  
ATOM 556   H HB3  . ASP A 1 36 ? -24.138 -0.732  -0.654  1.00 0.00 ? 36 ASP A HB3  1  
ATOM 557   N N    . GLU A 1 37 ? -23.461 0.865   1.051   1.00 0.00 ? 37 GLU A N    1  
ATOM 558   C CA   . GLU A 1 37 ? -22.829 0.884   2.364   1.00 0.00 ? 37 GLU A CA   1  
ATOM 559   C C    . GLU A 1 37 ? -22.794 2.292   2.941   1.00 0.00 ? 37 GLU A C    1  
ATOM 560   O O    . GLU A 1 37 ? -22.961 2.488   4.145   1.00 0.00 ? 37 GLU A O    1  
ATOM 561   C CB   . GLU A 1 37 ? -21.414 0.314   2.279   1.00 0.00 ? 37 GLU A CB   1  
ATOM 562   C CG   . GLU A 1 37 ? -21.213 -0.937  3.113   1.00 0.00 ? 37 GLU A CG   1  
ATOM 563   C CD   . GLU A 1 37 ? -20.158 -0.762  4.189   1.00 0.00 ? 37 GLU A CD   1  
ATOM 564   O OE1  . GLU A 1 37 ? -20.508 -0.294  5.293   1.00 0.00 ? 37 GLU A OE1  1  
ATOM 565   O OE2  . GLU A 1 37 ? -18.983 -1.093  3.927   1.00 0.00 ? 37 GLU A OE2  1  
ATOM 566   H H    . GLU A 1 37 ? -22.921 0.645   0.265   1.00 0.00 ? 37 GLU A H    1  
ATOM 567   H HA   . GLU A 1 37 ? -23.411 0.264   3.012   1.00 0.00 ? 37 GLU A HA   1  
ATOM 568   H HB2  . GLU A 1 37 ? -21.199 0.072   1.252   1.00 0.00 ? 37 GLU A HB2  1  
ATOM 569   H HB3  . GLU A 1 37 ? -20.717 1.060   2.619   1.00 0.00 ? 37 GLU A HB3  1  
ATOM 570   H HG2  . GLU A 1 37 ? -22.147 -1.188  3.586   1.00 0.00 ? 37 GLU A HG2  1  
ATOM 571   H HG3  . GLU A 1 37 ? -20.911 -1.743  2.462   1.00 0.00 ? 37 GLU A HG3  1  
ATOM 572   N N    . GLY A 1 38 ? -22.576 3.267   2.074   1.00 0.00 ? 38 GLY A N    1  
ATOM 573   C CA   . GLY A 1 38 ? -22.520 4.651   2.508   1.00 0.00 ? 38 GLY A CA   1  
ATOM 574   C C    . GLY A 1 38 ? -21.425 4.900   3.527   1.00 0.00 ? 38 GLY A C    1  
ATOM 575   O O    . GLY A 1 38 ? -21.438 5.913   4.227   1.00 0.00 ? 38 GLY A O    1  
ATOM 576   H H    . GLY A 1 38 ? -22.451 3.043   1.130   1.00 0.00 ? 38 GLY A H    1  
ATOM 577   H HA2  . GLY A 1 38 ? -22.346 5.280   1.648   1.00 0.00 ? 38 GLY A HA2  1  
ATOM 578   H HA3  . GLY A 1 38 ? -23.469 4.915   2.947   1.00 0.00 ? 38 GLY A HA3  1  
ATOM 579   N N    . LYS A 1 39 ? -20.466 3.984   3.600   1.00 0.00 ? 39 LYS A N    1  
ATOM 580   C CA   . LYS A 1 39 ? -19.355 4.109   4.517   1.00 0.00 ? 39 LYS A CA   1  
ATOM 581   C C    . LYS A 1 39 ? -18.099 3.518   3.896   1.00 0.00 ? 39 LYS A C    1  
ATOM 582   O O    . LYS A 1 39 ? -17.815 2.329   4.043   1.00 0.00 ? 39 LYS A O    1  
ATOM 583   C CB   . LYS A 1 39 ? -19.669 3.410   5.841   1.00 0.00 ? 39 LYS A CB   1  
ATOM 584   C CG   . LYS A 1 39 ? -20.471 4.267   6.807   1.00 0.00 ? 39 LYS A CG   1  
ATOM 585   C CD   . LYS A 1 39 ? -19.570 4.969   7.810   1.00 0.00 ? 39 LYS A CD   1  
ATOM 586   C CE   . LYS A 1 39 ? -19.300 6.409   7.404   1.00 0.00 ? 39 LYS A CE   1  
ATOM 587   N NZ   . LYS A 1 39 ? -20.389 7.324   7.844   1.00 0.00 ? 39 LYS A NZ   1  
ATOM 588   H H    . LYS A 1 39 ? -20.495 3.218   3.008   1.00 0.00 ? 39 LYS A H    1  
ATOM 589   H HA   . LYS A 1 39 ? -19.197 5.157   4.697   1.00 0.00 ? 39 LYS A HA   1  
ATOM 590   H HB2  . LYS A 1 39 ? -20.233 2.512   5.637   1.00 0.00 ? 39 LYS A HB2  1  
ATOM 591   H HB3  . LYS A 1 39 ? -18.740 3.139   6.321   1.00 0.00 ? 39 LYS A HB3  1  
ATOM 592   H HG2  . LYS A 1 39 ? -21.016 5.012   6.245   1.00 0.00 ? 39 LYS A HG2  1  
ATOM 593   H HG3  . LYS A 1 39 ? -21.167 3.636   7.340   1.00 0.00 ? 39 LYS A HG3  1  
ATOM 594   H HD2  . LYS A 1 39 ? -20.051 4.963   8.777   1.00 0.00 ? 39 LYS A HD2  1  
ATOM 595   H HD3  . LYS A 1 39 ? -18.631 4.438   7.868   1.00 0.00 ? 39 LYS A HD3  1  
ATOM 596   H HE2  . LYS A 1 39 ? -18.371 6.728   7.852   1.00 0.00 ? 39 LYS A HE2  1  
ATOM 597   H HE3  . LYS A 1 39 ? -19.214 6.456   6.328   1.00 0.00 ? 39 LYS A HE3  1  
ATOM 598   H HZ1  . LYS A 1 39 ? -19.995 8.254   8.094   1.00 0.00 ? 39 LYS A HZ1  1  
ATOM 599   H HZ2  . LYS A 1 39 ? -20.873 6.930   8.676   1.00 0.00 ? 39 LYS A HZ2  1  
ATOM 600   H HZ3  . LYS A 1 39 ? -21.083 7.448   7.080   1.00 0.00 ? 39 LYS A HZ3  1  
ATOM 601   N N    . MET A 1 40 ? -17.351 4.363   3.208   1.00 0.00 ? 40 MET A N    1  
ATOM 602   C CA   . MET A 1 40 ? -16.120 3.950   2.562   1.00 0.00 ? 40 MET A CA   1  
ATOM 603   C C    . MET A 1 40 ? -15.123 5.101   2.523   1.00 0.00 ? 40 MET A C    1  
ATOM 604   O O    . MET A 1 40 ? -15.058 5.851   1.549   1.00 0.00 ? 40 MET A O    1  
ATOM 605   C CB   . MET A 1 40 ? -16.403 3.443   1.146   1.00 0.00 ? 40 MET A CB   1  
ATOM 606   C CG   . MET A 1 40 ? -15.852 2.052   0.878   1.00 0.00 ? 40 MET A CG   1  
ATOM 607   S SD   . MET A 1 40 ? -16.697 0.775   1.830   1.00 0.00 ? 40 MET A SD   1  
ATOM 608   C CE   . MET A 1 40 ? -17.980 0.287   0.679   1.00 0.00 ? 40 MET A CE   1  
ATOM 609   H H    . MET A 1 40 ? -17.635 5.286   3.136   1.00 0.00 ? 40 MET A H    1  
ATOM 610   H HA   . MET A 1 40 ? -15.702 3.150   3.145   1.00 0.00 ? 40 MET A HA   1  
ATOM 611   H HB2  . MET A 1 40 ? -17.471 3.419   0.992   1.00 0.00 ? 40 MET A HB2  1  
ATOM 612   H HB3  . MET A 1 40 ? -15.961 4.125   0.435   1.00 0.00 ? 40 MET A HB3  1  
ATOM 613   H HG2  . MET A 1 40 ? -15.966 1.831   -0.173  1.00 0.00 ? 40 MET A HG2  1  
ATOM 614   H HG3  . MET A 1 40 ? -14.803 2.039   1.135   1.00 0.00 ? 40 MET A HG3  1  
ATOM 615   H HE1  . MET A 1 40 ? -18.095 1.051   -0.076  1.00 0.00 ? 40 MET A HE1  1  
ATOM 616   H HE2  . MET A 1 40 ? -18.911 0.162   1.211   1.00 0.00 ? 40 MET A HE2  1  
ATOM 617   H HE3  . MET A 1 40 ? -17.705 -0.645  0.209   1.00 0.00 ? 40 MET A HE3  1  
ATOM 618   N N    . TYR A 1 41 ? -14.350 5.232   3.591   1.00 0.00 ? 41 TYR A N    1  
ATOM 619   C CA   . TYR A 1 41 ? -13.353 6.288   3.693   1.00 0.00 ? 41 TYR A CA   1  
ATOM 620   C C    . TYR A 1 41 ? -12.204 6.048   2.718   1.00 0.00 ? 41 TYR A C    1  
ATOM 621   O O    . TYR A 1 41 ? -12.244 5.115   1.916   1.00 0.00 ? 41 TYR A O    1  
ATOM 622   C CB   . TYR A 1 41 ? -12.820 6.379   5.121   1.00 0.00 ? 41 TYR A CB   1  
ATOM 623   C CG   . TYR A 1 41 ? -13.115 7.699   5.796   1.00 0.00 ? 41 TYR A CG   1  
ATOM 624   C CD1  . TYR A 1 41 ? -12.961 8.900   5.113   1.00 0.00 ? 41 TYR A CD1  1  
ATOM 625   C CD2  . TYR A 1 41 ? -13.547 7.746   7.115   1.00 0.00 ? 41 TYR A CD2  1  
ATOM 626   C CE1  . TYR A 1 41 ? -13.230 10.109  5.726   1.00 0.00 ? 41 TYR A CE1  1  
ATOM 627   C CE2  . TYR A 1 41 ? -13.818 8.951   7.735   1.00 0.00 ? 41 TYR A CE2  1  
ATOM 628   C CZ   . TYR A 1 41 ? -13.657 10.129  7.037   1.00 0.00 ? 41 TYR A CZ   1  
ATOM 629   O OH   . TYR A 1 41 ? -13.926 11.331  7.651   1.00 0.00 ? 41 TYR A OH   1  
ATOM 630   H H    . TYR A 1 41 ? -14.458 4.605   4.333   1.00 0.00 ? 41 TYR A H    1  
ATOM 631   H HA   . TYR A 1 41 ? -13.832 7.217   3.444   1.00 0.00 ? 41 TYR A HA   1  
ATOM 632   H HB2  . TYR A 1 41 ? -13.270 5.598   5.712   1.00 0.00 ? 41 TYR A HB2  1  
ATOM 633   H HB3  . TYR A 1 41 ? -11.750 6.243   5.108   1.00 0.00 ? 41 TYR A HB3  1  
ATOM 634   H HD1  . TYR A 1 41 ? -12.627 8.881   4.086   1.00 0.00 ? 41 TYR A HD1  1  
ATOM 635   H HD2  . TYR A 1 41 ? -13.671 6.822   7.660   1.00 0.00 ? 41 TYR A HD2  1  
ATOM 636   H HE1  . TYR A 1 41 ? -13.104 11.031  5.179   1.00 0.00 ? 41 TYR A HE1  1  
ATOM 637   H HE2  . TYR A 1 41 ? -14.152 8.966   8.762   1.00 0.00 ? 41 TYR A HE2  1  
ATOM 638   H HH   . TYR A 1 41 ? -13.605 11.307  8.555   1.00 0.00 ? 41 TYR A HH   1  
ATOM 639   N N    . GLY A 1 42 ? -11.184 6.898   2.788   1.00 0.00 ? 42 GLY A N    1  
ATOM 640   C CA   . GLY A 1 42 ? -10.041 6.763   1.902   1.00 0.00 ? 42 GLY A CA   1  
ATOM 641   C C    . GLY A 1 42 ? -9.446  5.368   1.926   1.00 0.00 ? 42 GLY A C    1  
ATOM 642   O O    . GLY A 1 42 ? -9.332  4.752   2.986   1.00 0.00 ? 42 GLY A O    1  
ATOM 643   H H    . GLY A 1 42 ? -11.209 7.625   3.445   1.00 0.00 ? 42 GLY A H    1  
ATOM 644   H HA2  . GLY A 1 42 ? -10.353 6.991   0.894   1.00 0.00 ? 42 GLY A HA2  1  
ATOM 645   H HA3  . GLY A 1 42 ? -9.282  7.471   2.201   1.00 0.00 ? 42 GLY A HA3  1  
ATOM 646   N N    . ARG A 1 43 ? -9.071  4.868   0.753   1.00 0.00 ? 43 ARG A N    1  
ATOM 647   C CA   . ARG A 1 43 ? -8.490  3.535   0.638   1.00 0.00 ? 43 ARG A CA   1  
ATOM 648   C C    . ARG A 1 43 ? -7.245  3.395   1.507   1.00 0.00 ? 43 ARG A C    1  
ATOM 649   O O    . ARG A 1 43 ? -6.894  2.296   1.935   1.00 0.00 ? 43 ARG A O    1  
ATOM 650   C CB   . ARG A 1 43 ? -8.151  3.229   -0.819  1.00 0.00 ? 43 ARG A CB   1  
ATOM 651   C CG   . ARG A 1 43 ? -8.931  2.058   -1.392  1.00 0.00 ? 43 ARG A CG   1  
ATOM 652   C CD   . ARG A 1 43 ? -8.099  1.268   -2.389  1.00 0.00 ? 43 ARG A CD   1  
ATOM 653   N NE   . ARG A 1 43 ? -7.652  2.096   -3.507  1.00 0.00 ? 43 ARG A NE   1  
ATOM 654   C CZ   . ARG A 1 43 ? -6.956  1.631   -4.542  1.00 0.00 ? 43 ARG A CZ   1  
ATOM 655   N NH1  . ARG A 1 43 ? -6.627  0.347   -4.606  1.00 0.00 ? 43 ARG A NH1  1  
ATOM 656   N NH2  . ARG A 1 43 ? -6.589  2.452   -5.516  1.00 0.00 ? 43 ARG A NH2  1  
ATOM 657   H H    . ARG A 1 43 ? -9.191  5.407   -0.056  1.00 0.00 ? 43 ARG A H    1  
ATOM 658   H HA   . ARG A 1 43 ? -9.223  2.829   0.976   1.00 0.00 ? 43 ARG A HA   1  
ATOM 659   H HB2  . ARG A 1 43 ? -8.366  4.102   -1.413  1.00 0.00 ? 43 ARG A HB2  1  
ATOM 660   H HB3  . ARG A 1 43 ? -7.099  3.003   -0.893  1.00 0.00 ? 43 ARG A HB3  1  
ATOM 661   H HG2  . ARG A 1 43 ? -9.224  1.403   -0.585  1.00 0.00 ? 43 ARG A HG2  1  
ATOM 662   H HG3  . ARG A 1 43 ? -9.813  2.434   -1.891  1.00 0.00 ? 43 ARG A HG3  1  
ATOM 663   H HD2  . ARG A 1 43 ? -7.233  0.870   -1.880  1.00 0.00 ? 43 ARG A HD2  1  
ATOM 664   H HD3  . ARG A 1 43 ? -8.696  0.454   -2.772  1.00 0.00 ? 43 ARG A HD3  1  
ATOM 665   H HE   . ARG A 1 43 ? -7.881  3.048   -3.485  1.00 0.00 ? 43 ARG A HE   1  
ATOM 666   H HH11 . ARG A 1 43 ? -6.900  -0.278  -3.875  1.00 0.00 ? 43 ARG A HH11 1  
ATOM 667   H HH12 . ARG A 1 43 ? -6.104  0.004   -5.387  1.00 0.00 ? 43 ARG A HH12 1  
ATOM 668   H HH21 . ARG A 1 43 ? -6.835  3.421   -5.473  1.00 0.00 ? 43 ARG A HH21 1  
ATOM 669   H HH22 . ARG A 1 43 ? -6.067  2.103   -6.294  1.00 0.00 ? 43 ARG A HH22 1  
ATOM 670   N N    . ASN A 1 44 ? -6.582  4.515   1.764   1.00 0.00 ? 44 ASN A N    1  
ATOM 671   C CA   . ASN A 1 44 ? -5.373  4.519   2.583   1.00 0.00 ? 44 ASN A CA   1  
ATOM 672   C C    . ASN A 1 44 ? -5.628  3.874   3.939   1.00 0.00 ? 44 ASN A C    1  
ATOM 673   O O    . ASN A 1 44 ? -4.719  3.318   4.556   1.00 0.00 ? 44 ASN A O    1  
ATOM 674   C CB   . ASN A 1 44 ? -4.859  5.945   2.765   1.00 0.00 ? 44 ASN A CB   1  
ATOM 675   C CG   . ASN A 1 44 ? -3.476  6.143   2.173   1.00 0.00 ? 44 ASN A CG   1  
ATOM 676   O OD1  . ASN A 1 44 ? -3.047  5.385   1.304   1.00 0.00 ? 44 ASN A OD1  1  
ATOM 677   N ND2  . ASN A 1 44 ? -2.772  7.165   2.643   1.00 0.00 ? 44 ASN A ND2  1  
ATOM 678   H H    . ASN A 1 44 ? -6.913  5.359   1.395   1.00 0.00 ? 44 ASN A H    1  
ATOM 679   H HA   . ASN A 1 44 ? -4.628  3.946   2.067   1.00 0.00 ? 44 ASN A HA   1  
ATOM 680   H HB2  . ASN A 1 44 ? -5.537  6.628   2.279   1.00 0.00 ? 44 ASN A HB2  1  
ATOM 681   H HB3  . ASN A 1 44 ? -4.815  6.174   3.818   1.00 0.00 ? 44 ASN A HB3  1  
ATOM 682   H HD21 . ASN A 1 44 ? -3.178  7.727   3.336   1.00 0.00 ? 44 ASN A HD21 1  
ATOM 683   H HD22 . ASN A 1 44 ? -1.875  7.316   2.278   1.00 0.00 ? 44 ASN A HD22 1  
ATOM 684   N N    . GLU A 1 45 ? -6.871  3.946   4.392   1.00 0.00 ? 45 GLU A N    1  
ATOM 685   C CA   . GLU A 1 45 ? -7.253  3.364   5.669   1.00 0.00 ? 45 GLU A CA   1  
ATOM 686   C C    . GLU A 1 45 ? -7.323  1.843   5.572   1.00 0.00 ? 45 GLU A C    1  
ATOM 687   O O    . GLU A 1 45 ? -7.241  1.141   6.580   1.00 0.00 ? 45 GLU A O    1  
ATOM 688   C CB   . GLU A 1 45 ? -8.601  3.923   6.127   1.00 0.00 ? 45 GLU A CB   1  
ATOM 689   C CG   . GLU A 1 45 ? -8.494  5.257   6.847   1.00 0.00 ? 45 GLU A CG   1  
ATOM 690   C CD   . GLU A 1 45 ? -9.831  5.961   6.971   1.00 0.00 ? 45 GLU A CD   1  
ATOM 691   O OE1  . GLU A 1 45 ? -10.697 5.464   7.722   1.00 0.00 ? 45 GLU A OE1  1  
ATOM 692   O OE2  . GLU A 1 45 ? -10.013 7.011   6.318   1.00 0.00 ? 45 GLU A OE2  1  
ATOM 693   H H    . GLU A 1 45 ? -7.547  4.397   3.853   1.00 0.00 ? 45 GLU A H    1  
ATOM 694   H HA   . GLU A 1 45 ? -6.499  3.632   6.388   1.00 0.00 ? 45 GLU A HA   1  
ATOM 695   H HB2  . GLU A 1 45 ? -9.236  4.054   5.263   1.00 0.00 ? 45 GLU A HB2  1  
ATOM 696   H HB3  . GLU A 1 45 ? -9.063  3.213   6.798   1.00 0.00 ? 45 GLU A HB3  1  
ATOM 697   H HG2  . GLU A 1 45 ? -8.102  5.087   7.838   1.00 0.00 ? 45 GLU A HG2  1  
ATOM 698   H HG3  . GLU A 1 45 ? -7.817  5.895   6.297   1.00 0.00 ? 45 GLU A HG3  1  
ATOM 699   N N    . LEU A 1 46 ? -7.479  1.342   4.351   1.00 0.00 ? 46 LEU A N    1  
ATOM 700   C CA   . LEU A 1 46 ? -7.565  -0.091  4.116   1.00 0.00 ? 46 LEU A CA   1  
ATOM 701   C C    . LEU A 1 46 ? -6.192  -0.742  4.177   1.00 0.00 ? 46 LEU A C    1  
ATOM 702   O O    . LEU A 1 46 ? -6.051  -1.879  4.626   1.00 0.00 ? 46 LEU A O    1  
ATOM 703   C CB   . LEU A 1 46 ? -8.219  -0.370  2.764   1.00 0.00 ? 46 LEU A CB   1  
ATOM 704   C CG   . LEU A 1 46 ? -9.465  -1.255  2.814   1.00 0.00 ? 46 LEU A CG   1  
ATOM 705   C CD1  . LEU A 1 46 ? -10.095 -1.364  1.434   1.00 0.00 ? 46 LEU A CD1  1  
ATOM 706   C CD2  . LEU A 1 46 ? -9.115  -2.634  3.351   1.00 0.00 ? 46 LEU A CD2  1  
ATOM 707   H H    . LEU A 1 46 ? -7.542  1.950   3.591   1.00 0.00 ? 46 LEU A H    1  
ATOM 708   H HA   . LEU A 1 46 ? -8.172  -0.508  4.888   1.00 0.00 ? 46 LEU A HA   1  
ATOM 709   H HB2  . LEU A 1 46 ? -8.491  0.575   2.318   1.00 0.00 ? 46 LEU A HB2  1  
ATOM 710   H HB3  . LEU A 1 46 ? -7.492  -0.850  2.132   1.00 0.00 ? 46 LEU A HB3  1  
ATOM 711   H HG   . LEU A 1 46 ? -10.190 -0.809  3.478   1.00 0.00 ? 46 LEU A HG   1  
ATOM 712   H HD11 . LEU A 1 46 ? -10.582 -0.432  1.186   1.00 0.00 ? 46 LEU A HD11 1  
ATOM 713   H HD12 . LEU A 1 46 ? -10.822 -2.162  1.432   1.00 0.00 ? 46 LEU A HD12 1  
ATOM 714   H HD13 . LEU A 1 46 ? -9.327  -1.574  0.703   1.00 0.00 ? 46 LEU A HD13 1  
ATOM 715   H HD21 . LEU A 1 46 ? -8.582  -2.532  4.285   1.00 0.00 ? 46 LEU A HD21 1  
ATOM 716   H HD22 . LEU A 1 46 ? -8.492  -3.151  2.636   1.00 0.00 ? 46 LEU A HD22 1  
ATOM 717   H HD23 . LEU A 1 46 ? -10.022 -3.198  3.513   1.00 0.00 ? 46 LEU A HD23 1  
ATOM 718   N N    . ILE A 1 47 ? -5.182  -0.012  3.730   1.00 0.00 ? 47 ILE A N    1  
ATOM 719   C CA   . ILE A 1 47 ? -3.819  -0.524  3.745   1.00 0.00 ? 47 ILE A CA   1  
ATOM 720   C C    . ILE A 1 47 ? -3.228  -0.410  5.139   1.00 0.00 ? 47 ILE A C    1  
ATOM 721   O O    . ILE A 1 47 ? -2.425  -1.243  5.557   1.00 0.00 ? 47 ILE A O    1  
ATOM 722   C CB   . ILE A 1 47 ? -2.876  0.181   2.730   1.00 0.00 ? 47 ILE A CB   1  
ATOM 723   C CG1  . ILE A 1 47 ? -3.519  1.437   2.123   1.00 0.00 ? 47 ILE A CG1  1  
ATOM 724   C CG2  . ILE A 1 47 ? -2.464  -0.789  1.632   1.00 0.00 ? 47 ILE A CG2  1  
ATOM 725   C CD1  . ILE A 1 47 ? -4.565  1.146   1.065   1.00 0.00 ? 47 ILE A CD1  1  
ATOM 726   H H    . ILE A 1 47 ? -5.360  0.883   3.396   1.00 0.00 ? 47 ILE A H    1  
ATOM 727   H HA   . ILE A 1 47 ? -3.873  -1.566  3.491   1.00 0.00 ? 47 ILE A HA   1  
ATOM 728   H HB   . ILE A 1 47 ? -1.981  0.472   3.260   1.00 0.00 ? 47 ILE A HB   1  
ATOM 729   H HG12 . ILE A 1 47 ? -3.990  2.009   2.907   1.00 0.00 ? 47 ILE A HG12 1  
ATOM 730   H HG13 . ILE A 1 47 ? -2.746  2.038   1.666   1.00 0.00 ? 47 ILE A HG13 1  
ATOM 731   H HG21 . ILE A 1 47 ? -3.311  -0.995  0.995   1.00 0.00 ? 47 ILE A HG21 1  
ATOM 732   H HG22 . ILE A 1 47 ? -2.116  -1.710  2.077   1.00 0.00 ? 47 ILE A HG22 1  
ATOM 733   H HG23 . ILE A 1 47 ? -1.670  -0.351  1.044   1.00 0.00 ? 47 ILE A HG23 1  
ATOM 734   H HD11 . ILE A 1 47 ? -5.321  0.492   1.474   1.00 0.00 ? 47 ILE A HD11 1  
ATOM 735   H HD12 . ILE A 1 47 ? -4.096  0.667   0.219   1.00 0.00 ? 47 ILE A HD12 1  
ATOM 736   H HD13 . ILE A 1 47 ? -5.023  2.071   0.747   1.00 0.00 ? 47 ILE A HD13 1  
ATOM 737   N N    . ALA A 1 48 ? -3.645  0.619   5.859   1.00 0.00 ? 48 ALA A N    1  
ATOM 738   C CA   . ALA A 1 48 ? -3.174  0.837   7.213   1.00 0.00 ? 48 ALA A CA   1  
ATOM 739   C C    . ALA A 1 48 ? -3.861  -0.119  8.175   1.00 0.00 ? 48 ALA A C    1  
ATOM 740   O O    . ALA A 1 48 ? -3.297  -0.497  9.202   1.00 0.00 ? 48 ALA A O    1  
ATOM 741   C CB   . ALA A 1 48 ? -3.400  2.281   7.634   1.00 0.00 ? 48 ALA A CB   1  
ATOM 742   H H    . ALA A 1 48 ? -4.292  1.237   5.473   1.00 0.00 ? 48 ALA A H    1  
ATOM 743   H HA   . ALA A 1 48 ? -2.119  0.639   7.226   1.00 0.00 ? 48 ALA A HA   1  
ATOM 744   H HB1  . ALA A 1 48 ? -4.460  2.478   7.691   1.00 0.00 ? 48 ALA A HB1  1  
ATOM 745   H HB2  . ALA A 1 48 ? -2.950  2.942   6.907   1.00 0.00 ? 48 ALA A HB2  1  
ATOM 746   H HB3  . ALA A 1 48 ? -2.949  2.449   8.601   1.00 0.00 ? 48 ALA A HB3  1  
ATOM 747   N N    . ARG A 1 49 ? -5.077  -0.520  7.826   1.00 0.00 ? 49 ARG A N    1  
ATOM 748   C CA   . ARG A 1 49 ? -5.833  -1.447  8.649   1.00 0.00 ? 49 ARG A CA   1  
ATOM 749   C C    . ARG A 1 49 ? -5.196  -2.827  8.598   1.00 0.00 ? 49 ARG A C    1  
ATOM 750   O O    . ARG A 1 49 ? -5.274  -3.598  9.555   1.00 0.00 ? 49 ARG A O    1  
ATOM 751   C CB   . ARG A 1 49 ? -7.289  -1.517  8.187   1.00 0.00 ? 49 ARG A CB   1  
ATOM 752   C CG   . ARG A 1 49 ? -8.200  -0.528  8.895   1.00 0.00 ? 49 ARG A CG   1  
ATOM 753   C CD   . ARG A 1 49 ? -9.658  -0.749  8.525   1.00 0.00 ? 49 ARG A CD   1  
ATOM 754   N NE   . ARG A 1 49 ? -10.078 0.108   7.419   1.00 0.00 ? 49 ARG A NE   1  
ATOM 755   C CZ   . ARG A 1 49 ? -11.350 0.367   7.123   1.00 0.00 ? 49 ARG A CZ   1  
ATOM 756   N NH1  . ARG A 1 49 ? -12.328 -0.162  7.848   1.00 0.00 ? 49 ARG A NH1  1  
ATOM 757   N NH2  . ARG A 1 49 ? -11.644 1.158   6.100   1.00 0.00 ? 49 ARG A NH2  1  
ATOM 758   H H    . ARG A 1 49 ? -5.468  -0.193  6.991   1.00 0.00 ? 49 ARG A H    1  
ATOM 759   H HA   . ARG A 1 49 ? -5.797  -1.089  9.661   1.00 0.00 ? 49 ARG A HA   1  
ATOM 760   H HB2  . ARG A 1 49 ? -7.328  -1.314  7.127   1.00 0.00 ? 49 ARG A HB2  1  
ATOM 761   H HB3  . ARG A 1 49 ? -7.665  -2.513  8.368   1.00 0.00 ? 49 ARG A HB3  1  
ATOM 762   H HG2  . ARG A 1 49 ? -8.088  -0.650  9.962   1.00 0.00 ? 49 ARG A HG2  1  
ATOM 763   H HG3  . ARG A 1 49 ? -7.915  0.475   8.614   1.00 0.00 ? 49 ARG A HG3  1  
ATOM 764   H HD2  . ARG A 1 49 ? -9.790  -1.782  8.238   1.00 0.00 ? 49 ARG A HD2  1  
ATOM 765   H HD3  . ARG A 1 49 ? -10.272 -0.535  9.387   1.00 0.00 ? 49 ARG A HD3  1  
ATOM 766   H HE   . ARG A 1 49 ? -9.376  0.511   6.867   1.00 0.00 ? 49 ARG A HE   1  
ATOM 767   H HH11 . ARG A 1 49 ? -12.113 -0.759  8.620   1.00 0.00 ? 49 ARG A HH11 1  
ATOM 768   H HH12 . ARG A 1 49 ? -13.281 0.037   7.621   1.00 0.00 ? 49 ARG A HH12 1  
ATOM 769   H HH21 . ARG A 1 49 ? -10.911 1.559   5.551   1.00 0.00 ? 49 ARG A HH21 1  
ATOM 770   H HH22 . ARG A 1 49 ? -12.600 1.353   5.878   1.00 0.00 ? 49 ARG A HH22 1  
ATOM 771   N N    . TYR A 1 50 ? -4.553  -3.123  7.476   1.00 0.00 ? 50 TYR A N    1  
ATOM 772   C CA   . TYR A 1 50 ? -3.885  -4.400  7.296   1.00 0.00 ? 50 TYR A CA   1  
ATOM 773   C C    . TYR A 1 50 ? -2.676  -4.498  8.203   1.00 0.00 ? 50 TYR A C    1  
ATOM 774   O O    . TYR A 1 50 ? -2.535  -5.440  8.982   1.00 0.00 ? 50 TYR A O    1  
ATOM 775   C CB   . TYR A 1 50 ? -3.453  -4.575  5.852   1.00 0.00 ? 50 TYR A CB   1  
ATOM 776   C CG   . TYR A 1 50 ? -3.197  -6.013  5.468   1.00 0.00 ? 50 TYR A CG   1  
ATOM 777   C CD1  . TYR A 1 50 ? -2.020  -6.647  5.843   1.00 0.00 ? 50 TYR A CD1  1  
ATOM 778   C CD2  . TYR A 1 50 ? -4.129  -6.737  4.736   1.00 0.00 ? 50 TYR A CD2  1  
ATOM 779   C CE1  . TYR A 1 50 ? -1.777  -7.962  5.499   1.00 0.00 ? 50 TYR A CE1  1  
ATOM 780   C CE2  . TYR A 1 50 ? -3.894  -8.054  4.389   1.00 0.00 ? 50 TYR A CE2  1  
ATOM 781   C CZ   . TYR A 1 50 ? -2.717  -8.662  4.772   1.00 0.00 ? 50 TYR A CZ   1  
ATOM 782   O OH   . TYR A 1 50 ? -2.479  -9.972  4.428   1.00 0.00 ? 50 TYR A OH   1  
ATOM 783   H H    . TYR A 1 50 ? -4.520  -2.461  6.756   1.00 0.00 ? 50 TYR A H    1  
ATOM 784   H HA   . TYR A 1 50 ? -4.567  -5.171  7.549   1.00 0.00 ? 50 TYR A HA   1  
ATOM 785   H HB2  . TYR A 1 50 ? -4.216  -4.181  5.202   1.00 0.00 ? 50 TYR A HB2  1  
ATOM 786   H HB3  . TYR A 1 50 ? -2.545  -4.028  5.704   1.00 0.00 ? 50 TYR A HB3  1  
ATOM 787   H HD1  . TYR A 1 50 ? -1.287  -6.097  6.413   1.00 0.00 ? 50 TYR A HD1  1  
ATOM 788   H HD2  . TYR A 1 50 ? -5.050  -6.258  4.437   1.00 0.00 ? 50 TYR A HD2  1  
ATOM 789   H HE1  . TYR A 1 50 ? -0.855  -8.435  5.801   1.00 0.00 ? 50 TYR A HE1  1  
ATOM 790   H HE2  . TYR A 1 50 ? -4.631  -8.602  3.819   1.00 0.00 ? 50 TYR A HE2  1  
ATOM 791   H HH   . TYR A 1 50 ? -2.761  -10.122 3.522   1.00 0.00 ? 50 TYR A HH   1  
ATOM 792   N N    . ILE A 1 51 ? -1.810  -3.509  8.092   1.00 0.00 ? 51 ILE A N    1  
ATOM 793   C CA   . ILE A 1 51 ? -0.602  -3.462  8.902   1.00 0.00 ? 51 ILE A CA   1  
ATOM 794   C C    . ILE A 1 51 ? -0.952  -3.388  10.382  1.00 0.00 ? 51 ILE A C    1  
ATOM 795   O O    . ILE A 1 51 ? -0.195  -3.852  11.235  1.00 0.00 ? 51 ILE A O    1  
ATOM 796   C CB   . ILE A 1 51 ? 0.318   -2.273  8.534   1.00 0.00 ? 51 ILE A CB   1  
ATOM 797   C CG1  . ILE A 1 51 ? -0.423  -1.223  7.700   1.00 0.00 ? 51 ILE A CG1  1  
ATOM 798   C CG2  . ILE A 1 51 ? 1.546   -2.772  7.785   1.00 0.00 ? 51 ILE A CG2  1  
ATOM 799   C CD1  . ILE A 1 51 ? 0.319   0.090   7.582   1.00 0.00 ? 51 ILE A CD1  1  
ATOM 800   H H    . ILE A 1 51 ? -1.995  -2.793  7.452   1.00 0.00 ? 51 ILE A H    1  
ATOM 801   H HA   . ILE A 1 51 ? -0.060  -4.376  8.727   1.00 0.00 ? 51 ILE A HA   1  
ATOM 802   H HB   . ILE A 1 51 ? 0.651   -1.816  9.450   1.00 0.00 ? 51 ILE A HB   1  
ATOM 803   H HG12 . ILE A 1 51 ? -0.574  -1.607  6.703   1.00 0.00 ? 51 ILE A HG12 1  
ATOM 804   H HG13 . ILE A 1 51 ? -1.383  -1.023  8.154   1.00 0.00 ? 51 ILE A HG13 1  
ATOM 805   H HG21 . ILE A 1 51 ? 1.334   -3.740  7.353   1.00 0.00 ? 51 ILE A HG21 1  
ATOM 806   H HG22 . ILE A 1 51 ? 2.375   -2.858  8.472   1.00 0.00 ? 51 ILE A HG22 1  
ATOM 807   H HG23 . ILE A 1 51 ? 1.799   -2.074  7.001   1.00 0.00 ? 51 ILE A HG23 1  
ATOM 808   H HD11 . ILE A 1 51 ? 1.246   0.030   8.132   1.00 0.00 ? 51 ILE A HD11 1  
ATOM 809   H HD12 . ILE A 1 51 ? -0.289  0.886   7.987   1.00 0.00 ? 51 ILE A HD12 1  
ATOM 810   H HD13 . ILE A 1 51 ? 0.530   0.293   6.542   1.00 0.00 ? 51 ILE A HD13 1  
ATOM 811   N N    . LYS A 1 52 ? -2.109  -2.811  10.677  1.00 0.00 ? 52 LYS A N    1  
ATOM 812   C CA   . LYS A 1 52 ? -2.570  -2.685  12.050  1.00 0.00 ? 52 LYS A CA   1  
ATOM 813   C C    . LYS A 1 52 ? -3.010  -4.038  12.596  1.00 0.00 ? 52 LYS A C    1  
ATOM 814   O O    . LYS A 1 52 ? -2.949  -4.286  13.801  1.00 0.00 ? 52 LYS A O    1  
ATOM 815   C CB   . LYS A 1 52 ? -3.724  -1.684  12.137  1.00 0.00 ? 52 LYS A CB   1  
ATOM 816   C CG   . LYS A 1 52 ? -4.055  -1.260  13.558  1.00 0.00 ? 52 LYS A CG   1  
ATOM 817   C CD   . LYS A 1 52 ? -3.261  -0.031  13.972  1.00 0.00 ? 52 LYS A CD   1  
ATOM 818   C CE   . LYS A 1 52 ? -4.089  0.900   14.842  1.00 0.00 ? 52 LYS A CE   1  
ATOM 819   N NZ   . LYS A 1 52 ? -4.665  2.028   14.058  1.00 0.00 ? 52 LYS A NZ   1  
ATOM 820   H H    . LYS A 1 52 ? -2.668  -2.468  9.953   1.00 0.00 ? 52 LYS A H    1  
ATOM 821   H HA   . LYS A 1 52 ? -1.747  -2.325  12.638  1.00 0.00 ? 52 LYS A HA   1  
ATOM 822   H HB2  . LYS A 1 52 ? -3.463  -0.802  11.572  1.00 0.00 ? 52 LYS A HB2  1  
ATOM 823   H HB3  . LYS A 1 52 ? -4.606  -2.131  11.703  1.00 0.00 ? 52 LYS A HB3  1  
ATOM 824   H HG2  . LYS A 1 52 ? -5.109  -1.032  13.619  1.00 0.00 ? 52 LYS A HG2  1  
ATOM 825   H HG3  . LYS A 1 52 ? -3.821  -2.072  14.230  1.00 0.00 ? 52 LYS A HG3  1  
ATOM 826   H HD2  . LYS A 1 52 ? -2.391  -0.347  14.527  1.00 0.00 ? 52 LYS A HD2  1  
ATOM 827   H HD3  . LYS A 1 52 ? -2.951  0.500   13.084  1.00 0.00 ? 52 LYS A HD3  1  
ATOM 828   H HE2  . LYS A 1 52 ? -4.894  0.336   15.288  1.00 0.00 ? 52 LYS A HE2  1  
ATOM 829   H HE3  . LYS A 1 52 ? -3.457  1.301   15.621  1.00 0.00 ? 52 LYS A HE3  1  
ATOM 830   H HZ1  . LYS A 1 52 ? -4.788  2.861   14.668  1.00 0.00 ? 52 LYS A HZ1  1  
ATOM 831   H HZ2  . LYS A 1 52 ? -5.591  1.757   13.670  1.00 0.00 ? 52 LYS A HZ2  1  
ATOM 832   H HZ3  . LYS A 1 52 ? -4.031  2.277   13.272  1.00 0.00 ? 52 LYS A HZ3  1  
ATOM 833   N N    . LEU A 1 53 ? -3.453  -4.910  11.698  1.00 0.00 ? 53 LEU A N    1  
ATOM 834   C CA   . LEU A 1 53 ? -3.905  -6.239  12.075  1.00 0.00 ? 53 LEU A CA   1  
ATOM 835   C C    . LEU A 1 53 ? -2.739  -7.228  12.131  1.00 0.00 ? 53 LEU A C    1  
ATOM 836   O O    . LEU A 1 53 ? -2.857  -8.305  12.716  1.00 0.00 ? 53 LEU A O    1  
ATOM 837   C CB   . LEU A 1 53 ? -4.966  -6.735  11.089  1.00 0.00 ? 53 LEU A CB   1  
ATOM 838   C CG   . LEU A 1 53 ? -6.363  -6.932  11.686  1.00 0.00 ? 53 LEU A CG   1  
ATOM 839   C CD1  . LEU A 1 53 ? -7.399  -6.147  10.897  1.00 0.00 ? 53 LEU A CD1  1  
ATOM 840   C CD2  . LEU A 1 53 ? -6.725  -8.410  11.720  1.00 0.00 ? 53 LEU A CD2  1  
ATOM 841   H H    . LEU A 1 53 ? -3.477  -4.651  10.759  1.00 0.00 ? 53 LEU A H    1  
ATOM 842   H HA   . LEU A 1 53 ? -4.345  -6.165  13.053  1.00 0.00 ? 53 LEU A HA   1  
ATOM 843   H HB2  . LEU A 1 53 ? -5.038  -6.018  10.283  1.00 0.00 ? 53 LEU A HB2  1  
ATOM 844   H HB3  . LEU A 1 53 ? -4.637  -7.678  10.679  1.00 0.00 ? 53 LEU A HB3  1  
ATOM 845   H HG   . LEU A 1 53 ? -6.368  -6.563  12.701  1.00 0.00 ? 53 LEU A HG   1  
ATOM 846   H HD11 . LEU A 1 53 ? -7.058  -6.021  9.879   1.00 0.00 ? 53 LEU A HD11 1  
ATOM 847   H HD12 . LEU A 1 53 ? -7.539  -5.177  11.351  1.00 0.00 ? 53 LEU A HD12 1  
ATOM 848   H HD13 . LEU A 1 53 ? -8.336  -6.684  10.898  1.00 0.00 ? 53 LEU A HD13 1  
ATOM 849   H HD21 . LEU A 1 53 ? -6.262  -8.875  12.577  1.00 0.00 ? 53 LEU A HD21 1  
ATOM 850   H HD22 . LEU A 1 53 ? -6.373  -8.888  10.817  1.00 0.00 ? 53 LEU A HD22 1  
ATOM 851   H HD23 . LEU A 1 53 ? -7.798  -8.516  11.788  1.00 0.00 ? 53 LEU A HD23 1  
ATOM 852   N N    . ARG A 1 54 ? -1.619  -6.859  11.515  1.00 0.00 ? 54 ARG A N    1  
ATOM 853   C CA   . ARG A 1 54 ? -0.438  -7.717  11.490  1.00 0.00 ? 54 ARG A CA   1  
ATOM 854   C C    . ARG A 1 54 ? -0.017  -8.126  12.893  1.00 0.00 ? 54 ARG A C    1  
ATOM 855   O O    . ARG A 1 54 ? 0.044   -9.311  13.219  1.00 0.00 ? 54 ARG A O    1  
ATOM 856   C CB   . ARG A 1 54 ? 0.719   -7.006  10.786  1.00 0.00 ? 54 ARG A CB   1  
ATOM 857   C CG   . ARG A 1 54 ? 1.724   -7.958  10.157  1.00 0.00 ? 54 ARG A CG   1  
ATOM 858   C CD   . ARG A 1 54 ? 1.597   -7.990  8.641   1.00 0.00 ? 54 ARG A CD   1  
ATOM 859   N NE   . ARG A 1 54 ? 1.000   -9.237  8.168   1.00 0.00 ? 54 ARG A NE   1  
ATOM 860   C CZ   . ARG A 1 54 ? -0.309  -9.481  8.169   1.00 0.00 ? 54 ARG A CZ   1  
ATOM 861   N NH1  . ARG A 1 54 ? -1.162  -8.567  8.616   1.00 0.00 ? 54 ARG A NH1  1  
ATOM 862   N NH2  . ARG A 1 54 ? -0.767  -10.642 7.720   1.00 0.00 ? 54 ARG A NH2  1  
ATOM 863   H H    . ARG A 1 54 ? -1.586  -5.991  11.061  1.00 0.00 ? 54 ARG A H    1  
ATOM 864   H HA   . ARG A 1 54 ? -0.688  -8.601  10.940  1.00 0.00 ? 54 ARG A HA   1  
ATOM 865   H HB2  . ARG A 1 54 ? 0.318   -6.372  10.009  1.00 0.00 ? 54 ARG A HB2  1  
ATOM 866   H HB3  . ARG A 1 54 ? 1.240   -6.392  11.506  1.00 0.00 ? 54 ARG A HB3  1  
ATOM 867   H HG2  . ARG A 1 54 ? 2.721   -7.636  10.416  1.00 0.00 ? 54 ARG A HG2  1  
ATOM 868   H HG3  . ARG A 1 54 ? 1.554   -8.952  10.544  1.00 0.00 ? 54 ARG A HG3  1  
ATOM 869   H HD2  . ARG A 1 54 ? 0.978   -7.163  8.325   1.00 0.00 ? 54 ARG A HD2  1  
ATOM 870   H HD3  . ARG A 1 54 ? 2.581   -7.887  8.208   1.00 0.00 ? 54 ARG A HD3  1  
ATOM 871   H HE   . ARG A 1 54 ? 1.606   -9.929  7.831   1.00 0.00 ? 54 ARG A HE   1  
ATOM 872   H HH11 . ARG A 1 54 ? -0.824  -7.690  8.955   1.00 0.00 ? 54 ARG A HH11 1  
ATOM 873   H HH12 . ARG A 1 54 ? -2.144  -8.757  8.613   1.00 0.00 ? 54 ARG A HH12 1  
ATOM 874   H HH21 . ARG A 1 54 ? -0.129  -11.333 7.382   1.00 0.00 ? 54 ARG A HH21 1  
ATOM 875   H HH22 . ARG A 1 54 ? -1.750  -10.825 7.721   1.00 0.00 ? 54 ARG A HH22 1  
ATOM 876   N N    . THR A 1 55 ? 0.276   -7.134  13.713  1.00 0.00 ? 55 THR A N    1  
ATOM 877   C CA   . THR A 1 55 ? 0.699   -7.370  15.085  1.00 0.00 ? 55 THR A CA   1  
ATOM 878   C C    . THR A 1 55 ? 0.551   -6.109  15.931  1.00 0.00 ? 55 THR A C    1  
ATOM 879   O O    . THR A 1 55 ? 1.309   -5.892  16.876  1.00 0.00 ? 55 THR A O    1  
ATOM 880   C CB   . THR A 1 55 ? 2.150   -7.852  15.114  1.00 0.00 ? 55 THR A CB   1  
ATOM 881   O OG1  . THR A 1 55 ? 2.537   -8.200  16.432  1.00 0.00 ? 55 THR A OG1  1  
ATOM 882   C CG2  . THR A 1 55 ? 3.134   -6.822  14.603  1.00 0.00 ? 55 THR A CG2  1  
ATOM 883   H H    . THR A 1 55 ? 0.207   -6.221  13.385  1.00 0.00 ? 55 THR A H    1  
ATOM 884   H HA   . THR A 1 55 ? 0.065   -8.139  15.494  1.00 0.00 ? 55 THR A HA   1  
ATOM 885   H HB   . THR A 1 55 ? 2.237   -8.730  14.491  1.00 0.00 ? 55 THR A HB   1  
ATOM 886   H HG1  . THR A 1 55 ? 3.428   -8.557  16.420  1.00 0.00 ? 55 THR A HG1  1  
ATOM 887   H HG21 . THR A 1 55 ? 2.908   -5.860  15.039  1.00 0.00 ? 55 THR A HG21 1  
ATOM 888   H HG22 . THR A 1 55 ? 3.060   -6.756  13.527  1.00 0.00 ? 55 THR A HG22 1  
ATOM 889   H HG23 . THR A 1 55 ? 4.137   -7.114  14.877  1.00 0.00 ? 55 THR A HG23 1  
ATOM 890   N N    . GLY A 1 56 ? -0.429  -5.282  15.585  1.00 0.00 ? 56 GLY A N    1  
ATOM 891   C CA   . GLY A 1 56 ? -0.657  -4.054  16.323  1.00 0.00 ? 56 GLY A CA   1  
ATOM 892   C C    . GLY A 1 56 ? 0.507   -3.084  16.228  1.00 0.00 ? 56 GLY A C    1  
ATOM 893   O O    . GLY A 1 56 ? 0.581   -2.119  16.989  1.00 0.00 ? 56 GLY A O    1  
ATOM 894   H H    . GLY A 1 56 ? -1.002  -5.506  14.824  1.00 0.00 ? 56 GLY A H    1  
ATOM 895   H HA2  . GLY A 1 56 ? -1.543  -3.573  15.933  1.00 0.00 ? 56 GLY A HA2  1  
ATOM 896   H HA3  . GLY A 1 56 ? -0.823  -4.299  17.361  1.00 0.00 ? 56 GLY A HA3  1  
ATOM 897   N N    . LYS A 1 57 ? 1.418   -3.338  15.293  1.00 0.00 ? 57 LYS A N    1  
ATOM 898   C CA   . LYS A 1 57 ? 2.578   -2.480  15.104  1.00 0.00 ? 57 LYS A CA   1  
ATOM 899   C C    . LYS A 1 57 ? 2.186   -1.188  14.394  1.00 0.00 ? 57 LYS A C    1  
ATOM 900   O O    . LYS A 1 57 ? 1.002   -0.913  14.198  1.00 0.00 ? 57 LYS A O    1  
ATOM 901   C CB   . LYS A 1 57 ? 3.656   -3.212  14.308  1.00 0.00 ? 57 LYS A CB   1  
ATOM 902   C CG   . LYS A 1 57 ? 4.953   -3.407  15.076  1.00 0.00 ? 57 LYS A CG   1  
ATOM 903   C CD   . LYS A 1 57 ? 4.726   -4.178  16.367  1.00 0.00 ? 57 LYS A CD   1  
ATOM 904   C CE   . LYS A 1 57 ? 5.595   -3.645  17.494  1.00 0.00 ? 57 LYS A CE   1  
ATOM 905   N NZ   . LYS A 1 57 ? 4.945   -2.512  18.209  1.00 0.00 ? 57 LYS A NZ   1  
ATOM 906   H H    . LYS A 1 57 ? 1.309   -4.117  14.716  1.00 0.00 ? 57 LYS A H    1  
ATOM 907   H HA   . LYS A 1 57 ? 2.968   -2.240  16.074  1.00 0.00 ? 57 LYS A HA   1  
ATOM 908   H HB2  . LYS A 1 57 ? 3.280   -4.183  14.028  1.00 0.00 ? 57 LYS A HB2  1  
ATOM 909   H HB3  . LYS A 1 57 ? 3.874   -2.648  13.415  1.00 0.00 ? 57 LYS A HB3  1  
ATOM 910   H HG2  . LYS A 1 57 ? 5.647   -3.956  14.458  1.00 0.00 ? 57 LYS A HG2  1  
ATOM 911   H HG3  . LYS A 1 57 ? 5.368   -2.438  15.314  1.00 0.00 ? 57 LYS A HG3  1  
ATOM 912   H HD2  . LYS A 1 57 ? 3.689   -4.086  16.652  1.00 0.00 ? 57 LYS A HD2  1  
ATOM 913   H HD3  . LYS A 1 57 ? 4.965   -5.218  16.200  1.00 0.00 ? 57 LYS A HD3  1  
ATOM 914   H HE2  . LYS A 1 57 ? 5.780   -4.443  18.197  1.00 0.00 ? 57 LYS A HE2  1  
ATOM 915   H HE3  . LYS A 1 57 ? 6.533   -3.307  17.079  1.00 0.00 ? 57 LYS A HE3  1  
ATOM 916   H HZ1  . LYS A 1 57 ? 5.539   -2.205  19.006  1.00 0.00 ? 57 LYS A HZ1  1  
ATOM 917   H HZ2  . LYS A 1 57 ? 4.018   -2.805  18.576  1.00 0.00 ? 57 LYS A HZ2  1  
ATOM 918   H HZ3  . LYS A 1 57 ? 4.811   -1.710  17.560  1.00 0.00 ? 57 LYS A HZ3  1  
ATOM 919   N N    . THR A 1 58 ? 3.185   -0.400  14.008  1.00 0.00 ? 58 THR A N    1  
ATOM 920   C CA   . THR A 1 58 ? 2.942   0.862   13.315  1.00 0.00 ? 58 THR A CA   1  
ATOM 921   C C    . THR A 1 58 ? 1.945   0.672   12.174  1.00 0.00 ? 58 THR A C    1  
ATOM 922   O O    . THR A 1 58 ? 1.604   -0.456  11.818  1.00 0.00 ? 58 THR A O    1  
ATOM 923   C CB   . THR A 1 58 ? 4.254   1.435   12.775  1.00 0.00 ? 58 THR A CB   1  
ATOM 924   O OG1  . THR A 1 58 ? 4.060   2.744   12.272  1.00 0.00 ? 58 THR A OG1  1  
ATOM 925   C CG2  . THR A 1 58 ? 4.863   0.603   11.666  1.00 0.00 ? 58 THR A CG2  1  
ATOM 926   H H    . THR A 1 58 ? 4.108   -0.675  14.190  1.00 0.00 ? 58 THR A H    1  
ATOM 927   H HA   . THR A 1 58 ? 2.524   1.556   14.029  1.00 0.00 ? 58 THR A HA   1  
ATOM 928   H HB   . THR A 1 58 ? 4.971   1.485   13.582  1.00 0.00 ? 58 THR A HB   1  
ATOM 929   H HG1  . THR A 1 58 ? 4.620   3.359   12.752  1.00 0.00 ? 58 THR A HG1  1  
ATOM 930   H HG21 . THR A 1 58 ? 5.939   0.680   11.708  1.00 0.00 ? 58 THR A HG21 1  
ATOM 931   H HG22 . THR A 1 58 ? 4.513   0.966   10.711  1.00 0.00 ? 58 THR A HG22 1  
ATOM 932   H HG23 . THR A 1 58 ? 4.571   -0.430  11.788  1.00 0.00 ? 58 THR A HG23 1  
ATOM 933   N N    . ARG A 1 59 ? 1.489   1.778   11.596  1.00 0.00 ? 59 ARG A N    1  
ATOM 934   C CA   . ARG A 1 59 ? 0.549   1.725   10.496  1.00 0.00 ? 59 ARG A CA   1  
ATOM 935   C C    . ARG A 1 59 ? 0.650   2.985   9.651   1.00 0.00 ? 59 ARG A C    1  
ATOM 936   O O    . ARG A 1 59 ? -0.279  3.792   9.595   1.00 0.00 ? 59 ARG A O    1  
ATOM 937   C CB   . ARG A 1 59 ? -0.879  1.552   11.019  1.00 0.00 ? 59 ARG A CB   1  
ATOM 938   C CG   . ARG A 1 59 ? -1.289  2.611   12.028  1.00 0.00 ? 59 ARG A CG   1  
ATOM 939   C CD   . ARG A 1 59 ? -0.846  2.242   13.435  1.00 0.00 ? 59 ARG A CD   1  
ATOM 940   N NE   . ARG A 1 59 ? -1.459  3.101   14.445  1.00 0.00 ? 59 ARG A NE   1  
ATOM 941   C CZ   . ARG A 1 59 ? -1.087  4.359   14.674  1.00 0.00 ? 59 ARG A CZ   1  
ATOM 942   N NH1  . ARG A 1 59 ? -0.105  4.907   13.968  1.00 0.00 ? 59 ARG A NH1  1  
ATOM 943   N NH2  . ARG A 1 59 ? -1.698  5.071   15.611  1.00 0.00 ? 59 ARG A NH2  1  
ATOM 944   H H    . ARG A 1 59 ? 1.805   2.646   11.904  1.00 0.00 ? 59 ARG A H    1  
ATOM 945   H HA   . ARG A 1 59 ? 0.807   0.876   9.887   1.00 0.00 ? 59 ARG A HA   1  
ATOM 946   H HB2  . ARG A 1 59 ? -1.563  1.595   10.185  1.00 0.00 ? 59 ARG A HB2  1  
ATOM 947   H HB3  . ARG A 1 59 ? -0.962  0.584   11.491  1.00 0.00 ? 59 ARG A HB3  1  
ATOM 948   H HG2  . ARG A 1 59 ? -0.835  3.552   11.754  1.00 0.00 ? 59 ARG A HG2  1  
ATOM 949   H HG3  . ARG A 1 59 ? -2.365  2.711   12.013  1.00 0.00 ? 59 ARG A HG3  1  
ATOM 950   H HD2  . ARG A 1 59 ? -1.126  1.218   13.629  1.00 0.00 ? 59 ARG A HD2  1  
ATOM 951   H HD3  . ARG A 1 59 ? 0.228   2.339   13.497  1.00 0.00 ? 59 ARG A HD3  1  
ATOM 952   H HE   . ARG A 1 59 ? -2.186  2.722   14.981  1.00 0.00 ? 59 ARG A HE   1  
ATOM 953   H HH11 . ARG A 1 59 ? 0.359   4.375   13.259  1.00 0.00 ? 59 ARG A HH11 1  
ATOM 954   H HH12 . ARG A 1 59 ? 0.170   5.852   14.144  1.00 0.00 ? 59 ARG A HH12 1  
ATOM 955   H HH21 . ARG A 1 59 ? -2.438  4.663   16.145  1.00 0.00 ? 59 ARG A HH21 1  
ATOM 956   H HH22 . ARG A 1 59 ? -1.418  6.015   15.783  1.00 0.00 ? 59 ARG A HH22 1  
ATOM 957   N N    . THR A 1 60 ? 1.786   3.140   8.990   1.00 0.00 ? 60 THR A N    1  
ATOM 958   C CA   . THR A 1 60 ? 2.023   4.295   8.134   1.00 0.00 ? 60 THR A CA   1  
ATOM 959   C C    . THR A 1 60 ? 1.021   4.321   6.985   1.00 0.00 ? 60 THR A C    1  
ATOM 960   O O    . THR A 1 60 ? 0.683   3.280   6.423   1.00 0.00 ? 60 THR A O    1  
ATOM 961   C CB   . THR A 1 60 ? 3.452   4.267   7.586   1.00 0.00 ? 60 THR A CB   1  
ATOM 962   O OG1  . THR A 1 60 ? 4.019   2.976   7.725   1.00 0.00 ? 60 THR A OG1  1  
ATOM 963   C CG2  . THR A 1 60 ? 4.376   5.249   8.274   1.00 0.00 ? 60 THR A CG2  1  
ATOM 964   H H    . THR A 1 60 ? 2.484   2.460   9.083   1.00 0.00 ? 60 THR A H    1  
ATOM 965   H HA   . THR A 1 60 ? 1.893   5.182   8.734   1.00 0.00 ? 60 THR A HA   1  
ATOM 966   H HB   . THR A 1 60 ? 3.430   4.515   6.535   1.00 0.00 ? 60 THR A HB   1  
ATOM 967   H HG1  . THR A 1 60 ? 4.871   2.951   7.283   1.00 0.00 ? 60 THR A HG1  1  
ATOM 968   H HG21 . THR A 1 60 ? 5.160   5.544   7.592   1.00 0.00 ? 60 THR A HG21 1  
ATOM 969   H HG22 . THR A 1 60 ? 4.813   4.783   9.145   1.00 0.00 ? 60 THR A HG22 1  
ATOM 970   H HG23 . THR A 1 60 ? 3.814   6.120   8.576   1.00 0.00 ? 60 THR A HG23 1  
ATOM 971   N N    . ARG A 1 61 ? 0.544   5.513   6.640   1.00 0.00 ? 61 ARG A N    1  
ATOM 972   C CA   . ARG A 1 61 ? -0.419  5.663   5.563   1.00 0.00 ? 61 ARG A CA   1  
ATOM 973   C C    . ARG A 1 61 ? 0.208   6.351   4.361   1.00 0.00 ? 61 ARG A C    1  
ATOM 974   O O    . ARG A 1 61 ? -0.065  5.998   3.213   1.00 0.00 ? 61 ARG A O    1  
ATOM 975   C CB   . ARG A 1 61 ? -1.641  6.449   6.041   1.00 0.00 ? 61 ARG A CB   1  
ATOM 976   C CG   . ARG A 1 61 ? -1.313  7.856   6.514   1.00 0.00 ? 61 ARG A CG   1  
ATOM 977   C CD   . ARG A 1 61 ? -2.528  8.537   7.123   1.00 0.00 ? 61 ARG A CD   1  
ATOM 978   N NE   . ARG A 1 61 ? -2.377  9.989   7.168   1.00 0.00 ? 61 ARG A NE   1  
ATOM 979   C CZ   . ARG A 1 61 ? -3.106  10.786  7.946   1.00 0.00 ? 61 ARG A CZ   1  
ATOM 980   N NH1  . ARG A 1 61 ? -4.036  10.277  8.743   1.00 0.00 ? 61 ARG A NH1  1  
ATOM 981   N NH2  . ARG A 1 61 ? -2.903  12.097  7.926   1.00 0.00 ? 61 ARG A NH2  1  
ATOM 982   H H    . ARG A 1 61 ? 0.843   6.305   7.119   1.00 0.00 ? 61 ARG A H    1  
ATOM 983   H HA   . ARG A 1 61 ? -0.725  4.683   5.273   1.00 0.00 ? 61 ARG A HA   1  
ATOM 984   H HB2  . ARG A 1 61 ? -2.348  6.522   5.229   1.00 0.00 ? 61 ARG A HB2  1  
ATOM 985   H HB3  . ARG A 1 61 ? -2.100  5.915   6.860   1.00 0.00 ? 61 ARG A HB3  1  
ATOM 986   H HG2  . ARG A 1 61 ? -0.533  7.802   7.259   1.00 0.00 ? 61 ARG A HG2  1  
ATOM 987   H HG3  . ARG A 1 61 ? -0.969  8.438   5.671   1.00 0.00 ? 61 ARG A HG3  1  
ATOM 988   H HD2  . ARG A 1 61 ? -3.396  8.293   6.528   1.00 0.00 ? 61 ARG A HD2  1  
ATOM 989   H HD3  . ARG A 1 61 ? -2.666  8.167   8.128   1.00 0.00 ? 61 ARG A HD3  1  
ATOM 990   H HE   . ARG A 1 61 ? -1.697  10.391  6.588   1.00 0.00 ? 61 ARG A HE   1  
ATOM 991   H HH11 . ARG A 1 61 ? -4.194  9.290   8.763   1.00 0.00 ? 61 ARG A HH11 1  
ATOM 992   H HH12 . ARG A 1 61 ? -4.580  10.882  9.326   1.00 0.00 ? 61 ARG A HH12 1  
ATOM 993   H HH21 . ARG A 1 61 ? -2.203  12.486  7.327   1.00 0.00 ? 61 ARG A HH21 1  
ATOM 994   H HH22 . ARG A 1 61 ? -3.450  12.696  8.510   1.00 0.00 ? 61 ARG A HH22 1  
ATOM 995   N N    . LYS A 1 62 ? 1.049   7.333   4.636   1.00 0.00 ? 62 LYS A N    1  
ATOM 996   C CA   . LYS A 1 62 ? 1.723   8.079   3.586   1.00 0.00 ? 62 LYS A CA   1  
ATOM 997   C C    . LYS A 1 62 ? 2.806   7.234   2.931   1.00 0.00 ? 62 LYS A C    1  
ATOM 998   O O    . LYS A 1 62 ? 3.106   7.395   1.748   1.00 0.00 ? 62 LYS A O    1  
ATOM 999   C CB   . LYS A 1 62 ? 2.322   9.366   4.148   1.00 0.00 ? 62 LYS A CB   1  
ATOM 1000  C CG   . LYS A 1 62 ? 1.817   10.624  3.461   1.00 0.00 ? 62 LYS A CG   1  
ATOM 1001  C CD   . LYS A 1 62 ? 0.693   11.276  4.249   1.00 0.00 ? 62 LYS A CD   1  
ATOM 1002  C CE   . LYS A 1 62 ? 0.790   12.793  4.206   1.00 0.00 ? 62 LYS A CE   1  
ATOM 1003  N NZ   . LYS A 1 62 ? -0.554  13.435  4.182   1.00 0.00 ? 62 LYS A NZ   1  
ATOM 1004  H H    . LYS A 1 62 ? 1.219   7.559   5.569   1.00 0.00 ? 62 LYS A H    1  
ATOM 1005  H HA   . LYS A 1 62 ? 0.993   8.330   2.846   1.00 0.00 ? 62 LYS A HA   1  
ATOM 1006  H HB2  . LYS A 1 62 ? 2.080   9.432   5.198   1.00 0.00 ? 62 LYS A HB2  1  
ATOM 1007  H HB3  . LYS A 1 62 ? 3.392   9.326   4.036   1.00 0.00 ? 62 LYS A HB3  1  
ATOM 1008  H HG2  . LYS A 1 62 ? 2.633   11.325  3.369   1.00 0.00 ? 62 LYS A HG2  1  
ATOM 1009  H HG3  . LYS A 1 62 ? 1.451   10.363  2.478   1.00 0.00 ? 62 LYS A HG3  1  
ATOM 1010  H HD2  . LYS A 1 62 ? -0.254  10.974  3.826   1.00 0.00 ? 62 LYS A HD2  1  
ATOM 1011  H HD3  . LYS A 1 62 ? 0.751   10.950  5.277   1.00 0.00 ? 62 LYS A HD3  1  
ATOM 1012  H HE2  . LYS A 1 62 ? 1.325   13.132  5.080   1.00 0.00 ? 62 LYS A HE2  1  
ATOM 1013  H HE3  . LYS A 1 62 ? 1.333   13.081  3.317   1.00 0.00 ? 62 LYS A HE3  1  
ATOM 1014  H HZ1  . LYS A 1 62 ? -0.456  14.470  4.227   1.00 0.00 ? 62 LYS A HZ1  1  
ATOM 1015  H HZ2  . LYS A 1 62 ? -1.117  13.116  4.996   1.00 0.00 ? 62 LYS A HZ2  1  
ATOM 1016  H HZ3  . LYS A 1 62 ? -1.055  13.182  3.307   1.00 0.00 ? 62 LYS A HZ3  1  
ATOM 1017  N N    . GLN A 1 63 ? 3.385   6.331   3.708   1.00 0.00 ? 63 GLN A N    1  
ATOM 1018  C CA   . GLN A 1 63 ? 4.430   5.454   3.209   1.00 0.00 ? 63 GLN A CA   1  
ATOM 1019  C C    . GLN A 1 63 ? 3.834   4.314   2.396   1.00 0.00 ? 63 GLN A C    1  
ATOM 1020  O O    . GLN A 1 63 ? 4.455   3.813   1.459   1.00 0.00 ? 63 GLN A O    1  
ATOM 1021  C CB   . GLN A 1 63 ? 5.264   4.906   4.364   1.00 0.00 ? 63 GLN A CB   1  
ATOM 1022  C CG   . GLN A 1 63 ? 6.722   5.333   4.317   1.00 0.00 ? 63 GLN A CG   1  
ATOM 1023  C CD   . GLN A 1 63 ? 7.658   4.271   4.861   1.00 0.00 ? 63 GLN A CD   1  
ATOM 1024  O OE1  . GLN A 1 63 ? 7.329   3.085   4.875   1.00 0.00 ? 63 GLN A OE1  1  
ATOM 1025  N NE2  . GLN A 1 63 ? 8.834   4.694   5.312   1.00 0.00 ? 63 GLN A NE2  1  
ATOM 1026  H H    . GLN A 1 63 ? 3.099   6.252   4.636   1.00 0.00 ? 63 GLN A H    1  
ATOM 1027  H HA   . GLN A 1 63 ? 5.060   6.036   2.572   1.00 0.00 ? 63 GLN A HA   1  
ATOM 1028  H HB2  . GLN A 1 63 ? 4.840   5.254   5.292   1.00 0.00 ? 63 GLN A HB2  1  
ATOM 1029  H HB3  . GLN A 1 63 ? 5.227   3.829   4.341   1.00 0.00 ? 63 GLN A HB3  1  
ATOM 1030  H HG2  . GLN A 1 63 ? 6.992   5.537   3.292   1.00 0.00 ? 63 GLN A HG2  1  
ATOM 1031  H HG3  . GLN A 1 63 ? 6.840   6.232   4.906   1.00 0.00 ? 63 GLN A HG3  1  
ATOM 1032  H HE21 . GLN A 1 63 ? 9.028   5.653   5.270   1.00 0.00 ? 63 GLN A HE21 1  
ATOM 1033  H HE22 . GLN A 1 63 ? 9.458   4.029   5.669   1.00 0.00 ? 63 GLN A HE22 1  
ATOM 1034  N N    . VAL A 1 64 ? 2.624   3.914   2.760   1.00 0.00 ? 64 VAL A N    1  
ATOM 1035  C CA   . VAL A 1 64 ? 1.936   2.840   2.065   1.00 0.00 ? 64 VAL A CA   1  
ATOM 1036  C C    . VAL A 1 64 ? 1.296   3.342   0.777   1.00 0.00 ? 64 VAL A C    1  
ATOM 1037  O O    . VAL A 1 64 ? 1.010   2.561   -0.128  1.00 0.00 ? 64 VAL A O    1  
ATOM 1038  C CB   . VAL A 1 64 ? 0.854   2.188   2.948   1.00 0.00 ? 64 VAL A CB   1  
ATOM 1039  C CG1  . VAL A 1 64 ? 0.228   0.997   2.237   1.00 0.00 ? 64 VAL A CG1  1  
ATOM 1040  C CG2  . VAL A 1 64 ? 1.439   1.769   4.287   1.00 0.00 ? 64 VAL A CG2  1  
ATOM 1041  H H    . VAL A 1 64 ? 2.183   4.355   3.510   1.00 0.00 ? 64 VAL A H    1  
ATOM 1042  H HA   . VAL A 1 64 ? 2.669   2.093   1.818   1.00 0.00 ? 64 VAL A HA   1  
ATOM 1043  H HB   . VAL A 1 64 ? 0.079   2.918   3.130   1.00 0.00 ? 64 VAL A HB   1  
ATOM 1044  H HG11 . VAL A 1 64 ? 0.929   0.597   1.519   1.00 0.00 ? 64 VAL A HG11 1  
ATOM 1045  H HG12 . VAL A 1 64 ? -0.670  1.313   1.728   1.00 0.00 ? 64 VAL A HG12 1  
ATOM 1046  H HG13 . VAL A 1 64 ? -0.018  0.234   2.962   1.00 0.00 ? 64 VAL A HG13 1  
ATOM 1047  H HG21 . VAL A 1 64 ? 0.638   1.501   4.961   1.00 0.00 ? 64 VAL A HG21 1  
ATOM 1048  H HG22 . VAL A 1 64 ? 2.003   2.589   4.706   1.00 0.00 ? 64 VAL A HG22 1  
ATOM 1049  H HG23 . VAL A 1 64 ? 2.090   0.919   4.146   1.00 0.00 ? 64 VAL A HG23 1  
ATOM 1050  N N    . SER A 1 65 ? 1.088   4.651   0.693   1.00 0.00 ? 65 SER A N    1  
ATOM 1051  C CA   . SER A 1 65 ? 0.500   5.249   -0.491  1.00 0.00 ? 65 SER A CA   1  
ATOM 1052  C C    . SER A 1 65 ? 1.585   5.529   -1.513  1.00 0.00 ? 65 SER A C    1  
ATOM 1053  O O    . SER A 1 65 ? 1.372   5.420   -2.721  1.00 0.00 ? 65 SER A O    1  
ATOM 1054  C CB   . SER A 1 65 ? -0.239  6.540   -0.133  1.00 0.00 ? 65 SER A CB   1  
ATOM 1055  O OG   . SER A 1 65 ? 0.653   7.640   -0.067  1.00 0.00 ? 65 SER A OG   1  
ATOM 1056  H H    . SER A 1 65 ? 1.348   5.228   1.435   1.00 0.00 ? 65 SER A H    1  
ATOM 1057  H HA   . SER A 1 65 ? -0.192  4.543   -0.902  1.00 0.00 ? 65 SER A HA   1  
ATOM 1058  H HB2  . SER A 1 65 ? -0.987  6.745   -0.884  1.00 0.00 ? 65 SER A HB2  1  
ATOM 1059  H HB3  . SER A 1 65 ? -0.717  6.423   0.828   1.00 0.00 ? 65 SER A HB3  1  
ATOM 1060  H HG   . SER A 1 65 ? 0.416   8.285   -0.737  1.00 0.00 ? 65 SER A HG   1  
ATOM 1061  N N    . SER A 1 66 ? 2.755   5.874   -1.004  1.00 0.00 ? 66 SER A N    1  
ATOM 1062  C CA   . SER A 1 66 ? 3.905   6.158   -1.839  1.00 0.00 ? 66 SER A CA   1  
ATOM 1063  C C    . SER A 1 66 ? 4.419   4.882   -2.486  1.00 0.00 ? 66 SER A C    1  
ATOM 1064  O O    . SER A 1 66 ? 4.924   4.895   -3.608  1.00 0.00 ? 66 SER A O    1  
ATOM 1065  C CB   . SER A 1 66 ? 5.002   6.800   -1.002  1.00 0.00 ? 66 SER A CB   1  
ATOM 1066  O OG   . SER A 1 66 ? 5.548   7.935   -1.652  1.00 0.00 ? 66 SER A OG   1  
ATOM 1067  H H    . SER A 1 66 ? 2.850   5.928   -0.033  1.00 0.00 ? 66 SER A H    1  
ATOM 1068  H HA   . SER A 1 66 ? 3.603   6.839   -2.603  1.00 0.00 ? 66 SER A HA   1  
ATOM 1069  H HB2  . SER A 1 66 ? 4.592   7.103   -0.051  1.00 0.00 ? 66 SER A HB2  1  
ATOM 1070  H HB3  . SER A 1 66 ? 5.781   6.081   -0.842  1.00 0.00 ? 66 SER A HB3  1  
ATOM 1071  H HG   . SER A 1 66 ? 6.475   7.779   -1.843  1.00 0.00 ? 66 SER A HG   1  
ATOM 1072  N N    . HIS A 1 67 ? 4.285   3.781   -1.760  1.00 0.00 ? 67 HIS A N    1  
ATOM 1073  C CA   . HIS A 1 67 ? 4.734   2.484   -2.246  1.00 0.00 ? 67 HIS A CA   1  
ATOM 1074  C C    . HIS A 1 67 ? 3.866   2.000   -3.398  1.00 0.00 ? 67 HIS A C    1  
ATOM 1075  O O    . HIS A 1 67 ? 4.355   1.372   -4.337  1.00 0.00 ? 67 HIS A O    1  
ATOM 1076  C CB   . HIS A 1 67 ? 4.725   1.457   -1.113  1.00 0.00 ? 67 HIS A CB   1  
ATOM 1077  C CG   . HIS A 1 67 ? 5.598   0.270   -1.378  1.00 0.00 ? 67 HIS A CG   1  
ATOM 1078  N ND1  . HIS A 1 67 ? 6.551   -0.178  -0.487  1.00 0.00 ? 67 HIS A ND1  1  
ATOM 1079  C CD2  . HIS A 1 67 ? 5.660   -0.565  -2.442  1.00 0.00 ? 67 HIS A CD2  1  
ATOM 1080  C CE1  . HIS A 1 67 ? 7.161   -1.235  -0.992  1.00 0.00 ? 67 HIS A CE1  1  
ATOM 1081  N NE2  . HIS A 1 67 ? 6.638   -1.491  -2.176  1.00 0.00 ? 67 HIS A NE2  1  
ATOM 1082  H H    . HIS A 1 67 ? 3.877   3.846   -0.873  1.00 0.00 ? 67 HIS A H    1  
ATOM 1083  H HA   . HIS A 1 67 ? 5.737   2.603   -2.604  1.00 0.00 ? 67 HIS A HA   1  
ATOM 1084  H HB2  . HIS A 1 67 ? 5.072   1.929   -0.206  1.00 0.00 ? 67 HIS A HB2  1  
ATOM 1085  H HB3  . HIS A 1 67 ? 3.716   1.102   -0.966  1.00 0.00 ? 67 HIS A HB3  1  
ATOM 1086  H HD1  . HIS A 1 67 ? 6.752   0.222   0.386   1.00 0.00 ? 67 HIS A HD1  1  
ATOM 1087  H HD2  . HIS A 1 67 ? 5.050   -0.513  -3.333  1.00 0.00 ? 67 HIS A HD2  1  
ATOM 1088  H HE1  . HIS A 1 67 ? 7.952   -1.796  -0.515  1.00 0.00 ? 67 HIS A HE1  1  
ATOM 1089  H HE2  . HIS A 1 67 ? 6.843   -2.276  -2.726  1.00 0.00 ? 67 HIS A HE2  1  
ATOM 1090  N N    . ILE A 1 68 ? 2.579   2.299   -3.322  1.00 0.00 ? 68 ILE A N    1  
ATOM 1091  C CA   . ILE A 1 68 ? 1.643   1.898   -4.363  1.00 0.00 ? 68 ILE A CA   1  
ATOM 1092  C C    . ILE A 1 68 ? 1.850   2.725   -5.622  1.00 0.00 ? 68 ILE A C    1  
ATOM 1093  O O    . ILE A 1 68 ? 1.604   2.258   -6.735  1.00 0.00 ? 68 ILE A O    1  
ATOM 1094  C CB   . ILE A 1 68 ? 0.179   2.032   -3.900  1.00 0.00 ? 68 ILE A CB   1  
ATOM 1095  C CG1  . ILE A 1 68 ? -0.021  1.335   -2.554  1.00 0.00 ? 68 ILE A CG1  1  
ATOM 1096  C CG2  . ILE A 1 68 ? -0.766  1.452   -4.944  1.00 0.00 ? 68 ILE A CG2  1  
ATOM 1097  C CD1  . ILE A 1 68 ? -1.120  1.949   -1.714  1.00 0.00 ? 68 ILE A CD1  1  
ATOM 1098  H H    . ILE A 1 68 ? 2.253   2.804   -2.552  1.00 0.00 ? 68 ILE A H    1  
ATOM 1099  H HA   . ILE A 1 68 ? 1.835   0.866   -4.592  1.00 0.00 ? 68 ILE A HA   1  
ATOM 1100  H HB   . ILE A 1 68 ? -0.047  3.082   -3.790  1.00 0.00 ? 68 ILE A HB   1  
ATOM 1101  H HG12 . ILE A 1 68 ? -0.276  0.300   -2.725  1.00 0.00 ? 68 ILE A HG12 1  
ATOM 1102  H HG13 . ILE A 1 68 ? 0.898   1.386   -1.989  1.00 0.00 ? 68 ILE A HG13 1  
ATOM 1103  H HG21 . ILE A 1 68 ? -1.598  2.126   -5.089  1.00 0.00 ? 68 ILE A HG21 1  
ATOM 1104  H HG22 . ILE A 1 68 ? -1.134  0.495   -4.605  1.00 0.00 ? 68 ILE A HG22 1  
ATOM 1105  H HG23 . ILE A 1 68 ? -0.239  1.325   -5.877  1.00 0.00 ? 68 ILE A HG23 1  
ATOM 1106  H HD11 . ILE A 1 68 ? -2.078  1.580   -2.049  1.00 0.00 ? 68 ILE A HD11 1  
ATOM 1107  H HD12 . ILE A 1 68 ? -1.092  3.024   -1.818  1.00 0.00 ? 68 ILE A HD12 1  
ATOM 1108  H HD13 . ILE A 1 68 ? -0.973  1.683   -0.678  1.00 0.00 ? 68 ILE A HD13 1  
ATOM 1109  N N    . GLN A 1 69 ? 2.311   3.953   -5.438  1.00 0.00 ? 69 GLN A N    1  
ATOM 1110  C CA   . GLN A 1 69 ? 2.564   4.849   -6.554  1.00 0.00 ? 69 GLN A CA   1  
ATOM 1111  C C    . GLN A 1 69 ? 3.815   4.422   -7.310  1.00 0.00 ? 69 GLN A C    1  
ATOM 1112  O O    . GLN A 1 69 ? 3.945   4.670   -8.509  1.00 0.00 ? 69 GLN A O    1  
ATOM 1113  C CB   . GLN A 1 69 ? 2.709   6.290   -6.062  1.00 0.00 ? 69 GLN A CB   1  
ATOM 1114  C CG   . GLN A 1 69 ? 1.429   6.863   -5.476  1.00 0.00 ? 69 GLN A CG   1  
ATOM 1115  C CD   . GLN A 1 69 ? 1.145   8.271   -5.961  1.00 0.00 ? 69 GLN A CD   1  
ATOM 1116  O OE1  . GLN A 1 69 ? 1.551   8.657   -7.057  1.00 0.00 ? 69 GLN A OE1  1  
ATOM 1117  N NE2  . GLN A 1 69 ? 0.444   9.048   -5.144  1.00 0.00 ? 69 GLN A NE2  1  
ATOM 1118  H H    . GLN A 1 69 ? 2.491   4.261   -4.530  1.00 0.00 ? 69 GLN A H    1  
ATOM 1119  H HA   . GLN A 1 69 ? 1.722   4.786   -7.218  1.00 0.00 ? 69 GLN A HA   1  
ATOM 1120  H HB2  . GLN A 1 69 ? 3.475   6.322   -5.301  1.00 0.00 ? 69 GLN A HB2  1  
ATOM 1121  H HB3  . GLN A 1 69 ? 3.012   6.912   -6.891  1.00 0.00 ? 69 GLN A HB3  1  
ATOM 1122  H HG2  . GLN A 1 69 ? 0.603   6.229   -5.759  1.00 0.00 ? 69 GLN A HG2  1  
ATOM 1123  H HG3  . GLN A 1 69 ? 1.517   6.879   -4.400  1.00 0.00 ? 69 GLN A HG3  1  
ATOM 1124  H HE21 . GLN A 1 69 ? 0.153   8.674   -4.286  1.00 0.00 ? 69 GLN A HE21 1  
ATOM 1125  H HE22 . GLN A 1 69 ? 0.245   9.963   -5.432  1.00 0.00 ? 69 GLN A HE22 1  
ATOM 1126  N N    . VAL A 1 70 ? 4.729   3.773   -6.601  1.00 0.00 ? 70 VAL A N    1  
ATOM 1127  C CA   . VAL A 1 70 ? 5.967   3.302   -7.201  1.00 0.00 ? 70 VAL A CA   1  
ATOM 1128  C C    . VAL A 1 70 ? 5.711   2.118   -8.120  1.00 0.00 ? 70 VAL A C    1  
ATOM 1129  O O    . VAL A 1 70 ? 6.431   1.907   -9.096  1.00 0.00 ? 70 VAL A O    1  
ATOM 1130  C CB   . VAL A 1 70 ? 6.997   2.900   -6.139  1.00 0.00 ? 70 VAL A CB   1  
ATOM 1131  C CG1  . VAL A 1 70 ? 8.364   2.690   -6.771  1.00 0.00 ? 70 VAL A CG1  1  
ATOM 1132  C CG2  . VAL A 1 70 ? 7.063   3.938   -5.027  1.00 0.00 ? 70 VAL A CG2  1  
ATOM 1133  H H    . VAL A 1 70 ? 4.564   3.603   -5.653  1.00 0.00 ? 70 VAL A H    1  
ATOM 1134  H HA   . VAL A 1 70 ? 6.378   4.099   -7.773  1.00 0.00 ? 70 VAL A HA   1  
ATOM 1135  H HB   . VAL A 1 70 ? 6.679   1.971   -5.715  1.00 0.00 ? 70 VAL A HB   1  
ATOM 1136  H HG11 . VAL A 1 70 ? 8.963   3.579   -6.636  1.00 0.00 ? 70 VAL A HG11 1  
ATOM 1137  H HG12 . VAL A 1 70 ? 8.246   2.492   -7.826  1.00 0.00 ? 70 VAL A HG12 1  
ATOM 1138  H HG13 . VAL A 1 70 ? 8.853   1.851   -6.300  1.00 0.00 ? 70 VAL A HG13 1  
ATOM 1139  H HG21 . VAL A 1 70 ? 6.517   4.821   -5.325  1.00 0.00 ? 70 VAL A HG21 1  
ATOM 1140  H HG22 . VAL A 1 70 ? 8.094   4.200   -4.839  1.00 0.00 ? 70 VAL A HG22 1  
ATOM 1141  H HG23 . VAL A 1 70 ? 6.626   3.531   -4.128  1.00 0.00 ? 70 VAL A HG23 1  
ATOM 1142  N N    . LEU A 1 71 ? 4.676   1.351   -7.804  1.00 0.00 ? 71 LEU A N    1  
ATOM 1143  C CA   . LEU A 1 71 ? 4.316   0.189   -8.602  1.00 0.00 ? 71 LEU A CA   1  
ATOM 1144  C C    . LEU A 1 71 ? 3.746   0.615   -9.948  1.00 0.00 ? 71 LEU A C    1  
ATOM 1145  O O    . LEU A 1 71 ? 3.883   -0.092  -10.946 1.00 0.00 ? 71 LEU A O    1  
ATOM 1146  C CB   . LEU A 1 71 ? 3.311   -0.683  -7.851  1.00 0.00 ? 71 LEU A CB   1  
ATOM 1147  C CG   . LEU A 1 71 ? 3.796   -2.098  -7.529  1.00 0.00 ? 71 LEU A CG   1  
ATOM 1148  C CD1  . LEU A 1 71 ? 4.897   -2.059  -6.481  1.00 0.00 ? 71 LEU A CD1  1  
ATOM 1149  C CD2  . LEU A 1 71 ? 2.637   -2.961  -7.055  1.00 0.00 ? 71 LEU A CD2  1  
ATOM 1150  H H    . LEU A 1 71 ? 4.142   1.575   -7.017  1.00 0.00 ? 71 LEU A H    1  
ATOM 1151  H HA   . LEU A 1 71 ? 5.208   -0.377  -8.772  1.00 0.00 ? 71 LEU A HA   1  
ATOM 1152  H HB2  . LEU A 1 71 ? 3.065   -0.190  -6.925  1.00 0.00 ? 71 LEU A HB2  1  
ATOM 1153  H HB3  . LEU A 1 71 ? 2.417   -0.761  -8.448  1.00 0.00 ? 71 LEU A HB3  1  
ATOM 1154  H HG   . LEU A 1 71 ? 4.203   -2.544  -8.424  1.00 0.00 ? 71 LEU A HG   1  
ATOM 1155  H HD11 . LEU A 1 71 ? 5.547   -1.218  -6.674  1.00 0.00 ? 71 LEU A HD11 1  
ATOM 1156  H HD12 . LEU A 1 71 ? 5.469   -2.974  -6.526  1.00 0.00 ? 71 LEU A HD12 1  
ATOM 1157  H HD13 . LEU A 1 71 ? 4.457   -1.956  -5.500  1.00 0.00 ? 71 LEU A HD13 1  
ATOM 1158  H HD21 . LEU A 1 71 ? 2.028   -3.243  -7.902  1.00 0.00 ? 71 LEU A HD21 1  
ATOM 1159  H HD22 . LEU A 1 71 ? 2.037   -2.405  -6.350  1.00 0.00 ? 71 LEU A HD22 1  
ATOM 1160  H HD23 . LEU A 1 71 ? 3.022   -3.850  -6.577  1.00 0.00 ? 71 LEU A HD23 1  
ATOM 1161  N N    . ALA A 1 72 ? 3.113   1.780   -9.966  1.00 0.00 ? 72 ALA A N    1  
ATOM 1162  C CA   . ALA A 1 72 ? 2.527   2.311   -11.186 1.00 0.00 ? 72 ALA A CA   1  
ATOM 1163  C C    . ALA A 1 72 ? 3.611   2.743   -12.165 1.00 0.00 ? 72 ALA A C    1  
ATOM 1164  O O    . ALA A 1 72 ? 3.408   2.735   -13.379 1.00 0.00 ? 72 ALA A O    1  
ATOM 1165  C CB   . ALA A 1 72 ? 1.600   3.475   -10.869 1.00 0.00 ? 72 ALA A CB   1  
ATOM 1166  H H    . ALA A 1 72 ? 3.043   2.296   -9.139  1.00 0.00 ? 72 ALA A H    1  
ATOM 1167  H HA   . ALA A 1 72 ? 1.945   1.528   -11.637 1.00 0.00 ? 72 ALA A HA   1  
ATOM 1168  H HB1  . ALA A 1 72 ? 1.594   4.167   -11.698 1.00 0.00 ? 72 ALA A HB1  1  
ATOM 1169  H HB2  . ALA A 1 72 ? 1.949   3.981   -9.980  1.00 0.00 ? 72 ALA A HB2  1  
ATOM 1170  H HB3  . ALA A 1 72 ? 0.600   3.103   -10.702 1.00 0.00 ? 72 ALA A HB3  1  
ATOM 1171  N N    . ARG A 1 73 ? 4.764   3.115   -11.624 1.00 0.00 ? 73 ARG A N    1  
ATOM 1172  C CA   . ARG A 1 73 ? 5.887   3.547   -12.442 1.00 0.00 ? 73 ARG A CA   1  
ATOM 1173  C C    . ARG A 1 73 ? 6.489   2.370   -13.198 1.00 0.00 ? 73 ARG A C    1  
ATOM 1174  O O    . ARG A 1 73 ? 7.053   2.534   -14.280 1.00 0.00 ? 73 ARG A O    1  
ATOM 1175  C CB   . ARG A 1 73 ? 6.955   4.213   -11.572 1.00 0.00 ? 73 ARG A CB   1  
ATOM 1176  C CG   . ARG A 1 73 ? 6.511   5.536   -10.970 1.00 0.00 ? 73 ARG A CG   1  
ATOM 1177  C CD   . ARG A 1 73 ? 7.698   6.432   -10.657 1.00 0.00 ? 73 ARG A CD   1  
ATOM 1178  N NE   . ARG A 1 73 ? 8.380   6.028   -9.429  1.00 0.00 ? 73 ARG A NE   1  
ATOM 1179  C CZ   . ARG A 1 73 ? 9.383   6.709   -8.880  1.00 0.00 ? 73 ARG A CZ   1  
ATOM 1180  N NH1  . ARG A 1 73 ? 9.825   7.826   -9.446  1.00 0.00 ? 73 ARG A NH1  1  
ATOM 1181  N NH2  . ARG A 1 73 ? 9.946   6.273   -7.762  1.00 0.00 ? 73 ARG A NH2  1  
ATOM 1182  H H    . ARG A 1 73 ? 4.861   3.096   -10.653 1.00 0.00 ? 73 ARG A H    1  
ATOM 1183  H HA   . ARG A 1 73 ? 5.517   4.261   -13.153 1.00 0.00 ? 73 ARG A HA   1  
ATOM 1184  H HB2  . ARG A 1 73 ? 7.215   3.544   -10.765 1.00 0.00 ? 73 ARG A HB2  1  
ATOM 1185  H HB3  . ARG A 1 73 ? 7.833   4.393   -12.175 1.00 0.00 ? 73 ARG A HB3  1  
ATOM 1186  H HG2  . ARG A 1 73 ? 5.867   6.042   -11.673 1.00 0.00 ? 73 ARG A HG2  1  
ATOM 1187  H HG3  . ARG A 1 73 ? 5.968   5.340   -10.057 1.00 0.00 ? 73 ARG A HG3  1  
ATOM 1188  H HD2  . ARG A 1 73 ? 8.398   6.381   -11.478 1.00 0.00 ? 73 ARG A HD2  1  
ATOM 1189  H HD3  . ARG A 1 73 ? 7.347   7.447   -10.546 1.00 0.00 ? 73 ARG A HD3  1  
ATOM 1190  H HE   . ARG A 1 73 ? 8.074   5.207   -8.990  1.00 0.00 ? 73 ARG A HE   1  
ATOM 1191  H HH11 . ARG A 1 73 ? 9.404   8.161   -10.289 1.00 0.00 ? 73 ARG A HH11 1  
ATOM 1192  H HH12 . ARG A 1 73 ? 10.579  8.333   -9.028  1.00 0.00 ? 73 ARG A HH12 1  
ATOM 1193  H HH21 . ARG A 1 73 ? 9.617   5.433   -7.331  1.00 0.00 ? 73 ARG A HH21 1  
ATOM 1194  H HH22 . ARG A 1 73 ? 10.700  6.784   -7.349  1.00 0.00 ? 73 ARG A HH22 1  
ATOM 1195  N N    . ARG A 1 74 ? 6.362   1.183   -12.620 1.00 0.00 ? 74 ARG A N    1  
ATOM 1196  C CA   . ARG A 1 74 ? 6.889   -0.027  -13.235 1.00 0.00 ? 74 ARG A CA   1  
ATOM 1197  C C    . ARG A 1 74 ? 6.078   -0.408  -14.466 1.00 0.00 ? 74 ARG A C    1  
ATOM 1198  O O    . ARG A 1 74 ? 6.602   -0.991  -15.415 1.00 0.00 ? 74 ARG A O    1  
ATOM 1199  C CB   . ARG A 1 74 ? 6.889   -1.180  -12.229 1.00 0.00 ? 74 ARG A CB   1  
ATOM 1200  C CG   . ARG A 1 74 ? 8.086   -2.108  -12.367 1.00 0.00 ? 74 ARG A CG   1  
ATOM 1201  C CD   . ARG A 1 74 ? 7.874   -3.129  -13.473 1.00 0.00 ? 74 ARG A CD   1  
ATOM 1202  N NE   . ARG A 1 74 ? 6.656   -3.910  -13.272 1.00 0.00 ? 74 ARG A NE   1  
ATOM 1203  C CZ   . ARG A 1 74 ? 6.195   -4.801  -14.146 1.00 0.00 ? 74 ARG A CZ   1  
ATOM 1204  N NH1  . ARG A 1 74 ? 6.846   -5.028  -15.281 1.00 0.00 ? 74 ARG A NH1  1  
ATOM 1205  N NH2  . ARG A 1 74 ? 5.080   -5.469  -13.885 1.00 0.00 ? 74 ARG A NH2  1  
ATOM 1206  H H    . ARG A 1 74 ? 5.902   1.120   -11.760 1.00 0.00 ? 74 ARG A H    1  
ATOM 1207  H HA   . ARG A 1 74 ? 7.899   0.175   -13.536 1.00 0.00 ? 74 ARG A HA   1  
ATOM 1208  H HB2  . ARG A 1 74 ? 6.892   -0.771  -11.230 1.00 0.00 ? 74 ARG A HB2  1  
ATOM 1209  H HB3  . ARG A 1 74 ? 5.991   -1.764  -12.368 1.00 0.00 ? 74 ARG A HB3  1  
ATOM 1210  H HG2  . ARG A 1 74 ? 8.961   -1.519  -12.597 1.00 0.00 ? 74 ARG A HG2  1  
ATOM 1211  H HG3  . ARG A 1 74 ? 8.235   -2.628  -11.432 1.00 0.00 ? 74 ARG A HG3  1  
ATOM 1212  H HD2  . ARG A 1 74 ? 7.805   -2.608  -14.417 1.00 0.00 ? 74 ARG A HD2  1  
ATOM 1213  H HD3  . ARG A 1 74 ? 8.722   -3.798  -13.494 1.00 0.00 ? 74 ARG A HD3  1  
ATOM 1214  H HE   . ARG A 1 74 ? 6.156   -3.762  -12.443 1.00 0.00 ? 74 ARG A HE   1  
ATOM 1215  H HH11 . ARG A 1 74 ? 7.687   -4.528  -15.484 1.00 0.00 ? 74 ARG A HH11 1  
ATOM 1216  H HH12 . ARG A 1 74 ? 6.494   -5.699  -15.933 1.00 0.00 ? 74 ARG A HH12 1  
ATOM 1217  H HH21 . ARG A 1 74 ? 4.585   -5.303  -13.032 1.00 0.00 ? 74 ARG A HH21 1  
ATOM 1218  H HH22 . ARG A 1 74 ? 4.733   -6.139  -14.541 1.00 0.00 ? 74 ARG A HH22 1  
ATOM 1219  N N    . LYS A 1 75 ? 4.796   -0.073  -14.440 1.00 0.00 ? 75 LYS A N    1  
ATOM 1220  C CA   . LYS A 1 75 ? 3.903   -0.374  -15.548 1.00 0.00 ? 75 LYS A CA   1  
ATOM 1221  C C    . LYS A 1 75 ? 4.082   0.627   -16.684 1.00 0.00 ? 75 LYS A C    1  
ATOM 1222  O O    . LYS A 1 75 ? 3.820   0.318   -17.847 1.00 0.00 ? 75 LYS A O    1  
ATOM 1223  C CB   . LYS A 1 75 ? 2.448   -0.374  -15.075 1.00 0.00 ? 75 LYS A CB   1  
ATOM 1224  C CG   . LYS A 1 75 ? 2.154   -1.419  -14.012 1.00 0.00 ? 75 LYS A CG   1  
ATOM 1225  C CD   . LYS A 1 75 ? 0.890   -1.084  -13.236 1.00 0.00 ? 75 LYS A CD   1  
ATOM 1226  C CE   . LYS A 1 75 ? -0.307  -1.862  -13.757 1.00 0.00 ? 75 LYS A CE   1  
ATOM 1227  N NZ   . LYS A 1 75 ? -0.917  -1.210  -14.949 1.00 0.00 ? 75 LYS A NZ   1  
ATOM 1228  H H    . LYS A 1 75 ? 4.443   0.387   -13.656 1.00 0.00 ? 75 LYS A H    1  
ATOM 1229  H HA   . LYS A 1 75 ? 4.153   -1.353  -15.908 1.00 0.00 ? 75 LYS A HA   1  
ATOM 1230  H HB2  . LYS A 1 75 ? 2.214   0.599   -14.668 1.00 0.00 ? 75 LYS A HB2  1  
ATOM 1231  H HB3  . LYS A 1 75 ? 1.806   -0.564  -15.923 1.00 0.00 ? 75 LYS A HB3  1  
ATOM 1232  H HG2  . LYS A 1 75 ? 2.027   -2.379  -14.489 1.00 0.00 ? 75 LYS A HG2  1  
ATOM 1233  H HG3  . LYS A 1 75 ? 2.987   -1.463  -13.325 1.00 0.00 ? 75 LYS A HG3  1  
ATOM 1234  H HD2  . LYS A 1 75 ? 1.042   -1.331  -12.196 1.00 0.00 ? 75 LYS A HD2  1  
ATOM 1235  H HD3  . LYS A 1 75 ? 0.691   -0.026  -13.332 1.00 0.00 ? 75 LYS A HD3  1  
ATOM 1236  H HE2  . LYS A 1 75 ? 0.017   -2.856  -14.028 1.00 0.00 ? 75 LYS A HE2  1  
ATOM 1237  H HE3  . LYS A 1 75 ? -1.047  -1.927  -12.974 1.00 0.00 ? 75 LYS A HE3  1  
ATOM 1238  H HZ1  . LYS A 1 75 ? -0.548  -1.642  -15.820 1.00 0.00 ? 75 LYS A HZ1  1  
ATOM 1239  H HZ2  . LYS A 1 75 ? -0.692  -0.195  -14.956 1.00 0.00 ? 75 LYS A HZ2  1  
ATOM 1240  H HZ3  . LYS A 1 75 ? -1.951  -1.324  -14.928 1.00 0.00 ? 75 LYS A HZ3  1  
ATOM 1241  N N    . SER A 1 76 ? 4.528   1.827   -16.337 1.00 0.00 ? 76 SER A N    1  
ATOM 1242  C CA   . SER A 1 76 ? 4.743   2.880   -17.321 1.00 0.00 ? 76 SER A CA   1  
ATOM 1243  C C    . SER A 1 76 ? 5.932   2.561   -18.225 1.00 0.00 ? 76 SER A C    1  
ATOM 1244  O O    . SER A 1 76 ? 6.095   3.167   -19.284 1.00 0.00 ? 76 SER A O    1  
ATOM 1245  C CB   . SER A 1 76 ? 4.967   4.221   -16.620 1.00 0.00 ? 76 SER A CB   1  
ATOM 1246  O OG   . SER A 1 76 ? 3.745   4.761   -16.147 1.00 0.00 ? 76 SER A OG   1  
ATOM 1247  H H    . SER A 1 76 ? 4.715   2.010   -15.396 1.00 0.00 ? 76 SER A H    1  
ATOM 1248  H HA   . SER A 1 76 ? 3.855   2.947   -17.926 1.00 0.00 ? 76 SER A HA   1  
ATOM 1249  H HB2  . SER A 1 76 ? 5.632   4.080   -15.781 1.00 0.00 ? 76 SER A HB2  1  
ATOM 1250  H HB3  . SER A 1 76 ? 5.409   4.919   -17.316 1.00 0.00 ? 76 SER A HB3  1  
ATOM 1251  H HG   . SER A 1 76 ? 3.498   4.323   -15.329 1.00 0.00 ? 76 SER A HG   1  
ATOM 1252  N N    . ARG A 1 77 ? 6.761   1.610   -17.803 1.00 0.00 ? 77 ARG A N    1  
ATOM 1253  C CA   . ARG A 1 77 ? 7.930   1.220   -18.574 1.00 0.00 ? 77 ARG A CA   1  
ATOM 1254  C C    . ARG A 1 77 ? 7.606   0.089   -19.550 1.00 0.00 ? 77 ARG A C    1  
ATOM 1255  O O    . ARG A 1 77 ? 8.504   -0.611  -20.018 1.00 0.00 ? 77 ARG A O    1  
ATOM 1256  C CB   . ARG A 1 77 ? 9.063   0.791   -17.639 1.00 0.00 ? 77 ARG A CB   1  
ATOM 1257  C CG   . ARG A 1 77 ? 9.355   1.796   -16.537 1.00 0.00 ? 77 ARG A CG   1  
ATOM 1258  C CD   . ARG A 1 77 ? 10.837  1.844   -16.205 1.00 0.00 ? 77 ARG A CD   1  
ATOM 1259  N NE   . ARG A 1 77 ? 11.127  2.786   -15.126 1.00 0.00 ? 77 ARG A NE   1  
ATOM 1260  C CZ   . ARG A 1 77 ? 11.073  4.109   -15.262 1.00 0.00 ? 77 ARG A CZ   1  
ATOM 1261  N NH1  . ARG A 1 77 ? 10.741  4.650   -16.428 1.00 0.00 ? 77 ARG A NH1  1  
ATOM 1262  N NH2  . ARG A 1 77 ? 11.352  4.893   -14.230 1.00 0.00 ? 77 ARG A NH2  1  
ATOM 1263  H H    . ARG A 1 77 ? 6.587   1.165   -16.955 1.00 0.00 ? 77 ARG A H    1  
ATOM 1264  H HA   . ARG A 1 77 ? 8.249   2.080   -19.133 1.00 0.00 ? 77 ARG A HA   1  
ATOM 1265  H HB2  . ARG A 1 77 ? 8.797   -0.149  -17.178 1.00 0.00 ? 77 ARG A HB2  1  
ATOM 1266  H HB3  . ARG A 1 77 ? 9.962   0.655   -18.221 1.00 0.00 ? 77 ARG A HB3  1  
ATOM 1267  H HG2  . ARG A 1 77 ? 9.038   2.776   -16.863 1.00 0.00 ? 77 ARG A HG2  1  
ATOM 1268  H HG3  . ARG A 1 77 ? 8.805   1.514   -15.651 1.00 0.00 ? 77 ARG A HG3  1  
ATOM 1269  H HD2  . ARG A 1 77 ? 11.158  0.858   -15.904 1.00 0.00 ? 77 ARG A HD2  1  
ATOM 1270  H HD3  . ARG A 1 77 ? 11.381  2.145   -17.089 1.00 0.00 ? 77 ARG A HD3  1  
ATOM 1271  H HE   . ARG A 1 77 ? 11.375  2.413   -14.255 1.00 0.00 ? 77 ARG A HE   1  
ATOM 1272  H HH11 . ARG A 1 77 ? 10.529  4.065   -17.210 1.00 0.00 ? 77 ARG A HH11 1  
ATOM 1273  H HH12 . ARG A 1 77 ? 10.702  5.645   -16.523 1.00 0.00 ? 77 ARG A HH12 1  
ATOM 1274  H HH21 . ARG A 1 77 ? 11.603  4.490   -13.350 1.00 0.00 ? 77 ARG A HH21 1  
ATOM 1275  H HH22 . ARG A 1 77 ? 11.312  5.887   -14.332 1.00 0.00 ? 77 ARG A HH22 1  
ATOM 1276  N N    . ASP A 1 78 ? 6.323   -0.088  -19.854 1.00 0.00 ? 78 ASP A N    1  
ATOM 1277  C CA   . ASP A 1 78 ? 5.894   -1.132  -20.769 1.00 0.00 ? 78 ASP A CA   1  
ATOM 1278  C C    . ASP A 1 78 ? 5.731   -0.592  -22.188 1.00 0.00 ? 78 ASP A C    1  
ATOM 1279  O O    . ASP A 1 78 ? 4.967   -1.137  -22.984 1.00 0.00 ? 78 ASP A O    1  
ATOM 1280  C CB   . ASP A 1 78 ? 4.583   -1.752  -20.289 1.00 0.00 ? 78 ASP A CB   1  
ATOM 1281  C CG   . ASP A 1 78 ? 4.727   -3.224  -19.955 1.00 0.00 ? 78 ASP A CG   1  
ATOM 1282  O OD1  . ASP A 1 78 ? 4.817   -4.041  -20.896 1.00 0.00 ? 78 ASP A OD1  1  
ATOM 1283  O OD2  . ASP A 1 78 ? 4.749   -3.561  -18.752 1.00 0.00 ? 78 ASP A OD2  1  
ATOM 1284  H H    . ASP A 1 78 ? 5.652   0.491   -19.455 1.00 0.00 ? 78 ASP A H    1  
ATOM 1285  H HA   . ASP A 1 78 ? 6.652   -1.888  -20.770 1.00 0.00 ? 78 ASP A HA   1  
ATOM 1286  H HB2  . ASP A 1 78 ? 4.253   -1.234  -19.404 1.00 0.00 ? 78 ASP A HB2  1  
ATOM 1287  H HB3  . ASP A 1 78 ? 3.839   -1.649  -21.062 1.00 0.00 ? 78 ASP A HB3  1  
ATOM 1288  N N    . LEU A 1 79 ? 6.452   0.482   -22.498 1.00 0.00 ? 79 LEU A N    1  
ATOM 1289  C CA   . LEU A 1 79 ? 6.384   1.091   -23.820 1.00 0.00 ? 79 LEU A CA   1  
ATOM 1290  C C    . LEU A 1 79 ? 6.912   0.139   -24.888 1.00 0.00 ? 79 LEU A C    1  
ATOM 1291  O O    . LEU A 1 79 ? 8.118   0.064   -25.124 1.00 0.00 ? 79 LEU A O    1  
ATOM 1292  C CB   . LEU A 1 79 ? 7.181   2.397   -23.845 1.00 0.00 ? 79 LEU A CB   1  
ATOM 1293  C CG   . LEU A 1 79 ? 6.590   3.500   -24.724 1.00 0.00 ? 79 LEU A CG   1  
ATOM 1294  C CD1  . LEU A 1 79 ? 5.151   3.788   -24.324 1.00 0.00 ? 79 LEU A CD1  1  
ATOM 1295  C CD2  . LEU A 1 79 ? 7.433   4.762   -24.633 1.00 0.00 ? 79 LEU A CD2  1  
ATOM 1296  H H    . LEU A 1 79 ? 7.043   0.874   -21.824 1.00 0.00 ? 79 LEU A H    1  
ATOM 1297  H HA   . LEU A 1 79 ? 5.348   1.309   -24.030 1.00 0.00 ? 79 LEU A HA   1  
ATOM 1298  H HB2  . LEU A 1 79 ? 7.252   2.770   -22.834 1.00 0.00 ? 79 LEU A HB2  1  
ATOM 1299  H HB3  . LEU A 1 79 ? 8.177   2.180   -24.201 1.00 0.00 ? 79 LEU A HB3  1  
ATOM 1300  H HG   . LEU A 1 79 ? 6.589   3.170   -25.753 1.00 0.00 ? 79 LEU A HG   1  
ATOM 1301  H HD11 . LEU A 1 79 ? 4.918   4.821   -24.537 1.00 0.00 ? 79 LEU A HD11 1  
ATOM 1302  H HD12 . LEU A 1 79 ? 5.028   3.602   -23.267 1.00 0.00 ? 79 LEU A HD12 1  
ATOM 1303  H HD13 . LEU A 1 79 ? 4.486   3.146   -24.882 1.00 0.00 ? 79 LEU A HD13 1  
ATOM 1304  H HD21 . LEU A 1 79 ? 7.214   5.403   -25.474 1.00 0.00 ? 79 LEU A HD21 1  
ATOM 1305  H HD22 . LEU A 1 79 ? 8.480   4.497   -24.646 1.00 0.00 ? 79 LEU A HD22 1  
ATOM 1306  H HD23 . LEU A 1 79 ? 7.205   5.283   -23.715 1.00 0.00 ? 79 LEU A HD23 1  
ATOM 1307  N N    . VAL A 1 80 ? 6.003   -0.587  -25.529 1.00 0.00 ? 80 VAL A N    1  
ATOM 1308  C CA   . VAL A 1 80 ? 6.377   -1.535  -26.572 1.00 0.00 ? 80 VAL A CA   1  
ATOM 1309  C C    . VAL A 1 80 ? 7.121   -0.834  -27.710 1.00 0.00 ? 80 VAL A C    1  
ATOM 1310  O O    . VAL A 1 80 ? 6.525   -0.072  -28.472 1.00 0.00 ? 80 VAL A O    1  
ATOM 1311  C CB   . VAL A 1 80 ? 5.140   -2.256  -27.143 1.00 0.00 ? 80 VAL A CB   1  
ATOM 1312  C CG1  . VAL A 1 80 ? 4.171   -1.258  -27.758 1.00 0.00 ? 80 VAL A CG1  1  
ATOM 1313  C CG2  . VAL A 1 80 ? 5.553   -3.308  -28.162 1.00 0.00 ? 80 VAL A CG2  1  
ATOM 1314  H H    . VAL A 1 80 ? 5.056   -0.482  -25.296 1.00 0.00 ? 80 VAL A H    1  
ATOM 1315  H HA   . VAL A 1 80 ? 7.026   -2.276  -26.129 1.00 0.00 ? 80 VAL A HA   1  
ATOM 1316  H HB   . VAL A 1 80 ? 4.634   -2.756  -26.329 1.00 0.00 ? 80 VAL A HB   1  
ATOM 1317  H HG11 . VAL A 1 80 ? 4.214   -0.329  -27.208 1.00 0.00 ? 80 VAL A HG11 1  
ATOM 1318  H HG12 . VAL A 1 80 ? 3.168   -1.656  -27.714 1.00 0.00 ? 80 VAL A HG12 1  
ATOM 1319  H HG13 . VAL A 1 80 ? 4.443   -1.080  -28.788 1.00 0.00 ? 80 VAL A HG13 1  
ATOM 1320  H HG21 . VAL A 1 80 ? 5.433   -2.910  -29.159 1.00 0.00 ? 80 VAL A HG21 1  
ATOM 1321  H HG22 . VAL A 1 80 ? 4.934   -4.184  -28.047 1.00 0.00 ? 80 VAL A HG22 1  
ATOM 1322  H HG23 . VAL A 1 80 ? 6.588   -3.575  -28.004 1.00 0.00 ? 80 VAL A HG23 1  
ATOM 1323  N N    . PRO A 1 81 ? 8.438   -1.081  -27.844 1.00 0.00 ? 81 PRO A N    1  
ATOM 1324  C CA   . PRO A 1 81 ? 9.251   -0.464  -28.898 1.00 0.00 ? 81 PRO A CA   1  
ATOM 1325  C C    . PRO A 1 81 ? 8.884   -0.964  -30.292 1.00 0.00 ? 81 PRO A C    1  
ATOM 1326  O O    . PRO A 1 81 ? 9.301   -0.388  -31.297 1.00 0.00 ? 81 PRO A O    1  
ATOM 1327  C CB   . PRO A 1 81 ? 10.678  -0.880  -28.540 1.00 0.00 ? 81 PRO A CB   1  
ATOM 1328  C CG   . PRO A 1 81 ? 10.517  -2.130  -27.754 1.00 0.00 ? 81 PRO A CG   1  
ATOM 1329  C CD   . PRO A 1 81 ? 9.237   -1.973  -26.985 1.00 0.00 ? 81 PRO A CD   1  
ATOM 1330  H HA   . PRO A 1 81 ? 9.174   0.607   -28.873 1.00 0.00 ? 81 PRO A HA   1  
ATOM 1331  H HB2  . PRO A 1 81 ? 11.244  -1.049  -29.445 1.00 0.00 ? 81 PRO A HB2  1  
ATOM 1332  H HB3  . PRO A 1 81 ? 11.147  -0.103  -27.954 1.00 0.00 ? 81 PRO A HB3  1  
ATOM 1333  H HG2  . PRO A 1 81 ? 10.451  -2.973  -28.423 1.00 0.00 ? 81 PRO A HG2  1  
ATOM 1334  H HG3  . PRO A 1 81 ? 11.349  -2.247  -27.078 1.00 0.00 ? 81 PRO A HG3  1  
ATOM 1335  H HD2  . PRO A 1 81 ? 8.750   -2.929  -26.862 1.00 0.00 ? 81 PRO A HD2  1  
ATOM 1336  H HD3  . PRO A 1 81 ? 9.426   -1.516  -26.025 1.00 0.00 ? 81 PRO A HD3  1  
ATOM 1337  N N    . ARG A 1 82 ? 8.103   -2.038  -30.348 1.00 0.00 ? 82 ARG A N    1  
ATOM 1338  C CA   . ARG A 1 82 ? 7.683   -2.611  -31.621 1.00 0.00 ? 82 ARG A CA   1  
ATOM 1339  C C    . ARG A 1 82 ? 8.889   -3.056  -32.442 1.00 0.00 ? 82 ARG A C    1  
ATOM 1340  O O    . ARG A 1 82 ? 9.172   -4.272  -32.465 1.00 0.00 ? 82 ARG A O    1  
ATOM 1341  C CB   . ARG A 1 82 ? 6.858   -1.596  -32.414 1.00 0.00 ? 82 ARG A CB   1  
ATOM 1342  C CG   . ARG A 1 82 ? 5.792   -0.898  -31.585 1.00 0.00 ? 82 ARG A CG   1  
ATOM 1343  C CD   . ARG A 1 82 ? 5.177   0.271   -32.338 1.00 0.00 ? 82 ARG A CD   1  
ATOM 1344  N NE   . ARG A 1 82 ? 4.736   1.332   -31.436 1.00 0.00 ? 82 ARG A NE   1  
ATOM 1345  C CZ   . ARG A 1 82 ? 5.555   2.224   -30.884 1.00 0.00 ? 82 ARG A CZ   1  
ATOM 1346  N NH1  . ARG A 1 82 ? 6.857   2.187   -31.139 1.00 0.00 ? 82 ARG A NH1  1  
ATOM 1347  N NH2  . ARG A 1 82 ? 5.071   3.157   -30.076 1.00 0.00 ? 82 ARG A NH2  1  
ATOM 1348  O OXT  . ARG A 1 82 ? 9.540   -2.184  -33.056 1.00 0.00 ? 82 ARG A OXT  1  
ATOM 1349  H H    . ARG A 1 82 ? 7.802   -2.455  -29.515 1.00 0.00 ? 82 ARG A H    1  
ATOM 1350  H HA   . ARG A 1 82 ? 7.069   -3.474  -31.410 1.00 0.00 ? 82 ARG A HA   1  
ATOM 1351  H HB2  . ARG A 1 82 ? 7.522   -0.844  -32.814 1.00 0.00 ? 82 ARG A HB2  1  
ATOM 1352  H HB3  . ARG A 1 82 ? 6.370   -2.106  -33.232 1.00 0.00 ? 82 ARG A HB3  1  
ATOM 1353  H HG2  . ARG A 1 82 ? 5.014   -1.607  -31.345 1.00 0.00 ? 82 ARG A HG2  1  
ATOM 1354  H HG3  . ARG A 1 82 ? 6.242   -0.531  -30.674 1.00 0.00 ? 82 ARG A HG3  1  
ATOM 1355  H HD2  . ARG A 1 82 ? 5.914   0.672   -33.017 1.00 0.00 ? 82 ARG A HD2  1  
ATOM 1356  H HD3  . ARG A 1 82 ? 4.328   -0.088  -32.901 1.00 0.00 ? 82 ARG A HD3  1  
ATOM 1357  H HE   . ARG A 1 82 ? 3.779   1.382   -31.231 1.00 0.00 ? 82 ARG A HE   1  
ATOM 1358  H HH11 . ARG A 1 82 ? 7.229   1.487   -31.749 1.00 0.00 ? 82 ARG A HH11 1  
ATOM 1359  H HH12 . ARG A 1 82 ? 7.467   2.861   -30.722 1.00 0.00 ? 82 ARG A HH12 1  
ATOM 1360  H HH21 . ARG A 1 82 ? 4.091   3.189   -29.880 1.00 0.00 ? 82 ARG A HH21 1  
ATOM 1361  H HH22 . ARG A 1 82 ? 5.686   3.827   -29.661 1.00 0.00 ? 82 ARG A HH22 1  
ATOM 1362  N N    . MET A 1 1  ? 14.864  15.730  16.904  1.00 0.00 ? 1  MET A N    2  
ATOM 1363  C CA   . MET A 1 1  ? 15.782  14.774  16.230  1.00 0.00 ? 1  MET A CA   2  
ATOM 1364  C C    . MET A 1 1  ? 15.007  13.644  15.561  1.00 0.00 ? 1  MET A C    2  
ATOM 1365  O O    . MET A 1 1  ? 14.321  12.869  16.227  1.00 0.00 ? 1  MET A O    2  
ATOM 1366  C CB   . MET A 1 1  ? 16.746  14.206  17.274  1.00 0.00 ? 1  MET A CB   2  
ATOM 1367  C CG   . MET A 1 1  ? 17.986  15.060  17.484  1.00 0.00 ? 1  MET A CG   2  
ATOM 1368  S SD   . MET A 1 1  ? 18.780  14.752  19.074  1.00 0.00 ? 1  MET A SD   2  
ATOM 1369  C CE   . MET A 1 1  ? 19.668  16.289  19.312  1.00 0.00 ? 1  MET A CE   2  
ATOM 1370  H H1   . MET A 1 1  ? 14.519  15.278  17.774  1.00 0.00 ? 1  MET A H1   2  
ATOM 1371  H H2   . MET A 1 1  ? 14.082  15.932  16.248  1.00 0.00 ? 1  MET A H2   2  
ATOM 1372  H H3   . MET A 1 1  ? 15.406  16.591  17.119  1.00 0.00 ? 1  MET A H3   2  
ATOM 1373  H HA   . MET A 1 1  ? 16.345  15.308  15.480  1.00 0.00 ? 1  MET A HA   2  
ATOM 1374  H HB2  . MET A 1 1  ? 16.228  14.124  18.219  1.00 0.00 ? 1  MET A HB2  2  
ATOM 1375  H HB3  . MET A 1 1  ? 17.061  13.223  16.960  1.00 0.00 ? 1  MET A HB3  2  
ATOM 1376  H HG2  . MET A 1 1  ? 18.693  14.843  16.698  1.00 0.00 ? 1  MET A HG2  2  
ATOM 1377  H HG3  . MET A 1 1  ? 17.703  16.101  17.435  1.00 0.00 ? 1  MET A HG3  2  
ATOM 1378  H HE1  . MET A 1 1  ? 20.016  16.655  18.358  1.00 0.00 ? 1  MET A HE1  2  
ATOM 1379  H HE2  . MET A 1 1  ? 20.513  16.119  19.963  1.00 0.00 ? 1  MET A HE2  2  
ATOM 1380  H HE3  . MET A 1 1  ? 19.010  17.019  19.760  1.00 0.00 ? 1  MET A HE3  2  
ATOM 1381  N N    . ASP A 1 2  ? 15.121  13.557  14.239  1.00 0.00 ? 2  ASP A N    2  
ATOM 1382  C CA   . ASP A 1 2  ? 14.438  12.529  13.477  1.00 0.00 ? 2  ASP A CA   2  
ATOM 1383  C C    . ASP A 1 2  ? 14.896  11.137  13.900  1.00 0.00 ? 2  ASP A C    2  
ATOM 1384  O O    . ASP A 1 2  ? 15.880  10.612  13.378  1.00 0.00 ? 2  ASP A O    2  
ATOM 1385  C CB   . ASP A 1 2  ? 14.699  12.739  11.987  1.00 0.00 ? 2  ASP A CB   2  
ATOM 1386  C CG   . ASP A 1 2  ? 16.163  12.994  11.681  1.00 0.00 ? 2  ASP A CG   2  
ATOM 1387  O OD1  . ASP A 1 2  ? 16.912  12.011  11.500  1.00 0.00 ? 2  ASP A OD1  2  
ATOM 1388  O OD2  . ASP A 1 2  ? 16.559  14.177  11.621  1.00 0.00 ? 2  ASP A OD2  2  
ATOM 1389  H H    . ASP A 1 2  ? 15.680  14.199  13.762  1.00 0.00 ? 2  ASP A H    2  
ATOM 1390  H HA   . ASP A 1 2  ? 13.379  12.622  13.665  1.00 0.00 ? 2  ASP A HA   2  
ATOM 1391  H HB2  . ASP A 1 2  ? 14.393  11.861  11.456  1.00 0.00 ? 2  ASP A HB2  2  
ATOM 1392  H HB3  . ASP A 1 2  ? 14.124  13.585  11.641  1.00 0.00 ? 2  ASP A HB3  2  
ATOM 1393  N N    . ASN A 1 3  ? 14.177  10.546  14.848  1.00 0.00 ? 3  ASN A N    2  
ATOM 1394  C CA   . ASN A 1 3  ? 14.510  9.215   15.342  1.00 0.00 ? 3  ASN A CA   2  
ATOM 1395  C C    . ASN A 1 3  ? 14.438  8.177   14.224  1.00 0.00 ? 3  ASN A C    2  
ATOM 1396  O O    . ASN A 1 3  ? 15.038  7.107   14.319  1.00 0.00 ? 3  ASN A O    2  
ATOM 1397  C CB   . ASN A 1 3  ? 13.573  8.824   16.482  1.00 0.00 ? 3  ASN A CB   2  
ATOM 1398  C CG   . ASN A 1 3  ? 14.310  8.603   17.789  1.00 0.00 ? 3  ASN A CG   2  
ATOM 1399  O OD1  . ASN A 1 3  ? 15.307  7.882   17.838  1.00 0.00 ? 3  ASN A OD1  2  
ATOM 1400  N ND2  . ASN A 1 3  ? 13.823  9.226   18.856  1.00 0.00 ? 3  ASN A ND2  2  
ATOM 1401  H H    . ASN A 1 3  ? 13.404  11.016  15.225  1.00 0.00 ? 3  ASN A H    2  
ATOM 1402  H HA   . ASN A 1 3  ? 15.515  9.246   15.717  1.00 0.00 ? 3  ASN A HA   2  
ATOM 1403  H HB2  . ASN A 1 3  ? 12.851  9.611   16.628  1.00 0.00 ? 3  ASN A HB2  2  
ATOM 1404  H HB3  . ASN A 1 3  ? 13.060  7.912   16.222  1.00 0.00 ? 3  ASN A HB3  2  
ATOM 1405  H HD21 . ASN A 1 3  ? 13.026  9.785   18.742  1.00 0.00 ? 3  ASN A HD21 2  
ATOM 1406  H HD22 . ASN A 1 3  ? 14.280  9.101   19.714  1.00 0.00 ? 3  ASN A HD22 2  
ATOM 1407  N N    . ASP A 1 4  ? 13.701  8.501   13.167  1.00 0.00 ? 4  ASP A N    2  
ATOM 1408  C CA   . ASP A 1 4  ? 13.552  7.596   12.033  1.00 0.00 ? 4  ASP A CA   2  
ATOM 1409  C C    . ASP A 1 4  ? 14.902  7.289   11.391  1.00 0.00 ? 4  ASP A C    2  
ATOM 1410  O O    . ASP A 1 4  ? 15.058  6.281   10.702  1.00 0.00 ? 4  ASP A O    2  
ATOM 1411  C CB   . ASP A 1 4  ? 12.602  8.195   10.999  1.00 0.00 ? 4  ASP A CB   2  
ATOM 1412  C CG   . ASP A 1 4  ? 11.361  7.348   10.793  1.00 0.00 ? 4  ASP A CG   2  
ATOM 1413  O OD1  . ASP A 1 4  ? 10.499  7.329   11.695  1.00 0.00 ? 4  ASP A OD1  2  
ATOM 1414  O OD2  . ASP A 1 4  ? 11.253  6.704   9.728   1.00 0.00 ? 4  ASP A OD2  2  
ATOM 1415  H H    . ASP A 1 4  ? 13.247  9.368   13.149  1.00 0.00 ? 4  ASP A H    2  
ATOM 1416  H HA   . ASP A 1 4  ? 13.130  6.679   12.399  1.00 0.00 ? 4  ASP A HA   2  
ATOM 1417  H HB2  . ASP A 1 4  ? 12.294  9.173   11.331  1.00 0.00 ? 4  ASP A HB2  2  
ATOM 1418  H HB3  . ASP A 1 4  ? 13.116  8.283   10.056  1.00 0.00 ? 4  ASP A HB3  2  
ATOM 1419  N N    . ALA A 1 5  ? 15.875  8.166   11.619  1.00 0.00 ? 5  ALA A N    2  
ATOM 1420  C CA   . ALA A 1 5  ? 17.206  7.992   11.063  1.00 0.00 ? 5  ALA A CA   2  
ATOM 1421  C C    . ALA A 1 5  ? 18.135  7.285   12.047  1.00 0.00 ? 5  ALA A C    2  
ATOM 1422  O O    . ALA A 1 5  ? 19.355  7.430   11.974  1.00 0.00 ? 5  ALA A O    2  
ATOM 1423  C CB   . ALA A 1 5  ? 17.788  9.338   10.659  1.00 0.00 ? 5  ALA A CB   2  
ATOM 1424  H H    . ALA A 1 5  ? 15.692  8.946   12.169  1.00 0.00 ? 5  ALA A H    2  
ATOM 1425  H HA   . ALA A 1 5  ? 17.111  7.391   10.178  1.00 0.00 ? 5  ALA A HA   2  
ATOM 1426  H HB1  . ALA A 1 5  ? 18.287  9.783   11.507  1.00 0.00 ? 5  ALA A HB1  2  
ATOM 1427  H HB2  . ALA A 1 5  ? 16.993  9.989   10.327  1.00 0.00 ? 5  ALA A HB2  2  
ATOM 1428  H HB3  . ALA A 1 5  ? 18.497  9.198   9.857   1.00 0.00 ? 5  ALA A HB3  2  
ATOM 1429  N N    . GLU A 1 6  ? 17.553  6.522   12.968  1.00 0.00 ? 6  GLU A N    2  
ATOM 1430  C CA   . GLU A 1 6  ? 18.329  5.799   13.963  1.00 0.00 ? 6  GLU A CA   2  
ATOM 1431  C C    . GLU A 1 6  ? 18.539  4.350   13.559  1.00 0.00 ? 6  GLU A C    2  
ATOM 1432  O O    . GLU A 1 6  ? 18.844  3.491   14.386  1.00 0.00 ? 6  GLU A O    2  
ATOM 1433  C CB   . GLU A 1 6  ? 17.631  5.855   15.309  1.00 0.00 ? 6  GLU A CB   2  
ATOM 1434  C CG   . GLU A 1 6  ? 18.581  5.904   16.495  1.00 0.00 ? 6  GLU A CG   2  
ATOM 1435  C CD   . GLU A 1 6  ? 18.133  6.887   17.559  1.00 0.00 ? 6  GLU A CD   2  
ATOM 1436  O OE1  . GLU A 1 6  ? 18.375  8.100   17.387  1.00 0.00 ? 6  GLU A OE1  2  
ATOM 1437  O OE2  . GLU A 1 6  ? 17.541  6.443   18.565  1.00 0.00 ? 6  GLU A OE2  2  
ATOM 1438  H H    . GLU A 1 6  ? 16.583  6.446   12.982  1.00 0.00 ? 6  GLU A H    2  
ATOM 1439  H HA   . GLU A 1 6  ? 19.279  6.275   14.031  1.00 0.00 ? 6  GLU A HA   2  
ATOM 1440  H HB2  . GLU A 1 6  ? 17.004  6.731   15.335  1.00 0.00 ? 6  GLU A HB2  2  
ATOM 1441  H HB3  . GLU A 1 6  ? 17.012  4.977   15.402  1.00 0.00 ? 6  GLU A HB3  2  
ATOM 1442  H HG2  . GLU A 1 6  ? 18.637  4.920   16.936  1.00 0.00 ? 6  GLU A HG2  2  
ATOM 1443  H HG3  . GLU A 1 6  ? 19.559  6.197   16.144  1.00 0.00 ? 6  GLU A HG3  2  
ATOM 1444  N N    . GLY A 1 7  ? 18.371  4.102   12.283  1.00 0.00 ? 7  GLY A N    2  
ATOM 1445  C CA   . GLY A 1 7  ? 18.537  2.765   11.745  1.00 0.00 ? 7  GLY A CA   2  
ATOM 1446  C C    . GLY A 1 7  ? 17.391  1.844   12.115  1.00 0.00 ? 7  GLY A C    2  
ATOM 1447  O O    . GLY A 1 7  ? 17.561  0.626   12.181  1.00 0.00 ? 7  GLY A O    2  
ATOM 1448  H H    . GLY A 1 7  ? 18.130  4.842   11.701  1.00 0.00 ? 7  GLY A H    2  
ATOM 1449  H HA2  . GLY A 1 7  ? 18.601  2.828   10.669  1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1450  H HA3  . GLY A 1 7  ? 19.457  2.347   12.126  1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1451  N N    . VAL A 1 8  ? 16.220  2.425   12.356  1.00 0.00 ? 8  VAL A N    2  
ATOM 1452  C CA   . VAL A 1 8  ? 15.044  1.659   12.719  1.00 0.00 ? 8  VAL A CA   2  
ATOM 1453  C C    . VAL A 1 8  ? 14.610  0.728   11.589  1.00 0.00 ? 8  VAL A C    2  
ATOM 1454  O O    . VAL A 1 8  ? 13.863  -0.224  11.811  1.00 0.00 ? 8  VAL A O    2  
ATOM 1455  C CB   . VAL A 1 8  ? 13.878  2.592   13.079  1.00 0.00 ? 8  VAL A CB   2  
ATOM 1456  C CG1  . VAL A 1 8  ? 14.058  3.163   14.477  1.00 0.00 ? 8  VAL A CG1  2  
ATOM 1457  C CG2  . VAL A 1 8  ? 13.740  3.708   12.053  1.00 0.00 ? 8  VAL A CG2  2  
ATOM 1458  H H    . VAL A 1 8  ? 16.142  3.396   12.288  1.00 0.00 ? 8  VAL A H    2  
ATOM 1459  H HA   . VAL A 1 8  ? 15.286  1.067   13.587  1.00 0.00 ? 8  VAL A HA   2  
ATOM 1460  H HB   . VAL A 1 8  ? 12.976  2.015   13.067  1.00 0.00 ? 8  VAL A HB   2  
ATOM 1461  H HG11 . VAL A 1 8  ? 13.684  2.458   15.205  1.00 0.00 ? 8  VAL A HG11 2  
ATOM 1462  H HG12 . VAL A 1 8  ? 13.512  4.091   14.561  1.00 0.00 ? 8  VAL A HG12 2  
ATOM 1463  H HG13 . VAL A 1 8  ? 15.107  3.345   14.659  1.00 0.00 ? 8  VAL A HG13 2  
ATOM 1464  H HG21 . VAL A 1 8  ? 14.382  4.532   12.327  1.00 0.00 ? 8  VAL A HG21 2  
ATOM 1465  H HG22 . VAL A 1 8  ? 12.714  4.046   12.024  1.00 0.00 ? 8  VAL A HG22 2  
ATOM 1466  H HG23 . VAL A 1 8  ? 14.025  3.338   11.079  1.00 0.00 ? 8  VAL A HG23 2  
ATOM 1467  N N    . TRP A 1 9  ? 15.082  1.010   10.379  1.00 0.00 ? 9  TRP A N    2  
ATOM 1468  C CA   . TRP A 1 9  ? 14.741  0.197   9.217   1.00 0.00 ? 9  TRP A CA   2  
ATOM 1469  C C    . TRP A 1 9  ? 15.168  -1.254  9.419   1.00 0.00 ? 9  TRP A C    2  
ATOM 1470  O O    . TRP A 1 9  ? 16.313  -1.531  9.778   1.00 0.00 ? 9  TRP A O    2  
ATOM 1471  C CB   . TRP A 1 9  ? 15.395  0.767   7.961   1.00 0.00 ? 9  TRP A CB   2  
ATOM 1472  C CG   . TRP A 1 9  ? 14.408  1.204   6.922   1.00 0.00 ? 9  TRP A CG   2  
ATOM 1473  C CD1  . TRP A 1 9  ? 13.408  0.452   6.375   1.00 0.00 ? 9  TRP A CD1  2  
ATOM 1474  C CD2  . TRP A 1 9  ? 14.327  2.493   6.304   1.00 0.00 ? 9  TRP A CD2  2  
ATOM 1475  N NE1  . TRP A 1 9  ? 12.710  1.196   5.454   1.00 0.00 ? 9  TRP A NE1  2  
ATOM 1476  C CE2  . TRP A 1 9  ? 13.255  2.452   5.393   1.00 0.00 ? 9  TRP A CE2  2  
ATOM 1477  C CE3  . TRP A 1 9  ? 15.057  3.678   6.433   1.00 0.00 ? 9  TRP A CE3  2  
ATOM 1478  C CZ2  . TRP A 1 9  ? 12.896  3.550   4.615   1.00 0.00 ? 9  TRP A CZ2  2  
ATOM 1479  C CZ3  . TRP A 1 9  ? 14.699  4.768   5.661   1.00 0.00 ? 9  TRP A CZ3  2  
ATOM 1480  C CH2  . TRP A 1 9  ? 13.627  4.697   4.762   1.00 0.00 ? 9  TRP A CH2  2  
ATOM 1481  H H    . TRP A 1 9  ? 15.673  1.782   10.264  1.00 0.00 ? 9  TRP A H    2  
ATOM 1482  H HA   . TRP A 1 9  ? 13.673  0.229   9.094   1.00 0.00 ? 9  TRP A HA   2  
ATOM 1483  H HB2  . TRP A 1 9  ? 15.991  1.623   8.235   1.00 0.00 ? 9  TRP A HB2  2  
ATOM 1484  H HB3  . TRP A 1 9  ? 16.031  0.015   7.523   1.00 0.00 ? 9  TRP A HB3  2  
ATOM 1485  H HD1  . TRP A 1 9  ? 13.207  -0.576  6.636   1.00 0.00 ? 9  TRP A HD1  2  
ATOM 1486  H HE1  . TRP A 1 9  ? 11.947  0.879   4.928   1.00 0.00 ? 9  TRP A HE1  2  
ATOM 1487  H HE3  . TRP A 1 9  ? 15.887  3.752   7.120   1.00 0.00 ? 9  TRP A HE3  2  
ATOM 1488  H HZ2  . TRP A 1 9  ? 12.071  3.512   3.919   1.00 0.00 ? 9  TRP A HZ2  2  
ATOM 1489  H HZ3  . TRP A 1 9  ? 15.251  5.692   5.746   1.00 0.00 ? 9  TRP A HZ3  2  
ATOM 1490  H HH2  . TRP A 1 9  ? 13.383  5.573   4.179   1.00 0.00 ? 9  TRP A HH2  2  
ATOM 1491  N N    . SER A 1 10 ? 14.240  -2.176  9.185   1.00 0.00 ? 10 SER A N    2  
ATOM 1492  C CA   . SER A 1 10 ? 14.515  -3.594  9.336   1.00 0.00 ? 10 SER A CA   2  
ATOM 1493  C C    . SER A 1 10 ? 13.936  -4.389  8.168   1.00 0.00 ? 10 SER A C    2  
ATOM 1494  O O    . SER A 1 10 ? 12.936  -3.990  7.571   1.00 0.00 ? 10 SER A O    2  
ATOM 1495  C CB   . SER A 1 10 ? 13.945  -4.110  10.659  1.00 0.00 ? 10 SER A CB   2  
ATOM 1496  O OG   . SER A 1 10 ? 14.882  -4.931  11.334  1.00 0.00 ? 10 SER A OG   2  
ATOM 1497  H H    . SER A 1 10 ? 13.353  -1.897  8.901   1.00 0.00 ? 10 SER A H    2  
ATOM 1498  H HA   . SER A 1 10 ? 15.581  -3.715  9.343   1.00 0.00 ? 10 SER A HA   2  
ATOM 1499  H HB2  . SER A 1 10 ? 13.698  -3.272  11.294  1.00 0.00 ? 10 SER A HB2  2  
ATOM 1500  H HB3  . SER A 1 10 ? 13.053  -4.688  10.464  1.00 0.00 ? 10 SER A HB3  2  
ATOM 1501  H HG   . SER A 1 10 ? 14.572  -5.840  11.331  1.00 0.00 ? 10 SER A HG   2  
ATOM 1502  N N    . PRO A 1 11 ? 14.559  -5.529  7.825   1.00 0.00 ? 11 PRO A N    2  
ATOM 1503  C CA   . PRO A 1 11 ? 14.100  -6.379  6.721   1.00 0.00 ? 11 PRO A CA   2  
ATOM 1504  C C    . PRO A 1 11 ? 12.724  -6.980  6.981   1.00 0.00 ? 11 PRO A C    2  
ATOM 1505  O O    . PRO A 1 11 ? 12.020  -7.372  6.050   1.00 0.00 ? 11 PRO A O    2  
ATOM 1506  C CB   . PRO A 1 11 ? 15.160  -7.479  6.642   1.00 0.00 ? 11 PRO A CB   2  
ATOM 1507  C CG   . PRO A 1 11 ? 15.787  -7.499  7.990   1.00 0.00 ? 11 PRO A CG   2  
ATOM 1508  C CD   . PRO A 1 11 ? 15.757  -6.080  8.480   1.00 0.00 ? 11 PRO A CD   2  
ATOM 1509  H HA   . PRO A 1 11 ? 14.079  -5.836  5.797   1.00 0.00 ? 11 PRO A HA   2  
ATOM 1510  H HB2  . PRO A 1 11 ? 14.687  -8.423  6.412   1.00 0.00 ? 11 PRO A HB2  2  
ATOM 1511  H HB3  . PRO A 1 11 ? 15.880  -7.235  5.876   1.00 0.00 ? 11 PRO A HB3  2  
ATOM 1512  H HG2  . PRO A 1 11 ? 15.217  -8.134  8.647   1.00 0.00 ? 11 PRO A HG2  2  
ATOM 1513  H HG3  . PRO A 1 11 ? 16.805  -7.848  7.915   1.00 0.00 ? 11 PRO A HG3  2  
ATOM 1514  H HD2  . PRO A 1 11 ? 15.656  -6.053  9.555   1.00 0.00 ? 11 PRO A HD2  2  
ATOM 1515  H HD3  . PRO A 1 11 ? 16.645  -5.552  8.168   1.00 0.00 ? 11 PRO A HD3  2  
ATOM 1516  N N    . ASP A 1 12 ? 12.348  -7.048  8.250   1.00 0.00 ? 12 ASP A N    2  
ATOM 1517  C CA   . ASP A 1 12 ? 11.057  -7.598  8.637   1.00 0.00 ? 12 ASP A CA   2  
ATOM 1518  C C    . ASP A 1 12 ? 9.925   -6.645  8.275   1.00 0.00 ? 12 ASP A C    2  
ATOM 1519  O O    . ASP A 1 12 ? 8.780   -7.061  8.101   1.00 0.00 ? 12 ASP A O    2  
ATOM 1520  C CB   . ASP A 1 12 ? 11.033  -7.894  10.135  1.00 0.00 ? 12 ASP A CB   2  
ATOM 1521  C CG   . ASP A 1 12 ? 10.967  -9.380  10.431  1.00 0.00 ? 12 ASP A CG   2  
ATOM 1522  O OD1  . ASP A 1 12 ? 12.036  -10.021 10.495  1.00 0.00 ? 12 ASP A OD1  2  
ATOM 1523  O OD2  . ASP A 1 12 ? 9.844   -9.902  10.599  1.00 0.00 ? 12 ASP A OD2  2  
ATOM 1524  H H    . ASP A 1 12 ? 12.953  -6.719  8.942   1.00 0.00 ? 12 ASP A H    2  
ATOM 1525  H HA   . ASP A 1 12 ? 10.922  -8.514  8.100   1.00 0.00 ? 12 ASP A HA   2  
ATOM 1526  H HB2  . ASP A 1 12 ? 11.929  -7.499  10.581  1.00 0.00 ? 12 ASP A HB2  2  
ATOM 1527  H HB3  . ASP A 1 12 ? 10.172  -7.418  10.578  1.00 0.00 ? 12 ASP A HB3  2  
ATOM 1528  N N    . ILE A 1 13 ? 10.255  -5.366  8.158   1.00 0.00 ? 13 ILE A N    2  
ATOM 1529  C CA   . ILE A 1 13 ? 9.272   -4.355  7.811   1.00 0.00 ? 13 ILE A CA   2  
ATOM 1530  C C    . ILE A 1 13 ? 8.988   -4.376  6.322   1.00 0.00 ? 13 ILE A C    2  
ATOM 1531  O O    . ILE A 1 13 ? 7.837   -4.312  5.891   1.00 0.00 ? 13 ILE A O    2  
ATOM 1532  C CB   . ILE A 1 13 ? 9.729   -2.951  8.220   1.00 0.00 ? 13 ILE A CB   2  
ATOM 1533  C CG1  . ILE A 1 13 ? 10.274  -2.959  9.650   1.00 0.00 ? 13 ILE A CG1  2  
ATOM 1534  C CG2  . ILE A 1 13 ? 8.584   -1.959  8.087   1.00 0.00 ? 13 ILE A CG2  2  
ATOM 1535  C CD1  . ILE A 1 13 ? 9.280   -3.462  10.674  1.00 0.00 ? 13 ILE A CD1  2  
ATOM 1536  H H    . ILE A 1 13 ? 11.181  -5.100  8.302   1.00 0.00 ? 13 ILE A H    2  
ATOM 1537  H HA   . ILE A 1 13 ? 8.377   -4.578  8.334   1.00 0.00 ? 13 ILE A HA   2  
ATOM 1538  H HB   . ILE A 1 13 ? 10.505  -2.656  7.549   1.00 0.00 ? 13 ILE A HB   2  
ATOM 1539  H HG12 . ILE A 1 13 ? 11.145  -3.597  9.693   1.00 0.00 ? 13 ILE A HG12 2  
ATOM 1540  H HG13 . ILE A 1 13 ? 10.557  -1.954  9.926   1.00 0.00 ? 13 ILE A HG13 2  
ATOM 1541  H HG21 . ILE A 1 13 ? 8.932   -0.970  8.345   1.00 0.00 ? 13 ILE A HG21 2  
ATOM 1542  H HG22 . ILE A 1 13 ? 7.782   -2.244  8.752   1.00 0.00 ? 13 ILE A HG22 2  
ATOM 1543  H HG23 . ILE A 1 13 ? 8.224   -1.959  7.069   1.00 0.00 ? 13 ILE A HG23 2  
ATOM 1544  H HD11 . ILE A 1 13 ? 8.758   -4.321  10.278  1.00 0.00 ? 13 ILE A HD11 2  
ATOM 1545  H HD12 . ILE A 1 13 ? 8.569   -2.681  10.899  1.00 0.00 ? 13 ILE A HD12 2  
ATOM 1546  H HD13 . ILE A 1 13 ? 9.803   -3.744  11.576  1.00 0.00 ? 13 ILE A HD13 2  
ATOM 1547  N N    . GLU A 1 14 ? 10.050  -4.487  5.543   1.00 0.00 ? 14 GLU A N    2  
ATOM 1548  C CA   . GLU A 1 14 ? 9.932   -4.543  4.097   1.00 0.00 ? 14 GLU A CA   2  
ATOM 1549  C C    . GLU A 1 14 ? 9.278   -5.851  3.677   1.00 0.00 ? 14 GLU A C    2  
ATOM 1550  O O    . GLU A 1 14 ? 8.665   -5.941  2.613   1.00 0.00 ? 14 GLU A O    2  
ATOM 1551  C CB   . GLU A 1 14 ? 11.306  -4.404  3.439   1.00 0.00 ? 14 GLU A CB   2  
ATOM 1552  C CG   . GLU A 1 14 ? 11.249  -3.871  2.017   1.00 0.00 ? 14 GLU A CG   2  
ATOM 1553  C CD   . GLU A 1 14 ? 11.310  -2.357  1.959   1.00 0.00 ? 14 GLU A CD   2  
ATOM 1554  O OE1  . GLU A 1 14 ? 12.432  -1.809  1.940   1.00 0.00 ? 14 GLU A OE1  2  
ATOM 1555  O OE2  . GLU A 1 14 ? 10.236  -1.720  1.932   1.00 0.00 ? 14 GLU A OE2  2  
ATOM 1556  H H    . GLU A 1 14 ? 10.932  -4.548  5.955   1.00 0.00 ? 14 GLU A H    2  
ATOM 1557  H HA   . GLU A 1 14 ? 9.305   -3.726  3.787   1.00 0.00 ? 14 GLU A HA   2  
ATOM 1558  H HB2  . GLU A 1 14 ? 11.908  -3.729  4.030   1.00 0.00 ? 14 GLU A HB2  2  
ATOM 1559  H HB3  . GLU A 1 14 ? 11.783  -5.373  3.419   1.00 0.00 ? 14 GLU A HB3  2  
ATOM 1560  H HG2  . GLU A 1 14 ? 12.084  -4.271  1.462   1.00 0.00 ? 14 GLU A HG2  2  
ATOM 1561  H HG3  . GLU A 1 14 ? 10.326  -4.197  1.561   1.00 0.00 ? 14 GLU A HG3  2  
ATOM 1562  N N    . GLN A 1 15 ? 9.406   -6.863  4.529   1.00 0.00 ? 15 GLN A N    2  
ATOM 1563  C CA   . GLN A 1 15 ? 8.825   -8.163  4.264   1.00 0.00 ? 15 GLN A CA   2  
ATOM 1564  C C    . GLN A 1 15 ? 7.328   -8.132  4.493   1.00 0.00 ? 15 GLN A C    2  
ATOM 1565  O O    . GLN A 1 15 ? 6.548   -8.639  3.687   1.00 0.00 ? 15 GLN A O    2  
ATOM 1566  C CB   . GLN A 1 15 ? 9.476   -9.211  5.139   1.00 0.00 ? 15 GLN A CB   2  
ATOM 1567  C CG   . GLN A 1 15 ? 10.644  -9.892  4.460   1.00 0.00 ? 15 GLN A CG   2  
ATOM 1568  C CD   . GLN A 1 15 ? 10.217  -11.058 3.589   1.00 0.00 ? 15 GLN A CD   2  
ATOM 1569  O OE1  . GLN A 1 15 ? 9.803   -12.103 4.090   1.00 0.00 ? 15 GLN A OE1  2  
ATOM 1570  N NE2  . GLN A 1 15 ? 10.318  -10.884 2.276   1.00 0.00 ? 15 GLN A NE2  2  
ATOM 1571  H H    . GLN A 1 15 ? 9.900   -6.727  5.361   1.00 0.00 ? 15 GLN A H    2  
ATOM 1572  H HA   . GLN A 1 15 ? 9.018   -8.403  3.248   1.00 0.00 ? 15 GLN A HA   2  
ATOM 1573  H HB2  . GLN A 1 15 ? 9.833   -8.735  6.032   1.00 0.00 ? 15 GLN A HB2  2  
ATOM 1574  H HB3  . GLN A 1 15 ? 8.746   -9.959  5.400   1.00 0.00 ? 15 GLN A HB3  2  
ATOM 1575  H HG2  . GLN A 1 15 ? 11.154  -9.167  3.844   1.00 0.00 ? 15 GLN A HG2  2  
ATOM 1576  H HG3  . GLN A 1 15 ? 11.313  -10.250 5.213   1.00 0.00 ? 15 GLN A HG3  2  
ATOM 1577  H HE21 . GLN A 1 15 ? 10.657  -10.025 1.948   1.00 0.00 ? 15 GLN A HE21 2  
ATOM 1578  H HE22 . GLN A 1 15 ? 10.049  -11.621 1.689   1.00 0.00 ? 15 GLN A HE22 2  
ATOM 1579  N N    . SER A 1 16 ? 6.936   -7.508  5.590   1.00 0.00 ? 16 SER A N    2  
ATOM 1580  C CA   . SER A 1 16 ? 5.530   -7.377  5.927   1.00 0.00 ? 16 SER A CA   2  
ATOM 1581  C C    . SER A 1 16 ? 4.824   -6.536  4.873   1.00 0.00 ? 16 SER A C    2  
ATOM 1582  O O    . SER A 1 16 ? 3.614   -6.648  4.675   1.00 0.00 ? 16 SER A O    2  
ATOM 1583  C CB   . SER A 1 16 ? 5.366   -6.741  7.309   1.00 0.00 ? 16 SER A CB   2  
ATOM 1584  O OG   . SER A 1 16 ? 4.030   -6.854  7.769   1.00 0.00 ? 16 SER A OG   2  
ATOM 1585  H H    . SER A 1 16 ? 7.611   -7.113  6.176   1.00 0.00 ? 16 SER A H    2  
ATOM 1586  H HA   . SER A 1 16 ? 5.098   -8.363  5.935   1.00 0.00 ? 16 SER A HA   2  
ATOM 1587  H HB2  . SER A 1 16 ? 6.018   -7.239  8.012   1.00 0.00 ? 16 SER A HB2  2  
ATOM 1588  H HB3  . SER A 1 16 ? 5.628   -5.695  7.255   1.00 0.00 ? 16 SER A HB3  2  
ATOM 1589  H HG   . SER A 1 16 ? 3.425   -6.687  7.042   1.00 0.00 ? 16 SER A HG   2  
ATOM 1590  N N    . PHE A 1 17 ? 5.599   -5.698  4.189   1.00 0.00 ? 17 PHE A N    2  
ATOM 1591  C CA   . PHE A 1 17 ? 5.065   -4.840  3.144   1.00 0.00 ? 17 PHE A CA   2  
ATOM 1592  C C    . PHE A 1 17 ? 4.535   -5.673  1.992   1.00 0.00 ? 17 PHE A C    2  
ATOM 1593  O O    . PHE A 1 17 ? 3.480   -5.380  1.430   1.00 0.00 ? 17 PHE A O    2  
ATOM 1594  C CB   . PHE A 1 17 ? 6.139   -3.873  2.651   1.00 0.00 ? 17 PHE A CB   2  
ATOM 1595  C CG   . PHE A 1 17 ? 5.893   -2.445  3.045   1.00 0.00 ? 17 PHE A CG   2  
ATOM 1596  C CD1  . PHE A 1 17 ? 5.588   -2.117  4.356   1.00 0.00 ? 17 PHE A CD1  2  
ATOM 1597  C CD2  . PHE A 1 17 ? 5.971   -1.431  2.104   1.00 0.00 ? 17 PHE A CD2  2  
ATOM 1598  C CE1  . PHE A 1 17 ? 5.364   -0.804  4.722   1.00 0.00 ? 17 PHE A CE1  2  
ATOM 1599  C CE2  . PHE A 1 17 ? 5.749   -0.115  2.464   1.00 0.00 ? 17 PHE A CE2  2  
ATOM 1600  C CZ   . PHE A 1 17 ? 5.445   0.199   3.775   1.00 0.00 ? 17 PHE A CZ   2  
ATOM 1601  H H    . PHE A 1 17 ? 6.556   -5.662  4.390   1.00 0.00 ? 17 PHE A H    2  
ATOM 1602  H HA   . PHE A 1 17 ? 4.257   -4.281  3.562   1.00 0.00 ? 17 PHE A HA   2  
ATOM 1603  H HB2  . PHE A 1 17 ? 7.086   -4.170  3.066   1.00 0.00 ? 17 PHE A HB2  2  
ATOM 1604  H HB3  . PHE A 1 17 ? 6.192   -3.919  1.573   1.00 0.00 ? 17 PHE A HB3  2  
ATOM 1605  H HD1  . PHE A 1 17 ? 5.525   -2.901  5.097   1.00 0.00 ? 17 PHE A HD1  2  
ATOM 1606  H HD2  . PHE A 1 17 ? 6.208   -1.675  1.079   1.00 0.00 ? 17 PHE A HD2  2  
ATOM 1607  H HE1  . PHE A 1 17 ? 5.127   -0.561  5.747   1.00 0.00 ? 17 PHE A HE1  2  
ATOM 1608  H HE2  . PHE A 1 17 ? 5.813   0.666   1.722   1.00 0.00 ? 17 PHE A HE2  2  
ATOM 1609  H HZ   . PHE A 1 17 ? 5.271   1.226   4.059   1.00 0.00 ? 17 PHE A HZ   2  
ATOM 1610  N N    . GLN A 1 18 ? 5.268   -6.722  1.653   1.00 0.00 ? 18 GLN A N    2  
ATOM 1611  C CA   . GLN A 1 18 ? 4.858   -7.608  0.574   1.00 0.00 ? 18 GLN A CA   2  
ATOM 1612  C C    . GLN A 1 18 ? 3.566   -8.320  0.942   1.00 0.00 ? 18 GLN A C    2  
ATOM 1613  O O    . GLN A 1 18 ? 2.776   -8.687  0.075   1.00 0.00 ? 18 GLN A O    2  
ATOM 1614  C CB   . GLN A 1 18 ? 5.948   -8.635  0.260   1.00 0.00 ? 18 GLN A CB   2  
ATOM 1615  C CG   . GLN A 1 18 ? 5.473   -9.763  -0.645  1.00 0.00 ? 18 GLN A CG   2  
ATOM 1616  C CD   . GLN A 1 18 ? 6.618   -10.534 -1.271  1.00 0.00 ? 18 GLN A CD   2  
ATOM 1617  O OE1  . GLN A 1 18 ? 7.258   -10.063 -2.211  1.00 0.00 ? 18 GLN A OE1  2  
ATOM 1618  N NE2  . GLN A 1 18 ? 6.883   -11.727 -0.751  1.00 0.00 ? 18 GLN A NE2  2  
ATOM 1619  H H    . GLN A 1 18 ? 6.093   -6.908  2.147   1.00 0.00 ? 18 GLN A H    2  
ATOM 1620  H HA   . GLN A 1 18 ? 4.682   -7.002  -0.297  1.00 0.00 ? 18 GLN A HA   2  
ATOM 1621  H HB2  . GLN A 1 18 ? 6.771   -8.133  -0.227  1.00 0.00 ? 18 GLN A HB2  2  
ATOM 1622  H HB3  . GLN A 1 18 ? 6.297   -9.067  1.186   1.00 0.00 ? 18 GLN A HB3  2  
ATOM 1623  H HG2  . GLN A 1 18 ? 4.874   -10.447 -0.060  1.00 0.00 ? 18 GLN A HG2  2  
ATOM 1624  H HG3  . GLN A 1 18 ? 4.865   -9.342  -1.433  1.00 0.00 ? 18 GLN A HG3  2  
ATOM 1625  H HE21 . GLN A 1 18 ? 6.332   -12.038 -0.002  1.00 0.00 ? 18 GLN A HE21 2  
ATOM 1626  H HE22 . GLN A 1 18 ? 7.619   -12.247 -1.136  1.00 0.00 ? 18 GLN A HE22 2  
ATOM 1627  N N    . GLU A 1 19 ? 3.362   -8.512  2.237   1.00 0.00 ? 19 GLU A N    2  
ATOM 1628  C CA   . GLU A 1 19 ? 2.167   -9.179  2.726   1.00 0.00 ? 19 GLU A CA   2  
ATOM 1629  C C    . GLU A 1 19 ? 0.929   -8.359  2.411   1.00 0.00 ? 19 GLU A C    2  
ATOM 1630  O O    . GLU A 1 19 ? -0.123  -8.904  2.087   1.00 0.00 ? 19 GLU A O    2  
ATOM 1631  C CB   . GLU A 1 19 ? 2.272   -9.432  4.228   1.00 0.00 ? 19 GLU A CB   2  
ATOM 1632  C CG   . GLU A 1 19 ? 2.186   -10.902 4.605   1.00 0.00 ? 19 GLU A CG   2  
ATOM 1633  C CD   . GLU A 1 19 ? 3.389   -11.696 4.135   1.00 0.00 ? 19 GLU A CD   2  
ATOM 1634  O OE1  . GLU A 1 19 ? 4.410   -11.709 4.855   1.00 0.00 ? 19 GLU A OE1  2  
ATOM 1635  O OE2  . GLU A 1 19 ? 3.311   -12.304 3.047   1.00 0.00 ? 19 GLU A OE2  2  
ATOM 1636  H H    . GLU A 1 19 ? 4.031   -8.197  2.876   1.00 0.00 ? 19 GLU A H    2  
ATOM 1637  H HA   . GLU A 1 19 ? 2.089   -10.118 2.219   1.00 0.00 ? 19 GLU A HA   2  
ATOM 1638  H HB2  . GLU A 1 19 ? 3.217   -9.048  4.579   1.00 0.00 ? 19 GLU A HB2  2  
ATOM 1639  H HB3  . GLU A 1 19 ? 1.473   -8.908  4.724   1.00 0.00 ? 19 GLU A HB3  2  
ATOM 1640  H HG2  . GLU A 1 19 ? 2.119   -10.982 5.680   1.00 0.00 ? 19 GLU A HG2  2  
ATOM 1641  H HG3  . GLU A 1 19 ? 1.298   -11.324 4.157   1.00 0.00 ? 19 GLU A HG3  2  
ATOM 1642  N N    . ALA A 1 20 ? 1.067   -7.047  2.500   1.00 0.00 ? 20 ALA A N    2  
ATOM 1643  C CA   . ALA A 1 20 ? -0.038  -6.150  2.215   1.00 0.00 ? 20 ALA A CA   2  
ATOM 1644  C C    . ALA A 1 20 ? -0.226  -5.993  0.715   1.00 0.00 ? 20 ALA A C    2  
ATOM 1645  O O    . ALA A 1 20 ? -1.343  -5.812  0.231   1.00 0.00 ? 20 ALA A O    2  
ATOM 1646  C CB   . ALA A 1 20 ? 0.185   -4.797  2.875   1.00 0.00 ? 20 ALA A CB   2  
ATOM 1647  H H    . ALA A 1 20 ? 1.933   -6.676  2.756   1.00 0.00 ? 20 ALA A H    2  
ATOM 1648  H HA   . ALA A 1 20 ? -0.925  -6.589  2.627   1.00 0.00 ? 20 ALA A HA   2  
ATOM 1649  H HB1  . ALA A 1 20 ? 0.608   -4.111  2.156   1.00 0.00 ? 20 ALA A HB1  2  
ATOM 1650  H HB2  . ALA A 1 20 ? 0.863   -4.910  3.708   1.00 0.00 ? 20 ALA A HB2  2  
ATOM 1651  H HB3  . ALA A 1 20 ? -0.759  -4.410  3.229   1.00 0.00 ? 20 ALA A HB3  2  
ATOM 1652  N N    . LEU A 1 21 ? 0.876   -6.078  -0.014  1.00 0.00 ? 21 LEU A N    2  
ATOM 1653  C CA   . LEU A 1 21 ? 0.842   -5.962  -1.459  1.00 0.00 ? 21 LEU A CA   2  
ATOM 1654  C C    . LEU A 1 21 ? 0.425   -7.285  -2.087  1.00 0.00 ? 21 LEU A C    2  
ATOM 1655  O O    . LEU A 1 21 ? -0.184  -7.315  -3.156  1.00 0.00 ? 21 LEU A O    2  
ATOM 1656  C CB   . LEU A 1 21 ? 2.202   -5.520  -1.995  1.00 0.00 ? 21 LEU A CB   2  
ATOM 1657  C CG   . LEU A 1 21 ? 2.207   -4.161  -2.696  1.00 0.00 ? 21 LEU A CG   2  
ATOM 1658  C CD1  . LEU A 1 21 ? 1.176   -4.135  -3.813  1.00 0.00 ? 21 LEU A CD1  2  
ATOM 1659  C CD2  . LEU A 1 21 ? 1.940   -3.046  -1.694  1.00 0.00 ? 21 LEU A CD2  2  
ATOM 1660  H H    . LEU A 1 21 ? 1.728   -6.232  0.432   1.00 0.00 ? 21 LEU A H    2  
ATOM 1661  H HA   . LEU A 1 21 ? 0.114   -5.219  -1.705  1.00 0.00 ? 21 LEU A HA   2  
ATOM 1662  H HB2  . LEU A 1 21 ? 2.891   -5.478  -1.167  1.00 0.00 ? 21 LEU A HB2  2  
ATOM 1663  H HB3  . LEU A 1 21 ? 2.550   -6.262  -2.696  1.00 0.00 ? 21 LEU A HB3  2  
ATOM 1664  H HG   . LEU A 1 21 ? 3.179   -3.993  -3.135  1.00 0.00 ? 21 LEU A HG   2  
ATOM 1665  H HD11 . LEU A 1 21 ? 0.205   -3.898  -3.403  1.00 0.00 ? 21 LEU A HD11 2  
ATOM 1666  H HD12 . LEU A 1 21 ? 1.138   -5.102  -4.291  1.00 0.00 ? 21 LEU A HD12 2  
ATOM 1667  H HD13 . LEU A 1 21 ? 1.452   -3.385  -4.540  1.00 0.00 ? 21 LEU A HD13 2  
ATOM 1668  H HD21 . LEU A 1 21 ? 2.369   -2.125  -2.059  1.00 0.00 ? 21 LEU A HD21 2  
ATOM 1669  H HD22 . LEU A 1 21 ? 2.387   -3.301  -0.745  1.00 0.00 ? 21 LEU A HD22 2  
ATOM 1670  H HD23 . LEU A 1 21 ? 0.874   -2.922  -1.569  1.00 0.00 ? 21 LEU A HD23 2  
ATOM 1671  N N    . SER A 1 22 ? 0.746   -8.376  -1.403  1.00 0.00 ? 22 SER A N    2  
ATOM 1672  C CA   . SER A 1 22 ? 0.397   -9.703  -1.875  1.00 0.00 ? 22 SER A CA   2  
ATOM 1673  C C    . SER A 1 22 ? -1.070  -9.985  -1.597  1.00 0.00 ? 22 SER A C    2  
ATOM 1674  O O    . SER A 1 22 ? -1.747  -10.663 -2.371  1.00 0.00 ? 22 SER A O    2  
ATOM 1675  C CB   . SER A 1 22 ? 1.275   -10.761 -1.205  1.00 0.00 ? 22 SER A CB   2  
ATOM 1676  O OG   . SER A 1 22 ? 2.525   -10.879 -1.863  1.00 0.00 ? 22 SER A OG   2  
ATOM 1677  H H    . SER A 1 22 ? 1.222   -8.284  -0.555  1.00 0.00 ? 22 SER A H    2  
ATOM 1678  H HA   . SER A 1 22 ? 0.561   -9.725  -2.934  1.00 0.00 ? 22 SER A HA   2  
ATOM 1679  H HB2  . SER A 1 22 ? 1.449   -10.482 -0.176  1.00 0.00 ? 22 SER A HB2  2  
ATOM 1680  H HB3  . SER A 1 22 ? 0.773   -11.717 -1.239  1.00 0.00 ? 22 SER A HB3  2  
ATOM 1681  H HG   . SER A 1 22 ? 2.438   -11.474 -2.611  1.00 0.00 ? 22 SER A HG   2  
ATOM 1682  N N    . ILE A 1 23 ? -1.553  -9.448  -0.486  1.00 0.00 ? 23 ILE A N    2  
ATOM 1683  C CA   . ILE A 1 23 ? -2.942  -9.622  -0.091  1.00 0.00 ? 23 ILE A CA   2  
ATOM 1684  C C    . ILE A 1 23 ? -3.838  -8.646  -0.841  1.00 0.00 ? 23 ILE A C    2  
ATOM 1685  O O    . ILE A 1 23 ? -4.963  -8.972  -1.218  1.00 0.00 ? 23 ILE A O    2  
ATOM 1686  C CB   . ILE A 1 23 ? -3.119  -9.441  1.435   1.00 0.00 ? 23 ILE A CB   2  
ATOM 1687  C CG1  . ILE A 1 23 ? -4.048  -10.519 1.994   1.00 0.00 ? 23 ILE A CG1  2  
ATOM 1688  C CG2  . ILE A 1 23 ? -3.645  -8.052  1.778   1.00 0.00 ? 23 ILE A CG2  2  
ATOM 1689  C CD1  . ILE A 1 23 ? -3.327  -11.783 2.410   1.00 0.00 ? 23 ILE A CD1  2  
ATOM 1690  H H    . ILE A 1 23 ? -0.957  -8.916  0.080   1.00 0.00 ? 23 ILE A H    2  
ATOM 1691  H HA   . ILE A 1 23 ? -3.227  -10.622 -0.350  1.00 0.00 ? 23 ILE A HA   2  
ATOM 1692  H HB   . ILE A 1 23 ? -2.151  -9.544  1.891   1.00 0.00 ? 23 ILE A HB   2  
ATOM 1693  H HG12 . ILE A 1 23 ? -4.561  -10.130 2.861   1.00 0.00 ? 23 ILE A HG12 2  
ATOM 1694  H HG13 . ILE A 1 23 ? -4.776  -10.785 1.241   1.00 0.00 ? 23 ILE A HG13 2  
ATOM 1695  H HG21 . ILE A 1 23 ? -3.588  -7.899  2.846   1.00 0.00 ? 23 ILE A HG21 2  
ATOM 1696  H HG22 . ILE A 1 23 ? -4.672  -7.966  1.457   1.00 0.00 ? 23 ILE A HG22 2  
ATOM 1697  H HG23 . ILE A 1 23 ? -3.047  -7.306  1.275   1.00 0.00 ? 23 ILE A HG23 2  
ATOM 1698  H HD11 . ILE A 1 23 ? -2.263  -11.648 2.281   1.00 0.00 ? 23 ILE A HD11 2  
ATOM 1699  H HD12 . ILE A 1 23 ? -3.662  -12.607 1.798   1.00 0.00 ? 23 ILE A HD12 2  
ATOM 1700  H HD13 . ILE A 1 23 ? -3.539  -11.994 3.448   1.00 0.00 ? 23 ILE A HD13 2  
ATOM 1701  N N    . TYR A 1 24 ? -3.316  -7.448  -1.047  1.00 0.00 ? 24 TYR A N    2  
ATOM 1702  C CA   . TYR A 1 24 ? -4.036  -6.398  -1.748  1.00 0.00 ? 24 TYR A CA   2  
ATOM 1703  C C    . TYR A 1 24 ? -3.323  -6.008  -3.041  1.00 0.00 ? 24 TYR A C    2  
ATOM 1704  O O    . TYR A 1 24 ? -2.566  -5.038  -3.072  1.00 0.00 ? 24 TYR A O    2  
ATOM 1705  C CB   . TYR A 1 24 ? -4.197  -5.174  -0.860  1.00 0.00 ? 24 TYR A CB   2  
ATOM 1706  C CG   . TYR A 1 24 ? -4.818  -5.468  0.486   1.00 0.00 ? 24 TYR A CG   2  
ATOM 1707  C CD1  . TYR A 1 24 ? -6.052  -6.099  0.580   1.00 0.00 ? 24 TYR A CD1  2  
ATOM 1708  C CD2  . TYR A 1 24 ? -4.169  -5.115  1.661   1.00 0.00 ? 24 TYR A CD2  2  
ATOM 1709  C CE1  . TYR A 1 24 ? -6.622  -6.369  1.810   1.00 0.00 ? 24 TYR A CE1  2  
ATOM 1710  C CE2  . TYR A 1 24 ? -4.731  -5.382  2.894   1.00 0.00 ? 24 TYR A CE2  2  
ATOM 1711  C CZ   . TYR A 1 24 ? -5.958  -6.009  2.964   1.00 0.00 ? 24 TYR A CZ   2  
ATOM 1712  O OH   . TYR A 1 24 ? -6.523  -6.278  4.190   1.00 0.00 ? 24 TYR A OH   2  
ATOM 1713  H H    . TYR A 1 24 ? -2.420  -7.268  -0.715  1.00 0.00 ? 24 TYR A H    2  
ATOM 1714  H HA   . TYR A 1 24 ? -5.000  -6.774  -1.985  1.00 0.00 ? 24 TYR A HA   2  
ATOM 1715  H HB2  . TYR A 1 24 ? -3.231  -4.752  -0.690  1.00 0.00 ? 24 TYR A HB2  2  
ATOM 1716  H HB3  . TYR A 1 24 ? -4.818  -4.449  -1.363  1.00 0.00 ? 24 TYR A HB3  2  
ATOM 1717  H HD1  . TYR A 1 24 ? -6.568  -6.379  -0.326  1.00 0.00 ? 24 TYR A HD1  2  
ATOM 1718  H HD2  . TYR A 1 24 ? -3.208  -4.624  1.602   1.00 0.00 ? 24 TYR A HD2  2  
ATOM 1719  H HE1  . TYR A 1 24 ? -7.582  -6.860  1.863   1.00 0.00 ? 24 TYR A HE1  2  
ATOM 1720  H HE2  . TYR A 1 24 ? -4.211  -5.099  3.798   1.00 0.00 ? 24 TYR A HE2  2  
ATOM 1721  H HH   . TYR A 1 24 ? -6.223  -5.630  4.832   1.00 0.00 ? 24 TYR A HH   2  
ATOM 1722  N N    . PRO A 1 25 ? -3.556  -6.760  -4.132  1.00 0.00 ? 25 PRO A N    2  
ATOM 1723  C CA   . PRO A 1 25 ? -2.941  -6.495  -5.423  1.00 0.00 ? 25 PRO A CA   2  
ATOM 1724  C C    . PRO A 1 25 ? -3.741  -5.489  -6.249  1.00 0.00 ? 25 PRO A C    2  
ATOM 1725  O O    . PRO A 1 25 ? -4.863  -5.133  -5.891  1.00 0.00 ? 25 PRO A O    2  
ATOM 1726  C CB   . PRO A 1 25 ? -2.936  -7.868  -6.108  1.00 0.00 ? 25 PRO A CB   2  
ATOM 1727  C CG   . PRO A 1 25 ? -3.814  -8.764  -5.285  1.00 0.00 ? 25 PRO A CG   2  
ATOM 1728  C CD   . PRO A 1 25 ? -4.434  -7.927  -4.199  1.00 0.00 ? 25 PRO A CD   2  
ATOM 1729  H HA   . PRO A 1 25 ? -1.927  -6.143  -5.313  1.00 0.00 ? 25 PRO A HA   2  
ATOM 1730  H HB2  . PRO A 1 25 ? -3.315  -7.769  -7.114  1.00 0.00 ? 25 PRO A HB2  2  
ATOM 1731  H HB3  . PRO A 1 25 ? -1.926  -8.243  -6.141  1.00 0.00 ? 25 PRO A HB3  2  
ATOM 1732  H HG2  . PRO A 1 25 ? -4.585  -9.187  -5.909  1.00 0.00 ? 25 PRO A HG2  2  
ATOM 1733  H HG3  . PRO A 1 25 ? -3.216  -9.552  -4.850  1.00 0.00 ? 25 PRO A HG3  2  
ATOM 1734  H HD2  . PRO A 1 25 ? -5.438  -7.639  -4.471  1.00 0.00 ? 25 PRO A HD2  2  
ATOM 1735  H HD3  . PRO A 1 25 ? -4.433  -8.464  -3.265  1.00 0.00 ? 25 PRO A HD3  2  
ATOM 1736  N N    . PRO A 1 26 ? -3.170  -5.018  -7.371  1.00 0.00 ? 26 PRO A N    2  
ATOM 1737  C CA   . PRO A 1 26 ? -3.836  -4.050  -8.248  1.00 0.00 ? 26 PRO A CA   2  
ATOM 1738  C C    . PRO A 1 26 ? -5.034  -4.648  -8.978  1.00 0.00 ? 26 PRO A C    2  
ATOM 1739  O O    . PRO A 1 26 ? -5.874  -3.923  -9.511  1.00 0.00 ? 26 PRO A O    2  
ATOM 1740  C CB   . PRO A 1 26 ? -2.744  -3.659  -9.243  1.00 0.00 ? 26 PRO A CB   2  
ATOM 1741  C CG   . PRO A 1 26 ? -1.826  -4.827  -9.267  1.00 0.00 ? 26 PRO A CG   2  
ATOM 1742  C CD   . PRO A 1 26 ? -1.836  -5.389  -7.873  1.00 0.00 ? 26 PRO A CD   2  
ATOM 1743  H HA   . PRO A 1 26 ? -4.150  -3.181  -7.703  1.00 0.00 ? 26 PRO A HA   2  
ATOM 1744  H HB2  . PRO A 1 26 ? -3.184  -3.480  -10.214 1.00 0.00 ? 26 PRO A HB2  2  
ATOM 1745  H HB3  . PRO A 1 26 ? -2.240  -2.768  -8.899  1.00 0.00 ? 26 PRO A HB3  2  
ATOM 1746  H HG2  . PRO A 1 26 ? -2.189  -5.560  -9.968  1.00 0.00 ? 26 PRO A HG2  2  
ATOM 1747  H HG3  . PRO A 1 26 ? -0.832  -4.506  -9.534  1.00 0.00 ? 26 PRO A HG3  2  
ATOM 1748  H HD2  . PRO A 1 26 ? -1.717  -6.463  -7.898  1.00 0.00 ? 26 PRO A HD2  2  
ATOM 1749  H HD3  . PRO A 1 26 ? -1.059  -4.935  -7.276  1.00 0.00 ? 26 PRO A HD3  2  
ATOM 1750  N N    . CYS A 1 27 ? -5.107  -5.974  -8.998  1.00 0.00 ? 27 CYS A N    2  
ATOM 1751  C CA   . CYS A 1 27 ? -6.202  -6.670  -9.662  1.00 0.00 ? 27 CYS A CA   2  
ATOM 1752  C C    . CYS A 1 27 ? -7.530  -6.392  -8.963  1.00 0.00 ? 27 CYS A C    2  
ATOM 1753  O O    . CYS A 1 27 ? -7.575  -6.203  -7.748  1.00 0.00 ? 27 CYS A O    2  
ATOM 1754  C CB   . CYS A 1 27 ? -5.931  -8.172  -9.697  1.00 0.00 ? 27 CYS A CB   2  
ATOM 1755  S SG   . CYS A 1 27 ? -5.784  -8.856  -11.364 1.00 0.00 ? 27 CYS A SG   2  
ATOM 1756  H H    . CYS A 1 27 ? -4.409  -6.496  -8.556  1.00 0.00 ? 27 CYS A H    2  
ATOM 1757  H HA   . CYS A 1 27 ? -6.258  -6.306  -10.671 1.00 0.00 ? 27 CYS A HA   2  
ATOM 1758  H HB2  . CYS A 1 27 ? -5.007  -8.372  -9.180  1.00 0.00 ? 27 CYS A HB2  2  
ATOM 1759  H HB3  . CYS A 1 27 ? -6.737  -8.687  -9.200  1.00 0.00 ? 27 CYS A HB3  2  
ATOM 1760  H HG   . CYS A 1 27 ? -5.593  -9.793  -11.284 1.00 0.00 ? 27 CYS A HG   2  
ATOM 1761  N N    . GLY A 1 28 ? -8.608  -6.370  -9.740  1.00 0.00 ? 28 GLY A N    2  
ATOM 1762  C CA   . GLY A 1 28 ? -9.922  -6.115  -9.178  1.00 0.00 ? 28 GLY A CA   2  
ATOM 1763  C C    . GLY A 1 28 ? -9.999  -4.781  -8.464  1.00 0.00 ? 28 GLY A C    2  
ATOM 1764  O O    . GLY A 1 28 ? -10.491 -4.698  -7.339  1.00 0.00 ? 28 GLY A O    2  
ATOM 1765  H H    . GLY A 1 28 ? -8.511  -6.528  -10.702 1.00 0.00 ? 28 GLY A H    2  
ATOM 1766  H HA2  . GLY A 1 28 ? -10.650 -6.127  -9.976  1.00 0.00 ? 28 GLY A HA2  2  
ATOM 1767  H HA3  . GLY A 1 28 ? -10.160 -6.901  -8.477  1.00 0.00 ? 28 GLY A HA3  2  
ATOM 1768  N N    . ARG A 1 29 ? -9.510  -3.732  -9.119  1.00 0.00 ? 29 ARG A N    2  
ATOM 1769  C CA   . ARG A 1 29 ? -9.524  -2.394  -8.540  1.00 0.00 ? 29 ARG A CA   2  
ATOM 1770  C C    . ARG A 1 29 ? -10.950 -1.949  -8.233  1.00 0.00 ? 29 ARG A C    2  
ATOM 1771  O O    . ARG A 1 29 ? -11.677 -1.505  -9.122  1.00 0.00 ? 29 ARG A O    2  
ATOM 1772  C CB   . ARG A 1 29 ? -8.860  -1.397  -9.490  1.00 0.00 ? 29 ARG A CB   2  
ATOM 1773  C CG   . ARG A 1 29 ? -8.176  -0.241  -8.779  1.00 0.00 ? 29 ARG A CG   2  
ATOM 1774  C CD   . ARG A 1 29 ? -9.126  0.929   -8.579  1.00 0.00 ? 29 ARG A CD   2  
ATOM 1775  N NE   . ARG A 1 29 ? -8.424  2.211   -8.582  1.00 0.00 ? 29 ARG A NE   2  
ATOM 1776  C CZ   . ARG A 1 29 ? -9.031  3.389   -8.459  1.00 0.00 ? 29 ARG A CZ   2  
ATOM 1777  N NH1  . ARG A 1 29 ? -10.350 3.453   -8.322  1.00 0.00 ? 29 ARG A NH1  2  
ATOM 1778  N NH2  . ARG A 1 29 ? -8.318  4.506   -8.472  1.00 0.00 ? 29 ARG A NH2  2  
ATOM 1779  H H    . ARG A 1 29 ? -9.130  -3.862  -10.013 1.00 0.00 ? 29 ARG A H    2  
ATOM 1780  H HA   . ARG A 1 29 ? -8.964  -2.427  -7.617  1.00 0.00 ? 29 ARG A HA   2  
ATOM 1781  H HB2  . ARG A 1 29 ? -8.119  -1.918  -10.079 1.00 0.00 ? 29 ARG A HB2  2  
ATOM 1782  H HB3  . ARG A 1 29 ? -9.611  -0.991  -10.151 1.00 0.00 ? 29 ARG A HB3  2  
ATOM 1783  H HG2  . ARG A 1 29 ? -7.830  -0.579  -7.814  1.00 0.00 ? 29 ARG A HG2  2  
ATOM 1784  H HG3  . ARG A 1 29 ? -7.335  0.087   -9.371  1.00 0.00 ? 29 ARG A HG3  2  
ATOM 1785  H HD2  . ARG A 1 29 ? -9.853  0.927   -9.377  1.00 0.00 ? 29 ARG A HD2  2  
ATOM 1786  H HD3  . ARG A 1 29 ? -9.631  0.808   -7.632  1.00 0.00 ? 29 ARG A HD3  2  
ATOM 1787  H HE   . ARG A 1 29 ? -7.449  2.193   -8.682  1.00 0.00 ? 29 ARG A HE   2  
ATOM 1788  H HH11 . ARG A 1 29 ? -10.894 2.614   -8.311  1.00 0.00 ? 29 ARG A HH11 2  
ATOM 1789  H HH12 . ARG A 1 29 ? -10.800 4.341   -8.229  1.00 0.00 ? 29 ARG A HH12 2  
ATOM 1790  H HH21 . ARG A 1 29 ? -7.324  4.464   -8.575  1.00 0.00 ? 29 ARG A HH21 2  
ATOM 1791  H HH22 . ARG A 1 29 ? -8.774  5.392   -8.380  1.00 0.00 ? 29 ARG A HH22 2  
ATOM 1792  N N    . ARG A 1 30 ? -11.344 -2.069  -6.969  1.00 0.00 ? 30 ARG A N    2  
ATOM 1793  C CA   . ARG A 1 30 ? -12.682 -1.677  -6.544  1.00 0.00 ? 30 ARG A CA   2  
ATOM 1794  C C    . ARG A 1 30 ? -12.930 -0.198  -6.824  1.00 0.00 ? 30 ARG A C    2  
ATOM 1795  O O    . ARG A 1 30 ? -12.112 0.469   -7.458  1.00 0.00 ? 30 ARG A O    2  
ATOM 1796  C CB   . ARG A 1 30 ? -12.873 -1.969  -5.053  1.00 0.00 ? 30 ARG A CB   2  
ATOM 1797  C CG   . ARG A 1 30 ? -13.736 -3.189  -4.779  1.00 0.00 ? 30 ARG A CG   2  
ATOM 1798  C CD   . ARG A 1 30 ? -15.178 -2.799  -4.497  1.00 0.00 ? 30 ARG A CD   2  
ATOM 1799  N NE   . ARG A 1 30 ? -16.020 -3.965  -4.238  1.00 0.00 ? 30 ARG A NE   2  
ATOM 1800  C CZ   . ARG A 1 30 ? -16.508 -4.754  -5.193  1.00 0.00 ? 30 ARG A CZ   2  
ATOM 1801  N NH1  . ARG A 1 30 ? -16.240 -4.506  -6.469  1.00 0.00 ? 30 ARG A NH1  2  
ATOM 1802  N NH2  . ARG A 1 30 ? -17.265 -5.794  -4.871  1.00 0.00 ? 30 ARG A NH2  2  
ATOM 1803  H H    . ARG A 1 30 ? -10.718 -2.429  -6.306  1.00 0.00 ? 30 ARG A H    2  
ATOM 1804  H HA   . ARG A 1 30 ? -13.393 -2.261  -7.110  1.00 0.00 ? 30 ARG A HA   2  
ATOM 1805  H HB2  . ARG A 1 30 ? -11.904 -2.133  -4.604  1.00 0.00 ? 30 ARG A HB2  2  
ATOM 1806  H HB3  . ARG A 1 30 ? -13.337 -1.114  -4.585  1.00 0.00 ? 30 ARG A HB3  2  
ATOM 1807  H HG2  . ARG A 1 30 ? -13.712 -3.838  -5.642  1.00 0.00 ? 30 ARG A HG2  2  
ATOM 1808  H HG3  . ARG A 1 30 ? -13.340 -3.713  -3.921  1.00 0.00 ? 30 ARG A HG3  2  
ATOM 1809  H HD2  . ARG A 1 30 ? -15.200 -2.153  -3.632  1.00 0.00 ? 30 ARG A HD2  2  
ATOM 1810  H HD3  . ARG A 1 30 ? -15.568 -2.268  -5.353  1.00 0.00 ? 30 ARG A HD3  2  
ATOM 1811  H HE   . ARG A 1 30 ? -16.234 -4.171  -3.304  1.00 0.00 ? 30 ARG A HE   2  
ATOM 1812  H HH11 . ARG A 1 30 ? -15.670 -3.724  -6.719  1.00 0.00 ? 30 ARG A HH11 2  
ATOM 1813  H HH12 . ARG A 1 30 ? -16.609 -5.103  -7.182  1.00 0.00 ? 30 ARG A HH12 2  
ATOM 1814  H HH21 . ARG A 1 30 ? -17.470 -5.985  -3.911  1.00 0.00 ? 30 ARG A HH21 2  
ATOM 1815  H HH22 . ARG A 1 30 ? -17.632 -6.386  -5.588  1.00 0.00 ? 30 ARG A HH22 2  
ATOM 1816  N N    . LYS A 1 31 ? -14.061 0.309   -6.346  1.00 0.00 ? 31 LYS A N    2  
ATOM 1817  C CA   . LYS A 1 31 ? -14.414 1.705   -6.542  1.00 0.00 ? 31 LYS A CA   2  
ATOM 1818  C C    . LYS A 1 31 ? -15.267 2.221   -5.388  1.00 0.00 ? 31 LYS A C    2  
ATOM 1819  O O    . LYS A 1 31 ? -16.223 1.569   -4.969  1.00 0.00 ? 31 LYS A O    2  
ATOM 1820  C CB   . LYS A 1 31 ? -15.159 1.886   -7.866  1.00 0.00 ? 31 LYS A CB   2  
ATOM 1821  C CG   . LYS A 1 31 ? -16.420 1.045   -7.974  1.00 0.00 ? 31 LYS A CG   2  
ATOM 1822  C CD   . LYS A 1 31 ? -16.708 0.657   -9.415  1.00 0.00 ? 31 LYS A CD   2  
ATOM 1823  C CE   . LYS A 1 31 ? -18.198 0.696   -9.715  1.00 0.00 ? 31 LYS A CE   2  
ATOM 1824  N NZ   . LYS A 1 31 ? -18.606 1.986   -10.337 1.00 0.00 ? 31 LYS A NZ   2  
ATOM 1825  H H    . LYS A 1 31 ? -14.669 -0.267  -5.849  1.00 0.00 ? 31 LYS A H    2  
ATOM 1826  H HA   . LYS A 1 31 ? -13.499 2.268   -6.575  1.00 0.00 ? 31 LYS A HA   2  
ATOM 1827  H HB2  . LYS A 1 31 ? -15.435 2.925   -7.971  1.00 0.00 ? 31 LYS A HB2  2  
ATOM 1828  H HB3  . LYS A 1 31 ? -14.500 1.614   -8.677  1.00 0.00 ? 31 LYS A HB3  2  
ATOM 1829  H HG2  . LYS A 1 31 ? -16.294 0.147   -7.389  1.00 0.00 ? 31 LYS A HG2  2  
ATOM 1830  H HG3  . LYS A 1 31 ? -17.254 1.614   -7.590  1.00 0.00 ? 31 LYS A HG3  2  
ATOM 1831  H HD2  . LYS A 1 31 ? -16.201 1.347   -10.073 1.00 0.00 ? 31 LYS A HD2  2  
ATOM 1832  H HD3  . LYS A 1 31 ? -16.341 -0.344  -9.588  1.00 0.00 ? 31 LYS A HD3  2  
ATOM 1833  H HE2  . LYS A 1 31 ? -18.437 -0.111  -10.392 1.00 0.00 ? 31 LYS A HE2  2  
ATOM 1834  H HE3  . LYS A 1 31 ? -18.742 0.563   -8.791  1.00 0.00 ? 31 LYS A HE3  2  
ATOM 1835  H HZ1  . LYS A 1 31 ? -19.552 1.895   -10.759 1.00 0.00 ? 31 LYS A HZ1  2  
ATOM 1836  H HZ2  . LYS A 1 31 ? -17.931 2.254   -11.081 1.00 0.00 ? 31 LYS A HZ2  2  
ATOM 1837  H HZ3  . LYS A 1 31 ? -18.629 2.738   -9.618  1.00 0.00 ? 31 LYS A HZ3  2  
ATOM 1838  N N    . ILE A 1 32 ? -14.913 3.397   -4.878  1.00 0.00 ? 32 ILE A N    2  
ATOM 1839  C CA   . ILE A 1 32 ? -15.640 4.005   -3.776  1.00 0.00 ? 32 ILE A CA   2  
ATOM 1840  C C    . ILE A 1 32 ? -15.474 5.521   -3.785  1.00 0.00 ? 32 ILE A C    2  
ATOM 1841  O O    . ILE A 1 32 ? -14.503 6.045   -4.331  1.00 0.00 ? 32 ILE A O    2  
ATOM 1842  C CB   . ILE A 1 32 ? -15.187 3.455   -2.407  1.00 0.00 ? 32 ILE A CB   2  
ATOM 1843  C CG1  . ILE A 1 32 ? -14.246 2.258   -2.575  1.00 0.00 ? 32 ILE A CG1  2  
ATOM 1844  C CG2  . ILE A 1 32 ? -16.394 3.068   -1.565  1.00 0.00 ? 32 ILE A CG2  2  
ATOM 1845  C CD1  . ILE A 1 32 ? -13.639 1.779   -1.274  1.00 0.00 ? 32 ILE A CD1  2  
ATOM 1846  H H    . ILE A 1 32 ? -14.146 3.867   -5.253  1.00 0.00 ? 32 ILE A H    2  
ATOM 1847  H HA   . ILE A 1 32 ? -16.679 3.772   -3.903  1.00 0.00 ? 32 ILE A HA   2  
ATOM 1848  H HB   . ILE A 1 32 ? -14.666 4.242   -1.894  1.00 0.00 ? 32 ILE A HB   2  
ATOM 1849  H HG12 . ILE A 1 32 ? -14.795 1.435   -3.007  1.00 0.00 ? 32 ILE A HG12 2  
ATOM 1850  H HG13 . ILE A 1 32 ? -13.439 2.533   -3.238  1.00 0.00 ? 32 ILE A HG13 2  
ATOM 1851  H HG21 . ILE A 1 32 ? -16.976 3.950   -1.343  1.00 0.00 ? 32 ILE A HG21 2  
ATOM 1852  H HG22 . ILE A 1 32 ? -16.060 2.616   -0.643  1.00 0.00 ? 32 ILE A HG22 2  
ATOM 1853  H HG23 . ILE A 1 32 ? -17.003 2.363   -2.111  1.00 0.00 ? 32 ILE A HG23 2  
ATOM 1854  H HD11 . ILE A 1 32 ? -12.953 2.525   -0.901  1.00 0.00 ? 32 ILE A HD11 2  
ATOM 1855  H HD12 . ILE A 1 32 ? -13.107 0.854   -1.445  1.00 0.00 ? 32 ILE A HD12 2  
ATOM 1856  H HD13 . ILE A 1 32 ? -14.422 1.616   -0.549  1.00 0.00 ? 32 ILE A HD13 2  
ATOM 1857  N N    . ILE A 1 33 ? -16.427 6.221   -3.177  1.00 0.00 ? 33 ILE A N    2  
ATOM 1858  C CA   . ILE A 1 33 ? -16.384 7.674   -3.117  1.00 0.00 ? 33 ILE A CA   2  
ATOM 1859  C C    . ILE A 1 33 ? -17.403 8.216   -2.118  1.00 0.00 ? 33 ILE A C    2  
ATOM 1860  O O    . ILE A 1 33 ? -18.577 7.847   -2.151  1.00 0.00 ? 33 ILE A O    2  
ATOM 1861  C CB   . ILE A 1 33 ? -16.641 8.297   -4.504  1.00 0.00 ? 33 ILE A CB   2  
ATOM 1862  C CG1  . ILE A 1 33 ? -16.336 9.796   -4.480  1.00 0.00 ? 33 ILE A CG1  2  
ATOM 1863  C CG2  . ILE A 1 33 ? -18.076 8.045   -4.949  1.00 0.00 ? 33 ILE A CG2  2  
ATOM 1864  C CD1  . ILE A 1 33 ? -15.044 10.159  -5.180  1.00 0.00 ? 33 ILE A CD1  2  
ATOM 1865  H H    . ILE A 1 33 ? -17.174 5.750   -2.761  1.00 0.00 ? 33 ILE A H    2  
ATOM 1866  H HA   . ILE A 1 33 ? -15.395 7.960   -2.795  1.00 0.00 ? 33 ILE A HA   2  
ATOM 1867  H HB   . ILE A 1 33 ? -15.985 7.816   -5.212  1.00 0.00 ? 33 ILE A HB   2  
ATOM 1868  H HG12 . ILE A 1 33 ? -17.137 10.330  -4.969  1.00 0.00 ? 33 ILE A HG12 2  
ATOM 1869  H HG13 . ILE A 1 33 ? -16.262 10.127  -3.455  1.00 0.00 ? 33 ILE A HG13 2  
ATOM 1870  H HG21 . ILE A 1 33 ? -18.689 8.894   -4.685  1.00 0.00 ? 33 ILE A HG21 2  
ATOM 1871  H HG22 . ILE A 1 33 ? -18.455 7.160   -4.459  1.00 0.00 ? 33 ILE A HG22 2  
ATOM 1872  H HG23 . ILE A 1 33 ? -18.101 7.903   -6.020  1.00 0.00 ? 33 ILE A HG23 2  
ATOM 1873  H HD11 . ILE A 1 33 ? -14.222 9.643   -4.708  1.00 0.00 ? 33 ILE A HD11 2  
ATOM 1874  H HD12 . ILE A 1 33 ? -14.886 11.226  -5.112  1.00 0.00 ? 33 ILE A HD12 2  
ATOM 1875  H HD13 . ILE A 1 33 ? -15.103 9.869   -6.218  1.00 0.00 ? 33 ILE A HD13 2  
ATOM 1876  N N    . LEU A 1 34 ? -16.945 9.091   -1.228  1.00 0.00 ? 34 LEU A N    2  
ATOM 1877  C CA   . LEU A 1 34 ? -17.814 9.680   -0.217  1.00 0.00 ? 34 LEU A CA   2  
ATOM 1878  C C    . LEU A 1 34 ? -18.818 10.641  -0.844  1.00 0.00 ? 34 LEU A C    2  
ATOM 1879  O O    . LEU A 1 34 ? -19.931 10.808  -0.345  1.00 0.00 ? 34 LEU A O    2  
ATOM 1880  C CB   . LEU A 1 34 ? -16.983 10.404  0.841   1.00 0.00 ? 34 LEU A CB   2  
ATOM 1881  C CG   . LEU A 1 34 ? -17.108 9.842   2.259   1.00 0.00 ? 34 LEU A CG   2  
ATOM 1882  C CD1  . LEU A 1 34 ? -15.987 8.853   2.541   1.00 0.00 ? 34 LEU A CD1  2  
ATOM 1883  C CD2  . LEU A 1 34 ? -17.097 10.968  3.282   1.00 0.00 ? 34 LEU A CD2  2  
ATOM 1884  H H    . LEU A 1 34 ? -16.000 9.344   -1.248  1.00 0.00 ? 34 LEU A H    2  
ATOM 1885  H HA   . LEU A 1 34 ? -18.351 8.883   0.253   1.00 0.00 ? 34 LEU A HA   2  
ATOM 1886  H HB2  . LEU A 1 34 ? -15.947 10.353  0.546   1.00 0.00 ? 34 LEU A HB2  2  
ATOM 1887  H HB3  . LEU A 1 34 ? -17.285 11.438  0.861   1.00 0.00 ? 34 LEU A HB3  2  
ATOM 1888  H HG   . LEU A 1 34 ? -18.047 9.316   2.348   1.00 0.00 ? 34 LEU A HG   2  
ATOM 1889  H HD11 . LEU A 1 34 ? -15.047 9.381   2.596   1.00 0.00 ? 34 LEU A HD11 2  
ATOM 1890  H HD12 . LEU A 1 34 ? -15.944 8.122   1.747   1.00 0.00 ? 34 LEU A HD12 2  
ATOM 1891  H HD13 . LEU A 1 34 ? -16.176 8.354   3.480   1.00 0.00 ? 34 LEU A HD13 2  
ATOM 1892  H HD21 . LEU A 1 34 ? -17.880 11.674  3.048   1.00 0.00 ? 34 LEU A HD21 2  
ATOM 1893  H HD22 . LEU A 1 34 ? -16.141 11.469  3.256   1.00 0.00 ? 34 LEU A HD22 2  
ATOM 1894  H HD23 . LEU A 1 34 ? -17.263 10.559  4.268   1.00 0.00 ? 34 LEU A HD23 2  
ATOM 1895  N N    . SER A 1 35 ? -18.414 11.270  -1.938  1.00 0.00 ? 35 SER A N    2  
ATOM 1896  C CA   . SER A 1 35 ? -19.272 12.218  -2.639  1.00 0.00 ? 35 SER A CA   2  
ATOM 1897  C C    . SER A 1 35 ? -20.498 11.524  -3.226  1.00 0.00 ? 35 SER A C    2  
ATOM 1898  O O    . SER A 1 35 ? -21.501 12.171  -3.530  1.00 0.00 ? 35 SER A O    2  
ATOM 1899  C CB   . SER A 1 35 ? -18.489 12.928  -3.748  1.00 0.00 ? 35 SER A CB   2  
ATOM 1900  O OG   . SER A 1 35 ? -17.221 12.326  -3.947  1.00 0.00 ? 35 SER A OG   2  
ATOM 1901  H H    . SER A 1 35 ? -17.517 11.093  -2.280  1.00 0.00 ? 35 SER A H    2  
ATOM 1902  H HA   . SER A 1 35 ? -19.601 12.951  -1.922  1.00 0.00 ? 35 SER A HA   2  
ATOM 1903  H HB2  . SER A 1 35 ? -19.046 12.875  -4.671  1.00 0.00 ? 35 SER A HB2  2  
ATOM 1904  H HB3  . SER A 1 35 ? -18.343 13.963  -3.475  1.00 0.00 ? 35 SER A HB3  2  
ATOM 1905  H HG   . SER A 1 35 ? -16.533 12.986  -3.839  1.00 0.00 ? 35 SER A HG   2  
ATOM 1906  N N    . ASP A 1 36 ? -20.414 10.207  -3.382  1.00 0.00 ? 36 ASP A N    2  
ATOM 1907  C CA   . ASP A 1 36 ? -21.512 9.431   -3.929  1.00 0.00 ? 36 ASP A CA   2  
ATOM 1908  C C    . ASP A 1 36 ? -21.907 8.302   -2.983  1.00 0.00 ? 36 ASP A C    2  
ATOM 1909  O O    . ASP A 1 36 ? -22.981 8.331   -2.381  1.00 0.00 ? 36 ASP A O    2  
ATOM 1910  C CB   . ASP A 1 36 ? -21.134 8.862   -5.298  1.00 0.00 ? 36 ASP A CB   2  
ATOM 1911  C CG   . ASP A 1 36 ? -22.288 8.904   -6.280  1.00 0.00 ? 36 ASP A CG   2  
ATOM 1912  O OD1  . ASP A 1 36 ? -23.057 7.922   -6.336  1.00 0.00 ? 36 ASP A OD1  2  
ATOM 1913  O OD2  . ASP A 1 36 ? -22.423 9.921   -6.994  1.00 0.00 ? 36 ASP A OD2  2  
ATOM 1914  H H    . ASP A 1 36 ? -19.598 9.749   -3.124  1.00 0.00 ? 36 ASP A H    2  
ATOM 1915  H HA   . ASP A 1 36 ? -22.347 10.094  -4.044  1.00 0.00 ? 36 ASP A HA   2  
ATOM 1916  H HB2  . ASP A 1 36 ? -20.317 9.437   -5.707  1.00 0.00 ? 36 ASP A HB2  2  
ATOM 1917  H HB3  . ASP A 1 36 ? -20.823 7.834   -5.180  1.00 0.00 ? 36 ASP A HB3  2  
ATOM 1918  N N    . GLU A 1 37 ? -21.034 7.309   -2.856  1.00 0.00 ? 37 GLU A N    2  
ATOM 1919  C CA   . GLU A 1 37 ? -21.292 6.171   -1.983  1.00 0.00 ? 37 GLU A CA   2  
ATOM 1920  C C    . GLU A 1 37 ? -21.325 6.597   -0.518  1.00 0.00 ? 37 GLU A C    2  
ATOM 1921  O O    . GLU A 1 37 ? -21.927 5.926   0.320   1.00 0.00 ? 37 GLU A O    2  
ATOM 1922  C CB   . GLU A 1 37 ? -20.234 5.090   -2.194  1.00 0.00 ? 37 GLU A CB   2  
ATOM 1923  C CG   . GLU A 1 37 ? -20.799 3.779   -2.705  1.00 0.00 ? 37 GLU A CG   2  
ATOM 1924  C CD   . GLU A 1 37 ? -20.557 2.624   -1.752  1.00 0.00 ? 37 GLU A CD   2  
ATOM 1925  O OE1  . GLU A 1 37 ? -21.384 2.427   -0.837  1.00 0.00 ? 37 GLU A OE1  2  
ATOM 1926  O OE2  . GLU A 1 37 ? -19.541 1.918   -1.921  1.00 0.00 ? 37 GLU A OE2  2  
ATOM 1927  H H    . GLU A 1 37 ? -20.196 7.341   -3.361  1.00 0.00 ? 37 GLU A H    2  
ATOM 1928  H HA   . GLU A 1 37 ? -22.251 5.770   -2.246  1.00 0.00 ? 37 GLU A HA   2  
ATOM 1929  H HB2  . GLU A 1 37 ? -19.513 5.447   -2.909  1.00 0.00 ? 37 GLU A HB2  2  
ATOM 1930  H HB3  . GLU A 1 37 ? -19.739 4.900   -1.258  1.00 0.00 ? 37 GLU A HB3  2  
ATOM 1931  H HG2  . GLU A 1 37 ? -21.861 3.894   -2.843  1.00 0.00 ? 37 GLU A HG2  2  
ATOM 1932  H HG3  . GLU A 1 37 ? -20.336 3.548   -3.653  1.00 0.00 ? 37 GLU A HG3  2  
ATOM 1933  N N    . GLY A 1 38 ? -20.675 7.715   -0.219  1.00 0.00 ? 38 GLY A N    2  
ATOM 1934  C CA   . GLY A 1 38 ? -20.641 8.213   1.143   1.00 0.00 ? 38 GLY A CA   2  
ATOM 1935  C C    . GLY A 1 38 ? -19.971 7.249   2.104   1.00 0.00 ? 38 GLY A C    2  
ATOM 1936  O O    . GLY A 1 38 ? -20.111 7.377   3.320   1.00 0.00 ? 38 GLY A O    2  
ATOM 1937  H H    . GLY A 1 38 ? -20.215 8.207   -0.929  1.00 0.00 ? 38 GLY A H    2  
ATOM 1938  H HA2  . GLY A 1 38 ? -20.104 9.150   1.159   1.00 0.00 ? 38 GLY A HA2  2  
ATOM 1939  H HA3  . GLY A 1 38 ? -21.653 8.386   1.474   1.00 0.00 ? 38 GLY A HA3  2  
ATOM 1940  N N    . LYS A 1 39 ? -19.230 6.289   1.559   1.00 0.00 ? 39 LYS A N    2  
ATOM 1941  C CA   . LYS A 1 39 ? -18.526 5.317   2.367   1.00 0.00 ? 39 LYS A CA   2  
ATOM 1942  C C    . LYS A 1 39 ? -17.216 4.931   1.700   1.00 0.00 ? 39 LYS A C    2  
ATOM 1943  O O    . LYS A 1 39 ? -17.159 3.993   0.904   1.00 0.00 ? 39 LYS A O    2  
ATOM 1944  C CB   . LYS A 1 39 ? -19.392 4.076   2.590   1.00 0.00 ? 39 LYS A CB   2  
ATOM 1945  C CG   . LYS A 1 39 ? -19.226 3.457   3.968   1.00 0.00 ? 39 LYS A CG   2  
ATOM 1946  C CD   . LYS A 1 39 ? -20.054 4.189   5.011   1.00 0.00 ? 39 LYS A CD   2  
ATOM 1947  C CE   . LYS A 1 39 ? -19.315 4.295   6.335   1.00 0.00 ? 39 LYS A CE   2  
ATOM 1948  N NZ   . LYS A 1 39 ? -19.725 5.502   7.105   1.00 0.00 ? 39 LYS A NZ   2  
ATOM 1949  H H    . LYS A 1 39 ? -19.135 6.248   0.596   1.00 0.00 ? 39 LYS A H    2  
ATOM 1950  H HA   . LYS A 1 39 ? -18.313 5.775   3.316   1.00 0.00 ? 39 LYS A HA   2  
ATOM 1951  H HB2  . LYS A 1 39 ? -20.430 4.347   2.464   1.00 0.00 ? 39 LYS A HB2  2  
ATOM 1952  H HB3  . LYS A 1 39 ? -19.132 3.332   1.851   1.00 0.00 ? 39 LYS A HB3  2  
ATOM 1953  H HG2  . LYS A 1 39 ? -19.544 2.426   3.930   1.00 0.00 ? 39 LYS A HG2  2  
ATOM 1954  H HG3  . LYS A 1 39 ? -18.184 3.504   4.249   1.00 0.00 ? 39 LYS A HG3  2  
ATOM 1955  H HD2  . LYS A 1 39 ? -20.270 5.184   4.651   1.00 0.00 ? 39 LYS A HD2  2  
ATOM 1956  H HD3  . LYS A 1 39 ? -20.978 3.651   5.165   1.00 0.00 ? 39 LYS A HD3  2  
ATOM 1957  H HE2  . LYS A 1 39 ? -19.529 3.415   6.923   1.00 0.00 ? 39 LYS A HE2  2  
ATOM 1958  H HE3  . LYS A 1 39 ? -18.255 4.346   6.138   1.00 0.00 ? 39 LYS A HE3  2  
ATOM 1959  H HZ1  . LYS A 1 39 ? -18.907 5.897   7.612   1.00 0.00 ? 39 LYS A HZ1  2  
ATOM 1960  H HZ2  . LYS A 1 39 ? -20.460 5.253   7.797   1.00 0.00 ? 39 LYS A HZ2  2  
ATOM 1961  H HZ3  . LYS A 1 39 ? -20.102 6.226   6.460   1.00 0.00 ? 39 LYS A HZ3  2  
ATOM 1962  N N    . MET A 1 40 ? -16.166 5.657   2.039   1.00 0.00 ? 40 MET A N    2  
ATOM 1963  C CA   . MET A 1 40 ? -14.846 5.403   1.494   1.00 0.00 ? 40 MET A CA   2  
ATOM 1964  C C    . MET A 1 40 ? -13.767 5.773   2.504   1.00 0.00 ? 40 MET A C    2  
ATOM 1965  O O    . MET A 1 40 ? -13.245 6.888   2.492   1.00 0.00 ? 40 MET A O    2  
ATOM 1966  C CB   . MET A 1 40 ? -14.643 6.187   0.196   1.00 0.00 ? 40 MET A CB   2  
ATOM 1967  C CG   . MET A 1 40 ? -13.335 5.868   -0.510  1.00 0.00 ? 40 MET A CG   2  
ATOM 1968  S SD   . MET A 1 40 ? -12.048 7.084   -0.171  1.00 0.00 ? 40 MET A SD   2  
ATOM 1969  C CE   . MET A 1 40 ? -11.769 7.748   -1.811  1.00 0.00 ? 40 MET A CE   2  
ATOM 1970  H H    . MET A 1 40 ? -16.283 6.378   2.676   1.00 0.00 ? 40 MET A H    2  
ATOM 1971  H HA   . MET A 1 40 ? -14.779 4.351   1.284   1.00 0.00 ? 40 MET A HA   2  
ATOM 1972  H HB2  . MET A 1 40 ? -15.456 5.961   -0.478  1.00 0.00 ? 40 MET A HB2  2  
ATOM 1973  H HB3  . MET A 1 40 ? -14.657 7.243   0.421   1.00 0.00 ? 40 MET A HB3  2  
ATOM 1974  H HG2  . MET A 1 40 ? -12.991 4.899   -0.180  1.00 0.00 ? 40 MET A HG2  2  
ATOM 1975  H HG3  . MET A 1 40 ? -13.514 5.841   -1.575  1.00 0.00 ? 40 MET A HG3  2  
ATOM 1976  H HE1  . MET A 1 40 ? -10.801 8.223   -1.847  1.00 0.00 ? 40 MET A HE1  2  
ATOM 1977  H HE2  . MET A 1 40 ? -12.536 8.474   -2.040  1.00 0.00 ? 40 MET A HE2  2  
ATOM 1978  H HE3  . MET A 1 40 ? -11.804 6.947   -2.534  1.00 0.00 ? 40 MET A HE3  2  
ATOM 1979  N N    . TYR A 1 41 ? -13.441 4.829   3.375   1.00 0.00 ? 41 TYR A N    2  
ATOM 1980  C CA   . TYR A 1 41 ? -12.426 5.046   4.396   1.00 0.00 ? 41 TYR A CA   2  
ATOM 1981  C C    . TYR A 1 41 ? -11.029 5.052   3.783   1.00 0.00 ? 41 TYR A C    2  
ATOM 1982  O O    . TYR A 1 41 ? -10.847 4.678   2.625   1.00 0.00 ? 41 TYR A O    2  
ATOM 1983  C CB   . TYR A 1 41 ? -12.523 3.971   5.476   1.00 0.00 ? 41 TYR A CB   2  
ATOM 1984  C CG   . TYR A 1 41 ? -12.852 4.518   6.847   1.00 0.00 ? 41 TYR A CG   2  
ATOM 1985  C CD1  . TYR A 1 41 ? -14.167 4.772   7.217   1.00 0.00 ? 41 TYR A CD1  2  
ATOM 1986  C CD2  . TYR A 1 41 ? -11.848 4.779   7.771   1.00 0.00 ? 41 TYR A CD2  2  
ATOM 1987  C CE1  . TYR A 1 41 ? -14.471 5.272   8.469   1.00 0.00 ? 41 TYR A CE1  2  
ATOM 1988  C CE2  . TYR A 1 41 ? -12.145 5.278   9.025   1.00 0.00 ? 41 TYR A CE2  2  
ATOM 1989  C CZ   . TYR A 1 41 ? -13.457 5.523   9.369   1.00 0.00 ? 41 TYR A CZ   2  
ATOM 1990  O OH   . TYR A 1 41 ? -13.756 6.021   10.616  1.00 0.00 ? 41 TYR A OH   2  
ATOM 1991  H H    . TYR A 1 41 ? -13.898 3.968   3.333   1.00 0.00 ? 41 TYR A H    2  
ATOM 1992  H HA   . TYR A 1 41 ? -12.614 6.003   4.844   1.00 0.00 ? 41 TYR A HA   2  
ATOM 1993  H HB2  . TYR A 1 41 ? -13.296 3.271   5.205   1.00 0.00 ? 41 TYR A HB2  2  
ATOM 1994  H HB3  . TYR A 1 41 ? -11.580 3.453   5.542   1.00 0.00 ? 41 TYR A HB3  2  
ATOM 1995  H HD1  . TYR A 1 41 ? -14.959 4.575   6.510   1.00 0.00 ? 41 TYR A HD1  2  
ATOM 1996  H HD2  . TYR A 1 41 ? -10.821 4.587   7.498   1.00 0.00 ? 41 TYR A HD2  2  
ATOM 1997  H HE1  . TYR A 1 41 ? -15.499 5.464   8.738   1.00 0.00 ? 41 TYR A HE1  2  
ATOM 1998  H HE2  . TYR A 1 41 ? -11.350 5.475   9.729   1.00 0.00 ? 41 TYR A HE2  2  
ATOM 1999  H HH   . TYR A 1 41 ? -14.552 5.597   10.947  1.00 0.00 ? 41 TYR A HH   2  
ATOM 2000  N N    . GLY A 1 42 ? -10.045 5.477   4.569   1.00 0.00 ? 42 GLY A N    2  
ATOM 2001  C CA   . GLY A 1 42 ? -8.678  5.521   4.086   1.00 0.00 ? 42 GLY A CA   2  
ATOM 2002  C C    . GLY A 1 42 ? -8.170  4.156   3.664   1.00 0.00 ? 42 GLY A C    2  
ATOM 2003  O O    . GLY A 1 42 ? -7.876  3.308   4.506   1.00 0.00 ? 42 GLY A O    2  
ATOM 2004  H H    . GLY A 1 42 ? -10.249 5.762   5.484   1.00 0.00 ? 42 GLY A H    2  
ATOM 2005  H HA2  . GLY A 1 42 ? -8.628  6.189   3.239   1.00 0.00 ? 42 GLY A HA2  2  
ATOM 2006  H HA3  . GLY A 1 42 ? -8.042  5.902   4.871   1.00 0.00 ? 42 GLY A HA3  2  
ATOM 2007  N N    . ARG A 1 43 ? -8.068  3.943   2.355   1.00 0.00 ? 43 ARG A N    2  
ATOM 2008  C CA   . ARG A 1 43 ? -7.593  2.671   1.823   1.00 0.00 ? 43 ARG A CA   2  
ATOM 2009  C C    . ARG A 1 43 ? -6.191  2.351   2.330   1.00 0.00 ? 43 ARG A C    2  
ATOM 2010  O O    . ARG A 1 43 ? -5.804  1.186   2.425   1.00 0.00 ? 43 ARG A O    2  
ATOM 2011  C CB   . ARG A 1 43 ? -7.609  2.695   0.297   1.00 0.00 ? 43 ARG A CB   2  
ATOM 2012  C CG   . ARG A 1 43 ? -8.541  1.664   -0.318  1.00 0.00 ? 43 ARG A CG   2  
ATOM 2013  C CD   . ARG A 1 43 ? -8.263  1.476   -1.801  1.00 0.00 ? 43 ARG A CD   2  
ATOM 2014  N NE   . ARG A 1 43 ? -9.335  0.745   -2.471  1.00 0.00 ? 43 ARG A NE   2  
ATOM 2015  C CZ   . ARG A 1 43 ? -9.556  -0.558  -2.310  1.00 0.00 ? 43 ARG A CZ   2  
ATOM 2016  N NH1  . ARG A 1 43 ? -8.782  -1.275  -1.506  1.00 0.00 ? 43 ARG A NH1  2  
ATOM 2017  N NH2  . ARG A 1 43 ? -10.554 -1.145  -2.956  1.00 0.00 ? 43 ARG A NH2  2  
ATOM 2018  H H    . ARG A 1 43 ? -8.318  4.658   1.733   1.00 0.00 ? 43 ARG A H    2  
ATOM 2019  H HA   . ARG A 1 43 ? -8.263  1.905   2.163   1.00 0.00 ? 43 ARG A HA   2  
ATOM 2020  H HB2  . ARG A 1 43 ? -7.924  3.673   -0.030  1.00 0.00 ? 43 ARG A HB2  2  
ATOM 2021  H HB3  . ARG A 1 43 ? -6.611  2.507   -0.065  1.00 0.00 ? 43 ARG A HB3  2  
ATOM 2022  H HG2  . ARG A 1 43 ? -8.401  0.720   0.186   1.00 0.00 ? 43 ARG A HG2  2  
ATOM 2023  H HG3  . ARG A 1 43 ? -9.561  1.995   -0.192  1.00 0.00 ? 43 ARG A HG3  2  
ATOM 2024  H HD2  . ARG A 1 43 ? -8.161  2.448   -2.261  1.00 0.00 ? 43 ARG A HD2  2  
ATOM 2025  H HD3  . ARG A 1 43 ? -7.339  0.927   -1.914  1.00 0.00 ? 43 ARG A HD3  2  
ATOM 2026  H HE   . ARG A 1 43 ? -9.922  1.251   -3.071  1.00 0.00 ? 43 ARG A HE   2  
ATOM 2027  H HH11 . ARG A 1 43 ? -8.028  -0.839  -1.015  1.00 0.00 ? 43 ARG A HH11 2  
ATOM 2028  H HH12 . ARG A 1 43 ? -8.953  -2.254  -1.389  1.00 0.00 ? 43 ARG A HH12 2  
ATOM 2029  H HH21 . ARG A 1 43 ? -11.140 -0.609  -3.564  1.00 0.00 ? 43 ARG A HH21 2  
ATOM 2030  H HH22 . ARG A 1 43 ? -10.720 -2.124  -2.836  1.00 0.00 ? 43 ARG A HH22 2  
ATOM 2031  N N    . ASN A 1 44 ? -5.438  3.392   2.653   1.00 0.00 ? 44 ASN A N    2  
ATOM 2032  C CA   . ASN A 1 44 ? -4.079  3.227   3.151   1.00 0.00 ? 44 ASN A CA   2  
ATOM 2033  C C    . ASN A 1 44 ? -4.080  2.602   4.541   1.00 0.00 ? 44 ASN A C    2  
ATOM 2034  O O    . ASN A 1 44 ? -3.115  1.951   4.942   1.00 0.00 ? 44 ASN A O    2  
ATOM 2035  C CB   . ASN A 1 44 ? -3.355  4.571   3.177   1.00 0.00 ? 44 ASN A CB   2  
ATOM 2036  C CG   . ASN A 1 44 ? -2.164  4.606   2.238   1.00 0.00 ? 44 ASN A CG   2  
ATOM 2037  O OD1  . ASN A 1 44 ? -1.607  3.566   1.886   1.00 0.00 ? 44 ASN A OD1  2  
ATOM 2038  N ND2  . ASN A 1 44 ? -1.768  5.805   1.829   1.00 0.00 ? 44 ASN A ND2  2  
ATOM 2039  H H    . ASN A 1 44 ? -5.804  4.293   2.556   1.00 0.00 ? 44 ASN A H    2  
ATOM 2040  H HA   . ASN A 1 44 ? -3.565  2.569   2.480   1.00 0.00 ? 44 ASN A HA   2  
ATOM 2041  H HB2  . ASN A 1 44 ? -4.044  5.344   2.881   1.00 0.00 ? 44 ASN A HB2  2  
ATOM 2042  H HB3  . ASN A 1 44 ? -3.007  4.767   4.178   1.00 0.00 ? 44 ASN A HB3  2  
ATOM 2043  H HD21 . ASN A 1 44 ? -2.260  6.590   2.151   1.00 0.00 ? 44 ASN A HD21 2  
ATOM 2044  H HD22 . ASN A 1 44 ? -1.001  5.857   1.222   1.00 0.00 ? 44 ASN A HD22 2  
ATOM 2045  N N    . GLU A 1 45 ? -5.169  2.803   5.270   1.00 0.00 ? 45 GLU A N    2  
ATOM 2046  C CA   . GLU A 1 45 ? -5.299  2.257   6.612   1.00 0.00 ? 45 GLU A CA   2  
ATOM 2047  C C    . GLU A 1 45 ? -5.481  0.746   6.564   1.00 0.00 ? 45 GLU A C    2  
ATOM 2048  O O    . GLU A 1 45 ? -5.119  0.035   7.501   1.00 0.00 ? 45 GLU A O    2  
ATOM 2049  C CB   . GLU A 1 45 ? -6.478  2.906   7.340   1.00 0.00 ? 45 GLU A CB   2  
ATOM 2050  C CG   . GLU A 1 45 ? -6.315  2.939   8.851   1.00 0.00 ? 45 GLU A CG   2  
ATOM 2051  C CD   . GLU A 1 45 ? -6.979  4.147   9.483   1.00 0.00 ? 45 GLU A CD   2  
ATOM 2052  O OE1  . GLU A 1 45 ? -8.226  4.181   9.531   1.00 0.00 ? 45 GLU A OE1  2  
ATOM 2053  O OE2  . GLU A 1 45 ? -6.251  5.059   9.929   1.00 0.00 ? 45 GLU A OE2  2  
ATOM 2054  H H    . GLU A 1 45 ? -5.902  3.328   4.895   1.00 0.00 ? 45 GLU A H    2  
ATOM 2055  H HA   . GLU A 1 45 ? -4.392  2.479   7.142   1.00 0.00 ? 45 GLU A HA   2  
ATOM 2056  H HB2  . GLU A 1 45 ? -6.588  3.921   6.990   1.00 0.00 ? 45 GLU A HB2  2  
ATOM 2057  H HB3  . GLU A 1 45 ? -7.377  2.354   7.109   1.00 0.00 ? 45 GLU A HB3  2  
ATOM 2058  H HG2  . GLU A 1 45 ? -6.757  2.046   9.268   1.00 0.00 ? 45 GLU A HG2  2  
ATOM 2059  H HG3  . GLU A 1 45 ? -5.261  2.961   9.086   1.00 0.00 ? 45 GLU A HG3  2  
ATOM 2060  N N    . LEU A 1 46 ? -6.041  0.264   5.462   1.00 0.00 ? 46 LEU A N    2  
ATOM 2061  C CA   . LEU A 1 46 ? -6.272  -1.161  5.282   1.00 0.00 ? 46 LEU A CA   2  
ATOM 2062  C C    . LEU A 1 46 ? -4.965  -1.896  5.040   1.00 0.00 ? 46 LEU A C    2  
ATOM 2063  O O    . LEU A 1 46 ? -4.713  -2.952  5.622   1.00 0.00 ? 46 LEU A O    2  
ATOM 2064  C CB   . LEU A 1 46 ? -7.234  -1.404  4.121   1.00 0.00 ? 46 LEU A CB   2  
ATOM 2065  C CG   . LEU A 1 46 ? -8.410  -2.330  4.432   1.00 0.00 ? 46 LEU A CG   2  
ATOM 2066  C CD1  . LEU A 1 46 ? -9.244  -2.566  3.182   1.00 0.00 ? 46 LEU A CD1  2  
ATOM 2067  C CD2  . LEU A 1 46 ? -7.912  -3.651  4.998   1.00 0.00 ? 46 LEU A CD2  2  
ATOM 2068  H H    . LEU A 1 46 ? -6.304  0.882   4.754   1.00 0.00 ? 46 LEU A H    2  
ATOM 2069  H HA   . LEU A 1 46 ? -6.708  -1.536  6.178   1.00 0.00 ? 46 LEU A HA   2  
ATOM 2070  H HB2  . LEU A 1 46 ? -7.626  -0.450  3.799   1.00 0.00 ? 46 LEU A HB2  2  
ATOM 2071  H HB3  . LEU A 1 46 ? -6.674  -1.834  3.310   1.00 0.00 ? 46 LEU A HB3  2  
ATOM 2072  H HG   . LEU A 1 46 ? -9.042  -1.863  5.173   1.00 0.00 ? 46 LEU A HG   2  
ATOM 2073  H HD11 . LEU A 1 46 ? -8.605  -2.913  2.383   1.00 0.00 ? 46 LEU A HD11 2  
ATOM 2074  H HD12 . LEU A 1 46 ? -9.721  -1.643  2.888   1.00 0.00 ? 46 LEU A HD12 2  
ATOM 2075  H HD13 . LEU A 1 46 ? -9.999  -3.311  3.389   1.00 0.00 ? 46 LEU A HD13 2  
ATOM 2076  H HD21 . LEU A 1 46 ? -7.505  -4.254  4.199   1.00 0.00 ? 46 LEU A HD21 2  
ATOM 2077  H HD22 . LEU A 1 46 ? -8.733  -4.176  5.463   1.00 0.00 ? 46 LEU A HD22 2  
ATOM 2078  H HD23 . LEU A 1 46 ? -7.143  -3.461  5.732   1.00 0.00 ? 46 LEU A HD23 2  
ATOM 2079  N N    . ILE A 1 47 ? -4.137  -1.326  4.184   1.00 0.00 ? 47 ILE A N    2  
ATOM 2080  C CA   . ILE A 1 47 ? -2.850  -1.916  3.864   1.00 0.00 ? 47 ILE A CA   2  
ATOM 2081  C C    . ILE A 1 47 ? -1.882  -1.732  5.019   1.00 0.00 ? 47 ILE A C    2  
ATOM 2082  O O    . ILE A 1 47 ? -1.025  -2.579  5.269   1.00 0.00 ? 47 ILE A O    2  
ATOM 2083  C CB   . ILE A 1 47 ? -2.231  -1.325  2.576   1.00 0.00 ? 47 ILE A CB   2  
ATOM 2084  C CG1  . ILE A 1 47 ? -2.795  0.067   2.271   1.00 0.00 ? 47 ILE A CG1  2  
ATOM 2085  C CG2  . ILE A 1 47 ? -2.462  -2.260  1.399   1.00 0.00 ? 47 ILE A CG2  2  
ATOM 2086  C CD1  . ILE A 1 47 ? -2.015  0.818   1.214   1.00 0.00 ? 47 ILE A CD1  2  
ATOM 2087  H H    . ILE A 1 47 ? -4.397  -0.488  3.765   1.00 0.00 ? 47 ILE A H    2  
ATOM 2088  H HA   . ILE A 1 47 ? -3.006  -2.968  3.717   1.00 0.00 ? 47 ILE A HA   2  
ATOM 2089  H HB   . ILE A 1 47 ? -1.170  -1.241  2.729   1.00 0.00 ? 47 ILE A HB   2  
ATOM 2090  H HG12 . ILE A 1 47 ? -3.812  -0.033  1.922   1.00 0.00 ? 47 ILE A HG12 2  
ATOM 2091  H HG13 . ILE A 1 47 ? -2.786  0.658   3.174   1.00 0.00 ? 47 ILE A HG13 2  
ATOM 2092  H HG21 . ILE A 1 47 ? -3.499  -2.558  1.374   1.00 0.00 ? 47 ILE A HG21 2  
ATOM 2093  H HG22 . ILE A 1 47 ? -1.838  -3.135  1.507   1.00 0.00 ? 47 ILE A HG22 2  
ATOM 2094  H HG23 . ILE A 1 47 ? -2.212  -1.750  0.480   1.00 0.00 ? 47 ILE A HG23 2  
ATOM 2095  H HD11 . ILE A 1 47 ? -1.933  0.209   0.326   1.00 0.00 ? 47 ILE A HD11 2  
ATOM 2096  H HD12 . ILE A 1 47 ? -1.028  1.044   1.588   1.00 0.00 ? 47 ILE A HD12 2  
ATOM 2097  H HD13 . ILE A 1 47 ? -2.528  1.737   0.973   1.00 0.00 ? 47 ILE A HD13 2  
ATOM 2098  N N    . ALA A 1 48 ? -2.036  -0.626  5.728   1.00 0.00 ? 48 ALA A N    2  
ATOM 2099  C CA   . ALA A 1 48 ? -1.191  -0.332  6.868   1.00 0.00 ? 48 ALA A CA   2  
ATOM 2100  C C    . ALA A 1 48 ? -1.625  -1.144  8.078   1.00 0.00 ? 48 ALA A C    2  
ATOM 2101  O O    . ALA A 1 48 ? -0.826  -1.425  8.971   1.00 0.00 ? 48 ALA A O    2  
ATOM 2102  C CB   . ALA A 1 48 ? -1.209  1.157   7.179   1.00 0.00 ? 48 ALA A CB   2  
ATOM 2103  H H    . ALA A 1 48 ? -2.742  0.000   5.483   1.00 0.00 ? 48 ALA A H    2  
ATOM 2104  H HA   . ALA A 1 48 ? -0.187  -0.613  6.608   1.00 0.00 ? 48 ALA A HA   2  
ATOM 2105  H HB1  . ALA A 1 48 ? -0.835  1.707   6.327   1.00 0.00 ? 48 ALA A HB1  2  
ATOM 2106  H HB2  . ALA A 1 48 ? -0.583  1.353   8.037   1.00 0.00 ? 48 ALA A HB2  2  
ATOM 2107  H HB3  . ALA A 1 48 ? -2.221  1.468   7.392   1.00 0.00 ? 48 ALA A HB3  2  
ATOM 2108  N N    . ARG A 1 49 ? -2.893  -1.536  8.095   1.00 0.00 ? 49 ARG A N    2  
ATOM 2109  C CA   . ARG A 1 49 ? -3.420  -2.336  9.185   1.00 0.00 ? 49 ARG A CA   2  
ATOM 2110  C C    . ARG A 1 49 ? -2.895  -3.760  9.082   1.00 0.00 ? 49 ARG A C    2  
ATOM 2111  O O    . ARG A 1 49 ? -2.758  -4.461  10.085  1.00 0.00 ? 49 ARG A O    2  
ATOM 2112  C CB   . ARG A 1 49 ? -4.950  -2.329  9.173   1.00 0.00 ? 49 ARG A CB   2  
ATOM 2113  C CG   . ARG A 1 49 ? -5.561  -1.323  10.135  1.00 0.00 ? 49 ARG A CG   2  
ATOM 2114  C CD   . ARG A 1 49 ? -6.871  -1.833  10.715  1.00 0.00 ? 49 ARG A CD   2  
ATOM 2115  N NE   . ARG A 1 49 ? -6.657  -2.876  11.716  1.00 0.00 ? 49 ARG A NE   2  
ATOM 2116  C CZ   . ARG A 1 49 ? -7.632  -3.624  12.227  1.00 0.00 ? 49 ARG A CZ   2  
ATOM 2117  N NH1  . ARG A 1 49 ? -8.888  -3.448  11.835  1.00 0.00 ? 49 ARG A NH1  2  
ATOM 2118  N NH2  . ARG A 1 49 ? -7.351  -4.551  13.132  1.00 0.00 ? 49 ARG A NH2  2  
ATOM 2119  H H    . ARG A 1 49 ? -3.481  -1.295  7.352   1.00 0.00 ? 49 ARG A H    2  
ATOM 2120  H HA   . ARG A 1 49 ? -3.068  -1.905  10.104  1.00 0.00 ? 49 ARG A HA   2  
ATOM 2121  H HB2  . ARG A 1 49 ? -5.289  -2.093  8.175   1.00 0.00 ? 49 ARG A HB2  2  
ATOM 2122  H HB3  . ARG A 1 49 ? -5.306  -3.313  9.441   1.00 0.00 ? 49 ARG A HB3  2  
ATOM 2123  H HG2  . ARG A 1 49 ? -4.867  -1.144  10.942  1.00 0.00 ? 49 ARG A HG2  2  
ATOM 2124  H HG3  . ARG A 1 49 ? -5.747  -0.401  9.605   1.00 0.00 ? 49 ARG A HG3  2  
ATOM 2125  H HD2  . ARG A 1 49 ? -7.391  -1.007  11.176  1.00 0.00 ? 49 ARG A HD2  2  
ATOM 2126  H HD3  . ARG A 1 49 ? -7.473  -2.234  9.913   1.00 0.00 ? 49 ARG A HD3  2  
ATOM 2127  H HE   . ARG A 1 49 ? -5.739  -3.027  12.023  1.00 0.00 ? 49 ARG A HE   2  
ATOM 2128  H HH11 . ARG A 1 49 ? -9.107  -2.751  11.152  1.00 0.00 ? 49 ARG A HH11 2  
ATOM 2129  H HH12 . ARG A 1 49 ? -9.616  -4.014  12.223  1.00 0.00 ? 49 ARG A HH12 2  
ATOM 2130  H HH21 . ARG A 1 49 ? -6.406  -4.688  13.431  1.00 0.00 ? 49 ARG A HH21 2  
ATOM 2131  H HH22 . ARG A 1 49 ? -8.083  -5.113  13.517  1.00 0.00 ? 49 ARG A HH22 2  
ATOM 2132  N N    . TYR A 1 50 ? -2.590  -4.174  7.857   1.00 0.00 ? 50 TYR A N    2  
ATOM 2133  C CA   . TYR A 1 50 ? -2.063  -5.504  7.612   1.00 0.00 ? 50 TYR A CA   2  
ATOM 2134  C C    . TYR A 1 50 ? -0.659  -5.631  8.163   1.00 0.00 ? 50 TYR A C    2  
ATOM 2135  O O    . TYR A 1 50 ? -0.358  -6.536  8.942   1.00 0.00 ? 50 TYR A O    2  
ATOM 2136  C CB   . TYR A 1 50 ? -2.055  -5.806  6.124   1.00 0.00 ? 50 TYR A CB   2  
ATOM 2137  C CG   . TYR A 1 50 ? -2.020  -7.282  5.806   1.00 0.00 ? 50 TYR A CG   2  
ATOM 2138  C CD1  . TYR A 1 50 ? -0.843  -8.007  5.935   1.00 0.00 ? 50 TYR A CD1  2  
ATOM 2139  C CD2  . TYR A 1 50 ? -3.160  -7.951  5.380   1.00 0.00 ? 50 TYR A CD2  2  
ATOM 2140  C CE1  . TYR A 1 50 ? -0.801  -9.356  5.648   1.00 0.00 ? 50 TYR A CE1  2  
ATOM 2141  C CE2  . TYR A 1 50 ? -3.127  -9.303  5.091   1.00 0.00 ? 50 TYR A CE2  2  
ATOM 2142  C CZ   . TYR A 1 50 ? -1.945  -10.000 5.226   1.00 0.00 ? 50 TYR A CZ   2  
ATOM 2143  O OH   . TYR A 1 50 ? -1.907  -11.346 4.939   1.00 0.00 ? 50 TYR A OH   2  
ATOM 2144  H H    . TYR A 1 50 ? -2.713  -3.563  7.101   1.00 0.00 ? 50 TYR A H    2  
ATOM 2145  H HA   . TYR A 1 50 ? -2.688  -6.205  8.104   1.00 0.00 ? 50 TYR A HA   2  
ATOM 2146  H HB2  . TYR A 1 50 ? -2.934  -5.382  5.670   1.00 0.00 ? 50 TYR A HB2  2  
ATOM 2147  H HB3  . TYR A 1 50 ? -1.184  -5.357  5.695   1.00 0.00 ? 50 TYR A HB3  2  
ATOM 2148  H HD1  . TYR A 1 50 ? 0.052   -7.500  6.265   1.00 0.00 ? 50 TYR A HD1  2  
ATOM 2149  H HD2  . TYR A 1 50 ? -4.084  -7.402  5.274   1.00 0.00 ? 50 TYR A HD2  2  
ATOM 2150  H HE1  . TYR A 1 50 ? 0.126   -9.901  5.755   1.00 0.00 ? 50 TYR A HE1  2  
ATOM 2151  H HE2  . TYR A 1 50 ? -4.023  -9.806  4.761   1.00 0.00 ? 50 TYR A HE2  2  
ATOM 2152  H HH   . TYR A 1 50 ? -1.089  -11.553 4.481   1.00 0.00 ? 50 TYR A HH   2  
ATOM 2153  N N    . ILE A 1 51 ? 0.192   -4.712  7.752   1.00 0.00 ? 51 ILE A N    2  
ATOM 2154  C CA   . ILE A 1 51 ? 1.573   -4.703  8.200   1.00 0.00 ? 51 ILE A CA   2  
ATOM 2155  C C    . ILE A 1 51 ? 1.646   -4.501  9.705   1.00 0.00 ? 51 ILE A C    2  
ATOM 2156  O O    . ILE A 1 51 ? 2.543   -5.016  10.372  1.00 0.00 ? 51 ILE A O    2  
ATOM 2157  C CB   . ILE A 1 51 ? 2.412   -3.616  7.495   1.00 0.00 ? 51 ILE A CB   2  
ATOM 2158  C CG1  . ILE A 1 51 ? 1.535   -2.462  6.998   1.00 0.00 ? 51 ILE A CG1  2  
ATOM 2159  C CG2  . ILE A 1 51 ? 3.194   -4.223  6.341   1.00 0.00 ? 51 ILE A CG2  2  
ATOM 2160  C CD1  . ILE A 1 51 ? 2.315   -1.202  6.692   1.00 0.00 ? 51 ILE A CD1  2  
ATOM 2161  H H    . ILE A 1 51 ? -0.120  -4.021  7.136   1.00 0.00 ? 51 ILE A H    2  
ATOM 2162  H HA   . ILE A 1 51 ? 1.997   -5.663  7.964   1.00 0.00 ? 51 ILE A HA   2  
ATOM 2163  H HB   . ILE A 1 51 ? 3.115   -3.232  8.210   1.00 0.00 ? 51 ILE A HB   2  
ATOM 2164  H HG12 . ILE A 1 51 ? 1.030   -2.766  6.094   1.00 0.00 ? 51 ILE A HG12 2  
ATOM 2165  H HG13 . ILE A 1 51 ? 0.802   -2.225  7.753   1.00 0.00 ? 51 ILE A HG13 2  
ATOM 2166  H HG21 . ILE A 1 51 ? 2.708   -5.132  6.016   1.00 0.00 ? 51 ILE A HG21 2  
ATOM 2167  H HG22 . ILE A 1 51 ? 4.199   -4.449  6.667   1.00 0.00 ? 51 ILE A HG22 2  
ATOM 2168  H HG23 . ILE A 1 51 ? 3.231   -3.521  5.521   1.00 0.00 ? 51 ILE A HG23 2  
ATOM 2169  H HD11 . ILE A 1 51 ? 3.252   -1.219  7.229   1.00 0.00 ? 51 ILE A HD11 2  
ATOM 2170  H HD12 . ILE A 1 51 ? 1.741   -0.340  6.998   1.00 0.00 ? 51 ILE A HD12 2  
ATOM 2171  H HD13 . ILE A 1 51 ? 2.509   -1.148  5.631   1.00 0.00 ? 51 ILE A HD13 2  
ATOM 2172  N N    . LYS A 1 52 ? 0.686   -3.758  10.233  1.00 0.00 ? 52 LYS A N    2  
ATOM 2173  C CA   . LYS A 1 52 ? 0.624   -3.493  11.662  1.00 0.00 ? 52 LYS A CA   2  
ATOM 2174  C C    . LYS A 1 52 ? 0.243   -4.756  12.425  1.00 0.00 ? 52 LYS A C    2  
ATOM 2175  O O    . LYS A 1 52 ? 0.608   -4.928  13.588  1.00 0.00 ? 52 LYS A O    2  
ATOM 2176  C CB   . LYS A 1 52 ? -0.381  -2.377  11.956  1.00 0.00 ? 52 LYS A CB   2  
ATOM 2177  C CG   . LYS A 1 52 ? -0.099  -1.632  13.251  1.00 0.00 ? 52 LYS A CG   2  
ATOM 2178  C CD   . LYS A 1 52 ? -0.345  -2.512  14.465  1.00 0.00 ? 52 LYS A CD   2  
ATOM 2179  C CE   . LYS A 1 52 ? -0.843  -1.700  15.650  1.00 0.00 ? 52 LYS A CE   2  
ATOM 2180  N NZ   . LYS A 1 52 ? -0.448  -2.312  16.948  1.00 0.00 ? 52 LYS A NZ   2  
ATOM 2181  H H    . LYS A 1 52 ? -0.001  -3.384  9.647   1.00 0.00 ? 52 LYS A H    2  
ATOM 2182  H HA   . LYS A 1 52 ? 1.601   -3.180  11.978  1.00 0.00 ? 52 LYS A HA   2  
ATOM 2183  H HB2  . LYS A 1 52 ? -0.359  -1.666  11.144  1.00 0.00 ? 52 LYS A HB2  2  
ATOM 2184  H HB3  . LYS A 1 52 ? -1.369  -2.807  12.021  1.00 0.00 ? 52 LYS A HB3  2  
ATOM 2185  H HG2  . LYS A 1 52 ? 0.932   -1.311  13.254  1.00 0.00 ? 52 LYS A HG2  2  
ATOM 2186  H HG3  . LYS A 1 52 ? -0.747  -0.769  13.305  1.00 0.00 ? 52 LYS A HG3  2  
ATOM 2187  H HD2  . LYS A 1 52 ? -1.087  -3.255  14.215  1.00 0.00 ? 52 LYS A HD2  2  
ATOM 2188  H HD3  . LYS A 1 52 ? 0.580   -2.999  14.737  1.00 0.00 ? 52 LYS A HD3  2  
ATOM 2189  H HE2  . LYS A 1 52 ? -0.426  -0.706  15.589  1.00 0.00 ? 52 LYS A HE2  2  
ATOM 2190  H HE3  . LYS A 1 52 ? -1.920  -1.641  15.602  1.00 0.00 ? 52 LYS A HE3  2  
ATOM 2191  H HZ1  . LYS A 1 52 ? -1.134  -2.058  17.687  1.00 0.00 ? 52 LYS A HZ1  2  
ATOM 2192  H HZ2  . LYS A 1 52 ? 0.493   -1.971  17.233  1.00 0.00 ? 52 LYS A HZ2  2  
ATOM 2193  H HZ3  . LYS A 1 52 ? -0.416  -3.348  16.860  1.00 0.00 ? 52 LYS A HZ3  2  
ATOM 2194  N N    . LEU A 1 53 ? -0.494  -5.637  11.758  1.00 0.00 ? 53 LEU A N    2  
ATOM 2195  C CA   . LEU A 1 53 ? -0.929  -6.887  12.361  1.00 0.00 ? 53 LEU A CA   2  
ATOM 2196  C C    . LEU A 1 53 ? 0.143   -7.968  12.234  1.00 0.00 ? 53 LEU A C    2  
ATOM 2197  O O    . LEU A 1 53 ? 0.104   -8.978  12.936  1.00 0.00 ? 53 LEU A O    2  
ATOM 2198  C CB   . LEU A 1 53 ? -2.232  -7.360  11.711  1.00 0.00 ? 53 LEU A CB   2  
ATOM 2199  C CG   . LEU A 1 53 ? -3.435  -7.442  12.655  1.00 0.00 ? 53 LEU A CG   2  
ATOM 2200  C CD1  . LEU A 1 53 ? -4.632  -6.716  12.061  1.00 0.00 ? 53 LEU A CD1  2  
ATOM 2201  C CD2  . LEU A 1 53 ? -3.784  -8.893  12.952  1.00 0.00 ? 53 LEU A CD2  2  
ATOM 2202  H H    . LEU A 1 53 ? -0.751  -5.441  10.838  1.00 0.00 ? 53 LEU A H    2  
ATOM 2203  H HA   . LEU A 1 53 ? -1.109  -6.697  13.403  1.00 0.00 ? 53 LEU A HA   2  
ATOM 2204  H HB2  . LEU A 1 53 ? -2.474  -6.679  10.908  1.00 0.00 ? 53 LEU A HB2  2  
ATOM 2205  H HB3  . LEU A 1 53 ? -2.066  -8.341  11.289  1.00 0.00 ? 53 LEU A HB3  2  
ATOM 2206  H HG   . LEU A 1 53 ? -3.183  -6.960  13.589  1.00 0.00 ? 53 LEU A HG   2  
ATOM 2207  H HD11 . LEU A 1 53 ? -5.186  -6.230  12.850  1.00 0.00 ? 53 LEU A HD11 2  
ATOM 2208  H HD12 . LEU A 1 53 ? -5.270  -7.426  11.557  1.00 0.00 ? 53 LEU A HD12 2  
ATOM 2209  H HD13 . LEU A 1 53 ? -4.289  -5.975  11.354  1.00 0.00 ? 53 LEU A HD13 2  
ATOM 2210  H HD21 . LEU A 1 53 ? -3.118  -9.275  13.712  1.00 0.00 ? 53 LEU A HD21 2  
ATOM 2211  H HD22 . LEU A 1 53 ? -3.677  -9.480  12.052  1.00 0.00 ? 53 LEU A HD22 2  
ATOM 2212  H HD23 . LEU A 1 53 ? -4.803  -8.954  13.302  1.00 0.00 ? 53 LEU A HD23 2  
ATOM 2213  N N    . ARG A 1 54 ? 1.096   -7.755  11.329  1.00 0.00 ? 54 ARG A N    2  
ATOM 2214  C CA   . ARG A 1 54 ? 2.172   -8.715  11.106  1.00 0.00 ? 54 ARG A CA   2  
ATOM 2215  C C    . ARG A 1 54 ? 2.904   -9.042  12.400  1.00 0.00 ? 54 ARG A C    2  
ATOM 2216  O O    . ARG A 1 54 ? 3.129   -10.208 12.725  1.00 0.00 ? 54 ARG A O    2  
ATOM 2217  C CB   . ARG A 1 54 ? 3.160   -8.173  10.071  1.00 0.00 ? 54 ARG A CB   2  
ATOM 2218  C CG   . ARG A 1 54 ? 4.247   -9.165  9.690   1.00 0.00 ? 54 ARG A CG   2  
ATOM 2219  C CD   . ARG A 1 54 ? 3.712   -10.253 8.773   1.00 0.00 ? 54 ARG A CD   2  
ATOM 2220  N NE   . ARG A 1 54 ? 3.345   -11.459 9.510   1.00 0.00 ? 54 ARG A NE   2  
ATOM 2221  C CZ   . ARG A 1 54 ? 4.225   -12.356 9.950   1.00 0.00 ? 54 ARG A CZ   2  
ATOM 2222  N NH1  . ARG A 1 54 ? 5.523   -12.186 9.730   1.00 0.00 ? 54 ARG A NH1  2  
ATOM 2223  N NH2  . ARG A 1 54 ? 3.806   -13.426 10.613  1.00 0.00 ? 54 ARG A NH2  2  
ATOM 2224  H H    . ARG A 1 54 ? 1.071   -6.934  10.795  1.00 0.00 ? 54 ARG A H    2  
ATOM 2225  H HA   . ARG A 1 54 ? 1.732   -9.616  10.728  1.00 0.00 ? 54 ARG A HA   2  
ATOM 2226  H HB2  . ARG A 1 54 ? 2.617   -7.907  9.177   1.00 0.00 ? 54 ARG A HB2  2  
ATOM 2227  H HB3  . ARG A 1 54 ? 3.634   -7.289  10.471  1.00 0.00 ? 54 ARG A HB3  2  
ATOM 2228  H HG2  . ARG A 1 54 ? 5.040   -8.638  9.181   1.00 0.00 ? 54 ARG A HG2  2  
ATOM 2229  H HG3  . ARG A 1 54 ? 4.635   -9.622  10.589  1.00 0.00 ? 54 ARG A HG3  2  
ATOM 2230  H HD2  . ARG A 1 54 ? 2.839   -9.877  8.260   1.00 0.00 ? 54 ARG A HD2  2  
ATOM 2231  H HD3  . ARG A 1 54 ? 4.474   -10.502 8.049   1.00 0.00 ? 54 ARG A HD3  2  
ATOM 2232  H HE   . ARG A 1 54 ? 2.393   -11.610 9.687   1.00 0.00 ? 54 ARG A HE   2  
ATOM 2233  H HH11 . ARG A 1 54 ? 5.845   -11.381 9.231   1.00 0.00 ? 54 ARG A HH11 2  
ATOM 2234  H HH12 . ARG A 1 54 ? 6.179   -12.863 10.064  1.00 0.00 ? 54 ARG A HH12 2  
ATOM 2235  H HH21 . ARG A 1 54 ? 2.830   -13.559 10.782  1.00 0.00 ? 54 ARG A HH21 2  
ATOM 2236  H HH22 . ARG A 1 54 ? 4.467   -14.100 10.943  1.00 0.00 ? 54 ARG A HH22 2  
ATOM 2237  N N    . THR A 1 55 ? 3.272   -8.004  13.128  1.00 0.00 ? 55 THR A N    2  
ATOM 2238  C CA   . THR A 1 55 ? 3.981   -8.165  14.389  1.00 0.00 ? 55 THR A CA   2  
ATOM 2239  C C    . THR A 1 55 ? 3.925   -6.886  15.220  1.00 0.00 ? 55 THR A C    2  
ATOM 2240  O O    . THR A 1 55 ? 4.839   -6.597  15.994  1.00 0.00 ? 55 THR A O    2  
ATOM 2241  C CB   . THR A 1 55 ? 5.437   -8.556  14.130  1.00 0.00 ? 55 THR A CB   2  
ATOM 2242  O OG1  . THR A 1 55 ? 6.101   -8.854  15.345  1.00 0.00 ? 55 THR A OG1  2  
ATOM 2243  C CG2  . THR A 1 55 ? 6.232   -7.478  13.423  1.00 0.00 ? 55 THR A CG2  2  
ATOM 2244  H H    . THR A 1 55 ? 3.060   -7.110  12.809  1.00 0.00 ? 55 THR A H    2  
ATOM 2245  H HA   . THR A 1 55 ? 3.498   -8.956  14.937  1.00 0.00 ? 55 THR A HA   2  
ATOM 2246  H HB   . THR A 1 55 ? 5.454   -9.440  13.508  1.00 0.00 ? 55 THR A HB   2  
ATOM 2247  H HG1  . THR A 1 55 ? 6.814   -9.475  15.176  1.00 0.00 ? 55 THR A HG1  2  
ATOM 2248  H HG21 . THR A 1 55 ? 6.524   -6.721  14.136  1.00 0.00 ? 55 THR A HG21 2  
ATOM 2249  H HG22 . THR A 1 55 ? 5.624   -7.030  12.651  1.00 0.00 ? 55 THR A HG22 2  
ATOM 2250  H HG23 . THR A 1 55 ? 7.114   -7.914  12.978  1.00 0.00 ? 55 THR A HG23 2  
ATOM 2251  N N    . GLY A 1 56 ? 2.849   -6.124  15.056  1.00 0.00 ? 56 GLY A N    2  
ATOM 2252  C CA   . GLY A 1 56 ? 2.697   -4.887  15.798  1.00 0.00 ? 56 GLY A CA   2  
ATOM 2253  C C    . GLY A 1 56 ? 3.782   -3.873  15.480  1.00 0.00 ? 56 GLY A C    2  
ATOM 2254  O O    . GLY A 1 56 ? 3.953   -2.893  16.205  1.00 0.00 ? 56 GLY A O    2  
ATOM 2255  H H    . GLY A 1 56 ? 2.153   -6.404  14.427  1.00 0.00 ? 56 GLY A H    2  
ATOM 2256  H HA2  . GLY A 1 56 ? 1.736   -4.454  15.561  1.00 0.00 ? 56 GLY A HA2  2  
ATOM 2257  H HA3  . GLY A 1 56 ? 2.728   -5.109  16.854  1.00 0.00 ? 56 GLY A HA3  2  
ATOM 2258  N N    . LYS A 1 57 ? 4.514   -4.106  14.395  1.00 0.00 ? 57 LYS A N    2  
ATOM 2259  C CA   . LYS A 1 57 ? 5.581   -3.208  13.985  1.00 0.00 ? 57 LYS A CA   2  
ATOM 2260  C C    . LYS A 1 57 ? 5.013   -1.981  13.279  1.00 0.00 ? 57 LYS A C    2  
ATOM 2261  O O    . LYS A 1 57 ? 3.800   -1.775  13.254  1.00 0.00 ? 57 LYS A O    2  
ATOM 2262  C CB   . LYS A 1 57 ? 6.566   -3.935  13.072  1.00 0.00 ? 57 LYS A CB   2  
ATOM 2263  C CG   . LYS A 1 57 ? 7.958   -4.075  13.667  1.00 0.00 ? 57 LYS A CG   2  
ATOM 2264  C CD   . LYS A 1 57 ? 8.583   -2.719  13.949  1.00 0.00 ? 57 LYS A CD   2  
ATOM 2265  C CE   . LYS A 1 57 ? 9.966   -2.861  14.563  1.00 0.00 ? 57 LYS A CE   2  
ATOM 2266  N NZ   . LYS A 1 57 ? 10.815  -1.665  14.303  1.00 0.00 ? 57 LYS A NZ   2  
ATOM 2267  H H    . LYS A 1 57 ? 4.332   -4.899  13.857  1.00 0.00 ? 57 LYS A H    2  
ATOM 2268  H HA   . LYS A 1 57 ? 6.098   -2.893  14.870  1.00 0.00 ? 57 LYS A HA   2  
ATOM 2269  H HB2  . LYS A 1 57 ? 6.184   -4.922  12.872  1.00 0.00 ? 57 LYS A HB2  2  
ATOM 2270  H HB3  . LYS A 1 57 ? 6.648   -3.393  12.143  1.00 0.00 ? 57 LYS A HB3  2  
ATOM 2271  H HG2  . LYS A 1 57 ? 7.889   -4.628  14.592  1.00 0.00 ? 57 LYS A HG2  2  
ATOM 2272  H HG3  . LYS A 1 57 ? 8.584   -4.613  12.970  1.00 0.00 ? 57 LYS A HG3  2  
ATOM 2273  H HD2  . LYS A 1 57 ? 8.667   -2.172  13.022  1.00 0.00 ? 57 LYS A HD2  2  
ATOM 2274  H HD3  . LYS A 1 57 ? 7.948   -2.176  14.634  1.00 0.00 ? 57 LYS A HD3  2  
ATOM 2275  H HE2  . LYS A 1 57 ? 9.861   -2.991  15.630  1.00 0.00 ? 57 LYS A HE2  2  
ATOM 2276  H HE3  . LYS A 1 57 ? 10.446  -3.731  14.141  1.00 0.00 ? 57 LYS A HE3  2  
ATOM 2277  H HZ1  . LYS A 1 57 ? 11.418  -1.469  15.128  1.00 0.00 ? 57 LYS A HZ1  2  
ATOM 2278  H HZ2  . LYS A 1 57 ? 10.216  -0.835  14.121  1.00 0.00 ? 57 LYS A HZ2  2  
ATOM 2279  H HZ3  . LYS A 1 57 ? 11.421  -1.830  13.475  1.00 0.00 ? 57 LYS A HZ3  2  
ATOM 2280  N N    . THR A 1 58 ? 5.896   -1.170  12.701  1.00 0.00 ? 58 THR A N    2  
ATOM 2281  C CA   . THR A 1 58 ? 5.477   0.035   11.990  1.00 0.00 ? 58 THR A CA   2  
ATOM 2282  C C    . THR A 1 58 ? 4.332   -0.272  11.028  1.00 0.00 ? 58 THR A C    2  
ATOM 2283  O O    . THR A 1 58 ? 4.007   -1.435  10.788  1.00 0.00 ? 58 THR A O    2  
ATOM 2284  C CB   . THR A 1 58 ? 6.658   0.637   11.225  1.00 0.00 ? 58 THR A CB   2  
ATOM 2285  O OG1  . THR A 1 58 ? 6.313   1.901   10.686  1.00 0.00 ? 58 THR A OG1  2  
ATOM 2286  C CG2  . THR A 1 58 ? 7.142   -0.231  10.083  1.00 0.00 ? 58 THR A CG2  2  
ATOM 2287  H H    . THR A 1 58 ? 6.850   -1.388  12.752  1.00 0.00 ? 58 THR A H    2  
ATOM 2288  H HA   . THR A 1 58 ? 5.134   0.749   12.724  1.00 0.00 ? 58 THR A HA   2  
ATOM 2289  H HB   . THR A 1 58 ? 7.484   0.774   11.908  1.00 0.00 ? 58 THR A HB   2  
ATOM 2290  H HG1  . THR A 1 58 ? 6.635   2.595   11.266  1.00 0.00 ? 58 THR A HG1  2  
ATOM 2291  H HG21 . THR A 1 58 ? 8.221   -0.213  10.048  1.00 0.00 ? 58 THR A HG21 2  
ATOM 2292  H HG22 . THR A 1 58 ? 6.745   0.146   9.151   1.00 0.00 ? 58 THR A HG22 2  
ATOM 2293  H HG23 . THR A 1 58 ? 6.804   -1.246  10.234  1.00 0.00 ? 58 THR A HG23 2  
ATOM 2294  N N    . ARG A 1 59 ? 3.730   0.773   10.473  1.00 0.00 ? 59 ARG A N    2  
ATOM 2295  C CA   . ARG A 1 59 ? 2.638   0.609   9.535   1.00 0.00 ? 59 ARG A CA   2  
ATOM 2296  C C    . ARG A 1 59 ? 2.536   1.821   8.623   1.00 0.00 ? 59 ARG A C    2  
ATOM 2297  O O    . ARG A 1 59 ? 1.564   2.576   8.671   1.00 0.00 ? 59 ARG A O    2  
ATOM 2298  C CB   . ARG A 1 59 ? 1.319   0.395   10.281  1.00 0.00 ? 59 ARG A CB   2  
ATOM 2299  C CG   . ARG A 1 59 ? 1.101   1.373   11.425  1.00 0.00 ? 59 ARG A CG   2  
ATOM 2300  C CD   . ARG A 1 59 ? -0.019  2.355   11.118  1.00 0.00 ? 59 ARG A CD   2  
ATOM 2301  N NE   . ARG A 1 59 ? 0.304   3.710   11.558  1.00 0.00 ? 59 ARG A NE   2  
ATOM 2302  C CZ   . ARG A 1 59 ? -0.592  4.688   11.667  1.00 0.00 ? 59 ARG A CZ   2  
ATOM 2303  N NH1  . ARG A 1 59 ? -1.866  4.467   11.369  1.00 0.00 ? 59 ARG A NH1  2  
ATOM 2304  N NH2  . ARG A 1 59 ? -0.213  5.892   12.075  1.00 0.00 ? 59 ARG A NH2  2  
ATOM 2305  H H    . ARG A 1 59 ? 4.038   1.673   10.683  1.00 0.00 ? 59 ARG A H    2  
ATOM 2306  H HA   . ARG A 1 59 ? 2.850   -0.260  8.937   1.00 0.00 ? 59 ARG A HA   2  
ATOM 2307  H HB2  . ARG A 1 59 ? 0.502   0.502   9.582   1.00 0.00 ? 59 ARG A HB2  2  
ATOM 2308  H HB3  . ARG A 1 59 ? 1.306   -0.606  10.685  1.00 0.00 ? 59 ARG A HB3  2  
ATOM 2309  H HG2  . ARG A 1 59 ? 0.845   0.819   12.315  1.00 0.00 ? 59 ARG A HG2  2  
ATOM 2310  H HG3  . ARG A 1 59 ? 2.015   1.925   11.592  1.00 0.00 ? 59 ARG A HG3  2  
ATOM 2311  H HD2  . ARG A 1 59 ? -0.190  2.365   10.051  1.00 0.00 ? 59 ARG A HD2  2  
ATOM 2312  H HD3  . ARG A 1 59 ? -0.916  2.027   11.622  1.00 0.00 ? 59 ARG A HD3  2  
ATOM 2313  H HE   . ARG A 1 59 ? 1.239   3.901   11.784  1.00 0.00 ? 59 ARG A HE   2  
ATOM 2314  H HH11 . ARG A 1 59 ? -2.158  3.562   11.060  1.00 0.00 ? 59 ARG A HH11 2  
ATOM 2315  H HH12 . ARG A 1 59 ? -2.534  5.206   11.453  1.00 0.00 ? 59 ARG A HH12 2  
ATOM 2316  H HH21 . ARG A 1 59 ? 0.746   6.064   12.301  1.00 0.00 ? 59 ARG A HH21 2  
ATOM 2317  H HH22 . ARG A 1 59 ? -0.886  6.627   12.157  1.00 0.00 ? 59 ARG A HH22 2  
ATOM 2318  N N    . THR A 1 60 ? 3.547   1.994   7.787   1.00 0.00 ? 60 THR A N    2  
ATOM 2319  C CA   . THR A 1 60 ? 3.583   3.107   6.848   1.00 0.00 ? 60 THR A CA   2  
ATOM 2320  C C    . THR A 1 60 ? 2.407   3.026   5.881   1.00 0.00 ? 60 THR A C    2  
ATOM 2321  O O    . THR A 1 60 ? 1.988   1.937   5.492   1.00 0.00 ? 60 THR A O    2  
ATOM 2322  C CB   . THR A 1 60 ? 4.904   3.109   6.073   1.00 0.00 ? 60 THR A CB   2  
ATOM 2323  O OG1  . THR A 1 60 ? 5.558   1.858   6.193   1.00 0.00 ? 60 THR A OG1  2  
ATOM 2324  C CG2  . THR A 1 60 ? 5.869   4.178   6.539   1.00 0.00 ? 60 THR A CG2  2  
ATOM 2325  H H    . THR A 1 60 ? 4.289   1.356   7.805   1.00 0.00 ? 60 THR A H    2  
ATOM 2326  H HA   . THR A 1 60 ? 3.507   4.021   7.417   1.00 0.00 ? 60 THR A HA   2  
ATOM 2327  H HB   . THR A 1 60 ? 4.696   3.284   5.027   1.00 0.00 ? 60 THR A HB   2  
ATOM 2328  H HG1  . THR A 1 60 ? 6.353   1.860   5.655   1.00 0.00 ? 60 THR A HG1  2  
ATOM 2329  H HG21 . THR A 1 60 ? 6.444   4.534   5.697   1.00 0.00 ? 60 THR A HG21 2  
ATOM 2330  H HG22 . THR A 1 60 ? 6.535   3.763   7.281   1.00 0.00 ? 60 THR A HG22 2  
ATOM 2331  H HG23 . THR A 1 60 ? 5.316   4.999   6.970   1.00 0.00 ? 60 THR A HG23 2  
ATOM 2332  N N    . ARG A 1 61 ? 1.872   4.181   5.498   1.00 0.00 ? 61 ARG A N    2  
ATOM 2333  C CA   . ARG A 1 61 ? 0.745   4.229   4.582   1.00 0.00 ? 61 ARG A CA   2  
ATOM 2334  C C    . ARG A 1 61 ? 1.161   4.785   3.230   1.00 0.00 ? 61 ARG A C    2  
ATOM 2335  O O    . ARG A 1 61 ? 0.758   4.279   2.183   1.00 0.00 ? 61 ARG A O    2  
ATOM 2336  C CB   . ARG A 1 61 ? -0.389  5.070   5.171   1.00 0.00 ? 61 ARG A CB   2  
ATOM 2337  C CG   . ARG A 1 61 ? 0.081   6.375   5.792   1.00 0.00 ? 61 ARG A CG   2  
ATOM 2338  C CD   . ARG A 1 61 ? -1.091  7.223   6.259   1.00 0.00 ? 61 ARG A CD   2  
ATOM 2339  N NE   . ARG A 1 61 ? -0.702  8.166   7.305   1.00 0.00 ? 61 ARG A NE   2  
ATOM 2340  C CZ   . ARG A 1 61 ? 0.032   9.254   7.086   1.00 0.00 ? 61 ARG A CZ   2  
ATOM 2341  N NH1  . ARG A 1 61 ? 0.458   9.541   5.862   1.00 0.00 ? 61 ARG A NH1  2  
ATOM 2342  N NH2  . ARG A 1 61 ? 0.341   10.059  8.094   1.00 0.00 ? 61 ARG A NH2  2  
ATOM 2343  H H    . ARG A 1 61 ? 2.240   5.015   5.837   1.00 0.00 ? 61 ARG A H    2  
ATOM 2344  H HA   . ARG A 1 61 ? 0.404   3.228   4.447   1.00 0.00 ? 61 ARG A HA   2  
ATOM 2345  H HB2  . ARG A 1 61 ? -1.094  5.302   4.386   1.00 0.00 ? 61 ARG A HB2  2  
ATOM 2346  H HB3  . ARG A 1 61 ? -0.891  4.493   5.934   1.00 0.00 ? 61 ARG A HB3  2  
ATOM 2347  H HG2  . ARG A 1 61 ? 0.711   6.152   6.640   1.00 0.00 ? 61 ARG A HG2  2  
ATOM 2348  H HG3  . ARG A 1 61 ? 0.645   6.929   5.057   1.00 0.00 ? 61 ARG A HG3  2  
ATOM 2349  H HD2  . ARG A 1 61 ? -1.477  7.776   5.415   1.00 0.00 ? 61 ARG A HD2  2  
ATOM 2350  H HD3  . ARG A 1 61 ? -1.861  6.570   6.643   1.00 0.00 ? 61 ARG A HD3  2  
ATOM 2351  H HE   . ARG A 1 61 ? -1.003  7.978   8.218   1.00 0.00 ? 61 ARG A HE   2  
ATOM 2352  H HH11 . ARG A 1 61 ? 0.229   8.939   5.098   1.00 0.00 ? 61 ARG A HH11 2  
ATOM 2353  H HH12 . ARG A 1 61 ? 1.009   10.361  5.705   1.00 0.00 ? 61 ARG A HH12 2  
ATOM 2354  H HH21 . ARG A 1 61 ? 0.022   9.847   9.018   1.00 0.00 ? 61 ARG A HH21 2  
ATOM 2355  H HH22 . ARG A 1 61 ? 0.892   10.877  7.930   1.00 0.00 ? 61 ARG A HH22 2  
ATOM 2356  N N    . LYS A 1 62 ? 1.970   5.828   3.266   1.00 0.00 ? 62 LYS A N    2  
ATOM 2357  C CA   . LYS A 1 62 ? 2.451   6.465   2.051   1.00 0.00 ? 62 LYS A CA   2  
ATOM 2358  C C    . LYS A 1 62 ? 3.450   5.573   1.328   1.00 0.00 ? 62 LYS A C    2  
ATOM 2359  O O    . LYS A 1 62 ? 3.571   5.621   0.103   1.00 0.00 ? 62 LYS A O    2  
ATOM 2360  C CB   . LYS A 1 62 ? 3.085   7.815   2.375   1.00 0.00 ? 62 LYS A CB   2  
ATOM 2361  C CG   . LYS A 1 62 ? 2.441   8.982   1.644   1.00 0.00 ? 62 LYS A CG   2  
ATOM 2362  C CD   . LYS A 1 62 ? 2.888   9.045   0.193   1.00 0.00 ? 62 LYS A CD   2  
ATOM 2363  C CE   . LYS A 1 62 ? 4.100   9.947   0.022   1.00 0.00 ? 62 LYS A CE   2  
ATOM 2364  N NZ   . LYS A 1 62 ? 4.095   10.641  -1.295  1.00 0.00 ? 62 LYS A NZ   2  
ATOM 2365  H H    . LYS A 1 62 ? 2.250   6.176   4.133   1.00 0.00 ? 62 LYS A H    2  
ATOM 2366  H HA   . LYS A 1 62 ? 1.609   6.622   1.410   1.00 0.00 ? 62 LYS A HA   2  
ATOM 2367  H HB2  . LYS A 1 62 ? 3.002   7.993   3.436   1.00 0.00 ? 62 LYS A HB2  2  
ATOM 2368  H HB3  . LYS A 1 62 ? 4.127   7.781   2.105   1.00 0.00 ? 62 LYS A HB3  2  
ATOM 2369  H HG2  . LYS A 1 62 ? 1.368   8.865   1.675   1.00 0.00 ? 62 LYS A HG2  2  
ATOM 2370  H HG3  . LYS A 1 62 ? 2.719   9.901   2.138   1.00 0.00 ? 62 LYS A HG3  2  
ATOM 2371  H HD2  . LYS A 1 62 ? 3.143   8.050   -0.139  1.00 0.00 ? 62 LYS A HD2  2  
ATOM 2372  H HD3  . LYS A 1 62 ? 2.076   9.431   -0.407  1.00 0.00 ? 62 LYS A HD3  2  
ATOM 2373  H HE2  . LYS A 1 62 ? 4.096   10.687  0.808   1.00 0.00 ? 62 LYS A HE2  2  
ATOM 2374  H HE3  . LYS A 1 62 ? 4.994   9.345   0.100   1.00 0.00 ? 62 LYS A HE3  2  
ATOM 2375  H HZ1  . LYS A 1 62 ? 3.158   11.052  -1.480  1.00 0.00 ? 62 LYS A HZ1  2  
ATOM 2376  H HZ2  . LYS A 1 62 ? 4.322   9.968   -2.055  1.00 0.00 ? 62 LYS A HZ2  2  
ATOM 2377  H HZ3  . LYS A 1 62 ? 4.804   11.403  -1.300  1.00 0.00 ? 62 LYS A HZ3  2  
ATOM 2378  N N    . GLN A 1 63 ? 4.159   4.758   2.093   1.00 0.00 ? 63 GLN A N    2  
ATOM 2379  C CA   . GLN A 1 63 ? 5.145   3.851   1.532   1.00 0.00 ? 63 GLN A CA   2  
ATOM 2380  C C    . GLN A 1 63 ? 4.473   2.621   0.941   1.00 0.00 ? 63 GLN A C    2  
ATOM 2381  O O    . GLN A 1 63 ? 4.965   2.032   -0.022  1.00 0.00 ? 63 GLN A O    2  
ATOM 2382  C CB   . GLN A 1 63 ? 6.164   3.443   2.594   1.00 0.00 ? 63 GLN A CB   2  
ATOM 2383  C CG   . GLN A 1 63 ? 7.584   3.882   2.275   1.00 0.00 ? 63 GLN A CG   2  
ATOM 2384  C CD   . GLN A 1 63 ? 7.909   5.253   2.834   1.00 0.00 ? 63 GLN A CD   2  
ATOM 2385  O OE1  . GLN A 1 63 ? 7.017   6.069   3.067   1.00 0.00 ? 63 GLN A OE1  2  
ATOM 2386  N NE2  . GLN A 1 63 ? 9.193   5.515   3.050   1.00 0.00 ? 63 GLN A NE2  2  
ATOM 2387  H H    . GLN A 1 63 ? 4.015   4.767   3.057   1.00 0.00 ? 63 GLN A H    2  
ATOM 2388  H HA   . GLN A 1 63 ? 5.651   4.373   0.749   1.00 0.00 ? 63 GLN A HA   2  
ATOM 2389  H HB2  . GLN A 1 63 ? 5.877   3.885   3.535   1.00 0.00 ? 63 GLN A HB2  2  
ATOM 2390  H HB3  . GLN A 1 63 ? 6.155   2.370   2.691   1.00 0.00 ? 63 GLN A HB3  2  
ATOM 2391  H HG2  . GLN A 1 63 ? 8.272   3.166   2.698   1.00 0.00 ? 63 GLN A HG2  2  
ATOM 2392  H HG3  . GLN A 1 63 ? 7.706   3.907   1.202   1.00 0.00 ? 63 GLN A HG3  2  
ATOM 2393  H HE21 . GLN A 1 63 ? 9.849   4.817   2.840   1.00 0.00 ? 63 GLN A HE21 2  
ATOM 2394  H HE22 . GLN A 1 63 ? 9.432   6.394   3.411   1.00 0.00 ? 63 GLN A HE22 2  
ATOM 2395  N N    . VAL A 1 64 ? 3.342   2.242   1.520   1.00 0.00 ? 64 VAL A N    2  
ATOM 2396  C CA   . VAL A 1 64 ? 2.597   1.088   1.048   1.00 0.00 ? 64 VAL A CA   2  
ATOM 2397  C C    . VAL A 1 64 ? 1.745   1.443   -0.162  1.00 0.00 ? 64 VAL A C    2  
ATOM 2398  O O    . VAL A 1 64 ? 1.363   0.570   -0.938  1.00 0.00 ? 64 VAL A O    2  
ATOM 2399  C CB   . VAL A 1 64 ? 1.691   0.501   2.148   1.00 0.00 ? 64 VAL A CB   2  
ATOM 2400  C CG1  . VAL A 1 64 ? 1.026   -0.781  1.667   1.00 0.00 ? 64 VAL A CG1  2  
ATOM 2401  C CG2  . VAL A 1 64 ? 2.487   0.250   3.418   1.00 0.00 ? 64 VAL A CG2  2  
ATOM 2402  H H    . VAL A 1 64 ? 3.001   2.752   2.277   1.00 0.00 ? 64 VAL A H    2  
ATOM 2403  H HA   . VAL A 1 64 ? 3.311   0.338   0.760   1.00 0.00 ? 64 VAL A HA   2  
ATOM 2404  H HB   . VAL A 1 64 ? 0.916   1.220   2.369   1.00 0.00 ? 64 VAL A HB   2  
ATOM 2405  H HG11 . VAL A 1 64 ? 1.690   -1.299  0.990   1.00 0.00 ? 64 VAL A HG11 2  
ATOM 2406  H HG12 . VAL A 1 64 ? 0.106   -0.540  1.155   1.00 0.00 ? 64 VAL A HG12 2  
ATOM 2407  H HG13 . VAL A 1 64 ? 0.810   -1.414  2.515   1.00 0.00 ? 64 VAL A HG13 2  
ATOM 2408  H HG21 . VAL A 1 64 ? 1.807   0.086   4.241   1.00 0.00 ? 64 VAL A HG21 2  
ATOM 2409  H HG22 . VAL A 1 64 ? 3.107   1.108   3.630   1.00 0.00 ? 64 VAL A HG22 2  
ATOM 2410  H HG23 . VAL A 1 64 ? 3.110   -0.622  3.287   1.00 0.00 ? 64 VAL A HG23 2  
ATOM 2411  N N    . SER A 1 65 ? 1.463   2.730   -0.328  1.00 0.00 ? 65 SER A N    2  
ATOM 2412  C CA   . SER A 1 65 ? 0.672   3.192   -1.454  1.00 0.00 ? 65 SER A CA   2  
ATOM 2413  C C    . SER A 1 65 ? 1.570   3.405   -2.658  1.00 0.00 ? 65 SER A C    2  
ATOM 2414  O O    . SER A 1 65 ? 1.162   3.214   -3.802  1.00 0.00 ? 65 SER A O    2  
ATOM 2415  C CB   . SER A 1 65 ? -0.065  4.486   -1.103  1.00 0.00 ? 65 SER A CB   2  
ATOM 2416  O OG   . SER A 1 65 ? 0.740   5.329   -0.297  1.00 0.00 ? 65 SER A OG   2  
ATOM 2417  H H    . SER A 1 65 ? 1.805   3.383   0.310   1.00 0.00 ? 65 SER A H    2  
ATOM 2418  H HA   . SER A 1 65 ? -0.041  2.426   -1.684  1.00 0.00 ? 65 SER A HA   2  
ATOM 2419  H HB2  . SER A 1 65 ? -0.317  5.012   -2.012  1.00 0.00 ? 65 SER A HB2  2  
ATOM 2420  H HB3  . SER A 1 65 ? -0.969  4.247   -0.563  1.00 0.00 ? 65 SER A HB3  2  
ATOM 2421  H HG   . SER A 1 65 ? 0.710   5.025   0.614   1.00 0.00 ? 65 SER A HG   2  
ATOM 2422  N N    . SER A 1 66 ? 2.805   3.788   -2.377  1.00 0.00 ? 66 SER A N    2  
ATOM 2423  C CA   . SER A 1 66 ? 3.793   4.019   -3.410  1.00 0.00 ? 66 SER A CA   2  
ATOM 2424  C C    . SER A 1 66 ? 4.233   2.701   -4.026  1.00 0.00 ? 66 SER A C    2  
ATOM 2425  O O    . SER A 1 66 ? 4.545   2.625   -5.214  1.00 0.00 ? 66 SER A O    2  
ATOM 2426  C CB   . SER A 1 66 ? 4.991   4.747   -2.821  1.00 0.00 ? 66 SER A CB   2  
ATOM 2427  O OG   . SER A 1 66 ? 5.401   5.821   -3.651  1.00 0.00 ? 66 SER A OG   2  
ATOM 2428  H H    . SER A 1 66 ? 3.062   3.909   -1.441  1.00 0.00 ? 66 SER A H    2  
ATOM 2429  H HA   . SER A 1 66 ? 3.350   4.627   -4.167  1.00 0.00 ? 66 SER A HA   2  
ATOM 2430  H HB2  . SER A 1 66 ? 4.728   5.136   -1.850  1.00 0.00 ? 66 SER A HB2  2  
ATOM 2431  H HB3  . SER A 1 66 ? 5.803   4.055   -2.720  1.00 0.00 ? 66 SER A HB3  2  
ATOM 2432  H HG   . SER A 1 66 ? 4.716   6.494   -3.666  1.00 0.00 ? 66 SER A HG   2  
ATOM 2433  N N    . HIS A 1 67 ? 4.256   1.666   -3.199  1.00 0.00 ? 67 HIS A N    2  
ATOM 2434  C CA   . HIS A 1 67 ? 4.659   0.339   -3.642  1.00 0.00 ? 67 HIS A CA   2  
ATOM 2435  C C    . HIS A 1 67 ? 3.627   -0.263  -4.584  1.00 0.00 ? 67 HIS A C    2  
ATOM 2436  O O    . HIS A 1 67 ? 3.973   -0.942  -5.550  1.00 0.00 ? 67 HIS A O    2  
ATOM 2437  C CB   . HIS A 1 67 ? 4.876   -0.582  -2.441  1.00 0.00 ? 67 HIS A CB   2  
ATOM 2438  C CG   . HIS A 1 67 ? 5.634   -1.829  -2.772  1.00 0.00 ? 67 HIS A CG   2  
ATOM 2439  N ND1  . HIS A 1 67 ? 6.782   -1.833  -3.537  1.00 0.00 ? 67 HIS A ND1  2  
ATOM 2440  C CD2  . HIS A 1 67 ? 5.405   -3.121  -2.436  1.00 0.00 ? 67 HIS A CD2  2  
ATOM 2441  C CE1  . HIS A 1 67 ? 7.224   -3.072  -3.658  1.00 0.00 ? 67 HIS A CE1  2  
ATOM 2442  N NE2  . HIS A 1 67 ? 6.407   -3.872  -2.999  1.00 0.00 ? 67 HIS A NE2  2  
ATOM 2443  H H    . HIS A 1 67 ? 3.998   1.802   -2.265  1.00 0.00 ? 67 HIS A H    2  
ATOM 2444  H HA   . HIS A 1 67 ? 5.582   0.443   -4.175  1.00 0.00 ? 67 HIS A HA   2  
ATOM 2445  H HB2  . HIS A 1 67 ? 5.430   -0.049  -1.683  1.00 0.00 ? 67 HIS A HB2  2  
ATOM 2446  H HB3  . HIS A 1 67 ? 3.916   -0.872  -2.040  1.00 0.00 ? 67 HIS A HB3  2  
ATOM 2447  H HD1  . HIS A 1 67 ? 7.208   -1.044  -3.934  1.00 0.00 ? 67 HIS A HD1  2  
ATOM 2448  H HD2  . HIS A 1 67 ? 4.585   -3.491  -1.836  1.00 0.00 ? 67 HIS A HD2  2  
ATOM 2449  H HE1  . HIS A 1 67 ? 8.105   -3.378  -4.203  1.00 0.00 ? 67 HIS A HE1  2  
ATOM 2450  H HE2  . HIS A 1 67 ? 6.454   -4.851  -2.998  1.00 0.00 ? 67 HIS A HE2  2  
ATOM 2451  N N    . ILE A 1 68 ? 2.360   -0.006  -4.300  1.00 0.00 ? 68 ILE A N    2  
ATOM 2452  C CA   . ILE A 1 68 ? 1.279   -0.519  -5.129  1.00 0.00 ? 68 ILE A CA   2  
ATOM 2453  C C    . ILE A 1 68 ? 1.221   0.223   -6.455  1.00 0.00 ? 68 ILE A C    2  
ATOM 2454  O O    . ILE A 1 68 ? 0.789   -0.325  -7.469  1.00 0.00 ? 68 ILE A O    2  
ATOM 2455  C CB   . ILE A 1 68 ? -0.090  -0.410  -4.427  1.00 0.00 ? 68 ILE A CB   2  
ATOM 2456  C CG1  . ILE A 1 68 ? -0.007  -0.941  -2.996  1.00 0.00 ? 68 ILE A CG1  2  
ATOM 2457  C CG2  . ILE A 1 68 ? -1.149  -1.170  -5.212  1.00 0.00 ? 68 ILE A CG2  2  
ATOM 2458  C CD1  . ILE A 1 68 ? -0.971  -0.263  -2.048  1.00 0.00 ? 68 ILE A CD1  2  
ATOM 2459  H H    . ILE A 1 68 ? 2.150   0.544   -3.522  1.00 0.00 ? 68 ILE A H    2  
ATOM 2460  H HA   . ILE A 1 68 ? 1.482   -1.556  -5.323  1.00 0.00 ? 68 ILE A HA   2  
ATOM 2461  H HB   . ILE A 1 68 ? -0.374  0.631   -4.402  1.00 0.00 ? 68 ILE A HB   2  
ATOM 2462  H HG12 . ILE A 1 68 ? -0.231  -1.997  -2.997  1.00 0.00 ? 68 ILE A HG12 2  
ATOM 2463  H HG13 . ILE A 1 68 ? 0.993   -0.790  -2.619  1.00 0.00 ? 68 ILE A HG13 2  
ATOM 2464  H HG21 . ILE A 1 68 ? -2.057  -0.586  -5.251  1.00 0.00 ? 68 ILE A HG21 2  
ATOM 2465  H HG22 . ILE A 1 68 ? -1.350  -2.114  -4.725  1.00 0.00 ? 68 ILE A HG22 2  
ATOM 2466  H HG23 . ILE A 1 68 ? -0.794  -1.352  -6.215  1.00 0.00 ? 68 ILE A HG23 2  
ATOM 2467  H HD11 . ILE A 1 68 ? -1.009  0.794   -2.268  1.00 0.00 ? 68 ILE A HD11 2  
ATOM 2468  H HD12 . ILE A 1 68 ? -0.639  -0.408  -1.031  1.00 0.00 ? 68 ILE A HD12 2  
ATOM 2469  H HD13 . ILE A 1 68 ? -1.955  -0.691  -2.170  1.00 0.00 ? 68 ILE A HD13 2  
ATOM 2470  N N    . GLN A 1 69 ? 1.669   1.471   -6.440  1.00 0.00 ? 69 GLN A N    2  
ATOM 2471  C CA   . GLN A 1 69 ? 1.681   2.291   -7.638  1.00 0.00 ? 69 GLN A CA   2  
ATOM 2472  C C    . GLN A 1 69 ? 2.782   1.838   -8.587  1.00 0.00 ? 69 GLN A C    2  
ATOM 2473  O O    . GLN A 1 69 ? 2.681   2.011   -9.802  1.00 0.00 ? 69 GLN A O    2  
ATOM 2474  C CB   . GLN A 1 69 ? 1.868   3.766   -7.276  1.00 0.00 ? 69 GLN A CB   2  
ATOM 2475  C CG   . GLN A 1 69 ? 0.655   4.382   -6.597  1.00 0.00 ? 69 GLN A CG   2  
ATOM 2476  C CD   . GLN A 1 69 ? 0.258   5.713   -7.206  1.00 0.00 ? 69 GLN A CD   2  
ATOM 2477  O OE1  . GLN A 1 69 ? 0.508   5.969   -8.384  1.00 0.00 ? 69 GLN A OE1  2  
ATOM 2478  N NE2  . GLN A 1 69 ? -0.365  6.568   -6.404  1.00 0.00 ? 69 GLN A NE2  2  
ATOM 2479  H H    . GLN A 1 69 ? 2.004   1.845   -5.603  1.00 0.00 ? 69 GLN A H    2  
ATOM 2480  H HA   . GLN A 1 69 ? 0.733   2.167   -8.126  1.00 0.00 ? 69 GLN A HA   2  
ATOM 2481  H HB2  . GLN A 1 69 ? 2.712   3.856   -6.608  1.00 0.00 ? 69 GLN A HB2  2  
ATOM 2482  H HB3  . GLN A 1 69 ? 2.072   4.323   -8.178  1.00 0.00 ? 69 GLN A HB3  2  
ATOM 2483  H HG2  . GLN A 1 69 ? -0.177  3.700   -6.687  1.00 0.00 ? 69 GLN A HG2  2  
ATOM 2484  H HG3  . GLN A 1 69 ? 0.882   4.535   -5.552  1.00 0.00 ? 69 GLN A HG3  2  
ATOM 2485  H HE21 . GLN A 1 69 ? -0.531  6.297   -5.477  1.00 0.00 ? 69 GLN A HE21 2  
ATOM 2486  H HE22 . GLN A 1 69 ? -0.634  7.436   -6.771  1.00 0.00 ? 69 GLN A HE22 2  
ATOM 2487  N N    . VAL A 1 70 ? 3.831   1.249   -8.023  1.00 0.00 ? 70 VAL A N    2  
ATOM 2488  C CA   . VAL A 1 70 ? 4.947   0.762   -8.817  1.00 0.00 ? 70 VAL A CA   2  
ATOM 2489  C C    . VAL A 1 70 ? 4.554   -0.475  -9.610  1.00 0.00 ? 70 VAL A C    2  
ATOM 2490  O O    . VAL A 1 70 ? 5.092   -0.735  -10.687 1.00 0.00 ? 70 VAL A O    2  
ATOM 2491  C CB   . VAL A 1 70 ? 6.166   0.435   -7.948  1.00 0.00 ? 70 VAL A CB   2  
ATOM 2492  C CG1  . VAL A 1 70 ? 7.401   0.230   -8.812  1.00 0.00 ? 70 VAL A CG1  2  
ATOM 2493  C CG2  . VAL A 1 70 ? 6.401   1.526   -6.912  1.00 0.00 ? 70 VAL A CG2  2  
ATOM 2494  H H    . VAL A 1 70 ? 3.850   1.137   -7.052  1.00 0.00 ? 70 VAL A H    2  
ATOM 2495  H HA   . VAL A 1 70 ? 5.226   1.532   -9.498  1.00 0.00 ? 70 VAL A HA   2  
ATOM 2496  H HB   . VAL A 1 70 ? 5.961   -0.480  -7.435  1.00 0.00 ? 70 VAL A HB   2  
ATOM 2497  H HG11 . VAL A 1 70 ? 7.444   -0.797  -9.141  1.00 0.00 ? 70 VAL A HG11 2  
ATOM 2498  H HG12 . VAL A 1 70 ? 8.285   0.461   -8.236  1.00 0.00 ? 70 VAL A HG12 2  
ATOM 2499  H HG13 . VAL A 1 70 ? 7.351   0.882   -9.671  1.00 0.00 ? 70 VAL A HG13 2  
ATOM 2500  H HG21 . VAL A 1 70 ? 7.452   1.772   -6.879  1.00 0.00 ? 70 VAL A HG21 2  
ATOM 2501  H HG22 . VAL A 1 70 ? 6.084   1.174   -5.942  1.00 0.00 ? 70 VAL A HG22 2  
ATOM 2502  H HG23 . VAL A 1 70 ? 5.834   2.405   -7.179  1.00 0.00 ? 70 VAL A HG23 2  
ATOM 2503  N N    . LEU A 1 71 ? 3.607   -1.233  -9.073  1.00 0.00 ? 71 LEU A N    2  
ATOM 2504  C CA   . LEU A 1 71 ? 3.134   -2.442  -9.730  1.00 0.00 ? 71 LEU A CA   2  
ATOM 2505  C C    . LEU A 1 71 ? 2.328   -2.099  -10.975 1.00 0.00 ? 71 LEU A C    2  
ATOM 2506  O O    . LEU A 1 71 ? 2.301   -2.860  -11.942 1.00 0.00 ? 71 LEU A O    2  
ATOM 2507  C CB   . LEU A 1 71 ? 2.293   -3.279  -8.767  1.00 0.00 ? 71 LEU A CB   2  
ATOM 2508  C CG   . LEU A 1 71 ? 2.852   -4.670  -8.462  1.00 0.00 ? 71 LEU A CG   2  
ATOM 2509  C CD1  . LEU A 1 71 ? 3.813   -4.613  -7.286  1.00 0.00 ? 71 LEU A CD1  2  
ATOM 2510  C CD2  . LEU A 1 71 ? 1.720   -5.648  -8.182  1.00 0.00 ? 71 LEU A CD2  2  
ATOM 2511  H H    . LEU A 1 71 ? 3.217   -0.971  -8.216  1.00 0.00 ? 71 LEU A H    2  
ATOM 2512  H HA   . LEU A 1 71 ? 3.992   -3.009  -10.024 1.00 0.00 ? 71 LEU A HA   2  
ATOM 2513  H HB2  . LEU A 1 71 ? 2.207   -2.737  -7.839  1.00 0.00 ? 71 LEU A HB2  2  
ATOM 2514  H HB3  . LEU A 1 71 ? 1.309   -3.397  -9.190  1.00 0.00 ? 71 LEU A HB3  2  
ATOM 2515  H HG   . LEU A 1 71 ? 3.398   -5.028  -9.323  1.00 0.00 ? 71 LEU A HG   2  
ATOM 2516  H HD11 . LEU A 1 71 ? 4.592   -5.349  -7.421  1.00 0.00 ? 71 LEU A HD11 2  
ATOM 2517  H HD12 . LEU A 1 71 ? 3.277   -4.821  -6.372  1.00 0.00 ? 71 LEU A HD12 2  
ATOM 2518  H HD13 . LEU A 1 71 ? 4.254   -3.629  -7.228  1.00 0.00 ? 71 LEU A HD13 2  
ATOM 2519  H HD21 . LEU A 1 71 ? 1.382   -6.083  -9.110  1.00 0.00 ? 71 LEU A HD21 2  
ATOM 2520  H HD22 . LEU A 1 71 ? 0.901   -5.125  -7.711  1.00 0.00 ? 71 LEU A HD22 2  
ATOM 2521  H HD23 . LEU A 1 71 ? 2.074   -6.429  -7.525  1.00 0.00 ? 71 LEU A HD23 2  
ATOM 2522  N N    . ALA A 1 72 ? 1.677   -0.944  -10.943 1.00 0.00 ? 72 ALA A N    2  
ATOM 2523  C CA   . ALA A 1 72 ? 0.875   -0.489  -12.068 1.00 0.00 ? 72 ALA A CA   2  
ATOM 2524  C C    . ALA A 1 72 ? 1.760   -0.105  -13.245 1.00 0.00 ? 72 ALA A C    2  
ATOM 2525  O O    . ALA A 1 72 ? 1.344   -0.181  -14.402 1.00 0.00 ? 72 ALA A O    2  
ATOM 2526  C CB   . ALA A 1 72 ? -0.003  0.683   -11.655 1.00 0.00 ? 72 ALA A CB   2  
ATOM 2527  H H    . ALA A 1 72 ? 1.743   -0.384  -10.146 1.00 0.00 ? 72 ALA A H    2  
ATOM 2528  H HA   . ALA A 1 72 ? 0.236   -1.301  -12.364 1.00 0.00 ? 72 ALA A HA   2  
ATOM 2529  H HB1  . ALA A 1 72 ? -0.128  1.352   -12.493 1.00 0.00 ? 72 ALA A HB1  2  
ATOM 2530  H HB2  . ALA A 1 72 ? 0.466   1.213   -10.838 1.00 0.00 ? 72 ALA A HB2  2  
ATOM 2531  H HB3  . ALA A 1 72 ? -0.968  0.316   -11.339 1.00 0.00 ? 72 ALA A HB3  2  
ATOM 2532  N N    . ARG A 1 73 ? 2.984   0.304   -12.940 1.00 0.00 ? 73 ARG A N    2  
ATOM 2533  C CA   . ARG A 1 73 ? 3.937   0.698   -13.967 1.00 0.00 ? 73 ARG A CA   2  
ATOM 2534  C C    . ARG A 1 73 ? 4.410   -0.515  -14.757 1.00 0.00 ? 73 ARG A C    2  
ATOM 2535  O O    . ARG A 1 73 ? 4.758   -0.408  -15.933 1.00 0.00 ? 73 ARG A O    2  
ATOM 2536  C CB   . ARG A 1 73 ? 5.134   1.414   -13.338 1.00 0.00 ? 73 ARG A CB   2  
ATOM 2537  C CG   . ARG A 1 73 ? 4.856   2.865   -12.982 1.00 0.00 ? 73 ARG A CG   2  
ATOM 2538  C CD   . ARG A 1 73 ? 5.702   3.321   -11.804 1.00 0.00 ? 73 ARG A CD   2  
ATOM 2539  N NE   . ARG A 1 73 ? 5.814   4.776   -11.742 1.00 0.00 ? 73 ARG A NE   2  
ATOM 2540  C CZ   . ARG A 1 73 ? 4.828   5.580   -11.350 1.00 0.00 ? 73 ARG A CZ   2  
ATOM 2541  N NH1  . ARG A 1 73 ? 3.656   5.074   -10.985 1.00 0.00 ? 73 ARG A NH1  2  
ATOM 2542  N NH2  . ARG A 1 73 ? 5.013   6.892   -11.323 1.00 0.00 ? 73 ARG A NH2  2  
ATOM 2543  H H    . ARG A 1 73 ? 3.253   0.339   -12.002 1.00 0.00 ? 73 ARG A H    2  
ATOM 2544  H HA   . ARG A 1 73 ? 3.436   1.372   -14.636 1.00 0.00 ? 73 ARG A HA   2  
ATOM 2545  H HB2  . ARG A 1 73 ? 5.418   0.892   -12.436 1.00 0.00 ? 73 ARG A HB2  2  
ATOM 2546  H HB3  . ARG A 1 73 ? 5.960   1.388   -14.034 1.00 0.00 ? 73 ARG A HB3  2  
ATOM 2547  H HG2  . ARG A 1 73 ? 5.082   3.485   -13.836 1.00 0.00 ? 73 ARG A HG2  2  
ATOM 2548  H HG3  . ARG A 1 73 ? 3.812   2.968   -12.725 1.00 0.00 ? 73 ARG A HG3  2  
ATOM 2549  H HD2  . ARG A 1 73 ? 5.248   2.966   -10.892 1.00 0.00 ? 73 ARG A HD2  2  
ATOM 2550  H HD3  . ARG A 1 73 ? 6.691   2.897   -11.902 1.00 0.00 ? 73 ARG A HD3  2  
ATOM 2551  H HE   . ARG A 1 73 ? 6.669   5.176   -12.006 1.00 0.00 ? 73 ARG A HE   2  
ATOM 2552  H HH11 . ARG A 1 73 ? 3.510   4.085   -11.003 1.00 0.00 ? 73 ARG A HH11 2  
ATOM 2553  H HH12 . ARG A 1 73 ? 2.919   5.683   -10.692 1.00 0.00 ? 73 ARG A HH12 2  
ATOM 2554  H HH21 . ARG A 1 73 ? 5.894   7.279   -11.597 1.00 0.00 ? 73 ARG A HH21 2  
ATOM 2555  H HH22 . ARG A 1 73 ? 4.272   7.496   -11.029 1.00 0.00 ? 73 ARG A HH22 2  
ATOM 2556  N N    . ARG A 1 74 ? 4.417   -1.668  -14.101 1.00 0.00 ? 74 ARG A N    2  
ATOM 2557  C CA   . ARG A 1 74 ? 4.843   -2.906  -14.736 1.00 0.00 ? 74 ARG A CA   2  
ATOM 2558  C C    . ARG A 1 74 ? 3.832   -3.354  -15.783 1.00 0.00 ? 74 ARG A C    2  
ATOM 2559  O O    . ARG A 1 74 ? 4.188   -3.975  -16.784 1.00 0.00 ? 74 ARG A O    2  
ATOM 2560  C CB   . ARG A 1 74 ? 5.035   -4.005  -13.689 1.00 0.00 ? 74 ARG A CB   2  
ATOM 2561  C CG   . ARG A 1 74 ? 6.027   -5.078  -14.107 1.00 0.00 ? 74 ARG A CG   2  
ATOM 2562  C CD   . ARG A 1 74 ? 6.693   -5.721  -12.902 1.00 0.00 ? 74 ARG A CD   2  
ATOM 2563  N NE   . ARG A 1 74 ? 8.054   -6.163  -13.199 1.00 0.00 ? 74 ARG A NE   2  
ATOM 2564  C CZ   . ARG A 1 74 ? 9.083   -5.335  -13.363 1.00 0.00 ? 74 ARG A CZ   2  
ATOM 2565  N NH1  . ARG A 1 74 ? 8.912   -4.023  -13.259 1.00 0.00 ? 74 ARG A NH1  2  
ATOM 2566  N NH2  . ARG A 1 74 ? 10.288  -5.821  -13.631 1.00 0.00 ? 74 ARG A NH2  2  
ATOM 2567  H H    . ARG A 1 74 ? 4.128   -1.684  -13.168 1.00 0.00 ? 74 ARG A H    2  
ATOM 2568  H HA   . ARG A 1 74 ? 5.781   -2.717  -15.222 1.00 0.00 ? 74 ARG A HA   2  
ATOM 2569  H HB2  . ARG A 1 74 ? 5.389   -3.555  -12.773 1.00 0.00 ? 74 ARG A HB2  2  
ATOM 2570  H HB3  . ARG A 1 74 ? 4.083   -4.478  -13.502 1.00 0.00 ? 74 ARG A HB3  2  
ATOM 2571  H HG2  . ARG A 1 74 ? 5.504   -5.840  -14.665 1.00 0.00 ? 74 ARG A HG2  2  
ATOM 2572  H HG3  . ARG A 1 74 ? 6.786   -4.629  -14.731 1.00 0.00 ? 74 ARG A HG3  2  
ATOM 2573  H HD2  . ARG A 1 74 ? 6.728   -5.000  -12.098 1.00 0.00 ? 74 ARG A HD2  2  
ATOM 2574  H HD3  . ARG A 1 74 ? 6.106   -6.574  -12.594 1.00 0.00 ? 74 ARG A HD3  2  
ATOM 2575  H HE   . ARG A 1 74 ? 8.208   -7.127  -13.281 1.00 0.00 ? 74 ARG A HE   2  
ATOM 2576  H HH11 . ARG A 1 74 ? 8.006   -3.651  -13.057 1.00 0.00 ? 74 ARG A HH11 2  
ATOM 2577  H HH12 . ARG A 1 74 ? 9.689   -3.407  -13.383 1.00 0.00 ? 74 ARG A HH12 2  
ATOM 2578  H HH21 . ARG A 1 74 ? 10.423  -6.808  -13.710 1.00 0.00 ? 74 ARG A HH21 2  
ATOM 2579  H HH22 . ARG A 1 74 ? 11.061  -5.199  -13.754 1.00 0.00 ? 74 ARG A HH22 2  
ATOM 2580  N N    . LYS A 1 75 ? 2.570   -3.032  -15.540 1.00 0.00 ? 75 LYS A N    2  
ATOM 2581  C CA   . LYS A 1 75 ? 1.496   -3.394  -16.453 1.00 0.00 ? 75 LYS A CA   2  
ATOM 2582  C C    . LYS A 1 75 ? 1.382   -2.387  -17.593 1.00 0.00 ? 75 LYS A C    2  
ATOM 2583  O O    . LYS A 1 75 ? 0.883   -2.708  -18.671 1.00 0.00 ? 75 LYS A O    2  
ATOM 2584  C CB   . LYS A 1 75 ? 0.167   -3.486  -15.701 1.00 0.00 ? 75 LYS A CB   2  
ATOM 2585  C CG   . LYS A 1 75 ? -0.793  -4.508  -16.286 1.00 0.00 ? 75 LYS A CG   2  
ATOM 2586  C CD   . LYS A 1 75 ? -1.598  -5.203  -15.200 1.00 0.00 ? 75 LYS A CD   2  
ATOM 2587  C CE   . LYS A 1 75 ? -2.132  -6.545  -15.675 1.00 0.00 ? 75 LYS A CE   2  
ATOM 2588  N NZ   . LYS A 1 75 ? -2.148  -7.555  -14.581 1.00 0.00 ? 75 LYS A NZ   2  
ATOM 2589  H H    . LYS A 1 75 ? 2.356   -2.540  -14.727 1.00 0.00 ? 75 LYS A H    2  
ATOM 2590  H HA   . LYS A 1 75 ? 1.733   -4.356  -16.863 1.00 0.00 ? 75 LYS A HA   2  
ATOM 2591  H HB2  . LYS A 1 75 ? 0.365   -3.756  -14.674 1.00 0.00 ? 75 LYS A HB2  2  
ATOM 2592  H HB3  . LYS A 1 75 ? -0.313  -2.519  -15.723 1.00 0.00 ? 75 LYS A HB3  2  
ATOM 2593  H HG2  . LYS A 1 75 ? -1.473  -4.006  -16.958 1.00 0.00 ? 75 LYS A HG2  2  
ATOM 2594  H HG3  . LYS A 1 75 ? -0.227  -5.249  -16.832 1.00 0.00 ? 75 LYS A HG3  2  
ATOM 2595  H HD2  . LYS A 1 75 ? -0.964  -5.363  -14.342 1.00 0.00 ? 75 LYS A HD2  2  
ATOM 2596  H HD3  . LYS A 1 75 ? -2.430  -4.572  -14.923 1.00 0.00 ? 75 LYS A HD3  2  
ATOM 2597  H HE2  . LYS A 1 75 ? -3.139  -6.409  -16.041 1.00 0.00 ? 75 LYS A HE2  2  
ATOM 2598  H HE3  . LYS A 1 75 ? -1.504  -6.904  -16.477 1.00 0.00 ? 75 LYS A HE3  2  
ATOM 2599  H HZ1  . LYS A 1 75 ? -1.228  -8.036  -14.525 1.00 0.00 ? 75 LYS A HZ1  2  
ATOM 2600  H HZ2  . LYS A 1 75 ? -2.887  -8.265  -14.760 1.00 0.00 ? 75 LYS A HZ2  2  
ATOM 2601  H HZ3  . LYS A 1 75 ? -2.341  -7.093  -13.670 1.00 0.00 ? 75 LYS A HZ3  2  
ATOM 2602  N N    . SER A 1 76 ? 1.846   -1.168  -17.344 1.00 0.00 ? 76 SER A N    2  
ATOM 2603  C CA   . SER A 1 76 ? 1.797   -0.110  -18.344 1.00 0.00 ? 76 SER A CA   2  
ATOM 2604  C C    . SER A 1 76 ? 2.747   -0.395  -19.506 1.00 0.00 ? 76 SER A C    2  
ATOM 2605  O O    . SER A 1 76 ? 2.677   0.258   -20.547 1.00 0.00 ? 76 SER A O    2  
ATOM 2606  C CB   . SER A 1 76 ? 2.143   1.237   -17.707 1.00 0.00 ? 76 SER A CB   2  
ATOM 2607  O OG   . SER A 1 76 ? 0.999   1.833   -17.120 1.00 0.00 ? 76 SER A OG   2  
ATOM 2608  H H    . SER A 1 76 ? 2.229   -0.976  -16.466 1.00 0.00 ? 76 SER A H    2  
ATOM 2609  H HA   . SER A 1 76 ? 0.790   -0.067  -18.725 1.00 0.00 ? 76 SER A HA   2  
ATOM 2610  H HB2  . SER A 1 76 ? 2.890   1.090   -16.941 1.00 0.00 ? 76 SER A HB2  2  
ATOM 2611  H HB3  . SER A 1 76 ? 2.531   1.902   -18.465 1.00 0.00 ? 76 SER A HB3  2  
ATOM 2612  H HG   . SER A 1 76 ? 0.655   2.512   -17.705 1.00 0.00 ? 76 SER A HG   2  
ATOM 2613  N N    . ARG A 1 77 ? 3.635   -1.371  -19.326 1.00 0.00 ? 77 ARG A N    2  
ATOM 2614  C CA   . ARG A 1 77 ? 4.592   -1.733  -20.366 1.00 0.00 ? 77 ARG A CA   2  
ATOM 2615  C C    . ARG A 1 77 ? 3.882   -2.080  -21.672 1.00 0.00 ? 77 ARG A C    2  
ATOM 2616  O O    . ARG A 1 77 ? 4.476   -2.015  -22.748 1.00 0.00 ? 77 ARG A O    2  
ATOM 2617  C CB   . ARG A 1 77 ? 5.452   -2.914  -19.909 1.00 0.00 ? 77 ARG A CB   2  
ATOM 2618  C CG   . ARG A 1 77 ? 6.186   -2.664  -18.601 1.00 0.00 ? 77 ARG A CG   2  
ATOM 2619  C CD   . ARG A 1 77 ? 7.237   -1.575  -18.747 1.00 0.00 ? 77 ARG A CD   2  
ATOM 2620  N NE   . ARG A 1 77 ? 8.498   -2.096  -19.270 1.00 0.00 ? 77 ARG A NE   2  
ATOM 2621  C CZ   . ARG A 1 77 ? 8.791   -2.178  -20.567 1.00 0.00 ? 77 ARG A CZ   2  
ATOM 2622  N NH1  . ARG A 1 77 ? 7.917   -1.779  -21.483 1.00 0.00 ? 77 ARG A NH1  2  
ATOM 2623  N NH2  . ARG A 1 77 ? 9.965   -2.662  -20.950 1.00 0.00 ? 77 ARG A NH2  2  
ATOM 2624  H H    . ARG A 1 77 ? 3.647   -1.858  -18.477 1.00 0.00 ? 77 ARG A H    2  
ATOM 2625  H HA   . ARG A 1 77 ? 5.229   -0.881  -20.536 1.00 0.00 ? 77 ARG A HA   2  
ATOM 2626  H HB2  . ARG A 1 77 ? 4.816   -3.777  -19.781 1.00 0.00 ? 77 ARG A HB2  2  
ATOM 2627  H HB3  . ARG A 1 77 ? 6.184   -3.128  -20.673 1.00 0.00 ? 77 ARG A HB3  2  
ATOM 2628  H HG2  . ARG A 1 77 ? 5.471   -2.362  -17.851 1.00 0.00 ? 77 ARG A HG2  2  
ATOM 2629  H HG3  . ARG A 1 77 ? 6.669   -3.579  -18.292 1.00 0.00 ? 77 ARG A HG3  2  
ATOM 2630  H HD2  . ARG A 1 77 ? 6.863   -0.817  -19.419 1.00 0.00 ? 77 ARG A HD2  2  
ATOM 2631  H HD3  . ARG A 1 77 ? 7.415   -1.135  -17.777 1.00 0.00 ? 77 ARG A HD3  2  
ATOM 2632  H HE   . ARG A 1 77 ? 9.165   -2.400  -18.619 1.00 0.00 ? 77 ARG A HE   2  
ATOM 2633  H HH11 . ARG A 1 77 ? 7.029   -1.414  -21.204 1.00 0.00 ? 77 ARG A HH11 2  
ATOM 2634  H HH12 . ARG A 1 77 ? 8.146   -1.845  -22.454 1.00 0.00 ? 77 ARG A HH12 2  
ATOM 2635  H HH21 . ARG A 1 77 ? 10.628  -2.965  -20.265 1.00 0.00 ? 77 ARG A HH21 2  
ATOM 2636  H HH22 . ARG A 1 77 ? 10.186  -2.725  -21.923 1.00 0.00 ? 77 ARG A HH22 2  
ATOM 2637  N N    . ASP A 1 78 ? 2.610   -2.448  -21.570 1.00 0.00 ? 78 ASP A N    2  
ATOM 2638  C CA   . ASP A 1 78 ? 1.822   -2.804  -22.742 1.00 0.00 ? 78 ASP A CA   2  
ATOM 2639  C C    . ASP A 1 78 ? 1.592   -1.592  -23.640 1.00 0.00 ? 78 ASP A C    2  
ATOM 2640  O O    . ASP A 1 78 ? 1.337   -1.732  -24.836 1.00 0.00 ? 78 ASP A O    2  
ATOM 2641  C CB   . ASP A 1 78 ? 0.483   -3.405  -22.318 1.00 0.00 ? 78 ASP A CB   2  
ATOM 2642  C CG   . ASP A 1 78 ? 0.324   -4.843  -22.773 1.00 0.00 ? 78 ASP A CG   2  
ATOM 2643  O OD1  . ASP A 1 78 ? 0.831   -5.746  -22.075 1.00 0.00 ? 78 ASP A OD1  2  
ATOM 2644  O OD2  . ASP A 1 78 ? -0.308  -5.066  -23.827 1.00 0.00 ? 78 ASP A OD2  2  
ATOM 2645  H H    . ASP A 1 78 ? 2.192   -2.481  -20.687 1.00 0.00 ? 78 ASP A H    2  
ATOM 2646  H HA   . ASP A 1 78 ? 2.372   -3.542  -23.293 1.00 0.00 ? 78 ASP A HA   2  
ATOM 2647  H HB2  . ASP A 1 78 ? 0.412   -3.378  -21.244 1.00 0.00 ? 78 ASP A HB2  2  
ATOM 2648  H HB3  . ASP A 1 78 ? -0.317  -2.821  -22.744 1.00 0.00 ? 78 ASP A HB3  2  
ATOM 2649  N N    . LEU A 1 79 ? 1.685   -0.404  -23.055 1.00 0.00 ? 79 LEU A N    2  
ATOM 2650  C CA   . LEU A 1 79 ? 1.488   0.834   -23.801 1.00 0.00 ? 79 LEU A CA   2  
ATOM 2651  C C    . LEU A 1 79 ? 2.522   0.970   -24.913 1.00 0.00 ? 79 LEU A C    2  
ATOM 2652  O O    . LEU A 1 79 ? 3.575   1.578   -24.724 1.00 0.00 ? 79 LEU A O    2  
ATOM 2653  C CB   . LEU A 1 79 ? 1.571   2.039   -22.861 1.00 0.00 ? 79 LEU A CB   2  
ATOM 2654  C CG   . LEU A 1 79 ? 0.710   3.236   -23.266 1.00 0.00 ? 79 LEU A CG   2  
ATOM 2655  C CD1  . LEU A 1 79 ? -0.688  3.111   -22.680 1.00 0.00 ? 79 LEU A CD1  2  
ATOM 2656  C CD2  . LEU A 1 79 ? 1.363   4.536   -22.819 1.00 0.00 ? 79 LEU A CD2  2  
ATOM 2657  H H    . LEU A 1 79 ? 1.891   -0.358  -22.100 1.00 0.00 ? 79 LEU A H    2  
ATOM 2658  H HA   . LEU A 1 79 ? 0.503   0.801   -24.242 1.00 0.00 ? 79 LEU A HA   2  
ATOM 2659  H HB2  . LEU A 1 79 ? 1.268   1.720   -21.874 1.00 0.00 ? 79 LEU A HB2  2  
ATOM 2660  H HB3  . LEU A 1 79 ? 2.600   2.363   -22.816 1.00 0.00 ? 79 LEU A HB3  2  
ATOM 2661  H HG   . LEU A 1 79 ? 0.619   3.259   -24.342 1.00 0.00 ? 79 LEU A HG   2  
ATOM 2662  H HD11 . LEU A 1 79 ? -1.398  3.592   -23.336 1.00 0.00 ? 79 LEU A HD11 2  
ATOM 2663  H HD12 . LEU A 1 79 ? -0.715  3.586   -21.710 1.00 0.00 ? 79 LEU A HD12 2  
ATOM 2664  H HD13 . LEU A 1 79 ? -0.943  2.067   -22.577 1.00 0.00 ? 79 LEU A HD13 2  
ATOM 2665  H HD21 . LEU A 1 79 ? 1.810   4.398   -21.846 1.00 0.00 ? 79 LEU A HD21 2  
ATOM 2666  H HD22 . LEU A 1 79 ? 0.616   5.314   -22.766 1.00 0.00 ? 79 LEU A HD22 2  
ATOM 2667  H HD23 . LEU A 1 79 ? 2.126   4.818   -23.529 1.00 0.00 ? 79 LEU A HD23 2  
ATOM 2668  N N    . VAL A 1 80 ? 2.214   0.400   -26.073 1.00 0.00 ? 80 VAL A N    2  
ATOM 2669  C CA   . VAL A 1 80 ? 3.116   0.458   -27.216 1.00 0.00 ? 80 VAL A CA   2  
ATOM 2670  C C    . VAL A 1 80 ? 3.313   1.897   -27.690 1.00 0.00 ? 80 VAL A C    2  
ATOM 2671  O O    . VAL A 1 80 ? 2.344   2.595   -27.991 1.00 0.00 ? 80 VAL A O    2  
ATOM 2672  C CB   . VAL A 1 80 ? 2.601   -0.385  -28.389 1.00 0.00 ? 80 VAL A CB   2  
ATOM 2673  C CG1  . VAL A 1 80 ? 3.710   -0.628  -29.401 1.00 0.00 ? 80 VAL A CG1  2  
ATOM 2674  C CG2  . VAL A 1 80 ? 2.017   -1.702  -27.899 1.00 0.00 ? 80 VAL A CG2  2  
ATOM 2675  H H    . VAL A 1 80 ? 1.359   -0.071  -26.162 1.00 0.00 ? 80 VAL A H    2  
ATOM 2676  H HA   . VAL A 1 80 ? 4.060   0.057   -26.914 1.00 0.00 ? 80 VAL A HA   2  
ATOM 2677  H HB   . VAL A 1 80 ? 1.825   0.171   -28.872 1.00 0.00 ? 80 VAL A HB   2  
ATOM 2678  H HG11 . VAL A 1 80 ? 3.300   -0.593  -30.400 1.00 0.00 ? 80 VAL A HG11 2  
ATOM 2679  H HG12 . VAL A 1 80 ? 4.150   -1.599  -29.227 1.00 0.00 ? 80 VAL A HG12 2  
ATOM 2680  H HG13 . VAL A 1 80 ? 4.467   0.134   -29.296 1.00 0.00 ? 80 VAL A HG13 2  
ATOM 2681  H HG21 . VAL A 1 80 ? 2.611   -2.075  -27.077 1.00 0.00 ? 80 VAL A HG21 2  
ATOM 2682  H HG22 . VAL A 1 80 ? 2.026   -2.421  -28.704 1.00 0.00 ? 80 VAL A HG22 2  
ATOM 2683  H HG23 . VAL A 1 80 ? 1.002   -1.544  -27.567 1.00 0.00 ? 80 VAL A HG23 2  
ATOM 2684  N N    . PRO A 1 81 ? 4.573   2.366   -27.764 1.00 0.00 ? 81 PRO A N    2  
ATOM 2685  C CA   . PRO A 1 81 ? 4.881   3.732   -28.204 1.00 0.00 ? 81 PRO A CA   2  
ATOM 2686  C C    . PRO A 1 81 ? 4.547   3.965   -29.675 1.00 0.00 ? 81 PRO A C    2  
ATOM 2687  O O    . PRO A 1 81 ? 4.525   5.104   -30.142 1.00 0.00 ? 81 PRO A O    2  
ATOM 2688  C CB   . PRO A 1 81 ? 6.387   3.855   -27.973 1.00 0.00 ? 81 PRO A CB   2  
ATOM 2689  C CG   . PRO A 1 81 ? 6.887   2.456   -28.010 1.00 0.00 ? 81 PRO A CG   2  
ATOM 2690  C CD   . PRO A 1 81 ? 5.792   1.611   -27.426 1.00 0.00 ? 81 PRO A CD   2  
ATOM 2691  H HA   . PRO A 1 81 ? 4.367   4.460   -27.604 1.00 0.00 ? 81 PRO A HA   2  
ATOM 2692  H HB2  . PRO A 1 81 ? 6.827   4.454   -28.757 1.00 0.00 ? 81 PRO A HB2  2  
ATOM 2693  H HB3  . PRO A 1 81 ? 6.571   4.314   -27.014 1.00 0.00 ? 81 PRO A HB3  2  
ATOM 2694  H HG2  . PRO A 1 81 ? 7.080   2.166   -29.030 1.00 0.00 ? 81 PRO A HG2  2  
ATOM 2695  H HG3  . PRO A 1 81 ? 7.783   2.372   -27.416 1.00 0.00 ? 81 PRO A HG3  2  
ATOM 2696  H HD2  . PRO A 1 81 ? 5.782   0.634   -27.886 1.00 0.00 ? 81 PRO A HD2  2  
ATOM 2697  H HD3  . PRO A 1 81 ? 5.909   1.527   -26.356 1.00 0.00 ? 81 PRO A HD3  2  
ATOM 2698  N N    . ARG A 1 82 ? 4.286   2.882   -30.401 1.00 0.00 ? 82 ARG A N    2  
ATOM 2699  C CA   . ARG A 1 82 ? 3.954   2.975   -31.818 1.00 0.00 ? 82 ARG A CA   2  
ATOM 2700  C C    . ARG A 1 82 ? 5.099   3.604   -32.605 1.00 0.00 ? 82 ARG A C    2  
ATOM 2701  O O    . ARG A 1 82 ? 6.171   3.834   -32.006 1.00 0.00 ? 82 ARG A O    2  
ATOM 2702  C CB   . ARG A 1 82 ? 2.676   3.793   -32.012 1.00 0.00 ? 82 ARG A CB   2  
ATOM 2703  C CG   . ARG A 1 82 ? 1.412   2.949   -32.034 1.00 0.00 ? 82 ARG A CG   2  
ATOM 2704  C CD   . ARG A 1 82 ? 0.682   3.000   -30.701 1.00 0.00 ? 82 ARG A CD   2  
ATOM 2705  N NE   . ARG A 1 82 ? 0.448   4.372   -30.257 1.00 0.00 ? 82 ARG A NE   2  
ATOM 2706  C CZ   . ARG A 1 82 ? -0.071  4.689   -29.073 1.00 0.00 ? 82 ARG A CZ   2  
ATOM 2707  N NH1  . ARG A 1 82 ? -0.413  3.737   -28.214 1.00 0.00 ? 82 ARG A NH1  2  
ATOM 2708  N NH2  . ARG A 1 82 ? -0.251  5.962   -28.748 1.00 0.00 ? 82 ARG A NH2  2  
ATOM 2709  O OXT  . ARG A 1 82 ? 4.915   3.861   -33.813 1.00 0.00 ? 82 ARG A OXT  2  
ATOM 2710  H H    . ARG A 1 82 ? 4.318   2.002   -29.975 1.00 0.00 ? 82 ARG A H    2  
ATOM 2711  H HA   . ARG A 1 82 ? 3.789   1.973   -32.185 1.00 0.00 ? 82 ARG A HA   2  
ATOM 2712  H HB2  . ARG A 1 82 ? 2.593   4.506   -31.205 1.00 0.00 ? 82 ARG A HB2  2  
ATOM 2713  H HB3  . ARG A 1 82 ? 2.742   4.328   -32.948 1.00 0.00 ? 82 ARG A HB3  2  
ATOM 2714  H HG2  . ARG A 1 82 ? 0.755   3.322   -32.806 1.00 0.00 ? 82 ARG A HG2  2  
ATOM 2715  H HG3  . ARG A 1 82 ? 1.678   1.925   -32.250 1.00 0.00 ? 82 ARG A HG3  2  
ATOM 2716  H HD2  . ARG A 1 82 ? -0.269  2.499   -30.806 1.00 0.00 ? 82 ARG A HD2  2  
ATOM 2717  H HD3  . ARG A 1 82 ? 1.278   2.488   -29.960 1.00 0.00 ? 82 ARG A HD3  2  
ATOM 2718  H HE   . ARG A 1 82 ? 0.691   5.095   -30.873 1.00 0.00 ? 82 ARG A HE   2  
ATOM 2719  H HH11 . ARG A 1 82 ? -0.280  2.776   -28.452 1.00 0.00 ? 82 ARG A HH11 2  
ATOM 2720  H HH12 . ARG A 1 82 ? -0.802  3.983   -27.326 1.00 0.00 ? 82 ARG A HH12 2  
ATOM 2721  H HH21 . ARG A 1 82 ? 0.005   6.683   -29.392 1.00 0.00 ? 82 ARG A HH21 2  
ATOM 2722  H HH22 . ARG A 1 82 ? -0.641  6.201   -27.859 1.00 0.00 ? 82 ARG A HH22 2  
ATOM 2723  N N    . MET A 1 1  ? 28.791  0.079   15.354  1.00 0.00 ? 1  MET A N    3  
ATOM 2724  C CA   . MET A 1 1  ? 28.524  1.526   15.570  1.00 0.00 ? 1  MET A CA   3  
ATOM 2725  C C    . MET A 1 1  ? 27.029  1.797   15.701  1.00 0.00 ? 1  MET A C    3  
ATOM 2726  O O    . MET A 1 1  ? 26.204  1.061   15.160  1.00 0.00 ? 1  MET A O    3  
ATOM 2727  C CB   . MET A 1 1  ? 29.101  2.309   14.390  1.00 0.00 ? 1  MET A CB   3  
ATOM 2728  C CG   . MET A 1 1  ? 29.348  3.777   14.697  1.00 0.00 ? 1  MET A CG   3  
ATOM 2729  S SD   . MET A 1 1  ? 30.795  4.431   13.841  1.00 0.00 ? 1  MET A SD   3  
ATOM 2730  C CE   . MET A 1 1  ? 31.581  5.352   15.161  1.00 0.00 ? 1  MET A CE   3  
ATOM 2731  H H1   . MET A 1 1  ? 29.820  -0.045  15.274  1.00 0.00 ? 1  MET A H1   3  
ATOM 2732  H H2   . MET A 1 1  ? 28.308  -0.204  14.477  1.00 0.00 ? 1  MET A H2   3  
ATOM 2733  H H3   . MET A 1 1  ? 28.415  -0.438  16.174  1.00 0.00 ? 1  MET A H3   3  
ATOM 2734  H HA   . MET A 1 1  ? 29.019  1.835   16.479  1.00 0.00 ? 1  MET A HA   3  
ATOM 2735  H HB2  . MET A 1 1  ? 30.040  1.861   14.100  1.00 0.00 ? 1  MET A HB2  3  
ATOM 2736  H HB3  . MET A 1 1  ? 28.412  2.248   13.561  1.00 0.00 ? 1  MET A HB3  3  
ATOM 2737  H HG2  . MET A 1 1  ? 28.482  4.345   14.393  1.00 0.00 ? 1  MET A HG2  3  
ATOM 2738  H HG3  . MET A 1 1  ? 29.496  3.888   15.761  1.00 0.00 ? 1  MET A HG3  3  
ATOM 2739  H HE1  . MET A 1 1  ? 31.553  6.407   14.930  1.00 0.00 ? 1  MET A HE1  3  
ATOM 2740  H HE2  . MET A 1 1  ? 32.607  5.033   15.261  1.00 0.00 ? 1  MET A HE2  3  
ATOM 2741  H HE3  . MET A 1 1  ? 31.056  5.173   16.088  1.00 0.00 ? 1  MET A HE3  3  
ATOM 2742  N N    . ASP A 1 2  ? 26.687  2.859   16.424  1.00 0.00 ? 2  ASP A N    3  
ATOM 2743  C CA   . ASP A 1 2  ? 25.291  3.228   16.626  1.00 0.00 ? 2  ASP A CA   3  
ATOM 2744  C C    . ASP A 1 2  ? 24.606  3.522   15.295  1.00 0.00 ? 2  ASP A C    3  
ATOM 2745  O O    . ASP A 1 2  ? 24.998  4.438   14.572  1.00 0.00 ? 2  ASP A O    3  
ATOM 2746  C CB   . ASP A 1 2  ? 25.192  4.441   17.547  1.00 0.00 ? 2  ASP A CB   3  
ATOM 2747  C CG   . ASP A 1 2  ? 24.446  4.135   18.832  1.00 0.00 ? 2  ASP A CG   3  
ATOM 2748  O OD1  . ASP A 1 2  ? 23.208  4.298   18.852  1.00 0.00 ? 2  ASP A OD1  3  
ATOM 2749  O OD2  . ASP A 1 2  ? 25.100  3.732   19.816  1.00 0.00 ? 2  ASP A OD2  3  
ATOM 2750  H H    . ASP A 1 2  ? 27.390  3.407   16.830  1.00 0.00 ? 2  ASP A H    3  
ATOM 2751  H HA   . ASP A 1 2  ? 24.794  2.397   17.095  1.00 0.00 ? 2  ASP A HA   3  
ATOM 2752  H HB2  . ASP A 1 2  ? 26.186  4.770   17.802  1.00 0.00 ? 2  ASP A HB2  3  
ATOM 2753  H HB3  . ASP A 1 2  ? 24.674  5.234   17.033  1.00 0.00 ? 2  ASP A HB3  3  
ATOM 2754  N N    . ASN A 1 3  ? 23.580  2.738   14.977  1.00 0.00 ? 3  ASN A N    3  
ATOM 2755  C CA   . ASN A 1 3  ? 22.841  2.910   13.739  1.00 0.00 ? 3  ASN A CA   3  
ATOM 2756  C C    . ASN A 1 3  ? 21.492  3.574   14.000  1.00 0.00 ? 3  ASN A C    3  
ATOM 2757  O O    . ASN A 1 3  ? 20.518  3.326   13.288  1.00 0.00 ? 3  ASN A O    3  
ATOM 2758  C CB   . ASN A 1 3  ? 22.637  1.564   13.029  1.00 0.00 ? 3  ASN A CB   3  
ATOM 2759  C CG   . ASN A 1 3  ? 22.807  0.368   13.949  1.00 0.00 ? 3  ASN A CG   3  
ATOM 2760  O OD1  . ASN A 1 3  ? 23.928  -0.027  14.272  1.00 0.00 ? 3  ASN A OD1  3  
ATOM 2761  N ND2  . ASN A 1 3  ? 21.692  -0.215  14.374  1.00 0.00 ? 3  ASN A ND2  3  
ATOM 2762  H H    . ASN A 1 3  ? 23.315  2.031   15.586  1.00 0.00 ? 3  ASN A H    3  
ATOM 2763  H HA   . ASN A 1 3  ? 23.424  3.552   13.107  1.00 0.00 ? 3  ASN A HA   3  
ATOM 2764  H HB2  . ASN A 1 3  ? 21.642  1.532   12.620  1.00 0.00 ? 3  ASN A HB2  3  
ATOM 2765  H HB3  . ASN A 1 3  ? 23.353  1.480   12.225  1.00 0.00 ? 3  ASN A HB3  3  
ATOM 2766  H HD21 . ASN A 1 3  ? 20.835  0.154   14.076  1.00 0.00 ? 3  ASN A HD21 3  
ATOM 2767  H HD22 . ASN A 1 3  ? 21.773  -0.989  14.969  1.00 0.00 ? 3  ASN A HD22 3  
ATOM 2768  N N    . ASP A 1 4  ? 21.441  4.418   15.025  1.00 0.00 ? 4  ASP A N    3  
ATOM 2769  C CA   . ASP A 1 4  ? 20.211  5.118   15.379  1.00 0.00 ? 4  ASP A CA   3  
ATOM 2770  C C    . ASP A 1 4  ? 19.711  5.975   14.220  1.00 0.00 ? 4  ASP A C    3  
ATOM 2771  O O    . ASP A 1 4  ? 18.528  6.309   14.148  1.00 0.00 ? 4  ASP A O    3  
ATOM 2772  C CB   . ASP A 1 4  ? 20.433  5.984   16.617  1.00 0.00 ? 4  ASP A CB   3  
ATOM 2773  C CG   . ASP A 1 4  ? 19.564  5.559   17.785  1.00 0.00 ? 4  ASP A CG   3  
ATOM 2774  O OD1  . ASP A 1 4  ? 19.996  4.676   18.556  1.00 0.00 ? 4  ASP A OD1  3  
ATOM 2775  O OD2  . ASP A 1 4  ? 18.451  6.108   17.929  1.00 0.00 ? 4  ASP A OD2  3  
ATOM 2776  H H    . ASP A 1 4  ? 22.250  4.576   15.555  1.00 0.00 ? 4  ASP A H    3  
ATOM 2777  H HA   . ASP A 1 4  ? 19.467  4.377   15.605  1.00 0.00 ? 4  ASP A HA   3  
ATOM 2778  H HB2  . ASP A 1 4  ? 21.465  5.910   16.917  1.00 0.00 ? 4  ASP A HB2  3  
ATOM 2779  H HB3  . ASP A 1 4  ? 20.203  7.010   16.376  1.00 0.00 ? 4  ASP A HB3  3  
ATOM 2780  N N    . ALA A 1 5  ? 20.618  6.328   13.316  1.00 0.00 ? 5  ALA A N    3  
ATOM 2781  C CA   . ALA A 1 5  ? 20.274  7.142   12.164  1.00 0.00 ? 5  ALA A CA   3  
ATOM 2782  C C    . ALA A 1 5  ? 20.661  6.457   10.854  1.00 0.00 ? 5  ALA A C    3  
ATOM 2783  O O    . ALA A 1 5  ? 20.483  7.023   9.775   1.00 0.00 ? 5  ALA A O    3  
ATOM 2784  C CB   . ALA A 1 5  ? 20.938  8.507   12.265  1.00 0.00 ? 5  ALA A CB   3  
ATOM 2785  H H    . ALA A 1 5  ? 21.536  6.034   13.426  1.00 0.00 ? 5  ALA A H    3  
ATOM 2786  H HA   . ALA A 1 5  ? 19.211  7.287   12.179  1.00 0.00 ? 5  ALA A HA   3  
ATOM 2787  H HB1  . ALA A 1 5  ? 20.812  9.038   11.333  1.00 0.00 ? 5  ALA A HB1  3  
ATOM 2788  H HB2  . ALA A 1 5  ? 21.991  8.381   12.469  1.00 0.00 ? 5  ALA A HB2  3  
ATOM 2789  H HB3  . ALA A 1 5  ? 20.482  9.071   13.065  1.00 0.00 ? 5  ALA A HB3  3  
ATOM 2790  N N    . GLU A 1 6  ? 21.191  5.240   10.950  1.00 0.00 ? 6  GLU A N    3  
ATOM 2791  C CA   . GLU A 1 6  ? 21.600  4.490   9.772   1.00 0.00 ? 6  GLU A CA   3  
ATOM 2792  C C    . GLU A 1 6  ? 20.538  3.488   9.355   1.00 0.00 ? 6  GLU A C    3  
ATOM 2793  O O    . GLU A 1 6  ? 20.808  2.530   8.631   1.00 0.00 ? 6  GLU A O    3  
ATOM 2794  C CB   . GLU A 1 6  ? 22.904  3.765   10.045  1.00 0.00 ? 6  GLU A CB   3  
ATOM 2795  C CG   . GLU A 1 6  ? 23.799  3.627   8.824   1.00 0.00 ? 6  GLU A CG   3  
ATOM 2796  C CD   . GLU A 1 6  ? 24.843  4.723   8.739   1.00 0.00 ? 6  GLU A CD   3  
ATOM 2797  O OE1  . GLU A 1 6  ? 25.921  4.565   9.350   1.00 0.00 ? 6  GLU A OE1  3  
ATOM 2798  O OE2  . GLU A 1 6  ? 24.583  5.739   8.061   1.00 0.00 ? 6  GLU A OE2  3  
ATOM 2799  H H    . GLU A 1 6  ? 21.312  4.838   11.828  1.00 0.00 ? 6  GLU A H    3  
ATOM 2800  H HA   . GLU A 1 6  ? 21.736  5.191   8.982   1.00 0.00 ? 6  GLU A HA   3  
ATOM 2801  H HB2  . GLU A 1 6  ? 23.445  4.302   10.807  1.00 0.00 ? 6  GLU A HB2  3  
ATOM 2802  H HB3  . GLU A 1 6  ? 22.669  2.778   10.409  1.00 0.00 ? 6  GLU A HB3  3  
ATOM 2803  H HG2  . GLU A 1 6  ? 24.304  2.673   8.869   1.00 0.00 ? 6  GLU A HG2  3  
ATOM 2804  H HG3  . GLU A 1 6  ? 23.184  3.666   7.936   1.00 0.00 ? 6  GLU A HG3  3  
ATOM 2805  N N    . GLY A 1 7  ? 19.338  3.727   9.824   1.00 0.00 ? 7  GLY A N    3  
ATOM 2806  C CA   . GLY A 1 7  ? 18.218  2.858   9.514   1.00 0.00 ? 7  GLY A CA   3  
ATOM 2807  C C    . GLY A 1 7  ? 17.854  1.947   10.669  1.00 0.00 ? 7  GLY A C    3  
ATOM 2808  O O    . GLY A 1 7  ? 17.665  0.745   10.483  1.00 0.00 ? 7  GLY A O    3  
ATOM 2809  H H    . GLY A 1 7  ? 19.215  4.508   10.390  1.00 0.00 ? 7  GLY A H    3  
ATOM 2810  H HA2  . GLY A 1 7  ? 17.362  3.468   9.266   1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2811  H HA3  . GLY A 1 7  ? 18.474  2.252   8.658   1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2812  N N    . VAL A 1 8  ? 17.756  2.519   11.864  1.00 0.00 ? 8  VAL A N    3  
ATOM 2813  C CA   . VAL A 1 8  ? 17.412  1.750   13.054  1.00 0.00 ? 8  VAL A CA   3  
ATOM 2814  C C    . VAL A 1 8  ? 16.055  1.068   12.902  1.00 0.00 ? 8  VAL A C    3  
ATOM 2815  O O    . VAL A 1 8  ? 15.759  0.093   13.592  1.00 0.00 ? 8  VAL A O    3  
ATOM 2816  C CB   . VAL A 1 8  ? 17.394  2.641   14.313  1.00 0.00 ? 8  VAL A CB   3  
ATOM 2817  C CG1  . VAL A 1 8  ? 16.341  3.731   14.185  1.00 0.00 ? 8  VAL A CG1  3  
ATOM 2818  C CG2  . VAL A 1 8  ? 17.157  1.802   15.560  1.00 0.00 ? 8  VAL A CG2  3  
ATOM 2819  H H    . VAL A 1 8  ? 17.919  3.482   11.948  1.00 0.00 ? 8  VAL A H    3  
ATOM 2820  H HA   . VAL A 1 8  ? 18.168  0.992   13.187  1.00 0.00 ? 8  VAL A HA   3  
ATOM 2821  H HB   . VAL A 1 8  ? 18.360  3.116   14.405  1.00 0.00 ? 8  VAL A HB   3  
ATOM 2822  H HG11 . VAL A 1 8  ? 16.597  4.557   14.833  1.00 0.00 ? 8  VAL A HG11 3  
ATOM 2823  H HG12 . VAL A 1 8  ? 15.377  3.336   14.470  1.00 0.00 ? 8  VAL A HG12 3  
ATOM 2824  H HG13 . VAL A 1 8  ? 16.301  4.075   13.162  1.00 0.00 ? 8  VAL A HG13 3  
ATOM 2825  H HG21 . VAL A 1 8  ? 17.357  2.398   16.438  1.00 0.00 ? 8  VAL A HG21 3  
ATOM 2826  H HG22 . VAL A 1 8  ? 17.814  0.946   15.549  1.00 0.00 ? 8  VAL A HG22 3  
ATOM 2827  H HG23 . VAL A 1 8  ? 16.130  1.467   15.578  1.00 0.00 ? 8  VAL A HG23 3  
ATOM 2828  N N    . TRP A 1 9  ? 15.236  1.587   11.995  1.00 0.00 ? 9  TRP A N    3  
ATOM 2829  C CA   . TRP A 1 9  ? 13.911  1.027   11.752  1.00 0.00 ? 9  TRP A CA   3  
ATOM 2830  C C    . TRP A 1 9  ? 14.008  -0.420  11.280  1.00 0.00 ? 9  TRP A C    3  
ATOM 2831  O O    . TRP A 1 9  ? 14.697  -0.720  10.305  1.00 0.00 ? 9  TRP A O    3  
ATOM 2832  C CB   . TRP A 1 9  ? 13.162  1.868   10.721  1.00 0.00 ? 9  TRP A CB   3  
ATOM 2833  C CG   . TRP A 1 9  ? 11.907  2.487   11.257  1.00 0.00 ? 9  TRP A CG   3  
ATOM 2834  C CD1  . TRP A 1 9  ? 10.649  2.364   10.743  1.00 0.00 ? 9  TRP A CD1  3  
ATOM 2835  C CD2  . TRP A 1 9  ? 11.791  3.327   12.411  1.00 0.00 ? 9  TRP A CD2  3  
ATOM 2836  N NE1  . TRP A 1 9  ? 9.756   3.076   11.507  1.00 0.00 ? 9  TRP A NE1  3  
ATOM 2837  C CE2  . TRP A 1 9  ? 10.433  3.676   12.537  1.00 0.00 ? 9  TRP A CE2  3  
ATOM 2838  C CE3  . TRP A 1 9  ? 12.702  3.817   13.351  1.00 0.00 ? 9  TRP A CE3  3  
ATOM 2839  C CZ2  . TRP A 1 9  ? 9.966   4.492   13.565  1.00 0.00 ? 9  TRP A CZ2  3  
ATOM 2840  C CZ3  . TRP A 1 9  ? 12.237  4.627   14.370  1.00 0.00 ? 9  TRP A CZ3  3  
ATOM 2841  C CH2  . TRP A 1 9  ? 10.880  4.957   14.470  1.00 0.00 ? 9  TRP A CH2  3  
ATOM 2842  H H    . TRP A 1 9  ? 15.528  2.363   11.476  1.00 0.00 ? 9  TRP A H    3  
ATOM 2843  H HA   . TRP A 1 9  ? 13.367  1.054   12.680  1.00 0.00 ? 9  TRP A HA   3  
ATOM 2844  H HB2  . TRP A 1 9  ? 13.806  2.662   10.382  1.00 0.00 ? 9  TRP A HB2  3  
ATOM 2845  H HB3  . TRP A 1 9  ? 12.895  1.243   9.884   1.00 0.00 ? 9  TRP A HB3  3  
ATOM 2846  H HD1  . TRP A 1 9  ? 10.404  1.789   9.863   1.00 0.00 ? 9  TRP A HD1  3  
ATOM 2847  H HE1  . TRP A 1 9  ? 8.792   3.144   11.342  1.00 0.00 ? 9  TRP A HE1  3  
ATOM 2848  H HE3  . TRP A 1 9  ? 13.752  3.573   13.290  1.00 0.00 ? 9  TRP A HE3  3  
ATOM 2849  H HZ2  . TRP A 1 9  ? 8.922   4.755   13.656  1.00 0.00 ? 9  TRP A HZ2  3  
ATOM 2850  H HZ3  . TRP A 1 9  ? 12.927  5.015   15.105  1.00 0.00 ? 9  TRP A HZ3  3  
ATOM 2851  H HH2  . TRP A 1 9  ? 10.562  5.594   15.282  1.00 0.00 ? 9  TRP A HH2  3  
ATOM 2852  N N    . SER A 1 10 ? 13.314  -1.313  11.977  1.00 0.00 ? 10 SER A N    3  
ATOM 2853  C CA   . SER A 1 10 ? 13.321  -2.729  11.630  1.00 0.00 ? 10 SER A CA   3  
ATOM 2854  C C    . SER A 1 10 ? 12.825  -2.942  10.202  1.00 0.00 ? 10 SER A C    3  
ATOM 2855  O O    . SER A 1 10 ? 11.972  -2.200  9.715   1.00 0.00 ? 10 SER A O    3  
ATOM 2856  C CB   . SER A 1 10 ? 12.451  -3.520  12.608  1.00 0.00 ? 10 SER A CB   3  
ATOM 2857  O OG   . SER A 1 10 ? 13.026  -4.783  12.896  1.00 0.00 ? 10 SER A OG   3  
ATOM 2858  H H    . SER A 1 10 ? 12.784  -1.013  12.744  1.00 0.00 ? 10 SER A H    3  
ATOM 2859  H HA   . SER A 1 10 ? 14.339  -3.081  11.701  1.00 0.00 ? 10 SER A HA   3  
ATOM 2860  H HB2  . SER A 1 10 ? 12.354  -2.965  13.530  1.00 0.00 ? 10 SER A HB2  3  
ATOM 2861  H HB3  . SER A 1 10 ? 11.474  -3.673  12.175  1.00 0.00 ? 10 SER A HB3  3  
ATOM 2862  H HG   . SER A 1 10 ? 12.618  -5.149  13.684  1.00 0.00 ? 10 SER A HG   3  
ATOM 2863  N N    . PRO A 1 11 ? 13.356  -3.964  9.509   1.00 0.00 ? 11 PRO A N    3  
ATOM 2864  C CA   . PRO A 1 11 ? 12.964  -4.273  8.131   1.00 0.00 ? 11 PRO A CA   3  
ATOM 2865  C C    . PRO A 1 11 ? 11.549  -4.835  8.034   1.00 0.00 ? 11 PRO A C    3  
ATOM 2866  O O    . PRO A 1 11 ? 10.976  -4.911  6.947   1.00 0.00 ? 11 PRO A O    3  
ATOM 2867  C CB   . PRO A 1 11 ? 13.987  -5.321  7.696   1.00 0.00 ? 11 PRO A CB   3  
ATOM 2868  C CG   . PRO A 1 11 ? 14.416  -5.970  8.961   1.00 0.00 ? 11 PRO A CG   3  
ATOM 2869  C CD   . PRO A 1 11 ? 14.379  -4.897  10.013  1.00 0.00 ? 11 PRO A CD   3  
ATOM 2870  H HA   . PRO A 1 11 ? 13.047  -3.409  7.499   1.00 0.00 ? 11 PRO A HA   3  
ATOM 2871  H HB2  . PRO A 1 11 ? 13.520  -6.027  7.025   1.00 0.00 ? 11 PRO A HB2  3  
ATOM 2872  H HB3  . PRO A 1 11 ? 14.815  -4.837  7.201   1.00 0.00 ? 11 PRO A HB3  3  
ATOM 2873  H HG2  . PRO A 1 11 ? 13.730  -6.763  9.212   1.00 0.00 ? 11 PRO A HG2  3  
ATOM 2874  H HG3  . PRO A 1 11 ? 15.417  -6.355  8.854   1.00 0.00 ? 11 PRO A HG3  3  
ATOM 2875  H HD2  . PRO A 1 11 ? 14.085  -5.313  10.966  1.00 0.00 ? 11 PRO A HD2  3  
ATOM 2876  H HD3  . PRO A 1 11 ? 15.339  -4.410  10.092  1.00 0.00 ? 11 PRO A HD3  3  
ATOM 2877  N N    . ASP A 1 12 ? 10.990  -5.225  9.174   1.00 0.00 ? 12 ASP A N    3  
ATOM 2878  C CA   . ASP A 1 12 ? 9.641   -5.778  9.212   1.00 0.00 ? 12 ASP A CA   3  
ATOM 2879  C C    . ASP A 1 12 ? 8.618   -4.760  8.723   1.00 0.00 ? 12 ASP A C    3  
ATOM 2880  O O    . ASP A 1 12 ? 7.533   -5.122  8.268   1.00 0.00 ? 12 ASP A O    3  
ATOM 2881  C CB   . ASP A 1 12 ? 9.294   -6.231  10.628  1.00 0.00 ? 12 ASP A CB   3  
ATOM 2882  C CG   . ASP A 1 12 ? 9.146   -7.736  10.736  1.00 0.00 ? 12 ASP A CG   3  
ATOM 2883  O OD1  . ASP A 1 12 ? 8.180   -8.280  10.160  1.00 0.00 ? 12 ASP A OD1  3  
ATOM 2884  O OD2  . ASP A 1 12 ? 9.996   -8.370  11.396  1.00 0.00 ? 12 ASP A OD2  3  
ATOM 2885  H H    . ASP A 1 12 ? 11.495  -5.140  10.008  1.00 0.00 ? 12 ASP A H    3  
ATOM 2886  H HA   . ASP A 1 12 ? 9.618   -6.630  8.559   1.00 0.00 ? 12 ASP A HA   3  
ATOM 2887  H HB2  . ASP A 1 12 ? 10.077  -5.917  11.295  1.00 0.00 ? 12 ASP A HB2  3  
ATOM 2888  H HB3  . ASP A 1 12 ? 8.364   -5.773  10.930  1.00 0.00 ? 12 ASP A HB3  3  
ATOM 2889  N N    . ILE A 1 13 ? 8.974   -3.485  8.815   1.00 0.00 ? 13 ILE A N    3  
ATOM 2890  C CA   . ILE A 1 13 ? 8.092   -2.415  8.379   1.00 0.00 ? 13 ILE A CA   3  
ATOM 2891  C C    . ILE A 1 13 ? 7.981   -2.395  6.867   1.00 0.00 ? 13 ILE A C    3  
ATOM 2892  O O    . ILE A 1 13 ? 6.889   -2.495  6.307   1.00 0.00 ? 13 ILE A O    3  
ATOM 2893  C CB   . ILE A 1 13 ? 8.573   -1.047  8.870   1.00 0.00 ? 13 ILE A CB   3  
ATOM 2894  C CG1  . ILE A 1 13 ? 8.891   -1.097  10.366  1.00 0.00 ? 13 ILE A CG1  3  
ATOM 2895  C CG2  . ILE A 1 13 ? 7.531   0.021   8.576   1.00 0.00 ? 13 ILE A CG2  3  
ATOM 2896  C CD1  . ILE A 1 13 ? 7.718   -1.533  11.218  1.00 0.00 ? 13 ILE A CD1  3  
ATOM 2897  H H    . ILE A 1 13 ? 9.851   -3.261  9.181   1.00 0.00 ? 13 ILE A H    3  
ATOM 2898  H HA   . ILE A 1 13 ? 7.131   -2.594  8.789   1.00 0.00 ? 13 ILE A HA   3  
ATOM 2899  H HB   . ILE A 1 13 ? 9.461   -0.805  8.330   1.00 0.00 ? 13 ILE A HB   3  
ATOM 2900  H HG12 . ILE A 1 13 ? 9.698   -1.794  10.533  1.00 0.00 ? 13 ILE A HG12 3  
ATOM 2901  H HG13 . ILE A 1 13 ? 9.195   -0.115  10.696  1.00 0.00 ? 13 ILE A HG13 3  
ATOM 2902  H HG21 . ILE A 1 13 ? 7.434   0.145   7.507   1.00 0.00 ? 13 ILE A HG21 3  
ATOM 2903  H HG22 . ILE A 1 13 ? 7.840   0.957   9.020   1.00 0.00 ? 13 ILE A HG22 3  
ATOM 2904  H HG23 . ILE A 1 13 ? 6.581   -0.278  8.992   1.00 0.00 ? 13 ILE A HG23 3  
ATOM 2905  H HD11 . ILE A 1 13 ? 8.038   -1.634  12.245  1.00 0.00 ? 13 ILE A HD11 3  
ATOM 2906  H HD12 . ILE A 1 13 ? 7.347   -2.482  10.861  1.00 0.00 ? 13 ILE A HD12 3  
ATOM 2907  H HD13 . ILE A 1 13 ? 6.934   -0.793  11.157  1.00 0.00 ? 13 ILE A HD13 3  
ATOM 2908  N N    . GLU A 1 14 ? 9.123   -2.284  6.216   1.00 0.00 ? 14 GLU A N    3  
ATOM 2909  C CA   . GLU A 1 14 ? 9.172   -2.271  4.762   1.00 0.00 ? 14 GLU A CA   3  
ATOM 2910  C C    . GLU A 1 14 ? 8.652   -3.591  4.209   1.00 0.00 ? 14 GLU A C    3  
ATOM 2911  O O    . GLU A 1 14 ? 8.171   -3.659  3.078   1.00 0.00 ? 14 GLU A O    3  
ATOM 2912  C CB   . GLU A 1 14 ? 10.600  -2.019  4.275   1.00 0.00 ? 14 GLU A CB   3  
ATOM 2913  C CG   . GLU A 1 14 ? 10.670  -1.434  2.873   1.00 0.00 ? 14 GLU A CG   3  
ATOM 2914  C CD   . GLU A 1 14 ? 11.859  -1.950  2.086   1.00 0.00 ? 14 GLU A CD   3  
ATOM 2915  O OE1  . GLU A 1 14 ? 13.006  -1.653  2.481   1.00 0.00 ? 14 GLU A OE1  3  
ATOM 2916  O OE2  . GLU A 1 14 ? 11.643  -2.649  1.074   1.00 0.00 ? 14 GLU A OE2  3  
ATOM 2917  H H    . GLU A 1 14 ? 9.952   -2.222  6.727   1.00 0.00 ? 14 GLU A H    3  
ATOM 2918  H HA   . GLU A 1 14 ? 8.533   -1.476  4.418   1.00 0.00 ? 14 GLU A HA   3  
ATOM 2919  H HB2  . GLU A 1 14 ? 11.084  -1.331  4.953   1.00 0.00 ? 14 GLU A HB2  3  
ATOM 2920  H HB3  . GLU A 1 14 ? 11.140  -2.954  4.279   1.00 0.00 ? 14 GLU A HB3  3  
ATOM 2921  H HG2  . GLU A 1 14 ? 9.767   -1.695  2.343   1.00 0.00 ? 14 GLU A HG2  3  
ATOM 2922  H HG3  . GLU A 1 14 ? 10.745  -0.360  2.949   1.00 0.00 ? 14 GLU A HG3  3  
ATOM 2923  N N    . GLN A 1 15 ? 8.743   -4.636  5.025   1.00 0.00 ? 15 GLN A N    3  
ATOM 2924  C CA   . GLN A 1 15 ? 8.275   -5.951  4.634   1.00 0.00 ? 15 GLN A CA   3  
ATOM 2925  C C    . GLN A 1 15 ? 6.762   -6.011  4.682   1.00 0.00 ? 15 GLN A C    3  
ATOM 2926  O O    . GLN A 1 15 ? 6.115   -6.544  3.781   1.00 0.00 ? 15 GLN A O    3  
ATOM 2927  C CB   . GLN A 1 15 ? 8.877   -7.010  5.533   1.00 0.00 ? 15 GLN A CB   3  
ATOM 2928  C CG   . GLN A 1 15 ? 10.104  -7.657  4.931   1.00 0.00 ? 15 GLN A CG   3  
ATOM 2929  C CD   . GLN A 1 15 ? 9.762   -8.730  3.915   1.00 0.00 ? 15 GLN A CD   3  
ATOM 2930  O OE1  . GLN A 1 15 ? 9.467   -8.434  2.758   1.00 0.00 ? 15 GLN A OE1  3  
ATOM 2931  N NE2  . GLN A 1 15 ? 9.800   -9.986  4.346   1.00 0.00 ? 15 GLN A NE2  3  
ATOM 2932  H H    . GLN A 1 15 ? 9.128   -4.516  5.914   1.00 0.00 ? 15 GLN A H    3  
ATOM 2933  H HA   . GLN A 1 15 ? 8.601   -6.129  3.638   1.00 0.00 ? 15 GLN A HA   3  
ATOM 2934  H HB2  . GLN A 1 15 ? 9.157   -6.549  6.462   1.00 0.00 ? 15 GLN A HB2  3  
ATOM 2935  H HB3  . GLN A 1 15 ? 8.142   -7.777  5.722   1.00 0.00 ? 15 GLN A HB3  3  
ATOM 2936  H HG2  . GLN A 1 15 ? 10.693  -6.894  4.444   1.00 0.00 ? 15 GLN A HG2  3  
ATOM 2937  H HG3  . GLN A 1 15 ? 10.677  -8.098  5.720   1.00 0.00 ? 15 GLN A HG3  3  
ATOM 2938  H HE21 . GLN A 1 15 ? 10.043  -10.147 5.281   1.00 0.00 ? 15 GLN A HE21 3  
ATOM 2939  H HE22 . GLN A 1 15 ? 9.583   -10.700 3.710   1.00 0.00 ? 15 GLN A HE22 3  
ATOM 2940  N N    . SER A 1 16 ? 6.207   -5.438  5.736   1.00 0.00 ? 16 SER A N    3  
ATOM 2941  C CA   . SER A 1 16 ? 4.765   -5.398  5.909   1.00 0.00 ? 16 SER A CA   3  
ATOM 2942  C C    . SER A 1 16 ? 4.130   -4.591  4.785   1.00 0.00 ? 16 SER A C    3  
ATOM 2943  O O    . SER A 1 16 ? 2.971   -4.802  4.429   1.00 0.00 ? 16 SER A O    3  
ATOM 2944  C CB   . SER A 1 16 ? 4.404   -4.790  7.265   1.00 0.00 ? 16 SER A CB   3  
ATOM 2945  O OG   . SER A 1 16 ? 3.019   -4.927  7.533   1.00 0.00 ? 16 SER A OG   3  
ATOM 2946  H H    . SER A 1 16 ? 6.785   -5.021  6.406   1.00 0.00 ? 16 SER A H    3  
ATOM 2947  H HA   . SER A 1 16 ? 4.398   -6.408  5.863   1.00 0.00 ? 16 SER A HA   3  
ATOM 2948  H HB2  . SER A 1 16 ? 4.959   -5.293  8.042   1.00 0.00 ? 16 SER A HB2  3  
ATOM 2949  H HB3  . SER A 1 16 ? 4.655   -3.739  7.265   1.00 0.00 ? 16 SER A HB3  3  
ATOM 2950  H HG   . SER A 1 16 ? 2.740   -5.823  7.328   1.00 0.00 ? 16 SER A HG   3  
ATOM 2951  N N    . PHE A 1 17 ? 4.908   -3.671  4.224   1.00 0.00 ? 17 PHE A N    3  
ATOM 2952  C CA   . PHE A 1 17 ? 4.435   -2.833  3.133   1.00 0.00 ? 17 PHE A CA   3  
ATOM 2953  C C    . PHE A 1 17 ? 4.117   -3.677  1.912   1.00 0.00 ? 17 PHE A C    3  
ATOM 2954  O O    . PHE A 1 17 ? 3.123   -3.445  1.224   1.00 0.00 ? 17 PHE A O    3  
ATOM 2955  C CB   . PHE A 1 17 ? 5.477   -1.771  2.789   1.00 0.00 ? 17 PHE A CB   3  
ATOM 2956  C CG   . PHE A 1 17 ? 5.077   -0.381  3.194   1.00 0.00 ? 17 PHE A CG   3  
ATOM 2957  C CD1  . PHE A 1 17 ? 4.538   -0.139  4.447   1.00 0.00 ? 17 PHE A CD1  3  
ATOM 2958  C CD2  . PHE A 1 17 ? 5.242   0.683   2.322   1.00 0.00 ? 17 PHE A CD2  3  
ATOM 2959  C CE1  . PHE A 1 17 ? 4.171   1.139   4.823   1.00 0.00 ? 17 PHE A CE1  3  
ATOM 2960  C CE2  . PHE A 1 17 ? 4.877   1.963   2.693   1.00 0.00 ? 17 PHE A CE2  3  
ATOM 2961  C CZ   . PHE A 1 17 ? 4.341   2.192   3.945   1.00 0.00 ? 17 PHE A CZ   3  
ATOM 2962  H H    . PHE A 1 17 ? 5.824   -3.558  4.550   1.00 0.00 ? 17 PHE A H    3  
ATOM 2963  H HA   . PHE A 1 17 ? 3.539   -2.352  3.458   1.00 0.00 ? 17 PHE A HA   3  
ATOM 2964  H HB2  . PHE A 1 17 ? 6.393   -2.010  3.298   1.00 0.00 ? 17 PHE A HB2  3  
ATOM 2965  H HB3  . PHE A 1 17 ? 5.650   -1.773  1.723   1.00 0.00 ? 17 PHE A HB3  3  
ATOM 2966  H HD1  . PHE A 1 17 ? 4.404   -0.961  5.134   1.00 0.00 ? 17 PHE A HD1  3  
ATOM 2967  H HD2  . PHE A 1 17 ? 5.661   0.505   1.343   1.00 0.00 ? 17 PHE A HD2  3  
ATOM 2968  H HE1  . PHE A 1 17 ? 3.752   1.315   5.803   1.00 0.00 ? 17 PHE A HE1  3  
ATOM 2969  H HE2  . PHE A 1 17 ? 5.012   2.784   2.005   1.00 0.00 ? 17 PHE A HE2  3  
ATOM 2970  H HZ   . PHE A 1 17 ? 4.055   3.191   4.238   1.00 0.00 ? 17 PHE A HZ   3  
ATOM 2971  N N    . GLN A 1 18 ? 4.959   -4.666  1.657   1.00 0.00 ? 18 GLN A N    3  
ATOM 2972  C CA   . GLN A 1 18 ? 4.753   -5.555  0.525   1.00 0.00 ? 18 GLN A CA   3  
ATOM 2973  C C    . GLN A 1 18 ? 3.491   -6.379  0.727   1.00 0.00 ? 18 GLN A C    3  
ATOM 2974  O O    . GLN A 1 18 ? 2.848   -6.798  -0.234  1.00 0.00 ? 18 GLN A O    3  
ATOM 2975  C CB   . GLN A 1 18 ? 5.955   -6.482  0.329   1.00 0.00 ? 18 GLN A CB   3  
ATOM 2976  C CG   . GLN A 1 18 ? 5.689   -7.615  -0.653  1.00 0.00 ? 18 GLN A CG   3  
ATOM 2977  C CD   . GLN A 1 18 ? 6.963   -8.269  -1.151  1.00 0.00 ? 18 GLN A CD   3  
ATOM 2978  O OE1  . GLN A 1 18 ? 7.464   -9.218  -0.549  1.00 0.00 ? 18 GLN A OE1  3  
ATOM 2979  N NE2  . GLN A 1 18 ? 7.494   -7.762  -2.258  1.00 0.00 ? 18 GLN A NE2  3  
ATOM 2980  H H    . GLN A 1 18 ? 5.726   -4.805  2.250   1.00 0.00 ? 18 GLN A H    3  
ATOM 2981  H HA   . GLN A 1 18 ? 4.632   -4.944  -0.352  1.00 0.00 ? 18 GLN A HA   3  
ATOM 2982  H HB2  . GLN A 1 18 ? 6.788   -5.902  -0.040  1.00 0.00 ? 18 GLN A HB2  3  
ATOM 2983  H HB3  . GLN A 1 18 ? 6.222   -6.915  1.282   1.00 0.00 ? 18 GLN A HB3  3  
ATOM 2984  H HG2  . GLN A 1 18 ? 5.085   -8.365  -0.162  1.00 0.00 ? 18 GLN A HG2  3  
ATOM 2985  H HG3  . GLN A 1 18 ? 5.147   -7.220  -1.500  1.00 0.00 ? 18 GLN A HG3  3  
ATOM 2986  H HE21 . GLN A 1 18 ? 7.040   -7.005  -2.684  1.00 0.00 ? 18 GLN A HE21 3  
ATOM 2987  H HE22 . GLN A 1 18 ? 8.318   -8.165  -2.603  1.00 0.00 ? 18 GLN A HE22 3  
ATOM 2988  N N    . GLU A 1 19 ? 3.144   -6.607  1.985   1.00 0.00 ? 19 GLU A N    3  
ATOM 2989  C CA   . GLU A 1 19 ? 1.960   -7.379  2.318   1.00 0.00 ? 19 GLU A CA   3  
ATOM 2990  C C    . GLU A 1 19 ? 0.706   -6.653  1.866   1.00 0.00 ? 19 GLU A C    3  
ATOM 2991  O O    . GLU A 1 19 ? -0.249  -7.271  1.400   1.00 0.00 ? 19 GLU A O    3  
ATOM 2992  C CB   . GLU A 1 19 ? 1.905   -7.655  3.818   1.00 0.00 ? 19 GLU A CB   3  
ATOM 2993  C CG   . GLU A 1 19 ? 1.903   -9.135  4.165   1.00 0.00 ? 19 GLU A CG   3  
ATOM 2994  C CD   . GLU A 1 19 ? 3.283   -9.756  4.076   1.00 0.00 ? 19 GLU A CD   3  
ATOM 2995  O OE1  . GLU A 1 19 ? 3.900   -9.678  2.993   1.00 0.00 ? 19 GLU A OE1  3  
ATOM 2996  O OE2  . GLU A 1 19 ? 3.746   -10.320 5.090   1.00 0.00 ? 19 GLU A OE2  3  
ATOM 2997  H H    . GLU A 1 19 ? 3.699   -6.246  2.705   1.00 0.00 ? 19 GLU A H    3  
ATOM 2998  H HA   . GLU A 1 19 ? 2.020   -8.308  1.794   1.00 0.00 ? 19 GLU A HA   3  
ATOM 2999  H HB2  . GLU A 1 19 ? 2.763   -7.199  4.286   1.00 0.00 ? 19 GLU A HB2  3  
ATOM 3000  H HB3  . GLU A 1 19 ? 1.008   -7.213  4.220   1.00 0.00 ? 19 GLU A HB3  3  
ATOM 3001  H HG2  . GLU A 1 19 ? 1.535   -9.255  5.173   1.00 0.00 ? 19 GLU A HG2  3  
ATOM 3002  H HG3  . GLU A 1 19 ? 1.247   -9.651  3.480   1.00 0.00 ? 19 GLU A HG3  3  
ATOM 3003  N N    . ALA A 1 20 ? 0.721   -5.337  1.997   1.00 0.00 ? 20 ALA A N    3  
ATOM 3004  C CA   . ALA A 1 20 ? -0.412  -4.525  1.592   1.00 0.00 ? 20 ALA A CA   3  
ATOM 3005  C C    . ALA A 1 20 ? -0.430  -4.346  0.084   1.00 0.00 ? 20 ALA A C    3  
ATOM 3006  O O    . ALA A 1 20 ? -1.491  -4.230  -0.530  1.00 0.00 ? 20 ALA A O    3  
ATOM 3007  C CB   . ALA A 1 20 ? -0.385  -3.177  2.296   1.00 0.00 ? 20 ALA A CB   3  
ATOM 3008  H H    . ALA A 1 20 ? 1.513   -4.905  2.368   1.00 0.00 ? 20 ALA A H    3  
ATOM 3009  H HA   . ALA A 1 20 ? -1.303  -5.045  1.886   1.00 0.00 ? 20 ALA A HA   3  
ATOM 3010  H HB1  . ALA A 1 20 ? -0.779  -2.418  1.636   1.00 0.00 ? 20 ALA A HB1  3  
ATOM 3011  H HB2  . ALA A 1 20 ? 0.632   -2.930  2.562   1.00 0.00 ? 20 ALA A HB2  3  
ATOM 3012  H HB3  . ALA A 1 20 ? -0.990  -3.225  3.190   1.00 0.00 ? 20 ALA A HB3  3  
ATOM 3013  N N    . LEU A 1 21 ? 0.755   -4.338  -0.508  1.00 0.00 ? 21 LEU A N    3  
ATOM 3014  C CA   . LEU A 1 21 ? 0.886   -4.189  -1.946  1.00 0.00 ? 21 LEU A CA   3  
ATOM 3015  C C    . LEU A 1 21 ? 0.651   -5.523  -2.640  1.00 0.00 ? 21 LEU A C    3  
ATOM 3016  O O    . LEU A 1 21 ? 0.167   -5.573  -3.771  1.00 0.00 ? 21 LEU A O    3  
ATOM 3017  C CB   . LEU A 1 21 ? 2.262   -3.633  -2.304  1.00 0.00 ? 21 LEU A CB   3  
ATOM 3018  C CG   . LEU A 1 21 ? 2.249   -2.248  -2.952  1.00 0.00 ? 21 LEU A CG   3  
ATOM 3019  C CD1  . LEU A 1 21 ? 1.402   -2.259  -4.215  1.00 0.00 ? 21 LEU A CD1  3  
ATOM 3020  C CD2  . LEU A 1 21 ? 1.733   -1.208  -1.968  1.00 0.00 ? 21 LEU A CD2  3  
ATOM 3021  H H    . LEU A 1 21 ? 1.556   -4.443  0.034   1.00 0.00 ? 21 LEU A H    3  
ATOM 3022  H HA   . LEU A 1 21 ? 0.137   -3.497  -2.266  1.00 0.00 ? 21 LEU A HA   3  
ATOM 3023  H HB2  . LEU A 1 21 ? 2.847   -3.579  -1.400  1.00 0.00 ? 21 LEU A HB2  3  
ATOM 3024  H HB3  . LEU A 1 21 ? 2.741   -4.320  -2.984  1.00 0.00 ? 21 LEU A HB3  3  
ATOM 3025  H HG   . LEU A 1 21 ? 3.257   -1.978  -3.229  1.00 0.00 ? 21 LEU A HG   3  
ATOM 3026  H HD11 . LEU A 1 21 ? 2.044   -2.354  -5.078  1.00 0.00 ? 21 LEU A HD11 3  
ATOM 3027  H HD12 . LEU A 1 21 ? 0.843   -1.338  -4.283  1.00 0.00 ? 21 LEU A HD12 3  
ATOM 3028  H HD13 . LEU A 1 21 ? 0.717   -3.094  -4.183  1.00 0.00 ? 21 LEU A HD13 3  
ATOM 3029  H HD21 . LEU A 1 21 ? 0.653   -1.228  -1.955  1.00 0.00 ? 21 LEU A HD21 3  
ATOM 3030  H HD22 . LEU A 1 21 ? 2.071   -0.228  -2.270  1.00 0.00 ? 21 LEU A HD22 3  
ATOM 3031  H HD23 . LEU A 1 21 ? 2.109   -1.429  -0.980  1.00 0.00 ? 21 LEU A HD23 3  
ATOM 3032  N N    . SER A 1 22 ? 0.986   -6.602  -1.945  1.00 0.00 ? 22 SER A N    3  
ATOM 3033  C CA   . SER A 1 22 ? 0.803   -7.940  -2.478  1.00 0.00 ? 22 SER A CA   3  
ATOM 3034  C C    . SER A 1 22 ? -0.657  -8.350  -2.368  1.00 0.00 ? 22 SER A C    3  
ATOM 3035  O O    . SER A 1 22 ? -1.181  -9.073  -3.215  1.00 0.00 ? 22 SER A O    3  
ATOM 3036  C CB   . SER A 1 22 ? 1.691   -8.941  -1.735  1.00 0.00 ? 22 SER A CB   3  
ATOM 3037  O OG   . SER A 1 22 ? 1.729   -10.187 -2.409  1.00 0.00 ? 22 SER A OG   3  
ATOM 3038  H H    . SER A 1 22 ? 1.357   -6.495  -1.048  1.00 0.00 ? 22 SER A H    3  
ATOM 3039  H HA   . SER A 1 22 ? 1.081   -7.919  -3.512  1.00 0.00 ? 22 SER A HA   3  
ATOM 3040  H HB2  . SER A 1 22 ? 2.695   -8.550  -1.672  1.00 0.00 ? 22 SER A HB2  3  
ATOM 3041  H HB3  . SER A 1 22 ? 1.301   -9.095  -0.740  1.00 0.00 ? 22 SER A HB3  3  
ATOM 3042  H HG   . SER A 1 22 ? 2.146   -10.075 -3.266  1.00 0.00 ? 22 SER A HG   3  
ATOM 3043  N N    . ILE A 1 23 ? -1.306  -7.871  -1.316  1.00 0.00 ? 23 ILE A N    3  
ATOM 3044  C CA   . ILE A 1 23 ? -2.709  -8.169  -1.081  1.00 0.00 ? 23 ILE A CA   3  
ATOM 3045  C C    . ILE A 1 23 ? -3.600  -7.203  -1.851  1.00 0.00 ? 23 ILE A C    3  
ATOM 3046  O O    . ILE A 1 23 ? -4.657  -7.576  -2.359  1.00 0.00 ? 23 ILE A O    3  
ATOM 3047  C CB   . ILE A 1 23 ? -3.047  -8.117  0.428   1.00 0.00 ? 23 ILE A CB   3  
ATOM 3048  C CG1  . ILE A 1 23 ? -3.946  -9.293  0.812   1.00 0.00 ? 23 ILE A CG1  3  
ATOM 3049  C CG2  . ILE A 1 23 ? -3.701  -6.795  0.812   1.00 0.00 ? 23 ILE A CG2  3  
ATOM 3050  C CD1  . ILE A 1 23 ? -3.184  -10.571 1.091   1.00 0.00 ? 23 ILE A CD1  3  
ATOM 3051  H H    . ILE A 1 23 ? -0.826  -7.299  -0.685  1.00 0.00 ? 23 ILE A H    3  
ATOM 3052  H HA   . ILE A 1 23 ? -2.890  -9.163  -1.435  1.00 0.00 ? 23 ILE A HA   3  
ATOM 3053  H HB   . ILE A 1 23 ? -2.123  -8.192  0.971   1.00 0.00 ? 23 ILE A HB   3  
ATOM 3054  H HG12 . ILE A 1 23 ? -4.501  -9.038  1.703   1.00 0.00 ? 23 ILE A HG12 3  
ATOM 3055  H HG13 . ILE A 1 23 ? -4.638  -9.488  0.006   1.00 0.00 ? 23 ILE A HG13 3  
ATOM 3056  H HG21 . ILE A 1 23 ? -4.703  -6.761  0.412   1.00 0.00 ? 23 ILE A HG21 3  
ATOM 3057  H HG22 . ILE A 1 23 ? -3.123  -5.978  0.408   1.00 0.00 ? 23 ILE A HG22 3  
ATOM 3058  H HG23 . ILE A 1 23 ? -3.739  -6.712  1.888   1.00 0.00 ? 23 ILE A HG23 3  
ATOM 3059  H HD11 . ILE A 1 23 ? -2.886  -11.023 0.156   1.00 0.00 ? 23 ILE A HD11 3  
ATOM 3060  H HD12 . ILE A 1 23 ? -3.817  -11.255 1.636   1.00 0.00 ? 23 ILE A HD12 3  
ATOM 3061  H HD13 . ILE A 1 23 ? -2.306  -10.345 1.678   1.00 0.00 ? 23 ILE A HD13 3  
ATOM 3062  N N    . TYR A 1 24 ? -3.150  -5.961  -1.926  1.00 0.00 ? 24 TYR A N    3  
ATOM 3063  C CA   . TYR A 1 24 ? -3.876  -4.915  -2.628  1.00 0.00 ? 24 TYR A CA   3  
ATOM 3064  C C    . TYR A 1 24 ? -3.078  -4.393  -3.821  1.00 0.00 ? 24 TYR A C    3  
ATOM 3065  O O    . TYR A 1 24 ? -2.379  -3.385  -3.716  1.00 0.00 ? 24 TYR A O    3  
ATOM 3066  C CB   . TYR A 1 24 ? -4.205  -3.764  -1.689  1.00 0.00 ? 24 TYR A CB   3  
ATOM 3067  C CG   . TYR A 1 24 ? -4.888  -4.187  -0.410  1.00 0.00 ? 24 TYR A CG   3  
ATOM 3068  C CD1  . TYR A 1 24 ? -6.079  -4.901  -0.438  1.00 0.00 ? 24 TYR A CD1  3  
ATOM 3069  C CD2  . TYR A 1 24 ? -4.341  -3.871  0.826   1.00 0.00 ? 24 TYR A CD2  3  
ATOM 3070  C CE1  . TYR A 1 24 ? -6.706  -5.289  0.731   1.00 0.00 ? 24 TYR A CE1  3  
ATOM 3071  C CE2  . TYR A 1 24 ? -4.961  -4.255  2.000   1.00 0.00 ? 24 TYR A CE2  3  
ATOM 3072  C CZ   . TYR A 1 24 ? -6.143  -4.964  1.947   1.00 0.00 ? 24 TYR A CZ   3  
ATOM 3073  O OH   . TYR A 1 24 ? -6.763  -5.350  3.114   1.00 0.00 ? 24 TYR A OH   3  
ATOM 3074  H H    . TYR A 1 24 ? -2.306  -5.746  -1.497  1.00 0.00 ? 24 TYR A H    3  
ATOM 3075  H HA   . TYR A 1 24 ? -4.785  -5.336  -2.978  1.00 0.00 ? 24 TYR A HA   3  
ATOM 3076  H HB2  . TYR A 1 24 ? -3.295  -3.272  -1.428  1.00 0.00 ? 24 TYR A HB2  3  
ATOM 3077  H HB3  . TYR A 1 24 ? -4.853  -3.066  -2.198  1.00 0.00 ? 24 TYR A HB3  3  
ATOM 3078  H HD1  . TYR A 1 24 ? -6.517  -5.155  -1.393  1.00 0.00 ? 24 TYR A HD1  3  
ATOM 3079  H HD2  . TYR A 1 24 ? -3.416  -3.315  0.863   1.00 0.00 ? 24 TYR A HD2  3  
ATOM 3080  H HE1  . TYR A 1 24 ? -7.631  -5.844  0.689   1.00 0.00 ? 24 TYR A HE1  3  
ATOM 3081  H HE2  . TYR A 1 24 ? -4.519  -3.999  2.952   1.00 0.00 ? 24 TYR A HE2  3  
ATOM 3082  H HH   . TYR A 1 24 ? -6.609  -4.689  3.794   1.00 0.00 ? 24 TYR A HH   3  
ATOM 3083  N N    . PRO A 1 25 ? -3.174  -5.072  -4.978  1.00 0.00 ? 25 PRO A N    3  
ATOM 3084  C CA   . PRO A 1 25 ? -2.468  -4.677  -6.187  1.00 0.00 ? 25 PRO A CA   3  
ATOM 3085  C C    . PRO A 1 25 ? -3.236  -3.626  -6.986  1.00 0.00 ? 25 PRO A C    3  
ATOM 3086  O O    . PRO A 1 25 ? -4.372  -3.289  -6.651  1.00 0.00 ? 25 PRO A O    3  
ATOM 3087  C CB   . PRO A 1 25 ? -2.354  -5.983  -6.984  1.00 0.00 ? 25 PRO A CB   3  
ATOM 3088  C CG   . PRO A 1 25 ? -3.236  -6.986  -6.301  1.00 0.00 ? 25 PRO A CG   3  
ATOM 3089  C CD   . PRO A 1 25 ? -3.976  -6.273  -5.202  1.00 0.00 ? 25 PRO A CD   3  
ATOM 3090  H HA   . PRO A 1 25 ? -1.480  -4.304  -5.963  1.00 0.00 ? 25 PRO A HA   3  
ATOM 3091  H HB2  . PRO A 1 25 ? -2.674  -5.812  -8.001  1.00 0.00 ? 25 PRO A HB2  3  
ATOM 3092  H HB3  . PRO A 1 25 ? -1.327  -6.309  -6.982  1.00 0.00 ? 25 PRO A HB3  3  
ATOM 3093  H HG2  . PRO A 1 25 ? -3.938  -7.395  -7.012  1.00 0.00 ? 25 PRO A HG2  3  
ATOM 3094  H HG3  . PRO A 1 25 ? -2.628  -7.777  -5.886  1.00 0.00 ? 25 PRO A HG3  3  
ATOM 3095  H HD2  . PRO A 1 25 ? -4.973  -6.016  -5.524  1.00 0.00 ? 25 PRO A HD2  3  
ATOM 3096  H HD3  . PRO A 1 25 ? -4.009  -6.884  -4.315  1.00 0.00 ? 25 PRO A HD3  3  
ATOM 3097  N N    . PRO A 1 26 ? -2.625  -3.093  -8.057  1.00 0.00 ? 26 PRO A N    3  
ATOM 3098  C CA   . PRO A 1 26 ? -3.257  -2.075  -8.902  1.00 0.00 ? 26 PRO A CA   3  
ATOM 3099  C C    . PRO A 1 26 ? -4.429  -2.627  -9.704  1.00 0.00 ? 26 PRO A C    3  
ATOM 3100  O O    . PRO A 1 26 ? -5.328  -1.886  -10.102 1.00 0.00 ? 26 PRO A O    3  
ATOM 3101  C CB   . PRO A 1 26 ? -2.131  -1.631  -9.834  1.00 0.00 ? 26 PRO A CB   3  
ATOM 3102  C CG   . PRO A 1 26 ? -1.210  -2.797  -9.887  1.00 0.00 ? 26 PRO A CG   3  
ATOM 3103  C CD   . PRO A 1 26 ? -1.271  -3.435  -8.528  1.00 0.00 ? 26 PRO A CD   3  
ATOM 3104  H HA   . PRO A 1 26 ? -3.590  -1.240  -8.321  1.00 0.00 ? 26 PRO A HA   3  
ATOM 3105  H HB2  . PRO A 1 26 ? -2.535  -1.400  -10.809 1.00 0.00 ? 26 PRO A HB2  3  
ATOM 3106  H HB3  . PRO A 1 26 ? -1.641  -0.761  -9.425  1.00 0.00 ? 26 PRO A HB3  3  
ATOM 3107  H HG2  . PRO A 1 26 ? -1.546  -3.490  -10.641 1.00 0.00 ? 26 PRO A HG2  3  
ATOM 3108  H HG3  . PRO A 1 26 ? -0.208  -2.462  -10.100 1.00 0.00 ? 26 PRO A HG3  3  
ATOM 3109  H HD2  . PRO A 1 26 ? -1.148  -4.505  -8.607  1.00 0.00 ? 26 PRO A HD2  3  
ATOM 3110  H HD3  . PRO A 1 26 ? -0.519  -3.013  -7.878  1.00 0.00 ? 26 PRO A HD3  3  
ATOM 3111  N N    . CYS A 1 27 ? -4.408  -3.930  -9.939  1.00 0.00 ? 27 CYS A N    3  
ATOM 3112  C CA   . CYS A 1 27 ? -5.454  -4.594  -10.689 1.00 0.00 ? 27 CYS A CA   3  
ATOM 3113  C C    . CYS A 1 27 ? -6.759  -4.624  -9.900  1.00 0.00 ? 27 CYS A C    3  
ATOM 3114  O O    . CYS A 1 27 ? -6.782  -4.320  -8.707  1.00 0.00 ? 27 CYS A O    3  
ATOM 3115  C CB   . CYS A 1 27 ? -5.013  -6.014  -11.028 1.00 0.00 ? 27 CYS A CB   3  
ATOM 3116  S SG   . CYS A 1 27 ? -4.470  -6.984  -9.602  1.00 0.00 ? 27 CYS A SG   3  
ATOM 3117  H H    . CYS A 1 27 ? -3.667  -4.463  -9.600  1.00 0.00 ? 27 CYS A H    3  
ATOM 3118  H HA   . CYS A 1 27 ? -5.608  -4.044  -11.604 1.00 0.00 ? 27 CYS A HA   3  
ATOM 3119  H HB2  . CYS A 1 27 ? -5.835  -6.532  -11.477 1.00 0.00 ? 27 CYS A HB2  3  
ATOM 3120  H HB3  . CYS A 1 27 ? -4.193  -5.972  -11.730 1.00 0.00 ? 27 CYS A HB3  3  
ATOM 3121  H HG   . CYS A 1 27 ? -3.526  -7.136  -9.690  1.00 0.00 ? 27 CYS A HG   3  
ATOM 3122  N N    . GLY A 1 28 ? -7.844  -4.994  -10.573 1.00 0.00 ? 28 GLY A N    3  
ATOM 3123  C CA   . GLY A 1 28 ? -9.137  -5.059  -9.917  1.00 0.00 ? 28 GLY A CA   3  
ATOM 3124  C C    . GLY A 1 28 ? -9.559  -3.726  -9.330  1.00 0.00 ? 28 GLY A C    3  
ATOM 3125  O O    . GLY A 1 28 ? -9.804  -3.620  -8.128  1.00 0.00 ? 28 GLY A O    3  
ATOM 3126  H H    . GLY A 1 28 ? -7.765  -5.226  -11.522 1.00 0.00 ? 28 GLY A H    3  
ATOM 3127  H HA2  . GLY A 1 28 ? -9.878  -5.373  -10.637 1.00 0.00 ? 28 GLY A HA2  3  
ATOM 3128  H HA3  . GLY A 1 28 ? -9.089  -5.790  -9.123  1.00 0.00 ? 28 GLY A HA3  3  
ATOM 3129  N N    . ARG A 1 29 ? -9.645  -2.707  -10.179 1.00 0.00 ? 29 ARG A N    3  
ATOM 3130  C CA   . ARG A 1 29 ? -10.041 -1.375  -9.737  1.00 0.00 ? 29 ARG A CA   3  
ATOM 3131  C C    . ARG A 1 29 ? -11.425 -1.404  -9.095  1.00 0.00 ? 29 ARG A C    3  
ATOM 3132  O O    . ARG A 1 29 ? -12.441 -1.290  -9.780  1.00 0.00 ? 29 ARG A O    3  
ATOM 3133  C CB   . ARG A 1 29 ? -10.034 -0.400  -10.915 1.00 0.00 ? 29 ARG A CB   3  
ATOM 3134  C CG   . ARG A 1 29 ? -9.761  1.040   -10.512 1.00 0.00 ? 29 ARG A CG   3  
ATOM 3135  C CD   . ARG A 1 29 ? -9.507  1.920   -11.725 1.00 0.00 ? 29 ARG A CD   3  
ATOM 3136  N NE   . ARG A 1 29 ? -8.566  2.999   -11.431 1.00 0.00 ? 29 ARG A NE   3  
ATOM 3137  C CZ   . ARG A 1 29 ? -7.267  2.810   -11.213 1.00 0.00 ? 29 ARG A CZ   3  
ATOM 3138  N NH1  . ARG A 1 29 ? -6.750  1.588   -11.255 1.00 0.00 ? 29 ARG A NH1  3  
ATOM 3139  N NH2  . ARG A 1 29 ? -6.481  3.846   -10.953 1.00 0.00 ? 29 ARG A NH2  3  
ATOM 3140  H H    . ARG A 1 29 ? -9.438  -2.854  -11.126 1.00 0.00 ? 29 ARG A H    3  
ATOM 3141  H HA   . ARG A 1 29 ? -9.323  -1.043  -9.001  1.00 0.00 ? 29 ARG A HA   3  
ATOM 3142  H HB2  . ARG A 1 29 ? -9.270  -0.705  -11.615 1.00 0.00 ? 29 ARG A HB2  3  
ATOM 3143  H HB3  . ARG A 1 29 ? -10.995 -0.438  -11.405 1.00 0.00 ? 29 ARG A HB3  3  
ATOM 3144  H HG2  . ARG A 1 29 ? -10.618 1.422   -9.976  1.00 0.00 ? 29 ARG A HG2  3  
ATOM 3145  H HG3  . ARG A 1 29 ? -8.893  1.066   -9.870  1.00 0.00 ? 29 ARG A HG3  3  
ATOM 3146  H HD2  . ARG A 1 29 ? -9.103  1.309   -12.518 1.00 0.00 ? 29 ARG A HD2  3  
ATOM 3147  H HD3  . ARG A 1 29 ? -10.445 2.350   -12.045 1.00 0.00 ? 29 ARG A HD3  3  
ATOM 3148  H HE   . ARG A 1 29 ? -8.921  3.911   -11.394 1.00 0.00 ? 29 ARG A HE   3  
ATOM 3149  H HH11 . ARG A 1 29 ? -7.337  0.802   -11.450 1.00 0.00 ? 29 ARG A HH11 3  
ATOM 3150  H HH12 . ARG A 1 29 ? -5.773  1.453   -11.090 1.00 0.00 ? 29 ARG A HH12 3  
ATOM 3151  H HH21 . ARG A 1 29 ? -6.865  4.769   -10.921 1.00 0.00 ? 29 ARG A HH21 3  
ATOM 3152  H HH22 . ARG A 1 29 ? -5.505  3.704   -10.789 1.00 0.00 ? 29 ARG A HH22 3  
ATOM 3153  N N    . ARG A 1 30 ? -11.455 -1.560  -7.775  1.00 0.00 ? 30 ARG A N    3  
ATOM 3154  C CA   . ARG A 1 30 ? -12.713 -1.607  -7.039  1.00 0.00 ? 30 ARG A CA   3  
ATOM 3155  C C    . ARG A 1 30 ? -13.505 -0.317  -7.229  1.00 0.00 ? 30 ARG A C    3  
ATOM 3156  O O    . ARG A 1 30 ? -12.935 0.739   -7.501  1.00 0.00 ? 30 ARG A O    3  
ATOM 3157  C CB   . ARG A 1 30 ? -12.447 -1.841  -5.550  1.00 0.00 ? 30 ARG A CB   3  
ATOM 3158  C CG   . ARG A 1 30 ? -13.482 -2.730  -4.880  1.00 0.00 ? 30 ARG A CG   3  
ATOM 3159  C CD   . ARG A 1 30 ? -13.035 -4.182  -4.852  1.00 0.00 ? 30 ARG A CD   3  
ATOM 3160  N NE   . ARG A 1 30 ? -13.408 -4.846  -3.606  1.00 0.00 ? 30 ARG A NE   3  
ATOM 3161  C CZ   . ARG A 1 30 ? -12.806 -4.626  -2.439  1.00 0.00 ? 30 ARG A CZ   3  
ATOM 3162  N NH1  . ARG A 1 30 ? -11.802 -3.762  -2.355  1.00 0.00 ? 30 ARG A NH1  3  
ATOM 3163  N NH2  . ARG A 1 30 ? -13.208 -5.273  -1.354  1.00 0.00 ? 30 ARG A NH2  3  
ATOM 3164  H H    . ARG A 1 30 ? -10.611 -1.647  -7.285  1.00 0.00 ? 30 ARG A H    3  
ATOM 3165  H HA   . ARG A 1 30 ? -13.292 -2.431  -7.425  1.00 0.00 ? 30 ARG A HA   3  
ATOM 3166  H HB2  . ARG A 1 30 ? -11.479 -2.305  -5.438  1.00 0.00 ? 30 ARG A HB2  3  
ATOM 3167  H HB3  . ARG A 1 30 ? -12.441 -0.887  -5.043  1.00 0.00 ? 30 ARG A HB3  3  
ATOM 3168  H HG2  . ARG A 1 30 ? -13.632 -2.390  -3.866  1.00 0.00 ? 30 ARG A HG2  3  
ATOM 3169  H HG3  . ARG A 1 30 ? -14.411 -2.659  -5.427  1.00 0.00 ? 30 ARG A HG3  3  
ATOM 3170  H HD2  . ARG A 1 30 ? -13.495 -4.703  -5.678  1.00 0.00 ? 30 ARG A HD2  3  
ATOM 3171  H HD3  . ARG A 1 30 ? -11.960 -4.217  -4.960  1.00 0.00 ? 30 ARG A HD3  3  
ATOM 3172  H HE   . ARG A 1 30 ? -14.146 -5.490  -3.639  1.00 0.00 ? 30 ARG A HE   3  
ATOM 3173  H HH11 . ARG A 1 30 ? -11.494 -3.271  -3.170  1.00 0.00 ? 30 ARG A HH11 3  
ATOM 3174  H HH12 . ARG A 1 30 ? -11.354 -3.601  -1.476  1.00 0.00 ? 30 ARG A HH12 3  
ATOM 3175  H HH21 . ARG A 1 30 ? -13.964 -5.925  -1.411  1.00 0.00 ? 30 ARG A HH21 3  
ATOM 3176  H HH22 . ARG A 1 30 ? -12.756 -5.108  -0.477  1.00 0.00 ? 30 ARG A HH22 3  
ATOM 3177  N N    . LYS A 1 31 ? -14.823 -0.413  -7.082  1.00 0.00 ? 31 LYS A N    3  
ATOM 3178  C CA   . LYS A 1 31 ? -15.694 0.740   -7.232  1.00 0.00 ? 31 LYS A CA   3  
ATOM 3179  C C    . LYS A 1 31 ? -16.937 0.600   -6.359  1.00 0.00 ? 31 LYS A C    3  
ATOM 3180  O O    . LYS A 1 31 ? -17.712 -0.344  -6.512  1.00 0.00 ? 31 LYS A O    3  
ATOM 3181  C CB   . LYS A 1 31 ? -16.099 0.916   -8.697  1.00 0.00 ? 31 LYS A CB   3  
ATOM 3182  C CG   . LYS A 1 31 ? -16.688 2.283   -9.006  1.00 0.00 ? 31 LYS A CG   3  
ATOM 3183  C CD   . LYS A 1 31 ? -17.769 2.196   -10.071 1.00 0.00 ? 31 LYS A CD   3  
ATOM 3184  C CE   . LYS A 1 31 ? -19.158 2.166   -9.454  1.00 0.00 ? 31 LYS A CE   3  
ATOM 3185  N NZ   . LYS A 1 31 ? -19.597 0.778   -9.140  1.00 0.00 ? 31 LYS A NZ   3  
ATOM 3186  H H    . LYS A 1 31 ? -15.216 -1.277  -6.862  1.00 0.00 ? 31 LYS A H    3  
ATOM 3187  H HA   . LYS A 1 31 ? -15.143 1.606   -6.914  1.00 0.00 ? 31 LYS A HA   3  
ATOM 3188  H HB2  . LYS A 1 31 ? -15.227 0.774   -9.319  1.00 0.00 ? 31 LYS A HB2  3  
ATOM 3189  H HB3  . LYS A 1 31 ? -16.835 0.166   -8.948  1.00 0.00 ? 31 LYS A HB3  3  
ATOM 3190  H HG2  . LYS A 1 31 ? -17.118 2.691   -8.104  1.00 0.00 ? 31 LYS A HG2  3  
ATOM 3191  H HG3  . LYS A 1 31 ? -15.900 2.932   -9.358  1.00 0.00 ? 31 LYS A HG3  3  
ATOM 3192  H HD2  . LYS A 1 31 ? -17.693 3.056   -10.719 1.00 0.00 ? 31 LYS A HD2  3  
ATOM 3193  H HD3  . LYS A 1 31 ? -17.621 1.294   -10.647 1.00 0.00 ? 31 LYS A HD3  3  
ATOM 3194  H HE2  . LYS A 1 31 ? -19.145 2.744   -8.542  1.00 0.00 ? 31 LYS A HE2  3  
ATOM 3195  H HE3  . LYS A 1 31 ? -19.856 2.607   -10.149 1.00 0.00 ? 31 LYS A HE3  3  
ATOM 3196  H HZ1  . LYS A 1 31 ? -19.450 0.162   -9.965  1.00 0.00 ? 31 LYS A HZ1  3  
ATOM 3197  H HZ2  . LYS A 1 31 ? -20.607 0.770   -8.892  1.00 0.00 ? 31 LYS A HZ2  3  
ATOM 3198  H HZ3  . LYS A 1 31 ? -19.051 0.403   -8.338  1.00 0.00 ? 31 LYS A HZ3  3  
ATOM 3199  N N    . ILE A 1 32 ? -17.121 1.545   -5.443  1.00 0.00 ? 32 ILE A N    3  
ATOM 3200  C CA   . ILE A 1 32 ? -18.265 1.528   -4.547  1.00 0.00 ? 32 ILE A CA   3  
ATOM 3201  C C    . ILE A 1 32 ? -18.602 2.935   -4.063  1.00 0.00 ? 32 ILE A C    3  
ATOM 3202  O O    . ILE A 1 32 ? -17.815 3.866   -4.231  1.00 0.00 ? 32 ILE A O    3  
ATOM 3203  C CB   . ILE A 1 32 ? -18.031 0.617   -3.323  1.00 0.00 ? 32 ILE A CB   3  
ATOM 3204  C CG1  . ILE A 1 32 ? -16.743 -0.198  -3.479  1.00 0.00 ? 32 ILE A CG1  3  
ATOM 3205  C CG2  . ILE A 1 32 ? -19.222 -0.307  -3.115  1.00 0.00 ? 32 ILE A CG2  3  
ATOM 3206  C CD1  . ILE A 1 32 ? -16.387 -1.006  -2.250  1.00 0.00 ? 32 ILE A CD1  3  
ATOM 3207  H H    . ILE A 1 32 ? -16.473 2.270   -5.368  1.00 0.00 ? 32 ILE A H    3  
ATOM 3208  H HA   . ILE A 1 32 ? -19.102 1.144   -5.095  1.00 0.00 ? 32 ILE A HA   3  
ATOM 3209  H HB   . ILE A 1 32 ? -17.946 1.246   -2.457  1.00 0.00 ? 32 ILE A HB   3  
ATOM 3210  H HG12 . ILE A 1 32 ? -16.856 -0.884  -4.304  1.00 0.00 ? 32 ILE A HG12 3  
ATOM 3211  H HG13 . ILE A 1 32 ? -15.923 0.474   -3.685  1.00 0.00 ? 32 ILE A HG13 3  
ATOM 3212  H HG21 . ILE A 1 32 ? -19.989 0.213   -2.560  1.00 0.00 ? 32 ILE A HG21 3  
ATOM 3213  H HG22 . ILE A 1 32 ? -18.908 -1.180  -2.562  1.00 0.00 ? 32 ILE A HG22 3  
ATOM 3214  H HG23 . ILE A 1 32 ? -19.615 -0.610  -4.074  1.00 0.00 ? 32 ILE A HG23 3  
ATOM 3215  H HD11 . ILE A 1 32 ? -16.571 -0.415  -1.365  1.00 0.00 ? 32 ILE A HD11 3  
ATOM 3216  H HD12 . ILE A 1 32 ? -15.343 -1.280  -2.289  1.00 0.00 ? 32 ILE A HD12 3  
ATOM 3217  H HD13 . ILE A 1 32 ? -16.993 -1.899  -2.218  1.00 0.00 ? 32 ILE A HD13 3  
ATOM 3218  N N    . ILE A 1 33 ? -19.778 3.081   -3.460  1.00 0.00 ? 33 ILE A N    3  
ATOM 3219  C CA   . ILE A 1 33 ? -20.221 4.367   -2.951  1.00 0.00 ? 33 ILE A CA   3  
ATOM 3220  C C    . ILE A 1 33 ? -21.045 4.196   -1.678  1.00 0.00 ? 33 ILE A C    3  
ATOM 3221  O O    . ILE A 1 33 ? -21.887 3.303   -1.587  1.00 0.00 ? 33 ILE A O    3  
ATOM 3222  C CB   . ILE A 1 33 ? -21.055 5.149   -3.990  1.00 0.00 ? 33 ILE A CB   3  
ATOM 3223  C CG1  . ILE A 1 33 ? -21.149 4.384   -5.315  1.00 0.00 ? 33 ILE A CG1  3  
ATOM 3224  C CG2  . ILE A 1 33 ? -20.460 6.531   -4.217  1.00 0.00 ? 33 ILE A CG2  3  
ATOM 3225  C CD1  . ILE A 1 33 ? -22.001 3.136   -5.233  1.00 0.00 ? 33 ILE A CD1  3  
ATOM 3226  H H    . ILE A 1 33 ? -20.359 2.308   -3.354  1.00 0.00 ? 33 ILE A H    3  
ATOM 3227  H HA   . ILE A 1 33 ? -19.347 4.942   -2.720  1.00 0.00 ? 33 ILE A HA   3  
ATOM 3228  H HB   . ILE A 1 33 ? -22.046 5.278   -3.590  1.00 0.00 ? 33 ILE A HB   3  
ATOM 3229  H HG12 . ILE A 1 33 ? -21.578 5.029   -6.066  1.00 0.00 ? 33 ILE A HG12 3  
ATOM 3230  H HG13 . ILE A 1 33 ? -20.156 4.090   -5.624  1.00 0.00 ? 33 ILE A HG13 3  
ATOM 3231  H HG21 . ILE A 1 33 ? -21.171 7.147   -4.748  1.00 0.00 ? 33 ILE A HG21 3  
ATOM 3232  H HG22 . ILE A 1 33 ? -19.556 6.442   -4.801  1.00 0.00 ? 33 ILE A HG22 3  
ATOM 3233  H HG23 . ILE A 1 33 ? -20.231 6.985   -3.265  1.00 0.00 ? 33 ILE A HG23 3  
ATOM 3234  H HD11 . ILE A 1 33 ? -22.879 3.259   -5.849  1.00 0.00 ? 33 ILE A HD11 3  
ATOM 3235  H HD12 . ILE A 1 33 ? -22.300 2.971   -4.209  1.00 0.00 ? 33 ILE A HD12 3  
ATOM 3236  H HD13 . ILE A 1 33 ? -21.431 2.288   -5.583  1.00 0.00 ? 33 ILE A HD13 3  
ATOM 3237  N N    . LEU A 1 34 ? -20.796 5.058   -0.698  1.00 0.00 ? 34 LEU A N    3  
ATOM 3238  C CA   . LEU A 1 34 ? -21.509 5.007   0.567   1.00 0.00 ? 34 LEU A CA   3  
ATOM 3239  C C    . LEU A 1 34 ? -23.002 5.258   0.371   1.00 0.00 ? 34 LEU A C    3  
ATOM 3240  O O    . LEU A 1 34 ? -23.815 4.922   1.232   1.00 0.00 ? 34 LEU A O    3  
ATOM 3241  C CB   . LEU A 1 34 ? -20.929 6.037   1.537   1.00 0.00 ? 34 LEU A CB   3  
ATOM 3242  C CG   . LEU A 1 34 ? -20.473 7.356   0.904   1.00 0.00 ? 34 LEU A CG   3  
ATOM 3243  C CD1  . LEU A 1 34 ? -20.898 8.538   1.763   1.00 0.00 ? 34 LEU A CD1  3  
ATOM 3244  C CD2  . LEU A 1 34 ? -18.965 7.356   0.702   1.00 0.00 ? 34 LEU A CD2  3  
ATOM 3245  H H    . LEU A 1 34 ? -20.115 5.747   -0.827  1.00 0.00 ? 34 LEU A H    3  
ATOM 3246  H HA   . LEU A 1 34 ? -21.375 4.021   0.982   1.00 0.00 ? 34 LEU A HA   3  
ATOM 3247  H HB2  . LEU A 1 34 ? -21.681 6.260   2.270   1.00 0.00 ? 34 LEU A HB2  3  
ATOM 3248  H HB3  . LEU A 1 34 ? -20.083 5.593   2.039   1.00 0.00 ? 34 LEU A HB3  3  
ATOM 3249  H HG   . LEU A 1 34 ? -20.941 7.462   -0.064  1.00 0.00 ? 34 LEU A HG   3  
ATOM 3250  H HD11 . LEU A 1 34 ? -21.794 8.282   2.309   1.00 0.00 ? 34 LEU A HD11 3  
ATOM 3251  H HD12 . LEU A 1 34 ? -21.093 9.391   1.130   1.00 0.00 ? 34 LEU A HD12 3  
ATOM 3252  H HD13 . LEU A 1 34 ? -20.109 8.779   2.459   1.00 0.00 ? 34 LEU A HD13 3  
ATOM 3253  H HD21 . LEU A 1 34 ? -18.511 6.641   1.372   1.00 0.00 ? 34 LEU A HD21 3  
ATOM 3254  H HD22 . LEU A 1 34 ? -18.573 8.341   0.909   1.00 0.00 ? 34 LEU A HD22 3  
ATOM 3255  H HD23 . LEU A 1 34 ? -18.738 7.087   -0.319  1.00 0.00 ? 34 LEU A HD23 3  
ATOM 3256  N N    . SER A 1 35 ? -23.358 5.849   -0.765  1.00 0.00 ? 35 SER A N    3  
ATOM 3257  C CA   . SER A 1 35 ? -24.754 6.143   -1.069  1.00 0.00 ? 35 SER A CA   3  
ATOM 3258  C C    . SER A 1 35 ? -25.599 4.872   -1.072  1.00 0.00 ? 35 SER A C    3  
ATOM 3259  O O    . SER A 1 35 ? -26.819 4.927   -0.919  1.00 0.00 ? 35 SER A O    3  
ATOM 3260  C CB   . SER A 1 35 ? -24.864 6.850   -2.418  1.00 0.00 ? 35 SER A CB   3  
ATOM 3261  O OG   . SER A 1 35 ? -25.409 8.149   -2.270  1.00 0.00 ? 35 SER A OG   3  
ATOM 3262  H H    . SER A 1 35 ? -22.666 6.094   -1.413  1.00 0.00 ? 35 SER A H    3  
ATOM 3263  H HA   . SER A 1 35 ? -25.124 6.801   -0.306  1.00 0.00 ? 35 SER A HA   3  
ATOM 3264  H HB2  . SER A 1 35 ? -23.883 6.934   -2.856  1.00 0.00 ? 35 SER A HB2  3  
ATOM 3265  H HB3  . SER A 1 35 ? -25.503 6.277   -3.071  1.00 0.00 ? 35 SER A HB3  3  
ATOM 3266  H HG   . SER A 1 35 ? -26.180 8.110   -1.700  1.00 0.00 ? 35 SER A HG   3  
ATOM 3267  N N    . ASP A 1 36 ? -24.944 3.730   -1.247  1.00 0.00 ? 36 ASP A N    3  
ATOM 3268  C CA   . ASP A 1 36 ? -25.631 2.450   -1.269  1.00 0.00 ? 36 ASP A CA   3  
ATOM 3269  C C    . ASP A 1 36 ? -25.034 1.492   -0.242  1.00 0.00 ? 36 ASP A C    3  
ATOM 3270  O O    . ASP A 1 36 ? -25.667 1.170   0.762   1.00 0.00 ? 36 ASP A O    3  
ATOM 3271  C CB   . ASP A 1 36 ? -25.563 1.834   -2.669  1.00 0.00 ? 36 ASP A CB   3  
ATOM 3272  C CG   . ASP A 1 36 ? -26.914 1.810   -3.356  1.00 0.00 ? 36 ASP A CG   3  
ATOM 3273  O OD1  . ASP A 1 36 ? -27.750 0.957   -2.991  1.00 0.00 ? 36 ASP A OD1  3  
ATOM 3274  O OD2  . ASP A 1 36 ? -27.136 2.644   -4.259  1.00 0.00 ? 36 ASP A OD2  3  
ATOM 3275  H H    . ASP A 1 36 ? -23.981 3.747   -1.362  1.00 0.00 ? 36 ASP A H    3  
ATOM 3276  H HA   . ASP A 1 36 ? -26.657 2.633   -1.016  1.00 0.00 ? 36 ASP A HA   3  
ATOM 3277  H HB2  . ASP A 1 36 ? -24.882 2.411   -3.276  1.00 0.00 ? 36 ASP A HB2  3  
ATOM 3278  H HB3  . ASP A 1 36 ? -25.199 0.820   -2.593  1.00 0.00 ? 36 ASP A HB3  3  
ATOM 3279  N N    . GLU A 1 37 ? -23.811 1.041   -0.502  1.00 0.00 ? 37 GLU A N    3  
ATOM 3280  C CA   . GLU A 1 37 ? -23.129 0.119   0.399   1.00 0.00 ? 37 GLU A CA   3  
ATOM 3281  C C    . GLU A 1 37 ? -22.966 0.726   1.790   1.00 0.00 ? 37 GLU A C    3  
ATOM 3282  O O    . GLU A 1 37 ? -22.791 0.007   2.774   1.00 0.00 ? 37 GLU A O    3  
ATOM 3283  C CB   . GLU A 1 37 ? -21.765 -0.265  -0.170  1.00 0.00 ? 37 GLU A CB   3  
ATOM 3284  C CG   . GLU A 1 37 ? -21.626 -1.747  -0.465  1.00 0.00 ? 37 GLU A CG   3  
ATOM 3285  C CD   . GLU A 1 37 ? -21.371 -2.032  -1.932  1.00 0.00 ? 37 GLU A CD   3  
ATOM 3286  O OE1  . GLU A 1 37 ? -22.056 -1.425  -2.782  1.00 0.00 ? 37 GLU A OE1  3  
ATOM 3287  O OE2  . GLU A 1 37 ? -20.486 -2.861  -2.231  1.00 0.00 ? 37 GLU A OE2  3  
ATOM 3288  H H    . GLU A 1 37 ? -23.357 1.334   -1.320  1.00 0.00 ? 37 GLU A H    3  
ATOM 3289  H HA   . GLU A 1 37 ? -23.731 -0.766  0.479   1.00 0.00 ? 37 GLU A HA   3  
ATOM 3290  H HB2  . GLU A 1 37 ? -21.608 0.275   -1.087  1.00 0.00 ? 37 GLU A HB2  3  
ATOM 3291  H HB3  . GLU A 1 37 ? -21.001 0.011   0.538   1.00 0.00 ? 37 GLU A HB3  3  
ATOM 3292  H HG2  . GLU A 1 37 ? -20.801 -2.139  0.110   1.00 0.00 ? 37 GLU A HG2  3  
ATOM 3293  H HG3  . GLU A 1 37 ? -22.536 -2.242  -0.170  1.00 0.00 ? 37 GLU A HG3  3  
ATOM 3294  N N    . GLY A 1 38 ? -23.024 2.050   1.865   1.00 0.00 ? 38 GLY A N    3  
ATOM 3295  C CA   . GLY A 1 38 ? -22.882 2.729   3.139   1.00 0.00 ? 38 GLY A CA   3  
ATOM 3296  C C    . GLY A 1 38 ? -21.544 2.458   3.801   1.00 0.00 ? 38 GLY A C    3  
ATOM 3297  O O    . GLY A 1 38 ? -21.382 2.680   5.000   1.00 0.00 ? 38 GLY A O    3  
ATOM 3298  H H    . GLY A 1 38 ? -23.166 2.571   1.048   1.00 0.00 ? 38 GLY A H    3  
ATOM 3299  H HA2  . GLY A 1 38 ? -22.984 3.793   2.982   1.00 0.00 ? 38 GLY A HA2  3  
ATOM 3300  H HA3  . GLY A 1 38 ? -23.668 2.397   3.798   1.00 0.00 ? 38 GLY A HA3  3  
ATOM 3301  N N    . LYS A 1 39 ? -20.581 1.991   3.015   1.00 0.00 ? 39 LYS A N    3  
ATOM 3302  C CA   . LYS A 1 39 ? -19.255 1.706   3.518   1.00 0.00 ? 39 LYS A CA   3  
ATOM 3303  C C    . LYS A 1 39 ? -18.214 2.007   2.451   1.00 0.00 ? 39 LYS A C    3  
ATOM 3304  O O    . LYS A 1 39 ? -17.861 1.146   1.645   1.00 0.00 ? 39 LYS A O    3  
ATOM 3305  C CB   . LYS A 1 39 ? -19.150 0.245   3.961   1.00 0.00 ? 39 LYS A CB   3  
ATOM 3306  C CG   . LYS A 1 39 ? -19.779 -0.026  5.318   1.00 0.00 ? 39 LYS A CG   3  
ATOM 3307  C CD   . LYS A 1 39 ? -19.083 -1.170  6.036   1.00 0.00 ? 39 LYS A CD   3  
ATOM 3308  C CE   . LYS A 1 39 ? -19.894 -1.658  7.225   1.00 0.00 ? 39 LYS A CE   3  
ATOM 3309  N NZ   . LYS A 1 39 ? -19.507 -0.963  8.484   1.00 0.00 ? 39 LYS A NZ   3  
ATOM 3310  H H    . LYS A 1 39 ? -20.759 1.855   2.073   1.00 0.00 ? 39 LYS A H    3  
ATOM 3311  H HA   . LYS A 1 39 ? -19.083 2.346   4.364   1.00 0.00 ? 39 LYS A HA   3  
ATOM 3312  H HB2  . LYS A 1 39 ? -19.644 -0.377  3.229   1.00 0.00 ? 39 LYS A HB2  3  
ATOM 3313  H HB3  . LYS A 1 39 ? -18.107 -0.030  4.010   1.00 0.00 ? 39 LYS A HB3  3  
ATOM 3314  H HG2  . LYS A 1 39 ? -19.703 0.865   5.924   1.00 0.00 ? 39 LYS A HG2  3  
ATOM 3315  H HG3  . LYS A 1 39 ? -20.819 -0.280  5.178   1.00 0.00 ? 39 LYS A HG3  3  
ATOM 3316  H HD2  . LYS A 1 39 ? -18.950 -1.989  5.344   1.00 0.00 ? 39 LYS A HD2  3  
ATOM 3317  H HD3  . LYS A 1 39 ? -18.118 -0.830  6.384   1.00 0.00 ? 39 LYS A HD3  3  
ATOM 3318  H HE2  . LYS A 1 39 ? -20.940 -1.474  7.031   1.00 0.00 ? 39 LYS A HE2  3  
ATOM 3319  H HE3  . LYS A 1 39 ? -19.732 -2.719  7.345   1.00 0.00 ? 39 LYS A HE3  3  
ATOM 3320  H HZ1  . LYS A 1 39 ? -20.057 -1.339  9.283   1.00 0.00 ? 39 LYS A HZ1  3  
ATOM 3321  H HZ2  . LYS A 1 39 ? -19.691 0.057   8.401   1.00 0.00 ? 39 LYS A HZ2  3  
ATOM 3322  H HZ3  . LYS A 1 39 ? -18.495 -1.107  8.675   1.00 0.00 ? 39 LYS A HZ3  3  
ATOM 3323  N N    . MET A 1 40 ? -17.725 3.234   2.462   1.00 0.00 ? 40 MET A N    3  
ATOM 3324  C CA   . MET A 1 40 ? -16.719 3.671   1.513   1.00 0.00 ? 40 MET A CA   3  
ATOM 3325  C C    . MET A 1 40 ? -15.816 4.726   2.137   1.00 0.00 ? 40 MET A C    3  
ATOM 3326  O O    . MET A 1 40 ? -16.057 5.926   2.003   1.00 0.00 ? 40 MET A O    3  
ATOM 3327  C CB   . MET A 1 40 ? -17.380 4.224   0.249   1.00 0.00 ? 40 MET A CB   3  
ATOM 3328  C CG   . MET A 1 40 ? -16.625 3.892   -1.028  1.00 0.00 ? 40 MET A CG   3  
ATOM 3329  S SD   . MET A 1 40 ? -15.512 5.215   -1.540  1.00 0.00 ? 40 MET A SD   3  
ATOM 3330  C CE   . MET A 1 40 ? -16.674 6.384   -2.239  1.00 0.00 ? 40 MET A CE   3  
ATOM 3331  H H    . MET A 1 40 ? -18.048 3.859   3.129   1.00 0.00 ? 40 MET A H    3  
ATOM 3332  H HA   . MET A 1 40 ? -16.125 2.814   1.253   1.00 0.00 ? 40 MET A HA   3  
ATOM 3333  H HB2  . MET A 1 40 ? -18.376 3.815   0.169   1.00 0.00 ? 40 MET A HB2  3  
ATOM 3334  H HB3  . MET A 1 40 ? -17.447 5.299   0.333   1.00 0.00 ? 40 MET A HB3  3  
ATOM 3335  H HG2  . MET A 1 40 ? -16.044 2.996   -0.864  1.00 0.00 ? 40 MET A HG2  3  
ATOM 3336  H HG3  . MET A 1 40 ? -17.340 3.716   -1.818  1.00 0.00 ? 40 MET A HG3  3  
ATOM 3337  H HE1  . MET A 1 40 ? -17.574 5.865   -2.534  1.00 0.00 ? 40 MET A HE1  3  
ATOM 3338  H HE2  . MET A 1 40 ? -16.232 6.858   -3.103  1.00 0.00 ? 40 MET A HE2  3  
ATOM 3339  H HE3  . MET A 1 40 ? -16.917 7.135   -1.501  1.00 0.00 ? 40 MET A HE3  3  
ATOM 3340  N N    . TYR A 1 41 ? -14.776 4.268   2.820   1.00 0.00 ? 41 TYR A N    3  
ATOM 3341  C CA   . TYR A 1 41 ? -13.830 5.160   3.468   1.00 0.00 ? 41 TYR A CA   3  
ATOM 3342  C C    . TYR A 1 41 ? -12.538 5.259   2.664   1.00 0.00 ? 41 TYR A C    3  
ATOM 3343  O O    . TYR A 1 41 ? -12.425 4.690   1.578   1.00 0.00 ? 41 TYR A O    3  
ATOM 3344  C CB   . TYR A 1 41 ? -13.525 4.690   4.898   1.00 0.00 ? 41 TYR A CB   3  
ATOM 3345  C CG   . TYR A 1 41 ? -13.876 3.242   5.168   1.00 0.00 ? 41 TYR A CG   3  
ATOM 3346  C CD1  . TYR A 1 41 ? -15.200 2.838   5.282   1.00 0.00 ? 41 TYR A CD1  3  
ATOM 3347  C CD2  . TYR A 1 41 ? -12.882 2.282   5.310   1.00 0.00 ? 41 TYR A CD2  3  
ATOM 3348  C CE1  . TYR A 1 41 ? -15.524 1.517   5.529   1.00 0.00 ? 41 TYR A CE1  3  
ATOM 3349  C CE2  . TYR A 1 41 ? -13.198 0.959   5.557   1.00 0.00 ? 41 TYR A CE2  3  
ATOM 3350  C CZ   . TYR A 1 41 ? -14.520 0.582   5.666   1.00 0.00 ? 41 TYR A CZ   3  
ATOM 3351  O OH   . TYR A 1 41 ? -14.838 -0.734  5.911   1.00 0.00 ? 41 TYR A OH   3  
ATOM 3352  H H    . TYR A 1 41 ? -14.644 3.310   2.891   1.00 0.00 ? 41 TYR A H    3  
ATOM 3353  H HA   . TYR A 1 41 ? -14.286 6.130   3.511   1.00 0.00 ? 41 TYR A HA   3  
ATOM 3354  H HB2  . TYR A 1 41 ? -12.471 4.810   5.087   1.00 0.00 ? 41 TYR A HB2  3  
ATOM 3355  H HB3  . TYR A 1 41 ? -14.081 5.301   5.594   1.00 0.00 ? 41 TYR A HB3  3  
ATOM 3356  H HD1  . TYR A 1 41 ? -15.984 3.572   5.174   1.00 0.00 ? 41 TYR A HD1  3  
ATOM 3357  H HD2  . TYR A 1 41 ? -11.847 2.580   5.226   1.00 0.00 ? 41 TYR A HD2  3  
ATOM 3358  H HE1  . TYR A 1 41 ? -16.559 1.222   5.613   1.00 0.00 ? 41 TYR A HE1  3  
ATOM 3359  H HE2  . TYR A 1 41 ? -12.411 0.227   5.664   1.00 0.00 ? 41 TYR A HE2  3  
ATOM 3360  H HH   . TYR A 1 41 ? -14.717 -1.248  5.110   1.00 0.00 ? 41 TYR A HH   3  
ATOM 3361  N N    . GLY A 1 42 ? -11.564 5.984   3.205   1.00 0.00 ? 42 GLY A N    3  
ATOM 3362  C CA   . GLY A 1 42 ? -10.293 6.144   2.525   1.00 0.00 ? 42 GLY A CA   3  
ATOM 3363  C C    . GLY A 1 42 ? -9.606  4.818   2.261   1.00 0.00 ? 42 GLY A C    3  
ATOM 3364  O O    . GLY A 1 42 ? -9.350  4.049   3.187   1.00 0.00 ? 42 GLY A O    3  
ATOM 3365  H H    . GLY A 1 42 ? -11.711 6.415   4.074   1.00 0.00 ? 42 GLY A H    3  
ATOM 3366  H HA2  . GLY A 1 42 ? -10.461 6.643   1.582   1.00 0.00 ? 42 GLY A HA2  3  
ATOM 3367  H HA3  . GLY A 1 42 ? -9.645  6.757   3.134   1.00 0.00 ? 42 GLY A HA3  3  
ATOM 3368  N N    . ARG A 1 43 ? -9.307  4.551   0.994   1.00 0.00 ? 43 ARG A N    3  
ATOM 3369  C CA   . ARG A 1 43 ? -8.646  3.308   0.611   1.00 0.00 ? 43 ARG A CA   3  
ATOM 3370  C C    . ARG A 1 43 ? -7.296  3.166   1.306   1.00 0.00 ? 43 ARG A C    3  
ATOM 3371  O O    . ARG A 1 43 ? -6.802  2.057   1.506   1.00 0.00 ? 43 ARG A O    3  
ATOM 3372  C CB   . ARG A 1 43 ? -8.466  3.250   -0.904  1.00 0.00 ? 43 ARG A CB   3  
ATOM 3373  C CG   . ARG A 1 43 ? -9.228  2.112   -1.564  1.00 0.00 ? 43 ARG A CG   3  
ATOM 3374  C CD   . ARG A 1 43 ? -9.162  2.203   -3.080  1.00 0.00 ? 43 ARG A CD   3  
ATOM 3375  N NE   . ARG A 1 43 ? -9.076  0.885   -3.705  1.00 0.00 ? 43 ARG A NE   3  
ATOM 3376  C CZ   . ARG A 1 43 ? -9.043  0.689   -5.021  1.00 0.00 ? 43 ARG A CZ   3  
ATOM 3377  N NH1  . ARG A 1 43 ? -9.088  1.721   -5.854  1.00 0.00 ? 43 ARG A NH1  3  
ATOM 3378  N NH2  . ARG A 1 43 ? -8.963  -0.543  -5.505  1.00 0.00 ? 43 ARG A NH2  3  
ATOM 3379  H H    . ARG A 1 43 ? -9.536  5.204   0.300   1.00 0.00 ? 43 ARG A H    3  
ATOM 3380  H HA   . ARG A 1 43 ? -9.276  2.495   0.915   1.00 0.00 ? 43 ARG A HA   3  
ATOM 3381  H HB2  . ARG A 1 43 ? -8.812  4.178   -1.328  1.00 0.00 ? 43 ARG A HB2  3  
ATOM 3382  H HB3  . ARG A 1 43 ? -7.418  3.129   -1.127  1.00 0.00 ? 43 ARG A HB3  3  
ATOM 3383  H HG2  . ARG A 1 43 ? -8.797  1.173   -1.251  1.00 0.00 ? 43 ARG A HG2  3  
ATOM 3384  H HG3  . ARG A 1 43 ? -10.262 2.157   -1.254  1.00 0.00 ? 43 ARG A HG3  3  
ATOM 3385  H HD2  . ARG A 1 43 ? -10.051 2.702   -3.437  1.00 0.00 ? 43 ARG A HD2  3  
ATOM 3386  H HD3  . ARG A 1 43 ? -8.291  2.779   -3.356  1.00 0.00 ? 43 ARG A HD3  3  
ATOM 3387  H HE   . ARG A 1 43 ? -9.041  0.105   -3.112  1.00 0.00 ? 43 ARG A HE   3  
ATOM 3388  H HH11 . ARG A 1 43 ? -9.147  2.652   -5.495  1.00 0.00 ? 43 ARG A HH11 3  
ATOM 3389  H HH12 . ARG A 1 43 ? -9.062  1.567   -6.842  1.00 0.00 ? 43 ARG A HH12 3  
ATOM 3390  H HH21 . ARG A 1 43 ? -8.929  -1.324  -4.882  1.00 0.00 ? 43 ARG A HH21 3  
ATOM 3391  H HH22 . ARG A 1 43 ? -8.939  -0.691  -6.494  1.00 0.00 ? 43 ARG A HH22 3  
ATOM 3392  N N    . ASN A 1 44 ? -6.706  4.297   1.671   1.00 0.00 ? 44 ASN A N    3  
ATOM 3393  C CA   . ASN A 1 44 ? -5.413  4.303   2.343   1.00 0.00 ? 44 ASN A CA   3  
ATOM 3394  C C    . ASN A 1 44 ? -5.507  3.654   3.719   1.00 0.00 ? 44 ASN A C    3  
ATOM 3395  O O    . ASN A 1 44 ? -4.521  3.132   4.240   1.00 0.00 ? 44 ASN A O    3  
ATOM 3396  C CB   . ASN A 1 44 ? -4.888  5.732   2.469   1.00 0.00 ? 44 ASN A CB   3  
ATOM 3397  C CG   . ASN A 1 44 ? -3.602  5.948   1.696   1.00 0.00 ? 44 ASN A CG   3  
ATOM 3398  O OD1  . ASN A 1 44 ? -3.226  5.134   0.854   1.00 0.00 ? 44 ASN A OD1  3  
ATOM 3399  N ND2  . ASN A 1 44 ? -2.919  7.051   1.981   1.00 0.00 ? 44 ASN A ND2  3  
ATOM 3400  H H    . ASN A 1 44 ? -7.151  5.147   1.482   1.00 0.00 ? 44 ASN A H    3  
ATOM 3401  H HA   . ASN A 1 44 ? -4.731  3.736   1.742   1.00 0.00 ? 44 ASN A HA   3  
ATOM 3402  H HB2  . ASN A 1 44 ? -5.632  6.412   2.089   1.00 0.00 ? 44 ASN A HB2  3  
ATOM 3403  H HB3  . ASN A 1 44 ? -4.703  5.950   3.509   1.00 0.00 ? 44 ASN A HB3  3  
ATOM 3404  H HD21 . ASN A 1 44 ? -3.279  7.655   2.664   1.00 0.00 ? 44 ASN A HD21 3  
ATOM 3405  H HD22 . ASN A 1 44 ? -2.084  7.216   1.496   1.00 0.00 ? 44 ASN A HD22 3  
ATOM 3406  N N    . GLU A 1 45 ? -6.697  3.689   4.301   1.00 0.00 ? 45 GLU A N    3  
ATOM 3407  C CA   . GLU A 1 45 ? -6.921  3.104   5.614   1.00 0.00 ? 45 GLU A CA   3  
ATOM 3408  C C    . GLU A 1 45 ? -6.935  1.583   5.534   1.00 0.00 ? 45 GLU A C    3  
ATOM 3409  O O    . GLU A 1 45 ? -6.611  0.895   6.502   1.00 0.00 ? 45 GLU A O    3  
ATOM 3410  C CB   . GLU A 1 45 ? -8.237  3.610   6.208   1.00 0.00 ? 45 GLU A CB   3  
ATOM 3411  C CG   . GLU A 1 45 ? -8.180  5.059   6.666   1.00 0.00 ? 45 GLU A CG   3  
ATOM 3412  C CD   . GLU A 1 45 ? -9.524  5.753   6.569   1.00 0.00 ? 45 GLU A CD   3  
ATOM 3413  O OE1  . GLU A 1 45 ? -10.408 5.453   7.399   1.00 0.00 ? 45 GLU A OE1  3  
ATOM 3414  O OE2  . GLU A 1 45 ? -9.693  6.598   5.664   1.00 0.00 ? 45 GLU A OE2  3  
ATOM 3415  H H    . GLU A 1 45 ? -7.441  4.119   3.837   1.00 0.00 ? 45 GLU A H    3  
ATOM 3416  H HA   . GLU A 1 45 ? -6.109  3.408   6.247   1.00 0.00 ? 45 GLU A HA   3  
ATOM 3417  H HB2  . GLU A 1 45 ? -9.013  3.521   5.463   1.00 0.00 ? 45 GLU A HB2  3  
ATOM 3418  H HB3  . GLU A 1 45 ? -8.494  2.997   7.059   1.00 0.00 ? 45 GLU A HB3  3  
ATOM 3419  H HG2  . GLU A 1 45 ? -7.851  5.086   7.694   1.00 0.00 ? 45 GLU A HG2  3  
ATOM 3420  H HG3  . GLU A 1 45 ? -7.471  5.590   6.048   1.00 0.00 ? 45 GLU A HG3  3  
ATOM 3421  N N    . LEU A 1 46 ? -7.312  1.066   4.372   1.00 0.00 ? 46 LEU A N    3  
ATOM 3422  C CA   . LEU A 1 46 ? -7.369  -0.372  4.157   1.00 0.00 ? 46 LEU A CA   3  
ATOM 3423  C C    . LEU A 1 46 ? -5.973  -0.954  4.009   1.00 0.00 ? 46 LEU A C    3  
ATOM 3424  O O    . LEU A 1 46 ? -5.674  -2.027  4.532   1.00 0.00 ? 46 LEU A O    3  
ATOM 3425  C CB   . LEU A 1 46 ? -8.206  -0.695  2.922   1.00 0.00 ? 46 LEU A CB   3  
ATOM 3426  C CG   . LEU A 1 46 ? -9.274  -1.773  3.120   1.00 0.00 ? 46 LEU A CG   3  
ATOM 3427  C CD1  . LEU A 1 46 ? -9.941  -2.108  1.796   1.00 0.00 ? 46 LEU A CD1  3  
ATOM 3428  C CD2  . LEU A 1 46 ? -8.663  -3.020  3.741   1.00 0.00 ? 46 LEU A CD2  3  
ATOM 3429  H H    . LEU A 1 46 ? -7.556  1.666   3.643   1.00 0.00 ? 46 LEU A H    3  
ATOM 3430  H HA   . LEU A 1 46 ? -7.828  -0.810  5.013   1.00 0.00 ? 46 LEU A HA   3  
ATOM 3431  H HB2  . LEU A 1 46 ? -8.694  0.212   2.596   1.00 0.00 ? 46 LEU A HB2  3  
ATOM 3432  H HB3  . LEU A 1 46 ? -7.540  -1.024  2.146   1.00 0.00 ? 46 LEU A HB3  3  
ATOM 3433  H HG   . LEU A 1 46 ? -10.033 -1.400  3.792   1.00 0.00 ? 46 LEU A HG   3  
ATOM 3434  H HD11 . LEU A 1 46 ? -10.521 -1.262  1.460   1.00 0.00 ? 46 LEU A HD11 3  
ATOM 3435  H HD12 . LEU A 1 46 ? -10.589 -2.962  1.925   1.00 0.00 ? 46 LEU A HD12 3  
ATOM 3436  H HD13 . LEU A 1 46 ? -9.184  -2.340  1.060   1.00 0.00 ? 46 LEU A HD13 3  
ATOM 3437  H HD21 . LEU A 1 46 ? -8.000  -3.488  3.028   1.00 0.00 ? 46 LEU A HD21 3  
ATOM 3438  H HD22 . LEU A 1 46 ? -9.449  -3.711  4.009   1.00 0.00 ? 46 LEU A HD22 3  
ATOM 3439  H HD23 . LEU A 1 46 ? -8.106  -2.748  4.625   1.00 0.00 ? 46 LEU A HD23 3  
ATOM 3440  N N    . ILE A 1 47 ? -5.125  -0.235  3.296   1.00 0.00 ? 47 ILE A N    3  
ATOM 3441  C CA   . ILE A 1 47 ? -3.758  -0.667  3.078   1.00 0.00 ? 47 ILE A CA   3  
ATOM 3442  C C    . ILE A 1 47 ? -2.922  -0.430  4.322   1.00 0.00 ? 47 ILE A C    3  
ATOM 3443  O O    . ILE A 1 47 ? -2.010  -1.197  4.630   1.00 0.00 ? 47 ILE A O    3  
ATOM 3444  C CB   . ILE A 1 47 ? -3.099  0.042   1.871   1.00 0.00 ? 47 ILE A CB   3  
ATOM 3445  C CG1  . ILE A 1 47 ? -3.777  1.383   1.571   1.00 0.00 ? 47 ILE A CG1  3  
ATOM 3446  C CG2  . ILE A 1 47 ? -3.135  -0.856  0.644   1.00 0.00 ? 47 ILE A CG2  3  
ATOM 3447  C CD1  . ILE A 1 47 ? -3.012  2.243   0.590   1.00 0.00 ? 47 ILE A CD1  3  
ATOM 3448  H H    . ILE A 1 47 ? -5.426  0.607   2.915   1.00 0.00 ? 47 ILE A H    3  
ATOM 3449  H HA   . ILE A 1 47 ? -3.782  -1.722  2.883   1.00 0.00 ? 47 ILE A HA   3  
ATOM 3450  H HB   . ILE A 1 47 ? -2.068  0.223   2.118   1.00 0.00 ? 47 ILE A HB   3  
ATOM 3451  H HG12 . ILE A 1 47 ? -4.756  1.198   1.155   1.00 0.00 ? 47 ILE A HG12 3  
ATOM 3452  H HG13 . ILE A 1 47 ? -3.881  1.939   2.491   1.00 0.00 ? 47 ILE A HG13 3  
ATOM 3453  H HG21 . ILE A 1 47 ? -2.956  -0.263  -0.241  1.00 0.00 ? 47 ILE A HG21 3  
ATOM 3454  H HG22 . ILE A 1 47 ? -4.105  -1.327  0.571   1.00 0.00 ? 47 ILE A HG22 3  
ATOM 3455  H HG23 . ILE A 1 47 ? -2.372  -1.615  0.730   1.00 0.00 ? 47 ILE A HG23 3  
ATOM 3456  H HD11 . ILE A 1 47 ? -3.657  3.026   0.219   1.00 0.00 ? 47 ILE A HD11 3  
ATOM 3457  H HD12 . ILE A 1 47 ? -2.676  1.633   -0.235  1.00 0.00 ? 47 ILE A HD12 3  
ATOM 3458  H HD13 . ILE A 1 47 ? -2.159  2.682   1.085   1.00 0.00 ? 47 ILE A HD13 3  
ATOM 3459  N N    . ALA A 1 48 ? -3.252  0.630   5.042   1.00 0.00 ? 48 ALA A N    3  
ATOM 3460  C CA   . ALA A 1 48 ? -2.548  0.963   6.265   1.00 0.00 ? 48 ALA A CA   3  
ATOM 3461  C C    . ALA A 1 48 ? -3.033  0.089   7.411   1.00 0.00 ? 48 ALA A C    3  
ATOM 3462  O O    . ALA A 1 48 ? -2.307  -0.148  8.377   1.00 0.00 ? 48 ALA A O    3  
ATOM 3463  C CB   . ALA A 1 48 ? -2.719  2.437   6.597   1.00 0.00 ? 48 ALA A CB   3  
ATOM 3464  H H    . ALA A 1 48 ? -3.993  1.191   4.749   1.00 0.00 ? 48 ALA A H    3  
ATOM 3465  H HA   . ALA A 1 48 ? -1.504  0.769   6.101   1.00 0.00 ? 48 ALA A HA   3  
ATOM 3466  H HB1  . ALA A 1 48 ? -2.302  3.035   5.799   1.00 0.00 ? 48 ALA A HB1  3  
ATOM 3467  H HB2  . ALA A 1 48 ? -2.205  2.660   7.520   1.00 0.00 ? 48 ALA A HB2  3  
ATOM 3468  H HB3  . ALA A 1 48 ? -3.769  2.663   6.705   1.00 0.00 ? 48 ALA A HB3  3  
ATOM 3469  N N    . ARG A 1 49 ? -4.259  -0.407  7.288   1.00 0.00 ? 49 ARG A N    3  
ATOM 3470  C CA   . ARG A 1 49 ? -4.826  -1.275  8.303   1.00 0.00 ? 49 ARG A CA   3  
ATOM 3471  C C    . ARG A 1 49 ? -4.185  -2.652  8.221   1.00 0.00 ? 49 ARG A C    3  
ATOM 3472  O O    . ARG A 1 49 ? -4.084  -3.365  9.220   1.00 0.00 ? 49 ARG A O    3  
ATOM 3473  C CB   . ARG A 1 49 ? -6.343  -1.384  8.135   1.00 0.00 ? 49 ARG A CB   3  
ATOM 3474  C CG   . ARG A 1 49 ? -7.117  -0.329  8.909   1.00 0.00 ? 49 ARG A CG   3  
ATOM 3475  C CD   . ARG A 1 49 ? -8.523  -0.154  8.358   1.00 0.00 ? 49 ARG A CD   3  
ATOM 3476  N NE   . ARG A 1 49 ? -9.494  0.128   9.413   1.00 0.00 ? 49 ARG A NE   3  
ATOM 3477  C CZ   . ARG A 1 49 ? -10.701 0.643   9.191   1.00 0.00 ? 49 ARG A CZ   3  
ATOM 3478  N NH1  . ARG A 1 49 ? -11.090 0.933   7.956   1.00 0.00 ? 49 ARG A NH1  3  
ATOM 3479  N NH2  . ARG A 1 49 ? -11.522 0.870   10.208  1.00 0.00 ? 49 ARG A NH2  3  
ATOM 3480  H H    . ARG A 1 49 ? -4.785  -0.197  6.492   1.00 0.00 ? 49 ARG A H    3  
ATOM 3481  H HA   . ARG A 1 49 ? -4.603  -0.846  9.261   1.00 0.00 ? 49 ARG A HA   3  
ATOM 3482  H HB2  . ARG A 1 49 ? -6.586  -1.282  7.088   1.00 0.00 ? 49 ARG A HB2  3  
ATOM 3483  H HB3  . ARG A 1 49 ? -6.663  -2.357  8.477   1.00 0.00 ? 49 ARG A HB3  3  
ATOM 3484  H HG2  . ARG A 1 49 ? -7.182  -0.631  9.943   1.00 0.00 ? 49 ARG A HG2  3  
ATOM 3485  H HG3  . ARG A 1 49 ? -6.593  0.612   8.838   1.00 0.00 ? 49 ARG A HG3  3  
ATOM 3486  H HD2  . ARG A 1 49 ? -8.522  0.666   7.655   1.00 0.00 ? 49 ARG A HD2  3  
ATOM 3487  H HD3  . ARG A 1 49 ? -8.812  -1.062  7.849   1.00 0.00 ? 49 ARG A HD3  3  
ATOM 3488  H HE   . ARG A 1 49 ? -9.232  -0.077  10.335  1.00 0.00 ? 49 ARG A HE   3  
ATOM 3489  H HH11 . ARG A 1 49 ? -10.476 0.765   7.185   1.00 0.00 ? 49 ARG A HH11 3  
ATOM 3490  H HH12 . ARG A 1 49 ? -11.998 1.320   7.796   1.00 0.00 ? 49 ARG A HH12 3  
ATOM 3491  H HH21 . ARG A 1 49 ? -11.234 0.653   11.141  1.00 0.00 ? 49 ARG A HH21 3  
ATOM 3492  H HH22 . ARG A 1 49 ? -12.428 1.257   10.042  1.00 0.00 ? 49 ARG A HH22 3  
ATOM 3493  N N    . TYR A 1 50 ? -3.739  -3.010  7.023   1.00 0.00 ? 50 TYR A N    3  
ATOM 3494  C CA   . TYR A 1 50 ? -3.089  -4.290  6.801   1.00 0.00 ? 50 TYR A CA   3  
ATOM 3495  C C    . TYR A 1 50 ? -1.735  -4.320  7.478   1.00 0.00 ? 50 TYR A C    3  
ATOM 3496  O O    . TYR A 1 50 ? -1.432  -5.219  8.262   1.00 0.00 ? 50 TYR A O    3  
ATOM 3497  C CB   . TYR A 1 50 ? -2.922  -4.550  5.315   1.00 0.00 ? 50 TYR A CB   3  
ATOM 3498  C CG   . TYR A 1 50 ? -2.754  -6.011  4.969   1.00 0.00 ? 50 TYR A CG   3  
ATOM 3499  C CD1  . TYR A 1 50 ? -1.519  -6.631  5.096   1.00 0.00 ? 50 TYR A CD1  3  
ATOM 3500  C CD2  . TYR A 1 50 ? -3.827  -6.769  4.519   1.00 0.00 ? 50 TYR A CD2  3  
ATOM 3501  C CE1  . TYR A 1 50 ? -1.355  -7.966  4.783   1.00 0.00 ? 50 TYR A CE1  3  
ATOM 3502  C CE2  . TYR A 1 50 ? -3.672  -8.106  4.205   1.00 0.00 ? 50 TYR A CE2  3  
ATOM 3503  C CZ   . TYR A 1 50 ? -2.434  -8.700  4.338   1.00 0.00 ? 50 TYR A CZ   3  
ATOM 3504  O OH   . TYR A 1 50 ? -2.275  -10.030 4.026   1.00 0.00 ? 50 TYR A OH   3  
ATOM 3505  H H    . TYR A 1 50 ? -3.842  -2.391  6.270   1.00 0.00 ? 50 TYR A H    3  
ATOM 3506  H HA   . TYR A 1 50 ? -3.699  -5.049  7.220   1.00 0.00 ? 50 TYR A HA   3  
ATOM 3507  H HB2  . TYR A 1 50 ? -3.784  -4.175  4.789   1.00 0.00 ? 50 TYR A HB2  3  
ATOM 3508  H HB3  . TYR A 1 50 ? -2.049  -4.030  4.979   1.00 0.00 ? 50 TYR A HB3  3  
ATOM 3509  H HD1  . TYR A 1 50 ? -0.675  -6.054  5.446   1.00 0.00 ? 50 TYR A HD1  3  
ATOM 3510  H HD2  . TYR A 1 50 ? -4.795  -6.301  4.415   1.00 0.00 ? 50 TYR A HD2  3  
ATOM 3511  H HE1  . TYR A 1 50 ? -0.385  -8.428  4.889   1.00 0.00 ? 50 TYR A HE1  3  
ATOM 3512  H HE2  . TYR A 1 50 ? -4.518  -8.680  3.856   1.00 0.00 ? 50 TYR A HE2  3  
ATOM 3513  H HH   . TYR A 1 50 ? -1.451  -10.151 3.549   1.00 0.00 ? 50 TYR A HH   3  
ATOM 3514  N N    . ILE A 1 51 ? -0.929  -3.323  7.169   1.00 0.00 ? 51 ILE A N    3  
ATOM 3515  C CA   . ILE A 1 51 ? 0.399   -3.213  7.743   1.00 0.00 ? 51 ILE A CA   3  
ATOM 3516  C C    . ILE A 1 51 ? 0.317   -3.032  9.250   1.00 0.00 ? 51 ILE A C    3  
ATOM 3517  O O    . ILE A 1 51 ? 1.184   -3.493  9.993   1.00 0.00 ? 51 ILE A O    3  
ATOM 3518  C CB   . ILE A 1 51 ? 1.205   -2.049  7.129   1.00 0.00 ? 51 ILE A CB   3  
ATOM 3519  C CG1  . ILE A 1 51 ? 0.284   -0.949  6.594   1.00 0.00 ? 51 ILE A CG1  3  
ATOM 3520  C CG2  . ILE A 1 51 ? 2.113   -2.565  6.024   1.00 0.00 ? 51 ILE A CG2  3  
ATOM 3521  C CD1  . ILE A 1 51 ? 0.927   0.420   6.572   1.00 0.00 ? 51 ILE A CD1  3  
ATOM 3522  H H    . ILE A 1 51 ? -1.240  -2.642  6.541   1.00 0.00 ? 51 ILE A H    3  
ATOM 3523  H HA   . ILE A 1 51 ? 0.921   -4.132  7.536   1.00 0.00 ? 51 ILE A HA   3  
ATOM 3524  H HB   . ILE A 1 51 ? 1.822   -1.636  7.904   1.00 0.00 ? 51 ILE A HB   3  
ATOM 3525  H HG12 . ILE A 1 51 ? -0.008  -1.193  5.584   1.00 0.00 ? 51 ILE A HG12 3  
ATOM 3526  H HG13 . ILE A 1 51 ? -0.598  -0.893  7.215   1.00 0.00 ? 51 ILE A HG13 3  
ATOM 3527  H HG21 . ILE A 1 51 ? 2.252   -1.793  5.282   1.00 0.00 ? 51 ILE A HG21 3  
ATOM 3528  H HG22 . ILE A 1 51 ? 1.661   -3.431  5.563   1.00 0.00 ? 51 ILE A HG22 3  
ATOM 3529  H HG23 . ILE A 1 51 ? 3.070   -2.839  6.443   1.00 0.00 ? 51 ILE A HG23 3  
ATOM 3530  H HD11 . ILE A 1 51 ? 0.256   1.141   7.016   1.00 0.00 ? 51 ILE A HD11 3  
ATOM 3531  H HD12 . ILE A 1 51 ? 1.134   0.704   5.551   1.00 0.00 ? 51 ILE A HD12 3  
ATOM 3532  H HD13 . ILE A 1 51 ? 1.849   0.394   7.133   1.00 0.00 ? 51 ILE A HD13 3  
ATOM 3533  N N    . LYS A 1 52 ? -0.738  -2.366  9.691   1.00 0.00 ? 52 LYS A N    3  
ATOM 3534  C CA   . LYS A 1 52 ? -0.953  -2.127  11.110  1.00 0.00 ? 52 LYS A CA   3  
ATOM 3535  C C    . LYS A 1 52 ? -1.347  -3.418  11.819  1.00 0.00 ? 52 LYS A C    3  
ATOM 3536  O O    . LYS A 1 52 ? -1.098  -3.584  13.013  1.00 0.00 ? 52 LYS A O    3  
ATOM 3537  C CB   . LYS A 1 52 ? -2.035  -1.065  11.315  1.00 0.00 ? 52 LYS A CB   3  
ATOM 3538  C CG   . LYS A 1 52 ? -2.243  -0.683  12.771  1.00 0.00 ? 52 LYS A CG   3  
ATOM 3539  C CD   . LYS A 1 52 ? -1.275  0.406   13.205  1.00 0.00 ? 52 LYS A CD   3  
ATOM 3540  C CE   . LYS A 1 52 ? -1.024  0.362   14.704  1.00 0.00 ? 52 LYS A CE   3  
ATOM 3541  N NZ   . LYS A 1 52 ? -1.925  1.286   15.446  1.00 0.00 ? 52 LYS A NZ   3  
ATOM 3542  H H    . LYS A 1 52 ? -1.391  -2.033  9.046   1.00 0.00 ? 52 LYS A H    3  
ATOM 3543  H HA   . LYS A 1 52 ? -0.028  -1.772  11.524  1.00 0.00 ? 52 LYS A HA   3  
ATOM 3544  H HB2  . LYS A 1 52 ? -1.759  -0.176  10.768  1.00 0.00 ? 52 LYS A HB2  3  
ATOM 3545  H HB3  . LYS A 1 52 ? -2.970  -1.440  10.926  1.00 0.00 ? 52 LYS A HB3  3  
ATOM 3546  H HG2  . LYS A 1 52 ? -3.254  -0.323  12.898  1.00 0.00 ? 52 LYS A HG2  3  
ATOM 3547  H HG3  . LYS A 1 52 ? -2.090  -1.556  13.388  1.00 0.00 ? 52 LYS A HG3  3  
ATOM 3548  H HD2  . LYS A 1 52 ? -0.337  0.267   12.689  1.00 0.00 ? 52 LYS A HD2  3  
ATOM 3549  H HD3  . LYS A 1 52 ? -1.692  1.368   12.947  1.00 0.00 ? 52 LYS A HD3  3  
ATOM 3550  H HE2  . LYS A 1 52 ? -1.189  -0.646  15.054  1.00 0.00 ? 52 LYS A HE2  3  
ATOM 3551  H HE3  . LYS A 1 52 ? 0.002   0.644   14.892  1.00 0.00 ? 52 LYS A HE3  3  
ATOM 3552  H HZ1  . LYS A 1 52 ? -1.504  2.236   15.492  1.00 0.00 ? 52 LYS A HZ1  3  
ATOM 3553  H HZ2  . LYS A 1 52 ? -2.075  0.939   16.414  1.00 0.00 ? 52 LYS A HZ2  3  
ATOM 3554  H HZ3  . LYS A 1 52 ? -2.846  1.349   14.966  1.00 0.00 ? 52 LYS A HZ3  3  
ATOM 3555  N N    . LEU A 1 53 ? -1.963  -4.327  11.073  1.00 0.00 ? 53 LEU A N    3  
ATOM 3556  C CA   . LEU A 1 53 ? -2.394  -5.603  11.619  1.00 0.00 ? 53 LEU A CA   3  
ATOM 3557  C C    . LEU A 1 53 ? -1.258  -6.627  11.605  1.00 0.00 ? 53 LEU A C    3  
ATOM 3558  O O    . LEU A 1 53 ? -1.329  -7.653  12.281  1.00 0.00 ? 53 LEU A O    3  
ATOM 3559  C CB   . LEU A 1 53 ? -3.592  -6.138  10.828  1.00 0.00 ? 53 LEU A CB   3  
ATOM 3560  C CG   . LEU A 1 53 ? -4.901  -6.227  11.618  1.00 0.00 ? 53 LEU A CG   3  
ATOM 3561  C CD1  . LEU A 1 53 ? -6.003  -5.445  10.920  1.00 0.00 ? 53 LEU A CD1  3  
ATOM 3562  C CD2  . LEU A 1 53 ? -5.314  -7.680  11.807  1.00 0.00 ? 53 LEU A CD2  3  
ATOM 3563  H H    . LEU A 1 53 ? -2.132  -4.133  10.132  1.00 0.00 ? 53 LEU A H    3  
ATOM 3564  H HA   . LEU A 1 53 ? -2.697  -5.434  12.636  1.00 0.00 ? 53 LEU A HA   3  
ATOM 3565  H HB2  . LEU A 1 53 ? -3.750  -5.490  9.978   1.00 0.00 ? 53 LEU A HB2  3  
ATOM 3566  H HB3  . LEU A 1 53 ? -3.348  -7.125  10.465  1.00 0.00 ? 53 LEU A HB3  3  
ATOM 3567  H HG   . LEU A 1 53 ? -4.753  -5.792  12.596  1.00 0.00 ? 53 LEU A HG   3  
ATOM 3568  H HD11 . LEU A 1 53 ? -5.796  -5.399  9.861   1.00 0.00 ? 53 LEU A HD11 3  
ATOM 3569  H HD12 . LEU A 1 53 ? -6.045  -4.444  11.323  1.00 0.00 ? 53 LEU A HD12 3  
ATOM 3570  H HD13 . LEU A 1 53 ? -6.951  -5.937  11.081  1.00 0.00 ? 53 LEU A HD13 3  
ATOM 3571  H HD21 . LEU A 1 53 ? -6.359  -7.725  12.076  1.00 0.00 ? 53 LEU A HD21 3  
ATOM 3572  H HD22 . LEU A 1 53 ? -4.721  -8.124  12.592  1.00 0.00 ? 53 LEU A HD22 3  
ATOM 3573  H HD23 . LEU A 1 53 ? -5.156  -8.221  10.886  1.00 0.00 ? 53 LEU A HD23 3  
ATOM 3574  N N    . ARG A 1 54 ? -0.215  -6.345  10.828  1.00 0.00 ? 54 ARG A N    3  
ATOM 3575  C CA   . ARG A 1 54 ? 0.930   -7.246  10.724  1.00 0.00 ? 54 ARG A CA   3  
ATOM 3576  C C    . ARG A 1 54 ? 1.515   -7.558  12.094  1.00 0.00 ? 54 ARG A C    3  
ATOM 3577  O O    . ARG A 1 54 ? 1.747   -8.718  12.436  1.00 0.00 ? 54 ARG A O    3  
ATOM 3578  C CB   . ARG A 1 54 ? 2.005   -6.636  9.824   1.00 0.00 ? 54 ARG A CB   3  
ATOM 3579  C CG   . ARG A 1 54 ? 2.931   -7.667  9.198   1.00 0.00 ? 54 ARG A CG   3  
ATOM 3580  C CD   . ARG A 1 54 ? 2.153   -8.705  8.405   1.00 0.00 ? 54 ARG A CD   3  
ATOM 3581  N NE   . ARG A 1 54 ? 1.804   -9.867  9.218   1.00 0.00 ? 54 ARG A NE   3  
ATOM 3582  C CZ   . ARG A 1 54 ? 0.898   -10.775 8.863   1.00 0.00 ? 54 ARG A CZ   3  
ATOM 3583  N NH1  . ARG A 1 54 ? 0.248   -10.660 7.712   1.00 0.00 ? 54 ARG A NH1  3  
ATOM 3584  N NH2  . ARG A 1 54 ? 0.641   -11.802 9.662   1.00 0.00 ? 54 ARG A NH2  3  
ATOM 3585  H H    . ARG A 1 54 ? -0.215  -5.515  10.308  1.00 0.00 ? 54 ARG A H    3  
ATOM 3586  H HA   . ARG A 1 54 ? 0.586   -8.160  10.286  1.00 0.00 ? 54 ARG A HA   3  
ATOM 3587  H HB2  . ARG A 1 54 ? 1.524   -6.087  9.029   1.00 0.00 ? 54 ARG A HB2  3  
ATOM 3588  H HB3  . ARG A 1 54 ? 2.605   -5.954  10.409  1.00 0.00 ? 54 ARG A HB3  3  
ATOM 3589  H HG2  . ARG A 1 54 ? 3.619   -7.164  8.535   1.00 0.00 ? 54 ARG A HG2  3  
ATOM 3590  H HG3  . ARG A 1 54 ? 3.482   -8.165  9.982   1.00 0.00 ? 54 ARG A HG3  3  
ATOM 3591  H HD2  . ARG A 1 54 ? 1.246   -8.251  8.035   1.00 0.00 ? 54 ARG A HD2  3  
ATOM 3592  H HD3  . ARG A 1 54 ? 2.758   -9.029  7.571   1.00 0.00 ? 54 ARG A HD3  3  
ATOM 3593  H HE   . ARG A 1 54 ? 2.269   -9.977  10.074  1.00 0.00 ? 54 ARG A HE   3  
ATOM 3594  H HH11 . ARG A 1 54 ? 0.437   -9.888  7.105   1.00 0.00 ? 54 ARG A HH11 3  
ATOM 3595  H HH12 . ARG A 1 54 ? -0.432  -11.345 7.451   1.00 0.00 ? 54 ARG A HH12 3  
ATOM 3596  H HH21 . ARG A 1 54 ? 1.128   -11.895 10.530  1.00 0.00 ? 54 ARG A HH21 3  
ATOM 3597  H HH22 . ARG A 1 54 ? -0.040  -12.485 9.395   1.00 0.00 ? 54 ARG A HH22 3  
ATOM 3598  N N    . THR A 1 55 ? 1.750   -6.515  12.868  1.00 0.00 ? 55 THR A N    3  
ATOM 3599  C CA   . THR A 1 55 ? 2.310   -6.661  14.204  1.00 0.00 ? 55 THR A CA   3  
ATOM 3600  C C    . THR A 1 55 ? 2.102   -5.395  15.030  1.00 0.00 ? 55 THR A C    3  
ATOM 3601  O O    . THR A 1 55 ? 2.903   -5.077  15.908  1.00 0.00 ? 55 THR A O    3  
ATOM 3602  C CB   . THR A 1 55 ? 3.800   -6.992  14.119  1.00 0.00 ? 55 THR A CB   3  
ATOM 3603  O OG1  . THR A 1 55 ? 4.327   -7.273  15.403  1.00 0.00 ? 55 THR A OG1  3  
ATOM 3604  C CG2  . THR A 1 55 ? 4.629   -5.877  13.515  1.00 0.00 ? 55 THR A CG2  3  
ATOM 3605  H H    . THR A 1 55 ? 1.542   -5.626  12.531  1.00 0.00 ? 55 THR A H    3  
ATOM 3606  H HA   . THR A 1 55 ? 1.797   -7.476  14.685  1.00 0.00 ? 55 THR A HA   3  
ATOM 3607  H HB   . THR A 1 55 ? 3.927   -7.869  13.500  1.00 0.00 ? 55 THR A HB   3  
ATOM 3608  H HG1  . THR A 1 55 ? 3.749   -7.889  15.858  1.00 0.00 ? 55 THR A HG1  3  
ATOM 3609  H HG21 . THR A 1 55 ? 5.113   -5.321  14.304  1.00 0.00 ? 55 THR A HG21 3  
ATOM 3610  H HG22 . THR A 1 55 ? 3.988   -5.217  12.950  1.00 0.00 ? 55 THR A HG22 3  
ATOM 3611  H HG23 . THR A 1 55 ? 5.378   -6.299  12.861  1.00 0.00 ? 55 THR A HG23 3  
ATOM 3612  N N    . GLY A 1 56 ? 1.021   -4.676  14.743  1.00 0.00 ? 56 GLY A N    3  
ATOM 3613  C CA   . GLY A 1 56 ? 0.728   -3.454  15.469  1.00 0.00 ? 56 GLY A CA   3  
ATOM 3614  C C    . GLY A 1 56 ? 1.797   -2.391  15.290  1.00 0.00 ? 56 GLY A C    3  
ATOM 3615  O O    . GLY A 1 56 ? 1.840   -1.415  16.038  1.00 0.00 ? 56 GLY A O    3  
ATOM 3616  H H    . GLY A 1 56 ? 0.417   -4.978  14.034  1.00 0.00 ? 56 GLY A H    3  
ATOM 3617  H HA2  . GLY A 1 56 ? -0.216  -3.060  15.121  1.00 0.00 ? 56 GLY A HA2  3  
ATOM 3618  H HA3  . GLY A 1 56 ? 0.642   -3.687  16.519  1.00 0.00 ? 56 GLY A HA3  3  
ATOM 3619  N N    . LYS A 1 57 ? 2.661   -2.578  14.296  1.00 0.00 ? 57 LYS A N    3  
ATOM 3620  C CA   . LYS A 1 57 ? 3.729   -1.628  14.025  1.00 0.00 ? 57 LYS A CA   3  
ATOM 3621  C C    . LYS A 1 57 ? 3.192   -0.400  13.299  1.00 0.00 ? 57 LYS A C    3  
ATOM 3622  O O    . LYS A 1 57 ? 1.981   -0.234  13.154  1.00 0.00 ? 57 LYS A O    3  
ATOM 3623  C CB   . LYS A 1 57 ? 4.830   -2.289  13.198  1.00 0.00 ? 57 LYS A CB   3  
ATOM 3624  C CG   . LYS A 1 57 ? 6.178   -2.330  13.900  1.00 0.00 ? 57 LYS A CG   3  
ATOM 3625  C CD   . LYS A 1 57 ? 6.079   -3.003  15.260  1.00 0.00 ? 57 LYS A CD   3  
ATOM 3626  C CE   . LYS A 1 57 ? 7.269   -3.912  15.521  1.00 0.00 ? 57 LYS A CE   3  
ATOM 3627  N NZ   . LYS A 1 57 ? 6.968   -4.939  16.556  1.00 0.00 ? 57 LYS A NZ   3  
ATOM 3628  H H    . LYS A 1 57 ? 2.579   -3.370  13.734  1.00 0.00 ? 57 LYS A H    3  
ATOM 3629  H HA   . LYS A 1 57 ? 4.141   -1.324  14.967  1.00 0.00 ? 57 LYS A HA   3  
ATOM 3630  H HB2  . LYS A 1 57 ? 4.534   -3.302  12.975  1.00 0.00 ? 57 LYS A HB2  3  
ATOM 3631  H HB3  . LYS A 1 57 ? 4.946   -1.745  12.275  1.00 0.00 ? 57 LYS A HB3  3  
ATOM 3632  H HG2  . LYS A 1 57 ? 6.875   -2.881  13.287  1.00 0.00 ? 57 LYS A HG2  3  
ATOM 3633  H HG3  . LYS A 1 57 ? 6.534   -1.319  14.033  1.00 0.00 ? 57 LYS A HG3  3  
ATOM 3634  H HD2  . LYS A 1 57 ? 6.046   -2.242  16.026  1.00 0.00 ? 57 LYS A HD2  3  
ATOM 3635  H HD3  . LYS A 1 57 ? 5.173   -3.591  15.296  1.00 0.00 ? 57 LYS A HD3  3  
ATOM 3636  H HE2  . LYS A 1 57 ? 7.535   -4.409  14.600  1.00 0.00 ? 57 LYS A HE2  3  
ATOM 3637  H HE3  . LYS A 1 57 ? 8.100   -3.308  15.856  1.00 0.00 ? 57 LYS A HE3  3  
ATOM 3638  H HZ1  . LYS A 1 57 ? 6.597   -5.801  16.106  1.00 0.00 ? 57 LYS A HZ1  3  
ATOM 3639  H HZ2  . LYS A 1 57 ? 6.258   -4.577  17.223  1.00 0.00 ? 57 LYS A HZ2  3  
ATOM 3640  H HZ3  . LYS A 1 57 ? 7.832   -5.180  17.083  1.00 0.00 ? 57 LYS A HZ3  3  
ATOM 3641  N N    . THR A 1 58 ? 4.099   0.460   12.843  1.00 0.00 ? 58 THR A N    3  
ATOM 3642  C CA   . THR A 1 58 ? 3.715   1.674   12.129  1.00 0.00 ? 58 THR A CA   3  
ATOM 3643  C C    . THR A 1 58 ? 2.689   1.364   11.041  1.00 0.00 ? 58 THR A C    3  
ATOM 3644  O O    . THR A 1 58 ? 2.435   0.200   10.730  1.00 0.00 ? 58 THR A O    3  
ATOM 3645  C CB   . THR A 1 58 ? 4.949   2.338   11.513  1.00 0.00 ? 58 THR A CB   3  
ATOM 3646  O OG1  . THR A 1 58 ? 4.616   3.599   10.956  1.00 0.00 ? 58 THR A OG1  3  
ATOM 3647  C CG2  . THR A 1 58 ? 5.597   1.508   10.424  1.00 0.00 ? 58 THR A CG2  3  
ATOM 3648  H H    . THR A 1 58 ? 5.050   0.272   12.989  1.00 0.00 ? 58 THR A H    3  
ATOM 3649  H HA   . THR A 1 58 ? 3.271   2.351   12.843  1.00 0.00 ? 58 THR A HA   3  
ATOM 3650  H HB   . THR A 1 58 ? 5.684   2.495   12.289  1.00 0.00 ? 58 THR A HB   3  
ATOM 3651  H HG1  . THR A 1 58 ? 4.201   3.474   10.099  1.00 0.00 ? 58 THR A HG1  3  
ATOM 3652  H HG21 . THR A 1 58 ? 6.671   1.584   10.505  1.00 0.00 ? 58 THR A HG21 3  
ATOM 3653  H HG22 . THR A 1 58 ? 5.282   1.874   9.457   1.00 0.00 ? 58 THR A HG22 3  
ATOM 3654  H HG23 . THR A 1 58 ? 5.300   0.475   10.533  1.00 0.00 ? 58 THR A HG23 3  
ATOM 3655  N N    . ARG A 1 59 ? 2.110   2.408   10.460  1.00 0.00 ? 59 ARG A N    3  
ATOM 3656  C CA   . ARG A 1 59 ? 1.129   2.244   9.407   1.00 0.00 ? 59 ARG A CA   3  
ATOM 3657  C C    . ARG A 1 59 ? 1.083   3.486   8.530   1.00 0.00 ? 59 ARG A C    3  
ATOM 3658  O O    . ARG A 1 59 ? 0.089   4.211   8.504   1.00 0.00 ? 59 ARG A O    3  
ATOM 3659  C CB   . ARG A 1 59 ? -0.253  1.964   10.000  1.00 0.00 ? 59 ARG A CB   3  
ATOM 3660  C CG   . ARG A 1 59 ? -0.773  3.087   10.884  1.00 0.00 ? 59 ARG A CG   3  
ATOM 3661  C CD   . ARG A 1 59 ? -2.221  3.426   10.565  1.00 0.00 ? 59 ARG A CD   3  
ATOM 3662  N NE   . ARG A 1 59 ? -3.129  2.337   10.918  1.00 0.00 ? 59 ARG A NE   3  
ATOM 3663  C CZ   . ARG A 1 59 ? -4.454  2.416   10.820  1.00 0.00 ? 59 ARG A CZ   3  
ATOM 3664  N NH1  . ARG A 1 59 ? -5.029  3.530   10.382  1.00 0.00 ? 59 ARG A NH1  3  
ATOM 3665  N NH2  . ARG A 1 59 ? -5.207  1.379   11.161  1.00 0.00 ? 59 ARG A NH2  3  
ATOM 3666  H H    . ARG A 1 59 ? 2.361   3.309   10.732  1.00 0.00 ? 59 ARG A H    3  
ATOM 3667  H HA   . ARG A 1 59 ? 1.432   1.405   8.806   1.00 0.00 ? 59 ARG A HA   3  
ATOM 3668  H HB2  . ARG A 1 59 ? -0.955  1.814   9.193   1.00 0.00 ? 59 ARG A HB2  3  
ATOM 3669  H HB3  . ARG A 1 59 ? -0.201  1.063   10.593  1.00 0.00 ? 59 ARG A HB3  3  
ATOM 3670  H HG2  . ARG A 1 59 ? -0.707  2.779   11.917  1.00 0.00 ? 59 ARG A HG2  3  
ATOM 3671  H HG3  . ARG A 1 59 ? -0.164  3.965   10.729  1.00 0.00 ? 59 ARG A HG3  3  
ATOM 3672  H HD2  . ARG A 1 59 ? -2.501  4.309   11.119  1.00 0.00 ? 59 ARG A HD2  3  
ATOM 3673  H HD3  . ARG A 1 59 ? -2.305  3.624   9.506   1.00 0.00 ? 59 ARG A HD3  3  
ATOM 3674  H HE   . ARG A 1 59 ? -2.731  1.504   11.245  1.00 0.00 ? 59 ARG A HE   3  
ATOM 3675  H HH11 . ARG A 1 59 ? -4.467  4.315   10.123  1.00 0.00 ? 59 ARG A HH11 3  
ATOM 3676  H HH12 . ARG A 1 59 ? -6.025  3.583   10.310  1.00 0.00 ? 59 ARG A HH12 3  
ATOM 3677  H HH21 . ARG A 1 59 ? -4.779  0.538   11.492  1.00 0.00 ? 59 ARG A HH21 3  
ATOM 3678  H HH22 . ARG A 1 59 ? -6.202  1.438   11.088  1.00 0.00 ? 59 ARG A HH22 3  
ATOM 3679  N N    . THR A 1 60 ? 2.171   3.718   7.812   1.00 0.00 ? 60 THR A N    3  
ATOM 3680  C CA   . THR A 1 60 ? 2.271   4.869   6.921   1.00 0.00 ? 60 THR A CA   3  
ATOM 3681  C C    . THR A 1 60 ? 1.149   4.846   5.887   1.00 0.00 ? 60 THR A C    3  
ATOM 3682  O O    . THR A 1 60 ? 0.655   3.781   5.520   1.00 0.00 ? 60 THR A O    3  
ATOM 3683  C CB   . THR A 1 60 ? 3.633   4.887   6.219   1.00 0.00 ? 60 THR A CB   3  
ATOM 3684  O OG1  . THR A 1 60 ? 4.333   3.674   6.440   1.00 0.00 ? 60 THR A OG1  3  
ATOM 3685  C CG2  . THR A 1 60 ? 4.524   6.024   6.675   1.00 0.00 ? 60 THR A CG2  3  
ATOM 3686  H H    . THR A 1 60 ? 2.926   3.100   7.887   1.00 0.00 ? 60 THR A H    3  
ATOM 3687  H HA   . THR A 1 60 ? 2.174   5.760   7.522   1.00 0.00 ? 60 THR A HA   3  
ATOM 3688  H HB   . THR A 1 60 ? 3.477   4.998   5.156   1.00 0.00 ? 60 THR A HB   3  
ATOM 3689  H HG1  . THR A 1 60 ? 4.713   3.676   7.322   1.00 0.00 ? 60 THR A HG1  3  
ATOM 3690  H HG21 . THR A 1 60 ? 5.336   5.629   7.267   1.00 0.00 ? 60 THR A HG21 3  
ATOM 3691  H HG22 . THR A 1 60 ? 3.948   6.717   7.270   1.00 0.00 ? 60 THR A HG22 3  
ATOM 3692  H HG23 . THR A 1 60 ? 4.924   6.535   5.812   1.00 0.00 ? 60 THR A HG23 3  
ATOM 3693  N N    . ARG A 1 61 ? 0.748   6.025   5.423   1.00 0.00 ? 61 ARG A N    3  
ATOM 3694  C CA   . ARG A 1 61 ? -0.313  6.133   4.437   1.00 0.00 ? 61 ARG A CA   3  
ATOM 3695  C C    . ARG A 1 61 ? 0.238   6.589   3.097   1.00 0.00 ? 61 ARG A C    3  
ATOM 3696  O O    . ARG A 1 61 ? 0.221   5.848   2.114   1.00 0.00 ? 61 ARG A O    3  
ATOM 3697  C CB   . ARG A 1 61 ? -1.394  7.102   4.918   1.00 0.00 ? 61 ARG A CB   3  
ATOM 3698  C CG   . ARG A 1 61 ? -2.491  6.434   5.732   1.00 0.00 ? 61 ARG A CG   3  
ATOM 3699  C CD   . ARG A 1 61 ? -3.125  7.403   6.718   1.00 0.00 ? 61 ARG A CD   3  
ATOM 3700  N NE   . ARG A 1 61 ? -4.482  7.775   6.323   1.00 0.00 ? 61 ARG A NE   3  
ATOM 3701  C CZ   . ARG A 1 61 ? -4.761  8.699   5.405   1.00 0.00 ? 61 ARG A CZ   3  
ATOM 3702  N NH1  . ARG A 1 61 ? -3.782  9.346   4.786   1.00 0.00 ? 61 ARG A NH1  3  
ATOM 3703  N NH2  . ARG A 1 61 ? -6.022  8.975   5.106   1.00 0.00 ? 61 ARG A NH2  3  
ATOM 3704  H H    . ARG A 1 61 ? 1.173   6.837   5.748   1.00 0.00 ? 61 ARG A H    3  
ATOM 3705  H HA   . ARG A 1 61 ? -0.739  5.165   4.318   1.00 0.00 ? 61 ARG A HA   3  
ATOM 3706  H HB2  . ARG A 1 61 ? -0.933  7.862   5.531   1.00 0.00 ? 61 ARG A HB2  3  
ATOM 3707  H HB3  . ARG A 1 61 ? -1.849  7.571   4.059   1.00 0.00 ? 61 ARG A HB3  3  
ATOM 3708  H HG2  . ARG A 1 61 ? -3.253  6.069   5.061   1.00 0.00 ? 61 ARG A HG2  3  
ATOM 3709  H HG3  . ARG A 1 61 ? -2.065  5.605   6.280   1.00 0.00 ? 61 ARG A HG3  3  
ATOM 3710  H HD2  . ARG A 1 61 ? -3.161  6.935   7.690   1.00 0.00 ? 61 ARG A HD2  3  
ATOM 3711  H HD3  . ARG A 1 61 ? -2.518  8.294   6.770   1.00 0.00 ? 61 ARG A HD3  3  
ATOM 3712  H HE   . ARG A 1 61 ? -5.224  7.313   6.764   1.00 0.00 ? 61 ARG A HE   3  
ATOM 3713  H HH11 . ARG A 1 61 ? -2.828  9.143   5.006   1.00 0.00 ? 61 ARG A HH11 3  
ATOM 3714  H HH12 . ARG A 1 61 ? -3.998  10.039  4.097   1.00 0.00 ? 61 ARG A HH12 3  
ATOM 3715  H HH21 . ARG A 1 61 ? -6.764  8.490   5.569   1.00 0.00 ? 61 ARG A HH21 3  
ATOM 3716  H HH22 . ARG A 1 61 ? -6.232  9.669   4.417   1.00 0.00 ? 61 ARG A HH22 3  
ATOM 3717  N N    . LYS A 1 62 ? 0.727   7.814   3.077   1.00 0.00 ? 62 LYS A N    3  
ATOM 3718  C CA   . LYS A 1 62 ? 1.295   8.399   1.870   1.00 0.00 ? 62 LYS A CA   3  
ATOM 3719  C C    . LYS A 1 62 ? 2.391   7.512   1.296   1.00 0.00 ? 62 LYS A C    3  
ATOM 3720  O O    . LYS A 1 62 ? 2.617   7.486   0.086   1.00 0.00 ? 62 LYS A O    3  
ATOM 3721  C CB   . LYS A 1 62 ? 1.849   9.788   2.173   1.00 0.00 ? 62 LYS A CB   3  
ATOM 3722  C CG   . LYS A 1 62 ? 1.286   10.879  1.276   1.00 0.00 ? 62 LYS A CG   3  
ATOM 3723  C CD   . LYS A 1 62 ? 0.130   11.606  1.943   1.00 0.00 ? 62 LYS A CD   3  
ATOM 3724  C CE   . LYS A 1 62 ? -0.120  12.961  1.301   1.00 0.00 ? 62 LYS A CE   3  
ATOM 3725  N NZ   . LYS A 1 62 ? 0.941   13.945  1.649   1.00 0.00 ? 62 LYS A NZ   3  
ATOM 3726  H H    . LYS A 1 62 ? 0.706   8.339   3.900   1.00 0.00 ? 62 LYS A H    3  
ATOM 3727  H HA   . LYS A 1 62 ? 0.512   8.488   1.145   1.00 0.00 ? 62 LYS A HA   3  
ATOM 3728  H HB2  . LYS A 1 62 ? 1.620   10.039  3.198   1.00 0.00 ? 62 LYS A HB2  3  
ATOM 3729  H HB3  . LYS A 1 62 ? 2.917   9.766   2.049   1.00 0.00 ? 62 LYS A HB3  3  
ATOM 3730  H HG2  . LYS A 1 62 ? 2.068   11.591  1.058   1.00 0.00 ? 62 LYS A HG2  3  
ATOM 3731  H HG3  . LYS A 1 62 ? 0.937   10.431  0.357   1.00 0.00 ? 62 LYS A HG3  3  
ATOM 3732  H HD2  . LYS A 1 62 ? -0.762  11.005  1.851   1.00 0.00 ? 62 LYS A HD2  3  
ATOM 3733  H HD3  . LYS A 1 62 ? 0.363   11.750  2.988   1.00 0.00 ? 62 LYS A HD3  3  
ATOM 3734  H HE2  . LYS A 1 62 ? -0.147  12.838  0.229   1.00 0.00 ? 62 LYS A HE2  3  
ATOM 3735  H HE3  . LYS A 1 62 ? -1.074  13.336  1.643   1.00 0.00 ? 62 LYS A HE3  3  
ATOM 3736  H HZ1  . LYS A 1 62 ? 0.640   14.525  2.458   1.00 0.00 ? 62 LYS A HZ1  3  
ATOM 3737  H HZ2  . LYS A 1 62 ? 1.129   14.570  0.839   1.00 0.00 ? 62 LYS A HZ2  3  
ATOM 3738  H HZ3  . LYS A 1 62 ? 1.821   13.449  1.899   1.00 0.00 ? 62 LYS A HZ3  3  
ATOM 3739  N N    . GLN A 1 63 ? 3.067   6.787   2.174   1.00 0.00 ? 63 GLN A N    3  
ATOM 3740  C CA   . GLN A 1 63 ? 4.140   5.896   1.763   1.00 0.00 ? 63 GLN A CA   3  
ATOM 3741  C C    . GLN A 1 63 ? 3.583   4.632   1.122   1.00 0.00 ? 63 GLN A C    3  
ATOM 3742  O O    . GLN A 1 63 ? 4.201   4.050   0.231   1.00 0.00 ? 63 GLN A O    3  
ATOM 3743  C CB   . GLN A 1 63 ? 5.025   5.540   2.956   1.00 0.00 ? 63 GLN A CB   3  
ATOM 3744  C CG   . GLN A 1 63 ? 6.462   6.011   2.809   1.00 0.00 ? 63 GLN A CG   3  
ATOM 3745  C CD   . GLN A 1 63 ? 7.407   4.888   2.428   1.00 0.00 ? 63 GLN A CD   3  
ATOM 3746  O OE1  . GLN A 1 63 ? 7.005   3.907   1.804   1.00 0.00 ? 63 GLN A OE1  3  
ATOM 3747  N NE2  . GLN A 1 63 ? 8.673   5.027   2.805   1.00 0.00 ? 63 GLN A NE2  3  
ATOM 3748  H H    . GLN A 1 63 ? 2.838   6.855   3.119   1.00 0.00 ? 63 GLN A H    3  
ATOM 3749  H HA   . GLN A 1 63 ? 4.729   6.415   1.039   1.00 0.00 ? 63 GLN A HA   3  
ATOM 3750  H HB2  . GLN A 1 63 ? 4.610   5.993   3.841   1.00 0.00 ? 63 GLN A HB2  3  
ATOM 3751  H HB3  . GLN A 1 63 ? 5.031   4.469   3.078   1.00 0.00 ? 63 GLN A HB3  3  
ATOM 3752  H HG2  . GLN A 1 63 ? 6.502   6.770   2.041   1.00 0.00 ? 63 GLN A HG2  3  
ATOM 3753  H HG3  . GLN A 1 63 ? 6.787   6.433   3.748   1.00 0.00 ? 63 GLN A HG3  3  
ATOM 3754  H HE21 . GLN A 1 63 ? 8.923   5.835   3.300   1.00 0.00 ? 63 GLN A HE21 3  
ATOM 3755  H HE22 . GLN A 1 63 ? 9.306   4.316   2.572   1.00 0.00 ? 63 GLN A HE22 3  
ATOM 3756  N N    . VAL A 1 64 ? 2.411   4.217   1.580   1.00 0.00 ? 64 VAL A N    3  
ATOM 3757  C CA   . VAL A 1 64 ? 1.767   3.027   1.051   1.00 0.00 ? 64 VAL A CA   3  
ATOM 3758  C C    . VAL A 1 64 ? 1.060   3.322   -0.267  1.00 0.00 ? 64 VAL A C    3  
ATOM 3759  O O    . VAL A 1 64 ? 0.764   2.410   -1.036  1.00 0.00 ? 64 VAL A O    3  
ATOM 3760  C CB   . VAL A 1 64 ? 0.751   2.434   2.047   1.00 0.00 ? 64 VAL A CB   3  
ATOM 3761  C CG1  . VAL A 1 64 ? 0.174   1.131   1.513   1.00 0.00 ? 64 VAL A CG1  3  
ATOM 3762  C CG2  . VAL A 1 64 ? 1.397   2.217   3.406   1.00 0.00 ? 64 VAL A CG2  3  
ATOM 3763  H H    . VAL A 1 64 ? 1.971   4.724   2.287   1.00 0.00 ? 64 VAL A H    3  
ATOM 3764  H HA   . VAL A 1 64 ? 2.535   2.295   0.874   1.00 0.00 ? 64 VAL A HA   3  
ATOM 3765  H HB   . VAL A 1 64 ? -0.060  3.138   2.166   1.00 0.00 ? 64 VAL A HB   3  
ATOM 3766  H HG11 . VAL A 1 64 ? -0.101  0.493   2.340   1.00 0.00 ? 64 VAL A HG11 3  
ATOM 3767  H HG12 . VAL A 1 64 ? 0.913   0.632   0.905   1.00 0.00 ? 64 VAL A HG12 3  
ATOM 3768  H HG13 . VAL A 1 64 ? -0.701  1.342   0.916   1.00 0.00 ? 64 VAL A HG13 3  
ATOM 3769  H HG21 . VAL A 1 64 ? 0.631   2.025   4.142   1.00 0.00 ? 64 VAL A HG21 3  
ATOM 3770  H HG22 . VAL A 1 64 ? 1.952   3.100   3.686   1.00 0.00 ? 64 VAL A HG22 3  
ATOM 3771  H HG23 . VAL A 1 64 ? 2.067   1.372   3.355   1.00 0.00 ? 64 VAL A HG23 3  
ATOM 3772  N N    . SER A 1 65 ? 0.805   4.598   -0.530  1.00 0.00 ? 65 SER A N    3  
ATOM 3773  C CA   . SER A 1 65 ? 0.150   5.000   -1.761  1.00 0.00 ? 65 SER A CA   3  
ATOM 3774  C C    . SER A 1 65 ? 1.186   5.207   -2.850  1.00 0.00 ? 65 SER A C    3  
ATOM 3775  O O    . SER A 1 65 ? 0.928   4.979   -4.032  1.00 0.00 ? 65 SER A O    3  
ATOM 3776  C CB   . SER A 1 65 ? -0.663  6.278   -1.550  1.00 0.00 ? 65 SER A CB   3  
ATOM 3777  O OG   . SER A 1 65 ? -1.867  6.247   -2.296  1.00 0.00 ? 65 SER A OG   3  
ATOM 3778  H H    . SER A 1 65 ? 1.074   5.284   0.108   1.00 0.00 ? 65 SER A H    3  
ATOM 3779  H HA   . SER A 1 65 ? -0.505  4.205   -2.054  1.00 0.00 ? 65 SER A HA   3  
ATOM 3780  H HB2  . SER A 1 65 ? -0.906  6.379   -0.503  1.00 0.00 ? 65 SER A HB2  3  
ATOM 3781  H HB3  . SER A 1 65 ? -0.079  7.130   -1.867  1.00 0.00 ? 65 SER A HB3  3  
ATOM 3782  H HG   . SER A 1 65 ? -2.558  6.701   -1.808  1.00 0.00 ? 65 SER A HG   3  
ATOM 3783  N N    . SER A 1 66 ? 2.368   5.628   -2.429  1.00 0.00 ? 66 SER A N    3  
ATOM 3784  C CA   . SER A 1 66 ? 3.472   5.858   -3.338  1.00 0.00 ? 66 SER A CA   3  
ATOM 3785  C C    . SER A 1 66 ? 4.035   4.536   -3.833  1.00 0.00 ? 66 SER A C    3  
ATOM 3786  O O    . SER A 1 66 ? 4.518   4.431   -4.960  1.00 0.00 ? 66 SER A O    3  
ATOM 3787  C CB   . SER A 1 66 ? 4.557   6.661   -2.636  1.00 0.00 ? 66 SER A CB   3  
ATOM 3788  O OG   . SER A 1 66 ? 5.000   7.741   -3.439  1.00 0.00 ? 66 SER A OG   3  
ATOM 3789  H H    . SER A 1 66 ? 2.504   5.778   -1.474  1.00 0.00 ? 66 SER A H    3  
ATOM 3790  H HA   . SER A 1 66 ? 3.107   6.416   -4.172  1.00 0.00 ? 66 SER A HA   3  
ATOM 3791  H HB2  . SER A 1 66 ? 4.167   7.051   -1.709  1.00 0.00 ? 66 SER A HB2  3  
ATOM 3792  H HB3  . SER A 1 66 ? 5.388   6.016   -2.429  1.00 0.00 ? 66 SER A HB3  3  
ATOM 3793  H HG   . SER A 1 66 ? 5.957   7.714   -3.514  1.00 0.00 ? 66 SER A HG   3  
ATOM 3794  N N    . HIS A 1 67 ? 3.970   3.530   -2.972  1.00 0.00 ? 67 HIS A N    3  
ATOM 3795  C CA   . HIS A 1 67 ? 4.473   2.205   -3.303  1.00 0.00 ? 67 HIS A CA   3  
ATOM 3796  C C    . HIS A 1 67 ? 3.596   1.530   -4.348  1.00 0.00 ? 67 HIS A C    3  
ATOM 3797  O O    . HIS A 1 67 ? 4.086   0.784   -5.196  1.00 0.00 ? 67 HIS A O    3  
ATOM 3798  C CB   . HIS A 1 67 ? 4.558   1.337   -2.046  1.00 0.00 ? 67 HIS A CB   3  
ATOM 3799  C CG   . HIS A 1 67 ? 5.457   0.150   -2.199  1.00 0.00 ? 67 HIS A CG   3  
ATOM 3800  N ND1  . HIS A 1 67 ? 6.756   0.241   -2.651  1.00 0.00 ? 67 HIS A ND1  3  
ATOM 3801  C CD2  . HIS A 1 67 ? 5.237   -1.164  -1.956  1.00 0.00 ? 67 HIS A CD2  3  
ATOM 3802  C CE1  . HIS A 1 67 ? 7.296   -0.964  -2.680  1.00 0.00 ? 67 HIS A CE1  3  
ATOM 3803  N NE2  . HIS A 1 67 ? 6.396   -1.834  -2.263  1.00 0.00 ? 67 HIS A NE2  3  
ATOM 3804  H H    . HIS A 1 67 ? 3.576   3.687   -2.090  1.00 0.00 ? 67 HIS A H    3  
ATOM 3805  H HA   . HIS A 1 67 ? 5.455   2.326   -3.712  1.00 0.00 ? 67 HIS A HA   3  
ATOM 3806  H HB2  . HIS A 1 67 ? 4.935   1.935   -1.230  1.00 0.00 ? 67 HIS A HB2  3  
ATOM 3807  H HB3  . HIS A 1 67 ? 3.571   0.979   -1.797  1.00 0.00 ? 67 HIS A HB3  3  
ATOM 3808  H HD1  . HIS A 1 67 ? 7.215   1.067   -2.912  1.00 0.00 ? 67 HIS A HD1  3  
ATOM 3809  H HD2  . HIS A 1 67 ? 4.319   -1.604  -1.590  1.00 0.00 ? 67 HIS A HD2  3  
ATOM 3810  H HE1  . HIS A 1 67 ? 8.304   -1.198  -2.991  1.00 0.00 ? 67 HIS A HE1  3  
ATOM 3811  H HE2  . HIS A 1 67 ? 6.561   -2.787  -2.104  1.00 0.00 ? 67 HIS A HE2  3  
ATOM 3812  N N    . ILE A 1 68 ? 2.301   1.798   -4.285  1.00 0.00 ? 68 ILE A N    3  
ATOM 3813  C CA   . ILE A 1 68 ? 1.361   1.218   -5.232  1.00 0.00 ? 68 ILE A CA   3  
ATOM 3814  C C    . ILE A 1 68 ? 1.496   1.873   -6.599  1.00 0.00 ? 68 ILE A C    3  
ATOM 3815  O O    . ILE A 1 68 ? 1.197   1.264   -7.626  1.00 0.00 ? 68 ILE A O    3  
ATOM 3816  C CB   . ILE A 1 68 ? -0.098  1.349   -4.750  1.00 0.00 ? 68 ILE A CB   3  
ATOM 3817  C CG1  . ILE A 1 68 ? -0.227  0.891   -3.297  1.00 0.00 ? 68 ILE A CG1  3  
ATOM 3818  C CG2  . ILE A 1 68 ? -1.028  0.540   -5.644  1.00 0.00 ? 68 ILE A CG2  3  
ATOM 3819  C CD1  . ILE A 1 68 ? -1.355  1.567   -2.551  1.00 0.00 ? 68 ILE A CD1  3  
ATOM 3820  H H    . ILE A 1 68 ? 1.973   2.401   -3.590  1.00 0.00 ? 68 ILE A H    3  
ATOM 3821  H HA   . ILE A 1 68 ? 1.596   0.174   -5.325  1.00 0.00 ? 68 ILE A HA   3  
ATOM 3822  H HB   . ILE A 1 68 ? -0.386  2.387   -4.820  1.00 0.00 ? 68 ILE A HB   3  
ATOM 3823  H HG12 . ILE A 1 68 ? -0.408  -0.173  -3.277  1.00 0.00 ? 68 ILE A HG12 3  
ATOM 3824  H HG13 . ILE A 1 68 ? 0.694   1.104   -2.776  1.00 0.00 ? 68 ILE A HG13 3  
ATOM 3825  H HG21 . ILE A 1 68 ? -1.908  1.124   -5.870  1.00 0.00 ? 68 ILE A HG21 3  
ATOM 3826  H HG22 . ILE A 1 68 ? -1.318  -0.367  -5.134  1.00 0.00 ? 68 ILE A HG22 3  
ATOM 3827  H HG23 . ILE A 1 68 ? -0.517  0.289   -6.562  1.00 0.00 ? 68 ILE A HG23 3  
ATOM 3828  H HD11 . ILE A 1 68 ? -2.291  1.097   -2.811  1.00 0.00 ? 68 ILE A HD11 3  
ATOM 3829  H HD12 . ILE A 1 68 ? -1.389  2.612   -2.821  1.00 0.00 ? 68 ILE A HD12 3  
ATOM 3830  H HD13 . ILE A 1 68 ? -1.189  1.475   -1.488  1.00 0.00 ? 68 ILE A HD13 3  
ATOM 3831  N N    . GLN A 1 69 ? 1.955   3.118   -6.603  1.00 0.00 ? 69 GLN A N    3  
ATOM 3832  C CA   . GLN A 1 69 ? 2.139   3.859   -7.839  1.00 0.00 ? 69 GLN A CA   3  
ATOM 3833  C C    . GLN A 1 69 ? 3.364   3.358   -8.591  1.00 0.00 ? 69 GLN A C    3  
ATOM 3834  O O    . GLN A 1 69 ? 3.423   3.423   -9.818  1.00 0.00 ? 69 GLN A O    3  
ATOM 3835  C CB   . GLN A 1 69 ? 2.272   5.356   -7.551  1.00 0.00 ? 69 GLN A CB   3  
ATOM 3836  C CG   . GLN A 1 69 ? 1.004   5.982   -6.993  1.00 0.00 ? 69 GLN A CG   3  
ATOM 3837  C CD   . GLN A 1 69 ? 0.685   7.320   -7.631  1.00 0.00 ? 69 GLN A CD   3  
ATOM 3838  O OE1  . GLN A 1 69 ? 1.067   7.584   -8.771  1.00 0.00 ? 69 GLN A OE1  3  
ATOM 3839  N NE2  . GLN A 1 69 ? -0.019  8.173   -6.897  1.00 0.00 ? 69 GLN A NE2  3  
ATOM 3840  H H    . GLN A 1 69 ? 2.178   3.545   -5.754  1.00 0.00 ? 69 GLN A H    3  
ATOM 3841  H HA   . GLN A 1 69 ? 1.271   3.694   -8.448  1.00 0.00 ? 69 GLN A HA   3  
ATOM 3842  H HB2  . GLN A 1 69 ? 3.066   5.503   -6.834  1.00 0.00 ? 69 GLN A HB2  3  
ATOM 3843  H HB3  . GLN A 1 69 ? 2.527   5.866   -8.468  1.00 0.00 ? 69 GLN A HB3  3  
ATOM 3844  H HG2  . GLN A 1 69 ? 0.178   5.310   -7.171  1.00 0.00 ? 69 GLN A HG2  3  
ATOM 3845  H HG3  . GLN A 1 69 ? 1.127   6.127   -5.930  1.00 0.00 ? 69 GLN A HG3  3  
ATOM 3846  H HE21 . GLN A 1 69 ? -0.290  7.895   -5.996  1.00 0.00 ? 69 GLN A HE21 3  
ATOM 3847  H HE22 . GLN A 1 69 ? -0.240  9.045   -7.284  1.00 0.00 ? 69 GLN A HE22 3  
ATOM 3848  N N    . VAL A 1 70 ? 4.338   2.854   -7.844  1.00 0.00 ? 70 VAL A N    3  
ATOM 3849  C CA   . VAL A 1 70 ? 5.560   2.334   -8.437  1.00 0.00 ? 70 VAL A CA   3  
ATOM 3850  C C    . VAL A 1 70 ? 5.304   1.011   -9.144  1.00 0.00 ? 70 VAL A C    3  
ATOM 3851  O O    . VAL A 1 70 ? 5.982   0.669   -10.112 1.00 0.00 ? 70 VAL A O    3  
ATOM 3852  C CB   . VAL A 1 70 ? 6.668   2.139   -7.394  1.00 0.00 ? 70 VAL A CB   3  
ATOM 3853  C CG1  . VAL A 1 70 ? 8.029   2.066   -8.068  1.00 0.00 ? 70 VAL A CG1  3  
ATOM 3854  C CG2  . VAL A 1 70 ? 6.638   3.249   -6.353  1.00 0.00 ? 70 VAL A CG2  3  
ATOM 3855  H H    . VAL A 1 70 ? 4.229   2.827   -6.873  1.00 0.00 ? 70 VAL A H    3  
ATOM 3856  H HA   . VAL A 1 70 ? 5.903   3.044   -9.154  1.00 0.00 ? 70 VAL A HA   3  
ATOM 3857  H HB   . VAL A 1 70 ? 6.489   1.207   -6.901  1.00 0.00 ? 70 VAL A HB   3  
ATOM 3858  H HG11 . VAL A 1 70 ? 8.495   3.041   -8.046  1.00 0.00 ? 70 VAL A HG11 3  
ATOM 3859  H HG12 . VAL A 1 70 ? 7.908   1.748   -9.092  1.00 0.00 ? 70 VAL A HG12 3  
ATOM 3860  H HG13 . VAL A 1 70 ? 8.653   1.358   -7.543  1.00 0.00 ? 70 VAL A HG13 3  
ATOM 3861  H HG21 . VAL A 1 70 ? 6.164   4.124   -6.773  1.00 0.00 ? 70 VAL A HG21 3  
ATOM 3862  H HG22 . VAL A 1 70 ? 7.647   3.493   -6.057  1.00 0.00 ? 70 VAL A HG22 3  
ATOM 3863  H HG23 . VAL A 1 70 ? 6.080   2.918   -5.490  1.00 0.00 ? 70 VAL A HG23 3  
ATOM 3864  N N    . LEU A 1 71 ? 4.316   0.275   -8.654  1.00 0.00 ? 71 LEU A N    3  
ATOM 3865  C CA   . LEU A 1 71 ? 3.960   -1.009  -9.239  1.00 0.00 ? 71 LEU A CA   3  
ATOM 3866  C C    . LEU A 1 71 ? 3.280   -0.817  -10.588 1.00 0.00 ? 71 LEU A C    3  
ATOM 3867  O O    . LEU A 1 71 ? 3.372   -1.671  -11.470 1.00 0.00 ? 71 LEU A O    3  
ATOM 3868  C CB   . LEU A 1 71 ? 3.051   -1.793  -8.293  1.00 0.00 ? 71 LEU A CB   3  
ATOM 3869  C CG   . LEU A 1 71 ? 3.623   -3.124  -7.802  1.00 0.00 ? 71 LEU A CG   3  
ATOM 3870  C CD1  . LEU A 1 71 ? 4.502   -2.909  -6.579  1.00 0.00 ? 71 LEU A CD1  3  
ATOM 3871  C CD2  . LEU A 1 71 ? 2.500   -4.101  -7.488  1.00 0.00 ? 71 LEU A CD2  3  
ATOM 3872  H H    . LEU A 1 71 ? 3.812   0.605   -7.885  1.00 0.00 ? 71 LEU A H    3  
ATOM 3873  H HA   . LEU A 1 71 ? 4.865   -1.560  -9.386  1.00 0.00 ? 71 LEU A HA   3  
ATOM 3874  H HB2  . LEU A 1 71 ? 2.847   -1.173  -7.434  1.00 0.00 ? 71 LEU A HB2  3  
ATOM 3875  H HB3  . LEU A 1 71 ? 2.123   -1.992  -8.802  1.00 0.00 ? 71 LEU A HB3  3  
ATOM 3876  H HG   . LEU A 1 71 ? 4.235   -3.555  -8.581  1.00 0.00 ? 71 LEU A HG   3  
ATOM 3877  H HD11 . LEU A 1 71 ? 3.981   -2.287  -5.866  1.00 0.00 ? 71 LEU A HD11 3  
ATOM 3878  H HD12 . LEU A 1 71 ? 5.420   -2.424  -6.877  1.00 0.00 ? 71 LEU A HD12 3  
ATOM 3879  H HD13 . LEU A 1 71 ? 4.728   -3.863  -6.126  1.00 0.00 ? 71 LEU A HD13 3  
ATOM 3880  H HD21 . LEU A 1 71 ? 2.137   -4.539  -8.406  1.00 0.00 ? 71 LEU A HD21 3  
ATOM 3881  H HD22 . LEU A 1 71 ? 1.694   -3.577  -6.996  1.00 0.00 ? 71 LEU A HD22 3  
ATOM 3882  H HD23 . LEU A 1 71 ? 2.871   -4.880  -6.839  1.00 0.00 ? 71 LEU A HD23 3  
ATOM 3883  N N    . ALA A 1 72 ? 2.602   0.312   -10.739 1.00 0.00 ? 72 ALA A N    3  
ATOM 3884  C CA   . ALA A 1 72 ? 1.908   0.626   -11.978 1.00 0.00 ? 72 ALA A CA   3  
ATOM 3885  C C    . ALA A 1 72 ? 2.898   0.954   -13.088 1.00 0.00 ? 72 ALA A C    3  
ATOM 3886  O O    . ALA A 1 72 ? 2.615   0.751   -14.268 1.00 0.00 ? 72 ALA A O    3  
ATOM 3887  C CB   . ALA A 1 72 ? 0.942   1.782   -11.767 1.00 0.00 ? 72 ALA A CB   3  
ATOM 3888  H H    . ALA A 1 72 ? 2.570   0.949   -10.000 1.00 0.00 ? 72 ALA A H    3  
ATOM 3889  H HA   . ALA A 1 72 ? 1.341   -0.240  -12.264 1.00 0.00 ? 72 ALA A HA   3  
ATOM 3890  H HB1  . ALA A 1 72 ? 0.869   2.361   -12.675 1.00 0.00 ? 72 ALA A HB1  3  
ATOM 3891  H HB2  . ALA A 1 72 ? 1.302   2.411   -10.967 1.00 0.00 ? 72 ALA A HB2  3  
ATOM 3892  H HB3  . ALA A 1 72 ? -0.033  1.394   -11.508 1.00 0.00 ? 72 ALA A HB3  3  
ATOM 3893  N N    . ARG A 1 73 ? 4.060   1.461   -12.697 1.00 0.00 ? 73 ARG A N    3  
ATOM 3894  C CA   . ARG A 1 73 ? 5.099   1.817   -13.651 1.00 0.00 ? 73 ARG A CA   3  
ATOM 3895  C C    . ARG A 1 73 ? 5.746   0.569   -14.239 1.00 0.00 ? 73 ARG A C    3  
ATOM 3896  O O    . ARG A 1 73 ? 6.235   0.582   -15.369 1.00 0.00 ? 73 ARG A O    3  
ATOM 3897  C CB   . ARG A 1 73 ? 6.160   2.693   -12.983 1.00 0.00 ? 73 ARG A CB   3  
ATOM 3898  C CG   . ARG A 1 73 ? 5.740   4.146   -12.829 1.00 0.00 ? 73 ARG A CG   3  
ATOM 3899  C CD   . ARG A 1 73 ? 6.946   5.067   -12.735 1.00 0.00 ? 73 ARG A CD   3  
ATOM 3900  N NE   . ARG A 1 73 ? 6.726   6.162   -11.793 1.00 0.00 ? 73 ARG A NE   3  
ATOM 3901  C CZ   . ARG A 1 73 ? 7.684   6.987   -11.379 1.00 0.00 ? 73 ARG A CZ   3  
ATOM 3902  N NH1  . ARG A 1 73 ? 8.928   6.845   -11.819 1.00 0.00 ? 73 ARG A NH1  3  
ATOM 3903  N NH2  . ARG A 1 73 ? 7.399   7.957   -10.521 1.00 0.00 ? 73 ARG A NH2  3  
ATOM 3904  H H    . ARG A 1 73 ? 4.222   1.596   -11.744 1.00 0.00 ? 73 ARG A H    3  
ATOM 3905  H HA   . ARG A 1 73 ? 4.635   2.371   -14.445 1.00 0.00 ? 73 ARG A HA   3  
ATOM 3906  H HB2  . ARG A 1 73 ? 6.372   2.296   -12.001 1.00 0.00 ? 73 ARG A HB2  3  
ATOM 3907  H HB3  . ARG A 1 73 ? 7.061   2.662   -13.577 1.00 0.00 ? 73 ARG A HB3  3  
ATOM 3908  H HG2  . ARG A 1 73 ? 5.147   4.432   -13.685 1.00 0.00 ? 73 ARG A HG2  3  
ATOM 3909  H HG3  . ARG A 1 73 ? 5.150   4.246   -11.930 1.00 0.00 ? 73 ARG A HG3  3  
ATOM 3910  H HD2  . ARG A 1 73 ? 7.798   4.490   -12.408 1.00 0.00 ? 73 ARG A HD2  3  
ATOM 3911  H HD3  . ARG A 1 73 ? 7.145   5.479   -13.713 1.00 0.00 ? 73 ARG A HD3  3  
ATOM 3912  H HE   . ARG A 1 73 ? 5.816   6.289   -11.452 1.00 0.00 ? 73 ARG A HE   3  
ATOM 3913  H HH11 . ARG A 1 73 ? 9.151   6.116   -12.466 1.00 0.00 ? 73 ARG A HH11 3  
ATOM 3914  H HH12 . ARG A 1 73 ? 9.644   7.468   -11.505 1.00 0.00 ? 73 ARG A HH12 3  
ATOM 3915  H HH21 . ARG A 1 73 ? 6.463   8.069   -10.186 1.00 0.00 ? 73 ARG A HH21 3  
ATOM 3916  H HH22 . ARG A 1 73 ? 8.119   8.577   -10.209 1.00 0.00 ? 73 ARG A HH22 3  
ATOM 3917  N N    . ARG A 1 74 ? 5.745   -0.505  -13.462 1.00 0.00 ? 74 ARG A N    3  
ATOM 3918  C CA   . ARG A 1 74 ? 6.330   -1.765  -13.897 1.00 0.00 ? 74 ARG A CA   3  
ATOM 3919  C C    . ARG A 1 74 ? 5.440   -2.456  -14.924 1.00 0.00 ? 74 ARG A C    3  
ATOM 3920  O O    . ARG A 1 74 ? 5.916   -3.233  -15.752 1.00 0.00 ? 74 ARG A O    3  
ATOM 3921  C CB   . ARG A 1 74 ? 6.559   -2.688  -12.698 1.00 0.00 ? 74 ARG A CB   3  
ATOM 3922  C CG   . ARG A 1 74 ? 7.754   -3.613  -12.862 1.00 0.00 ? 74 ARG A CG   3  
ATOM 3923  C CD   . ARG A 1 74 ? 9.066   -2.856  -12.730 1.00 0.00 ? 74 ARG A CD   3  
ATOM 3924  N NE   . ARG A 1 74 ? 10.140  -3.707  -12.224 1.00 0.00 ? 74 ARG A NE   3  
ATOM 3925  C CZ   . ARG A 1 74 ? 11.271  -3.240  -11.699 1.00 0.00 ? 74 ARG A CZ   3  
ATOM 3926  N NH1  . ARG A 1 74 ? 11.478  -1.932  -11.610 1.00 0.00 ? 74 ARG A NH1  3  
ATOM 3927  N NH2  . ARG A 1 74 ? 12.196  -4.083  -11.262 1.00 0.00 ? 74 ARG A NH2  3  
ATOM 3928  H H    . ARG A 1 74 ? 5.342   -0.449  -12.575 1.00 0.00 ? 74 ARG A H    3  
ATOM 3929  H HA   . ARG A 1 74 ? 7.276   -1.543  -14.353 1.00 0.00 ? 74 ARG A HA   3  
ATOM 3930  H HB2  . ARG A 1 74 ? 6.717   -2.082  -11.818 1.00 0.00 ? 74 ARG A HB2  3  
ATOM 3931  H HB3  . ARG A 1 74 ? 5.678   -3.295  -12.553 1.00 0.00 ? 74 ARG A HB3  3  
ATOM 3932  H HG2  . ARG A 1 74 ? 7.712   -4.377  -12.101 1.00 0.00 ? 74 ARG A HG2  3  
ATOM 3933  H HG3  . ARG A 1 74 ? 7.710   -4.072  -13.839 1.00 0.00 ? 74 ARG A HG3  3  
ATOM 3934  H HD2  . ARG A 1 74 ? 9.347   -2.477  -13.701 1.00 0.00 ? 74 ARG A HD2  3  
ATOM 3935  H HD3  . ARG A 1 74 ? 8.922   -2.030  -12.049 1.00 0.00 ? 74 ARG A HD3  3  
ATOM 3936  H HE   . ARG A 1 74 ? 10.012  -4.677  -12.278 1.00 0.00 ? 74 ARG A HE   3  
ATOM 3937  H HH11 . ARG A 1 74 ? 10.785  -1.291  -11.937 1.00 0.00 ? 74 ARG A HH11 3  
ATOM 3938  H HH12 . ARG A 1 74 ? 12.330  -1.588  -11.214 1.00 0.00 ? 74 ARG A HH12 3  
ATOM 3939  H HH21 . ARG A 1 74 ? 12.044  -5.070  -11.327 1.00 0.00 ? 74 ARG A HH21 3  
ATOM 3940  H HH22 . ARG A 1 74 ? 13.046  -3.733  -10.868 1.00 0.00 ? 74 ARG A HH22 3  
ATOM 3941  N N    . LYS A 1 75 ? 4.147   -2.169  -14.862 1.00 0.00 ? 75 LYS A N    3  
ATOM 3942  C CA   . LYS A 1 75 ? 3.187   -2.760  -15.779 1.00 0.00 ? 75 LYS A CA   3  
ATOM 3943  C C    . LYS A 1 75 ? 3.017   -1.902  -17.029 1.00 0.00 ? 75 LYS A C    3  
ATOM 3944  O O    . LYS A 1 75 ? 2.622   -2.396  -18.085 1.00 0.00 ? 75 LYS A O    3  
ATOM 3945  C CB   . LYS A 1 75 ? 1.836   -2.949  -15.086 1.00 0.00 ? 75 LYS A CB   3  
ATOM 3946  C CG   . LYS A 1 75 ? 0.877   -3.840  -15.857 1.00 0.00 ? 75 LYS A CG   3  
ATOM 3947  C CD   . LYS A 1 75 ? -0.448  -3.993  -15.127 1.00 0.00 ? 75 LYS A CD   3  
ATOM 3948  C CE   . LYS A 1 75 ? -1.463  -4.750  -15.968 1.00 0.00 ? 75 LYS A CE   3  
ATOM 3949  N NZ   . LYS A 1 75 ? -2.517  -5.385  -15.129 1.00 0.00 ? 75 LYS A NZ   3  
ATOM 3950  H H    . LYS A 1 75 ? 3.832   -1.549  -14.181 1.00 0.00 ? 75 LYS A H    3  
ATOM 3951  H HA   . LYS A 1 75 ? 3.568   -3.719  -16.068 1.00 0.00 ? 75 LYS A HA   3  
ATOM 3952  H HB2  . LYS A 1 75 ? 2.002   -3.390  -14.115 1.00 0.00 ? 75 LYS A HB2  3  
ATOM 3953  H HB3  . LYS A 1 75 ? 1.372   -1.982  -14.959 1.00 0.00 ? 75 LYS A HB3  3  
ATOM 3954  H HG2  . LYS A 1 75 ? 0.693   -3.403  -16.827 1.00 0.00 ? 75 LYS A HG2  3  
ATOM 3955  H HG3  . LYS A 1 75 ? 1.325   -4.815  -15.979 1.00 0.00 ? 75 LYS A HG3  3  
ATOM 3956  H HD2  . LYS A 1 75 ? -0.282  -4.536  -14.209 1.00 0.00 ? 75 LYS A HD2  3  
ATOM 3957  H HD3  . LYS A 1 75 ? -0.840  -3.012  -14.903 1.00 0.00 ? 75 LYS A HD3  3  
ATOM 3958  H HE2  . LYS A 1 75 ? -1.930  -4.060  -16.654 1.00 0.00 ? 75 LYS A HE2  3  
ATOM 3959  H HE3  . LYS A 1 75 ? -0.948  -5.518  -16.527 1.00 0.00 ? 75 LYS A HE3  3  
ATOM 3960  H HZ1  . LYS A 1 75 ? -2.259  -6.370  -14.917 1.00 0.00 ? 75 LYS A HZ1  3  
ATOM 3961  H HZ2  . LYS A 1 75 ? -3.427  -5.378  -15.632 1.00 0.00 ? 75 LYS A HZ2  3  
ATOM 3962  H HZ3  . LYS A 1 75 ? -2.624  -4.865  -14.235 1.00 0.00 ? 75 LYS A HZ3  3  
ATOM 3963  N N    . SER A 1 76 ? 3.312   -0.614  -16.900 1.00 0.00 ? 76 SER A N    3  
ATOM 3964  C CA   . SER A 1 76 ? 3.186   0.315   -18.015 1.00 0.00 ? 76 SER A CA   3  
ATOM 3965  C C    . SER A 1 76 ? 4.288   0.101   -19.047 1.00 0.00 ? 76 SER A C    3  
ATOM 3966  O O    . SER A 1 76 ? 4.155   0.504   -20.202 1.00 0.00 ? 76 SER A O    3  
ATOM 3967  C CB   . SER A 1 76 ? 3.217   1.759   -17.510 1.00 0.00 ? 76 SER A CB   3  
ATOM 3968  O OG   . SER A 1 76 ? 2.378   2.591   -18.293 1.00 0.00 ? 76 SER A OG   3  
ATOM 3969  H H    . SER A 1 76 ? 3.616   -0.280  -16.035 1.00 0.00 ? 76 SER A H    3  
ATOM 3970  H HA   . SER A 1 76 ? 2.238   0.129   -18.484 1.00 0.00 ? 76 SER A HA   3  
ATOM 3971  H HB2  . SER A 1 76 ? 2.875   1.788   -16.486 1.00 0.00 ? 76 SER A HB2  3  
ATOM 3972  H HB3  . SER A 1 76 ? 4.228   2.135   -17.563 1.00 0.00 ? 76 SER A HB3  3  
ATOM 3973  H HG   . SER A 1 76 ? 2.713   3.491   -18.275 1.00 0.00 ? 76 SER A HG   3  
ATOM 3974  N N    . ARG A 1 77 ? 5.374   -0.538  -18.628 1.00 0.00 ? 77 ARG A N    3  
ATOM 3975  C CA   . ARG A 1 77 ? 6.492   -0.805  -19.525 1.00 0.00 ? 77 ARG A CA   3  
ATOM 3976  C C    . ARG A 1 77 ? 6.076   -1.744  -20.658 1.00 0.00 ? 77 ARG A C    3  
ATOM 3977  O O    . ARG A 1 77 ? 6.788   -1.879  -21.653 1.00 0.00 ? 77 ARG A O    3  
ATOM 3978  C CB   . ARG A 1 77 ? 7.666   -1.408  -18.749 1.00 0.00 ? 77 ARG A CB   3  
ATOM 3979  C CG   . ARG A 1 77 ? 7.388   -2.800  -18.203 1.00 0.00 ? 77 ARG A CG   3  
ATOM 3980  C CD   . ARG A 1 77 ? 8.250   -3.851  -18.885 1.00 0.00 ? 77 ARG A CD   3  
ATOM 3981  N NE   . ARG A 1 77 ? 7.653   -4.327  -20.130 1.00 0.00 ? 77 ARG A NE   3  
ATOM 3982  C CZ   . ARG A 1 77 ? 8.319   -5.009  -21.059 1.00 0.00 ? 77 ARG A CZ   3  
ATOM 3983  N NH1  . ARG A 1 77 ? 9.603   -5.298  -20.886 1.00 0.00 ? 77 ARG A NH1  3  
ATOM 3984  N NH2  . ARG A 1 77 ? 7.700   -5.405  -22.163 1.00 0.00 ? 77 ARG A NH2  3  
ATOM 3985  H H    . ARG A 1 77 ? 5.425   -0.839  -17.699 1.00 0.00 ? 77 ARG A H    3  
ATOM 3986  H HA   . ARG A 1 77 ? 6.802   0.136   -19.952 1.00 0.00 ? 77 ARG A HA   3  
ATOM 3987  H HB2  . ARG A 1 77 ? 8.523   -1.464  -19.404 1.00 0.00 ? 77 ARG A HB2  3  
ATOM 3988  H HB3  . ARG A 1 77 ? 7.902   -0.760  -17.918 1.00 0.00 ? 77 ARG A HB3  3  
ATOM 3989  H HG2  . ARG A 1 77 ? 7.599   -2.809  -17.145 1.00 0.00 ? 77 ARG A HG2  3  
ATOM 3990  H HG3  . ARG A 1 77 ? 6.347   -3.039  -18.366 1.00 0.00 ? 77 ARG A HG3  3  
ATOM 3991  H HD2  . ARG A 1 77 ? 9.216   -3.420  -19.102 1.00 0.00 ? 77 ARG A HD2  3  
ATOM 3992  H HD3  . ARG A 1 77 ? 8.374   -4.688  -18.213 1.00 0.00 ? 77 ARG A HD3  3  
ATOM 3993  H HE   . ARG A 1 77 ? 6.705   -4.128  -20.283 1.00 0.00 ? 77 ARG A HE   3  
ATOM 3994  H HH11 . ARG A 1 77 ? 10.076  -5.003  -20.056 1.00 0.00 ? 77 ARG A HH11 3  
ATOM 3995  H HH12 . ARG A 1 77 ? 10.099  -5.811  -21.587 1.00 0.00 ? 77 ARG A HH12 3  
ATOM 3996  H HH21 . ARG A 1 77 ? 6.733   -5.191  -22.298 1.00 0.00 ? 77 ARG A HH21 3  
ATOM 3997  H HH22 . ARG A 1 77 ? 8.201   -5.917  -22.860 1.00 0.00 ? 77 ARG A HH22 3  
ATOM 3998  N N    . ASP A 1 78 ? 4.923   -2.392  -20.502 1.00 0.00 ? 78 ASP A N    3  
ATOM 3999  C CA   . ASP A 1 78 ? 4.425   -3.315  -21.513 1.00 0.00 ? 78 ASP A CA   3  
ATOM 4000  C C    . ASP A 1 78 ? 4.042   -2.579  -22.793 1.00 0.00 ? 78 ASP A C    3  
ATOM 4001  O O    . ASP A 1 78 ? 4.004   -3.170  -23.873 1.00 0.00 ? 78 ASP A O    3  
ATOM 4002  C CB   . ASP A 1 78 ? 3.226   -4.093  -20.975 1.00 0.00 ? 78 ASP A CB   3  
ATOM 4003  C CG   . ASP A 1 78 ? 3.488   -5.585  -20.903 1.00 0.00 ? 78 ASP A CG   3  
ATOM 4004  O OD1  . ASP A 1 78 ? 3.997   -6.049  -19.861 1.00 0.00 ? 78 ASP A OD1  3  
ATOM 4005  O OD2  . ASP A 1 78 ? 3.184   -6.289  -21.889 1.00 0.00 ? 78 ASP A OD2  3  
ATOM 4006  H H    . ASP A 1 78 ? 4.397   -2.249  -19.689 1.00 0.00 ? 78 ASP A H    3  
ATOM 4007  H HA   . ASP A 1 78 ? 5.212   -4.008  -21.737 1.00 0.00 ? 78 ASP A HA   3  
ATOM 4008  H HB2  . ASP A 1 78 ? 2.995   -3.740  -19.983 1.00 0.00 ? 78 ASP A HB2  3  
ATOM 4009  H HB3  . ASP A 1 78 ? 2.378   -3.926  -21.620 1.00 0.00 ? 78 ASP A HB3  3  
ATOM 4010  N N    . LEU A 1 79 ? 3.757   -1.289  -22.665 1.00 0.00 ? 79 LEU A N    3  
ATOM 4011  C CA   . LEU A 1 79 ? 3.375   -0.472  -23.810 1.00 0.00 ? 79 LEU A CA   3  
ATOM 4012  C C    . LEU A 1 79 ? 4.535   -0.331  -24.791 1.00 0.00 ? 79 LEU A C    3  
ATOM 4013  O O    . LEU A 1 79 ? 5.199   0.705   -24.838 1.00 0.00 ? 79 LEU A O    3  
ATOM 4014  C CB   . LEU A 1 79 ? 2.912   0.911   -23.346 1.00 0.00 ? 79 LEU A CB   3  
ATOM 4015  C CG   . LEU A 1 79 ? 1.432   1.006   -22.971 1.00 0.00 ? 79 LEU A CG   3  
ATOM 4016  C CD1  . LEU A 1 79 ? 1.153   2.303   -22.228 1.00 0.00 ? 79 LEU A CD1  3  
ATOM 4017  C CD2  . LEU A 1 79 ? 0.561   0.902   -24.213 1.00 0.00 ? 79 LEU A CD2  3  
ATOM 4018  H H    . LEU A 1 79 ? 3.802   -0.876  -21.780 1.00 0.00 ? 79 LEU A H    3  
ATOM 4019  H HA   . LEU A 1 79 ? 2.556   -0.966  -24.308 1.00 0.00 ? 79 LEU A HA   3  
ATOM 4020  H HB2  . LEU A 1 79 ? 3.500   1.193   -22.484 1.00 0.00 ? 79 LEU A HB2  3  
ATOM 4021  H HB3  . LEU A 1 79 ? 3.105   1.617   -24.139 1.00 0.00 ? 79 LEU A HB3  3  
ATOM 4022  H HG   . LEU A 1 79 ? 1.180   0.185   -22.315 1.00 0.00 ? 79 LEU A HG   3  
ATOM 4023  H HD11 . LEU A 1 79 ? 1.283   3.138   -22.900 1.00 0.00 ? 79 LEU A HD11 3  
ATOM 4024  H HD12 . LEU A 1 79 ? 1.838   2.398   -21.398 1.00 0.00 ? 79 LEU A HD12 3  
ATOM 4025  H HD13 . LEU A 1 79 ? 0.138   2.293   -21.857 1.00 0.00 ? 79 LEU A HD13 3  
ATOM 4026  H HD21 . LEU A 1 79 ? 0.673   -0.078  -24.651 1.00 0.00 ? 79 LEU A HD21 3  
ATOM 4027  H HD22 . LEU A 1 79 ? 0.864   1.653   -24.929 1.00 0.00 ? 79 LEU A HD22 3  
ATOM 4028  H HD23 . LEU A 1 79 ? -0.473  1.059   -23.943 1.00 0.00 ? 79 LEU A HD23 3  
ATOM 4029  N N    . VAL A 1 80 ? 4.772   -1.378  -25.574 1.00 0.00 ? 80 VAL A N    3  
ATOM 4030  C CA   . VAL A 1 80 ? 5.851   -1.371  -26.553 1.00 0.00 ? 80 VAL A CA   3  
ATOM 4031  C C    . VAL A 1 80 ? 5.604   -0.319  -27.634 1.00 0.00 ? 80 VAL A C    3  
ATOM 4032  O O    . VAL A 1 80 ? 4.488   -0.186  -28.135 1.00 0.00 ? 80 VAL A O    3  
ATOM 4033  C CB   . VAL A 1 80 ? 6.013   -2.753  -27.218 1.00 0.00 ? 80 VAL A CB   3  
ATOM 4034  C CG1  . VAL A 1 80 ? 4.743   -3.145  -27.959 1.00 0.00 ? 80 VAL A CG1  3  
ATOM 4035  C CG2  . VAL A 1 80 ? 7.211   -2.761  -28.156 1.00 0.00 ? 80 VAL A CG2  3  
ATOM 4036  H H    . VAL A 1 80 ? 4.209   -2.175  -25.490 1.00 0.00 ? 80 VAL A H    3  
ATOM 4037  H HA   . VAL A 1 80 ? 6.767   -1.136  -26.033 1.00 0.00 ? 80 VAL A HA   3  
ATOM 4038  H HB   . VAL A 1 80 ? 6.187   -3.484  -26.441 1.00 0.00 ? 80 VAL A HB   3  
ATOM 4039  H HG11 . VAL A 1 80 ? 4.630   -4.219  -27.936 1.00 0.00 ? 80 VAL A HG11 3  
ATOM 4040  H HG12 . VAL A 1 80 ? 4.807   -2.811  -28.984 1.00 0.00 ? 80 VAL A HG12 3  
ATOM 4041  H HG13 . VAL A 1 80 ? 3.891   -2.683  -27.483 1.00 0.00 ? 80 VAL A HG13 3  
ATOM 4042  H HG21 . VAL A 1 80 ? 8.119   -2.651  -27.581 1.00 0.00 ? 80 VAL A HG21 3  
ATOM 4043  H HG22 . VAL A 1 80 ? 7.126   -1.943  -28.855 1.00 0.00 ? 80 VAL A HG22 3  
ATOM 4044  H HG23 . VAL A 1 80 ? 7.238   -3.695  -28.697 1.00 0.00 ? 80 VAL A HG23 3  
ATOM 4045  N N    . PRO A 1 81 ? 6.645   0.446   -28.010 1.00 0.00 ? 81 PRO A N    3  
ATOM 4046  C CA   . PRO A 1 81 ? 6.529   1.486   -29.038 1.00 0.00 ? 81 PRO A CA   3  
ATOM 4047  C C    . PRO A 1 81 ? 6.252   0.907   -30.421 1.00 0.00 ? 81 PRO A C    3  
ATOM 4048  O O    . PRO A 1 81 ? 7.144   0.840   -31.267 1.00 0.00 ? 81 PRO A O    3  
ATOM 4049  C CB   . PRO A 1 81 ? 7.892   2.177   -29.008 1.00 0.00 ? 81 PRO A CB   3  
ATOM 4050  C CG   . PRO A 1 81 ? 8.819   1.156   -28.455 1.00 0.00 ? 81 PRO A CG   3  
ATOM 4051  C CD   . PRO A 1 81 ? 8.013   0.359   -27.470 1.00 0.00 ? 81 PRO A CD   3  
ATOM 4052  H HA   . PRO A 1 81 ? 5.762   2.198   -28.788 1.00 0.00 ? 81 PRO A HA   3  
ATOM 4053  H HB2  . PRO A 1 81 ? 8.174   2.467   -30.010 1.00 0.00 ? 81 PRO A HB2  3  
ATOM 4054  H HB3  . PRO A 1 81 ? 7.844   3.050   -28.375 1.00 0.00 ? 81 PRO A HB3  3  
ATOM 4055  H HG2  . PRO A 1 81 ? 9.174   0.519   -29.249 1.00 0.00 ? 81 PRO A HG2  3  
ATOM 4056  H HG3  . PRO A 1 81 ? 9.644   1.641   -27.960 1.00 0.00 ? 81 PRO A HG3  3  
ATOM 4057  H HD2  . PRO A 1 81 ? 8.355   -0.665  -27.442 1.00 0.00 ? 81 PRO A HD2  3  
ATOM 4058  H HD3  . PRO A 1 81 ? 8.068   0.805   -26.488 1.00 0.00 ? 81 PRO A HD3  3  
ATOM 4059  N N    . ARG A 1 82 ? 5.010   0.490   -30.645 1.00 0.00 ? 82 ARG A N    3  
ATOM 4060  C CA   . ARG A 1 82 ? 4.615   -0.083  -31.926 1.00 0.00 ? 82 ARG A CA   3  
ATOM 4061  C C    . ARG A 1 82 ? 5.440   -1.326  -32.244 1.00 0.00 ? 82 ARG A C    3  
ATOM 4062  O O    . ARG A 1 82 ? 5.366   -1.806  -33.395 1.00 0.00 ? 82 ARG A O    3  
ATOM 4063  C CB   . ARG A 1 82 ? 4.776   0.950   -33.043 1.00 0.00 ? 82 ARG A CB   3  
ATOM 4064  C CG   . ARG A 1 82 ? 3.525   1.776   -33.292 1.00 0.00 ? 82 ARG A CG   3  
ATOM 4065  C CD   . ARG A 1 82 ? 3.601   3.126   -32.598 1.00 0.00 ? 82 ARG A CD   3  
ATOM 4066  N NE   . ARG A 1 82 ? 2.395   3.922   -32.816 1.00 0.00 ? 82 ARG A NE   3  
ATOM 4067  C CZ   . ARG A 1 82 ? 2.082   4.489   -33.979 1.00 0.00 ? 82 ARG A CZ   3  
ATOM 4068  N NH1  . ARG A 1 82 ? 2.881   4.350   -35.030 1.00 0.00 ? 82 ARG A NH1  3  
ATOM 4069  N NH2  . ARG A 1 82 ? 0.966   5.196   -34.092 1.00 0.00 ? 82 ARG A NH2  3  
ATOM 4070  O OXT  . ARG A 1 82 ? 6.154   -1.809  -31.340 1.00 0.00 ? 82 ARG A OXT  3  
ATOM 4071  H H    . ARG A 1 82 ? 4.343   0.570   -29.931 1.00 0.00 ? 82 ARG A H    3  
ATOM 4072  H HA   . ARG A 1 82 ? 3.575   -0.365  -31.856 1.00 0.00 ? 82 ARG A HA   3  
ATOM 4073  H HB2  . ARG A 1 82 ? 5.580   1.623   -32.781 1.00 0.00 ? 82 ARG A HB2  3  
ATOM 4074  H HB3  . ARG A 1 82 ? 5.032   0.437   -33.958 1.00 0.00 ? 82 ARG A HB3  3  
ATOM 4075  H HG2  . ARG A 1 82 ? 3.416   1.935   -34.354 1.00 0.00 ? 82 ARG A HG2  3  
ATOM 4076  H HG3  . ARG A 1 82 ? 2.668   1.235   -32.916 1.00 0.00 ? 82 ARG A HG3  3  
ATOM 4077  H HD2  . ARG A 1 82 ? 3.726   2.965   -31.537 1.00 0.00 ? 82 ARG A HD2  3  
ATOM 4078  H HD3  . ARG A 1 82 ? 4.453   3.667   -32.983 1.00 0.00 ? 82 ARG A HD3  3  
ATOM 4079  H HE   . ARG A 1 82 ? 1.788   4.041   -32.057 1.00 0.00 ? 82 ARG A HE   3  
ATOM 4080  H HH11 . ARG A 1 82 ? 3.724   3.818   -34.951 1.00 0.00 ? 82 ARG A HH11 3  
ATOM 4081  H HH12 . ARG A 1 82 ? 2.640   4.778   -35.901 1.00 0.00 ? 82 ARG A HH12 3  
ATOM 4082  H HH21 . ARG A 1 82 ? 0.360   5.304   -33.304 1.00 0.00 ? 82 ARG A HH21 3  
ATOM 4083  H HH22 . ARG A 1 82 ? 0.730   5.622   -34.966 1.00 0.00 ? 82 ARG A HH22 3  
ATOM 4084  N N    . MET A 1 1  ? 19.495  11.089  8.229   1.00 0.00 ? 1  MET A N    4  
ATOM 4085  C CA   . MET A 1 1  ? 18.100  10.862  7.769   1.00 0.00 ? 1  MET A CA   4  
ATOM 4086  C C    . MET A 1 1  ? 17.754  9.377   7.769   1.00 0.00 ? 1  MET A C    4  
ATOM 4087  O O    . MET A 1 1  ? 16.943  8.918   8.574   1.00 0.00 ? 1  MET A O    4  
ATOM 4088  C CB   . MET A 1 1  ? 17.952  11.439  6.359   1.00 0.00 ? 1  MET A CB   4  
ATOM 4089  C CG   . MET A 1 1  ? 16.555  11.280  5.781   1.00 0.00 ? 1  MET A CG   4  
ATOM 4090  S SD   . MET A 1 1  ? 16.571  10.918  4.015   1.00 0.00 ? 1  MET A SD   4  
ATOM 4091  C CE   . MET A 1 1  ? 17.767  12.119  3.434   1.00 0.00 ? 1  MET A CE   4  
ATOM 4092  H H1   . MET A 1 1  ? 19.515  10.955  9.259   1.00 0.00 ? 1  MET A H1   4  
ATOM 4093  H H2   . MET A 1 1  ? 19.760  12.061  7.970   1.00 0.00 ? 1  MET A H2   4  
ATOM 4094  H H3   . MET A 1 1  ? 20.103  10.394  7.750   1.00 0.00 ? 1  MET A H3   4  
ATOM 4095  H HA   . MET A 1 1  ? 17.429  11.381  8.437   1.00 0.00 ? 1  MET A HA   4  
ATOM 4096  H HB2  . MET A 1 1  ? 18.189  12.492  6.387   1.00 0.00 ? 1  MET A HB2  4  
ATOM 4097  H HB3  . MET A 1 1  ? 18.649  10.938  5.703   1.00 0.00 ? 1  MET A HB3  4  
ATOM 4098  H HG2  . MET A 1 1  ? 16.057  10.471  6.294   1.00 0.00 ? 1  MET A HG2  4  
ATOM 4099  H HG3  . MET A 1 1  ? 16.008  12.197  5.942   1.00 0.00 ? 1  MET A HG3  4  
ATOM 4100  H HE1  . MET A 1 1  ? 18.696  11.990  3.970   1.00 0.00 ? 1  MET A HE1  4  
ATOM 4101  H HE2  . MET A 1 1  ? 17.388  13.116  3.604   1.00 0.00 ? 1  MET A HE2  4  
ATOM 4102  H HE3  . MET A 1 1  ? 17.938  11.974  2.377   1.00 0.00 ? 1  MET A HE3  4  
ATOM 4103  N N    . ASP A 1 2  ? 18.372  8.630   6.860   1.00 0.00 ? 2  ASP A N    4  
ATOM 4104  C CA   . ASP A 1 2  ? 18.136  7.204   6.750   1.00 0.00 ? 2  ASP A CA   4  
ATOM 4105  C C    . ASP A 1 2  ? 18.541  6.481   8.031   1.00 0.00 ? 2  ASP A C    4  
ATOM 4106  O O    . ASP A 1 2  ? 19.695  6.083   8.192   1.00 0.00 ? 2  ASP A O    4  
ATOM 4107  C CB   . ASP A 1 2  ? 18.915  6.645   5.562   1.00 0.00 ? 2  ASP A CB   4  
ATOM 4108  C CG   . ASP A 1 2  ? 20.353  7.128   5.527   1.00 0.00 ? 2  ASP A CG   4  
ATOM 4109  O OD1  . ASP A 1 2  ? 21.192  6.548   6.247   1.00 0.00 ? 2  ASP A OD1  4  
ATOM 4110  O OD2  . ASP A 1 2  ? 20.638  8.088   4.780   1.00 0.00 ? 2  ASP A OD2  4  
ATOM 4111  H H    . ASP A 1 2  ? 19.006  9.048   6.246   1.00 0.00 ? 2  ASP A H    4  
ATOM 4112  H HA   . ASP A 1 2  ? 17.080  7.052   6.581   1.00 0.00 ? 2  ASP A HA   4  
ATOM 4113  H HB2  . ASP A 1 2  ? 18.922  5.576   5.624   1.00 0.00 ? 2  ASP A HB2  4  
ATOM 4114  H HB3  . ASP A 1 2  ? 18.430  6.947   4.646   1.00 0.00 ? 2  ASP A HB3  4  
ATOM 4115  N N    . ASN A 1 3  ? 17.585  6.314   8.939   1.00 0.00 ? 3  ASN A N    4  
ATOM 4116  C CA   . ASN A 1 3  ? 17.834  5.643   10.201  1.00 0.00 ? 3  ASN A CA   4  
ATOM 4117  C C    . ASN A 1 3  ? 18.285  4.200   9.982   1.00 0.00 ? 3  ASN A C    4  
ATOM 4118  O O    . ASN A 1 3  ? 18.883  3.587   10.865  1.00 0.00 ? 3  ASN A O    4  
ATOM 4119  C CB   . ASN A 1 3  ? 16.570  5.674   11.056  1.00 0.00 ? 3  ASN A CB   4  
ATOM 4120  C CG   . ASN A 1 3  ? 15.328  5.285   10.277  1.00 0.00 ? 3  ASN A CG   4  
ATOM 4121  O OD1  . ASN A 1 3  ? 14.529  6.139   9.891   1.00 0.00 ? 3  ASN A OD1  4  
ATOM 4122  N ND2  . ASN A 1 3  ? 15.159  3.989   10.042  1.00 0.00 ? 3  ASN A ND2  4  
ATOM 4123  H H    . ASN A 1 3  ? 16.686  6.650   8.758   1.00 0.00 ? 3  ASN A H    4  
ATOM 4124  H HA   . ASN A 1 3  ? 18.617  6.178   10.712  1.00 0.00 ? 3  ASN A HA   4  
ATOM 4125  H HB2  . ASN A 1 3  ? 16.685  4.988   11.869  1.00 0.00 ? 3  ASN A HB2  4  
ATOM 4126  H HB3  . ASN A 1 3  ? 16.430  6.671   11.446  1.00 0.00 ? 3  ASN A HB3  4  
ATOM 4127  H HD21 . ASN A 1 3  ? 15.835  3.365   10.379  1.00 0.00 ? 3  ASN A HD21 4  
ATOM 4128  H HD22 . ASN A 1 3  ? 14.365  3.709   9.541   1.00 0.00 ? 3  ASN A HD22 4  
ATOM 4129  N N    . ASP A 1 4  ? 17.994  3.666   8.801   1.00 0.00 ? 4  ASP A N    4  
ATOM 4130  C CA   . ASP A 1 4  ? 18.370  2.297   8.467   1.00 0.00 ? 4  ASP A CA   4  
ATOM 4131  C C    . ASP A 1 4  ? 19.881  2.101   8.552   1.00 0.00 ? 4  ASP A C    4  
ATOM 4132  O O    . ASP A 1 4  ? 20.364  0.977   8.685   1.00 0.00 ? 4  ASP A O    4  
ATOM 4133  C CB   . ASP A 1 4  ? 17.872  1.937   7.069   1.00 0.00 ? 4  ASP A CB   4  
ATOM 4134  C CG   . ASP A 1 4  ? 16.881  0.789   7.083   1.00 0.00 ? 4  ASP A CG   4  
ATOM 4135  O OD1  . ASP A 1 4  ? 17.293  -0.346  7.404   1.00 0.00 ? 4  ASP A OD1  4  
ATOM 4136  O OD2  . ASP A 1 4  ? 15.694  1.025   6.774   1.00 0.00 ? 4  ASP A OD2  4  
ATOM 4137  H H    . ASP A 1 4  ? 17.516  4.204   8.137   1.00 0.00 ? 4  ASP A H    4  
ATOM 4138  H HA   . ASP A 1 4  ? 17.898  1.645   9.179   1.00 0.00 ? 4  ASP A HA   4  
ATOM 4139  H HB2  . ASP A 1 4  ? 17.388  2.798   6.637   1.00 0.00 ? 4  ASP A HB2  4  
ATOM 4140  H HB3  . ASP A 1 4  ? 18.713  1.655   6.456   1.00 0.00 ? 4  ASP A HB3  4  
ATOM 4141  N N    . ALA A 1 5  ? 20.623  3.201   8.472   1.00 0.00 ? 5  ALA A N    4  
ATOM 4142  C CA   . ALA A 1 5  ? 22.078  3.147   8.538   1.00 0.00 ? 5  ALA A CA   4  
ATOM 4143  C C    . ALA A 1 5  ? 22.551  2.527   9.848   1.00 0.00 ? 5  ALA A C    4  
ATOM 4144  O O    . ALA A 1 5  ? 23.644  1.967   9.922   1.00 0.00 ? 5  ALA A O    4  
ATOM 4145  C CB   . ALA A 1 5  ? 22.666  4.540   8.368   1.00 0.00 ? 5  ALA A CB   4  
ATOM 4146  H H    . ALA A 1 5  ? 20.181  4.068   8.366   1.00 0.00 ? 5  ALA A H    4  
ATOM 4147  H HA   . ALA A 1 5  ? 22.423  2.535   7.722   1.00 0.00 ? 5  ALA A HA   4  
ATOM 4148  H HB1  . ALA A 1 5  ? 23.684  4.548   8.729   1.00 0.00 ? 5  ALA A HB1  4  
ATOM 4149  H HB2  . ALA A 1 5  ? 22.079  5.250   8.932   1.00 0.00 ? 5  ALA A HB2  4  
ATOM 4150  H HB3  . ALA A 1 5  ? 22.653  4.811   7.323   1.00 0.00 ? 5  ALA A HB3  4  
ATOM 4151  N N    . GLU A 1 6  ? 21.721  2.633   10.877  1.00 0.00 ? 6  GLU A N    4  
ATOM 4152  C CA   . GLU A 1 6  ? 22.050  2.085   12.184  1.00 0.00 ? 6  GLU A CA   4  
ATOM 4153  C C    . GLU A 1 6  ? 21.372  0.746   12.411  1.00 0.00 ? 6  GLU A C    4  
ATOM 4154  O O    . GLU A 1 6  ? 21.241  0.276   13.542  1.00 0.00 ? 6  GLU A O    4  
ATOM 4155  C CB   . GLU A 1 6  ? 21.637  3.056   13.276  1.00 0.00 ? 6  GLU A CB   4  
ATOM 4156  C CG   . GLU A 1 6  ? 22.662  4.145   13.550  1.00 0.00 ? 6  GLU A CG   4  
ATOM 4157  C CD   . GLU A 1 6  ? 22.065  5.340   14.266  1.00 0.00 ? 6  GLU A CD   4  
ATOM 4158  O OE1  . GLU A 1 6  ? 21.272  6.074   13.639  1.00 0.00 ? 6  GLU A OE1  4  
ATOM 4159  O OE2  . GLU A 1 6  ? 22.389  5.543   15.455  1.00 0.00 ? 6  GLU A OE2  4  
ATOM 4160  H H    . GLU A 1 6  ? 20.872  3.089   10.755  1.00 0.00 ? 6  GLU A H    4  
ATOM 4161  H HA   . GLU A 1 6  ? 23.104  1.942   12.210  1.00 0.00 ? 6  GLU A HA   4  
ATOM 4162  H HB2  . GLU A 1 6  ? 20.712  3.523   12.978  1.00 0.00 ? 6  GLU A HB2  4  
ATOM 4163  H HB3  . GLU A 1 6  ? 21.475  2.502   14.185  1.00 0.00 ? 6  GLU A HB3  4  
ATOM 4164  H HG2  . GLU A 1 6  ? 23.450  3.734   14.163  1.00 0.00 ? 6  GLU A HG2  4  
ATOM 4165  H HG3  . GLU A 1 6  ? 23.076  4.477   12.609  1.00 0.00 ? 6  GLU A HG3  4  
ATOM 4166  N N    . GLY A 1 7  ? 20.950  0.149   11.323  1.00 0.00 ? 7  GLY A N    4  
ATOM 4167  C CA   . GLY A 1 7  ? 20.282  -1.140  11.373  1.00 0.00 ? 7  GLY A CA   4  
ATOM 4168  C C    . GLY A 1 7  ? 19.118  -1.161  12.347  1.00 0.00 ? 7  GLY A C    4  
ATOM 4169  O O    . GLY A 1 7  ? 18.736  -2.221  12.843  1.00 0.00 ? 7  GLY A O    4  
ATOM 4170  H H    . GLY A 1 7  ? 21.097  0.595   10.471  1.00 0.00 ? 7  GLY A H    4  
ATOM 4171  H HA2  . GLY A 1 7  ? 19.914  -1.380  10.387  1.00 0.00 ? 7  GLY A HA2  4  
ATOM 4172  H HA3  . GLY A 1 7  ? 20.998  -1.891  11.671  1.00 0.00 ? 7  GLY A HA3  4  
ATOM 4173  N N    . VAL A 1 8  ? 18.555  0.011   12.624  1.00 0.00 ? 8  VAL A N    4  
ATOM 4174  C CA   . VAL A 1 8  ? 17.433  0.120   13.544  1.00 0.00 ? 8  VAL A CA   4  
ATOM 4175  C C    . VAL A 1 8  ? 16.148  -0.409  12.916  1.00 0.00 ? 8  VAL A C    4  
ATOM 4176  O O    . VAL A 1 8  ? 15.244  -0.867  13.615  1.00 0.00 ? 8  VAL A O    4  
ATOM 4177  C CB   . VAL A 1 8  ? 17.216  1.578   13.997  1.00 0.00 ? 8  VAL A CB   4  
ATOM 4178  C CG1  . VAL A 1 8  ? 16.883  2.467   12.808  1.00 0.00 ? 8  VAL A CG1  4  
ATOM 4179  C CG2  . VAL A 1 8  ? 16.122  1.654   15.053  1.00 0.00 ? 8  VAL A CG2  4  
ATOM 4180  H H    . VAL A 1 8  ? 18.903  0.820   12.201  1.00 0.00 ? 8  VAL A H    4  
ATOM 4181  H HA   . VAL A 1 8  ? 17.664  -0.472  14.410  1.00 0.00 ? 8  VAL A HA   4  
ATOM 4182  H HB   . VAL A 1 8  ? 18.135  1.936   14.437  1.00 0.00 ? 8  VAL A HB   4  
ATOM 4183  H HG11 . VAL A 1 8  ? 17.216  1.990   11.898  1.00 0.00 ? 8  VAL A HG11 4  
ATOM 4184  H HG12 . VAL A 1 8  ? 17.381  3.418   12.919  1.00 0.00 ? 8  VAL A HG12 4  
ATOM 4185  H HG13 . VAL A 1 8  ? 15.815  2.623   12.763  1.00 0.00 ? 8  VAL A HG13 4  
ATOM 4186  H HG21 . VAL A 1 8  ? 15.156  1.669   14.570  1.00 0.00 ? 8  VAL A HG21 4  
ATOM 4187  H HG22 . VAL A 1 8  ? 16.247  2.555   15.636  1.00 0.00 ? 8  VAL A HG22 4  
ATOM 4188  H HG23 . VAL A 1 8  ? 16.187  0.793   15.702  1.00 0.00 ? 8  VAL A HG23 4  
ATOM 4189  N N    . TRP A 1 9  ? 16.077  -0.339  11.594  1.00 0.00 ? 9  TRP A N    4  
ATOM 4190  C CA   . TRP A 1 9  ? 14.907  -0.806  10.864  1.00 0.00 ? 9  TRP A CA   4  
ATOM 4191  C C    . TRP A 1 9  ? 14.841  -2.330  10.851  1.00 0.00 ? 9  TRP A C    4  
ATOM 4192  O O    . TRP A 1 9  ? 15.805  -3.006  11.211  1.00 0.00 ? 9  TRP A O    4  
ATOM 4193  C CB   . TRP A 1 9  ? 14.926  -0.268  9.435   1.00 0.00 ? 9  TRP A CB   4  
ATOM 4194  C CG   . TRP A 1 9  ? 13.757  0.614   9.116   1.00 0.00 ? 9  TRP A CG   4  
ATOM 4195  C CD1  . TRP A 1 9  ? 13.065  0.664   7.941   1.00 0.00 ? 9  TRP A CD1  4  
ATOM 4196  C CD2  . TRP A 1 9  ? 13.145  1.574   9.985   1.00 0.00 ? 9  TRP A CD2  4  
ATOM 4197  N NE1  . TRP A 1 9  ? 12.059  1.596   8.025   1.00 0.00 ? 9  TRP A NE1  4  
ATOM 4198  C CE2  . TRP A 1 9  ? 12.088  2.168   9.271   1.00 0.00 ? 9  TRP A CE2  4  
ATOM 4199  C CE3  . TRP A 1 9  ? 13.387  1.988   11.298  1.00 0.00 ? 9  TRP A CE3  4  
ATOM 4200  C CZ2  . TRP A 1 9  ? 11.275  3.154   9.825   1.00 0.00 ? 9  TRP A CZ2  4  
ATOM 4201  C CZ3  . TRP A 1 9  ? 12.580  2.966   11.848  1.00 0.00 ? 9  TRP A CZ3  4  
ATOM 4202  C CH2  . TRP A 1 9  ? 11.535  3.539   11.112  1.00 0.00 ? 9  TRP A CH2  4  
ATOM 4203  H H    . TRP A 1 9  ? 16.828  0.038   11.098  1.00 0.00 ? 9  TRP A H    4  
ATOM 4204  H HA   . TRP A 1 9  ? 14.037  -0.425  11.364  1.00 0.00 ? 9  TRP A HA   4  
ATOM 4205  H HB2  . TRP A 1 9  ? 15.825  0.306   9.289   1.00 0.00 ? 9  TRP A HB2  4  
ATOM 4206  H HB3  . TRP A 1 9  ? 14.916  -1.098  8.747   1.00 0.00 ? 9  TRP A HB3  4  
ATOM 4207  H HD1  . TRP A 1 9  ? 13.287  0.054   7.078   1.00 0.00 ? 9  TRP A HD1  4  
ATOM 4208  H HE1  . TRP A 1 9  ? 11.425  1.816   7.311   1.00 0.00 ? 9  TRP A HE1  4  
ATOM 4209  H HE3  . TRP A 1 9  ? 14.188  1.557   11.881  1.00 0.00 ? 9  TRP A HE3  4  
ATOM 4210  H HZ2  . TRP A 1 9  ? 10.465  3.605   9.272   1.00 0.00 ? 9  TRP A HZ2  4  
ATOM 4211  H HZ3  . TRP A 1 9  ? 12.752  3.299   12.860  1.00 0.00 ? 9  TRP A HZ3  4  
ATOM 4212  H HH2  . TRP A 1 9  ? 10.930  4.301   11.581  1.00 0.00 ? 9  TRP A HH2  4  
ATOM 4213  N N    . SER A 1 10 ? 13.699  -2.863  10.431  1.00 0.00 ? 10 SER A N    4  
ATOM 4214  C CA   . SER A 1 10 ? 13.505  -4.300  10.365  1.00 0.00 ? 10 SER A CA   4  
ATOM 4215  C C    . SER A 1 10 ? 12.818  -4.698  9.061   1.00 0.00 ? 10 SER A C    4  
ATOM 4216  O O    . SER A 1 10 ? 12.017  -3.939  8.516   1.00 0.00 ? 10 SER A O    4  
ATOM 4217  C CB   . SER A 1 10 ? 12.681  -4.783  11.561  1.00 0.00 ? 10 SER A CB   4  
ATOM 4218  O OG   . SER A 1 10 ? 13.516  -5.098  12.662  1.00 0.00 ? 10 SER A OG   4  
ATOM 4219  H H    . SER A 1 10 ? 12.974  -2.277  10.155  1.00 0.00 ? 10 SER A H    4  
ATOM 4220  H HA   . SER A 1 10 ? 14.475  -4.757  10.400  1.00 0.00 ? 10 SER A HA   4  
ATOM 4221  H HB2  . SER A 1 10 ? 11.993  -4.006  11.858  1.00 0.00 ? 10 SER A HB2  4  
ATOM 4222  H HB3  . SER A 1 10 ? 12.127  -5.666  11.280  1.00 0.00 ? 10 SER A HB3  4  
ATOM 4223  H HG   . SER A 1 10 ? 13.046  -5.681  13.263  1.00 0.00 ? 10 SER A HG   4  
ATOM 4224  N N    . PRO A 1 11 ? 13.124  -5.899  8.541   1.00 0.00 ? 11 PRO A N    4  
ATOM 4225  C CA   . PRO A 1 11 ? 12.532  -6.394  7.294   1.00 0.00 ? 11 PRO A CA   4  
ATOM 4226  C C    . PRO A 1 11 ? 11.031  -6.636  7.414   1.00 0.00 ? 11 PRO A C    4  
ATOM 4227  O O    . PRO A 1 11 ? 10.328  -6.743  6.410   1.00 0.00 ? 11 PRO A O    4  
ATOM 4228  C CB   . PRO A 1 11 ? 13.268  -7.710  7.040   1.00 0.00 ? 11 PRO A CB   4  
ATOM 4229  C CG   . PRO A 1 11 ? 13.757  -8.133  8.379   1.00 0.00 ? 11 PRO A CG   4  
ATOM 4230  C CD   . PRO A 1 11 ? 14.067  -6.868  9.124   1.00 0.00 ? 11 PRO A CD   4  
ATOM 4231  H HA   . PRO A 1 11 ? 12.717  -5.718  6.481   1.00 0.00 ? 11 PRO A HA   4  
ATOM 4232  H HB2  . PRO A 1 11 ? 12.584  -8.434  6.622   1.00 0.00 ? 11 PRO A HB2  4  
ATOM 4233  H HB3  . PRO A 1 11 ? 14.087  -7.542  6.357   1.00 0.00 ? 11 PRO A HB3  4  
ATOM 4234  H HG2  . PRO A 1 11 ? 12.986  -8.688  8.889   1.00 0.00 ? 11 PRO A HG2  4  
ATOM 4235  H HG3  . PRO A 1 11 ? 14.646  -8.733  8.271   1.00 0.00 ? 11 PRO A HG3  4  
ATOM 4236  H HD2  . PRO A 1 11 ? 13.886  -6.997  10.181  1.00 0.00 ? 11 PRO A HD2  4  
ATOM 4237  H HD3  . PRO A 1 11 ? 15.089  -6.565  8.948   1.00 0.00 ? 11 PRO A HD3  4  
ATOM 4238  N N    . ASP A 1 12 ? 10.546  -6.717  8.647   1.00 0.00 ? 12 ASP A N    4  
ATOM 4239  C CA   . ASP A 1 12 ? 9.128   -6.942  8.895   1.00 0.00 ? 12 ASP A CA   4  
ATOM 4240  C C    . ASP A 1 12 ? 8.290   -5.787  8.362   1.00 0.00 ? 12 ASP A C    4  
ATOM 4241  O O    . ASP A 1 12 ? 7.104   -5.946  8.074   1.00 0.00 ? 12 ASP A O    4  
ATOM 4242  C CB   . ASP A 1 12 ? 8.873   -7.129  10.389  1.00 0.00 ? 12 ASP A CB   4  
ATOM 4243  C CG   . ASP A 1 12 ? 8.422   -8.536  10.729  1.00 0.00 ? 12 ASP A CG   4  
ATOM 4244  O OD1  . ASP A 1 12 ? 9.294   -9.392  10.987  1.00 0.00 ? 12 ASP A OD1  4  
ATOM 4245  O OD2  . ASP A 1 12 ? 7.197   -8.781  10.738  1.00 0.00 ? 12 ASP A OD2  4  
ATOM 4246  H H    . ASP A 1 12 ? 11.155  -6.621  9.407   1.00 0.00 ? 12 ASP A H    4  
ATOM 4247  H HA   . ASP A 1 12 ? 8.845   -7.840  8.380   1.00 0.00 ? 12 ASP A HA   4  
ATOM 4248  H HB2  . ASP A 1 12 ? 9.783   -6.924  10.925  1.00 0.00 ? 12 ASP A HB2  4  
ATOM 4249  H HB3  . ASP A 1 12 ? 8.108   -6.437  10.708  1.00 0.00 ? 12 ASP A HB3  4  
ATOM 4250  N N    . ILE A 1 13 ? 8.917   -4.625  8.230   1.00 0.00 ? 13 ILE A N    4  
ATOM 4251  C CA   . ILE A 1 13 ? 8.234   -3.445  7.726   1.00 0.00 ? 13 ILE A CA   4  
ATOM 4252  C C    . ILE A 1 13 ? 7.977   -3.573  6.238   1.00 0.00 ? 13 ILE A C    4  
ATOM 4253  O O    . ILE A 1 13 ? 6.837   -3.495  5.779   1.00 0.00 ? 13 ILE A O    4  
ATOM 4254  C CB   . ILE A 1 13 ? 9.030   -2.163  7.994   1.00 0.00 ? 13 ILE A CB   4  
ATOM 4255  C CG1  . ILE A 1 13 ? 9.574   -2.153  9.425   1.00 0.00 ? 13 ILE A CG1  4  
ATOM 4256  C CG2  . ILE A 1 13 ? 8.165   -0.938  7.740   1.00 0.00 ? 13 ILE A CG2  4  
ATOM 4257  C CD1  . ILE A 1 13 ? 8.501   -2.316  10.481  1.00 0.00 ? 13 ILE A CD1  4  
ATOM 4258  H H    . ILE A 1 13 ? 9.861   -4.564  8.470   1.00 0.00 ? 13 ILE A H    4  
ATOM 4259  H HA   . ILE A 1 13 ? 7.303   -3.368  8.227   1.00 0.00 ? 13 ILE A HA   4  
ATOM 4260  H HB   . ILE A 1 13 ? 9.847   -2.142  7.306   1.00 0.00 ? 13 ILE A HB   4  
ATOM 4261  H HG12 . ILE A 1 13 ? 10.278  -2.963  9.542   1.00 0.00 ? 13 ILE A HG12 4  
ATOM 4262  H HG13 . ILE A 1 13 ? 10.078  -1.215  9.605   1.00 0.00 ? 13 ILE A HG13 4  
ATOM 4263  H HG21 . ILE A 1 13 ? 8.798   -0.083  7.552   1.00 0.00 ? 13 ILE A HG21 4  
ATOM 4264  H HG22 . ILE A 1 13 ? 7.550   -0.746  8.607   1.00 0.00 ? 13 ILE A HG22 4  
ATOM 4265  H HG23 . ILE A 1 13 ? 7.533   -1.115  6.882   1.00 0.00 ? 13 ILE A HG23 4  
ATOM 4266  H HD11 . ILE A 1 13 ? 7.547   -2.479  10.003  1.00 0.00 ? 13 ILE A HD11 4  
ATOM 4267  H HD12 . ILE A 1 13 ? 8.453   -1.422  11.086  1.00 0.00 ? 13 ILE A HD12 4  
ATOM 4268  H HD13 . ILE A 1 13 ? 8.739   -3.162  11.108  1.00 0.00 ? 13 ILE A HD13 4  
ATOM 4269  N N    . GLU A 1 14 ? 9.045   -3.789  5.495   1.00 0.00 ? 14 GLU A N    4  
ATOM 4270  C CA   . GLU A 1 14 ? 8.947   -3.954  4.055   1.00 0.00 ? 14 GLU A CA   4  
ATOM 4271  C C    . GLU A 1 14 ? 8.160   -5.215  3.726   1.00 0.00 ? 14 GLU A C    4  
ATOM 4272  O O    . GLU A 1 14 ? 7.570   -5.332  2.652   1.00 0.00 ? 14 GLU A O    4  
ATOM 4273  C CB   . GLU A 1 14 ? 10.340  -4.020  3.425   1.00 0.00 ? 14 GLU A CB   4  
ATOM 4274  C CG   . GLU A 1 14 ? 10.412  -3.392  2.042   1.00 0.00 ? 14 GLU A CG   4  
ATOM 4275  C CD   . GLU A 1 14 ? 11.743  -3.640  1.359   1.00 0.00 ? 14 GLU A CD   4  
ATOM 4276  O OE1  . GLU A 1 14 ? 12.728  -2.957  1.711   1.00 0.00 ? 14 GLU A OE1  4  
ATOM 4277  O OE2  . GLU A 1 14 ? 11.800  -4.517  0.472   1.00 0.00 ? 14 GLU A OE2  4  
ATOM 4278  H H    . GLU A 1 14 ? 9.916   -3.854  5.930   1.00 0.00 ? 14 GLU A H    4  
ATOM 4279  H HA   . GLU A 1 14 ? 8.418   -3.103  3.661   1.00 0.00 ? 14 GLU A HA   4  
ATOM 4280  H HB2  . GLU A 1 14 ? 11.038  -3.504  4.067   1.00 0.00 ? 14 GLU A HB2  4  
ATOM 4281  H HB3  . GLU A 1 14 ? 10.636  -5.055  3.342   1.00 0.00 ? 14 GLU A HB3  4  
ATOM 4282  H HG2  . GLU A 1 14 ? 9.628   -3.810  1.429   1.00 0.00 ? 14 GLU A HG2  4  
ATOM 4283  H HG3  . GLU A 1 14 ? 10.265  -2.326  2.137   1.00 0.00 ? 14 GLU A HG3  4  
ATOM 4284  N N    . GLN A 1 15 ? 8.148   -6.152  4.669   1.00 0.00 ? 15 GLN A N    4  
ATOM 4285  C CA   . GLN A 1 15 ? 7.429   -7.397  4.497   1.00 0.00 ? 15 GLN A CA   4  
ATOM 4286  C C    . GLN A 1 15 ? 5.948   -7.194  4.744   1.00 0.00 ? 15 GLN A C    4  
ATOM 4287  O O    . GLN A 1 15 ? 5.102   -7.696  4.004   1.00 0.00 ? 15 GLN A O    4  
ATOM 4288  C CB   . GLN A 1 15 ? 7.982   -8.454  5.430   1.00 0.00 ? 15 GLN A CB   4  
ATOM 4289  C CG   . GLN A 1 15 ? 9.007   -9.342  4.761   1.00 0.00 ? 15 GLN A CG   4  
ATOM 4290  C CD   . GLN A 1 15 ? 8.376   -10.441 3.929   1.00 0.00 ? 15 GLN A CD   4  
ATOM 4291  O OE1  . GLN A 1 15 ? 7.281   -10.278 3.391   1.00 0.00 ? 15 GLN A OE1  4  
ATOM 4292  N NE2  . GLN A 1 15 ? 9.066   -11.570 3.819   1.00 0.00 ? 15 GLN A NE2  4  
ATOM 4293  H H    . GLN A 1 15 ? 8.630   -5.996  5.504   1.00 0.00 ? 15 GLN A H    4  
ATOM 4294  H HA   . GLN A 1 15 ? 7.577   -7.721  3.496   1.00 0.00 ? 15 GLN A HA   4  
ATOM 4295  H HB2  . GLN A 1 15 ? 8.450   -7.962  6.262   1.00 0.00 ? 15 GLN A HB2  4  
ATOM 4296  H HB3  . GLN A 1 15 ? 7.174   -9.072  5.788   1.00 0.00 ? 15 GLN A HB3  4  
ATOM 4297  H HG2  . GLN A 1 15 ? 9.625   -8.732  4.119   1.00 0.00 ? 15 GLN A HG2  4  
ATOM 4298  H HG3  . GLN A 1 15 ? 9.616   -9.788  5.519   1.00 0.00 ? 15 GLN A HG3  4  
ATOM 4299  H HE21 . GLN A 1 15 ? 9.932   -11.630 4.274   1.00 0.00 ? 15 GLN A HE21 4  
ATOM 4300  H HE22 . GLN A 1 15 ? 8.682   -12.298 3.286   1.00 0.00 ? 15 GLN A HE22 4  
ATOM 4301  N N    . SER A 1 16 ? 5.648   -6.435  5.784   1.00 0.00 ? 16 SER A N    4  
ATOM 4302  C CA   . SER A 1 16 ? 4.271   -6.133  6.135   1.00 0.00 ? 16 SER A CA   4  
ATOM 4303  C C    . SER A 1 16 ? 3.647   -5.231  5.079   1.00 0.00 ? 16 SER A C    4  
ATOM 4304  O O    . SER A 1 16 ? 2.428   -5.198  4.914   1.00 0.00 ? 16 SER A O    4  
ATOM 4305  C CB   . SER A 1 16 ? 4.203   -5.463  7.508   1.00 0.00 ? 16 SER A CB   4  
ATOM 4306  O OG   . SER A 1 16 ? 2.874   -5.441  8.000   1.00 0.00 ? 16 SER A OG   4  
ATOM 4307  H H    . SER A 1 16 ? 6.373   -6.058  6.319   1.00 0.00 ? 16 SER A H    4  
ATOM 4308  H HA   . SER A 1 16 ? 3.729   -7.061  6.166   1.00 0.00 ? 16 SER A HA   4  
ATOM 4309  H HB2  . SER A 1 16 ? 4.821   -6.009  8.204   1.00 0.00 ? 16 SER A HB2  4  
ATOM 4310  H HB3  . SER A 1 16 ? 4.561   -4.447  7.429   1.00 0.00 ? 16 SER A HB3  4  
ATOM 4311  H HG   . SER A 1 16 ? 2.489   -6.317  7.921   1.00 0.00 ? 16 SER A HG   4  
ATOM 4312  N N    . PHE A 1 17 ? 4.498   -4.503  4.361   1.00 0.00 ? 17 PHE A N    4  
ATOM 4313  C CA   . PHE A 1 17 ? 4.041   -3.602  3.318   1.00 0.00 ? 17 PHE A CA   4  
ATOM 4314  C C    . PHE A 1 17 ? 3.549   -4.379  2.109   1.00 0.00 ? 17 PHE A C    4  
ATOM 4315  O O    . PHE A 1 17 ? 2.572   -3.996  1.466   1.00 0.00 ? 17 PHE A O    4  
ATOM 4316  C CB   . PHE A 1 17 ? 5.160   -2.645  2.915   1.00 0.00 ? 17 PHE A CB   4  
ATOM 4317  C CG   . PHE A 1 17 ? 4.944   -1.237  3.390   1.00 0.00 ? 17 PHE A CG   4  
ATOM 4318  C CD1  . PHE A 1 17 ? 4.525   -0.986  4.687   1.00 0.00 ? 17 PHE A CD1  4  
ATOM 4319  C CD2  . PHE A 1 17 ? 5.160   -0.164  2.540   1.00 0.00 ? 17 PHE A CD2  4  
ATOM 4320  C CE1  . PHE A 1 17 ? 4.326   0.307   5.127   1.00 0.00 ? 17 PHE A CE1  4  
ATOM 4321  C CE2  . PHE A 1 17 ? 4.962   1.133   2.975   1.00 0.00 ? 17 PHE A CE2  4  
ATOM 4322  C CZ   . PHE A 1 17 ? 4.545   1.368   4.271   1.00 0.00 ? 17 PHE A CZ   4  
ATOM 4323  H H    . PHE A 1 17 ? 5.457   -4.576  4.539   1.00 0.00 ? 17 PHE A H    4  
ATOM 4324  H HA   . PHE A 1 17 ? 3.228   -3.037  3.715   1.00 0.00 ? 17 PHE A HA   4  
ATOM 4325  H HB2  . PHE A 1 17 ? 6.083   -2.996  3.339   1.00 0.00 ? 17 PHE A HB2  4  
ATOM 4326  H HB3  . PHE A 1 17 ? 5.245   -2.626  1.838   1.00 0.00 ? 17 PHE A HB3  4  
ATOM 4327  H HD1  . PHE A 1 17 ? 4.354   -1.815  5.357   1.00 0.00 ? 17 PHE A HD1  4  
ATOM 4328  H HD2  . PHE A 1 17 ? 5.485   -0.347  1.527   1.00 0.00 ? 17 PHE A HD2  4  
ATOM 4329  H HE1  . PHE A 1 17 ? 4.000   0.489   6.141   1.00 0.00 ? 17 PHE A HE1  4  
ATOM 4330  H HE2  . PHE A 1 17 ? 5.134   1.961   2.304   1.00 0.00 ? 17 PHE A HE2  4  
ATOM 4331  H HZ   . PHE A 1 17 ? 4.389   2.380   4.613   1.00 0.00 ? 17 PHE A HZ   4  
ATOM 4332  N N    . GLN A 1 18 ? 4.223   -5.480  1.813   1.00 0.00 ? 18 GLN A N    4  
ATOM 4333  C CA   . GLN A 1 18 ? 3.839   -6.315  0.685   1.00 0.00 ? 18 GLN A CA   4  
ATOM 4334  C C    . GLN A 1 18 ? 2.486   -6.959  0.942   1.00 0.00 ? 18 GLN A C    4  
ATOM 4335  O O    . GLN A 1 18 ? 1.747   -7.273  0.011   1.00 0.00 ? 18 GLN A O    4  
ATOM 4336  C CB   . GLN A 1 18 ? 4.888   -7.397  0.419   1.00 0.00 ? 18 GLN A CB   4  
ATOM 4337  C CG   . GLN A 1 18 ? 4.414   -8.470  -0.552  1.00 0.00 ? 18 GLN A CG   4  
ATOM 4338  C CD   . GLN A 1 18 ? 5.554   -9.299  -1.111  1.00 0.00 ? 18 GLN A CD   4  
ATOM 4339  O OE1  . GLN A 1 18 ? 6.576   -9.494  -0.453  1.00 0.00 ? 18 GLN A OE1  4  
ATOM 4340  N NE2  . GLN A 1 18 ? 5.384   -9.792  -2.332  1.00 0.00 ? 18 GLN A NE2  4  
ATOM 4341  H H    . GLN A 1 18 ? 4.987   -5.738  2.369   1.00 0.00 ? 18 GLN A H    4  
ATOM 4342  H HA   . GLN A 1 18 ? 3.761   -5.680  -0.179  1.00 0.00 ? 18 GLN A HA   4  
ATOM 4343  H HB2  . GLN A 1 18 ? 5.772   -6.933  0.008   1.00 0.00 ? 18 GLN A HB2  4  
ATOM 4344  H HB3  . GLN A 1 18 ? 5.143   -7.875  1.354   1.00 0.00 ? 18 GLN A HB3  4  
ATOM 4345  H HG2  . GLN A 1 18 ? 3.729   -9.127  -0.035  1.00 0.00 ? 18 GLN A HG2  4  
ATOM 4346  H HG3  . GLN A 1 18 ? 3.897   -7.992  -1.372  1.00 0.00 ? 18 GLN A HG3  4  
ATOM 4347  H HE21 . GLN A 1 18 ? 4.544   -9.595  -2.798  1.00 0.00 ? 18 GLN A HE21 4  
ATOM 4348  H HE22 . GLN A 1 18 ? 6.105   -10.331 -2.718  1.00 0.00 ? 18 GLN A HE22 4  
ATOM 4349  N N    . GLU A 1 19 ? 2.169   -7.155  2.214   1.00 0.00 ? 19 GLU A N    4  
ATOM 4350  C CA   . GLU A 1 19 ? 0.907   -7.762  2.595   1.00 0.00 ? 19 GLU A CA   4  
ATOM 4351  C C    . GLU A 1 19 ? -0.254  -6.858  2.223   1.00 0.00 ? 19 GLU A C    4  
ATOM 4352  O O    . GLU A 1 19 ? -1.293  -7.323  1.761   1.00 0.00 ? 19 GLU A O    4  
ATOM 4353  C CB   . GLU A 1 19 ? 0.889   -8.069  4.091   1.00 0.00 ? 19 GLU A CB   4  
ATOM 4354  C CG   . GLU A 1 19 ? 0.699   -9.544  4.407   1.00 0.00 ? 19 GLU A CG   4  
ATOM 4355  C CD   . GLU A 1 19 ? 1.945   -10.363 4.135   1.00 0.00 ? 19 GLU A CD   4  
ATOM 4356  O OE1  . GLU A 1 19 ? 2.784   -10.490 5.052   1.00 0.00 ? 19 GLU A OE1  4  
ATOM 4357  O OE2  . GLU A 1 19 ? 2.083   -10.878 3.005   1.00 0.00 ? 19 GLU A OE2  4  
ATOM 4358  H H    . GLU A 1 19 ? 2.801   -6.885  2.909   1.00 0.00 ? 19 GLU A H    4  
ATOM 4359  H HA   . GLU A 1 19 ? 0.810   -8.676  2.050   1.00 0.00 ? 19 GLU A HA   4  
ATOM 4360  H HB2  . GLU A 1 19 ? 1.824   -7.749  4.521   1.00 0.00 ? 19 GLU A HB2  4  
ATOM 4361  H HB3  . GLU A 1 19 ? 0.084   -7.519  4.549   1.00 0.00 ? 19 GLU A HB3  4  
ATOM 4362  H HG2  . GLU A 1 19 ? 0.441   -9.645  5.450   1.00 0.00 ? 19 GLU A HG2  4  
ATOM 4363  H HG3  . GLU A 1 19 ? -0.107  -9.928  3.798   1.00 0.00 ? 19 GLU A HG3  4  
ATOM 4364  N N    . ALA A 1 20 ? -0.063  -5.565  2.418   1.00 0.00 ? 20 ALA A N    4  
ATOM 4365  C CA   . ALA A 1 20 ? -1.090  -4.592  2.092   1.00 0.00 ? 20 ALA A CA   4  
ATOM 4366  C C    . ALA A 1 20 ? -1.131  -4.340  0.594   1.00 0.00 ? 20 ALA A C    4  
ATOM 4367  O O    . ALA A 1 20 ? -2.189  -4.080  0.021   1.00 0.00 ? 20 ALA A O    4  
ATOM 4368  C CB   . ALA A 1 20 ? -0.859  -3.293  2.850   1.00 0.00 ? 20 ALA A CB   4  
ATOM 4369  H H    . ALA A 1 20 ? 0.789   -5.260  2.780   1.00 0.00 ? 20 ALA A H    4  
ATOM 4370  H HA   . ALA A 1 20 ? -2.033  -5.001  2.398   1.00 0.00 ? 20 ALA A HA   4  
ATOM 4371  H HB1  . ALA A 1 20 ? -0.569  -3.517  3.866   1.00 0.00 ? 20 ALA A HB1  4  
ATOM 4372  H HB2  . ALA A 1 20 ? -1.769  -2.712  2.855   1.00 0.00 ? 20 ALA A HB2  4  
ATOM 4373  H HB3  . ALA A 1 20 ? -0.074  -2.730  2.368   1.00 0.00 ? 20 ALA A HB3  4  
ATOM 4374  N N    . LEU A 1 21 ? 0.030   -4.433  -0.034  1.00 0.00 ? 21 LEU A N    4  
ATOM 4375  C CA   . LEU A 1 21 ? 0.141   -4.231  -1.467  1.00 0.00 ? 21 LEU A CA   4  
ATOM 4376  C C    . LEU A 1 21 ? -0.276  -5.488  -2.219  1.00 0.00 ? 21 LEU A C    4  
ATOM 4377  O O    . LEU A 1 21 ? -0.726  -5.421  -3.363  1.00 0.00 ? 21 LEU A O    4  
ATOM 4378  C CB   . LEU A 1 21 ? 1.567   -3.833  -1.843  1.00 0.00 ? 21 LEU A CB   4  
ATOM 4379  C CG   . LEU A 1 21 ? 1.712   -2.432  -2.439  1.00 0.00 ? 21 LEU A CG   4  
ATOM 4380  C CD1  . LEU A 1 21 ? 0.843   -2.286  -3.678  1.00 0.00 ? 21 LEU A CD1  4  
ATOM 4381  C CD2  . LEU A 1 21 ? 1.352   -1.375  -1.405  1.00 0.00 ? 21 LEU A CD2  4  
ATOM 4382  H H    . LEU A 1 21 ? 0.829   -4.651  0.479   1.00 0.00 ? 21 LEU A H    4  
ATOM 4383  H HA   . LEU A 1 21 ? -0.522  -3.435  -1.731  1.00 0.00 ? 21 LEU A HA   4  
ATOM 4384  H HB2  . LEU A 1 21 ? 2.175   -3.888  -0.954  1.00 0.00 ? 21 LEU A HB2  4  
ATOM 4385  H HB3  . LEU A 1 21 ? 1.942   -4.546  -2.561  1.00 0.00 ? 21 LEU A HB3  4  
ATOM 4386  H HG   . LEU A 1 21 ? 2.740   -2.278  -2.733  1.00 0.00 ? 21 LEU A HG   4  
ATOM 4387  H HD11 . LEU A 1 21 ? 0.001   -2.959  -3.608  1.00 0.00 ? 21 LEU A HD11 4  
ATOM 4388  H HD12 . LEU A 1 21 ? 1.424   -2.527  -4.556  1.00 0.00 ? 21 LEU A HD12 4  
ATOM 4389  H HD13 . LEU A 1 21 ? 0.486   -1.270  -3.750  1.00 0.00 ? 21 LEU A HD13 4  
ATOM 4390  H HD21 . LEU A 1 21 ? 1.639   -1.720  -0.423  1.00 0.00 ? 21 LEU A HD21 4  
ATOM 4391  H HD22 . LEU A 1 21 ? 0.287   -1.197  -1.427  1.00 0.00 ? 21 LEU A HD22 4  
ATOM 4392  H HD23 . LEU A 1 21 ? 1.875   -0.457  -1.632  1.00 0.00 ? 21 LEU A HD23 4  
ATOM 4393  N N    . SER A 1 22 ? -0.130  -6.634  -1.564  1.00 0.00 ? 22 SER A N    4  
ATOM 4394  C CA   . SER A 1 22 ? -0.495  -7.906  -2.161  1.00 0.00 ? 22 SER A CA   4  
ATOM 4395  C C    . SER A 1 22 ? -1.985  -8.162  -1.997  1.00 0.00 ? 22 SER A C    4  
ATOM 4396  O O    . SER A 1 22 ? -2.619  -8.789  -2.845  1.00 0.00 ? 22 SER A O    4  
ATOM 4397  C CB   . SER A 1 22 ? 0.308   -9.044  -1.530  1.00 0.00 ? 22 SER A CB   4  
ATOM 4398  O OG   . SER A 1 22 ? 1.652   -9.031  -1.978  1.00 0.00 ? 22 SER A OG   4  
ATOM 4399  H H    . SER A 1 22 ? 0.229   -6.623  -0.656  1.00 0.00 ? 22 SER A H    4  
ATOM 4400  H HA   . SER A 1 22 ? -0.266  -7.850  -3.205  1.00 0.00 ? 22 SER A HA   4  
ATOM 4401  H HB2  . SER A 1 22 ? 0.300   -8.936  -0.455  1.00 0.00 ? 22 SER A HB2  4  
ATOM 4402  H HB3  . SER A 1 22 ? -0.139  -9.990  -1.800  1.00 0.00 ? 22 SER A HB3  4  
ATOM 4403  H HG   . SER A 1 22 ? 1.820   -9.811  -2.512  1.00 0.00 ? 22 SER A HG   4  
ATOM 4404  N N    . ILE A 1 23 ? -2.536  -7.670  -0.896  1.00 0.00 ? 23 ILE A N    4  
ATOM 4405  C CA   . ILE A 1 23 ? -3.952  -7.838  -0.610  1.00 0.00 ? 23 ILE A CA   4  
ATOM 4406  C C    . ILE A 1 23 ? -4.784  -6.721  -1.241  1.00 0.00 ? 23 ILE A C    4  
ATOM 4407  O O    . ILE A 1 23 ? -5.989  -6.873  -1.443  1.00 0.00 ? 23 ILE A O    4  
ATOM 4408  C CB   . ILE A 1 23 ? -4.213  -7.909  0.912   1.00 0.00 ? 23 ILE A CB   4  
ATOM 4409  C CG1  . ILE A 1 23 ? -4.387  -9.364  1.351   1.00 0.00 ? 23 ILE A CG1  4  
ATOM 4410  C CG2  . ILE A 1 23 ? -5.427  -7.083  1.317   1.00 0.00 ? 23 ILE A CG2  4  
ATOM 4411  C CD1  . ILE A 1 23 ? -3.078  -10.094 1.559   1.00 0.00 ? 23 ILE A CD1  4  
ATOM 4412  H H    . ILE A 1 23 ? -1.975  -7.182  -0.263  1.00 0.00 ? 23 ILE A H    4  
ATOM 4413  H HA   . ILE A 1 23 ? -4.250  -8.772  -1.038  1.00 0.00 ? 23 ILE A HA   4  
ATOM 4414  H HB   . ILE A 1 23 ? -3.355  -7.500  1.407   1.00 0.00 ? 23 ILE A HB   4  
ATOM 4415  H HG12 . ILE A 1 23 ? -4.931  -9.389  2.284   1.00 0.00 ? 23 ILE A HG12 4  
ATOM 4416  H HG13 . ILE A 1 23 ? -4.949  -9.896  0.597   1.00 0.00 ? 23 ILE A HG13 4  
ATOM 4417  H HG21 . ILE A 1 23 ? -5.217  -6.035  1.158   1.00 0.00 ? 23 ILE A HG21 4  
ATOM 4418  H HG22 . ILE A 1 23 ? -5.646  -7.252  2.360   1.00 0.00 ? 23 ILE A HG22 4  
ATOM 4419  H HG23 . ILE A 1 23 ? -6.277  -7.374  0.718   1.00 0.00 ? 23 ILE A HG23 4  
ATOM 4420  H HD11 . ILE A 1 23 ? -2.388  -9.453  2.087   1.00 0.00 ? 23 ILE A HD11 4  
ATOM 4421  H HD12 . ILE A 1 23 ? -2.659  -10.361 0.600   1.00 0.00 ? 23 ILE A HD12 4  
ATOM 4422  H HD13 . ILE A 1 23 ? -3.253  -10.989 2.137   1.00 0.00 ? 23 ILE A HD13 4  
ATOM 4423  N N    . TYR A 1 24 ? -4.137  -5.600  -1.549  1.00 0.00 ? 24 TYR A N    4  
ATOM 4424  C CA   . TYR A 1 24 ? -4.819  -4.467  -2.151  1.00 0.00 ? 24 TYR A CA   4  
ATOM 4425  C C    . TYR A 1 24 ? -4.219  -4.118  -3.512  1.00 0.00 ? 24 TYR A C    4  
ATOM 4426  O O    . TYR A 1 24 ? -3.411  -3.198  -3.625  1.00 0.00 ? 24 TYR A O    4  
ATOM 4427  C CB   . TYR A 1 24 ? -4.759  -3.260  -1.228  1.00 0.00 ? 24 TYR A CB   4  
ATOM 4428  C CG   . TYR A 1 24 ? -5.294  -3.528  0.160   1.00 0.00 ? 24 TYR A CG   4  
ATOM 4429  C CD1  . TYR A 1 24 ? -6.545  -4.103  0.344   1.00 0.00 ? 24 TYR A CD1  4  
ATOM 4430  C CD2  . TYR A 1 24 ? -4.545  -3.210  1.285   1.00 0.00 ? 24 TYR A CD2  4  
ATOM 4431  C CE1  . TYR A 1 24 ? -7.035  -4.352  1.613   1.00 0.00 ? 24 TYR A CE1  4  
ATOM 4432  C CE2  . TYR A 1 24 ? -5.027  -3.457  2.556   1.00 0.00 ? 24 TYR A CE2  4  
ATOM 4433  C CZ   . TYR A 1 24 ? -6.272  -4.028  2.714   1.00 0.00 ? 24 TYR A CZ   4  
ATOM 4434  O OH   . TYR A 1 24 ? -6.755  -4.276  3.979   1.00 0.00 ? 24 TYR A OH   4  
ATOM 4435  H H    . TYR A 1 24 ? -3.185  -5.535  -1.367  1.00 0.00 ? 24 TYR A H    4  
ATOM 4436  H HA   . TYR A 1 24 ? -5.836  -4.740  -2.284  1.00 0.00 ? 24 TYR A HA   4  
ATOM 4437  H HB2  . TYR A 1 24 ? -3.741  -2.955  -1.135  1.00 0.00 ? 24 TYR A HB2  4  
ATOM 4438  H HB3  . TYR A 1 24 ? -5.335  -2.453  -1.657  1.00 0.00 ? 24 TYR A HB3  4  
ATOM 4439  H HD1  . TYR A 1 24 ? -7.139  -4.356  -0.521  1.00 0.00 ? 24 TYR A HD1  4  
ATOM 4440  H HD2  . TYR A 1 24 ? -3.570  -2.762  1.157   1.00 0.00 ? 24 TYR A HD2  4  
ATOM 4441  H HE1  . TYR A 1 24 ? -8.010  -4.799  1.736   1.00 0.00 ? 24 TYR A HE1  4  
ATOM 4442  H HE2  . TYR A 1 24 ? -4.429  -3.201  3.418   1.00 0.00 ? 24 TYR A HE2  4  
ATOM 4443  H HH   . TYR A 1 24 ? -6.493  -3.564  4.568   1.00 0.00 ? 24 TYR A HH   4  
ATOM 4444  N N    . PRO A 1 25 ? -4.612  -4.854  -4.567  1.00 0.00 ? 25 PRO A N    4  
ATOM 4445  C CA   . PRO A 1 25 ? -4.123  -4.632  -5.918  1.00 0.00 ? 25 PRO A CA   4  
ATOM 4446  C C    . PRO A 1 25 ? -4.962  -3.605  -6.677  1.00 0.00 ? 25 PRO A C    4  
ATOM 4447  O O    . PRO A 1 25 ? -6.119  -3.865  -7.010  1.00 0.00 ? 25 PRO A O    4  
ATOM 4448  C CB   . PRO A 1 25 ? -4.249  -6.014  -6.573  1.00 0.00 ? 25 PRO A CB   4  
ATOM 4449  C CG   . PRO A 1 25 ? -5.096  -6.849  -5.657  1.00 0.00 ? 25 PRO A CG   4  
ATOM 4450  C CD   . PRO A 1 25 ? -5.563  -5.964  -4.533  1.00 0.00 ? 25 PRO A CD   4  
ATOM 4451  H HA   . PRO A 1 25 ? -3.088  -4.328  -5.919  1.00 0.00 ? 25 PRO A HA   4  
ATOM 4452  H HB2  . PRO A 1 25 ? -4.711  -5.911  -7.544  1.00 0.00 ? 25 PRO A HB2  4  
ATOM 4453  H HB3  . PRO A 1 25 ? -3.267  -6.443  -6.687  1.00 0.00 ? 25 PRO A HB3  4  
ATOM 4454  H HG2  . PRO A 1 25 ? -5.946  -7.233  -6.200  1.00 0.00 ? 25 PRO A HG2  4  
ATOM 4455  H HG3  . PRO A 1 25 ? -4.506  -7.665  -5.267  1.00 0.00 ? 25 PRO A HG3  4  
ATOM 4456  H HD2  . PRO A 1 25 ? -6.567  -5.617  -4.718  1.00 0.00 ? 25 PRO A HD2  4  
ATOM 4457  H HD3  . PRO A 1 25 ? -5.509  -6.490  -3.594  1.00 0.00 ? 25 PRO A HD3  4  
ATOM 4458  N N    . PRO A 1 26 ? -4.393  -2.420  -6.964  1.00 0.00 ? 26 PRO A N    4  
ATOM 4459  C CA   . PRO A 1 26 ? -5.101  -1.360  -7.688  1.00 0.00 ? 26 PRO A CA   4  
ATOM 4460  C C    . PRO A 1 26 ? -5.334  -1.712  -9.154  1.00 0.00 ? 26 PRO A C    4  
ATOM 4461  O O    . PRO A 1 26 ? -6.126  -1.065  -9.839  1.00 0.00 ? 26 PRO A O    4  
ATOM 4462  C CB   . PRO A 1 26 ? -4.177  -0.143  -7.572  1.00 0.00 ? 26 PRO A CB   4  
ATOM 4463  C CG   . PRO A 1 26 ? -3.117  -0.520  -6.589  1.00 0.00 ? 26 PRO A CG   4  
ATOM 4464  C CD   . PRO A 1 26 ? -3.026  -2.017  -6.614  1.00 0.00 ? 26 PRO A CD   4  
ATOM 4465  H HA   . PRO A 1 26 ? -6.044  -1.134  -7.228  1.00 0.00 ? 26 PRO A HA   4  
ATOM 4466  H HB2  . PRO A 1 26 ? -3.758  0.074   -8.538  1.00 0.00 ? 26 PRO A HB2  4  
ATOM 4467  H HB3  . PRO A 1 26 ? -4.746  0.707   -7.227  1.00 0.00 ? 26 PRO A HB3  4  
ATOM 4468  H HG2  . PRO A 1 26 ? -2.174  -0.084  -6.883  1.00 0.00 ? 26 PRO A HG2  4  
ATOM 4469  H HG3  . PRO A 1 26 ? -3.395  -0.178  -5.602  1.00 0.00 ? 26 PRO A HG3  4  
ATOM 4470  H HD2  . PRO A 1 26 ? -2.321  -2.341  -7.366  1.00 0.00 ? 26 PRO A HD2  4  
ATOM 4471  H HD3  . PRO A 1 26 ? -2.749  -2.396  -5.642  1.00 0.00 ? 26 PRO A HD3  4  
ATOM 4472  N N    . CYS A 1 27 ? -4.640  -2.740  -9.631  1.00 0.00 ? 27 CYS A N    4  
ATOM 4473  C CA   . CYS A 1 27 ? -4.766  -3.178  -11.007 1.00 0.00 ? 27 CYS A CA   4  
ATOM 4474  C C    . CYS A 1 27 ? -6.188  -3.644  -11.307 1.00 0.00 ? 27 CYS A C    4  
ATOM 4475  O O    . CYS A 1 27 ? -6.507  -4.824  -11.165 1.00 0.00 ? 27 CYS A O    4  
ATOM 4476  C CB   . CYS A 1 27 ? -3.776  -4.307  -11.274 1.00 0.00 ? 27 CYS A CB   4  
ATOM 4477  S SG   . CYS A 1 27 ? -3.835  -5.648  -10.062 1.00 0.00 ? 27 CYS A SG   4  
ATOM 4478  H H    . CYS A 1 27 ? -4.024  -3.217  -9.044  1.00 0.00 ? 27 CYS A H    4  
ATOM 4479  H HA   . CYS A 1 27 ? -4.528  -2.342  -11.648 1.00 0.00 ? 27 CYS A HA   4  
ATOM 4480  H HB2  . CYS A 1 27 ? -3.986  -4.730  -12.235 1.00 0.00 ? 27 CYS A HB2  4  
ATOM 4481  H HB3  . CYS A 1 27 ? -2.773  -3.906  -11.273 1.00 0.00 ? 27 CYS A HB3  4  
ATOM 4482  H HG   . CYS A 1 27 ? -4.654  -6.132  -10.194 1.00 0.00 ? 27 CYS A HG   4  
ATOM 4483  N N    . GLY A 1 28 ? -7.037  -2.709  -11.722 1.00 0.00 ? 28 GLY A N    4  
ATOM 4484  C CA   . GLY A 1 28 ? -8.413  -3.045  -12.036 1.00 0.00 ? 28 GLY A CA   4  
ATOM 4485  C C    . GLY A 1 28 ? -9.349  -2.819  -10.865 1.00 0.00 ? 28 GLY A C    4  
ATOM 4486  O O    . GLY A 1 28 ? -10.459 -2.315  -11.038 1.00 0.00 ? 28 GLY A O    4  
ATOM 4487  H H    . GLY A 1 28 ? -6.725  -1.785  -11.818 1.00 0.00 ? 28 GLY A H    4  
ATOM 4488  H HA2  . GLY A 1 28 ? -8.740  -2.436  -12.866 1.00 0.00 ? 28 GLY A HA2  4  
ATOM 4489  H HA3  . GLY A 1 28 ? -8.461  -4.084  -12.326 1.00 0.00 ? 28 GLY A HA3  4  
ATOM 4490  N N    . ARG A 1 29 ? -8.902  -3.193  -9.671  1.00 0.00 ? 29 ARG A N    4  
ATOM 4491  C CA   . ARG A 1 29 ? -9.708  -3.029  -8.466  1.00 0.00 ? 29 ARG A CA   4  
ATOM 4492  C C    . ARG A 1 29 ? -10.070 -1.563  -8.248  1.00 0.00 ? 29 ARG A C    4  
ATOM 4493  O O    . ARG A 1 29 ? -9.270  -0.787  -7.726  1.00 0.00 ? 29 ARG A O    4  
ATOM 4494  C CB   . ARG A 1 29 ? -8.957  -3.568  -7.248  1.00 0.00 ? 29 ARG A CB   4  
ATOM 4495  C CG   . ARG A 1 29 ? -9.862  -4.208  -6.209  1.00 0.00 ? 29 ARG A CG   4  
ATOM 4496  C CD   . ARG A 1 29 ? -9.177  -5.376  -5.516  1.00 0.00 ? 29 ARG A CD   4  
ATOM 4497  N NE   . ARG A 1 29 ? -10.101 -6.477  -5.257  1.00 0.00 ? 29 ARG A NE   4  
ATOM 4498  C CZ   . ARG A 1 29 ? -9.714  -7.723  -4.991  1.00 0.00 ? 29 ARG A CZ   4  
ATOM 4499  N NH1  . ARG A 1 29 ? -8.423  -8.029  -4.950  1.00 0.00 ? 29 ARG A NH1  4  
ATOM 4500  N NH2  . ARG A 1 29 ? -10.619 -8.665  -4.767  1.00 0.00 ? 29 ARG A NH2  4  
ATOM 4501  H H    . ARG A 1 29 ? -8.008  -3.589  -9.598  1.00 0.00 ? 29 ARG A H    4  
ATOM 4502  H HA   . ARG A 1 29 ? -10.617 -3.596  -8.597  1.00 0.00 ? 29 ARG A HA   4  
ATOM 4503  H HB2  . ARG A 1 29 ? -8.243  -4.308  -7.578  1.00 0.00 ? 29 ARG A HB2  4  
ATOM 4504  H HB3  . ARG A 1 29 ? -8.425  -2.753  -6.778  1.00 0.00 ? 29 ARG A HB3  4  
ATOM 4505  H HG2  . ARG A 1 29 ? -10.125 -3.468  -5.468  1.00 0.00 ? 29 ARG A HG2  4  
ATOM 4506  H HG3  . ARG A 1 29 ? -10.757 -4.566  -6.697  1.00 0.00 ? 29 ARG A HG3  4  
ATOM 4507  H HD2  . ARG A 1 29 ? -8.376  -5.732  -6.146  1.00 0.00 ? 29 ARG A HD2  4  
ATOM 4508  H HD3  . ARG A 1 29 ? -8.770  -5.031  -4.577  1.00 0.00 ? 29 ARG A HD3  4  
ATOM 4509  H HE   . ARG A 1 29 ? -11.061 -6.279  -5.281  1.00 0.00 ? 29 ARG A HE   4  
ATOM 4510  H HH11 . ARG A 1 29 ? -7.735  -7.323  -5.118  1.00 0.00 ? 29 ARG A HH11 4  
ATOM 4511  H HH12 . ARG A 1 29 ? -8.138  -8.967  -4.750  1.00 0.00 ? 29 ARG A HH12 4  
ATOM 4512  H HH21 . ARG A 1 29 ? -11.593 -8.440  -4.797  1.00 0.00 ? 29 ARG A HH21 4  
ATOM 4513  H HH22 . ARG A 1 29 ? -10.329 -9.601  -4.568  1.00 0.00 ? 29 ARG A HH22 4  
ATOM 4514  N N    . ARG A 1 30 ? -11.282 -1.193  -8.649  1.00 0.00 ? 30 ARG A N    4  
ATOM 4515  C CA   . ARG A 1 30 ? -11.752 0.173   -8.496  1.00 0.00 ? 30 ARG A CA   4  
ATOM 4516  C C    . ARG A 1 30 ? -13.225 0.203   -8.101  1.00 0.00 ? 30 ARG A C    4  
ATOM 4517  O O    . ARG A 1 30 ? -14.108 0.235   -8.959  1.00 0.00 ? 30 ARG A O    4  
ATOM 4518  C CB   . ARG A 1 30 ? -11.540 0.959   -9.792  1.00 0.00 ? 30 ARG A CB   4  
ATOM 4519  C CG   . ARG A 1 30 ? -11.200 2.423   -9.566  1.00 0.00 ? 30 ARG A CG   4  
ATOM 4520  C CD   . ARG A 1 30 ? -9.749  2.601   -9.150  1.00 0.00 ? 30 ARG A CD   4  
ATOM 4521  N NE   . ARG A 1 30 ? -9.580  2.517   -7.702  1.00 0.00 ? 30 ARG A NE   4  
ATOM 4522  C CZ   . ARG A 1 30 ? -9.885  3.504   -6.862  1.00 0.00 ? 30 ARG A CZ   4  
ATOM 4523  N NH1  . ARG A 1 30 ? -10.375 4.648   -7.321  1.00 0.00 ? 30 ARG A NH1  4  
ATOM 4524  N NH2  . ARG A 1 30 ? -9.700  3.345   -5.558  1.00 0.00 ? 30 ARG A NH2  4  
ATOM 4525  H H    . ARG A 1 30 ? -11.873 -1.852  -9.052  1.00 0.00 ? 30 ARG A H    4  
ATOM 4526  H HA   . ARG A 1 30 ? -11.175 0.626   -7.713  1.00 0.00 ? 30 ARG A HA   4  
ATOM 4527  H HB2  . ARG A 1 30 ? -10.731 0.505   -10.346 1.00 0.00 ? 30 ARG A HB2  4  
ATOM 4528  H HB3  . ARG A 1 30 ? -12.443 0.908   -10.382 1.00 0.00 ? 30 ARG A HB3  4  
ATOM 4529  H HG2  . ARG A 1 30 ? -11.370 2.968   -10.483 1.00 0.00 ? 30 ARG A HG2  4  
ATOM 4530  H HG3  . ARG A 1 30 ? -11.839 2.815   -8.788  1.00 0.00 ? 30 ARG A HG3  4  
ATOM 4531  H HD2  . ARG A 1 30 ? -9.157  1.827   -9.617  1.00 0.00 ? 30 ARG A HD2  4  
ATOM 4532  H HD3  . ARG A 1 30 ? -9.407  3.568   -9.488  1.00 0.00 ? 30 ARG A HD3  4  
ATOM 4533  H HE   . ARG A 1 30 ? -9.219  1.683   -7.335  1.00 0.00 ? 30 ARG A HE   4  
ATOM 4534  H HH11 . ARG A 1 30 ? -10.518 4.774   -8.303  1.00 0.00 ? 30 ARG A HH11 4  
ATOM 4535  H HH12 . ARG A 1 30 ? -10.603 5.385   -6.685  1.00 0.00 ? 30 ARG A HH12 4  
ATOM 4536  H HH21 . ARG A 1 30 ? -9.331  2.484   -5.207  1.00 0.00 ? 30 ARG A HH21 4  
ATOM 4537  H HH22 . ARG A 1 30 ? -9.929  4.086   -4.927  1.00 0.00 ? 30 ARG A HH22 4  
ATOM 4538  N N    . LYS A 1 31 ? -13.483 0.197   -6.798  1.00 0.00 ? 31 LYS A N    4  
ATOM 4539  C CA   . LYS A 1 31 ? -14.843 0.226   -6.287  1.00 0.00 ? 31 LYS A CA   4  
ATOM 4540  C C    . LYS A 1 31 ? -14.900 0.920   -4.930  1.00 0.00 ? 31 LYS A C    4  
ATOM 4541  O O    . LYS A 1 31 ? -14.196 0.538   -3.997  1.00 0.00 ? 31 LYS A O    4  
ATOM 4542  C CB   . LYS A 1 31 ? -15.403 -1.193  -6.174  1.00 0.00 ? 31 LYS A CB   4  
ATOM 4543  C CG   . LYS A 1 31 ? -15.893 -1.761  -7.497  1.00 0.00 ? 31 LYS A CG   4  
ATOM 4544  C CD   . LYS A 1 31 ? -14.855 -2.673  -8.131  1.00 0.00 ? 31 LYS A CD   4  
ATOM 4545  C CE   . LYS A 1 31 ? -14.814 -4.030  -7.447  1.00 0.00 ? 31 LYS A CE   4  
ATOM 4546  N NZ   . LYS A 1 31 ? -16.003 -4.859  -7.787  1.00 0.00 ? 31 LYS A NZ   4  
ATOM 4547  H H    . LYS A 1 31 ? -12.742 0.175   -6.166  1.00 0.00 ? 31 LYS A H    4  
ATOM 4548  H HA   . LYS A 1 31 ? -15.439 0.784   -6.987  1.00 0.00 ? 31 LYS A HA   4  
ATOM 4549  H HB2  . LYS A 1 31 ? -14.630 -1.843  -5.792  1.00 0.00 ? 31 LYS A HB2  4  
ATOM 4550  H HB3  . LYS A 1 31 ? -16.231 -1.187  -5.481  1.00 0.00 ? 31 LYS A HB3  4  
ATOM 4551  H HG2  . LYS A 1 31 ? -16.795 -2.327  -7.322  1.00 0.00 ? 31 LYS A HG2  4  
ATOM 4552  H HG3  . LYS A 1 31 ? -16.102 -0.944  -8.172  1.00 0.00 ? 31 LYS A HG3  4  
ATOM 4553  H HD2  . LYS A 1 31 ? -15.101 -2.813  -9.173  1.00 0.00 ? 31 LYS A HD2  4  
ATOM 4554  H HD3  . LYS A 1 31 ? -13.883 -2.208  -8.048  1.00 0.00 ? 31 LYS A HD3  4  
ATOM 4555  H HE2  . LYS A 1 31 ? -13.922 -4.551  -7.762  1.00 0.00 ? 31 LYS A HE2  4  
ATOM 4556  H HE3  . LYS A 1 31 ? -14.784 -3.879  -6.378  1.00 0.00 ? 31 LYS A HE3  4  
ATOM 4557  H HZ1  . LYS A 1 31 ? -15.867 -5.318  -8.710  1.00 0.00 ? 31 LYS A HZ1  4  
ATOM 4558  H HZ2  . LYS A 1 31 ? -16.854 -4.262  -7.831  1.00 0.00 ? 31 LYS A HZ2  4  
ATOM 4559  H HZ3  . LYS A 1 31 ? -16.145 -5.593  -7.064  1.00 0.00 ? 31 LYS A HZ3  4  
ATOM 4560  N N    . ILE A 1 32 ? -15.742 1.944   -4.829  1.00 0.00 ? 32 ILE A N    4  
ATOM 4561  C CA   . ILE A 1 32 ? -15.889 2.690   -3.590  1.00 0.00 ? 32 ILE A CA   4  
ATOM 4562  C C    . ILE A 1 32 ? -17.165 3.529   -3.596  1.00 0.00 ? 32 ILE A C    4  
ATOM 4563  O O    . ILE A 1 32 ? -17.304 4.461   -4.388  1.00 0.00 ? 32 ILE A O    4  
ATOM 4564  C CB   . ILE A 1 32 ? -14.675 3.606   -3.345  1.00 0.00 ? 32 ILE A CB   4  
ATOM 4565  C CG1  . ILE A 1 32 ? -14.766 4.257   -1.963  1.00 0.00 ? 32 ILE A CG1  4  
ATOM 4566  C CG2  . ILE A 1 32 ? -14.576 4.667   -4.432  1.00 0.00 ? 32 ILE A CG2  4  
ATOM 4567  C CD1  . ILE A 1 32 ? -13.442 4.307   -1.231  1.00 0.00 ? 32 ILE A CD1  4  
ATOM 4568  H H    . ILE A 1 32 ? -16.275 2.202   -5.604  1.00 0.00 ? 32 ILE A H    4  
ATOM 4569  H HA   . ILE A 1 32 ? -15.945 1.978   -2.783  1.00 0.00 ? 32 ILE A HA   4  
ATOM 4570  H HB   . ILE A 1 32 ? -13.785 2.999   -3.391  1.00 0.00 ? 32 ILE A HB   4  
ATOM 4571  H HG12 . ILE A 1 32 ? -15.122 5.270   -2.072  1.00 0.00 ? 32 ILE A HG12 4  
ATOM 4572  H HG13 . ILE A 1 32 ? -15.462 3.699   -1.354  1.00 0.00 ? 32 ILE A HG13 4  
ATOM 4573  H HG21 . ILE A 1 32 ? -15.120 5.548   -4.126  1.00 0.00 ? 32 ILE A HG21 4  
ATOM 4574  H HG22 . ILE A 1 32 ? -14.999 4.283   -5.349  1.00 0.00 ? 32 ILE A HG22 4  
ATOM 4575  H HG23 . ILE A 1 32 ? -13.539 4.922   -4.594  1.00 0.00 ? 32 ILE A HG23 4  
ATOM 4576  H HD11 . ILE A 1 32 ? -13.359 5.245   -0.702  1.00 0.00 ? 32 ILE A HD11 4  
ATOM 4577  H HD12 . ILE A 1 32 ? -12.634 4.223   -1.943  1.00 0.00 ? 32 ILE A HD12 4  
ATOM 4578  H HD13 . ILE A 1 32 ? -13.389 3.490   -0.527  1.00 0.00 ? 32 ILE A HD13 4  
ATOM 4579  N N    . ILE A 1 33 ? -18.093 3.190   -2.707  1.00 0.00 ? 33 ILE A N    4  
ATOM 4580  C CA   . ILE A 1 33 ? -19.354 3.907   -2.608  1.00 0.00 ? 33 ILE A CA   4  
ATOM 4581  C C    . ILE A 1 33 ? -20.066 3.593   -1.294  1.00 0.00 ? 33 ILE A C    4  
ATOM 4582  O O    . ILE A 1 33 ? -20.558 2.483   -1.091  1.00 0.00 ? 33 ILE A O    4  
ATOM 4583  C CB   . ILE A 1 33 ? -20.282 3.567   -3.790  1.00 0.00 ? 33 ILE A CB   4  
ATOM 4584  C CG1  . ILE A 1 33 ? -21.538 4.439   -3.753  1.00 0.00 ? 33 ILE A CG1  4  
ATOM 4585  C CG2  . ILE A 1 33 ? -20.652 2.090   -3.774  1.00 0.00 ? 33 ILE A CG2  4  
ATOM 4586  C CD1  . ILE A 1 33 ? -22.459 4.223   -4.934  1.00 0.00 ? 33 ILE A CD1  4  
ATOM 4587  H H    . ILE A 1 33 ? -17.927 2.441   -2.106  1.00 0.00 ? 33 ILE A H    4  
ATOM 4588  H HA   . ILE A 1 33 ? -19.135 4.962   -2.642  1.00 0.00 ? 33 ILE A HA   4  
ATOM 4589  H HB   . ILE A 1 33 ? -19.743 3.764   -4.703  1.00 0.00 ? 33 ILE A HB   4  
ATOM 4590  H HG12 . ILE A 1 33 ? -22.095 4.219   -2.854  1.00 0.00 ? 33 ILE A HG12 4  
ATOM 4591  H HG13 . ILE A 1 33 ? -21.246 5.479   -3.744  1.00 0.00 ? 33 ILE A HG13 4  
ATOM 4592  H HG21 . ILE A 1 33 ? -21.528 1.946   -3.159  1.00 0.00 ? 33 ILE A HG21 4  
ATOM 4593  H HG22 . ILE A 1 33 ? -19.830 1.518   -3.371  1.00 0.00 ? 33 ILE A HG22 4  
ATOM 4594  H HG23 . ILE A 1 33 ? -20.861 1.761   -4.781  1.00 0.00 ? 33 ILE A HG23 4  
ATOM 4595  H HD11 . ILE A 1 33 ? -23.075 5.099   -5.075  1.00 0.00 ? 33 ILE A HD11 4  
ATOM 4596  H HD12 . ILE A 1 33 ? -23.090 3.366   -4.747  1.00 0.00 ? 33 ILE A HD12 4  
ATOM 4597  H HD13 . ILE A 1 33 ? -21.871 4.050   -5.822  1.00 0.00 ? 33 ILE A HD13 4  
ATOM 4598  N N    . LEU A 1 34 ? -20.113 4.578   -0.403  1.00 0.00 ? 34 LEU A N    4  
ATOM 4599  C CA   . LEU A 1 34 ? -20.759 4.408   0.891   1.00 0.00 ? 34 LEU A CA   4  
ATOM 4600  C C    . LEU A 1 34 ? -22.278 4.398   0.756   1.00 0.00 ? 34 LEU A C    4  
ATOM 4601  O O    . LEU A 1 34 ? -22.983 3.841   1.598   1.00 0.00 ? 34 LEU A O    4  
ATOM 4602  C CB   . LEU A 1 34 ? -20.324 5.516   1.850   1.00 0.00 ? 34 LEU A CB   4  
ATOM 4603  C CG   . LEU A 1 34 ? -19.541 5.041   3.075   1.00 0.00 ? 34 LEU A CG   4  
ATOM 4604  C CD1  . LEU A 1 34 ? -18.581 6.123   3.547   1.00 0.00 ? 34 LEU A CD1  4  
ATOM 4605  C CD2  . LEU A 1 34 ? -20.492 4.644   4.195   1.00 0.00 ? 34 LEU A CD2  4  
ATOM 4606  H H    . LEU A 1 34 ? -19.700 5.438   -0.618  1.00 0.00 ? 34 LEU A H    4  
ATOM 4607  H HA   . LEU A 1 34 ? -20.442 3.466   1.289   1.00 0.00 ? 34 LEU A HA   4  
ATOM 4608  H HB2  . LEU A 1 34 ? -19.709 6.210   1.302   1.00 0.00 ? 34 LEU A HB2  4  
ATOM 4609  H HB3  . LEU A 1 34 ? -21.205 6.034   2.194   1.00 0.00 ? 34 LEU A HB3  4  
ATOM 4610  H HG   . LEU A 1 34 ? -18.957 4.172   2.807   1.00 0.00 ? 34 LEU A HG   4  
ATOM 4611  H HD11 . LEU A 1 34 ? -19.065 6.730   4.297   1.00 0.00 ? 34 LEU A HD11 4  
ATOM 4612  H HD12 . LEU A 1 34 ? -18.298 6.743   2.709   1.00 0.00 ? 34 LEU A HD12 4  
ATOM 4613  H HD13 . LEU A 1 34 ? -17.700 5.663   3.968   1.00 0.00 ? 34 LEU A HD13 4  
ATOM 4614  H HD21 . LEU A 1 34 ? -21.463 4.420   3.779   1.00 0.00 ? 34 LEU A HD21 4  
ATOM 4615  H HD22 . LEU A 1 34 ? -20.580 5.460   4.897   1.00 0.00 ? 34 LEU A HD22 4  
ATOM 4616  H HD23 . LEU A 1 34 ? -20.106 3.772   4.702   1.00 0.00 ? 34 LEU A HD23 4  
ATOM 4617  N N    . SER A 1 35 ? -22.776 5.018   -0.306  1.00 0.00 ? 35 SER A N    4  
ATOM 4618  C CA   . SER A 1 35 ? -24.212 5.082   -0.551  1.00 0.00 ? 35 SER A CA   4  
ATOM 4619  C C    . SER A 1 35 ? -24.805 3.686   -0.718  1.00 0.00 ? 35 SER A C    4  
ATOM 4620  O O    . SER A 1 35 ? -25.999 3.479   -0.502  1.00 0.00 ? 35 SER A O    4  
ATOM 4621  C CB   . SER A 1 35 ? -24.503 5.929   -1.793  1.00 0.00 ? 35 SER A CB   4  
ATOM 4622  O OG   . SER A 1 35 ? -23.329 6.136   -2.558  1.00 0.00 ? 35 SER A OG   4  
ATOM 4623  H H    . SER A 1 35 ? -22.163 5.443   -0.940  1.00 0.00 ? 35 SER A H    4  
ATOM 4624  H HA   . SER A 1 35 ? -24.669 5.549   0.305   1.00 0.00 ? 35 SER A HA   4  
ATOM 4625  H HB2  . SER A 1 35 ? -25.233 5.425   -2.409  1.00 0.00 ? 35 SER A HB2  4  
ATOM 4626  H HB3  . SER A 1 35 ? -24.893 6.889   -1.487  1.00 0.00 ? 35 SER A HB3  4  
ATOM 4627  H HG   . SER A 1 35 ? -23.018 7.036   -2.431  1.00 0.00 ? 35 SER A HG   4  
ATOM 4628  N N    . ASP A 1 36 ? -23.964 2.734   -1.104  1.00 0.00 ? 36 ASP A N    4  
ATOM 4629  C CA   . ASP A 1 36 ? -24.399 1.363   -1.299  1.00 0.00 ? 36 ASP A CA   4  
ATOM 4630  C C    . ASP A 1 36 ? -23.556 0.397   -0.473  1.00 0.00 ? 36 ASP A C    4  
ATOM 4631  O O    . ASP A 1 36 ? -24.034 -0.182  0.502   1.00 0.00 ? 36 ASP A O    4  
ATOM 4632  C CB   . ASP A 1 36 ? -24.329 0.987   -2.780  1.00 0.00 ? 36 ASP A CB   4  
ATOM 4633  C CG   . ASP A 1 36 ? -24.854 -0.410  -3.048  1.00 0.00 ? 36 ASP A CG   4  
ATOM 4634  O OD1  . ASP A 1 36 ? -26.072 -0.551  -3.287  1.00 0.00 ? 36 ASP A OD1  4  
ATOM 4635  O OD2  . ASP A 1 36 ? -24.047 -1.363  -3.019  1.00 0.00 ? 36 ASP A OD2  4  
ATOM 4636  H H    . ASP A 1 36 ? -23.033 2.959   -1.258  1.00 0.00 ? 36 ASP A H    4  
ATOM 4637  H HA   . ASP A 1 36 ? -25.418 1.301   -0.971  1.00 0.00 ? 36 ASP A HA   4  
ATOM 4638  H HB2  . ASP A 1 36 ? -24.918 1.688   -3.352  1.00 0.00 ? 36 ASP A HB2  4  
ATOM 4639  H HB3  . ASP A 1 36 ? -23.301 1.035   -3.109  1.00 0.00 ? 36 ASP A HB3  4  
ATOM 4640  N N    . GLU A 1 37 ? -22.300 0.225   -0.872  1.00 0.00 ? 37 GLU A N    4  
ATOM 4641  C CA   . GLU A 1 37 ? -21.391 -0.674  -0.171  1.00 0.00 ? 37 GLU A CA   4  
ATOM 4642  C C    . GLU A 1 37 ? -21.123 -0.195  1.253   1.00 0.00 ? 37 GLU A C    4  
ATOM 4643  O O    . GLU A 1 37 ? -20.696 -0.972  2.108   1.00 0.00 ? 37 GLU A O    4  
ATOM 4644  C CB   . GLU A 1 37 ? -20.077 -0.802  -0.939  1.00 0.00 ? 37 GLU A CB   4  
ATOM 4645  C CG   . GLU A 1 37 ? -19.807 -2.204  -1.450  1.00 0.00 ? 37 GLU A CG   4  
ATOM 4646  C CD   . GLU A 1 37 ? -18.542 -2.807  -0.870  1.00 0.00 ? 37 GLU A CD   4  
ATOM 4647  O OE1  . GLU A 1 37 ? -18.503 -3.039  0.356   1.00 0.00 ? 37 GLU A OE1  4  
ATOM 4648  O OE2  . GLU A 1 37 ? -17.591 -3.048  -1.643  1.00 0.00 ? 37 GLU A OE2  4  
ATOM 4649  H H    . GLU A 1 37 ? -21.978 0.712   -1.658  1.00 0.00 ? 37 GLU A H    4  
ATOM 4650  H HA   . GLU A 1 37 ? -21.858 -1.639  -0.127  1.00 0.00 ? 37 GLU A HA   4  
ATOM 4651  H HB2  . GLU A 1 37 ? -20.105 -0.135  -1.784  1.00 0.00 ? 37 GLU A HB2  4  
ATOM 4652  H HB3  . GLU A 1 37 ? -19.266 -0.518  -0.292  1.00 0.00 ? 37 GLU A HB3  4  
ATOM 4653  H HG2  . GLU A 1 37 ? -20.640 -2.832  -1.183  1.00 0.00 ? 37 GLU A HG2  4  
ATOM 4654  H HG3  . GLU A 1 37 ? -19.713 -2.169  -2.525  1.00 0.00 ? 37 GLU A HG3  4  
ATOM 4655  N N    . GLY A 1 38 ? -21.376 1.085   1.505   1.00 0.00 ? 38 GLY A N    4  
ATOM 4656  C CA   . GLY A 1 38 ? -21.156 1.636   2.828   1.00 0.00 ? 38 GLY A CA   4  
ATOM 4657  C C    . GLY A 1 38 ? -19.694 1.629   3.221   1.00 0.00 ? 38 GLY A C    4  
ATOM 4658  O O    . GLY A 1 38 ? -19.357 1.496   4.397   1.00 0.00 ? 38 GLY A O    4  
ATOM 4659  H H    . GLY A 1 38 ? -21.716 1.658   0.789   1.00 0.00 ? 38 GLY A H    4  
ATOM 4660  H HA2  . GLY A 1 38 ? -21.519 2.653   2.850   1.00 0.00 ? 38 GLY A HA2  4  
ATOM 4661  H HA3  . GLY A 1 38 ? -21.708 1.053   3.540   1.00 0.00 ? 38 GLY A HA3  4  
ATOM 4662  N N    . LYS A 1 39 ? -18.829 1.785   2.231   1.00 0.00 ? 39 LYS A N    4  
ATOM 4663  C CA   . LYS A 1 39 ? -17.401 1.813   2.456   1.00 0.00 ? 39 LYS A CA   4  
ATOM 4664  C C    . LYS A 1 39 ? -16.736 2.772   1.480   1.00 0.00 ? 39 LYS A C    4  
ATOM 4665  O O    . LYS A 1 39 ? -16.348 2.390   0.376   1.00 0.00 ? 39 LYS A O    4  
ATOM 4666  C CB   . LYS A 1 39 ? -16.805 0.411   2.310   1.00 0.00 ? 39 LYS A CB   4  
ATOM 4667  C CG   . LYS A 1 39 ? -17.011 -0.199  0.932   1.00 0.00 ? 39 LYS A CG   4  
ATOM 4668  C CD   . LYS A 1 39 ? -15.692 -0.384  0.198   1.00 0.00 ? 39 LYS A CD   4  
ATOM 4669  C CE   . LYS A 1 39 ? -15.810 -0.005  -1.270  1.00 0.00 ? 39 LYS A CE   4  
ATOM 4670  N NZ   . LYS A 1 39 ? -15.840 -1.203  -2.153  1.00 0.00 ? 39 LYS A NZ   4  
ATOM 4671  H H    . LYS A 1 39 ? -19.162 1.904   1.331   1.00 0.00 ? 39 LYS A H    4  
ATOM 4672  H HA   . LYS A 1 39 ? -17.236 2.165   3.458   1.00 0.00 ? 39 LYS A HA   4  
ATOM 4673  H HB2  . LYS A 1 39 ? -15.744 0.461   2.505   1.00 0.00 ? 39 LYS A HB2  4  
ATOM 4674  H HB3  . LYS A 1 39 ? -17.265 -0.240  3.040   1.00 0.00 ? 39 LYS A HB3  4  
ATOM 4675  H HG2  . LYS A 1 39 ? -17.487 -1.161  1.042   1.00 0.00 ? 39 LYS A HG2  4  
ATOM 4676  H HG3  . LYS A 1 39 ? -17.647 0.455   0.352   1.00 0.00 ? 39 LYS A HG3  4  
ATOM 4677  H HD2  . LYS A 1 39 ? -14.943 0.241   0.661   1.00 0.00 ? 39 LYS A HD2  4  
ATOM 4678  H HD3  . LYS A 1 39 ? -15.394 -1.420  0.270   1.00 0.00 ? 39 LYS A HD3  4  
ATOM 4679  H HE2  . LYS A 1 39 ? -16.720 0.559   -1.412  1.00 0.00 ? 39 LYS A HE2  4  
ATOM 4680  H HE3  . LYS A 1 39 ? -14.963 0.609   -1.539  1.00 0.00 ? 39 LYS A HE3  4  
ATOM 4681  H HZ1  . LYS A 1 39 ? -16.188 -2.028  -1.624  1.00 0.00 ? 39 LYS A HZ1  4  
ATOM 4682  H HZ2  . LYS A 1 39 ? -14.885 -1.411  -2.507  1.00 0.00 ? 39 LYS A HZ2  4  
ATOM 4683  H HZ3  . LYS A 1 39 ? -16.469 -1.034  -2.964  1.00 0.00 ? 39 LYS A HZ3  4  
ATOM 4684  N N    . MET A 1 40 ? -16.607 4.015   1.905   1.00 0.00 ? 40 MET A N    4  
ATOM 4685  C CA   . MET A 1 40 ? -15.988 5.046   1.094   1.00 0.00 ? 40 MET A CA   4  
ATOM 4686  C C    . MET A 1 40 ? -15.279 6.066   1.976   1.00 0.00 ? 40 MET A C    4  
ATOM 4687  O O    . MET A 1 40 ? -15.850 7.093   2.343   1.00 0.00 ? 40 MET A O    4  
ATOM 4688  C CB   . MET A 1 40 ? -17.034 5.742   0.221   1.00 0.00 ? 40 MET A CB   4  
ATOM 4689  C CG   . MET A 1 40 ? -16.458 6.834   -0.668  1.00 0.00 ? 40 MET A CG   4  
ATOM 4690  S SD   . MET A 1 40 ? -17.060 8.478   -0.235  1.00 0.00 ? 40 MET A SD   4  
ATOM 4691  C CE   . MET A 1 40 ? -18.771 8.358   -0.751  1.00 0.00 ? 40 MET A CE   4  
ATOM 4692  H H    . MET A 1 40 ? -16.935 4.243   2.787   1.00 0.00 ? 40 MET A H    4  
ATOM 4693  H HA   . MET A 1 40 ? -15.261 4.569   0.462   1.00 0.00 ? 40 MET A HA   4  
ATOM 4694  H HB2  . MET A 1 40 ? -17.505 5.004   -0.412  1.00 0.00 ? 40 MET A HB2  4  
ATOM 4695  H HB3  . MET A 1 40 ? -17.782 6.185   0.861   1.00 0.00 ? 40 MET A HB3  4  
ATOM 4696  H HG2  . MET A 1 40 ? -15.382 6.825   -0.573  1.00 0.00 ? 40 MET A HG2  4  
ATOM 4697  H HG3  . MET A 1 40 ? -16.728 6.624   -1.693  1.00 0.00 ? 40 MET A HG3  4  
ATOM 4698  H HE1  . MET A 1 40 ? -18.939 9.010   -1.595  1.00 0.00 ? 40 MET A HE1  4  
ATOM 4699  H HE2  . MET A 1 40 ? -19.415 8.651   0.065   1.00 0.00 ? 40 MET A HE2  4  
ATOM 4700  H HE3  . MET A 1 40 ? -18.991 7.339   -1.034  1.00 0.00 ? 40 MET A HE3  4  
ATOM 4701  N N    . TYR A 1 41 ? -14.031 5.770   2.310   1.00 0.00 ? 41 TYR A N    4  
ATOM 4702  C CA   . TYR A 1 41 ? -13.229 6.645   3.145   1.00 0.00 ? 41 TYR A CA   4  
ATOM 4703  C C    . TYR A 1 41 ? -11.760 6.587   2.736   1.00 0.00 ? 41 TYR A C    4  
ATOM 4704  O O    . TYR A 1 41 ? -11.405 5.931   1.757   1.00 0.00 ? 41 TYR A O    4  
ATOM 4705  C CB   . TYR A 1 41 ? -13.384 6.263   4.615   1.00 0.00 ? 41 TYR A CB   4  
ATOM 4706  C CG   . TYR A 1 41 ? -13.936 7.375   5.479   1.00 0.00 ? 41 TYR A CG   4  
ATOM 4707  C CD1  . TYR A 1 41 ? -13.556 8.696   5.275   1.00 0.00 ? 41 TYR A CD1  4  
ATOM 4708  C CD2  . TYR A 1 41 ? -14.838 7.103   6.500   1.00 0.00 ? 41 TYR A CD2  4  
ATOM 4709  C CE1  . TYR A 1 41 ? -14.059 9.714   6.064   1.00 0.00 ? 41 TYR A CE1  4  
ATOM 4710  C CE2  . TYR A 1 41 ? -15.345 8.115   7.293   1.00 0.00 ? 41 TYR A CE2  4  
ATOM 4711  C CZ   . TYR A 1 41 ? -14.953 9.418   7.071   1.00 0.00 ? 41 TYR A CZ   4  
ATOM 4712  O OH   . TYR A 1 41 ? -15.456 10.428  7.859   1.00 0.00 ? 41 TYR A OH   4  
ATOM 4713  H H    . TYR A 1 41 ? -13.642 4.940   1.988   1.00 0.00 ? 41 TYR A H    4  
ATOM 4714  H HA   . TYR A 1 41 ? -13.588 7.643   3.006   1.00 0.00 ? 41 TYR A HA   4  
ATOM 4715  H HB2  . TYR A 1 41 ? -14.055 5.422   4.690   1.00 0.00 ? 41 TYR A HB2  4  
ATOM 4716  H HB3  . TYR A 1 41 ? -12.420 5.984   5.006   1.00 0.00 ? 41 TYR A HB3  4  
ATOM 4717  H HD1  . TYR A 1 41 ? -12.857 8.925   4.485   1.00 0.00 ? 41 TYR A HD1  4  
ATOM 4718  H HD2  . TYR A 1 41 ? -15.144 6.081   6.672   1.00 0.00 ? 41 TYR A HD2  4  
ATOM 4719  H HE1  . TYR A 1 41 ? -13.752 10.734  5.890   1.00 0.00 ? 41 TYR A HE1  4  
ATOM 4720  H HE2  . TYR A 1 41 ? -16.045 7.882   8.082   1.00 0.00 ? 41 TYR A HE2  4  
ATOM 4721  H HH   . TYR A 1 41 ? -14.732 10.894  8.283   1.00 0.00 ? 41 TYR A HH   4  
ATOM 4722  N N    . GLY A 1 42 ? -10.910 7.277   3.490   1.00 0.00 ? 42 GLY A N    4  
ATOM 4723  C CA   . GLY A 1 42 ? -9.490  7.288   3.187   1.00 0.00 ? 42 GLY A CA   4  
ATOM 4724  C C    . GLY A 1 42 ? -8.913  5.892   3.052   1.00 0.00 ? 42 GLY A C    4  
ATOM 4725  O O    . GLY A 1 42 ? -8.660  5.217   4.050   1.00 0.00 ? 42 GLY A O    4  
ATOM 4726  H H    . GLY A 1 42 ? -11.249 7.782   4.259   1.00 0.00 ? 42 GLY A H    4  
ATOM 4727  H HA2  . GLY A 1 42 ? -9.335  7.821   2.260   1.00 0.00 ? 42 GLY A HA2  4  
ATOM 4728  H HA3  . GLY A 1 42 ? -8.968  7.806   3.978   1.00 0.00 ? 42 GLY A HA3  4  
ATOM 4729  N N    . ARG A 1 43 ? -8.709  5.457   1.812   1.00 0.00 ? 43 ARG A N    4  
ATOM 4730  C CA   . ARG A 1 43 ? -8.164  4.131   1.544   1.00 0.00 ? 43 ARG A CA   4  
ATOM 4731  C C    . ARG A 1 43 ? -6.822  3.931   2.240   1.00 0.00 ? 43 ARG A C    4  
ATOM 4732  O O    . ARG A 1 43 ? -6.424  2.803   2.532   1.00 0.00 ? 43 ARG A O    4  
ATOM 4733  C CB   . ARG A 1 43 ? -8.011  3.918   0.039   1.00 0.00 ? 43 ARG A CB   4  
ATOM 4734  C CG   . ARG A 1 43 ? -8.891  2.807   -0.510  1.00 0.00 ? 43 ARG A CG   4  
ATOM 4735  C CD   . ARG A 1 43 ? -8.257  1.441   -0.304  1.00 0.00 ? 43 ARG A CD   4  
ATOM 4736  N NE   . ARG A 1 43 ? -8.939  0.400   -1.069  1.00 0.00 ? 43 ARG A NE   4  
ATOM 4737  C CZ   . ARG A 1 43 ? -8.765  0.203   -2.373  1.00 0.00 ? 43 ARG A CZ   4  
ATOM 4738  N NH1  . ARG A 1 43 ? -7.933  0.974   -3.063  1.00 0.00 ? 43 ARG A NH1  4  
ATOM 4739  N NH2  . ARG A 1 43 ? -9.425  -0.767  -2.991  1.00 0.00 ? 43 ARG A NH2  4  
ATOM 4740  H H    . ARG A 1 43 ? -8.934  6.042   1.059   1.00 0.00 ? 43 ARG A H    4  
ATOM 4741  H HA   . ARG A 1 43 ? -8.859  3.409   1.925   1.00 0.00 ? 43 ARG A HA   4  
ATOM 4742  H HB2  . ARG A 1 43 ? -8.269  4.834   -0.465  1.00 0.00 ? 43 ARG A HB2  4  
ATOM 4743  H HB3  . ARG A 1 43 ? -6.983  3.673   -0.177  1.00 0.00 ? 43 ARG A HB3  4  
ATOM 4744  H HG2  . ARG A 1 43 ? -9.843  2.830   -0.002  1.00 0.00 ? 43 ARG A HG2  4  
ATOM 4745  H HG3  . ARG A 1 43 ? -9.041  2.969   -1.567  1.00 0.00 ? 43 ARG A HG3  4  
ATOM 4746  H HD2  . ARG A 1 43 ? -7.225  1.486   -0.619  1.00 0.00 ? 43 ARG A HD2  4  
ATOM 4747  H HD3  . ARG A 1 43 ? -8.302  1.192   0.746   1.00 0.00 ? 43 ARG A HD3  4  
ATOM 4748  H HE   . ARG A 1 43 ? -9.560  -0.184  -0.584  1.00 0.00 ? 43 ARG A HE   4  
ATOM 4749  H HH11 . ARG A 1 43 ? -7.432  1.707   -2.603  1.00 0.00 ? 43 ARG A HH11 4  
ATOM 4750  H HH12 . ARG A 1 43 ? -7.806  0.821   -4.043  1.00 0.00 ? 43 ARG A HH12 4  
ATOM 4751  H HH21 . ARG A 1 43 ? -10.053 -1.351  -2.477  1.00 0.00 ? 43 ARG A HH21 4  
ATOM 4752  H HH22 . ARG A 1 43 ? -9.294  -0.915  -3.972  1.00 0.00 ? 43 ARG A HH22 4  
ATOM 4753  N N    . ASN A 1 44 ? -6.130  5.032   2.503   1.00 0.00 ? 44 ASN A N    4  
ATOM 4754  C CA   . ASN A 1 44 ? -4.832  4.976   3.165   1.00 0.00 ? 44 ASN A CA   4  
ATOM 4755  C C    . ASN A 1 44 ? -4.951  4.350   4.547   1.00 0.00 ? 44 ASN A C    4  
ATOM 4756  O O    . ASN A 1 44 ? -3.996  3.766   5.061   1.00 0.00 ? 44 ASN A O    4  
ATOM 4757  C CB   . ASN A 1 44 ? -4.225  6.374   3.266   1.00 0.00 ? 44 ASN A CB   4  
ATOM 4758  C CG   . ASN A 1 44 ? -2.929  6.500   2.491   1.00 0.00 ? 44 ASN A CG   4  
ATOM 4759  O OD1  . ASN A 1 44 ? -2.708  5.792   1.508   1.00 0.00 ? 44 ASN A OD1  4  
ATOM 4760  N ND2  . ASN A 1 44 ? -2.063  7.406   2.930   1.00 0.00 ? 44 ASN A ND2  4  
ATOM 4761  H H    . ASN A 1 44 ? -6.501  5.900   2.245   1.00 0.00 ? 44 ASN A H    4  
ATOM 4762  H HA   . ASN A 1 44 ? -4.189  4.361   2.567   1.00 0.00 ? 44 ASN A HA   4  
ATOM 4763  H HB2  . ASN A 1 44 ? -4.928  7.089   2.874   1.00 0.00 ? 44 ASN A HB2  4  
ATOM 4764  H HB3  . ASN A 1 44 ? -4.027  6.599   4.302   1.00 0.00 ? 44 ASN A HB3  4  
ATOM 4765  H HD21 . ASN A 1 44 ? -2.305  7.934   3.719   1.00 0.00 ? 44 ASN A HD21 4  
ATOM 4766  H HD22 . ASN A 1 44 ? -1.216  7.509   2.447   1.00 0.00 ? 44 ASN A HD22 4  
ATOM 4767  N N    . GLU A 1 45 ? -6.128  4.469   5.142   1.00 0.00 ? 45 GLU A N    4  
ATOM 4768  C CA   . GLU A 1 45 ? -6.374  3.906   6.459   1.00 0.00 ? 45 GLU A CA   4  
ATOM 4769  C C    . GLU A 1 45 ? -6.583  2.400   6.366   1.00 0.00 ? 45 GLU A C    4  
ATOM 4770  O O    . GLU A 1 45 ? -6.332  1.666   7.321   1.00 0.00 ? 45 GLU A O    4  
ATOM 4771  C CB   . GLU A 1 45 ? -7.590  4.569   7.107   1.00 0.00 ? 45 GLU A CB   4  
ATOM 4772  C CG   . GLU A 1 45 ? -7.447  4.767   8.608   1.00 0.00 ? 45 GLU A CG   4  
ATOM 4773  C CD   . GLU A 1 45 ? -8.240  5.955   9.117   1.00 0.00 ? 45 GLU A CD   4  
ATOM 4774  O OE1  . GLU A 1 45 ? -7.717  7.087   9.058   1.00 0.00 ? 45 GLU A OE1  4  
ATOM 4775  O OE2  . GLU A 1 45 ? -9.384  5.752   9.574   1.00 0.00 ? 45 GLU A OE2  4  
ATOM 4776  H H    . GLU A 1 45 ? -6.848  4.939   4.683   1.00 0.00 ? 45 GLU A H    4  
ATOM 4777  H HA   . GLU A 1 45 ? -5.505  4.097   7.059   1.00 0.00 ? 45 GLU A HA   4  
ATOM 4778  H HB2  . GLU A 1 45 ? -7.745  5.536   6.651   1.00 0.00 ? 45 GLU A HB2  4  
ATOM 4779  H HB3  . GLU A 1 45 ? -8.459  3.953   6.929   1.00 0.00 ? 45 GLU A HB3  4  
ATOM 4780  H HG2  . GLU A 1 45 ? -7.797  3.878   9.110   1.00 0.00 ? 45 GLU A HG2  4  
ATOM 4781  H HG3  . GLU A 1 45 ? -6.403  4.923   8.839   1.00 0.00 ? 45 GLU A HG3  4  
ATOM 4782  N N    . LEU A 1 46 ? -7.039  1.950   5.203   1.00 0.00 ? 46 LEU A N    4  
ATOM 4783  C CA   . LEU A 1 46 ? -7.279  0.535   4.972   1.00 0.00 ? 46 LEU A CA   4  
ATOM 4784  C C    . LEU A 1 46 ? -5.972  -0.209  4.770   1.00 0.00 ? 46 LEU A C    4  
ATOM 4785  O O    . LEU A 1 46 ? -5.792  -1.322  5.266   1.00 0.00 ? 46 LEU A O    4  
ATOM 4786  C CB   . LEU A 1 46 ? -8.184  0.338   3.760   1.00 0.00 ? 46 LEU A CB   4  
ATOM 4787  C CG   . LEU A 1 46 ? -9.263  -0.736  3.915   1.00 0.00 ? 46 LEU A CG   4  
ATOM 4788  C CD1  . LEU A 1 46 ? -9.958  -0.984  2.585   1.00 0.00 ? 46 LEU A CD1  4  
ATOM 4789  C CD2  . LEU A 1 46 ? -8.660  -2.026  4.449   1.00 0.00 ? 46 LEU A CD2  4  
ATOM 4790  H H    . LEU A 1 46 ? -7.215  2.585   4.484   1.00 0.00 ? 46 LEU A H    4  
ATOM 4791  H HA   . LEU A 1 46 ? -7.764  0.142   5.833   1.00 0.00 ? 46 LEU A HA   4  
ATOM 4792  H HB2  . LEU A 1 46 ? -8.667  1.278   3.539   1.00 0.00 ? 46 LEU A HB2  4  
ATOM 4793  H HB3  . LEU A 1 46 ? -7.563  0.069   2.927   1.00 0.00 ? 46 LEU A HB3  4  
ATOM 4794  H HG   . LEU A 1 46 ? -10.005 -0.393  4.621   1.00 0.00 ? 46 LEU A HG   4  
ATOM 4795  H HD11 . LEU A 1 46 ? -10.441 -0.077  2.256   1.00 0.00 ? 46 LEU A HD11 4  
ATOM 4796  H HD12 . LEU A 1 46 ? -10.697 -1.763  2.705   1.00 0.00 ? 46 LEU A HD12 4  
ATOM 4797  H HD13 . LEU A 1 46 ? -9.228  -1.291  1.850   1.00 0.00 ? 46 LEU A HD13 4  
ATOM 4798  H HD21 . LEU A 1 46 ? -7.881  -2.363  3.781   1.00 0.00 ? 46 LEU A HD21 4  
ATOM 4799  H HD22 . LEU A 1 46 ? -9.428  -2.782  4.516   1.00 0.00 ? 46 LEU A HD22 4  
ATOM 4800  H HD23 . LEU A 1 46 ? -8.242  -1.850  5.429   1.00 0.00 ? 46 LEU A HD23 4  
ATOM 4801  N N    . ILE A 1 47 ? -5.062  0.415   4.043   1.00 0.00 ? 47 ILE A N    4  
ATOM 4802  C CA   . ILE A 1 47 ? -3.768  -0.180  3.776   1.00 0.00 ? 47 ILE A CA   4  
ATOM 4803  C C    . ILE A 1 47 ? -2.884  -0.108  5.008   1.00 0.00 ? 47 ILE A C    4  
ATOM 4804  O O    . ILE A 1 47 ? -2.080  -1.004  5.265   1.00 0.00 ? 47 ILE A O    4  
ATOM 4805  C CB   . ILE A 1 47 ? -3.045  0.494   2.588   1.00 0.00 ? 47 ILE A CB   4  
ATOM 4806  C CG1  . ILE A 1 47 ? -3.488  1.949   2.416   1.00 0.00 ? 47 ILE A CG1  4  
ATOM 4807  C CG2  . ILE A 1 47 ? -3.284  -0.290  1.307   1.00 0.00 ? 47 ILE A CG2  4  
ATOM 4808  C CD1  . ILE A 1 47 ? -2.493  2.797   1.654   1.00 0.00 ? 47 ILE A CD1  4  
ATOM 4809  H H    . ILE A 1 47 ? -5.266  1.296   3.683   1.00 0.00 ? 47 ILE A H    4  
ATOM 4810  H HA   . ILE A 1 47 ? -3.931  -1.213  3.535   1.00 0.00 ? 47 ILE A HA   4  
ATOM 4811  H HB   . ILE A 1 47 ? -1.992  0.476   2.796   1.00 0.00 ? 47 ILE A HB   4  
ATOM 4812  H HG12 . ILE A 1 47 ? -4.424  1.973   1.878   1.00 0.00 ? 47 ILE A HG12 4  
ATOM 4813  H HG13 . ILE A 1 47 ? -3.627  2.394   3.390   1.00 0.00 ? 47 ILE A HG13 4  
ATOM 4814  H HG21 . ILE A 1 47 ? -4.268  -0.735  1.336   1.00 0.00 ? 47 ILE A HG21 4  
ATOM 4815  H HG22 . ILE A 1 47 ? -2.540  -1.066  1.216   1.00 0.00 ? 47 ILE A HG22 4  
ATOM 4816  H HG23 . ILE A 1 47 ? -3.216  0.377   0.460   1.00 0.00 ? 47 ILE A HG23 4  
ATOM 4817  H HD11 . ILE A 1 47 ? -1.979  2.184   0.929   1.00 0.00 ? 47 ILE A HD11 4  
ATOM 4818  H HD12 . ILE A 1 47 ? -1.776  3.217   2.343   1.00 0.00 ? 47 ILE A HD12 4  
ATOM 4819  H HD13 . ILE A 1 47 ? -3.015  3.595   1.146   1.00 0.00 ? 47 ILE A HD13 4  
ATOM 4820  N N    . ALA A 1 48 ? -3.047  0.960   5.770   1.00 0.00 ? 48 ALA A N    4  
ATOM 4821  C CA   . ALA A 1 48 ? -2.276  1.151   6.983   1.00 0.00 ? 48 ALA A CA   4  
ATOM 4822  C C    . ALA A 1 48 ? -2.832  0.302   8.115   1.00 0.00 ? 48 ALA A C    4  
ATOM 4823  O O    . ALA A 1 48 ? -2.113  -0.058  9.045   1.00 0.00 ? 48 ALA A O    4  
ATOM 4824  C CB   . ALA A 1 48 ? -2.244  2.620   7.374   1.00 0.00 ? 48 ALA A CB   4  
ATOM 4825  H H    . ALA A 1 48 ? -3.707  1.630   5.513   1.00 0.00 ? 48 ALA A H    4  
ATOM 4826  H HA   . ALA A 1 48 ? -1.270  0.831   6.779   1.00 0.00 ? 48 ALA A HA   4  
ATOM 4827  H HB1  . ALA A 1 48 ? -3.244  3.026   7.327   1.00 0.00 ? 48 ALA A HB1  4  
ATOM 4828  H HB2  . ALA A 1 48 ? -1.604  3.160   6.691   1.00 0.00 ? 48 ALA A HB2  4  
ATOM 4829  H HB3  . ALA A 1 48 ? -1.862  2.717   8.379   1.00 0.00 ? 48 ALA A HB3  4  
ATOM 4830  N N    . ARG A 1 49 ? -4.113  -0.033  8.023   1.00 0.00 ? 49 ARG A N    4  
ATOM 4831  C CA   . ARG A 1 49 ? -4.746  -0.860  9.032   1.00 0.00 ? 49 ARG A CA   4  
ATOM 4832  C C    . ARG A 1 49 ? -4.338  -2.312  8.838   1.00 0.00 ? 49 ARG A C    4  
ATOM 4833  O O    . ARG A 1 49 ? -4.306  -3.095  9.787   1.00 0.00 ? 49 ARG A O    4  
ATOM 4834  C CB   . ARG A 1 49 ? -6.269  -0.722  8.972   1.00 0.00 ? 49 ARG A CB   4  
ATOM 4835  C CG   . ARG A 1 49 ? -6.821  0.339   9.910   1.00 0.00 ? 49 ARG A CG   4  
ATOM 4836  C CD   . ARG A 1 49 ? -8.330  0.228   10.050  1.00 0.00 ? 49 ARG A CD   4  
ATOM 4837  N NE   . ARG A 1 49 ? -8.717  -0.486  11.265  1.00 0.00 ? 49 ARG A NE   4  
ATOM 4838  C CZ   . ARG A 1 49 ? -9.923  -1.011  11.464  1.00 0.00 ? 49 ARG A CZ   4  
ATOM 4839  N NH1  . ARG A 1 49 ? -10.863 -0.905  10.532  1.00 0.00 ? 49 ARG A NH1  4  
ATOM 4840  N NH2  . ARG A 1 49 ? -10.191 -1.645  12.597  1.00 0.00 ? 49 ARG A NH2  4  
ATOM 4841  H H    . ARG A 1 49 ? -4.636  0.270   7.255   1.00 0.00 ? 49 ARG A H    4  
ATOM 4842  H HA   . ARG A 1 49 ? -4.394  -0.529  9.990   1.00 0.00 ? 49 ARG A HA   4  
ATOM 4843  H HB2  . ARG A 1 49 ? -6.556  -0.464  7.963   1.00 0.00 ? 49 ARG A HB2  4  
ATOM 4844  H HB3  . ARG A 1 49 ? -6.716  -1.670  9.232   1.00 0.00 ? 49 ARG A HB3  4  
ATOM 4845  H HG2  . ARG A 1 49 ? -6.369  0.215   10.883  1.00 0.00 ? 49 ARG A HG2  4  
ATOM 4846  H HG3  . ARG A 1 49 ? -6.574  1.315   9.519   1.00 0.00 ? 49 ARG A HG3  4  
ATOM 4847  H HD2  . ARG A 1 49 ? -8.750  1.223   10.081  1.00 0.00 ? 49 ARG A HD2  4  
ATOM 4848  H HD3  . ARG A 1 49 ? -8.721  -0.300  9.193   1.00 0.00 ? 49 ARG A HD3  4  
ATOM 4849  H HE   . ARG A 1 49 ? -8.042  -0.579  11.969  1.00 0.00 ? 49 ARG A HE   4  
ATOM 4850  H HH11 . ARG A 1 49 ? -10.667 -0.429  9.675   1.00 0.00 ? 49 ARG A HH11 4  
ATOM 4851  H HH12 . ARG A 1 49 ? -11.767 -1.302  10.688  1.00 0.00 ? 49 ARG A HH12 4  
ATOM 4852  H HH21 . ARG A 1 49 ? -9.487  -1.729  13.302  1.00 0.00 ? 49 ARG A HH21 4  
ATOM 4853  H HH22 . ARG A 1 49 ? -11.098 -2.040  12.747  1.00 0.00 ? 49 ARG A HH22 4  
ATOM 4854  N N    . TYR A 1 50 ? -4.008  -2.656  7.599   1.00 0.00 ? 50 TYR A N    4  
ATOM 4855  C CA   . TYR A 1 50 ? -3.580  -4.002  7.270   1.00 0.00 ? 50 TYR A CA   4  
ATOM 4856  C C    . TYR A 1 50 ? -2.207  -4.275  7.844   1.00 0.00 ? 50 TYR A C    4  
ATOM 4857  O O    . TYR A 1 50 ? -1.992  -5.262  8.548   1.00 0.00 ? 50 TYR A O    4  
ATOM 4858  C CB   . TYR A 1 50 ? -3.548  -4.195  5.766   1.00 0.00 ? 50 TYR A CB   4  
ATOM 4859  C CG   . TYR A 1 50 ? -3.609  -5.643  5.340   1.00 0.00 ? 50 TYR A CG   4  
ATOM 4860  C CD1  . TYR A 1 50 ? -4.752  -6.403  5.547   1.00 0.00 ? 50 TYR A CD1  4  
ATOM 4861  C CD2  . TYR A 1 50 ? -2.516  -6.250  4.737   1.00 0.00 ? 50 TYR A CD2  4  
ATOM 4862  C CE1  . TYR A 1 50 ? -4.805  -7.729  5.163   1.00 0.00 ? 50 TYR A CE1  4  
ATOM 4863  C CE2  . TYR A 1 50 ? -2.560  -7.574  4.349   1.00 0.00 ? 50 TYR A CE2  4  
ATOM 4864  C CZ   . TYR A 1 50 ? -3.707  -8.310  4.564   1.00 0.00 ? 50 TYR A CZ   4  
ATOM 4865  O OH   . TYR A 1 50 ? -3.755  -9.630  4.180   1.00 0.00 ? 50 TYR A OH   4  
ATOM 4866  H H    . TYR A 1 50 ? -4.043  -1.982  6.890   1.00 0.00 ? 50 TYR A H    4  
ATOM 4867  H HA   . TYR A 1 50 ? -4.271  -4.685  7.693   1.00 0.00 ? 50 TYR A HA   4  
ATOM 4868  H HB2  . TYR A 1 50 ? -4.380  -3.676  5.324   1.00 0.00 ? 50 TYR A HB2  4  
ATOM 4869  H HB3  . TYR A 1 50 ? -2.635  -3.780  5.393   1.00 0.00 ? 50 TYR A HB3  4  
ATOM 4870  H HD1  . TYR A 1 50 ? -5.611  -5.944  6.015   1.00 0.00 ? 50 TYR A HD1  4  
ATOM 4871  H HD2  . TYR A 1 50 ? -1.620  -5.671  4.571   1.00 0.00 ? 50 TYR A HD2  4  
ATOM 4872  H HE1  . TYR A 1 50 ? -5.703  -8.304  5.332   1.00 0.00 ? 50 TYR A HE1  4  
ATOM 4873  H HE2  . TYR A 1 50 ? -1.699  -8.026  3.882   1.00 0.00 ? 50 TYR A HE2  4  
ATOM 4874  H HH   . TYR A 1 50 ? -3.948  -10.179 4.943   1.00 0.00 ? 50 TYR A HH   4  
ATOM 4875  N N    . ILE A 1 51 ? -1.283  -3.384  7.538   1.00 0.00 ? 51 ILE A N    4  
ATOM 4876  C CA   . ILE A 1 51 ? 0.078   -3.508  8.018   1.00 0.00 ? 51 ILE A CA   4  
ATOM 4877  C C    . ILE A 1 51 ? 0.117   -3.455  9.536   1.00 0.00 ? 51 ILE A C    4  
ATOM 4878  O O    . ILE A 1 51 ? 0.919   -4.135  10.176  1.00 0.00 ? 51 ILE A O    4  
ATOM 4879  C CB   . ILE A 1 51 ? 0.992   -2.412  7.443   1.00 0.00 ? 51 ILE A CB   4  
ATOM 4880  C CG1  . ILE A 1 51 ? 0.225   -1.106  7.220   1.00 0.00 ? 51 ILE A CG1  4  
ATOM 4881  C CG2  . ILE A 1 51 ? 1.629   -2.886  6.145   1.00 0.00 ? 51 ILE A CG2  4  
ATOM 4882  C CD1  . ILE A 1 51 ? 1.025   0.131   7.567   1.00 0.00 ? 51 ILE A CD1  4  
ATOM 4883  H H    . ILE A 1 51 ? -1.528  -2.622  6.976   1.00 0.00 ? 51 ILE A H    4  
ATOM 4884  H HA   . ILE A 1 51 ? 0.453   -4.465  7.700   1.00 0.00 ? 51 ILE A HA   4  
ATOM 4885  H HB   . ILE A 1 51 ? 1.773   -2.236  8.154   1.00 0.00 ? 51 ILE A HB   4  
ATOM 4886  H HG12 . ILE A 1 51 ? -0.059  -1.035  6.181   1.00 0.00 ? 51 ILE A HG12 4  
ATOM 4887  H HG13 . ILE A 1 51 ? -0.663  -1.110  7.832   1.00 0.00 ? 51 ILE A HG13 4  
ATOM 4888  H HG21 . ILE A 1 51 ? 2.609   -3.289  6.350   1.00 0.00 ? 51 ILE A HG21 4  
ATOM 4889  H HG22 . ILE A 1 51 ? 1.716   -2.055  5.461   1.00 0.00 ? 51 ILE A HG22 4  
ATOM 4890  H HG23 . ILE A 1 51 ? 1.010   -3.654  5.700   1.00 0.00 ? 51 ILE A HG23 4  
ATOM 4891  H HD11 . ILE A 1 51 ? 0.731   0.943   6.918   1.00 0.00 ? 51 ILE A HD11 4  
ATOM 4892  H HD12 . ILE A 1 51 ? 2.077   -0.072  7.435   1.00 0.00 ? 51 ILE A HD12 4  
ATOM 4893  H HD13 . ILE A 1 51 ? 0.837   0.405   8.594   1.00 0.00 ? 51 ILE A HD13 4  
ATOM 4894  N N    . LYS A 1 52 ? -0.769  -2.653  10.104  1.00 0.00 ? 52 LYS A N    4  
ATOM 4895  C CA   . LYS A 1 52 ? -0.856  -2.516  11.549  1.00 0.00 ? 52 LYS A CA   4  
ATOM 4896  C C    . LYS A 1 52 ? -1.387  -3.802  12.175  1.00 0.00 ? 52 LYS A C    4  
ATOM 4897  O O    . LYS A 1 52 ? -1.134  -4.086  13.346  1.00 0.00 ? 52 LYS A O    4  
ATOM 4898  C CB   . LYS A 1 52 ? -1.757  -1.336  11.923  1.00 0.00 ? 52 LYS A CB   4  
ATOM 4899  C CG   . LYS A 1 52 ? -0.997  -0.149  12.493  1.00 0.00 ? 52 LYS A CG   4  
ATOM 4900  C CD   . LYS A 1 52 ? -0.443  0.740   11.391  1.00 0.00 ? 52 LYS A CD   4  
ATOM 4901  C CE   . LYS A 1 52 ? -1.305  1.976   11.184  1.00 0.00 ? 52 LYS A CE   4  
ATOM 4902  N NZ   . LYS A 1 52 ? -2.757  1.645   11.162  1.00 0.00 ? 52 LYS A NZ   4  
ATOM 4903  H H    . LYS A 1 52 ? -1.383  -2.148  9.535   1.00 0.00 ? 52 LYS A H    4  
ATOM 4904  H HA   . LYS A 1 52 ? 0.136   -2.334  11.920  1.00 0.00 ? 52 LYS A HA   4  
ATOM 4905  H HB2  . LYS A 1 52 ? -2.286  -1.008  11.041  1.00 0.00 ? 52 LYS A HB2  4  
ATOM 4906  H HB3  . LYS A 1 52 ? -2.475  -1.663  12.661  1.00 0.00 ? 52 LYS A HB3  4  
ATOM 4907  H HG2  . LYS A 1 52 ? -1.667  0.433   13.108  1.00 0.00 ? 52 LYS A HG2  4  
ATOM 4908  H HG3  . LYS A 1 52 ? -0.178  -0.514  13.095  1.00 0.00 ? 52 LYS A HG3  4  
ATOM 4909  H HD2  . LYS A 1 52 ? 0.555   1.051   11.661  1.00 0.00 ? 52 LYS A HD2  4  
ATOM 4910  H HD3  . LYS A 1 52 ? -0.410  0.176   10.470  1.00 0.00 ? 52 LYS A HD3  4  
ATOM 4911  H HE2  . LYS A 1 52 ? -1.116  2.670   11.989  1.00 0.00 ? 52 LYS A HE2  4  
ATOM 4912  H HE3  . LYS A 1 52 ? -1.034  2.434   10.244  1.00 0.00 ? 52 LYS A HE3  4  
ATOM 4913  H HZ1  . LYS A 1 52 ? -3.301  2.449   10.789  1.00 0.00 ? 52 LYS A HZ1  4  
ATOM 4914  H HZ2  . LYS A 1 52 ? -3.090  1.432   12.123  1.00 0.00 ? 52 LYS A HZ2  4  
ATOM 4915  H HZ3  . LYS A 1 52 ? -2.925  0.816   10.557  1.00 0.00 ? 52 LYS A HZ3  4  
ATOM 4916  N N    . LEU A 1 53 ? -2.123  -4.575  11.384  1.00 0.00 ? 53 LEU A N    4  
ATOM 4917  C CA   . LEU A 1 53 ? -2.692  -5.831  11.851  1.00 0.00 ? 53 LEU A CA   4  
ATOM 4918  C C    . LEU A 1 53 ? -1.618  -6.903  11.991  1.00 0.00 ? 53 LEU A C    4  
ATOM 4919  O O    . LEU A 1 53 ? -1.738  -7.816  12.807  1.00 0.00 ? 53 LEU A O    4  
ATOM 4920  C CB   . LEU A 1 53 ? -3.784  -6.308  10.890  1.00 0.00 ? 53 LEU A CB   4  
ATOM 4921  C CG   . LEU A 1 53 ? -5.012  -6.936  11.554  1.00 0.00 ? 53 LEU A CG   4  
ATOM 4922  C CD1  . LEU A 1 53 ? -4.596  -7.976  12.582  1.00 0.00 ? 53 LEU A CD1  4  
ATOM 4923  C CD2  . LEU A 1 53 ? -5.875  -5.861  12.197  1.00 0.00 ? 53 LEU A CD2  4  
ATOM 4924  H H    . LEU A 1 53 ? -2.289  -4.293  10.463  1.00 0.00 ? 53 LEU A H    4  
ATOM 4925  H HA   . LEU A 1 53 ? -3.129  -5.651  12.815  1.00 0.00 ? 53 LEU A HA   4  
ATOM 4926  H HB2  . LEU A 1 53 ? -4.112  -5.462  10.303  1.00 0.00 ? 53 LEU A HB2  4  
ATOM 4927  H HB3  . LEU A 1 53 ? -3.352  -7.039  10.223  1.00 0.00 ? 53 LEU A HB3  4  
ATOM 4928  H HG   . LEU A 1 53 ? -5.605  -7.433  10.800  1.00 0.00 ? 53 LEU A HG   4  
ATOM 4929  H HD11 . LEU A 1 53 ? -5.470  -8.338  13.103  1.00 0.00 ? 53 LEU A HD11 4  
ATOM 4930  H HD12 . LEU A 1 53 ? -3.914  -7.529  13.291  1.00 0.00 ? 53 LEU A HD12 4  
ATOM 4931  H HD13 . LEU A 1 53 ? -4.107  -8.800  12.084  1.00 0.00 ? 53 LEU A HD13 4  
ATOM 4932  H HD21 . LEU A 1 53 ? -6.468  -6.300  12.986  1.00 0.00 ? 53 LEU A HD21 4  
ATOM 4933  H HD22 . LEU A 1 53 ? -6.528  -5.431  11.452  1.00 0.00 ? 53 LEU A HD22 4  
ATOM 4934  H HD23 . LEU A 1 53 ? -5.241  -5.090  12.609  1.00 0.00 ? 53 LEU A HD23 4  
ATOM 4935  N N    . ARG A 1 54 ? -0.573  -6.788  11.182  1.00 0.00 ? 54 ARG A N    4  
ATOM 4936  C CA   . ARG A 1 54 ? 0.521   -7.748  11.203  1.00 0.00 ? 54 ARG A CA   4  
ATOM 4937  C C    . ARG A 1 54 ? 1.499   -7.449  12.329  1.00 0.00 ? 54 ARG A C    4  
ATOM 4938  O O    . ARG A 1 54 ? 1.733   -8.281  13.205  1.00 0.00 ? 54 ARG A O    4  
ATOM 4939  C CB   . ARG A 1 54 ? 1.254   -7.745  9.861   1.00 0.00 ? 54 ARG A CB   4  
ATOM 4940  C CG   . ARG A 1 54 ? 2.194   -8.926  9.679   1.00 0.00 ? 54 ARG A CG   4  
ATOM 4941  C CD   . ARG A 1 54 ? 2.253   -9.372  8.227   1.00 0.00 ? 54 ARG A CD   4  
ATOM 4942  N NE   . ARG A 1 54 ? 2.822   -10.710 8.088   1.00 0.00 ? 54 ARG A NE   4  
ATOM 4943  C CZ   . ARG A 1 54 ? 2.211   -11.821 8.495   1.00 0.00 ? 54 ARG A CZ   4  
ATOM 4944  N NH1  . ARG A 1 54 ? 1.015   -11.758 9.065   1.00 0.00 ? 54 ARG A NH1  4  
ATOM 4945  N NH2  . ARG A 1 54 ? 2.799   -12.998 8.330   1.00 0.00 ? 54 ARG A NH2  4  
ATOM 4946  H H    . ARG A 1 54 ? -0.541  -6.045  10.552  1.00 0.00 ? 54 ARG A H    4  
ATOM 4947  H HA   . ARG A 1 54 ? 0.098   -8.714  11.365  1.00 0.00 ? 54 ARG A HA   4  
ATOM 4948  H HB2  . ARG A 1 54 ? 0.524   -7.767  9.065   1.00 0.00 ? 54 ARG A HB2  4  
ATOM 4949  H HB3  . ARG A 1 54 ? 1.833   -6.837  9.781   1.00 0.00 ? 54 ARG A HB3  4  
ATOM 4950  H HG2  . ARG A 1 54 ? 3.185   -8.638  9.997   1.00 0.00 ? 54 ARG A HG2  4  
ATOM 4951  H HG3  . ARG A 1 54 ? 1.844   -9.749  10.285  1.00 0.00 ? 54 ARG A HG3  4  
ATOM 4952  H HD2  . ARG A 1 54 ? 1.252   -9.373  7.823   1.00 0.00 ? 54 ARG A HD2  4  
ATOM 4953  H HD3  . ARG A 1 54 ? 2.862   -8.673  7.673   1.00 0.00 ? 54 ARG A HD3  4  
ATOM 4954  H HE   . ARG A 1 54 ? 3.705   -10.786 7.670   1.00 0.00 ? 54 ARG A HE   4  
ATOM 4955  H HH11 . ARG A 1 54 ? 0.566   -10.874 9.192   1.00 0.00 ? 54 ARG A HH11 4  
ATOM 4956  H HH12 . ARG A 1 54 ? 0.561   -12.596 9.368   1.00 0.00 ? 54 ARG A HH12 4  
ATOM 4957  H HH21 . ARG A 1 54 ? 3.700   -13.052 7.900   1.00 0.00 ? 54 ARG A HH21 4  
ATOM 4958  H HH22 . ARG A 1 54 ? 2.341   -13.833 8.636   1.00 0.00 ? 54 ARG A HH22 4  
ATOM 4959  N N    . THR A 1 55 ? 2.068   -6.259  12.288  1.00 0.00 ? 55 THR A N    4  
ATOM 4960  C CA   . THR A 1 55 ? 3.032   -5.831  13.294  1.00 0.00 ? 55 THR A CA   4  
ATOM 4961  C C    . THR A 1 55 ? 2.344   -5.497  14.613  1.00 0.00 ? 55 THR A C    4  
ATOM 4962  O O    . THR A 1 55 ? 2.953   -5.574  15.680  1.00 0.00 ? 55 THR A O    4  
ATOM 4963  C CB   . THR A 1 55 ? 3.826   -4.620  12.793  1.00 0.00 ? 55 THR A CB   4  
ATOM 4964  O OG1  . THR A 1 55 ? 3.251   -4.094  11.609  1.00 0.00 ? 55 THR A OG1  4  
ATOM 4965  C CG2  . THR A 1 55 ? 5.276   -4.938  12.497  1.00 0.00 ? 55 THR A CG2  4  
ATOM 4966  H H    . THR A 1 55 ? 1.837   -5.656  11.560  1.00 0.00 ? 55 THR A H    4  
ATOM 4967  H HA   . THR A 1 55 ? 3.710   -6.648  13.457  1.00 0.00 ? 55 THR A HA   4  
ATOM 4968  H HB   . THR A 1 55 ? 3.805   -3.850  13.551  1.00 0.00 ? 55 THR A HB   4  
ATOM 4969  H HG1  . THR A 1 55 ? 3.425   -4.688  10.875  1.00 0.00 ? 55 THR A HG1  4  
ATOM 4970  H HG21 . THR A 1 55 ? 5.530   -4.576  11.512  1.00 0.00 ? 55 THR A HG21 4  
ATOM 4971  H HG22 . THR A 1 55 ? 5.426   -6.007  12.538  1.00 0.00 ? 55 THR A HG22 4  
ATOM 4972  H HG23 . THR A 1 55 ? 5.906   -4.458  13.231  1.00 0.00 ? 55 THR A HG23 4  
ATOM 4973  N N    . GLY A 1 56 ? 1.073   -5.127  14.531  1.00 0.00 ? 56 GLY A N    4  
ATOM 4974  C CA   . GLY A 1 56 ? 0.321   -4.785  15.723  1.00 0.00 ? 56 GLY A CA   4  
ATOM 4975  C C    . GLY A 1 56 ? 0.804   -3.502  16.379  1.00 0.00 ? 56 GLY A C    4  
ATOM 4976  O O    . GLY A 1 56 ? 0.387   -3.174  17.489  1.00 0.00 ? 56 GLY A O    4  
ATOM 4977  H H    . GLY A 1 56 ? 0.643   -5.085  13.656  1.00 0.00 ? 56 GLY A H    4  
ATOM 4978  H HA2  . GLY A 1 56 ? -0.719  -4.668  15.456  1.00 0.00 ? 56 GLY A HA2  4  
ATOM 4979  H HA3  . GLY A 1 56 ? 0.410   -5.593  16.430  1.00 0.00 ? 56 GLY A HA3  4  
ATOM 4980  N N    . LYS A 1 57 ? 1.685   -2.775  15.695  1.00 0.00 ? 57 LYS A N    4  
ATOM 4981  C CA   . LYS A 1 57 ? 2.219   -1.529  16.221  1.00 0.00 ? 57 LYS A CA   4  
ATOM 4982  C C    . LYS A 1 57 ? 3.044   -0.802  15.164  1.00 0.00 ? 57 LYS A C    4  
ATOM 4983  O O    . LYS A 1 57 ? 4.260   -0.975  15.083  1.00 0.00 ? 57 LYS A O    4  
ATOM 4984  C CB   . LYS A 1 57 ? 3.072   -1.803  17.452  1.00 0.00 ? 57 LYS A CB   4  
ATOM 4985  C CG   . LYS A 1 57 ? 2.822   -0.835  18.597  1.00 0.00 ? 57 LYS A CG   4  
ATOM 4986  C CD   . LYS A 1 57 ? 3.704   0.398   18.486  1.00 0.00 ? 57 LYS A CD   4  
ATOM 4987  C CE   . LYS A 1 57 ? 3.001   1.521   17.741  1.00 0.00 ? 57 LYS A CE   4  
ATOM 4988  N NZ   . LYS A 1 57 ? 3.943   2.298   16.889  1.00 0.00 ? 57 LYS A NZ   4  
ATOM 4989  H H    . LYS A 1 57 ? 1.983   -3.083  14.818  1.00 0.00 ? 57 LYS A H    4  
ATOM 4990  H HA   . LYS A 1 57 ? 1.393   -0.906  16.505  1.00 0.00 ? 57 LYS A HA   4  
ATOM 4991  H HB2  . LYS A 1 57 ? 2.869   -2.804  17.803  1.00 0.00 ? 57 LYS A HB2  4  
ATOM 4992  H HB3  . LYS A 1 57 ? 4.103   -1.734  17.170  1.00 0.00 ? 57 LYS A HB3  4  
ATOM 4993  H HG2  . LYS A 1 57 ? 1.787   -0.527  18.576  1.00 0.00 ? 57 LYS A HG2  4  
ATOM 4994  H HG3  . LYS A 1 57 ? 3.032   -1.335  19.531  1.00 0.00 ? 57 LYS A HG3  4  
ATOM 4995  H HD2  . LYS A 1 57 ? 3.955   0.740   19.479  1.00 0.00 ? 57 LYS A HD2  4  
ATOM 4996  H HD3  . LYS A 1 57 ? 4.607   0.135   17.954  1.00 0.00 ? 57 LYS A HD3  4  
ATOM 4997  H HE2  . LYS A 1 57 ? 2.232   1.094   17.114  1.00 0.00 ? 57 LYS A HE2  4  
ATOM 4998  H HE3  . LYS A 1 57 ? 2.548   2.186   18.462  1.00 0.00 ? 57 LYS A HE3  4  
ATOM 4999  H HZ1  . LYS A 1 57 ? 4.604   1.655   16.409  1.00 0.00 ? 57 LYS A HZ1  4  
ATOM 5000  H HZ2  . LYS A 1 57 ? 4.488   2.963   17.474  1.00 0.00 ? 57 LYS A HZ2  4  
ATOM 5001  H HZ3  . LYS A 1 57 ? 3.416   2.836   16.172  1.00 0.00 ? 57 LYS A HZ3  4  
ATOM 5002  N N    . THR A 1 58 ? 2.375   0.014   14.357  1.00 0.00 ? 58 THR A N    4  
ATOM 5003  C CA   . THR A 1 58 ? 3.040   0.769   13.309  1.00 0.00 ? 58 THR A CA   4  
ATOM 5004  C C    . THR A 1 58 ? 2.337   2.099   13.060  1.00 0.00 ? 58 THR A C    4  
ATOM 5005  O O    . THR A 1 58 ? 1.238   2.336   13.562  1.00 0.00 ? 58 THR A O    4  
ATOM 5006  C CB   . THR A 1 58 ? 3.102   -0.040  12.016  1.00 0.00 ? 58 THR A CB   4  
ATOM 5007  O OG1  . THR A 1 58 ? 2.742   -1.391  12.246  1.00 0.00 ? 58 THR A OG1  4  
ATOM 5008  C CG2  . THR A 1 58 ? 4.470   -0.031  11.369  1.00 0.00 ? 58 THR A CG2  4  
ATOM 5009  H H    . THR A 1 58 ? 1.412   0.113   14.471  1.00 0.00 ? 58 THR A H    4  
ATOM 5010  H HA   . THR A 1 58 ? 4.038   0.968   13.637  1.00 0.00 ? 58 THR A HA   4  
ATOM 5011  H HB   . THR A 1 58 ? 2.405   0.382   11.315  1.00 0.00 ? 58 THR A HB   4  
ATOM 5012  H HG1  . THR A 1 58 ? 2.008   -1.629  11.675  1.00 0.00 ? 58 THR A HG1  4  
ATOM 5013  H HG21 . THR A 1 58 ? 4.589   -0.918  10.764  1.00 0.00 ? 58 THR A HG21 4  
ATOM 5014  H HG22 . THR A 1 58 ? 5.231   -0.013  12.135  1.00 0.00 ? 58 THR A HG22 4  
ATOM 5015  H HG23 . THR A 1 58 ? 4.567   0.846   10.744  1.00 0.00 ? 58 THR A HG23 4  
ATOM 5016  N N    . ARG A 1 59 ? 2.970   2.954   12.265  1.00 0.00 ? 59 ARG A N    4  
ATOM 5017  C CA   . ARG A 1 59 ? 2.406   4.246   11.928  1.00 0.00 ? 59 ARG A CA   4  
ATOM 5018  C C    . ARG A 1 59 ? 2.976   4.731   10.603  1.00 0.00 ? 59 ARG A C    4  
ATOM 5019  O O    . ARG A 1 59 ? 3.705   5.721   10.545  1.00 0.00 ? 59 ARG A O    4  
ATOM 5020  C CB   . ARG A 1 59 ? 2.694   5.264   13.034  1.00 0.00 ? 59 ARG A CB   4  
ATOM 5021  C CG   . ARG A 1 59 ? 1.588   5.364   14.071  1.00 0.00 ? 59 ARG A CG   4  
ATOM 5022  C CD   . ARG A 1 59 ? 1.973   6.299   15.207  1.00 0.00 ? 59 ARG A CD   4  
ATOM 5023  N NE   . ARG A 1 59 ? 2.473   5.570   16.370  1.00 0.00 ? 59 ARG A NE   4  
ATOM 5024  C CZ   . ARG A 1 59 ? 2.940   6.158   17.469  1.00 0.00 ? 59 ARG A CZ   4  
ATOM 5025  N NH1  . ARG A 1 59 ? 2.974   7.482   17.559  1.00 0.00 ? 59 ARG A NH1  4  
ATOM 5026  N NH2  . ARG A 1 59 ? 3.375   5.420   18.482  1.00 0.00 ? 59 ARG A NH2  4  
ATOM 5027  H H    . ARG A 1 59 ? 3.827   2.701   11.878  1.00 0.00 ? 59 ARG A H    4  
ATOM 5028  H HA   . ARG A 1 59 ? 1.342   4.123   11.826  1.00 0.00 ? 59 ARG A HA   4  
ATOM 5029  H HB2  . ARG A 1 59 ? 3.607   4.981   13.538  1.00 0.00 ? 59 ARG A HB2  4  
ATOM 5030  H HB3  . ARG A 1 59 ? 2.828   6.237   12.586  1.00 0.00 ? 59 ARG A HB3  4  
ATOM 5031  H HG2  . ARG A 1 59 ? 0.695   5.741   13.596  1.00 0.00 ? 59 ARG A HG2  4  
ATOM 5032  H HG3  . ARG A 1 59 ? 1.396   4.381   14.475  1.00 0.00 ? 59 ARG A HG3  4  
ATOM 5033  H HD2  . ARG A 1 59 ? 2.743   6.971   14.858  1.00 0.00 ? 59 ARG A HD2  4  
ATOM 5034  H HD3  . ARG A 1 59 ? 1.103   6.869   15.497  1.00 0.00 ? 59 ARG A HD3  4  
ATOM 5035  H HE   . ARG A 1 59 ? 2.459   4.591   16.331  1.00 0.00 ? 59 ARG A HE   4  
ATOM 5036  H HH11 . ARG A 1 59 ? 2.647   8.044   16.799  1.00 0.00 ? 59 ARG A HH11 4  
ATOM 5037  H HH12 . ARG A 1 59 ? 3.326   7.917   18.387  1.00 0.00 ? 59 ARG A HH12 4  
ATOM 5038  H HH21 . ARG A 1 59 ? 3.351   4.423   18.420  1.00 0.00 ? 59 ARG A HH21 4  
ATOM 5039  H HH22 . ARG A 1 59 ? 3.726   5.862   19.307  1.00 0.00 ? 59 ARG A HH22 4  
ATOM 5040  N N    . THR A 1 60 ? 2.630   4.019   9.541   1.00 0.00 ? 60 THR A N    4  
ATOM 5041  C CA   . THR A 1 60 ? 3.090   4.355   8.206   1.00 0.00 ? 60 THR A CA   4  
ATOM 5042  C C    . THR A 1 60 ? 1.970   4.172   7.186   1.00 0.00 ? 60 THR A C    4  
ATOM 5043  O O    . THR A 1 60 ? 1.727   3.063   6.711   1.00 0.00 ? 60 THR A O    4  
ATOM 5044  C CB   . THR A 1 60 ? 4.296   3.495   7.825   1.00 0.00 ? 60 THR A CB   4  
ATOM 5045  O OG1  . THR A 1 60 ? 4.591   3.629   6.446   1.00 0.00 ? 60 THR A OG1  4  
ATOM 5046  C CG2  . THR A 1 60 ? 4.096   2.023   8.112   1.00 0.00 ? 60 THR A CG2  4  
ATOM 5047  H H    . THR A 1 60 ? 2.054   3.246   9.661   1.00 0.00 ? 60 THR A H    4  
ATOM 5048  H HA   . THR A 1 60 ? 3.384   5.386   8.219   1.00 0.00 ? 60 THR A HA   4  
ATOM 5049  H HB   . THR A 1 60 ? 5.154   3.829   8.390   1.00 0.00 ? 60 THR A HB   4  
ATOM 5050  H HG1  . THR A 1 60 ? 5.543   3.655   6.324   1.00 0.00 ? 60 THR A HG1  4  
ATOM 5051  H HG21 . THR A 1 60 ? 3.242   1.661   7.559   1.00 0.00 ? 60 THR A HG21 4  
ATOM 5052  H HG22 . THR A 1 60 ? 3.927   1.882   9.169   1.00 0.00 ? 60 THR A HG22 4  
ATOM 5053  H HG23 . THR A 1 60 ? 4.977   1.475   7.812   1.00 0.00 ? 60 THR A HG23 4  
ATOM 5054  N N    . ARG A 1 61 ? 1.288   5.264   6.854   1.00 0.00 ? 61 ARG A N    4  
ATOM 5055  C CA   . ARG A 1 61 ? 0.196   5.218   5.897   1.00 0.00 ? 61 ARG A CA   4  
ATOM 5056  C C    . ARG A 1 61 ? 0.575   5.916   4.599   1.00 0.00 ? 61 ARG A C    4  
ATOM 5057  O O    . ARG A 1 61 ? 0.148   5.517   3.516   1.00 0.00 ? 61 ARG A O    4  
ATOM 5058  C CB   . ARG A 1 61 ? -1.065  5.857   6.486   1.00 0.00 ? 61 ARG A CB   4  
ATOM 5059  C CG   . ARG A 1 61 ? -1.263  5.571   7.967   1.00 0.00 ? 61 ARG A CG   4  
ATOM 5060  C CD   . ARG A 1 61 ? -2.725  5.688   8.367   1.00 0.00 ? 61 ARG A CD   4  
ATOM 5061  N NE   . ARG A 1 61 ? -2.887  6.346   9.661   1.00 0.00 ? 61 ARG A NE   4  
ATOM 5062  C CZ   . ARG A 1 61 ? -4.031  6.880   10.084  1.00 0.00 ? 61 ARG A CZ   4  
ATOM 5063  N NH1  . ARG A 1 61 ? -5.115  6.834   9.319   1.00 0.00 ? 61 ARG A NH1  4  
ATOM 5064  N NH2  . ARG A 1 61 ? -4.092  7.460   11.274  1.00 0.00 ? 61 ARG A NH2  4  
ATOM 5065  H H    . ARG A 1 61 ? 1.521   6.115   7.262   1.00 0.00 ? 61 ARG A H    4  
ATOM 5066  H HA   . ARG A 1 61 ? 0.001   4.189   5.687   1.00 0.00 ? 61 ARG A HA   4  
ATOM 5067  H HB2  . ARG A 1 61 ? -1.007  6.927   6.354   1.00 0.00 ? 61 ARG A HB2  4  
ATOM 5068  H HB3  . ARG A 1 61 ? -1.926  5.484   5.952   1.00 0.00 ? 61 ARG A HB3  4  
ATOM 5069  H HG2  . ARG A 1 61 ? -0.921  4.569   8.179   1.00 0.00 ? 61 ARG A HG2  4  
ATOM 5070  H HG3  . ARG A 1 61 ? -0.684  6.280   8.540   1.00 0.00 ? 61 ARG A HG3  4  
ATOM 5071  H HD2  . ARG A 1 61 ? -3.246  6.261   7.615   1.00 0.00 ? 61 ARG A HD2  4  
ATOM 5072  H HD3  . ARG A 1 61 ? -3.150  4.697   8.422   1.00 0.00 ? 61 ARG A HD3  4  
ATOM 5073  H HE   . ARG A 1 61 ? -2.102  6.394   10.246  1.00 0.00 ? 61 ARG A HE   4  
ATOM 5074  H HH11 . ARG A 1 61 ? -5.076  6.398   8.420   1.00 0.00 ? 61 ARG A HH11 4  
ATOM 5075  H HH12 . ARG A 1 61 ? -5.971  7.236   9.642   1.00 0.00 ? 61 ARG A HH12 4  
ATOM 5076  H HH21 . ARG A 1 61 ? -3.279  7.496   11.855  1.00 0.00 ? 61 ARG A HH21 4  
ATOM 5077  H HH22 . ARG A 1 61 ? -4.951  7.860   11.592  1.00 0.00 ? 61 ARG A HH22 4  
ATOM 5078  N N    . LYS A 1 62 ? 1.378   6.960   4.720   1.00 0.00 ? 62 LYS A N    4  
ATOM 5079  C CA   . LYS A 1 62 ? 1.821   7.722   3.563   1.00 0.00 ? 62 LYS A CA   4  
ATOM 5080  C C    . LYS A 1 62 ? 2.827   6.930   2.742   1.00 0.00 ? 62 LYS A C    4  
ATOM 5081  O O    . LYS A 1 62 ? 2.912   7.084   1.524   1.00 0.00 ? 62 LYS A O    4  
ATOM 5082  C CB   . LYS A 1 62 ? 2.426   9.053   4.004   1.00 0.00 ? 62 LYS A CB   4  
ATOM 5083  C CG   . LYS A 1 62 ? 1.734   10.265  3.403   1.00 0.00 ? 62 LYS A CG   4  
ATOM 5084  C CD   . LYS A 1 62 ? 2.325   10.631  2.051   1.00 0.00 ? 62 LYS A CD   4  
ATOM 5085  C CE   . LYS A 1 62 ? 3.573   11.486  2.202   1.00 0.00 ? 62 LYS A CE   4  
ATOM 5086  N NZ   . LYS A 1 62 ? 3.916   12.195  0.938   1.00 0.00 ? 62 LYS A NZ   4  
ATOM 5087  H H    . LYS A 1 62 ? 1.679   7.223   5.610   1.00 0.00 ? 62 LYS A H    4  
ATOM 5088  H HA   . LYS A 1 62 ? 0.963   7.917   2.955   1.00 0.00 ? 62 LYS A HA   4  
ATOM 5089  H HB2  . LYS A 1 62 ? 2.362   9.125   5.079   1.00 0.00 ? 62 LYS A HB2  4  
ATOM 5090  H HB3  . LYS A 1 62 ? 3.462   9.075   3.712   1.00 0.00 ? 62 LYS A HB3  4  
ATOM 5091  H HG2  . LYS A 1 62 ? 0.685   10.044  3.278   1.00 0.00 ? 62 LYS A HG2  4  
ATOM 5092  H HG3  . LYS A 1 62 ? 1.850   11.103  4.075   1.00 0.00 ? 62 LYS A HG3  4  
ATOM 5093  H HD2  . LYS A 1 62 ? 2.584   9.724   1.525   1.00 0.00 ? 62 LYS A HD2  4  
ATOM 5094  H HD3  . LYS A 1 62 ? 1.588   11.180  1.484   1.00 0.00 ? 62 LYS A HD3  4  
ATOM 5095  H HE2  . LYS A 1 62 ? 3.402   12.216  2.978   1.00 0.00 ? 62 LYS A HE2  4  
ATOM 5096  H HE3  . LYS A 1 62 ? 4.399   10.849  2.482   1.00 0.00 ? 62 LYS A HE3  4  
ATOM 5097  H HZ1  . LYS A 1 62 ? 4.297   13.139  1.150   1.00 0.00 ? 62 LYS A HZ1  4  
ATOM 5098  H HZ2  . LYS A 1 62 ? 3.067   12.302  0.346   1.00 0.00 ? 62 LYS A HZ2  4  
ATOM 5099  H HZ3  . LYS A 1 62 ? 4.629   11.656  0.407   1.00 0.00 ? 62 LYS A HZ3  4  
ATOM 5100  N N    . GLN A 1 63 ? 3.584   6.079   3.417   1.00 0.00 ? 63 GLN A N    4  
ATOM 5101  C CA   . GLN A 1 63 ? 4.582   5.256   2.755   1.00 0.00 ? 63 GLN A CA   4  
ATOM 5102  C C    . GLN A 1 63 ? 3.920   4.124   1.978   1.00 0.00 ? 63 GLN A C    4  
ATOM 5103  O O    . GLN A 1 63 ? 4.461   3.637   0.986   1.00 0.00 ? 63 GLN A O    4  
ATOM 5104  C CB   . GLN A 1 63 ? 5.572   4.693   3.772   1.00 0.00 ? 63 GLN A CB   4  
ATOM 5105  C CG   . GLN A 1 63 ? 6.991   5.207   3.588   1.00 0.00 ? 63 GLN A CG   4  
ATOM 5106  C CD   . GLN A 1 63 ? 7.828   4.302   2.706   1.00 0.00 ? 63 GLN A CD   4  
ATOM 5107  O OE1  . GLN A 1 63 ? 7.300   3.561   1.877   1.00 0.00 ? 63 GLN A OE1  4  
ATOM 5108  N NE2  . GLN A 1 63 ? 9.143   4.356   2.882   1.00 0.00 ? 63 GLN A NE2  4  
ATOM 5109  H H    . GLN A 1 63 ? 3.465   6.001   4.383   1.00 0.00 ? 63 GLN A H    4  
ATOM 5110  H HA   . GLN A 1 63 ? 5.111   5.882   2.067   1.00 0.00 ? 63 GLN A HA   4  
ATOM 5111  H HB2  . GLN A 1 63 ? 5.241   4.964   4.761   1.00 0.00 ? 63 GLN A HB2  4  
ATOM 5112  H HB3  . GLN A 1 63 ? 5.588   3.618   3.687   1.00 0.00 ? 63 GLN A HB3  4  
ATOM 5113  H HG2  . GLN A 1 63 ? 6.949   6.186   3.135   1.00 0.00 ? 63 GLN A HG2  4  
ATOM 5114  H HG3  . GLN A 1 63 ? 7.462   5.279   4.557   1.00 0.00 ? 63 GLN A HG3  4  
ATOM 5115  H HE21 . GLN A 1 63 ? 9.495   4.969   3.561   1.00 0.00 ? 63 GLN A HE21 4  
ATOM 5116  H HE22 . GLN A 1 63 ? 9.709   3.782   2.325   1.00 0.00 ? 63 GLN A HE22 4  
ATOM 5117  N N    . VAL A 1 64 ? 2.744   3.714   2.437   1.00 0.00 ? 64 VAL A N    4  
ATOM 5118  C CA   . VAL A 1 64 ? 2.003   2.644   1.789   1.00 0.00 ? 64 VAL A CA   4  
ATOM 5119  C C    . VAL A 1 64 ? 1.294   3.139   0.535   1.00 0.00 ? 64 VAL A C    4  
ATOM 5120  O O    . VAL A 1 64 ? 0.942   2.349   -0.339  1.00 0.00 ? 64 VAL A O    4  
ATOM 5121  C CB   . VAL A 1 64 ? 0.962   2.014   2.735   1.00 0.00 ? 64 VAL A CB   4  
ATOM 5122  C CG1  . VAL A 1 64 ? 0.365   0.761   2.112   1.00 0.00 ? 64 VAL A CG1  4  
ATOM 5123  C CG2  . VAL A 1 64 ? 1.585   1.701   4.087   1.00 0.00 ? 64 VAL A CG2  4  
ATOM 5124  H H    . VAL A 1 64 ? 2.367   4.141   3.229   1.00 0.00 ? 64 VAL A H    4  
ATOM 5125  H HA   . VAL A 1 64 ? 2.710   1.883   1.510   1.00 0.00 ? 64 VAL A HA   4  
ATOM 5126  H HB   . VAL A 1 64 ? 0.165   2.728   2.886   1.00 0.00 ? 64 VAL A HB   4  
ATOM 5127  H HG11 . VAL A 1 64 ? -0.028  0.124   2.891   1.00 0.00 ? 64 VAL A HG11 4  
ATOM 5128  H HG12 . VAL A 1 64 ? 1.131   0.231   1.566   1.00 0.00 ? 64 VAL A HG12 4  
ATOM 5129  H HG13 . VAL A 1 64 ? -0.432  1.038   1.438   1.00 0.00 ? 64 VAL A HG13 4  
ATOM 5130  H HG21 . VAL A 1 64 ? 2.134   0.774   4.024   1.00 0.00 ? 64 VAL A HG21 4  
ATOM 5131  H HG22 . VAL A 1 64 ? 0.806   1.608   4.829   1.00 0.00 ? 64 VAL A HG22 4  
ATOM 5132  H HG23 . VAL A 1 64 ? 2.256   2.499   4.369   1.00 0.00 ? 64 VAL A HG23 4  
ATOM 5133  N N    . SER A 1 65 ? 1.097   4.449   0.444   1.00 0.00 ? 65 SER A N    4  
ATOM 5134  C CA   . SER A 1 65 ? 0.442   5.036   -0.712  1.00 0.00 ? 65 SER A CA   4  
ATOM 5135  C C    . SER A 1 65 ? 1.457   5.265   -1.815  1.00 0.00 ? 65 SER A C    4  
ATOM 5136  O O    . SER A 1 65 ? 1.161   5.114   -3.000  1.00 0.00 ? 65 SER A O    4  
ATOM 5137  C CB   . SER A 1 65 ? -0.241  6.352   -0.336  1.00 0.00 ? 65 SER A CB   4  
ATOM 5138  O OG   . SER A 1 65 ? 0.686   7.424   -0.326  1.00 0.00 ? 65 SER A OG   4  
ATOM 5139  H H    . SER A 1 65 ? 1.407   5.033   1.160   1.00 0.00 ? 65 SER A H    4  
ATOM 5140  H HA   . SER A 1 65 ? -0.293  4.338   -1.057  1.00 0.00 ? 65 SER A HA   4  
ATOM 5141  H HB2  . SER A 1 65 ? -1.017  6.571   -1.054  1.00 0.00 ? 65 SER A HB2  4  
ATOM 5142  H HB3  . SER A 1 65 ? -0.677  6.260   0.648   1.00 0.00 ? 65 SER A HB3  4  
ATOM 5143  H HG   . SER A 1 65 ? 0.897   7.673   -1.229  1.00 0.00 ? 65 SER A HG   4  
ATOM 5144  N N    . SER A 1 66 ? 2.661   5.613   -1.400  1.00 0.00 ? 66 SER A N    4  
ATOM 5145  C CA   . SER A 1 66 ? 3.755   5.852   -2.320  1.00 0.00 ? 66 SER A CA   4  
ATOM 5146  C C    . SER A 1 66 ? 4.204   4.547   -2.957  1.00 0.00 ? 66 SER A C    4  
ATOM 5147  O O    . SER A 1 66 ? 4.626   4.513   -4.113  1.00 0.00 ? 66 SER A O    4  
ATOM 5148  C CB   . SER A 1 66 ? 4.915   6.500   -1.581  1.00 0.00 ? 66 SER A CB   4  
ATOM 5149  O OG   . SER A 1 66 ? 5.447   7.592   -2.312  1.00 0.00 ? 66 SER A OG   4  
ATOM 5150  H H    . SER A 1 66 ? 2.822   5.700   -0.441  1.00 0.00 ? 66 SER A H    4  
ATOM 5151  H HA   . SER A 1 66 ? 3.412   6.513   -3.084  1.00 0.00 ? 66 SER A HA   4  
ATOM 5152  H HB2  . SER A 1 66 ? 4.572   6.855   -0.622  1.00 0.00 ? 66 SER A HB2  4  
ATOM 5153  H HB3  . SER A 1 66 ? 5.686   5.769   -1.435  1.00 0.00 ? 66 SER A HB3  4  
ATOM 5154  H HG   . SER A 1 66 ? 6.014   7.262   -3.013  1.00 0.00 ? 66 SER A HG   4  
ATOM 5155  N N    . HIS A 1 67 ? 4.109   3.475   -2.184  1.00 0.00 ? 67 HIS A N    4  
ATOM 5156  C CA   . HIS A 1 67 ? 4.501   2.153   -2.651  1.00 0.00 ? 67 HIS A CA   4  
ATOM 5157  C C    . HIS A 1 67 ? 3.561   1.655   -3.738  1.00 0.00 ? 67 HIS A C    4  
ATOM 5158  O O    . HIS A 1 67 ? 3.981   0.979   -4.677  1.00 0.00 ? 67 HIS A O    4  
ATOM 5159  C CB   . HIS A 1 67 ? 4.530   1.162   -1.487  1.00 0.00 ? 67 HIS A CB   4  
ATOM 5160  C CG   . HIS A 1 67 ? 5.208   -0.131  -1.818  1.00 0.00 ? 67 HIS A CG   4  
ATOM 5161  N ND1  . HIS A 1 67 ? 6.451   -0.200  -2.410  1.00 0.00 ? 67 HIS A ND1  4  
ATOM 5162  C CD2  . HIS A 1 67 ? 4.809   -1.412  -1.634  1.00 0.00 ? 67 HIS A CD2  4  
ATOM 5163  C CE1  . HIS A 1 67 ? 6.787   -1.467  -2.578  1.00 0.00 ? 67 HIS A CE1  4  
ATOM 5164  N NE2  . HIS A 1 67 ? 5.808   -2.222  -2.115  1.00 0.00 ? 67 HIS A NE2  4  
ATOM 5165  H H    . HIS A 1 67 ? 3.766   3.579   -1.273  1.00 0.00 ? 67 HIS A H    4  
ATOM 5166  H HA   . HIS A 1 67 ? 5.487   2.236   -3.066  1.00 0.00 ? 67 HIS A HA   4  
ATOM 5167  H HB2  . HIS A 1 67 ? 5.056   1.609   -0.656  1.00 0.00 ? 67 HIS A HB2  4  
ATOM 5168  H HB3  . HIS A 1 67 ? 3.516   0.940   -1.187  1.00 0.00 ? 67 HIS A HB3  4  
ATOM 5169  H HD1  . HIS A 1 67 ? 7.005   0.566   -2.670  1.00 0.00 ? 67 HIS A HD1  4  
ATOM 5170  H HD2  . HIS A 1 67 ? 3.877   -1.737  -1.192  1.00 0.00 ? 67 HIS A HD2  4  
ATOM 5171  H HE1  . HIS A 1 67 ? 7.707   -1.824  -3.018  1.00 0.00 ? 67 HIS A HE1  4  
ATOM 5172  H HE2  . HIS A 1 67 ? 5.762   -3.198  -2.194  1.00 0.00 ? 67 HIS A HE2  4  
ATOM 5173  N N    . ILE A 1 68 ? 2.289   1.997   -3.607  1.00 0.00 ? 68 ILE A N    4  
ATOM 5174  C CA   . ILE A 1 68 ? 1.289   1.587   -4.582  1.00 0.00 ? 68 ILE A CA   4  
ATOM 5175  C C    . ILE A 1 68 ? 1.469   2.341   -5.892  1.00 0.00 ? 68 ILE A C    4  
ATOM 5176  O O    . ILE A 1 68 ? 1.117   1.845   -6.962  1.00 0.00 ? 68 ILE A O    4  
ATOM 5177  C CB   . ILE A 1 68 ? -0.145  1.808   -4.059  1.00 0.00 ? 68 ILE A CB   4  
ATOM 5178  C CG1  . ILE A 1 68 ? -0.314  1.160   -2.684  1.00 0.00 ? 68 ILE A CG1  4  
ATOM 5179  C CG2  . ILE A 1 68 ? -1.166  1.248   -5.040  1.00 0.00 ? 68 ILE A CG2  4  
ATOM 5180  C CD1  . ILE A 1 68 ? -1.338  1.854   -1.813  1.00 0.00 ? 68 ILE A CD1  4  
ATOM 5181  H H    . ILE A 1 68 ? 2.019   2.538   -2.840  1.00 0.00 ? 68 ILE A H    4  
ATOM 5182  H HA   . ILE A 1 68 ? 1.425   0.537   -4.767  1.00 0.00 ? 68 ILE A HA   4  
ATOM 5183  H HB   . ILE A 1 68 ? -0.312  2.871   -3.971  1.00 0.00 ? 68 ILE A HB   4  
ATOM 5184  H HG12 . ILE A 1 68 ? -0.629  0.136   -2.812  1.00 0.00 ? 68 ILE A HG12 4  
ATOM 5185  H HG13 . ILE A 1 68 ? 0.633   1.179   -2.165  1.00 0.00 ? 68 ILE A HG13 4  
ATOM 5186  H HG21 . ILE A 1 68 ? -1.653  0.389   -4.602  1.00 0.00 ? 68 ILE A HG21 4  
ATOM 5187  H HG22 . ILE A 1 68 ? -0.667  0.952   -5.951  1.00 0.00 ? 68 ILE A HG22 4  
ATOM 5188  H HG23 . ILE A 1 68 ? -1.903  2.005   -5.263  1.00 0.00 ? 68 ILE A HG23 4  
ATOM 5189  H HD11 . ILE A 1 68 ? -1.296  2.919   -1.988  1.00 0.00 ? 68 ILE A HD11 4  
ATOM 5190  H HD12 . ILE A 1 68 ? -1.125  1.650   -0.774  1.00 0.00 ? 68 ILE A HD12 4  
ATOM 5191  H HD13 . ILE A 1 68 ? -2.324  1.488   -2.057  1.00 0.00 ? 68 ILE A HD13 4  
ATOM 5192  N N    . GLN A 1 69 ? 2.027   3.540   -5.799  1.00 0.00 ? 69 GLN A N    4  
ATOM 5193  C CA   . GLN A 1 69 ? 2.265   4.364   -6.974  1.00 0.00 ? 69 GLN A CA   4  
ATOM 5194  C C    . GLN A 1 69 ? 3.420   3.808   -7.794  1.00 0.00 ? 69 GLN A C    4  
ATOM 5195  O O    . GLN A 1 69 ? 3.469   3.975   -9.013  1.00 0.00 ? 69 GLN A O    4  
ATOM 5196  C CB   . GLN A 1 69 ? 2.555   5.809   -6.565  1.00 0.00 ? 69 GLN A CB   4  
ATOM 5197  C CG   . GLN A 1 69 ? 1.412   6.467   -5.810  1.00 0.00 ? 69 GLN A CG   4  
ATOM 5198  C CD   . GLN A 1 69 ? 1.218   7.920   -6.197  1.00 0.00 ? 69 GLN A CD   4  
ATOM 5199  O OE1  . GLN A 1 69 ? 1.595   8.338   -7.292  1.00 0.00 ? 69 GLN A OE1  4  
ATOM 5200  N NE2  . GLN A 1 69 ? 0.628   8.699   -5.298  1.00 0.00 ? 69 GLN A NE2  4  
ATOM 5201  H H    . GLN A 1 69 ? 2.289   3.876   -4.921  1.00 0.00 ? 69 GLN A H    4  
ATOM 5202  H HA   . GLN A 1 69 ? 1.375   4.339   -7.573  1.00 0.00 ? 69 GLN A HA   4  
ATOM 5203  H HB2  . GLN A 1 69 ? 3.431   5.823   -5.933  1.00 0.00 ? 69 GLN A HB2  4  
ATOM 5204  H HB3  . GLN A 1 69 ? 2.753   6.389   -7.454  1.00 0.00 ? 69 GLN A HB3  4  
ATOM 5205  H HG2  . GLN A 1 69 ? 0.500   5.930   -6.022  1.00 0.00 ? 69 GLN A HG2  4  
ATOM 5206  H HG3  . GLN A 1 69 ? 1.621   6.417   -4.751  1.00 0.00 ? 69 GLN A HG3  4  
ATOM 5207  H HE21 . GLN A 1 69 ? 0.355   8.298   -4.447  1.00 0.00 ? 69 GLN A HE21 4  
ATOM 5208  H HE22 . GLN A 1 69 ? 0.490   9.643   -5.522  1.00 0.00 ? 69 GLN A HE22 4  
ATOM 5209  N N    . VAL A 1 70 ? 4.344   3.138   -7.117  1.00 0.00 ? 70 VAL A N    4  
ATOM 5210  C CA   . VAL A 1 70 ? 5.496   2.547   -7.781  1.00 0.00 ? 70 VAL A CA   4  
ATOM 5211  C C    . VAL A 1 70 ? 5.082   1.349   -8.623  1.00 0.00 ? 70 VAL A C    4  
ATOM 5212  O O    . VAL A 1 70 ? 5.728   1.022   -9.618  1.00 0.00 ? 70 VAL A O    4  
ATOM 5213  C CB   . VAL A 1 70 ? 6.573   2.109   -6.781  1.00 0.00 ? 70 VAL A CB   4  
ATOM 5214  C CG1  . VAL A 1 70 ? 7.916   1.951   -7.478  1.00 0.00 ? 70 VAL A CG1  4  
ATOM 5215  C CG2  . VAL A 1 70 ? 6.677   3.092   -5.624  1.00 0.00 ? 70 VAL A CG2  4  
ATOM 5216  H H    . VAL A 1 70 ? 4.244   3.036   -6.150  1.00 0.00 ? 70 VAL A H    4  
ATOM 5217  H HA   . VAL A 1 70 ? 5.921   3.286   -8.421  1.00 0.00 ? 70 VAL A HA   4  
ATOM 5218  H HB   . VAL A 1 70 ? 6.286   1.155   -6.391  1.00 0.00 ? 70 VAL A HB   4  
ATOM 5219  H HG11 . VAL A 1 70 ? 8.094   2.805   -8.114  1.00 0.00 ? 70 VAL A HG11 4  
ATOM 5220  H HG12 . VAL A 1 70 ? 7.908   1.052   -8.076  1.00 0.00 ? 70 VAL A HG12 4  
ATOM 5221  H HG13 . VAL A 1 70 ? 8.700   1.884   -6.738  1.00 0.00 ? 70 VAL A HG13 4  
ATOM 5222  H HG21 . VAL A 1 70 ? 7.653   3.010   -5.168  1.00 0.00 ? 70 VAL A HG21 4  
ATOM 5223  H HG22 . VAL A 1 70 ? 5.917   2.865   -4.891  1.00 0.00 ? 70 VAL A HG22 4  
ATOM 5224  H HG23 . VAL A 1 70 ? 6.534   4.097   -5.991  1.00 0.00 ? 70 VAL A HG23 4  
ATOM 5225  N N    . LEU A 1 71 ? 3.997   0.701   -8.216  1.00 0.00 ? 71 LEU A N    4  
ATOM 5226  C CA   . LEU A 1 71 ? 3.488   -0.459  -8.932  1.00 0.00 ? 71 LEU A CA   4  
ATOM 5227  C C    . LEU A 1 71 ? 2.891   -0.050  -10.271 1.00 0.00 ? 71 LEU A C    4  
ATOM 5228  O O    . LEU A 1 71 ? 2.908   -0.818  -11.233 1.00 0.00 ? 71 LEU A O    4  
ATOM 5229  C CB   . LEU A 1 71 ? 2.445   -1.190  -8.087  1.00 0.00 ? 71 LEU A CB   4  
ATOM 5230  C CG   . LEU A 1 71 ? 2.816   -2.621  -7.696  1.00 0.00 ? 71 LEU A CG   4  
ATOM 5231  C CD1  . LEU A 1 71 ? 2.848   -3.518  -8.924  1.00 0.00 ? 71 LEU A CD1  4  
ATOM 5232  C CD2  . LEU A 1 71 ? 4.158   -2.646  -6.980  1.00 0.00 ? 71 LEU A CD2  4  
ATOM 5233  H H    . LEU A 1 71 ? 3.527   1.014   -7.418  1.00 0.00 ? 71 LEU A H    4  
ATOM 5234  H HA   . LEU A 1 71 ? 4.313   -1.117  -9.110  1.00 0.00 ? 71 LEU A HA   4  
ATOM 5235  H HB2  . LEU A 1 71 ? 2.288   -0.622  -7.184  1.00 0.00 ? 71 LEU A HB2  4  
ATOM 5236  H HB3  . LEU A 1 71 ? 1.521   -1.220  -8.641  1.00 0.00 ? 71 LEU A HB3  4  
ATOM 5237  H HG   . LEU A 1 71 ? 2.067   -3.008  -7.020  1.00 0.00 ? 71 LEU A HG   4  
ATOM 5238  H HD11 . LEU A 1 71 ? 3.843   -3.520  -9.343  1.00 0.00 ? 71 LEU A HD11 4  
ATOM 5239  H HD12 . LEU A 1 71 ? 2.149   -3.147  -9.659  1.00 0.00 ? 71 LEU A HD12 4  
ATOM 5240  H HD13 . LEU A 1 71 ? 2.574   -4.524  -8.642  1.00 0.00 ? 71 LEU A HD13 4  
ATOM 5241  H HD21 . LEU A 1 71 ? 4.142   -3.405  -6.212  1.00 0.00 ? 71 LEU A HD21 4  
ATOM 5242  H HD22 . LEU A 1 71 ? 4.344   -1.683  -6.530  1.00 0.00 ? 71 LEU A HD22 4  
ATOM 5243  H HD23 . LEU A 1 71 ? 4.941   -2.869  -7.690  1.00 0.00 ? 71 LEU A HD23 4  
ATOM 5244  N N    . ALA A 1 72 ? 2.369   1.168   -10.326 1.00 0.00 ? 72 ALA A N    4  
ATOM 5245  C CA   . ALA A 1 72 ? 1.770   1.687   -11.546 1.00 0.00 ? 72 ALA A CA   4  
ATOM 5246  C C    . ALA A 1 72 ? 2.832   1.958   -12.601 1.00 0.00 ? 72 ALA A C    4  
ATOM 5247  O O    . ALA A 1 72 ? 2.567   1.882   -13.801 1.00 0.00 ? 72 ALA A O    4  
ATOM 5248  C CB   . ALA A 1 72 ? 0.976   2.951   -11.251 1.00 0.00 ? 72 ALA A CB   4  
ATOM 5249  H H    . ALA A 1 72 ? 2.390   1.729   -9.527  1.00 0.00 ? 72 ALA A H    4  
ATOM 5250  H HA   . ALA A 1 72 ? 1.092   0.942   -11.920 1.00 0.00 ? 72 ALA A HA   4  
ATOM 5251  H HB1  . ALA A 1 72 ? 1.426   3.474   -10.420 1.00 0.00 ? 72 ALA A HB1  4  
ATOM 5252  H HB2  . ALA A 1 72 ? -0.041  2.687   -11.001 1.00 0.00 ? 72 ALA A HB2  4  
ATOM 5253  H HB3  . ALA A 1 72 ? 0.978   3.589   -12.122 1.00 0.00 ? 72 ALA A HB3  4  
ATOM 5254  N N    . ARG A 1 73 ? 4.037   2.268   -12.143 1.00 0.00 ? 73 ARG A N    4  
ATOM 5255  C CA   . ARG A 1 73 ? 5.148   2.545   -13.040 1.00 0.00 ? 73 ARG A CA   4  
ATOM 5256  C C    . ARG A 1 73 ? 5.610   1.272   -13.736 1.00 0.00 ? 73 ARG A C    4  
ATOM 5257  O O    . ARG A 1 73 ? 6.132   1.313   -14.850 1.00 0.00 ? 73 ARG A O    4  
ATOM 5258  C CB   . ARG A 1 73 ? 6.311   3.176   -12.272 1.00 0.00 ? 73 ARG A CB   4  
ATOM 5259  C CG   . ARG A 1 73 ? 5.899   4.352   -11.402 1.00 0.00 ? 73 ARG A CG   4  
ATOM 5260  C CD   . ARG A 1 73 ? 6.992   5.406   -11.337 1.00 0.00 ? 73 ARG A CD   4  
ATOM 5261  N NE   . ARG A 1 73 ? 6.666   6.475   -10.395 1.00 0.00 ? 73 ARG A NE   4  
ATOM 5262  C CZ   . ARG A 1 73 ? 5.739   7.404   -10.620 1.00 0.00 ? 73 ARG A CZ   4  
ATOM 5263  N NH1  . ARG A 1 73 ? 5.046   7.400   -11.751 1.00 0.00 ? 73 ARG A NH1  4  
ATOM 5264  N NH2  . ARG A 1 73 ? 5.505   8.339   -9.710  1.00 0.00 ? 73 ARG A NH2  4  
ATOM 5265  H H    . ARG A 1 73 ? 4.182   2.307   -11.178 1.00 0.00 ? 73 ARG A H    4  
ATOM 5266  H HA   . ARG A 1 73 ? 4.801   3.238   -13.784 1.00 0.00 ? 73 ARG A HA   4  
ATOM 5267  H HB2  . ARG A 1 73 ? 6.757   2.425   -11.637 1.00 0.00 ? 73 ARG A HB2  4  
ATOM 5268  H HB3  . ARG A 1 73 ? 7.050   3.521   -12.980 1.00 0.00 ? 73 ARG A HB3  4  
ATOM 5269  H HG2  . ARG A 1 73 ? 5.007   4.797   -11.815 1.00 0.00 ? 73 ARG A HG2  4  
ATOM 5270  H HG3  . ARG A 1 73 ? 5.696   3.994   -10.403 1.00 0.00 ? 73 ARG A HG3  4  
ATOM 5271  H HD2  . ARG A 1 73 ? 7.912   4.935   -11.026 1.00 0.00 ? 73 ARG A HD2  4  
ATOM 5272  H HD3  . ARG A 1 73 ? 7.121   5.833   -12.321 1.00 0.00 ? 73 ARG A HD3  4  
ATOM 5273  H HE   . ARG A 1 73 ? 7.163   6.502   -9.551  1.00 0.00 ? 73 ARG A HE   4  
ATOM 5274  H HH11 . ARG A 1 73 ? 5.217   6.697   -12.442 1.00 0.00 ? 73 ARG A HH11 4  
ATOM 5275  H HH12 . ARG A 1 73 ? 4.351   8.100   -11.914 1.00 0.00 ? 73 ARG A HH12 4  
ATOM 5276  H HH21 . ARG A 1 73 ? 6.024   8.347   -8.855  1.00 0.00 ? 73 ARG A HH21 4  
ATOM 5277  H HH22 . ARG A 1 73 ? 4.809   9.038   -9.878  1.00 0.00 ? 73 ARG A HH22 4  
ATOM 5278  N N    . ARG A 1 74 ? 5.411   0.142   -13.070 1.00 0.00 ? 74 ARG A N    4  
ATOM 5279  C CA   . ARG A 1 74 ? 5.801   -1.148  -13.618 1.00 0.00 ? 74 ARG A CA   4  
ATOM 5280  C C    . ARG A 1 74 ? 4.896   -1.539  -14.779 1.00 0.00 ? 74 ARG A C    4  
ATOM 5281  O O    . ARG A 1 74 ? 5.308   -2.258  -15.689 1.00 0.00 ? 74 ARG A O    4  
ATOM 5282  C CB   . ARG A 1 74 ? 5.757   -2.225  -12.532 1.00 0.00 ? 74 ARG A CB   4  
ATOM 5283  C CG   . ARG A 1 74 ? 6.861   -3.261  -12.657 1.00 0.00 ? 74 ARG A CG   4  
ATOM 5284  C CD   . ARG A 1 74 ? 6.473   -4.572  -11.992 1.00 0.00 ? 74 ARG A CD   4  
ATOM 5285  N NE   . ARG A 1 74 ? 7.618   -5.229  -11.367 1.00 0.00 ? 74 ARG A NE   4  
ATOM 5286  C CZ   . ARG A 1 74 ? 8.609   -5.799  -12.048 1.00 0.00 ? 74 ARG A CZ   4  
ATOM 5287  N NH1  . ARG A 1 74 ? 8.600   -5.794  -13.376 1.00 0.00 ? 74 ARG A NH1  4  
ATOM 5288  N NH2  . ARG A 1 74 ? 9.613   -6.375  -11.401 1.00 0.00 ? 74 ARG A NH2  4  
ATOM 5289  H H    . ARG A 1 74 ? 4.990   0.179   -12.190 1.00 0.00 ? 74 ARG A H    4  
ATOM 5290  H HA   . ARG A 1 74 ? 6.807   -1.056  -13.981 1.00 0.00 ? 74 ARG A HA   4  
ATOM 5291  H HB2  . ARG A 1 74 ? 5.846   -1.749  -11.566 1.00 0.00 ? 74 ARG A HB2  4  
ATOM 5292  H HB3  . ARG A 1 74 ? 4.806   -2.735  -12.586 1.00 0.00 ? 74 ARG A HB3  4  
ATOM 5293  H HG2  . ARG A 1 74 ? 7.054   -3.443  -13.704 1.00 0.00 ? 74 ARG A HG2  4  
ATOM 5294  H HG3  . ARG A 1 74 ? 7.755   -2.879  -12.186 1.00 0.00 ? 74 ARG A HG3  4  
ATOM 5295  H HD2  . ARG A 1 74 ? 5.729   -4.370  -11.236 1.00 0.00 ? 74 ARG A HD2  4  
ATOM 5296  H HD3  . ARG A 1 74 ? 6.056   -5.230  -12.740 1.00 0.00 ? 74 ARG A HD3  4  
ATOM 5297  H HE   . ARG A 1 74 ? 7.650   -5.247  -10.388 1.00 0.00 ? 74 ARG A HE   4  
ATOM 5298  H HH11 . ARG A 1 74 ? 7.847   -5.361  -13.870 1.00 0.00 ? 74 ARG A HH11 4  
ATOM 5299  H HH12 . ARG A 1 74 ? 9.348   -6.223  -13.882 1.00 0.00 ? 74 ARG A HH12 4  
ATOM 5300  H HH21 . ARG A 1 74 ? 9.625   -6.381  -10.401 1.00 0.00 ? 74 ARG A HH21 4  
ATOM 5301  H HH22 . ARG A 1 74 ? 10.358  -6.803  -11.913 1.00 0.00 ? 74 ARG A HH22 4  
ATOM 5302  N N    . LYS A 1 75 ? 3.660   -1.058  -14.738 1.00 0.00 ? 75 LYS A N    4  
ATOM 5303  C CA   . LYS A 1 75 ? 2.690   -1.352  -15.783 1.00 0.00 ? 75 LYS A CA   4  
ATOM 5304  C C    . LYS A 1 75 ? 3.031   -0.608  -17.069 1.00 0.00 ? 75 LYS A C    4  
ATOM 5305  O O    . LYS A 1 75 ? 2.690   -1.052  -18.166 1.00 0.00 ? 75 LYS A O    4  
ATOM 5306  C CB   . LYS A 1 75 ? 1.280   -0.980  -15.321 1.00 0.00 ? 75 LYS A CB   4  
ATOM 5307  C CG   . LYS A 1 75 ? 0.543   -2.120  -14.639 1.00 0.00 ? 75 LYS A CG   4  
ATOM 5308  C CD   . LYS A 1 75 ? -0.943  -2.094  -14.960 1.00 0.00 ? 75 LYS A CD   4  
ATOM 5309  C CE   . LYS A 1 75 ? -1.780  -2.483  -13.752 1.00 0.00 ? 75 LYS A CE   4  
ATOM 5310  N NZ   . LYS A 1 75 ? -3.239  -2.353  -14.022 1.00 0.00 ? 75 LYS A NZ   4  
ATOM 5311  H H    . LYS A 1 75 ? 3.396   -0.493  -13.988 1.00 0.00 ? 75 LYS A H    4  
ATOM 5312  H HA   . LYS A 1 75 ? 2.729   -2.408  -15.975 1.00 0.00 ? 75 LYS A HA   4  
ATOM 5313  H HB2  . LYS A 1 75 ? 1.348   -0.156  -14.626 1.00 0.00 ? 75 LYS A HB2  4  
ATOM 5314  H HB3  . LYS A 1 75 ? 0.703   -0.668  -16.179 1.00 0.00 ? 75 LYS A HB3  4  
ATOM 5315  H HG2  . LYS A 1 75 ? 0.957   -3.058  -14.978 1.00 0.00 ? 75 LYS A HG2  4  
ATOM 5316  H HG3  . LYS A 1 75 ? 0.673   -2.032  -13.570 1.00 0.00 ? 75 LYS A HG3  4  
ATOM 5317  H HD2  . LYS A 1 75 ? -1.217  -1.097  -15.269 1.00 0.00 ? 75 LYS A HD2  4  
ATOM 5318  H HD3  . LYS A 1 75 ? -1.140  -2.789  -15.763 1.00 0.00 ? 75 LYS A HD3  4  
ATOM 5319  H HE2  . LYS A 1 75 ? -1.562  -3.508  -13.493 1.00 0.00 ? 75 LYS A HE2  4  
ATOM 5320  H HE3  . LYS A 1 75 ? -1.517  -1.839  -12.926 1.00 0.00 ? 75 LYS A HE3  4  
ATOM 5321  H HZ1  . LYS A 1 75 ? -3.547  -1.373  -13.859 1.00 0.00 ? 75 LYS A HZ1  4  
ATOM 5322  H HZ2  . LYS A 1 75 ? -3.777  -2.983  -13.394 1.00 0.00 ? 75 LYS A HZ2  4  
ATOM 5323  H HZ3  . LYS A 1 75 ? -3.444  -2.609  -15.010 1.00 0.00 ? 75 LYS A HZ3  4  
ATOM 5324  N N    . SER A 1 76 ? 3.705   0.525   -16.925 1.00 0.00 ? 76 SER A N    4  
ATOM 5325  C CA   . SER A 1 76 ? 4.095   1.337   -18.070 1.00 0.00 ? 76 SER A CA   4  
ATOM 5326  C C    . SER A 1 76 ? 5.172   0.643   -18.900 1.00 0.00 ? 76 SER A C    4  
ATOM 5327  O O    . SER A 1 76 ? 5.408   1.006   -20.052 1.00 0.00 ? 76 SER A O    4  
ATOM 5328  C CB   . SER A 1 76 ? 4.595   2.706   -17.605 1.00 0.00 ? 76 SER A CB   4  
ATOM 5329  O OG   . SER A 1 76 ? 3.522   3.619   -17.460 1.00 0.00 ? 76 SER A OG   4  
ATOM 5330  H H    . SER A 1 76 ? 3.944   0.823   -16.026 1.00 0.00 ? 76 SER A H    4  
ATOM 5331  H HA   . SER A 1 76 ? 3.221   1.474   -18.684 1.00 0.00 ? 76 SER A HA   4  
ATOM 5332  H HB2  . SER A 1 76 ? 5.093   2.601   -16.653 1.00 0.00 ? 76 SER A HB2  4  
ATOM 5333  H HB3  . SER A 1 76 ? 5.290   3.098   -18.333 1.00 0.00 ? 76 SER A HB3  4  
ATOM 5334  H HG   . SER A 1 76 ? 3.523   3.976   -16.569 1.00 0.00 ? 76 SER A HG   4  
ATOM 5335  N N    . ARG A 1 77 ? 5.821   -0.357  -18.312 1.00 0.00 ? 77 ARG A N    4  
ATOM 5336  C CA   . ARG A 1 77 ? 6.869   -1.098  -19.004 1.00 0.00 ? 77 ARG A CA   4  
ATOM 5337  C C    . ARG A 1 77 ? 6.324   -1.787  -20.254 1.00 0.00 ? 77 ARG A C    4  
ATOM 5338  O O    . ARG A 1 77 ? 7.086   -2.186  -21.134 1.00 0.00 ? 77 ARG A O    4  
ATOM 5339  C CB   . ARG A 1 77 ? 7.494   -2.134  -18.068 1.00 0.00 ? 77 ARG A CB   4  
ATOM 5340  C CG   . ARG A 1 77 ? 8.628   -1.581  -17.221 1.00 0.00 ? 77 ARG A CG   4  
ATOM 5341  C CD   . ARG A 1 77 ? 8.746   -2.320  -15.897 1.00 0.00 ? 77 ARG A CD   4  
ATOM 5342  N NE   . ARG A 1 77 ? 9.804   -3.327  -15.925 1.00 0.00 ? 77 ARG A NE   4  
ATOM 5343  C CZ   . ARG A 1 77 ? 10.359  -3.850  -14.834 1.00 0.00 ? 77 ARG A CZ   4  
ATOM 5344  N NH1  . ARG A 1 77 ? 9.961   -3.464  -13.628 1.00 0.00 ? 77 ARG A NH1  4  
ATOM 5345  N NH2  . ARG A 1 77 ? 11.316  -4.761  -14.949 1.00 0.00 ? 77 ARG A NH2  4  
ATOM 5346  H H    . ARG A 1 77 ? 5.591   -0.604  -17.393 1.00 0.00 ? 77 ARG A H    4  
ATOM 5347  H HA   . ARG A 1 77 ? 7.629   -0.392  -19.302 1.00 0.00 ? 77 ARG A HA   4  
ATOM 5348  H HB2  . ARG A 1 77 ? 6.729   -2.511  -17.406 1.00 0.00 ? 77 ARG A HB2  4  
ATOM 5349  H HB3  . ARG A 1 77 ? 7.880   -2.950  -18.660 1.00 0.00 ? 77 ARG A HB3  4  
ATOM 5350  H HG2  . ARG A 1 77 ? 9.555   -1.687  -17.764 1.00 0.00 ? 77 ARG A HG2  4  
ATOM 5351  H HG3  . ARG A 1 77 ? 8.441   -0.536  -17.024 1.00 0.00 ? 77 ARG A HG3  4  
ATOM 5352  H HD2  . ARG A 1 77 ? 8.964   -1.604  -15.119 1.00 0.00 ? 77 ARG A HD2  4  
ATOM 5353  H HD3  . ARG A 1 77 ? 7.805   -2.805  -15.685 1.00 0.00 ? 77 ARG A HD3  4  
ATOM 5354  H HE   . ARG A 1 77 ? 10.117  -3.630  -16.803 1.00 0.00 ? 77 ARG A HE   4  
ATOM 5355  H HH11 . ARG A 1 77 ? 9.240   -2.778  -13.534 1.00 0.00 ? 77 ARG A HH11 4  
ATOM 5356  H HH12 . ARG A 1 77 ? 10.382  -3.861  -12.813 1.00 0.00 ? 77 ARG A HH12 4  
ATOM 5357  H HH21 . ARG A 1 77 ? 11.619  -5.055  -15.856 1.00 0.00 ? 77 ARG A HH21 4  
ATOM 5358  H HH22 . ARG A 1 77 ? 11.733  -5.154  -14.130 1.00 0.00 ? 77 ARG A HH22 4  
ATOM 5359  N N    . ASP A 1 78 ? 5.002   -1.923  -20.328 1.00 0.00 ? 78 ASP A N    4  
ATOM 5360  C CA   . ASP A 1 78 ? 4.364   -2.565  -21.472 1.00 0.00 ? 78 ASP A CA   4  
ATOM 5361  C C    . ASP A 1 78 ? 4.714   -1.847  -22.772 1.00 0.00 ? 78 ASP A C    4  
ATOM 5362  O O    . ASP A 1 78 ? 4.640   -2.430  -23.854 1.00 0.00 ? 78 ASP A O    4  
ATOM 5363  C CB   . ASP A 1 78 ? 2.849   -2.601  -21.282 1.00 0.00 ? 78 ASP A CB   4  
ATOM 5364  C CG   . ASP A 1 78 ? 2.306   -4.015  -21.222 1.00 0.00 ? 78 ASP A CG   4  
ATOM 5365  O OD1  . ASP A 1 78 ? 2.415   -4.736  -22.236 1.00 0.00 ? 78 ASP A OD1  4  
ATOM 5366  O OD2  . ASP A 1 78 ? 1.773   -4.402  -20.161 1.00 0.00 ? 78 ASP A OD2  4  
ATOM 5367  H H    . ASP A 1 78 ? 4.443   -1.586  -19.597 1.00 0.00 ? 78 ASP A H    4  
ATOM 5368  H HA   . ASP A 1 78 ? 4.729   -3.573  -21.527 1.00 0.00 ? 78 ASP A HA   4  
ATOM 5369  H HB2  . ASP A 1 78 ? 2.600   -2.101  -20.360 1.00 0.00 ? 78 ASP A HB2  4  
ATOM 5370  H HB3  . ASP A 1 78 ? 2.378   -2.088  -22.105 1.00 0.00 ? 78 ASP A HB3  4  
ATOM 5371  N N    . LEU A 1 79 ? 5.094   -0.580  -22.659 1.00 0.00 ? 79 LEU A N    4  
ATOM 5372  C CA   . LEU A 1 79 ? 5.455   0.218   -23.824 1.00 0.00 ? 79 LEU A CA   4  
ATOM 5373  C C    . LEU A 1 79 ? 6.698   -0.346  -24.506 1.00 0.00 ? 79 LEU A C    4  
ATOM 5374  O O    . LEU A 1 79 ? 7.808   0.144   -24.299 1.00 0.00 ? 79 LEU A O    4  
ATOM 5375  C CB   . LEU A 1 79 ? 5.698   1.673   -23.417 1.00 0.00 ? 79 LEU A CB   4  
ATOM 5376  C CG   . LEU A 1 79 ? 5.325   2.712   -24.476 1.00 0.00 ? 79 LEU A CG   4  
ATOM 5377  C CD1  . LEU A 1 79 ? 5.112   4.074   -23.834 1.00 0.00 ? 79 LEU A CD1  4  
ATOM 5378  C CD2  . LEU A 1 79 ? 6.401   2.788   -25.549 1.00 0.00 ? 79 LEU A CD2  4  
ATOM 5379  H H    . LEU A 1 79 ? 5.132   -0.171  -21.772 1.00 0.00 ? 79 LEU A H    4  
ATOM 5380  H HA   . LEU A 1 79 ? 4.630   0.181   -24.518 1.00 0.00 ? 79 LEU A HA   4  
ATOM 5381  H HB2  . LEU A 1 79 ? 5.124   1.875   -22.525 1.00 0.00 ? 79 LEU A HB2  4  
ATOM 5382  H HB3  . LEU A 1 79 ? 6.746   1.789   -23.185 1.00 0.00 ? 79 LEU A HB3  4  
ATOM 5383  H HG   . LEU A 1 79 ? 4.399   2.418   -24.949 1.00 0.00 ? 79 LEU A HG   4  
ATOM 5384  H HD11 . LEU A 1 79 ? 5.108   4.836   -24.599 1.00 0.00 ? 79 LEU A HD11 4  
ATOM 5385  H HD12 . LEU A 1 79 ? 5.911   4.271   -23.134 1.00 0.00 ? 79 LEU A HD12 4  
ATOM 5386  H HD13 . LEU A 1 79 ? 4.167   4.083   -23.312 1.00 0.00 ? 79 LEU A HD13 4  
ATOM 5387  H HD21 . LEU A 1 79 ? 6.264   1.981   -26.253 1.00 0.00 ? 79 LEU A HD21 4  
ATOM 5388  H HD22 . LEU A 1 79 ? 7.374   2.704   -25.089 1.00 0.00 ? 79 LEU A HD22 4  
ATOM 5389  H HD23 . LEU A 1 79 ? 6.327   3.733   -26.066 1.00 0.00 ? 79 LEU A HD23 4  
ATOM 5390  N N    . VAL A 1 80 ? 6.504   -1.379  -25.319 1.00 0.00 ? 80 VAL A N    4  
ATOM 5391  C CA   . VAL A 1 80 ? 7.609   -2.009  -26.031 1.00 0.00 ? 80 VAL A CA   4  
ATOM 5392  C C    . VAL A 1 80 ? 8.318   -1.006  -26.942 1.00 0.00 ? 80 VAL A C    4  
ATOM 5393  O O    . VAL A 1 80 ? 7.669   -0.225  -27.637 1.00 0.00 ? 80 VAL A O    4  
ATOM 5394  C CB   . VAL A 1 80 ? 7.123   -3.205  -26.874 1.00 0.00 ? 80 VAL A CB   4  
ATOM 5395  C CG1  . VAL A 1 80 ? 6.119   -2.750  -27.923 1.00 0.00 ? 80 VAL A CG1  4  
ATOM 5396  C CG2  . VAL A 1 80 ? 8.299   -3.917  -27.525 1.00 0.00 ? 80 VAL A CG2  4  
ATOM 5397  H H    . VAL A 1 80 ? 5.596   -1.725  -25.444 1.00 0.00 ? 80 VAL A H    4  
ATOM 5398  H HA   . VAL A 1 80 ? 8.310   -2.375  -25.296 1.00 0.00 ? 80 VAL A HA   4  
ATOM 5399  H HB   . VAL A 1 80 ? 6.627   -3.904  -26.216 1.00 0.00 ? 80 VAL A HB   4  
ATOM 5400  H HG11 . VAL A 1 80 ? 6.646   -2.373  -28.787 1.00 0.00 ? 80 VAL A HG11 4  
ATOM 5401  H HG12 . VAL A 1 80 ? 5.497   -1.968  -27.511 1.00 0.00 ? 80 VAL A HG12 4  
ATOM 5402  H HG13 . VAL A 1 80 ? 5.500   -3.585  -28.216 1.00 0.00 ? 80 VAL A HG13 4  
ATOM 5403  H HG21 . VAL A 1 80 ? 7.932   -4.676  -28.200 1.00 0.00 ? 80 VAL A HG21 4  
ATOM 5404  H HG22 . VAL A 1 80 ? 8.908   -4.378  -26.762 1.00 0.00 ? 80 VAL A HG22 4  
ATOM 5405  H HG23 . VAL A 1 80 ? 8.893   -3.202  -28.076 1.00 0.00 ? 80 VAL A HG23 4  
ATOM 5406  N N    . PRO A 1 81 ? 9.664   -1.015  -26.952 1.00 0.00 ? 81 PRO A N    4  
ATOM 5407  C CA   . PRO A 1 81 ? 10.451  -0.100  -27.785 1.00 0.00 ? 81 PRO A CA   4  
ATOM 5408  C C    . PRO A 1 81 ? 10.299  -0.394  -29.274 1.00 0.00 ? 81 PRO A C    4  
ATOM 5409  O O    . PRO A 1 81 ? 10.985  -1.260  -29.818 1.00 0.00 ? 81 PRO A O    4  
ATOM 5410  C CB   . PRO A 1 81 ? 11.890  -0.352  -27.335 1.00 0.00 ? 81 PRO A CB   4  
ATOM 5411  C CG   . PRO A 1 81 ? 11.875  -1.732  -26.786 1.00 0.00 ? 81 PRO A CG   4  
ATOM 5412  C CD   . PRO A 1 81 ? 10.522  -1.910  -26.157 1.00 0.00 ? 81 PRO A CD   4  
ATOM 5413  H HA   . PRO A 1 81 ? 10.191  0.926   -27.595 1.00 0.00 ? 81 PRO A HA   4  
ATOM 5414  H HB2  . PRO A 1 81 ? 12.556  -0.269  -28.183 1.00 0.00 ? 81 PRO A HB2  4  
ATOM 5415  H HB3  . PRO A 1 81 ? 12.167  0.369   -26.581 1.00 0.00 ? 81 PRO A HB3  4  
ATOM 5416  H HG2  . PRO A 1 81 ? 12.012  -2.443  -27.585 1.00 0.00 ? 81 PRO A HG2  4  
ATOM 5417  H HG3  . PRO A 1 81 ? 12.650  -1.840  -26.045 1.00 0.00 ? 81 PRO A HG3  4  
ATOM 5418  H HD2  . PRO A 1 81 ? 10.197  -2.937  -26.245 1.00 0.00 ? 81 PRO A HD2  4  
ATOM 5419  H HD3  . PRO A 1 81 ? 10.543  -1.605  -25.122 1.00 0.00 ? 81 PRO A HD3  4  
ATOM 5420  N N    . ARG A 1 82 ? 9.399   0.334   -29.926 1.00 0.00 ? 82 ARG A N    4  
ATOM 5421  C CA   . ARG A 1 82 ? 9.157   0.156   -31.350 1.00 0.00 ? 82 ARG A CA   4  
ATOM 5422  C C    . ARG A 1 82 ? 8.493   1.392   -31.948 1.00 0.00 ? 82 ARG A C    4  
ATOM 5423  O O    . ARG A 1 82 ? 7.557   1.925   -31.314 1.00 0.00 ? 82 ARG A O    4  
ATOM 5424  C CB   . ARG A 1 82 ? 8.282   -1.076  -31.593 1.00 0.00 ? 82 ARG A CB   4  
ATOM 5425  C CG   . ARG A 1 82 ? 8.983   -2.390  -31.290 1.00 0.00 ? 82 ARG A CG   4  
ATOM 5426  C CD   . ARG A 1 82 ? 8.161   -3.580  -31.759 1.00 0.00 ? 82 ARG A CD   4  
ATOM 5427  N NE   . ARG A 1 82 ? 8.253   -4.707  -30.833 1.00 0.00 ? 82 ARG A NE   4  
ATOM 5428  C CZ   . ARG A 1 82 ? 7.520   -5.813  -30.937 1.00 0.00 ? 82 ARG A CZ   4  
ATOM 5429  N NH1  . ARG A 1 82 ? 6.642   -5.946  -31.924 1.00 0.00 ? 82 ARG A NH1  4  
ATOM 5430  N NH2  . ARG A 1 82 ? 7.666   -6.790  -30.053 1.00 0.00 ? 82 ARG A NH2  4  
ATOM 5431  O OXT  . ARG A 1 82 ? 8.914   1.818   -33.044 1.00 0.00 ? 82 ARG A OXT  4  
ATOM 5432  H H    . ARG A 1 82 ? 8.888   1.009   -29.440 1.00 0.00 ? 82 ARG A H    4  
ATOM 5433  H HA   . ARG A 1 82 ? 10.110  0.010   -31.826 1.00 0.00 ? 82 ARG A HA   4  
ATOM 5434  H HB2  . ARG A 1 82 ? 7.405   -1.008  -30.967 1.00 0.00 ? 82 ARG A HB2  4  
ATOM 5435  H HB3  . ARG A 1 82 ? 7.975   -1.086  -32.628 1.00 0.00 ? 82 ARG A HB3  4  
ATOM 5436  H HG2  . ARG A 1 82 ? 9.937   -2.403  -31.796 1.00 0.00 ? 82 ARG A HG2  4  
ATOM 5437  H HG3  . ARG A 1 82 ? 9.137   -2.467  -30.224 1.00 0.00 ? 82 ARG A HG3  4  
ATOM 5438  H HD2  . ARG A 1 82 ? 7.128   -3.278  -31.841 1.00 0.00 ? 82 ARG A HD2  4  
ATOM 5439  H HD3  . ARG A 1 82 ? 8.522   -3.892  -32.728 1.00 0.00 ? 82 ARG A HD3  4  
ATOM 5440  H HE   . ARG A 1 82 ? 8.894   -4.635  -30.095 1.00 0.00 ? 82 ARG A HE   4  
ATOM 5441  H HH11 . ARG A 1 82 ? 6.527   -5.213  -32.594 1.00 0.00 ? 82 ARG A HH11 4  
ATOM 5442  H HH12 . ARG A 1 82 ? 6.095   -6.779  -31.997 1.00 0.00 ? 82 ARG A HH12 4  
ATOM 5443  H HH21 . ARG A 1 82 ? 8.327   -6.696  -29.308 1.00 0.00 ? 82 ARG A HH21 4  
ATOM 5444  H HH22 . ARG A 1 82 ? 7.116   -7.622  -30.131 1.00 0.00 ? 82 ARG A HH22 4  
ATOM 5445  N N    . MET A 1 1  ? 25.357  10.436  18.532  1.00 0.00 ? 1  MET A N    5  
ATOM 5446  C CA   . MET A 1 1  ? 25.184  9.065   17.986  1.00 0.00 ? 1  MET A CA   5  
ATOM 5447  C C    . MET A 1 1  ? 23.725  8.792   17.633  1.00 0.00 ? 1  MET A C    5  
ATOM 5448  O O    . MET A 1 1  ? 22.912  8.491   18.507  1.00 0.00 ? 1  MET A O    5  
ATOM 5449  C CB   . MET A 1 1  ? 25.672  8.059   19.030  1.00 0.00 ? 1  MET A CB   5  
ATOM 5450  C CG   . MET A 1 1  ? 25.681  6.622   18.534  1.00 0.00 ? 1  MET A CG   5  
ATOM 5451  S SD   . MET A 1 1  ? 25.510  5.425   19.871  1.00 0.00 ? 1  MET A SD   5  
ATOM 5452  C CE   . MET A 1 1  ? 24.263  4.334   19.191  1.00 0.00 ? 1  MET A CE   5  
ATOM 5453  H H1   . MET A 1 1  ? 26.355  10.545  18.805  1.00 0.00 ? 1  MET A H1   5  
ATOM 5454  H H2   . MET A 1 1  ? 24.729  10.530  19.356  1.00 0.00 ? 1  MET A H2   5  
ATOM 5455  H H3   . MET A 1 1  ? 25.100  11.110  17.784  1.00 0.00 ? 1  MET A H3   5  
ATOM 5456  H HA   . MET A 1 1  ? 25.785  8.971   17.094  1.00 0.00 ? 1  MET A HA   5  
ATOM 5457  H HB2  . MET A 1 1  ? 26.677  8.322   19.324  1.00 0.00 ? 1  MET A HB2  5  
ATOM 5458  H HB3  . MET A 1 1  ? 25.027  8.114   19.895  1.00 0.00 ? 1  MET A HB3  5  
ATOM 5459  H HG2  . MET A 1 1  ? 24.861  6.489   17.844  1.00 0.00 ? 1  MET A HG2  5  
ATOM 5460  H HG3  . MET A 1 1  ? 26.614  6.439   18.021  1.00 0.00 ? 1  MET A HG3  5  
ATOM 5461  H HE1  . MET A 1 1  ? 23.704  3.881   19.996  1.00 0.00 ? 1  MET A HE1  5  
ATOM 5462  H HE2  . MET A 1 1  ? 24.740  3.562   18.605  1.00 0.00 ? 1  MET A HE2  5  
ATOM 5463  H HE3  . MET A 1 1  ? 23.593  4.901   18.562  1.00 0.00 ? 1  MET A HE3  5  
ATOM 5464  N N    . ASP A 1 2  ? 23.402  8.899   16.349  1.00 0.00 ? 2  ASP A N    5  
ATOM 5465  C CA   . ASP A 1 2  ? 22.041  8.663   15.881  1.00 0.00 ? 2  ASP A CA   5  
ATOM 5466  C C    . ASP A 1 2  ? 21.594  7.240   16.199  1.00 0.00 ? 2  ASP A C    5  
ATOM 5467  O O    . ASP A 1 2  ? 22.366  6.291   16.064  1.00 0.00 ? 2  ASP A O    5  
ATOM 5468  C CB   . ASP A 1 2  ? 21.946  8.921   14.379  1.00 0.00 ? 2  ASP A CB   5  
ATOM 5469  C CG   . ASP A 1 2  ? 20.994  10.053  14.044  1.00 0.00 ? 2  ASP A CG   5  
ATOM 5470  O OD1  . ASP A 1 2  ? 21.421  11.225  14.103  1.00 0.00 ? 2  ASP A OD1  5  
ATOM 5471  O OD2  . ASP A 1 2  ? 19.821  9.767   13.723  1.00 0.00 ? 2  ASP A OD2  5  
ATOM 5472  H H    . ASP A 1 2  ? 24.095  9.142   15.700  1.00 0.00 ? 2  ASP A H    5  
ATOM 5473  H HA   . ASP A 1 2  ? 21.393  9.353   16.392  1.00 0.00 ? 2  ASP A HA   5  
ATOM 5474  H HB2  . ASP A 1 2  ? 22.923  9.177   14.005  1.00 0.00 ? 2  ASP A HB2  5  
ATOM 5475  H HB3  . ASP A 1 2  ? 21.598  8.026   13.889  1.00 0.00 ? 2  ASP A HB3  5  
ATOM 5476  N N    . ASN A 1 3  ? 20.342  7.099   16.623  1.00 0.00 ? 3  ASN A N    5  
ATOM 5477  C CA   . ASN A 1 3  ? 19.792  5.791   16.961  1.00 0.00 ? 3  ASN A CA   5  
ATOM 5478  C C    . ASN A 1 3  ? 19.793  4.864   15.749  1.00 0.00 ? 3  ASN A C    5  
ATOM 5479  O O    . ASN A 1 3  ? 19.798  3.641   15.891  1.00 0.00 ? 3  ASN A O    5  
ATOM 5480  C CB   . ASN A 1 3  ? 18.374  5.938   17.509  1.00 0.00 ? 3  ASN A CB   5  
ATOM 5481  C CG   . ASN A 1 3  ? 18.254  5.455   18.941  1.00 0.00 ? 3  ASN A CG   5  
ATOM 5482  O OD1  . ASN A 1 3  ? 17.992  4.278   19.192  1.00 0.00 ? 3  ASN A OD1  5  
ATOM 5483  N ND2  . ASN A 1 3  ? 18.445  6.364   19.891  1.00 0.00 ? 3  ASN A ND2  5  
ATOM 5484  H H    . ASN A 1 3  ? 19.775  7.893   16.711  1.00 0.00 ? 3  ASN A H    5  
ATOM 5485  H HA   . ASN A 1 3  ? 20.414  5.362   17.722  1.00 0.00 ? 3  ASN A HA   5  
ATOM 5486  H HB2  . ASN A 1 3  ? 18.092  6.978   17.476  1.00 0.00 ? 3  ASN A HB2  5  
ATOM 5487  H HB3  . ASN A 1 3  ? 17.697  5.364   16.897  1.00 0.00 ? 3  ASN A HB3  5  
ATOM 5488  H HD21 . ASN A 1 3  ? 18.649  7.282   19.618  1.00 0.00 ? 3  ASN A HD21 5  
ATOM 5489  H HD22 . ASN A 1 3  ? 18.373  6.078   20.826  1.00 0.00 ? 3  ASN A HD22 5  
ATOM 5490  N N    . ASP A 1 4  ? 19.790  5.454   14.560  1.00 0.00 ? 4  ASP A N    5  
ATOM 5491  C CA   . ASP A 1 4  ? 19.791  4.683   13.323  1.00 0.00 ? 4  ASP A CA   5  
ATOM 5492  C C    . ASP A 1 4  ? 21.030  3.797   13.225  1.00 0.00 ? 4  ASP A C    5  
ATOM 5493  O O    . ASP A 1 4  ? 21.049  2.821   12.475  1.00 0.00 ? 4  ASP A O    5  
ATOM 5494  C CB   . ASP A 1 4  ? 19.719  5.618   12.117  1.00 0.00 ? 4  ASP A CB   5  
ATOM 5495  C CG   . ASP A 1 4  ? 18.465  5.402   11.291  1.00 0.00 ? 4  ASP A CG   5  
ATOM 5496  O OD1  . ASP A 1 4  ? 18.437  4.441   10.494  1.00 0.00 ? 4  ASP A OD1  5  
ATOM 5497  O OD2  . ASP A 1 4  ? 17.511  6.195   11.442  1.00 0.00 ? 4  ASP A OD2  5  
ATOM 5498  H H    . ASP A 1 4  ? 19.787  6.432   14.515  1.00 0.00 ? 4  ASP A H    5  
ATOM 5499  H HA   . ASP A 1 4  ? 18.919  4.057   13.326  1.00 0.00 ? 4  ASP A HA   5  
ATOM 5500  H HB2  . ASP A 1 4  ? 19.726  6.638   12.463  1.00 0.00 ? 4  ASP A HB2  5  
ATOM 5501  H HB3  . ASP A 1 4  ? 20.576  5.448   11.486  1.00 0.00 ? 4  ASP A HB3  5  
ATOM 5502  N N    . ALA A 1 5  ? 22.063  4.142   13.986  1.00 0.00 ? 5  ALA A N    5  
ATOM 5503  C CA   . ALA A 1 5  ? 23.305  3.378   13.984  1.00 0.00 ? 5  ALA A CA   5  
ATOM 5504  C C    . ALA A 1 5  ? 23.077  1.941   14.447  1.00 0.00 ? 5  ALA A C    5  
ATOM 5505  O O    . ALA A 1 5  ? 23.903  1.063   14.199  1.00 0.00 ? 5  ALA A O    5  
ATOM 5506  C CB   . ALA A 1 5  ? 24.343  4.058   14.863  1.00 0.00 ? 5  ALA A CB   5  
ATOM 5507  H H    . ALA A 1 5  ? 21.989  4.930   14.562  1.00 0.00 ? 5  ALA A H    5  
ATOM 5508  H HA   . ALA A 1 5  ? 23.680  3.361   12.973  1.00 0.00 ? 5  ALA A HA   5  
ATOM 5509  H HB1  . ALA A 1 5  ? 24.991  3.311   15.299  1.00 0.00 ? 5  ALA A HB1  5  
ATOM 5510  H HB2  . ALA A 1 5  ? 23.846  4.607   15.649  1.00 0.00 ? 5  ALA A HB2  5  
ATOM 5511  H HB3  . ALA A 1 5  ? 24.931  4.739   14.264  1.00 0.00 ? 5  ALA A HB3  5  
ATOM 5512  N N    . GLU A 1 6  ? 21.955  1.708   15.122  1.00 0.00 ? 6  GLU A N    5  
ATOM 5513  C CA   . GLU A 1 6  ? 21.626  0.381   15.620  1.00 0.00 ? 6  GLU A CA   5  
ATOM 5514  C C    . GLU A 1 6  ? 20.703  -0.361  14.669  1.00 0.00 ? 6  GLU A C    5  
ATOM 5515  O O    . GLU A 1 6  ? 20.052  -1.339  15.038  1.00 0.00 ? 6  GLU A O    5  
ATOM 5516  C CB   . GLU A 1 6  ? 20.973  0.484   16.987  1.00 0.00 ? 6  GLU A CB   5  
ATOM 5517  C CG   . GLU A 1 6  ? 21.297  -0.677  17.913  1.00 0.00 ? 6  GLU A CG   5  
ATOM 5518  C CD   . GLU A 1 6  ? 20.473  -0.654  19.186  1.00 0.00 ? 6  GLU A CD   5  
ATOM 5519  O OE1  . GLU A 1 6  ? 19.352  -1.207  19.177  1.00 0.00 ? 6  GLU A OE1  5  
ATOM 5520  O OE2  . GLU A 1 6  ? 20.947  -0.084  20.190  1.00 0.00 ? 6  GLU A OE2  5  
ATOM 5521  H H    . GLU A 1 6  ? 21.340  2.441   15.293  1.00 0.00 ? 6  GLU A H    5  
ATOM 5522  H HA   . GLU A 1 6  ? 22.539  -0.161  15.699  1.00 0.00 ? 6  GLU A HA   5  
ATOM 5523  H HB2  . GLU A 1 6  ? 21.298  1.398   17.456  1.00 0.00 ? 6  GLU A HB2  5  
ATOM 5524  H HB3  . GLU A 1 6  ? 19.904  0.521   16.846  1.00 0.00 ? 6  GLU A HB3  5  
ATOM 5525  H HG2  . GLU A 1 6  ? 21.100  -1.602  17.392  1.00 0.00 ? 6  GLU A HG2  5  
ATOM 5526  H HG3  . GLU A 1 6  ? 22.343  -0.628  18.178  1.00 0.00 ? 6  GLU A HG3  5  
ATOM 5527  N N    . GLY A 1 7  ? 20.663  0.118   13.450  1.00 0.00 ? 7  GLY A N    5  
ATOM 5528  C CA   . GLY A 1 7  ? 19.829  -0.485  12.427  1.00 0.00 ? 7  GLY A CA   5  
ATOM 5529  C C    . GLY A 1 7  ? 18.367  -0.533  12.824  1.00 0.00 ? 7  GLY A C    5  
ATOM 5530  O O    . GLY A 1 7  ? 17.702  -1.554  12.649  1.00 0.00 ? 7  GLY A O    5  
ATOM 5531  H H    . GLY A 1 7  ? 21.211  0.893   13.245  1.00 0.00 ? 7  GLY A H    5  
ATOM 5532  H HA2  . GLY A 1 7  ? 19.924  0.087   11.516  1.00 0.00 ? 7  GLY A HA2  5  
ATOM 5533  H HA3  . GLY A 1 7  ? 20.174  -1.492  12.244  1.00 0.00 ? 7  GLY A HA3  5  
ATOM 5534  N N    . VAL A 1 8  ? 17.866  0.574   13.362  1.00 0.00 ? 8  VAL A N    5  
ATOM 5535  C CA   . VAL A 1 8  ? 16.473  0.653   13.786  1.00 0.00 ? 8  VAL A CA   5  
ATOM 5536  C C    . VAL A 1 8  ? 15.521  0.381   12.628  1.00 0.00 ? 8  VAL A C    5  
ATOM 5537  O O    . VAL A 1 8  ? 14.388  -0.054  12.831  1.00 0.00 ? 8  VAL A O    5  
ATOM 5538  C CB   . VAL A 1 8  ? 16.141  2.021   14.392  1.00 0.00 ? 8  VAL A CB   5  
ATOM 5539  C CG1  . VAL A 1 8  ? 14.806  1.975   15.121  1.00 0.00 ? 8  VAL A CG1  5  
ATOM 5540  C CG2  . VAL A 1 8  ? 17.251  2.487   15.324  1.00 0.00 ? 8  VAL A CG2  5  
ATOM 5541  H H    . VAL A 1 8  ? 18.447  1.355   13.475  1.00 0.00 ? 8  VAL A H    5  
ATOM 5542  H HA   . VAL A 1 8  ? 16.316  -0.085  14.540  1.00 0.00 ? 8  VAL A HA   5  
ATOM 5543  H HB   . VAL A 1 8  ? 16.058  2.721   13.588  1.00 0.00 ? 8  VAL A HB   5  
ATOM 5544  H HG11 . VAL A 1 8  ? 14.592  2.946   15.542  1.00 0.00 ? 8  VAL A HG11 5  
ATOM 5545  H HG12 . VAL A 1 8  ? 14.853  1.241   15.912  1.00 0.00 ? 8  VAL A HG12 5  
ATOM 5546  H HG13 . VAL A 1 8  ? 14.026  1.704   14.425  1.00 0.00 ? 8  VAL A HG13 5  
ATOM 5547  H HG21 . VAL A 1 8  ? 16.820  3.010   16.165  1.00 0.00 ? 8  VAL A HG21 5  
ATOM 5548  H HG22 . VAL A 1 8  ? 17.914  3.151   14.789  1.00 0.00 ? 8  VAL A HG22 5  
ATOM 5549  H HG23 . VAL A 1 8  ? 17.806  1.631   15.678  1.00 0.00 ? 8  VAL A HG23 5  
ATOM 5550  N N    . TRP A 1 9  ? 15.990  0.639   11.414  1.00 0.00 ? 9  TRP A N    5  
ATOM 5551  C CA   . TRP A 1 9  ? 15.183  0.423   10.221  1.00 0.00 ? 9  TRP A CA   5  
ATOM 5552  C C    . TRP A 1 9  ? 14.988  -1.067  9.957   1.00 0.00 ? 9  TRP A C    5  
ATOM 5553  O O    . TRP A 1 9  ? 15.854  -1.723  9.378   1.00 0.00 ? 9  TRP A O    5  
ATOM 5554  C CB   . TRP A 1 9  ? 15.835  1.090   9.013   1.00 0.00 ? 9  TRP A CB   5  
ATOM 5555  C CG   . TRP A 1 9  ? 14.992  2.167   8.401   1.00 0.00 ? 9  TRP A CG   5  
ATOM 5556  C CD1  . TRP A 1 9  ? 14.759  2.370   7.071   1.00 0.00 ? 9  TRP A CD1  5  
ATOM 5557  C CD2  . TRP A 1 9  ? 14.271  3.191   9.096   1.00 0.00 ? 9  TRP A CD2  5  
ATOM 5558  N NE1  . TRP A 1 9  ? 13.936  3.457   6.897   1.00 0.00 ? 9  TRP A NE1  5  
ATOM 5559  C CE2  . TRP A 1 9  ? 13.623  3.978   8.125   1.00 0.00 ? 9  TRP A CE2  5  
ATOM 5560  C CE3  . TRP A 1 9  ? 14.109  3.518   10.446  1.00 0.00 ? 9  TRP A CE3  5  
ATOM 5561  C CZ2  . TRP A 1 9  ? 12.827  5.070   8.462   1.00 0.00 ? 9  TRP A CZ2  5  
ATOM 5562  C CZ3  . TRP A 1 9  ? 13.319  4.603   10.778  1.00 0.00 ? 9  TRP A CZ3  5  
ATOM 5563  C CH2  . TRP A 1 9  ? 12.686  5.367   9.790   1.00 0.00 ? 9  TRP A CH2  5  
ATOM 5564  H H    . TRP A 1 9  ? 16.898  0.983   11.319  1.00 0.00 ? 9  TRP A H    5  
ATOM 5565  H HA   . TRP A 1 9  ? 14.224  0.875   10.389  1.00 0.00 ? 9  TRP A HA   5  
ATOM 5566  H HB2  . TRP A 1 9  ? 16.769  1.533   9.319   1.00 0.00 ? 9  TRP A HB2  5  
ATOM 5567  H HB3  . TRP A 1 9  ? 16.024  0.345   8.257   1.00 0.00 ? 9  TRP A HB3  5  
ATOM 5568  H HD1  . TRP A 1 9  ? 15.168  1.757   6.282   1.00 0.00 ? 9  TRP A HD1  5  
ATOM 5569  H HE1  . TRP A 1 9  ? 13.625  3.802   6.035   1.00 0.00 ? 9  TRP A HE1  5  
ATOM 5570  H HE3  . TRP A 1 9  ? 14.589  2.941   11.222  1.00 0.00 ? 9  TRP A HE3  5  
ATOM 5571  H HZ2  . TRP A 1 9  ? 12.332  5.669   7.712   1.00 0.00 ? 9  TRP A HZ2  5  
ATOM 5572  H HZ3  . TRP A 1 9  ? 13.183  4.871   11.815  1.00 0.00 ? 9  TRP A HZ3  5  
ATOM 5573  H HH2  . TRP A 1 9  ? 12.079  6.206   10.095  1.00 0.00 ? 9  TRP A HH2  5  
ATOM 5574  N N    . SER A 1 10 ? 13.846  -1.595  10.385  1.00 0.00 ? 10 SER A N    5  
ATOM 5575  C CA   . SER A 1 10 ? 13.538  -3.004  10.197  1.00 0.00 ? 10 SER A CA   5  
ATOM 5576  C C    . SER A 1 10 ? 13.014  -3.266  8.786   1.00 0.00 ? 10 SER A C    5  
ATOM 5577  O O    . SER A 1 10 ? 12.211  -2.493  8.262   1.00 0.00 ? 10 SER A O    5  
ATOM 5578  C CB   . SER A 1 10 ? 12.508  -3.464  11.230  1.00 0.00 ? 10 SER A CB   5  
ATOM 5579  O OG   . SER A 1 10 ? 13.105  -3.641  12.503  1.00 0.00 ? 10 SER A OG   5  
ATOM 5580  H H    . SER A 1 10 ? 13.198  -1.025  10.840  1.00 0.00 ? 10 SER A H    5  
ATOM 5581  H HA   . SER A 1 10 ? 14.449  -3.556  10.342  1.00 0.00 ? 10 SER A HA   5  
ATOM 5582  H HB2  . SER A 1 10 ? 11.728  -2.722  11.313  1.00 0.00 ? 10 SER A HB2  5  
ATOM 5583  H HB3  . SER A 1 10 ? 12.079  -4.404  10.914  1.00 0.00 ? 10 SER A HB3  5  
ATOM 5584  H HG   . SER A 1 10 ? 12.579  -3.191  13.169  1.00 0.00 ? 10 SER A HG   5  
ATOM 5585  N N    . PRO A 1 11 ? 13.459  -4.364  8.149   1.00 0.00 ? 11 PRO A N    5  
ATOM 5586  C CA   . PRO A 1 11 ? 13.026  -4.720  6.795   1.00 0.00 ? 11 PRO A CA   5  
ATOM 5587  C C    . PRO A 1 11 ? 11.590  -5.233  6.755   1.00 0.00 ? 11 PRO A C    5  
ATOM 5588  O O    . PRO A 1 11 ? 10.983  -5.325  5.689   1.00 0.00 ? 11 PRO A O    5  
ATOM 5589  C CB   . PRO A 1 11 ? 14.000  -5.825  6.394   1.00 0.00 ? 11 PRO A CB   5  
ATOM 5590  C CG   . PRO A 1 11 ? 14.394  -6.454  7.681   1.00 0.00 ? 11 PRO A CG   5  
ATOM 5591  C CD   . PRO A 1 11 ? 14.417  -5.344  8.696   1.00 0.00 ? 11 PRO A CD   5  
ATOM 5592  H HA   . PRO A 1 11 ? 13.128  -3.891  6.121   1.00 0.00 ? 11 PRO A HA   5  
ATOM 5593  H HB2  . PRO A 1 11 ? 13.502  -6.530  5.743   1.00 0.00 ? 11 PRO A HB2  5  
ATOM 5594  H HB3  . PRO A 1 11 ? 14.851  -5.395  5.888   1.00 0.00 ? 11 PRO A HB3  5  
ATOM 5595  H HG2  . PRO A 1 11 ? 13.666  -7.199  7.958   1.00 0.00 ? 11 PRO A HG2  5  
ATOM 5596  H HG3  . PRO A 1 11 ? 15.372  -6.896  7.587   1.00 0.00 ? 11 PRO A HG3  5  
ATOM 5597  H HD2  . PRO A 1 11 ? 14.090  -5.706  9.659   1.00 0.00 ? 11 PRO A HD2  5  
ATOM 5598  H HD3  . PRO A 1 11 ? 15.406  -4.917  8.767   1.00 0.00 ? 11 PRO A HD3  5  
ATOM 5599  N N    . ASP A 1 12 ? 11.054  -5.567  7.924   1.00 0.00 ? 12 ASP A N    5  
ATOM 5600  C CA   . ASP A 1 12 ? 9.689   -6.071  8.024   1.00 0.00 ? 12 ASP A CA   5  
ATOM 5601  C C    . ASP A 1 12 ? 8.679   -5.029  7.559   1.00 0.00 ? 12 ASP A C    5  
ATOM 5602  O O    . ASP A 1 12 ? 7.560   -5.363  7.171   1.00 0.00 ? 12 ASP A O    5  
ATOM 5603  C CB   . ASP A 1 12 ? 9.385   -6.484  9.462   1.00 0.00 ? 12 ASP A CB   5  
ATOM 5604  C CG   . ASP A 1 12 ? 9.188   -7.980  9.608   1.00 0.00 ? 12 ASP A CG   5  
ATOM 5605  O OD1  . ASP A 1 12 ? 8.063   -8.459  9.352   1.00 0.00 ? 12 ASP A OD1  5  
ATOM 5606  O OD2  . ASP A 1 12 ? 10.159  -8.674  9.977   1.00 0.00 ? 12 ASP A OD2  5  
ATOM 5607  H H    . ASP A 1 12 ? 11.588  -5.472  8.738   1.00 0.00 ? 12 ASP A H    5  
ATOM 5608  H HA   . ASP A 1 12 ? 9.612   -6.936  7.393   1.00 0.00 ? 12 ASP A HA   5  
ATOM 5609  H HB2  . ASP A 1 12 ? 10.206  -6.186  10.090  1.00 0.00 ? 12 ASP A HB2  5  
ATOM 5610  H HB3  . ASP A 1 12 ? 8.485   -5.986  9.792   1.00 0.00 ? 12 ASP A HB3  5  
ATOM 5611  N N    . ILE A 1 13 ? 9.081   -3.765  7.603   1.00 0.00 ? 13 ILE A N    5  
ATOM 5612  C CA   . ILE A 1 13 ? 8.212   -2.674  7.189   1.00 0.00 ? 13 ILE A CA   5  
ATOM 5613  C C    . ILE A 1 13 ? 8.100   -2.621  5.676   1.00 0.00 ? 13 ILE A C    5  
ATOM 5614  O O    . ILE A 1 13 ? 7.004   -2.555  5.118   1.00 0.00 ? 13 ILE A O    5  
ATOM 5615  C CB   . ILE A 1 13 ? 8.704   -1.315  7.749   1.00 0.00 ? 13 ILE A CB   5  
ATOM 5616  C CG1  . ILE A 1 13 ? 7.514   -0.395  8.028   1.00 0.00 ? 13 ILE A CG1  5  
ATOM 5617  C CG2  . ILE A 1 13 ? 9.697   -0.633  6.812   1.00 0.00 ? 13 ILE A CG2  5  
ATOM 5618  C CD1  . ILE A 1 13 ? 6.985   -0.505  9.441   1.00 0.00 ? 13 ILE A CD1  5  
ATOM 5619  H H    . ILE A 1 13 ? 9.981   -3.564  7.921   1.00 0.00 ? 13 ILE A H    5  
ATOM 5620  H HA   . ILE A 1 13 ? 7.240   -2.872  7.592   1.00 0.00 ? 13 ILE A HA   5  
ATOM 5621  H HB   . ILE A 1 13 ? 9.217   -1.510  8.674   1.00 0.00 ? 13 ILE A HB   5  
ATOM 5622  H HG12 . ILE A 1 13 ? 7.813   0.629   7.865   1.00 0.00 ? 13 ILE A HG12 5  
ATOM 5623  H HG13 . ILE A 1 13 ? 6.710   -0.643  7.351   1.00 0.00 ? 13 ILE A HG13 5  
ATOM 5624  H HG21 . ILE A 1 13 ? 9.233   -0.467  5.851   1.00 0.00 ? 13 ILE A HG21 5  
ATOM 5625  H HG22 . ILE A 1 13 ? 10.566  -1.262  6.689   1.00 0.00 ? 13 ILE A HG22 5  
ATOM 5626  H HG23 . ILE A 1 13 ? 9.997   0.314   7.234   1.00 0.00 ? 13 ILE A HG23 5  
ATOM 5627  H HD11 . ILE A 1 13 ? 6.215   -1.261  9.480   1.00 0.00 ? 13 ILE A HD11 5  
ATOM 5628  H HD12 . ILE A 1 13 ? 6.571   0.446   9.745   1.00 0.00 ? 13 ILE A HD12 5  
ATOM 5629  H HD13 . ILE A 1 13 ? 7.790   -0.776  10.107  1.00 0.00 ? 13 ILE A HD13 5  
ATOM 5630  N N    . GLU A 1 14 ? 9.245   -2.667  5.025   1.00 0.00 ? 14 GLU A N    5  
ATOM 5631  C CA   . GLU A 1 14 ? 9.299   -2.643  3.574   1.00 0.00 ? 14 GLU A CA   5  
ATOM 5632  C C    . GLU A 1 14 ? 8.746   -3.943  3.009   1.00 0.00 ? 14 GLU A C    5  
ATOM 5633  O O    . GLU A 1 14 ? 8.263   -3.990  1.878   1.00 0.00 ? 14 GLU A O    5  
ATOM 5634  C CB   . GLU A 1 14 ? 10.735  -2.425  3.092   1.00 0.00 ? 14 GLU A CB   5  
ATOM 5635  C CG   . GLU A 1 14 ? 11.095  -0.962  2.894   1.00 0.00 ? 14 GLU A CG   5  
ATOM 5636  C CD   . GLU A 1 14 ? 11.931  -0.408  4.030   1.00 0.00 ? 14 GLU A CD   5  
ATOM 5637  O OE1  . GLU A 1 14 ? 13.138  -0.726  4.089   1.00 0.00 ? 14 GLU A OE1  5  
ATOM 5638  O OE2  . GLU A 1 14 ? 11.380  0.344   4.861   1.00 0.00 ? 14 GLU A OE2  5  
ATOM 5639  H H    . GLU A 1 14 ? 10.072  -2.729  5.539   1.00 0.00 ? 14 GLU A H    5  
ATOM 5640  H HA   . GLU A 1 14 ? 8.684   -1.829  3.236   1.00 0.00 ? 14 GLU A HA   5  
ATOM 5641  H HB2  . GLU A 1 14 ? 11.414  -2.845  3.820   1.00 0.00 ? 14 GLU A HB2  5  
ATOM 5642  H HB3  . GLU A 1 14 ? 10.868  -2.937  2.151   1.00 0.00 ? 14 GLU A HB3  5  
ATOM 5643  H HG2  . GLU A 1 14 ? 11.654  -0.863  1.975   1.00 0.00 ? 14 GLU A HG2  5  
ATOM 5644  H HG3  . GLU A 1 14 ? 10.183  -0.387  2.823   1.00 0.00 ? 14 GLU A HG3  5  
ATOM 5645  N N    . GLN A 1 15 ? 8.813   -4.996  3.816   1.00 0.00 ? 15 GLN A N    5  
ATOM 5646  C CA   . GLN A 1 15 ? 8.315   -6.296  3.419   1.00 0.00 ? 15 GLN A CA   5  
ATOM 5647  C C    . GLN A 1 15 ? 6.804   -6.342  3.523   1.00 0.00 ? 15 GLN A C    5  
ATOM 5648  O O    . GLN A 1 15 ? 6.120   -6.879  2.652   1.00 0.00 ? 15 GLN A O    5  
ATOM 5649  C CB   . GLN A 1 15 ? 8.938   -7.375  4.277   1.00 0.00 ? 15 GLN A CB   5  
ATOM 5650  C CG   . GLN A 1 15 ? 10.179  -7.971  3.652   1.00 0.00 ? 15 GLN A CG   5  
ATOM 5651  C CD   . GLN A 1 15 ? 9.864   -9.060  2.645   1.00 0.00 ? 15 GLN A CD   5  
ATOM 5652  O OE1  . GLN A 1 15 ? 9.427   -10.151 3.009   1.00 0.00 ? 15 GLN A OE1  5  
ATOM 5653  N NE2  . GLN A 1 15 ? 10.085  -8.767  1.368   1.00 0.00 ? 15 GLN A NE2  5  
ATOM 5654  H H    . GLN A 1 15 ? 9.202   -4.891  4.704   1.00 0.00 ? 15 GLN A H    5  
ATOM 5655  H HA   . GLN A 1 15 ? 8.603   -6.460  2.410   1.00 0.00 ? 15 GLN A HA   5  
ATOM 5656  H HB2  . GLN A 1 15 ? 9.208   -6.944  5.222   1.00 0.00 ? 15 GLN A HB2  5  
ATOM 5657  H HB3  . GLN A 1 15 ? 8.220   -8.163  4.435   1.00 0.00 ? 15 GLN A HB3  5  
ATOM 5658  H HG2  . GLN A 1 15 ? 10.726  -7.185  3.153   1.00 0.00 ? 15 GLN A HG2  5  
ATOM 5659  H HG3  . GLN A 1 15 ? 10.786  -8.385  4.430   1.00 0.00 ? 15 GLN A HG3  5  
ATOM 5660  H HE21 . GLN A 1 15 ? 10.434  -7.877  1.151   1.00 0.00 ? 15 GLN A HE21 5  
ATOM 5661  H HE22 . GLN A 1 15 ? 9.890   -9.452  0.696   1.00 0.00 ? 15 GLN A HE22 5  
ATOM 5662  N N    . SER A 1 16 ? 6.293   -5.755  4.591   1.00 0.00 ? 16 SER A N    5  
ATOM 5663  C CA   . SER A 1 16 ? 4.860   -5.700  4.819   1.00 0.00 ? 16 SER A CA   5  
ATOM 5664  C C    . SER A 1 16 ? 4.198   -4.808  3.777   1.00 0.00 ? 16 SER A C    5  
ATOM 5665  O O    . SER A 1 16 ? 3.012   -4.952  3.482   1.00 0.00 ? 16 SER A O    5  
ATOM 5666  C CB   . SER A 1 16 ? 4.560   -5.181  6.226   1.00 0.00 ? 16 SER A CB   5  
ATOM 5667  O OG   . SER A 1 16 ? 3.182   -5.308  6.533   1.00 0.00 ? 16 SER A OG   5  
ATOM 5668  H H    . SER A 1 16 ? 6.898   -5.336  5.236   1.00 0.00 ? 16 SER A H    5  
ATOM 5669  H HA   . SER A 1 16 ? 4.473   -6.699  4.719   1.00 0.00 ? 16 SER A HA   5  
ATOM 5670  H HB2  . SER A 1 16 ? 5.129   -5.749  6.946   1.00 0.00 ? 16 SER A HB2  5  
ATOM 5671  H HB3  . SER A 1 16 ? 4.836   -4.139  6.289   1.00 0.00 ? 16 SER A HB3  5  
ATOM 5672  H HG   . SER A 1 16 ? 2.988   -4.825  7.340   1.00 0.00 ? 16 SER A HG   5  
ATOM 5673  N N    . PHE A 1 17 ? 4.980   -3.888  3.220   1.00 0.00 ? 17 PHE A N    5  
ATOM 5674  C CA   . PHE A 1 17 ? 4.481   -2.973  2.209   1.00 0.00 ? 17 PHE A CA   5  
ATOM 5675  C C    . PHE A 1 17 ? 4.200   -3.706  0.908   1.00 0.00 ? 17 PHE A C    5  
ATOM 5676  O O    . PHE A 1 17 ? 3.260   -3.374  0.186   1.00 0.00 ? 17 PHE A O    5  
ATOM 5677  C CB   . PHE A 1 17 ? 5.477   -1.840  1.977   1.00 0.00 ? 17 PHE A CB   5  
ATOM 5678  C CG   . PHE A 1 17 ? 4.976   -0.499  2.430   1.00 0.00 ? 17 PHE A CG   5  
ATOM 5679  C CD1  . PHE A 1 17 ? 4.348   -0.359  3.657   1.00 0.00 ? 17 PHE A CD1  5  
ATOM 5680  C CD2  . PHE A 1 17 ? 5.132   0.621   1.630   1.00 0.00 ? 17 PHE A CD2  5  
ATOM 5681  C CE1  . PHE A 1 17 ? 3.885   0.873   4.078   1.00 0.00 ? 17 PHE A CE1  5  
ATOM 5682  C CE2  . PHE A 1 17 ? 4.671   1.856   2.045   1.00 0.00 ? 17 PHE A CE2  5  
ATOM 5683  C CZ   . PHE A 1 17 ? 4.047   1.982   3.271   1.00 0.00 ? 17 PHE A CZ   5  
ATOM 5684  H H    . PHE A 1 17 ? 5.917   -3.827  3.497   1.00 0.00 ? 17 PHE A H    5  
ATOM 5685  H HA   . PHE A 1 17 ? 3.565   -2.560  2.573   1.00 0.00 ? 17 PHE A HA   5  
ATOM 5686  H HB2  . PHE A 1 17 ? 6.380   -2.055  2.522   1.00 0.00 ? 17 PHE A HB2  5  
ATOM 5687  H HB3  . PHE A 1 17 ? 5.703   -1.774  0.923   1.00 0.00 ? 17 PHE A HB3  5  
ATOM 5688  H HD1  . PHE A 1 17 ? 4.222   -1.226  4.289   1.00 0.00 ? 17 PHE A HD1  5  
ATOM 5689  H HD2  . PHE A 1 17 ? 5.620   0.524   0.671   1.00 0.00 ? 17 PHE A HD2  5  
ATOM 5690  H HE1  . PHE A 1 17 ? 3.398   0.968   5.037   1.00 0.00 ? 17 PHE A HE1  5  
ATOM 5691  H HE2  . PHE A 1 17 ? 4.799   2.722   1.412   1.00 0.00 ? 17 PHE A HE2  5  
ATOM 5692  H HZ   . PHE A 1 17 ? 3.685   2.945   3.598   1.00 0.00 ? 17 PHE A HZ   5  
ATOM 5693  N N    . GLN A 1 18 ? 5.013   -4.711  0.618   1.00 0.00 ? 18 GLN A N    5  
ATOM 5694  C CA   . GLN A 1 18 ? 4.838   -5.495  -0.595  1.00 0.00 ? 18 GLN A CA   5  
ATOM 5695  C C    . GLN A 1 18 ? 3.559   -6.311  -0.515  1.00 0.00 ? 18 GLN A C    5  
ATOM 5696  O O    . GLN A 1 18 ? 2.884   -6.533  -1.518  1.00 0.00 ? 18 GLN A O    5  
ATOM 5697  C CB   . GLN A 1 18 ? 6.033   -6.421  -0.830  1.00 0.00 ? 18 GLN A CB   5  
ATOM 5698  C CG   . GLN A 1 18 ? 5.784   -7.468  -1.906  1.00 0.00 ? 18 GLN A CG   5  
ATOM 5699  C CD   . GLN A 1 18 ? 7.065   -8.090  -2.426  1.00 0.00 ? 18 GLN A CD   5  
ATOM 5700  O OE1  . GLN A 1 18 ? 7.940   -8.475  -1.651  1.00 0.00 ? 18 GLN A OE1  5  
ATOM 5701  N NE2  . GLN A 1 18 ? 7.181   -8.191  -3.745  1.00 0.00 ? 18 GLN A NE2  5  
ATOM 5702  H H    . GLN A 1 18 ? 5.740   -4.932  1.236   1.00 0.00 ? 18 GLN A H    5  
ATOM 5703  H HA   . GLN A 1 18 ? 4.757   -4.809  -1.416  1.00 0.00 ? 18 GLN A HA   5  
ATOM 5704  H HB2  . GLN A 1 18 ? 6.884   -5.824  -1.127  1.00 0.00 ? 18 GLN A HB2  5  
ATOM 5705  H HB3  . GLN A 1 18 ? 6.266   -6.931  0.093   1.00 0.00 ? 18 GLN A HB3  5  
ATOM 5706  H HG2  . GLN A 1 18 ? 5.162   -8.249  -1.492  1.00 0.00 ? 18 GLN A HG2  5  
ATOM 5707  H HG3  . GLN A 1 18 ? 5.265   -7.000  -2.731  1.00 0.00 ? 18 GLN A HG3  5  
ATOM 5708  H HE21 . GLN A 1 18 ? 6.444   -7.863  -4.301  1.00 0.00 ? 18 GLN A HE21 5  
ATOM 5709  H HE22 . GLN A 1 18 ? 7.999   -8.589  -4.108  1.00 0.00 ? 18 GLN A HE22 5  
ATOM 5710  N N    . GLU A 1 19 ? 3.237   -6.755  0.689   1.00 0.00 ? 19 GLU A N    5  
ATOM 5711  C CA   . GLU A 1 19 ? 2.039   -7.548  0.910   1.00 0.00 ? 19 GLU A CA   5  
ATOM 5712  C C    . GLU A 1 19 ? 0.797   -6.737  0.584   1.00 0.00 ? 19 GLU A C    5  
ATOM 5713  O O    . GLU A 1 19 ? -0.204  -7.274  0.114   1.00 0.00 ? 19 GLU A O    5  
ATOM 5714  C CB   . GLU A 1 19 ? 1.986   -8.050  2.350   1.00 0.00 ? 19 GLU A CB   5  
ATOM 5715  C CG   . GLU A 1 19 ? 1.992   -9.566  2.467   1.00 0.00 ? 19 GLU A CG   5  
ATOM 5716  C CD   . GLU A 1 19 ? 3.340   -10.171 2.129   1.00 0.00 ? 19 GLU A CD   5  
ATOM 5717  O OE1  . GLU A 1 19 ? 4.298   -9.956  2.901   1.00 0.00 ? 19 GLU A OE1  5  
ATOM 5718  O OE2  . GLU A 1 19 ? 3.439   -10.860 1.092   1.00 0.00 ? 19 GLU A OE2  5  
ATOM 5719  H H    . GLU A 1 19 ? 3.819   -6.541  1.444   1.00 0.00 ? 19 GLU A H    5  
ATOM 5720  H HA   . GLU A 1 19 ? 2.079   -8.388  0.248   1.00 0.00 ? 19 GLU A HA   5  
ATOM 5721  H HB2  . GLU A 1 19 ? 2.842   -7.667  2.882   1.00 0.00 ? 19 GLU A HB2  5  
ATOM 5722  H HB3  . GLU A 1 19 ? 1.087   -7.679  2.815   1.00 0.00 ? 19 GLU A HB3  5  
ATOM 5723  H HG2  . GLU A 1 19 ? 1.737   -9.837  3.480   1.00 0.00 ? 19 GLU A HG2  5  
ATOM 5724  H HG3  . GLU A 1 19 ? 1.253   -9.969  1.790   1.00 0.00 ? 19 GLU A HG3  5  
ATOM 5725  N N    . ALA A 1 20 ? 0.874   -5.439  0.826   1.00 0.00 ? 20 ALA A N    5  
ATOM 5726  C CA   . ALA A 1 20 ? -0.237  -4.550  0.548   1.00 0.00 ? 20 ALA A CA   5  
ATOM 5727  C C    . ALA A 1 20 ? -0.270  -4.180  -0.925  1.00 0.00 ? 20 ALA A C    5  
ATOM 5728  O O    . ALA A 1 20 ? -1.332  -3.927  -1.490  1.00 0.00 ? 20 ALA A O    5  
ATOM 5729  C CB   . ALA A 1 20 ? -0.159  -3.304  1.417   1.00 0.00 ? 20 ALA A CB   5  
ATOM 5730  H H    . ALA A 1 20 ? 1.700   -5.072  1.193   1.00 0.00 ? 20 ALA A H    5  
ATOM 5731  H HA   . ALA A 1 20 ? -1.139  -5.078  0.789   1.00 0.00 ? 20 ALA A HA   5  
ATOM 5732  H HB1  . ALA A 1 20 ? 0.434   -3.514  2.295   1.00 0.00 ? 20 ALA A HB1  5  
ATOM 5733  H HB2  . ALA A 1 20 ? -1.155  -3.012  1.718   1.00 0.00 ? 20 ALA A HB2  5  
ATOM 5734  H HB3  . ALA A 1 20 ? 0.297   -2.502  0.856   1.00 0.00 ? 20 ALA A HB3  5  
ATOM 5735  N N    . LEU A 1 21 ? 0.900   -4.164  -1.544  1.00 0.00 ? 21 LEU A N    5  
ATOM 5736  C CA   . LEU A 1 21 ? 1.007   -3.842  -2.954  1.00 0.00 ? 21 LEU A CA   5  
ATOM 5737  C C    . LEU A 1 21 ? 0.716   -5.073  -3.800  1.00 0.00 ? 21 LEU A C    5  
ATOM 5738  O O    . LEU A 1 21 ? 0.187   -4.972  -4.907  1.00 0.00 ? 21 LEU A O    5  
ATOM 5739  C CB   . LEU A 1 21 ? 2.390   -3.280  -3.279  1.00 0.00 ? 21 LEU A CB   5  
ATOM 5740  C CG   . LEU A 1 21 ? 2.398   -1.841  -3.800  1.00 0.00 ? 21 LEU A CG   5  
ATOM 5741  C CD1  . LEU A 1 21 ? 1.413   -1.681  -4.948  1.00 0.00 ? 21 LEU A CD1  5  
ATOM 5742  C CD2  . LEU A 1 21 ? 2.075   -0.866  -2.677  1.00 0.00 ? 21 LEU A CD2  5  
ATOM 5743  H H    . LEU A 1 21 ? 1.706   -4.383  -1.043  1.00 0.00 ? 21 LEU A H    5  
ATOM 5744  H HA   . LEU A 1 21 ? 0.270   -3.098  -3.168  1.00 0.00 ? 21 LEU A HA   5  
ATOM 5745  H HB2  . LEU A 1 21 ? 2.987   -3.320  -2.382  1.00 0.00 ? 21 LEU A HB2  5  
ATOM 5746  H HB3  . LEU A 1 21 ? 2.846   -3.911  -4.025  1.00 0.00 ? 21 LEU A HB3  5  
ATOM 5747  H HG   . LEU A 1 21 ? 3.385   -1.607  -4.174  1.00 0.00 ? 21 LEU A HG   5  
ATOM 5748  H HD11 . LEU A 1 21 ? 0.416   -1.557  -4.552  1.00 0.00 ? 21 LEU A HD11 5  
ATOM 5749  H HD12 . LEU A 1 21 ? 1.445   -2.561  -5.574  1.00 0.00 ? 21 LEU A HD12 5  
ATOM 5750  H HD13 . LEU A 1 21 ? 1.679   -0.813  -5.533  1.00 0.00 ? 21 LEU A HD13 5  
ATOM 5751  H HD21 . LEU A 1 21 ? 2.610   -1.154  -1.784  1.00 0.00 ? 21 LEU A HD21 5  
ATOM 5752  H HD22 . LEU A 1 21 ? 1.013   -0.882  -2.480  1.00 0.00 ? 21 LEU A HD22 5  
ATOM 5753  H HD23 . LEU A 1 21 ? 2.371   0.131   -2.969  1.00 0.00 ? 21 LEU A HD23 5  
ATOM 5754  N N    . SER A 1 22 ? 1.050   -6.237  -3.258  1.00 0.00 ? 22 SER A N    5  
ATOM 5755  C CA   . SER A 1 22 ? 0.811   -7.493  -3.944  1.00 0.00 ? 22 SER A CA   5  
ATOM 5756  C C    . SER A 1 22 ? -0.657  -7.874  -3.827  1.00 0.00 ? 22 SER A C    5  
ATOM 5757  O O    . SER A 1 22 ? -1.238  -8.465  -4.736  1.00 0.00 ? 22 SER A O    5  
ATOM 5758  C CB   . SER A 1 22 ? 1.692   -8.600  -3.363  1.00 0.00 ? 22 SER A CB   5  
ATOM 5759  O OG   . SER A 1 22 ? 2.953   -8.641  -4.009  1.00 0.00 ? 22 SER A OG   5  
ATOM 5760  H H    . SER A 1 22 ? 1.454   -6.250  -2.369  1.00 0.00 ? 22 SER A H    5  
ATOM 5761  H HA   . SER A 1 22 ? 1.053   -7.352  -4.978  1.00 0.00 ? 22 SER A HA   5  
ATOM 5762  H HB2  . SER A 1 22 ? 1.848   -8.419  -2.310  1.00 0.00 ? 22 SER A HB2  5  
ATOM 5763  H HB3  . SER A 1 22 ? 1.203   -9.554  -3.495  1.00 0.00 ? 22 SER A HB3  5  
ATOM 5764  H HG   . SER A 1 22 ? 3.460   -7.861  -3.773  1.00 0.00 ? 22 SER A HG   5  
ATOM 5765  N N    . ILE A 1 23 ? -1.247  -7.515  -2.695  1.00 0.00 ? 23 ILE A N    5  
ATOM 5766  C CA   . ILE A 1 23 ? -2.648  -7.795  -2.435  1.00 0.00 ? 23 ILE A CA   5  
ATOM 5767  C C    . ILE A 1 23 ? -3.523  -6.650  -2.921  1.00 0.00 ? 23 ILE A C    5  
ATOM 5768  O O    . ILE A 1 23 ? -4.619  -6.855  -3.442  1.00 0.00 ? 23 ILE A O    5  
ATOM 5769  C CB   . ILE A 1 23 ? -2.898  -8.040  -0.930  1.00 0.00 ? 23 ILE A CB   5  
ATOM 5770  C CG1  . ILE A 1 23 ? -3.929  -9.152  -0.735  1.00 0.00 ? 23 ILE A CG1  5  
ATOM 5771  C CG2  . ILE A 1 23 ? -3.342  -6.764  -0.222  1.00 0.00 ? 23 ILE A CG2  5  
ATOM 5772  C CD1  . ILE A 1 23 ? -5.315  -8.782  -1.218  1.00 0.00 ? 23 ILE A CD1  5  
ATOM 5773  H H    . ILE A 1 23 ? -0.723  -7.043  -2.019  1.00 0.00 ? 23 ILE A H    5  
ATOM 5774  H HA   . ILE A 1 23 ? -2.906  -8.684  -2.972  1.00 0.00 ? 23 ILE A HA   5  
ATOM 5775  H HB   . ILE A 1 23 ? -1.965  -8.346  -0.492  1.00 0.00 ? 23 ILE A HB   5  
ATOM 5776  H HG12 . ILE A 1 23 ? -3.612  -10.028 -1.279  1.00 0.00 ? 23 ILE A HG12 5  
ATOM 5777  H HG13 . ILE A 1 23 ? -3.997  -9.391  0.317   1.00 0.00 ? 23 ILE A HG13 5  
ATOM 5778  H HG21 . ILE A 1 23 ? -4.334  -6.495  -0.554  1.00 0.00 ? 23 ILE A HG21 5  
ATOM 5779  H HG22 . ILE A 1 23 ? -2.655  -5.964  -0.458  1.00 0.00 ? 23 ILE A HG22 5  
ATOM 5780  H HG23 . ILE A 1 23 ? -3.351  -6.928  0.845   1.00 0.00 ? 23 ILE A HG23 5  
ATOM 5781  H HD11 . ILE A 1 23 ? -5.479  -9.204  -2.199  1.00 0.00 ? 23 ILE A HD11 5  
ATOM 5782  H HD12 . ILE A 1 23 ? -5.403  -7.707  -1.269  1.00 0.00 ? 23 ILE A HD12 5  
ATOM 5783  H HD13 . ILE A 1 23 ? -6.052  -9.172  -0.531  1.00 0.00 ? 23 ILE A HD13 5  
ATOM 5784  N N    . TYR A 1 24 ? -3.015  -5.444  -2.732  1.00 0.00 ? 24 TYR A N    5  
ATOM 5785  C CA   . TYR A 1 24 ? -3.712  -4.234  -3.131  1.00 0.00 ? 24 TYR A CA   5  
ATOM 5786  C C    . TYR A 1 24 ? -2.934  -3.482  -4.210  1.00 0.00 ? 24 TYR A C    5  
ATOM 5787  O O    . TYR A 1 24 ? -2.176  -2.560  -3.911  1.00 0.00 ? 24 TYR A O    5  
ATOM 5788  C CB   . TYR A 1 24 ? -3.932  -3.333  -1.921  1.00 0.00 ? 24 TYR A CB   5  
ATOM 5789  C CG   . TYR A 1 24 ? -5.301  -2.696  -1.865  1.00 0.00 ? 24 TYR A CG   5  
ATOM 5790  C CD1  . TYR A 1 24 ? -6.444  -3.422  -2.173  1.00 0.00 ? 24 TYR A CD1  5  
ATOM 5791  C CD2  . TYR A 1 24 ? -5.448  -1.365  -1.497  1.00 0.00 ? 24 TYR A CD2  5  
ATOM 5792  C CE1  . TYR A 1 24 ? -7.696  -2.838  -2.117  1.00 0.00 ? 24 TYR A CE1  5  
ATOM 5793  C CE2  . TYR A 1 24 ? -6.694  -0.774  -1.438  1.00 0.00 ? 24 TYR A CE2  5  
ATOM 5794  C CZ   . TYR A 1 24 ? -7.815  -1.514  -1.750  1.00 0.00 ? 24 TYR A CZ   5  
ATOM 5795  O OH   . TYR A 1 24 ? -9.060  -0.929  -1.693  1.00 0.00 ? 24 TYR A OH   5  
ATOM 5796  H H    . TYR A 1 24 ? -2.144  -5.370  -2.307  1.00 0.00 ? 24 TYR A H    5  
ATOM 5797  H HA   . TYR A 1 24 ? -4.660  -4.521  -3.523  1.00 0.00 ? 24 TYR A HA   5  
ATOM 5798  H HB2  . TYR A 1 24 ? -3.798  -3.911  -1.019  1.00 0.00 ? 24 TYR A HB2  5  
ATOM 5799  H HB3  . TYR A 1 24 ? -3.204  -2.545  -1.946  1.00 0.00 ? 24 TYR A HB3  5  
ATOM 5800  H HD1  . TYR A 1 24 ? -6.347  -4.459  -2.459  1.00 0.00 ? 24 TYR A HD1  5  
ATOM 5801  H HD2  . TYR A 1 24 ? -4.568  -0.788  -1.256  1.00 0.00 ? 24 TYR A HD2  5  
ATOM 5802  H HE1  . TYR A 1 24 ? -8.573  -3.418  -2.361  1.00 0.00 ? 24 TYR A HE1  5  
ATOM 5803  H HE2  . TYR A 1 24 ? -6.785  0.263   -1.150  1.00 0.00 ? 24 TYR A HE2  5  
ATOM 5804  H HH   . TYR A 1 24 ? -9.169  -0.490  -0.846  1.00 0.00 ? 24 TYR A HH   5  
ATOM 5805  N N    . PRO A 1 25 ? -3.113  -3.867  -5.486  1.00 0.00 ? 25 PRO A N    5  
ATOM 5806  C CA   . PRO A 1 25 ? -2.435  -3.235  -6.607  1.00 0.00 ? 25 PRO A CA   5  
ATOM 5807  C C    . PRO A 1 25 ? -3.179  -2.002  -7.115  1.00 0.00 ? 25 PRO A C    5  
ATOM 5808  O O    . PRO A 1 25 ? -4.282  -1.701  -6.659  1.00 0.00 ? 25 PRO A O    5  
ATOM 5809  C CB   . PRO A 1 25 ? -2.414  -4.332  -7.681  1.00 0.00 ? 25 PRO A CB   5  
ATOM 5810  C CG   . PRO A 1 25 ? -3.326  -5.423  -7.204  1.00 0.00 ? 25 PRO A CG   5  
ATOM 5811  C CD   . PRO A 1 25 ? -3.989  -4.946  -5.940  1.00 0.00 ? 25 PRO A CD   5  
ATOM 5812  H HA   . PRO A 1 25 ? -1.422  -2.962  -6.352  1.00 0.00 ? 25 PRO A HA   5  
ATOM 5813  H HB2  . PRO A 1 25 ? -2.757  -3.922  -8.619  1.00 0.00 ? 25 PRO A HB2  5  
ATOM 5814  H HB3  . PRO A 1 25 ? -1.406  -4.695  -7.796  1.00 0.00 ? 25 PRO A HB3  5  
ATOM 5815  H HG2  . PRO A 1 25 ? -4.073  -5.625  -7.956  1.00 0.00 ? 25 PRO A HG2  5  
ATOM 5816  H HG3  . PRO A 1 25 ? -2.749  -6.314  -7.007  1.00 0.00 ? 25 PRO A HG3  5  
ATOM 5817  H HD2  . PRO A 1 25 ? -4.980  -4.576  -6.150  1.00 0.00 ? 25 PRO A HD2  5  
ATOM 5818  H HD3  . PRO A 1 25 ? -4.025  -5.742  -5.214  1.00 0.00 ? 25 PRO A HD3  5  
ATOM 5819  N N    . PRO A 1 26 ? -2.582  -1.269  -8.072  1.00 0.00 ? 26 PRO A N    5  
ATOM 5820  C CA   . PRO A 1 26 ? -3.193  -0.064  -8.642  1.00 0.00 ? 26 PRO A CA   5  
ATOM 5821  C C    . PRO A 1 26 ? -4.450  -0.368  -9.453  1.00 0.00 ? 26 PRO A C    5  
ATOM 5822  O O    . PRO A 1 26 ? -5.199  0.539   -9.815  1.00 0.00 ? 26 PRO A O    5  
ATOM 5823  C CB   . PRO A 1 26 ? -2.099  0.502   -9.548  1.00 0.00 ? 26 PRO A CB   5  
ATOM 5824  C CG   . PRO A 1 26 ? -1.246  -0.667  -9.884  1.00 0.00 ? 26 PRO A CG   5  
ATOM 5825  C CD   . PRO A 1 26 ? -1.268  -1.556  -8.673  1.00 0.00 ? 26 PRO A CD   5  
ATOM 5826  H HA   . PRO A 1 26 ? -3.429  0.653   -7.877  1.00 0.00 ? 26 PRO A HA   5  
ATOM 5827  H HB2  . PRO A 1 26 ? -2.547  0.934   -10.431 1.00 0.00 ? 26 PRO A HB2  5  
ATOM 5828  H HB3  . PRO A 1 26 ? -1.541  1.257   -9.015  1.00 0.00 ? 26 PRO A HB3  5  
ATOM 5829  H HG2  . PRO A 1 26 ? -1.659  -1.185  -10.735 1.00 0.00 ? 26 PRO A HG2  5  
ATOM 5830  H HG3  . PRO A 1 26 ? -0.241  -0.339  -10.090 1.00 0.00 ? 26 PRO A HG3  5  
ATOM 5831  H HD2  . PRO A 1 26 ? -1.193  -2.593  -8.964  1.00 0.00 ? 26 PRO A HD2  5  
ATOM 5832  H HD3  . PRO A 1 26 ? -0.469  -1.292  -7.996  1.00 0.00 ? 26 PRO A HD3  5  
ATOM 5833  N N    . CYS A 1 27 ? -4.678  -1.647  -9.735  1.00 0.00 ? 27 CYS A N    5  
ATOM 5834  C CA   . CYS A 1 27 ? -5.840  -2.064  -10.498 1.00 0.00 ? 27 CYS A CA   5  
ATOM 5835  C C    . CYS A 1 27 ? -6.333  -3.433  -10.039 1.00 0.00 ? 27 CYS A C    5  
ATOM 5836  O O    . CYS A 1 27 ? -5.604  -4.180  -9.386  1.00 0.00 ? 27 CYS A O    5  
ATOM 5837  C CB   . CYS A 1 27 ? -5.512  -2.095  -11.988 1.00 0.00 ? 27 CYS A CB   5  
ATOM 5838  S SG   . CYS A 1 27 ? -6.558  -1.019  -12.997 1.00 0.00 ? 27 CYS A SG   5  
ATOM 5839  H H    . CYS A 1 27 ? -4.053  -2.324  -9.422  1.00 0.00 ? 27 CYS A H    5  
ATOM 5840  H HA   . CYS A 1 27 ? -6.614  -1.345  -10.329 1.00 0.00 ? 27 CYS A HA   5  
ATOM 5841  H HB2  . CYS A 1 27 ? -4.489  -1.783  -12.129 1.00 0.00 ? 27 CYS A HB2  5  
ATOM 5842  H HB3  . CYS A 1 27 ? -5.629  -3.102  -12.351 1.00 0.00 ? 27 CYS A HB3  5  
ATOM 5843  H HG   . CYS A 1 27 ? -6.268  -1.094  -13.909 1.00 0.00 ? 27 CYS A HG   5  
ATOM 5844  N N    . GLY A 1 28 ? -7.575  -3.755  -10.385 1.00 0.00 ? 28 GLY A N    5  
ATOM 5845  C CA   . GLY A 1 28 ? -8.146  -5.033  -10.000 1.00 0.00 ? 28 GLY A CA   5  
ATOM 5846  C C    . GLY A 1 28 ? -9.564  -4.901  -9.481  1.00 0.00 ? 28 GLY A C    5  
ATOM 5847  O O    . GLY A 1 28 ? -10.362 -5.831  -9.593  1.00 0.00 ? 28 GLY A O    5  
ATOM 5848  H H    . GLY A 1 28 ? -8.110  -3.119  -10.906 1.00 0.00 ? 28 GLY A H    5  
ATOM 5849  H HA2  . GLY A 1 28 ? -8.148  -5.687  -10.859 1.00 0.00 ? 28 GLY A HA2  5  
ATOM 5850  H HA3  . GLY A 1 28 ? -7.531  -5.471  -9.228  1.00 0.00 ? 28 GLY A HA3  5  
ATOM 5851  N N    . ARG A 1 29 ? -9.878  -3.741  -8.913  1.00 0.00 ? 29 ARG A N    5  
ATOM 5852  C CA   . ARG A 1 29 ? -11.207 -3.488  -8.377  1.00 0.00 ? 29 ARG A CA   5  
ATOM 5853  C C    . ARG A 1 29 ? -11.469 -1.990  -8.260  1.00 0.00 ? 29 ARG A C    5  
ATOM 5854  O O    . ARG A 1 29 ? -10.851 -1.303  -7.446  1.00 0.00 ? 29 ARG A O    5  
ATOM 5855  C CB   . ARG A 1 29 ? -11.368 -4.158  -7.011  1.00 0.00 ? 29 ARG A CB   5  
ATOM 5856  C CG   . ARG A 1 29 ? -11.937 -5.565  -7.088  1.00 0.00 ? 29 ARG A CG   5  
ATOM 5857  C CD   . ARG A 1 29 ? -12.278 -6.104  -5.708  1.00 0.00 ? 29 ARG A CD   5  
ATOM 5858  N NE   . ARG A 1 29 ? -11.217 -6.957  -5.175  1.00 0.00 ? 29 ARG A NE   5  
ATOM 5859  C CZ   . ARG A 1 29 ? -11.314 -7.633  -4.033  1.00 0.00 ? 29 ARG A CZ   5  
ATOM 5860  N NH1  . ARG A 1 29 ? -12.419 -7.560  -3.301  1.00 0.00 ? 29 ARG A NH1  5  
ATOM 5861  N NH2  . ARG A 1 29 ? -10.302 -8.385  -3.622  1.00 0.00 ? 29 ARG A NH2  5  
ATOM 5862  H H    . ARG A 1 29 ? -9.203  -3.039  -8.856  1.00 0.00 ? 29 ARG A H    5  
ATOM 5863  H HA   . ARG A 1 29 ? -11.920 -3.911  -9.063  1.00 0.00 ? 29 ARG A HA   5  
ATOM 5864  H HB2  . ARG A 1 29 ? -10.402 -4.208  -6.532  1.00 0.00 ? 29 ARG A HB2  5  
ATOM 5865  H HB3  . ARG A 1 29 ? -12.031 -3.558  -6.405  1.00 0.00 ? 29 ARG A HB3  5  
ATOM 5866  H HG2  . ARG A 1 29 ? -12.834 -5.549  -7.689  1.00 0.00 ? 29 ARG A HG2  5  
ATOM 5867  H HG3  . ARG A 1 29 ? -11.205 -6.214  -7.547  1.00 0.00 ? 29 ARG A HG3  5  
ATOM 5868  H HD2  . ARG A 1 29 ? -12.427 -5.271  -5.037  1.00 0.00 ? 29 ARG A HD2  5  
ATOM 5869  H HD3  . ARG A 1 29 ? -13.190 -6.679  -5.776  1.00 0.00 ? 29 ARG A HD3  5  
ATOM 5870  H HE   . ARG A 1 29 ? -10.390 -7.028  -5.696  1.00 0.00 ? 29 ARG A HE   5  
ATOM 5871  H HH11 . ARG A 1 29 ? -13.185 -6.995  -3.606  1.00 0.00 ? 29 ARG A HH11 5  
ATOM 5872  H HH12 . ARG A 1 29 ? -12.485 -8.071  -2.444  1.00 0.00 ? 29 ARG A HH12 5  
ATOM 5873  H HH21 . ARG A 1 29 ? -9.468  -8.444  -4.169  1.00 0.00 ? 29 ARG A HH21 5  
ATOM 5874  H HH22 . ARG A 1 29 ? -10.374 -8.894  -2.763  1.00 0.00 ? 29 ARG A HH22 5  
ATOM 5875  N N    . ARG A 1 30 ? -12.388 -1.489  -9.079  1.00 0.00 ? 30 ARG A N    5  
ATOM 5876  C CA   . ARG A 1 30 ? -12.732 -0.071  -9.067  1.00 0.00 ? 30 ARG A CA   5  
ATOM 5877  C C    . ARG A 1 30 ? -13.238 0.356   -7.693  1.00 0.00 ? 30 ARG A C    5  
ATOM 5878  O O    . ARG A 1 30 ? -13.293 -0.448  -6.763  1.00 0.00 ? 30 ARG A O    5  
ATOM 5879  C CB   . ARG A 1 30 ? -13.793 0.226   -10.129 1.00 0.00 ? 30 ARG A CB   5  
ATOM 5880  C CG   . ARG A 1 30 ? -13.211 0.584   -11.487 1.00 0.00 ? 30 ARG A CG   5  
ATOM 5881  C CD   . ARG A 1 30 ? -14.203 0.316   -12.609 1.00 0.00 ? 30 ARG A CD   5  
ATOM 5882  N NE   . ARG A 1 30 ? -14.718 1.553   -13.191 1.00 0.00 ? 30 ARG A NE   5  
ATOM 5883  C CZ   . ARG A 1 30 ? -15.691 2.281   -12.647 1.00 0.00 ? 30 ARG A CZ   5  
ATOM 5884  N NH1  . ARG A 1 30 ? -16.257 1.901   -11.508 1.00 0.00 ? 30 ARG A NH1  5  
ATOM 5885  N NH2  . ARG A 1 30 ? -16.099 3.393   -13.243 1.00 0.00 ? 30 ARG A NH2  5  
ATOM 5886  H H    . ARG A 1 30 ? -12.846 -2.086  -9.706  1.00 0.00 ? 30 ARG A H    5  
ATOM 5887  H HA   . ARG A 1 30 ? -11.838 0.488   -9.299  1.00 0.00 ? 30 ARG A HA   5  
ATOM 5888  H HB2  . ARG A 1 30 ? -14.420 -0.645  -10.248 1.00 0.00 ? 30 ARG A HB2  5  
ATOM 5889  H HB3  . ARG A 1 30 ? -14.401 1.053   -9.792  1.00 0.00 ? 30 ARG A HB3  5  
ATOM 5890  H HG2  . ARG A 1 30 ? -12.954 1.632   -11.492 1.00 0.00 ? 30 ARG A HG2  5  
ATOM 5891  H HG3  . ARG A 1 30 ? -12.323 -0.008  -11.654 1.00 0.00 ? 30 ARG A HG3  5  
ATOM 5892  H HD2  . ARG A 1 30 ? -13.707 -0.254  -13.380 1.00 0.00 ? 30 ARG A HD2  5  
ATOM 5893  H HD3  . ARG A 1 30 ? -15.029 -0.257  -12.214 1.00 0.00 ? 30 ARG A HD3  5  
ATOM 5894  H HE   . ARG A 1 30 ? -14.318 1.857   -14.033 1.00 0.00 ? 30 ARG A HE   5  
ATOM 5895  H HH11 . ARG A 1 30 ? -15.954 1.064   -11.053 1.00 0.00 ? 30 ARG A HH11 5  
ATOM 5896  H HH12 . ARG A 1 30 ? -16.987 2.452   -11.105 1.00 0.00 ? 30 ARG A HH12 5  
ATOM 5897  H HH21 . ARG A 1 30 ? -15.676 3.684   -14.101 1.00 0.00 ? 30 ARG A HH21 5  
ATOM 5898  H HH22 . ARG A 1 30 ? -16.830 3.940   -12.835 1.00 0.00 ? 30 ARG A HH22 5  
ATOM 5899  N N    . LYS A 1 31 ? -13.606 1.628   -7.573  1.00 0.00 ? 31 LYS A N    5  
ATOM 5900  C CA   . LYS A 1 31 ? -14.108 2.163   -6.313  1.00 0.00 ? 31 LYS A CA   5  
ATOM 5901  C C    . LYS A 1 31 ? -15.359 1.416   -5.863  1.00 0.00 ? 31 LYS A C    5  
ATOM 5902  O O    . LYS A 1 31 ? -15.780 0.451   -6.501  1.00 0.00 ? 31 LYS A O    5  
ATOM 5903  C CB   . LYS A 1 31 ? -14.414 3.656   -6.455  1.00 0.00 ? 31 LYS A CB   5  
ATOM 5904  C CG   . LYS A 1 31 ? -13.237 4.554   -6.111  1.00 0.00 ? 31 LYS A CG   5  
ATOM 5905  C CD   . LYS A 1 31 ? -13.700 5.887   -5.546  1.00 0.00 ? 31 LYS A CD   5  
ATOM 5906  C CE   . LYS A 1 31 ? -13.694 6.974   -6.607  1.00 0.00 ? 31 LYS A CE   5  
ATOM 5907  N NZ   . LYS A 1 31 ? -13.260 8.288   -6.055  1.00 0.00 ? 31 LYS A NZ   5  
ATOM 5908  H H    . LYS A 1 31 ? -13.540 2.220   -8.351  1.00 0.00 ? 31 LYS A H    5  
ATOM 5909  H HA   . LYS A 1 31 ? -13.338 2.033   -5.568  1.00 0.00 ? 31 LYS A HA   5  
ATOM 5910  H HB2  . LYS A 1 31 ? -14.706 3.856   -7.476  1.00 0.00 ? 31 LYS A HB2  5  
ATOM 5911  H HB3  . LYS A 1 31 ? -15.235 3.907   -5.800  1.00 0.00 ? 31 LYS A HB3  5  
ATOM 5912  H HG2  . LYS A 1 31 ? -12.621 4.057   -5.376  1.00 0.00 ? 31 LYS A HG2  5  
ATOM 5913  H HG3  . LYS A 1 31 ? -12.660 4.733   -7.006  1.00 0.00 ? 31 LYS A HG3  5  
ATOM 5914  H HD2  . LYS A 1 31 ? -14.704 5.776   -5.164  1.00 0.00 ? 31 LYS A HD2  5  
ATOM 5915  H HD3  . LYS A 1 31 ? -13.037 6.175   -4.743  1.00 0.00 ? 31 LYS A HD3  5  
ATOM 5916  H HE2  . LYS A 1 31 ? -13.016 6.685   -7.397  1.00 0.00 ? 31 LYS A HE2  5  
ATOM 5917  H HE3  . LYS A 1 31 ? -14.692 7.073   -7.009  1.00 0.00 ? 31 LYS A HE3  5  
ATOM 5918  H HZ1  . LYS A 1 31 ? -13.366 9.030   -6.776  1.00 0.00 ? 31 LYS A HZ1  5  
ATOM 5919  H HZ2  . LYS A 1 31 ? -12.263 8.242   -5.764  1.00 0.00 ? 31 LYS A HZ2  5  
ATOM 5920  H HZ3  . LYS A 1 31 ? -13.840 8.536   -5.228  1.00 0.00 ? 31 LYS A HZ3  5  
ATOM 5921  N N    . ILE A 1 32 ? -15.949 1.868   -4.762  1.00 0.00 ? 32 ILE A N    5  
ATOM 5922  C CA   . ILE A 1 32 ? -17.148 1.246   -4.227  1.00 0.00 ? 32 ILE A CA   5  
ATOM 5923  C C    . ILE A 1 32 ? -18.071 2.287   -3.601  1.00 0.00 ? 32 ILE A C    5  
ATOM 5924  O O    . ILE A 1 32 ? -17.741 2.891   -2.580  1.00 0.00 ? 32 ILE A O    5  
ATOM 5925  C CB   . ILE A 1 32 ? -16.822 0.162   -3.174  1.00 0.00 ? 32 ILE A CB   5  
ATOM 5926  C CG1  . ILE A 1 32 ? -15.309 -0.013  -3.011  1.00 0.00 ? 32 ILE A CG1  5  
ATOM 5927  C CG2  . ILE A 1 32 ? -17.471 -1.160  -3.556  1.00 0.00 ? 32 ILE A CG2  5  
ATOM 5928  C CD1  . ILE A 1 32 ? -14.633 1.163   -2.340  1.00 0.00 ? 32 ILE A CD1  5  
ATOM 5929  H H    . ILE A 1 32 ? -15.571 2.636   -4.299  1.00 0.00 ? 32 ILE A H    5  
ATOM 5930  H HA   . ILE A 1 32 ? -17.661 0.778   -5.043  1.00 0.00 ? 32 ILE A HA   5  
ATOM 5931  H HB   . ILE A 1 32 ? -17.242 0.477   -2.235  1.00 0.00 ? 32 ILE A HB   5  
ATOM 5932  H HG12 . ILE A 1 32 ? -15.117 -0.890  -2.411  1.00 0.00 ? 32 ILE A HG12 5  
ATOM 5933  H HG13 . ILE A 1 32 ? -14.860 -0.143  -3.985  1.00 0.00 ? 32 ILE A HG13 5  
ATOM 5934  H HG21 . ILE A 1 32 ? -16.982 -1.966  -3.029  1.00 0.00 ? 32 ILE A HG21 5  
ATOM 5935  H HG22 . ILE A 1 32 ? -17.373 -1.315  -4.621  1.00 0.00 ? 32 ILE A HG22 5  
ATOM 5936  H HG23 . ILE A 1 32 ? -18.517 -1.138  -3.290  1.00 0.00 ? 32 ILE A HG23 5  
ATOM 5937  H HD11 . ILE A 1 32 ? -13.894 1.582   -3.006  1.00 0.00 ? 32 ILE A HD11 5  
ATOM 5938  H HD12 . ILE A 1 32 ? -14.153 0.832   -1.431  1.00 0.00 ? 32 ILE A HD12 5  
ATOM 5939  H HD13 . ILE A 1 32 ? -15.371 1.916   -2.103  1.00 0.00 ? 32 ILE A HD13 5  
ATOM 5940  N N    . ILE A 1 33 ? -19.229 2.492   -4.221  1.00 0.00 ? 33 ILE A N    5  
ATOM 5941  C CA   . ILE A 1 33 ? -20.198 3.458   -3.728  1.00 0.00 ? 33 ILE A CA   5  
ATOM 5942  C C    . ILE A 1 33 ? -20.918 2.931   -2.490  1.00 0.00 ? 33 ILE A C    5  
ATOM 5943  O O    . ILE A 1 33 ? -21.633 1.931   -2.553  1.00 0.00 ? 33 ILE A O    5  
ATOM 5944  C CB   . ILE A 1 33 ? -21.235 3.819   -4.814  1.00 0.00 ? 33 ILE A CB   5  
ATOM 5945  C CG1  . ILE A 1 33 ? -22.174 4.930   -4.316  1.00 0.00 ? 33 ILE A CG1  5  
ATOM 5946  C CG2  . ILE A 1 33 ? -22.015 2.582   -5.249  1.00 0.00 ? 33 ILE A CG2  5  
ATOM 5947  C CD1  . ILE A 1 33 ? -23.426 4.430   -3.619  1.00 0.00 ? 33 ILE A CD1  5  
ATOM 5948  H H    . ILE A 1 33 ? -19.434 1.984   -5.029  1.00 0.00 ? 33 ILE A H    5  
ATOM 5949  H HA   . ILE A 1 33 ? -19.661 4.354   -3.464  1.00 0.00 ? 33 ILE A HA   5  
ATOM 5950  H HB   . ILE A 1 33 ? -20.695 4.183   -5.676  1.00 0.00 ? 33 ILE A HB   5  
ATOM 5951  H HG12 . ILE A 1 33 ? -21.639 5.553   -3.617  1.00 0.00 ? 33 ILE A HG12 5  
ATOM 5952  H HG13 . ILE A 1 33 ? -22.483 5.531   -5.159  1.00 0.00 ? 33 ILE A HG13 5  
ATOM 5953  H HG21 . ILE A 1 33 ? -22.612 2.821   -6.117  1.00 0.00 ? 33 ILE A HG21 5  
ATOM 5954  H HG22 . ILE A 1 33 ? -22.661 2.260   -4.447  1.00 0.00 ? 33 ILE A HG22 5  
ATOM 5955  H HG23 . ILE A 1 33 ? -21.325 1.789   -5.495  1.00 0.00 ? 33 ILE A HG23 5  
ATOM 5956  H HD11 . ILE A 1 33 ? -23.968 3.771   -4.280  1.00 0.00 ? 33 ILE A HD11 5  
ATOM 5957  H HD12 . ILE A 1 33 ? -24.052 5.271   -3.359  1.00 0.00 ? 33 ILE A HD12 5  
ATOM 5958  H HD13 . ILE A 1 33 ? -23.152 3.896   -2.722  1.00 0.00 ? 33 ILE A HD13 5  
ATOM 5959  N N    . LEU A 1 34 ? -20.720 3.609   -1.364  1.00 0.00 ? 34 LEU A N    5  
ATOM 5960  C CA   . LEU A 1 34 ? -21.344 3.213   -0.114  1.00 0.00 ? 34 LEU A CA   5  
ATOM 5961  C C    . LEU A 1 34 ? -22.134 4.366   0.498   1.00 0.00 ? 34 LEU A C    5  
ATOM 5962  O O    . LEU A 1 34 ? -22.276 4.453   1.718   1.00 0.00 ? 34 LEU A O    5  
ATOM 5963  C CB   . LEU A 1 34 ? -20.290 2.712   0.872   1.00 0.00 ? 34 LEU A CB   5  
ATOM 5964  C CG   . LEU A 1 34 ? -20.412 1.237   1.257   1.00 0.00 ? 34 LEU A CG   5  
ATOM 5965  C CD1  . LEU A 1 34 ? -19.631 0.366   0.286   1.00 0.00 ? 34 LEU A CD1  5  
ATOM 5966  C CD2  . LEU A 1 34 ? -19.926 1.017   2.682   1.00 0.00 ? 34 LEU A CD2  5  
ATOM 5967  H H    . LEU A 1 34 ? -20.143 4.391   -1.374  1.00 0.00 ? 34 LEU A H    5  
ATOM 5968  H HA   . LEU A 1 34 ? -22.017 2.412   -0.334  1.00 0.00 ? 34 LEU A HA   5  
ATOM 5969  H HB2  . LEU A 1 34 ? -19.319 2.869   0.432   1.00 0.00 ? 34 LEU A HB2  5  
ATOM 5970  H HB3  . LEU A 1 34 ? -20.358 3.302   1.773   1.00 0.00 ? 34 LEU A HB3  5  
ATOM 5971  H HG   . LEU A 1 34 ? -21.451 0.944   1.208   1.00 0.00 ? 34 LEU A HG   5  
ATOM 5972  H HD11 . LEU A 1 34 ? -20.147 -0.573  0.149   1.00 0.00 ? 34 LEU A HD11 5  
ATOM 5973  H HD12 . LEU A 1 34 ? -18.644 0.179   0.683   1.00 0.00 ? 34 LEU A HD12 5  
ATOM 5974  H HD13 . LEU A 1 34 ? -19.547 0.872   -0.664  1.00 0.00 ? 34 LEU A HD13 5  
ATOM 5975  H HD21 . LEU A 1 34 ? -20.429 0.160   3.105   1.00 0.00 ? 34 LEU A HD21 5  
ATOM 5976  H HD22 . LEU A 1 34 ? -20.145 1.892   3.276   1.00 0.00 ? 34 LEU A HD22 5  
ATOM 5977  H HD23 . LEU A 1 34 ? -18.861 0.844   2.677   1.00 0.00 ? 34 LEU A HD23 5  
ATOM 5978  N N    . SER A 1 35 ? -22.647 5.249   -0.354  1.00 0.00 ? 35 SER A N    5  
ATOM 5979  C CA   . SER A 1 35 ? -23.423 6.395   0.109   1.00 0.00 ? 35 SER A CA   5  
ATOM 5980  C C    . SER A 1 35 ? -24.556 5.954   1.030   1.00 0.00 ? 35 SER A C    5  
ATOM 5981  O O    . SER A 1 35 ? -25.011 6.716   1.883   1.00 0.00 ? 35 SER A O    5  
ATOM 5982  C CB   . SER A 1 35 ? -23.982 7.173   -1.080  1.00 0.00 ? 35 SER A CB   5  
ATOM 5983  O OG   . SER A 1 35 ? -23.477 8.496   -1.107  1.00 0.00 ? 35 SER A OG   5  
ATOM 5984  H H    . SER A 1 35 ? -22.501 5.127   -1.315  1.00 0.00 ? 35 SER A H    5  
ATOM 5985  H HA   . SER A 1 35 ? -22.763 7.036   0.660   1.00 0.00 ? 35 SER A HA   5  
ATOM 5986  H HB2  . SER A 1 35 ? -23.701 6.675   -1.993  1.00 0.00 ? 35 SER A HB2  5  
ATOM 5987  H HB3  . SER A 1 35 ? -25.057 7.213   -1.006  1.00 0.00 ? 35 SER A HB3  5  
ATOM 5988  H HG   . SER A 1 35 ? -22.520 8.472   -1.184  1.00 0.00 ? 35 SER A HG   5  
ATOM 5989  N N    . ASP A 1 36 ? -25.004 4.719   0.850   1.00 0.00 ? 36 ASP A N    5  
ATOM 5990  C CA   . ASP A 1 36 ? -26.079 4.168   1.660   1.00 0.00 ? 36 ASP A CA   5  
ATOM 5991  C C    . ASP A 1 36 ? -25.561 3.739   3.029   1.00 0.00 ? 36 ASP A C    5  
ATOM 5992  O O    . ASP A 1 36 ? -26.106 4.131   4.060   1.00 0.00 ? 36 ASP A O    5  
ATOM 5993  C CB   . ASP A 1 36 ? -26.723 2.977   0.948   1.00 0.00 ? 36 ASP A CB   5  
ATOM 5994  C CG   . ASP A 1 36 ? -28.222 2.916   1.166   1.00 0.00 ? 36 ASP A CG   5  
ATOM 5995  O OD1  . ASP A 1 36 ? -28.955 3.641   0.460   1.00 0.00 ? 36 ASP A OD1  5  
ATOM 5996  O OD2  . ASP A 1 36 ? -28.664 2.143   2.042   1.00 0.00 ? 36 ASP A OD2  5  
ATOM 5997  H H    . ASP A 1 36 ? -24.601 4.165   0.157   1.00 0.00 ? 36 ASP A H    5  
ATOM 5998  H HA   . ASP A 1 36 ? -26.817 4.939   1.791   1.00 0.00 ? 36 ASP A HA   5  
ATOM 5999  H HB2  . ASP A 1 36 ? -26.535 3.054   -0.112  1.00 0.00 ? 36 ASP A HB2  5  
ATOM 6000  H HB3  . ASP A 1 36 ? -26.286 2.062   1.322   1.00 0.00 ? 36 ASP A HB3  5  
ATOM 6001  N N    . GLU A 1 37 ? -24.505 2.930   3.029   1.00 0.00 ? 37 GLU A N    5  
ATOM 6002  C CA   . GLU A 1 37 ? -23.913 2.447   4.270   1.00 0.00 ? 37 GLU A CA   5  
ATOM 6003  C C    . GLU A 1 37 ? -23.297 3.592   5.065   1.00 0.00 ? 37 GLU A C    5  
ATOM 6004  O O    . GLU A 1 37 ? -23.213 3.536   6.292   1.00 0.00 ? 37 GLU A O    5  
ATOM 6005  C CB   . GLU A 1 37 ? -22.859 1.383   3.975   1.00 0.00 ? 37 GLU A CB   5  
ATOM 6006  C CG   . GLU A 1 37 ? -23.187 0.024   4.565   1.00 0.00 ? 37 GLU A CG   5  
ATOM 6007  C CD   . GLU A 1 37 ? -22.148 -0.448  5.564   1.00 0.00 ? 37 GLU A CD   5  
ATOM 6008  O OE1  . GLU A 1 37 ? -21.181 -1.118  5.143   1.00 0.00 ? 37 GLU A OE1  5  
ATOM 6009  O OE2  . GLU A 1 37 ? -22.301 -0.147  6.766   1.00 0.00 ? 37 GLU A OE2  5  
ATOM 6010  H H    . GLU A 1 37 ? -24.116 2.652   2.175   1.00 0.00 ? 37 GLU A H    5  
ATOM 6011  H HA   . GLU A 1 37 ? -24.695 2.006   4.853   1.00 0.00 ? 37 GLU A HA   5  
ATOM 6012  H HB2  . GLU A 1 37 ? -22.767 1.273   2.908   1.00 0.00 ? 37 GLU A HB2  5  
ATOM 6013  H HB3  . GLU A 1 37 ? -21.915 1.705   4.379   1.00 0.00 ? 37 GLU A HB3  5  
ATOM 6014  H HG2  . GLU A 1 37 ? -24.139 0.087   5.063   1.00 0.00 ? 37 GLU A HG2  5  
ATOM 6015  H HG3  . GLU A 1 37 ? -23.247 -0.696  3.763   1.00 0.00 ? 37 GLU A HG3  5  
ATOM 6016  N N    . GLY A 1 38 ? -22.872 4.630   4.357   1.00 0.00 ? 38 GLY A N    5  
ATOM 6017  C CA   . GLY A 1 38 ? -22.272 5.778   5.008   1.00 0.00 ? 38 GLY A CA   5  
ATOM 6018  C C    . GLY A 1 38 ? -20.971 5.439   5.706   1.00 0.00 ? 38 GLY A C    5  
ATOM 6019  O O    . GLY A 1 38 ? -20.574 6.111   6.658   1.00 0.00 ? 38 GLY A O    5  
ATOM 6020  H H    . GLY A 1 38 ? -22.970 4.615   3.384   1.00 0.00 ? 38 GLY A H    5  
ATOM 6021  H HA2  . GLY A 1 38 ? -22.083 6.541   4.268   1.00 0.00 ? 38 GLY A HA2  5  
ATOM 6022  H HA3  . GLY A 1 38 ? -22.965 6.162   5.736   1.00 0.00 ? 38 GLY A HA3  5  
ATOM 6023  N N    . LYS A 1 39 ? -20.303 4.402   5.222   1.00 0.00 ? 39 LYS A N    5  
ATOM 6024  C CA   . LYS A 1 39 ? -19.038 3.977   5.782   1.00 0.00 ? 39 LYS A CA   5  
ATOM 6025  C C    . LYS A 1 39 ? -18.133 3.442   4.684   1.00 0.00 ? 39 LYS A C    5  
ATOM 6026  O O    . LYS A 1 39 ? -18.148 2.252   4.369   1.00 0.00 ? 39 LYS A O    5  
ATOM 6027  C CB   . LYS A 1 39 ? -19.258 2.908   6.854   1.00 0.00 ? 39 LYS A CB   5  
ATOM 6028  C CG   . LYS A 1 39 ? -18.294 3.014   8.025   1.00 0.00 ? 39 LYS A CG   5  
ATOM 6029  C CD   . LYS A 1 39 ? -18.924 3.743   9.201   1.00 0.00 ? 39 LYS A CD   5  
ATOM 6030  C CE   . LYS A 1 39 ? -18.515 3.119   10.526  1.00 0.00 ? 39 LYS A CE   5  
ATOM 6031  N NZ   . LYS A 1 39 ? -19.630 3.130   11.513  1.00 0.00 ? 39 LYS A NZ   5  
ATOM 6032  H H    . LYS A 1 39 ? -20.657 3.926   4.458   1.00 0.00 ? 39 LYS A H    5  
ATOM 6033  H HA   . LYS A 1 39 ? -18.574 4.837   6.229   1.00 0.00 ? 39 LYS A HA   5  
ATOM 6034  H HB2  . LYS A 1 39 ? -20.264 2.998   7.235   1.00 0.00 ? 39 LYS A HB2  5  
ATOM 6035  H HB3  . LYS A 1 39 ? -19.138 1.934   6.404   1.00 0.00 ? 39 LYS A HB3  5  
ATOM 6036  H HG2  . LYS A 1 39 ? -18.013 2.020   8.339   1.00 0.00 ? 39 LYS A HG2  5  
ATOM 6037  H HG3  . LYS A 1 39 ? -17.415 3.555   7.707   1.00 0.00 ? 39 LYS A HG3  5  
ATOM 6038  H HD2  . LYS A 1 39 ? -18.604 4.774   9.187   1.00 0.00 ? 39 LYS A HD2  5  
ATOM 6039  H HD3  . LYS A 1 39 ? -19.999 3.695   9.107   1.00 0.00 ? 39 LYS A HD3  5  
ATOM 6040  H HE2  . LYS A 1 39 ? -18.212 2.097   10.350  1.00 0.00 ? 39 LYS A HE2  5  
ATOM 6041  H HE3  . LYS A 1 39 ? -17.683 3.676   10.930  1.00 0.00 ? 39 LYS A HE3  5  
ATOM 6042  H HZ1  . LYS A 1 39 ? -20.224 2.284   11.391  1.00 0.00 ? 39 LYS A HZ1  5  
ATOM 6043  H HZ2  . LYS A 1 39 ? -20.220 3.975   11.377  1.00 0.00 ? 39 LYS A HZ2  5  
ATOM 6044  H HZ3  . LYS A 1 39 ? -19.251 3.137   12.481  1.00 0.00 ? 39 LYS A HZ3  5  
ATOM 6045  N N    . MET A 1 40 ? -17.341 4.333   4.115   1.00 0.00 ? 40 MET A N    5  
ATOM 6046  C CA   . MET A 1 40 ? -16.413 3.977   3.058   1.00 0.00 ? 40 MET A CA   5  
ATOM 6047  C C    . MET A 1 40 ? -15.179 4.869   3.108   1.00 0.00 ? 40 MET A C    5  
ATOM 6048  O O    . MET A 1 40 ? -15.115 5.898   2.435   1.00 0.00 ? 40 MET A O    5  
ATOM 6049  C CB   . MET A 1 40 ? -17.089 4.089   1.691   1.00 0.00 ? 40 MET A CB   5  
ATOM 6050  C CG   . MET A 1 40 ? -16.377 3.315   0.594   1.00 0.00 ? 40 MET A CG   5  
ATOM 6051  S SD   . MET A 1 40 ? -15.314 4.363   -0.418  1.00 0.00 ? 40 MET A SD   5  
ATOM 6052  C CE   . MET A 1 40 ? -16.534 5.254   -1.380  1.00 0.00 ? 40 MET A CE   5  
ATOM 6053  H H    . MET A 1 40 ? -17.381 5.253   4.417   1.00 0.00 ? 40 MET A H    5  
ATOM 6054  H HA   . MET A 1 40 ? -16.112 2.958   3.220   1.00 0.00 ? 40 MET A HA   5  
ATOM 6055  H HB2  . MET A 1 40 ? -18.099 3.713   1.769   1.00 0.00 ? 40 MET A HB2  5  
ATOM 6056  H HB3  . MET A 1 40 ? -17.124 5.130   1.403   1.00 0.00 ? 40 MET A HB3  5  
ATOM 6057  H HG2  . MET A 1 40 ? -15.770 2.547   1.050   1.00 0.00 ? 40 MET A HG2  5  
ATOM 6058  H HG3  . MET A 1 40 ? -17.118 2.855   -0.043  1.00 0.00 ? 40 MET A HG3  5  
ATOM 6059  H HE1  . MET A 1 40 ? -17.482 4.738   -1.326  1.00 0.00 ? 40 MET A HE1  5  
ATOM 6060  H HE2  . MET A 1 40 ? -16.212 5.308   -2.409  1.00 0.00 ? 40 MET A HE2  5  
ATOM 6061  H HE3  . MET A 1 40 ? -16.645 6.252   -0.984  1.00 0.00 ? 40 MET A HE3  5  
ATOM 6062  N N    . TYR A 1 41 ? -14.205 4.466   3.911   1.00 0.00 ? 41 TYR A N    5  
ATOM 6063  C CA   . TYR A 1 41 ? -12.970 5.223   4.057   1.00 0.00 ? 41 TYR A CA   5  
ATOM 6064  C C    . TYR A 1 41 ? -12.129 5.152   2.786   1.00 0.00 ? 41 TYR A C    5  
ATOM 6065  O O    . TYR A 1 41 ? -12.429 4.380   1.875   1.00 0.00 ? 41 TYR A O    5  
ATOM 6066  C CB   . TYR A 1 41 ? -12.167 4.702   5.248   1.00 0.00 ? 41 TYR A CB   5  
ATOM 6067  C CG   . TYR A 1 41 ? -11.972 5.727   6.343   1.00 0.00 ? 41 TYR A CG   5  
ATOM 6068  C CD1  . TYR A 1 41 ? -12.974 5.977   7.272   1.00 0.00 ? 41 TYR A CD1  5  
ATOM 6069  C CD2  . TYR A 1 41 ? -10.787 6.443   6.447   1.00 0.00 ? 41 TYR A CD2  5  
ATOM 6070  C CE1  . TYR A 1 41 ? -12.800 6.913   8.274   1.00 0.00 ? 41 TYR A CE1  5  
ATOM 6071  C CE2  . TYR A 1 41 ? -10.605 7.380   7.446   1.00 0.00 ? 41 TYR A CE2  5  
ATOM 6072  C CZ   . TYR A 1 41 ? -11.614 7.611   8.357   1.00 0.00 ? 41 TYR A CZ   5  
ATOM 6073  O OH   . TYR A 1 41 ? -11.436 8.543   9.354   1.00 0.00 ? 41 TYR A OH   5  
ATOM 6074  H H    . TYR A 1 41 ? -14.323 3.642   4.422   1.00 0.00 ? 41 TYR A H    5  
ATOM 6075  H HA   . TYR A 1 41 ? -13.234 6.248   4.242   1.00 0.00 ? 41 TYR A HA   5  
ATOM 6076  H HB2  . TYR A 1 41 ? -12.683 3.858   5.674   1.00 0.00 ? 41 TYR A HB2  5  
ATOM 6077  H HB3  . TYR A 1 41 ? -11.193 4.391   4.907   1.00 0.00 ? 41 TYR A HB3  5  
ATOM 6078  H HD1  . TYR A 1 41 ? -13.902 5.428   7.205   1.00 0.00 ? 41 TYR A HD1  5  
ATOM 6079  H HD2  . TYR A 1 41 ? -9.999  6.261   5.731   1.00 0.00 ? 41 TYR A HD2  5  
ATOM 6080  H HE1  . TYR A 1 41 ? -13.590 7.093   8.988   1.00 0.00 ? 41 TYR A HE1  5  
ATOM 6081  H HE2  . TYR A 1 41 ? -9.676  7.927   7.510   1.00 0.00 ? 41 TYR A HE2  5  
ATOM 6082  H HH   . TYR A 1 41 ? -11.128 8.105   10.150  1.00 0.00 ? 41 TYR A HH   5  
ATOM 6083  N N    . GLY A 1 42 ? -11.076 5.961   2.733   1.00 0.00 ? 42 GLY A N    5  
ATOM 6084  C CA   . GLY A 1 42 ? -10.209 5.974   1.569   1.00 0.00 ? 42 GLY A CA   5  
ATOM 6085  C C    . GLY A 1 42 ? -9.587  4.620   1.294   1.00 0.00 ? 42 GLY A C    5  
ATOM 6086  O O    . GLY A 1 42 ? -9.412  3.812   2.206   1.00 0.00 ? 42 GLY A O    5  
ATOM 6087  H H    . GLY A 1 42 ? -10.887 6.554   3.489   1.00 0.00 ? 42 GLY A H    5  
ATOM 6088  H HA2  . GLY A 1 42 ? -10.786 6.275   0.708   1.00 0.00 ? 42 GLY A HA2  5  
ATOM 6089  H HA3  . GLY A 1 42 ? -9.420  6.694   1.731   1.00 0.00 ? 42 GLY A HA3  5  
ATOM 6090  N N    . ARG A 1 43 ? -9.253  4.370   0.032   1.00 0.00 ? 43 ARG A N    5  
ATOM 6091  C CA   . ARG A 1 43 ? -8.647  3.104   -0.362  1.00 0.00 ? 43 ARG A CA   5  
ATOM 6092  C C    . ARG A 1 43 ? -7.293  2.908   0.312   1.00 0.00 ? 43 ARG A C    5  
ATOM 6093  O O    . ARG A 1 43 ? -6.840  1.780   0.503   1.00 0.00 ? 43 ARG A O    5  
ATOM 6094  C CB   . ARG A 1 43 ? -8.495  3.039   -1.880  1.00 0.00 ? 43 ARG A CB   5  
ATOM 6095  C CG   . ARG A 1 43 ? -9.324  1.941   -2.528  1.00 0.00 ? 43 ARG A CG   5  
ATOM 6096  C CD   . ARG A 1 43 ? -8.536  1.204   -3.600  1.00 0.00 ? 43 ARG A CD   5  
ATOM 6097  N NE   . ARG A 1 43 ? -8.302  2.037   -4.777  1.00 0.00 ? 43 ARG A NE   5  
ATOM 6098  C CZ   . ARG A 1 43 ? -7.386  1.769   -5.705  1.00 0.00 ? 43 ARG A CZ   5  
ATOM 6099  N NH1  . ARG A 1 43 ? -6.616  0.693   -5.595  1.00 0.00 ? 43 ARG A NH1  5  
ATOM 6100  N NH2  . ARG A 1 43 ? -7.239  2.578   -6.745  1.00 0.00 ? 43 ARG A NH2  5  
ATOM 6101  H H    . ARG A 1 43 ? -9.418  5.053   -0.651  1.00 0.00 ? 43 ARG A H    5  
ATOM 6102  H HA   . ARG A 1 43 ? -9.304  2.316   -0.047  1.00 0.00 ? 43 ARG A HA   5  
ATOM 6103  H HB2  . ARG A 1 43 ? -8.802  3.984   -2.297  1.00 0.00 ? 43 ARG A HB2  5  
ATOM 6104  H HB3  . ARG A 1 43 ? -7.458  2.867   -2.120  1.00 0.00 ? 43 ARG A HB3  5  
ATOM 6105  H HG2  . ARG A 1 43 ? -9.626  1.235   -1.769  1.00 0.00 ? 43 ARG A HG2  5  
ATOM 6106  H HG3  . ARG A 1 43 ? -10.200 2.384   -2.979  1.00 0.00 ? 43 ARG A HG3  5  
ATOM 6107  H HD2  . ARG A 1 43 ? -7.584  0.906   -3.187  1.00 0.00 ? 43 ARG A HD2  5  
ATOM 6108  H HD3  . ARG A 1 43 ? -9.090  0.325   -3.895  1.00 0.00 ? 43 ARG A HD3  5  
ATOM 6109  H HE   . ARG A 1 43 ? -8.858  2.837   -4.883  1.00 0.00 ? 43 ARG A HE   5  
ATOM 6110  H HH11 . ARG A 1 43 ? -6.721  0.079   -4.814  1.00 0.00 ? 43 ARG A HH11 5  
ATOM 6111  H HH12 . ARG A 1 43 ? -5.929  0.497   -6.295  1.00 0.00 ? 43 ARG A HH12 5  
ATOM 6112  H HH21 . ARG A 1 43 ? -7.817  3.390   -6.832  1.00 0.00 ? 43 ARG A HH21 5  
ATOM 6113  H HH22 . ARG A 1 43 ? -6.550  2.377   -7.441  1.00 0.00 ? 43 ARG A HH22 5  
ATOM 6114  N N    . ASN A 1 44 ? -6.654  4.015   0.669   1.00 0.00 ? 44 ASN A N    5  
ATOM 6115  C CA   . ASN A 1 44 ? -5.352  3.970   1.322   1.00 0.00 ? 44 ASN A CA   5  
ATOM 6116  C C    . ASN A 1 44 ? -5.451  3.323   2.699   1.00 0.00 ? 44 ASN A C    5  
ATOM 6117  O O    . ASN A 1 44 ? -4.477  2.770   3.209   1.00 0.00 ? 44 ASN A O    5  
ATOM 6118  C CB   . ASN A 1 44 ? -4.771  5.377   1.442   1.00 0.00 ? 44 ASN A CB   5  
ATOM 6119  C CG   . ASN A 1 44 ? -3.491  5.545   0.647   1.00 0.00 ? 44 ASN A CG   5  
ATOM 6120  O OD1  . ASN A 1 44 ? -2.822  4.568   0.311   1.00 0.00 ? 44 ASN A OD1  5  
ATOM 6121  N ND2  . ASN A 1 44 ? -3.143  6.790   0.342   1.00 0.00 ? 44 ASN A ND2  5  
ATOM 6122  H H    . ASN A 1 44 ? -7.069  4.882   0.489   1.00 0.00 ? 44 ASN A H    5  
ATOM 6123  H HA   . ASN A 1 44 ? -4.701  3.378   0.710   1.00 0.00 ? 44 ASN A HA   5  
ATOM 6124  H HB2  . ASN A 1 44 ? -5.495  6.086   1.076   1.00 0.00 ? 44 ASN A HB2  5  
ATOM 6125  H HB3  . ASN A 1 44 ? -4.560  5.585   2.479   1.00 0.00 ? 44 ASN A HB3  5  
ATOM 6126  H HD21 . ASN A 1 44 ? -3.724  7.520   0.643   1.00 0.00 ? 44 ASN A HD21 5  
ATOM 6127  H HD22 . ASN A 1 44 ? -2.320  6.928   -0.171  1.00 0.00 ? 44 ASN A HD22 5  
ATOM 6128  N N    . GLU A 1 45 ? -6.634  3.398   3.294   1.00 0.00 ? 45 GLU A N    5  
ATOM 6129  C CA   . GLU A 1 45 ? -6.865  2.822   4.610   1.00 0.00 ? 45 GLU A CA   5  
ATOM 6130  C C    . GLU A 1 45 ? -6.892  1.299   4.547   1.00 0.00 ? 45 GLU A C    5  
ATOM 6131  O O    . GLU A 1 45 ? -6.620  0.621   5.537   1.00 0.00 ? 45 GLU A O    5  
ATOM 6132  C CB   . GLU A 1 45 ? -8.178  3.345   5.197   1.00 0.00 ? 45 GLU A CB   5  
ATOM 6133  C CG   . GLU A 1 45 ? -8.126  3.572   6.699   1.00 0.00 ? 45 GLU A CG   5  
ATOM 6134  C CD   . GLU A 1 45 ? -9.392  3.122   7.401   1.00 0.00 ? 45 GLU A CD   5  
ATOM 6135  O OE1  . GLU A 1 45 ? -10.466 3.148   6.763   1.00 0.00 ? 45 GLU A OE1  5  
ATOM 6136  O OE2  . GLU A 1 45 ? -9.310  2.742   8.588   1.00 0.00 ? 45 GLU A OE2  5  
ATOM 6137  H H    . GLU A 1 45 ? -7.367  3.852   2.837   1.00 0.00 ? 45 GLU A H    5  
ATOM 6138  H HA   . GLU A 1 45 ? -6.053  3.127   5.245   1.00 0.00 ? 45 GLU A HA   5  
ATOM 6139  H HB2  . GLU A 1 45 ? -8.424  4.283   4.721   1.00 0.00 ? 45 GLU A HB2  5  
ATOM 6140  H HB3  . GLU A 1 45 ? -8.961  2.630   4.989   1.00 0.00 ? 45 GLU A HB3  5  
ATOM 6141  H HG2  . GLU A 1 45 ? -7.292  3.019   7.105   1.00 0.00 ? 45 GLU A HG2  5  
ATOM 6142  H HG3  . GLU A 1 45 ? -7.983  4.626   6.885   1.00 0.00 ? 45 GLU A HG3  5  
ATOM 6143  N N    . LEU A 1 46 ? -7.225  0.769   3.376   1.00 0.00 ? 46 LEU A N    5  
ATOM 6144  C CA   . LEU A 1 46 ? -7.292  -0.672  3.182   1.00 0.00 ? 46 LEU A CA   5  
ATOM 6145  C C    . LEU A 1 46 ? -5.900  -1.277  3.086   1.00 0.00 ? 46 LEU A C    5  
ATOM 6146  O O    . LEU A 1 46 ? -5.654  -2.381  3.572   1.00 0.00 ? 46 LEU A O    5  
ATOM 6147  C CB   . LEU A 1 46 ? -8.100  -1.005  1.929   1.00 0.00 ? 46 LEU A CB   5  
ATOM 6148  C CG   . LEU A 1 46 ? -9.309  -1.913  2.160   1.00 0.00 ? 46 LEU A CG   5  
ATOM 6149  C CD1  . LEU A 1 46 ? -10.052 -2.153  0.856   1.00 0.00 ? 46 LEU A CD1  5  
ATOM 6150  C CD2  . LEU A 1 46 ? -8.871  -3.233  2.777   1.00 0.00 ? 46 LEU A CD2  5  
ATOM 6151  H H    . LEU A 1 46 ? -7.433  1.360   2.629   1.00 0.00 ? 46 LEU A H    5  
ATOM 6152  H HA   . LEU A 1 46 ? -7.784  -1.089  4.033   1.00 0.00 ? 46 LEU A HA   5  
ATOM 6153  H HB2  . LEU A 1 46 ? -8.448  -0.080  1.495   1.00 0.00 ? 46 LEU A HB2  5  
ATOM 6154  H HB3  . LEU A 1 46 ? -7.446  -1.490  1.226   1.00 0.00 ? 46 LEU A HB3  5  
ATOM 6155  H HG   . LEU A 1 46 ? -9.988  -1.430  2.848   1.00 0.00 ? 46 LEU A HG   5  
ATOM 6156  H HD11 . LEU A 1 46 ? -10.686 -3.022  0.957   1.00 0.00 ? 46 LEU A HD11 5  
ATOM 6157  H HD12 . LEU A 1 46 ? -9.339  -2.318  0.061   1.00 0.00 ? 46 LEU A HD12 5  
ATOM 6158  H HD13 . LEU A 1 46 ? -10.658 -1.290  0.622   1.00 0.00 ? 46 LEU A HD13 5  
ATOM 6159  H HD21 . LEU A 1 46 ? -7.948  -3.556  2.318   1.00 0.00 ? 46 LEU A HD21 5  
ATOM 6160  H HD22 . LEU A 1 46 ? -9.635  -3.979  2.612   1.00 0.00 ? 46 LEU A HD22 5  
ATOM 6161  H HD23 . LEU A 1 46 ? -8.719  -3.102  3.838   1.00 0.00 ? 46 LEU A HD23 5  
ATOM 6162  N N    . ILE A 1 47 ? -4.994  -0.544  2.462   1.00 0.00 ? 47 ILE A N    5  
ATOM 6163  C CA   . ILE A 1 47 ? -3.620  -1.006  2.308   1.00 0.00 ? 47 ILE A CA   5  
ATOM 6164  C C    . ILE A 1 47 ? -2.859  -0.845  3.611   1.00 0.00 ? 47 ILE A C    5  
ATOM 6165  O O    . ILE A 1 47 ? -2.000  -1.659  3.950   1.00 0.00 ? 47 ILE A O    5  
ATOM 6166  C CB   . ILE A 1 47 ? -2.853  -0.274  1.175   1.00 0.00 ? 47 ILE A CB   5  
ATOM 6167  C CG1  . ILE A 1 47 ? -3.660  0.905   0.619   1.00 0.00 ? 47 ILE A CG1  5  
ATOM 6168  C CG2  . ILE A 1 47 ? -2.504  -1.249  0.060   1.00 0.00 ? 47 ILE A CG2  5  
ATOM 6169  C CD1  . ILE A 1 47 ? -2.944  1.667   -0.476  1.00 0.00 ? 47 ILE A CD1  5  
ATOM 6170  H H    . ILE A 1 47 ? -5.254  0.323   2.107   1.00 0.00 ? 47 ILE A H    5  
ATOM 6171  H HA   . ILE A 1 47 ? -3.662  -2.051  2.070   1.00 0.00 ? 47 ILE A HA   5  
ATOM 6172  H HB   . ILE A 1 47 ? -1.927  0.100   1.586   1.00 0.00 ? 47 ILE A HB   5  
ATOM 6173  H HG12 . ILE A 1 47 ? -4.590  0.537   0.212   1.00 0.00 ? 47 ILE A HG12 5  
ATOM 6174  H HG13 . ILE A 1 47 ? -3.872  1.596   1.420   1.00 0.00 ? 47 ILE A HG13 5  
ATOM 6175  H HG21 . ILE A 1 47 ? -2.609  -0.758  -0.896  1.00 0.00 ? 47 ILE A HG21 5  
ATOM 6176  H HG22 . ILE A 1 47 ? -3.170  -2.098  0.104   1.00 0.00 ? 47 ILE A HG22 5  
ATOM 6177  H HG23 . ILE A 1 47 ? -1.485  -1.585  0.182   1.00 0.00 ? 47 ILE A HG23 5  
ATOM 6178  H HD11 . ILE A 1 47 ? -2.430  0.970   -1.121  1.00 0.00 ? 47 ILE A HD11 5  
ATOM 6179  H HD12 . ILE A 1 47 ? -2.229  2.344   -0.034  1.00 0.00 ? 47 ILE A HD12 5  
ATOM 6180  H HD13 . ILE A 1 47 ? -3.664  2.228   -1.053  1.00 0.00 ? 47 ILE A HD13 5  
ATOM 6181  N N    . ALA A 1 48 ? -3.193  0.204   4.343   1.00 0.00 ? 48 ALA A N    5  
ATOM 6182  C CA   . ALA A 1 48 ? -2.558  0.472   5.619   1.00 0.00 ? 48 ALA A CA   5  
ATOM 6183  C C    . ALA A 1 48 ? -3.089  -0.474  6.686   1.00 0.00 ? 48 ALA A C    5  
ATOM 6184  O O    . ALA A 1 48 ? -2.408  -0.764  7.670   1.00 0.00 ? 48 ALA A O    5  
ATOM 6185  C CB   . ALA A 1 48 ? -2.767  1.922   6.027   1.00 0.00 ? 48 ALA A CB   5  
ATOM 6186  H H    . ALA A 1 48 ? -3.889  0.805   4.021   1.00 0.00 ? 48 ALA A H    5  
ATOM 6187  H HA   . ALA A 1 48 ? -1.503  0.300   5.500   1.00 0.00 ? 48 ALA A HA   5  
ATOM 6188  H HB1  . ALA A 1 48 ? -3.824  2.121   6.120   1.00 0.00 ? 48 ALA A HB1  5  
ATOM 6189  H HB2  . ALA A 1 48 ? -2.343  2.571   5.274   1.00 0.00 ? 48 ALA A HB2  5  
ATOM 6190  H HB3  . ALA A 1 48 ? -2.281  2.103   6.974   1.00 0.00 ? 48 ALA A HB3  5  
ATOM 6191  N N    . ARG A 1 49 ? -4.304  -0.968  6.475   1.00 0.00 ? 49 ARG A N    5  
ATOM 6192  C CA   . ARG A 1 49 ? -4.915  -1.897  7.407   1.00 0.00 ? 49 ARG A CA   5  
ATOM 6193  C C    . ARG A 1 49 ? -4.226  -3.250  7.318   1.00 0.00 ? 49 ARG A C    5  
ATOM 6194  O O    . ARG A 1 49 ? -4.147  -3.990  8.299   1.00 0.00 ? 49 ARG A O    5  
ATOM 6195  C CB   . ARG A 1 49 ? -6.411  -2.044  7.122   1.00 0.00 ? 49 ARG A CB   5  
ATOM 6196  C CG   . ARG A 1 49 ? -7.163  -2.811  8.197   1.00 0.00 ? 49 ARG A CG   5  
ATOM 6197  C CD   . ARG A 1 49 ? -8.650  -2.886  7.891   1.00 0.00 ? 49 ARG A CD   5  
ATOM 6198  N NE   . ARG A 1 49 ? -9.015  -4.149  7.255   1.00 0.00 ? 49 ARG A NE   5  
ATOM 6199  C CZ   . ARG A 1 49 ? -9.040  -5.319  7.890   1.00 0.00 ? 49 ARG A CZ   5  
ATOM 6200  N NH1  . ARG A 1 49 ? -8.722  -5.390  9.177   1.00 0.00 ? 49 ARG A NH1  5  
ATOM 6201  N NH2  . ARG A 1 49 ? -9.384  -6.420  7.237   1.00 0.00 ? 49 ARG A NH2  5  
ATOM 6202  H H    . ARG A 1 49 ? -4.792  -0.710  5.668   1.00 0.00 ? 49 ARG A H    5  
ATOM 6203  H HA   . ARG A 1 49 ? -4.777  -1.505  8.397   1.00 0.00 ? 49 ARG A HA   5  
ATOM 6204  H HB2  . ARG A 1 49 ? -6.848  -1.059  7.040   1.00 0.00 ? 49 ARG A HB2  5  
ATOM 6205  H HB3  . ARG A 1 49 ? -6.537  -2.563  6.184   1.00 0.00 ? 49 ARG A HB3  5  
ATOM 6206  H HG2  . ARG A 1 49 ? -6.766  -3.814  8.254   1.00 0.00 ? 49 ARG A HG2  5  
ATOM 6207  H HG3  . ARG A 1 49 ? -7.024  -2.312  9.145   1.00 0.00 ? 49 ARG A HG3  5  
ATOM 6208  H HD2  . ARG A 1 49 ? -9.200  -2.787  8.815   1.00 0.00 ? 49 ARG A HD2  5  
ATOM 6209  H HD3  . ARG A 1 49 ? -8.909  -2.072  7.230   1.00 0.00 ? 49 ARG A HD3  5  
ATOM 6210  H HE   . ARG A 1 49 ? -9.254  -4.125  6.305   1.00 0.00 ? 49 ARG A HE   5  
ATOM 6211  H HH11 . ARG A 1 49 ? -8.462  -4.564  9.675   1.00 0.00 ? 49 ARG A HH11 5  
ATOM 6212  H HH12 . ARG A 1 49 ? -8.743  -6.272  9.648   1.00 0.00 ? 49 ARG A HH12 5  
ATOM 6213  H HH21 . ARG A 1 49 ? -9.625  -6.372  6.267   1.00 0.00 ? 49 ARG A HH21 5  
ATOM 6214  H HH22 . ARG A 1 49 ? -9.403  -7.299  7.713   1.00 0.00 ? 49 ARG A HH22 5  
ATOM 6215  N N    . TYR A 1 50 ? -3.714  -3.557  6.133   1.00 0.00 ? 50 TYR A N    5  
ATOM 6216  C CA   . TYR A 1 50 ? -3.012  -4.809  5.905   1.00 0.00 ? 50 TYR A CA   5  
ATOM 6217  C C    . TYR A 1 50 ? -1.698  -4.823  6.658   1.00 0.00 ? 50 TYR A C    5  
ATOM 6218  O O    . TYR A 1 50 ? -1.419  -5.732  7.440   1.00 0.00 ? 50 TYR A O    5  
ATOM 6219  C CB   . TYR A 1 50 ? -2.755  -5.013  4.422   1.00 0.00 ? 50 TYR A CB   5  
ATOM 6220  C CG   . TYR A 1 50 ? -2.542  -6.459  4.035   1.00 0.00 ? 50 TYR A CG   5  
ATOM 6221  C CD1  . TYR A 1 50 ? -1.294  -7.052  4.168   1.00 0.00 ? 50 TYR A CD1  5  
ATOM 6222  C CD2  . TYR A 1 50 ? -3.585  -7.229  3.537   1.00 0.00 ? 50 TYR A CD2  5  
ATOM 6223  C CE1  . TYR A 1 50 ? -1.089  -8.372  3.817   1.00 0.00 ? 50 TYR A CE1  5  
ATOM 6224  C CE2  . TYR A 1 50 ? -3.389  -8.551  3.183   1.00 0.00 ? 50 TYR A CE2  5  
ATOM 6225  C CZ   . TYR A 1 50 ? -2.140  -9.117  3.325   1.00 0.00 ? 50 TYR A CZ   5  
ATOM 6226  O OH   . TYR A 1 50 ? -1.941  -10.432 2.974   1.00 0.00 ? 50 TYR A OH   5  
ATOM 6227  H H    . TYR A 1 50 ? -3.802  -2.919  5.395   1.00 0.00 ? 50 TYR A H    5  
ATOM 6228  H HA   . TYR A 1 50 ? -3.620  -5.600  6.264   1.00 0.00 ? 50 TYR A HA   5  
ATOM 6229  H HB2  . TYR A 1 50 ? -3.593  -4.634  3.860   1.00 0.00 ? 50 TYR A HB2  5  
ATOM 6230  H HB3  . TYR A 1 50 ? -1.874  -4.468  4.155   1.00 0.00 ? 50 TYR A HB3  5  
ATOM 6231  H HD1  . TYR A 1 50 ? -0.473  -6.466  4.555   1.00 0.00 ? 50 TYR A HD1  5  
ATOM 6232  H HD2  . TYR A 1 50 ? -4.562  -6.782  3.427   1.00 0.00 ? 50 TYR A HD2  5  
ATOM 6233  H HE1  . TYR A 1 50 ? -0.110  -8.813  3.929   1.00 0.00 ? 50 TYR A HE1  5  
ATOM 6234  H HE2  . TYR A 1 50 ? -4.213  -9.134  2.797   1.00 0.00 ? 50 TYR A HE2  5  
ATOM 6235  H HH   . TYR A 1 50 ? -1.947  -10.513 2.017   1.00 0.00 ? 50 TYR A HH   5  
ATOM 6236  N N    . ILE A 1 51 ? -0.903  -3.798  6.421   1.00 0.00 ? 51 ILE A N    5  
ATOM 6237  C CA   . ILE A 1 51 ? 0.385   -3.666  7.077   1.00 0.00 ? 51 ILE A CA   5  
ATOM 6238  C C    . ILE A 1 51 ? 0.201   -3.496  8.576   1.00 0.00 ? 51 ILE A C    5  
ATOM 6239  O O    . ILE A 1 51 ? 1.030   -3.935  9.373   1.00 0.00 ? 51 ILE A O    5  
ATOM 6240  C CB   . ILE A 1 51 ? 1.203   -2.479  6.524   1.00 0.00 ? 51 ILE A CB   5  
ATOM 6241  C CG1  . ILE A 1 51 ? 0.294   -1.401  5.926   1.00 0.00 ? 51 ILE A CG1  5  
ATOM 6242  C CG2  . ILE A 1 51 ? 2.204   -2.967  5.487   1.00 0.00 ? 51 ILE A CG2  5  
ATOM 6243  C CD1  . ILE A 1 51 ? 0.938   -0.033  5.866   1.00 0.00 ? 51 ILE A CD1  5  
ATOM 6244  H H    . ILE A 1 51 ? -1.195  -3.110  5.794   1.00 0.00 ? 51 ILE A H    5  
ATOM 6245  H HA   . ILE A 1 51 ? 0.938   -4.572  6.898   1.00 0.00 ? 51 ILE A HA   5  
ATOM 6246  H HB   . ILE A 1 51 ? 1.752   -2.053  7.342   1.00 0.00 ? 51 ILE A HB   5  
ATOM 6247  H HG12 . ILE A 1 51 ? 0.024   -1.684  4.919   1.00 0.00 ? 51 ILE A HG12 5  
ATOM 6248  H HG13 . ILE A 1 51 ? -0.601  -1.322  6.525   1.00 0.00 ? 51 ILE A HG13 5  
ATOM 6249  H HG21 . ILE A 1 51 ? 2.275   -2.245  4.687   1.00 0.00 ? 51 ILE A HG21 5  
ATOM 6250  H HG22 . ILE A 1 51 ? 1.875   -3.916  5.089   1.00 0.00 ? 51 ILE A HG22 5  
ATOM 6251  H HG23 . ILE A 1 51 ? 3.172   -3.087  5.950   1.00 0.00 ? 51 ILE A HG23 5  
ATOM 6252  H HD11 . ILE A 1 51 ? 0.922   0.328   4.848   1.00 0.00 ? 51 ILE A HD11 5  
ATOM 6253  H HD12 . ILE A 1 51 ? 1.960   -0.101  6.208   1.00 0.00 ? 51 ILE A HD12 5  
ATOM 6254  H HD13 . ILE A 1 51 ? 0.391   0.650   6.499   1.00 0.00 ? 51 ILE A HD13 5  
ATOM 6255  N N    . LYS A 1 52 ? -0.899  -2.860  8.949   1.00 0.00 ? 52 LYS A N    5  
ATOM 6256  C CA   . LYS A 1 52 ? -1.215  -2.630  10.349  1.00 0.00 ? 52 LYS A CA   5  
ATOM 6257  C C    . LYS A 1 52 ? -1.646  -3.926  11.026  1.00 0.00 ? 52 LYS A C    5  
ATOM 6258  O O    . LYS A 1 52 ? -1.490  -4.089  12.236  1.00 0.00 ? 52 LYS A O    5  
ATOM 6259  C CB   . LYS A 1 52 ? -2.319  -1.579  10.480  1.00 0.00 ? 52 LYS A CB   5  
ATOM 6260  C CG   . LYS A 1 52 ? -1.800  -0.150  10.494  1.00 0.00 ? 52 LYS A CG   5  
ATOM 6261  C CD   . LYS A 1 52 ? -1.740  0.407   11.907  1.00 0.00 ? 52 LYS A CD   5  
ATOM 6262  C CE   . LYS A 1 52 ? -2.091  1.886   11.938  1.00 0.00 ? 52 LYS A CE   5  
ATOM 6263  N NZ   . LYS A 1 52 ? -2.030  2.443   13.317  1.00 0.00 ? 52 LYS A NZ   5  
ATOM 6264  H H    . LYS A 1 52 ? -1.516  -2.542  8.263   1.00 0.00 ? 52 LYS A H    5  
ATOM 6265  H HA   . LYS A 1 52 ? -0.326  -2.268  10.829  1.00 0.00 ? 52 LYS A HA   5  
ATOM 6266  H HB2  . LYS A 1 52 ? -3.000  -1.683  9.648   1.00 0.00 ? 52 LYS A HB2  5  
ATOM 6267  H HB3  . LYS A 1 52 ? -2.858  -1.753  11.400  1.00 0.00 ? 52 LYS A HB3  5  
ATOM 6268  H HG2  . LYS A 1 52 ? -0.807  -0.134  10.070  1.00 0.00 ? 52 LYS A HG2  5  
ATOM 6269  H HG3  . LYS A 1 52 ? -2.457  0.467   9.900   1.00 0.00 ? 52 LYS A HG3  5  
ATOM 6270  H HD2  . LYS A 1 52 ? -2.442  -0.131  12.526  1.00 0.00 ? 52 LYS A HD2  5  
ATOM 6271  H HD3  . LYS A 1 52 ? -0.741  0.275   12.294  1.00 0.00 ? 52 LYS A HD3  5  
ATOM 6272  H HE2  . LYS A 1 52 ? -1.393  2.421   11.312  1.00 0.00 ? 52 LYS A HE2  5  
ATOM 6273  H HE3  . LYS A 1 52 ? -3.091  2.013   11.551  1.00 0.00 ? 52 LYS A HE3  5  
ATOM 6274  H HZ1  . LYS A 1 52 ? -1.694  3.427   13.291  1.00 0.00 ? 52 LYS A HZ1  5  
ATOM 6275  H HZ2  . LYS A 1 52 ? -1.378  1.882   13.901  1.00 0.00 ? 52 LYS A HZ2  5  
ATOM 6276  H HZ3  . LYS A 1 52 ? -2.974  2.421   13.754  1.00 0.00 ? 52 LYS A HZ3  5  
ATOM 6277  N N    . LEU A 1 53 ? -2.192  -4.843  10.236  1.00 0.00 ? 53 LEU A N    5  
ATOM 6278  C CA   . LEU A 1 53 ? -2.650  -6.123  10.753  1.00 0.00 ? 53 LEU A CA   5  
ATOM 6279  C C    . LEU A 1 53 ? -1.516  -7.141  10.789  1.00 0.00 ? 53 LEU A C    5  
ATOM 6280  O O    . LEU A 1 53 ? -1.516  -8.058  11.610  1.00 0.00 ? 53 LEU A O    5  
ATOM 6281  C CB   . LEU A 1 53 ? -3.805  -6.657  9.904   1.00 0.00 ? 53 LEU A CB   5  
ATOM 6282  C CG   . LEU A 1 53 ? -4.723  -7.653  10.614  1.00 0.00 ? 53 LEU A CG   5  
ATOM 6283  C CD1  . LEU A 1 53 ? -6.128  -7.589  10.035  1.00 0.00 ? 53 LEU A CD1  5  
ATOM 6284  C CD2  . LEU A 1 53 ? -4.164  -9.064  10.503  1.00 0.00 ? 53 LEU A CD2  5  
ATOM 6285  H H    . LEU A 1 53 ? -2.292  -4.653  9.285   1.00 0.00 ? 53 LEU A H    5  
ATOM 6286  H HA   . LEU A 1 53 ? -2.998  -5.959  11.752  1.00 0.00 ? 53 LEU A HA   5  
ATOM 6287  H HB2  . LEU A 1 53 ? -4.402  -5.817  9.578   1.00 0.00 ? 53 LEU A HB2  5  
ATOM 6288  H HB3  . LEU A 1 53 ? -3.390  -7.141  9.033   1.00 0.00 ? 53 LEU A HB3  5  
ATOM 6289  H HG   . LEU A 1 53 ? -4.781  -7.396  11.661  1.00 0.00 ? 53 LEU A HG   5  
ATOM 6290  H HD11 . LEU A 1 53 ? -6.727  -6.908  10.621  1.00 0.00 ? 53 LEU A HD11 5  
ATOM 6291  H HD12 . LEU A 1 53 ? -6.573  -8.572  10.059  1.00 0.00 ? 53 LEU A HD12 5  
ATOM 6292  H HD13 . LEU A 1 53 ? -6.081  -7.239  9.014   1.00 0.00 ? 53 LEU A HD13 5  
ATOM 6293  H HD21 . LEU A 1 53 ? -3.099  -9.016  10.325  1.00 0.00 ? 53 LEU A HD21 5  
ATOM 6294  H HD22 . LEU A 1 53 ? -4.643  -9.578  9.684   1.00 0.00 ? 53 LEU A HD22 5  
ATOM 6295  H HD23 . LEU A 1 53 ? -4.351  -9.598  11.423  1.00 0.00 ? 53 LEU A HD23 5  
ATOM 6296  N N    . ARG A 1 54 ? -0.555  -6.975  9.890   1.00 0.00 ? 54 ARG A N    5  
ATOM 6297  C CA   . ARG A 1 54 ? 0.584   -7.879  9.811   1.00 0.00 ? 54 ARG A CA   5  
ATOM 6298  C C    . ARG A 1 54 ? 1.552   -7.644  10.961  1.00 0.00 ? 54 ARG A C    5  
ATOM 6299  O O    . ARG A 1 54 ? 1.829   -8.544  11.754  1.00 0.00 ? 54 ARG A O    5  
ATOM 6300  C CB   . ARG A 1 54 ? 1.306   -7.707  8.472   1.00 0.00 ? 54 ARG A CB   5  
ATOM 6301  C CG   . ARG A 1 54 ? 0.964   -8.782  7.454   1.00 0.00 ? 54 ARG A CG   5  
ATOM 6302  C CD   . ARG A 1 54 ? 1.878   -9.988  7.590   1.00 0.00 ? 54 ARG A CD   5  
ATOM 6303  N NE   . ARG A 1 54 ? 2.205   -10.576 6.293   1.00 0.00 ? 54 ARG A NE   5  
ATOM 6304  C CZ   . ARG A 1 54 ? 2.724   -11.793 6.140   1.00 0.00 ? 54 ARG A CZ   5  
ATOM 6305  N NH1  . ARG A 1 54 ? 2.975   -12.553 7.199   1.00 0.00 ? 54 ARG A NH1  5  
ATOM 6306  N NH2  . ARG A 1 54 ? 2.991   -12.251 4.925   1.00 0.00 ? 54 ARG A NH2  5  
ATOM 6307  H H    . ARG A 1 54 ? -0.617  -6.230  9.264   1.00 0.00 ? 54 ARG A H    5  
ATOM 6308  H HA   . ARG A 1 54 ? 0.210   -8.877  9.878   1.00 0.00 ? 54 ARG A HA   5  
ATOM 6309  H HB2  . ARG A 1 54 ? 1.039   -6.747  8.054   1.00 0.00 ? 54 ARG A HB2  5  
ATOM 6310  H HB3  . ARG A 1 54 ? 2.372   -7.731  8.644   1.00 0.00 ? 54 ARG A HB3  5  
ATOM 6311  H HG2  . ARG A 1 54 ? -0.057  -9.098  7.608   1.00 0.00 ? 54 ARG A HG2  5  
ATOM 6312  H HG3  . ARG A 1 54 ? 1.069   -8.370  6.461   1.00 0.00 ? 54 ARG A HG3  5  
ATOM 6313  H HD2  . ARG A 1 54 ? 2.792   -9.678  8.074   1.00 0.00 ? 54 ARG A HD2  5  
ATOM 6314  H HD3  . ARG A 1 54 ? 1.384   -10.732 8.198   1.00 0.00 ? 54 ARG A HD3  5  
ATOM 6315  H HE   . ARG A 1 54 ? 2.030   -10.036 5.494   1.00 0.00 ? 54 ARG A HE   5  
ATOM 6316  H HH11 . ARG A 1 54 ? 2.775   -12.213 8.118   1.00 0.00 ? 54 ARG A HH11 5  
ATOM 6317  H HH12 . ARG A 1 54 ? 3.364   -13.466 7.077   1.00 0.00 ? 54 ARG A HH12 5  
ATOM 6318  H HH21 . ARG A 1 54 ? 2.804   -11.682 4.124   1.00 0.00 ? 54 ARG A HH21 5  
ATOM 6319  H HH22 . ARG A 1 54 ? 3.381   -13.164 4.809   1.00 0.00 ? 54 ARG A HH22 5  
ATOM 6320  N N    . THR A 1 55 ? 2.061   -6.429  11.036  1.00 0.00 ? 55 THR A N    5  
ATOM 6321  C CA   . THR A 1 55 ? 3.004   -6.052  12.079  1.00 0.00 ? 55 THR A CA   5  
ATOM 6322  C C    . THR A 1 55 ? 2.283   -5.732  13.385  1.00 0.00 ? 55 THR A C    5  
ATOM 6323  O O    . THR A 1 55 ? 2.873   -5.800  14.463  1.00 0.00 ? 55 THR A O    5  
ATOM 6324  C CB   . THR A 1 55 ? 3.839   -4.851  11.631  1.00 0.00 ? 55 THR A CB   5  
ATOM 6325  O OG1  . THR A 1 55 ? 3.193   -4.152  10.582  1.00 0.00 ? 55 THR A OG1  5  
ATOM 6326  C CG2  . THR A 1 55 ? 5.221   -5.231  11.145  1.00 0.00 ? 55 THR A CG2  5  
ATOM 6327  H H    . THR A 1 55 ? 1.798   -5.771  10.371  1.00 0.00 ? 55 THR A H    5  
ATOM 6328  H HA   . THR A 1 55 ? 3.656   -6.889  12.240  1.00 0.00 ? 55 THR A HA   5  
ATOM 6329  H HB   . THR A 1 55 ? 3.957   -4.175  12.466  1.00 0.00 ? 55 THR A HB   5  
ATOM 6330  H HG1  . THR A 1 55 ? 3.650   -3.324  10.418  1.00 0.00 ? 55 THR A HG1  5  
ATOM 6331  H HG21 . THR A 1 55 ? 5.844   -5.481  11.991  1.00 0.00 ? 55 THR A HG21 5  
ATOM 6332  H HG22 . THR A 1 55 ? 5.656   -4.399  10.610  1.00 0.00 ? 55 THR A HG22 5  
ATOM 6333  H HG23 . THR A 1 55 ? 5.149   -6.084  10.486  1.00 0.00 ? 55 THR A HG23 5  
ATOM 6334  N N    . GLY A 1 56 ? 1.007   -5.382  13.279  1.00 0.00 ? 56 GLY A N    5  
ATOM 6335  C CA   . GLY A 1 56 ? 0.226   -5.056  14.455  1.00 0.00 ? 56 GLY A CA   5  
ATOM 6336  C C    . GLY A 1 56 ? 0.626   -3.732  15.083  1.00 0.00 ? 56 GLY A C    5  
ATOM 6337  O O    . GLY A 1 56 ? 0.151   -3.386  16.165  1.00 0.00 ? 56 GLY A O    5  
ATOM 6338  H H    . GLY A 1 56 ? 0.592   -5.346  12.396  1.00 0.00 ? 56 GLY A H    5  
ATOM 6339  H HA2  . GLY A 1 56 ? -0.816  -5.007  14.177  1.00 0.00 ? 56 GLY A HA2  5  
ATOM 6340  H HA3  . GLY A 1 56 ? 0.356   -5.840  15.182  1.00 0.00 ? 56 GLY A HA3  5  
ATOM 6341  N N    . LYS A 1 57 ? 1.500   -2.988  14.409  1.00 0.00 ? 57 LYS A N    5  
ATOM 6342  C CA   . LYS A 1 57 ? 1.955   -1.703  14.912  1.00 0.00 ? 57 LYS A CA   5  
ATOM 6343  C C    . LYS A 1 57 ? 2.704   -0.928  13.831  1.00 0.00 ? 57 LYS A C    5  
ATOM 6344  O O    . LYS A 1 57 ? 3.927   -1.012  13.726  1.00 0.00 ? 57 LYS A O    5  
ATOM 6345  C CB   . LYS A 1 57 ? 2.850   -1.902  16.128  1.00 0.00 ? 57 LYS A CB   5  
ATOM 6346  C CG   . LYS A 1 57 ? 2.511   -0.986  17.293  1.00 0.00 ? 57 LYS A CG   5  
ATOM 6347  C CD   . LYS A 1 57 ? 3.383   0.259   17.294  1.00 0.00 ? 57 LYS A CD   5  
ATOM 6348  C CE   . LYS A 1 57 ? 3.082   1.148   18.489  1.00 0.00 ? 57 LYS A CE   5  
ATOM 6349  N NZ   . LYS A 1 57 ? 3.429   2.572   18.224  1.00 0.00 ? 57 LYS A NZ   5  
ATOM 6350  H H    . LYS A 1 57 ? 1.846   -3.310  13.555  1.00 0.00 ? 57 LYS A H    5  
ATOM 6351  H HA   . LYS A 1 57 ? 1.092   -1.138  15.207  1.00 0.00 ? 57 LYS A HA   5  
ATOM 6352  H HB2  . LYS A 1 57 ? 2.763   -2.925  16.463  1.00 0.00 ? 57 LYS A HB2  5  
ATOM 6353  H HB3  . LYS A 1 57 ? 3.865   -1.715  15.835  1.00 0.00 ? 57 LYS A HB3  5  
ATOM 6354  H HG2  . LYS A 1 57 ? 1.476   -0.688  17.214  1.00 0.00 ? 57 LYS A HG2  5  
ATOM 6355  H HG3  . LYS A 1 57 ? 2.664   -1.524  18.217  1.00 0.00 ? 57 LYS A HG3  5  
ATOM 6356  H HD2  . LYS A 1 57 ? 4.420   -0.040  17.333  1.00 0.00 ? 57 LYS A HD2  5  
ATOM 6357  H HD3  . LYS A 1 57 ? 3.200   0.816   16.387  1.00 0.00 ? 57 LYS A HD3  5  
ATOM 6358  H HE2  . LYS A 1 57 ? 2.028   1.081   18.716  1.00 0.00 ? 57 LYS A HE2  5  
ATOM 6359  H HE3  . LYS A 1 57 ? 3.654   0.798   19.336  1.00 0.00 ? 57 LYS A HE3  5  
ATOM 6360  H HZ1  . LYS A 1 57 ? 3.664   3.054   19.115  1.00 0.00 ? 57 LYS A HZ1  5  
ATOM 6361  H HZ2  . LYS A 1 57 ? 2.625   3.059   17.780  1.00 0.00 ? 57 LYS A HZ2  5  
ATOM 6362  H HZ3  . LYS A 1 57 ? 4.249   2.627   17.586  1.00 0.00 ? 57 LYS A HZ3  5  
ATOM 6363  N N    . THR A 1 58 ? 1.959   -0.170  13.032  1.00 0.00 ? 58 THR A N    5  
ATOM 6364  C CA   . THR A 1 58 ? 2.546   0.623   11.965  1.00 0.00 ? 58 THR A CA   5  
ATOM 6365  C C    . THR A 1 58 ? 1.739   1.893   11.720  1.00 0.00 ? 58 THR A C    5  
ATOM 6366  O O    . THR A 1 58 ? 0.633   2.049   12.238  1.00 0.00 ? 58 THR A O    5  
ATOM 6367  C CB   . THR A 1 58 ? 2.644   -0.192  10.678  1.00 0.00 ? 58 THR A CB   5  
ATOM 6368  O OG1  . THR A 1 58 ? 2.397   -1.564  10.926  1.00 0.00 ? 58 THR A OG1  5  
ATOM 6369  C CG2  . THR A 1 58 ? 3.994   -0.081  10.001  1.00 0.00 ? 58 THR A CG2  5  
ATOM 6370  H H    . THR A 1 58 ? 0.995   -0.141  13.167  1.00 0.00 ? 58 THR A H    5  
ATOM 6371  H HA   . THR A 1 58 ? 3.532   0.899   12.272  1.00 0.00 ? 58 THR A HA   5  
ATOM 6372  H HB   . THR A 1 58 ? 1.902   0.168   9.988   1.00 0.00 ? 58 THR A HB   5  
ATOM 6373  H HG1  . THR A 1 58 ? 1.515   -1.671  11.288  1.00 0.00 ? 58 THR A HG1  5  
ATOM 6374  H HG21 . THR A 1 58 ? 4.190   -0.982  9.439   1.00 0.00 ? 58 THR A HG21 5  
ATOM 6375  H HG22 . THR A 1 58 ? 4.762   0.050   10.749  1.00 0.00 ? 58 THR A HG22 5  
ATOM 6376  H HG23 . THR A 1 58 ? 3.993   0.768   9.333   1.00 0.00 ? 58 THR A HG23 5  
ATOM 6377  N N    . ARG A 1 59 ? 2.293   2.790   10.912  1.00 0.00 ? 59 ARG A N    5  
ATOM 6378  C CA   . ARG A 1 59 ? 1.628   4.034   10.578  1.00 0.00 ? 59 ARG A CA   5  
ATOM 6379  C C    . ARG A 1 59 ? 2.149   4.560   9.248   1.00 0.00 ? 59 ARG A C    5  
ATOM 6380  O O    . ARG A 1 59 ? 2.806   5.599   9.187   1.00 0.00 ? 59 ARG A O    5  
ATOM 6381  C CB   . ARG A 1 59 ? 1.845   5.073   11.680  1.00 0.00 ? 59 ARG A CB   5  
ATOM 6382  C CG   . ARG A 1 59 ? 3.307   5.291   12.031  1.00 0.00 ? 59 ARG A CG   5  
ATOM 6383  C CD   . ARG A 1 59 ? 3.561   6.716   12.498  1.00 0.00 ? 59 ARG A CD   5  
ATOM 6384  N NE   . ARG A 1 59 ? 4.858   7.217   12.048  1.00 0.00 ? 59 ARG A NE   5  
ATOM 6385  C CZ   . ARG A 1 59 ? 6.022   6.823   12.558  1.00 0.00 ? 59 ARG A CZ   5  
ATOM 6386  N NH1  . ARG A 1 59 ? 6.058   5.924   13.534  1.00 0.00 ? 59 ARG A NH1  5  
ATOM 6387  N NH2  . ARG A 1 59 ? 7.155   7.329   12.091  1.00 0.00 ? 59 ARG A NH2  5  
ATOM 6388  H H    . ARG A 1 59 ? 3.161   2.601   10.513  1.00 0.00 ? 59 ARG A H    5  
ATOM 6389  H HA   . ARG A 1 59 ? 0.576   3.829   10.484  1.00 0.00 ? 59 ARG A HA   5  
ATOM 6390  H HB2  . ARG A 1 59 ? 1.429   6.016   11.357  1.00 0.00 ? 59 ARG A HB2  5  
ATOM 6391  H HB3  . ARG A 1 59 ? 1.328   4.748   12.571  1.00 0.00 ? 59 ARG A HB3  5  
ATOM 6392  H HG2  . ARG A 1 59 ? 3.584   4.610   12.821  1.00 0.00 ? 59 ARG A HG2  5  
ATOM 6393  H HG3  . ARG A 1 59 ? 3.910   5.096   11.157  1.00 0.00 ? 59 ARG A HG3  5  
ATOM 6394  H HD2  . ARG A 1 59 ? 2.784   7.354   12.105  1.00 0.00 ? 59 ARG A HD2  5  
ATOM 6395  H HD3  . ARG A 1 59 ? 3.532   6.737   13.578  1.00 0.00 ? 59 ARG A HD3  5  
ATOM 6396  H HE   . ARG A 1 59 ? 4.861   7.882   11.329  1.00 0.00 ? 59 ARG A HE   5  
ATOM 6397  H HH11 . ARG A 1 59 ? 5.207   5.538   13.891  1.00 0.00 ? 59 ARG A HH11 5  
ATOM 6398  H HH12 . ARG A 1 59 ? 6.936   5.632   13.913  1.00 0.00 ? 59 ARG A HH12 5  
ATOM 6399  H HH21 . ARG A 1 59 ? 7.135   8.007   11.356  1.00 0.00 ? 59 ARG A HH21 5  
ATOM 6400  H HH22 . ARG A 1 59 ? 8.031   7.034   12.474  1.00 0.00 ? 59 ARG A HH22 5  
ATOM 6401  N N    . THR A 1 60 ? 1.849   3.827   8.186   1.00 0.00 ? 60 THR A N    5  
ATOM 6402  C CA   . THR A 1 60 ? 2.278   4.200   6.852   1.00 0.00 ? 60 THR A CA   5  
ATOM 6403  C C    . THR A 1 60 ? 1.170   3.953   5.830   1.00 0.00 ? 60 THR A C    5  
ATOM 6404  O O    . THR A 1 60 ? 1.006   2.838   5.336   1.00 0.00 ? 60 THR A O    5  
ATOM 6405  C CB   . THR A 1 60 ? 3.536   3.424   6.461   1.00 0.00 ? 60 THR A CB   5  
ATOM 6406  O OG1  . THR A 1 60 ? 3.883   2.484   7.463   1.00 0.00 ? 60 THR A OG1  5  
ATOM 6407  C CG2  . THR A 1 60 ? 4.739   4.313   6.229   1.00 0.00 ? 60 THR A CG2  5  
ATOM 6408  H H    . THR A 1 60 ? 1.333   3.013   8.307   1.00 0.00 ? 60 THR A H    5  
ATOM 6409  H HA   . THR A 1 60 ? 2.506   5.246   6.868   1.00 0.00 ? 60 THR A HA   5  
ATOM 6410  H HB   . THR A 1 60 ? 3.343   2.887   5.546   1.00 0.00 ? 60 THR A HB   5  
ATOM 6411  H HG1  . THR A 1 60 ? 4.126   1.651   7.051   1.00 0.00 ? 60 THR A HG1  5  
ATOM 6412  H HG21 . THR A 1 60 ? 5.269   4.450   7.160   1.00 0.00 ? 60 THR A HG21 5  
ATOM 6413  H HG22 . THR A 1 60 ? 4.412   5.272   5.856   1.00 0.00 ? 60 THR A HG22 5  
ATOM 6414  H HG23 . THR A 1 60 ? 5.395   3.850   5.506   1.00 0.00 ? 60 THR A HG23 5  
ATOM 6415  N N    . ARG A 1 61 ? 0.414   5.002   5.516   1.00 0.00 ? 61 ARG A N    5  
ATOM 6416  C CA   . ARG A 1 61 ? -0.670  4.900   4.555   1.00 0.00 ? 61 ARG A CA   5  
ATOM 6417  C C    . ARG A 1 61 ? -0.333  5.649   3.278   1.00 0.00 ? 61 ARG A C    5  
ATOM 6418  O O    . ARG A 1 61 ? -0.420  5.103   2.178   1.00 0.00 ? 61 ARG A O    5  
ATOM 6419  C CB   . ARG A 1 61 ? -1.971  5.440   5.154   1.00 0.00 ? 61 ARG A CB   5  
ATOM 6420  C CG   . ARG A 1 61 ? -2.228  4.966   6.577   1.00 0.00 ? 61 ARG A CG   5  
ATOM 6421  C CD   . ARG A 1 61 ? -2.461  6.134   7.522   1.00 0.00 ? 61 ARG A CD   5  
ATOM 6422  N NE   . ARG A 1 61 ? -2.956  5.693   8.824   1.00 0.00 ? 61 ARG A NE   5  
ATOM 6423  C CZ   . ARG A 1 61 ? -4.173  5.193   9.024   1.00 0.00 ? 61 ARG A CZ   5  
ATOM 6424  N NH1  . ARG A 1 61 ? -5.022  5.068   8.011   1.00 0.00 ? 61 ARG A NH1  5  
ATOM 6425  N NH2  . ARG A 1 61 ? -4.544  4.817   10.241  1.00 0.00 ? 61 ARG A NH2  5  
ATOM 6426  H H    . ARG A 1 61 ? 0.592   5.860   5.936   1.00 0.00 ? 61 ARG A H    5  
ATOM 6427  H HA   . ARG A 1 61 ? -0.794  3.869   4.321   1.00 0.00 ? 61 ARG A HA   5  
ATOM 6428  H HB2  . ARG A 1 61 ? -1.931  6.519   5.157   1.00 0.00 ? 61 ARG A HB2  5  
ATOM 6429  H HB3  . ARG A 1 61 ? -2.797  5.121   4.537   1.00 0.00 ? 61 ARG A HB3  5  
ATOM 6430  H HG2  . ARG A 1 61 ? -3.102  4.333   6.582   1.00 0.00 ? 61 ARG A HG2  5  
ATOM 6431  H HG3  . ARG A 1 61 ? -1.372  4.403   6.918   1.00 0.00 ? 61 ARG A HG3  5  
ATOM 6432  H HD2  . ARG A 1 61 ? -1.528  6.659   7.662   1.00 0.00 ? 61 ARG A HD2  5  
ATOM 6433  H HD3  . ARG A 1 61 ? -3.186  6.801   7.079   1.00 0.00 ? 61 ARG A HD3  5  
ATOM 6434  H HE   . ARG A 1 61 ? -2.350  5.775   9.590   1.00 0.00 ? 61 ARG A HE   5  
ATOM 6435  H HH11 . ARG A 1 61 ? -4.749  5.350   7.091   1.00 0.00 ? 61 ARG A HH11 5  
ATOM 6436  H HH12 . ARG A 1 61 ? -5.935  4.692   8.168   1.00 0.00 ? 61 ARG A HH12 5  
ATOM 6437  H HH21 . ARG A 1 61 ? -3.908  4.908   11.007  1.00 0.00 ? 61 ARG A HH21 5  
ATOM 6438  H HH22 . ARG A 1 61 ? -5.458  4.441   10.391  1.00 0.00 ? 61 ARG A HH22 5  
ATOM 6439  N N    . LYS A 1 62 ? 0.061   6.898   3.438   1.00 0.00 ? 62 LYS A N    5  
ATOM 6440  C CA   . LYS A 1 62 ? 0.426   7.737   2.306   1.00 0.00 ? 62 LYS A CA   5  
ATOM 6441  C C    . LYS A 1 62 ? 1.618   7.147   1.566   1.00 0.00 ? 62 LYS A C    5  
ATOM 6442  O O    . LYS A 1 62 ? 1.767   7.328   0.358   1.00 0.00 ? 62 LYS A O    5  
ATOM 6443  C CB   . LYS A 1 62 ? 0.741   9.155   2.774   1.00 0.00 ? 62 LYS A CB   5  
ATOM 6444  C CG   . LYS A 1 62 ? -0.117  10.220  2.110   1.00 0.00 ? 62 LYS A CG   5  
ATOM 6445  C CD   . LYS A 1 62 ? 0.153   10.303  0.617   1.00 0.00 ? 62 LYS A CD   5  
ATOM 6446  C CE   . LYS A 1 62 ? 1.210   11.349  0.300   1.00 0.00 ? 62 LYS A CE   5  
ATOM 6447  N NZ   . LYS A 1 62 ? 2.557   10.741  0.120   1.00 0.00 ? 62 LYS A NZ   5  
ATOM 6448  H H    . LYS A 1 62 ? 0.112   7.262   4.343   1.00 0.00 ? 62 LYS A H    5  
ATOM 6449  H HA   . LYS A 1 62 ? -0.410  7.768   1.636   1.00 0.00 ? 62 LYS A HA   5  
ATOM 6450  H HB2  . LYS A 1 62 ? 0.587   9.212   3.840   1.00 0.00 ? 62 LYS A HB2  5  
ATOM 6451  H HB3  . LYS A 1 62 ? 1.773   9.369   2.556   1.00 0.00 ? 62 LYS A HB3  5  
ATOM 6452  H HG2  . LYS A 1 62 ? -1.158  9.977   2.264   1.00 0.00 ? 62 LYS A HG2  5  
ATOM 6453  H HG3  . LYS A 1 62 ? 0.101   11.177  2.561   1.00 0.00 ? 62 LYS A HG3  5  
ATOM 6454  H HD2  . LYS A 1 62 ? 0.498   9.341   0.269   1.00 0.00 ? 62 LYS A HD2  5  
ATOM 6455  H HD3  . LYS A 1 62 ? -0.764  10.564  0.109   1.00 0.00 ? 62 LYS A HD3  5  
ATOM 6456  H HE2  . LYS A 1 62 ? 0.931   11.859  -0.610  1.00 0.00 ? 62 LYS A HE2  5  
ATOM 6457  H HE3  . LYS A 1 62 ? 1.250   12.059  1.112   1.00 0.00 ? 62 LYS A HE3  5  
ATOM 6458  H HZ1  . LYS A 1 62 ? 3.092   11.264  -0.602  1.00 0.00 ? 62 LYS A HZ1  5  
ATOM 6459  H HZ2  . LYS A 1 62 ? 2.465   9.750   -0.184  1.00 0.00 ? 62 LYS A HZ2  5  
ATOM 6460  H HZ3  . LYS A 1 62 ? 3.084   10.769  1.016   1.00 0.00 ? 62 LYS A HZ3  5  
ATOM 6461  N N    . GLN A 1 63 ? 2.457   6.431   2.302   1.00 0.00 ? 63 GLN A N    5  
ATOM 6462  C CA   . GLN A 1 63 ? 3.631   5.801   1.722   1.00 0.00 ? 63 GLN A CA   5  
ATOM 6463  C C    . GLN A 1 63 ? 3.229   4.616   0.852   1.00 0.00 ? 63 GLN A C    5  
ATOM 6464  O O    . GLN A 1 63 ? 3.951   4.236   -0.071  1.00 0.00 ? 63 GLN A O    5  
ATOM 6465  C CB   . GLN A 1 63 ? 4.594   5.353   2.819   1.00 0.00 ? 63 GLN A CB   5  
ATOM 6466  C CG   . GLN A 1 63 ? 5.923   6.089   2.800   1.00 0.00 ? 63 GLN A CG   5  
ATOM 6467  C CD   . GLN A 1 63 ? 5.912   7.337   3.661   1.00 0.00 ? 63 GLN A CD   5  
ATOM 6468  O OE1  . GLN A 1 63 ? 4.852   7.878   3.976   1.00 0.00 ? 63 GLN A OE1  5  
ATOM 6469  N NE2  . GLN A 1 63 ? 7.095   7.800   4.047   1.00 0.00 ? 63 GLN A NE2  5  
ATOM 6470  H H    . GLN A 1 63 ? 2.277   6.320   3.254   1.00 0.00 ? 63 GLN A H    5  
ATOM 6471  H HA   . GLN A 1 63 ? 4.121   6.530   1.109   1.00 0.00 ? 63 GLN A HA   5  
ATOM 6472  H HB2  . GLN A 1 63 ? 4.128   5.523   3.776   1.00 0.00 ? 63 GLN A HB2  5  
ATOM 6473  H HB3  . GLN A 1 63 ? 4.789   4.298   2.704   1.00 0.00 ? 63 GLN A HB3  5  
ATOM 6474  H HG2  . GLN A 1 63 ? 6.693   5.426   3.165   1.00 0.00 ? 63 GLN A HG2  5  
ATOM 6475  H HG3  . GLN A 1 63 ? 6.148   6.373   1.782   1.00 0.00 ? 63 GLN A HG3  5  
ATOM 6476  H HE21 . GLN A 1 63 ? 7.898   7.318   3.758   1.00 0.00 ? 63 GLN A HE21 5  
ATOM 6477  H HE22 . GLN A 1 63 ? 7.117   8.606   4.604   1.00 0.00 ? 63 GLN A HE22 5  
ATOM 6478  N N    . VAL A 1 64 ? 2.070   4.039   1.150   1.00 0.00 ? 64 VAL A N    5  
ATOM 6479  C CA   . VAL A 1 64 ? 1.568   2.902   0.392   1.00 0.00 ? 64 VAL A CA   5  
ATOM 6480  C C    . VAL A 1 64 ? 1.098   3.334   -0.987  1.00 0.00 ? 64 VAL A C    5  
ATOM 6481  O O    . VAL A 1 64 ? 1.131   2.555   -1.938  1.00 0.00 ? 64 VAL A O    5  
ATOM 6482  C CB   . VAL A 1 64 ? 0.403   2.190   1.110   1.00 0.00 ? 64 VAL A CB   5  
ATOM 6483  C CG1  . VAL A 1 64 ? 0.211   0.789   0.547   1.00 0.00 ? 64 VAL A CG1  5  
ATOM 6484  C CG2  . VAL A 1 64 ? 0.633   2.139   2.613   1.00 0.00 ? 64 VAL A CG2  5  
ATOM 6485  H H    . VAL A 1 64 ? 1.540   4.388   1.892   1.00 0.00 ? 64 VAL A H    5  
ATOM 6486  H HA   . VAL A 1 64 ? 2.376   2.204   0.279   1.00 0.00 ? 64 VAL A HA   5  
ATOM 6487  H HB   . VAL A 1 64 ? -0.502  2.752   0.925   1.00 0.00 ? 64 VAL A HB   5  
ATOM 6488  H HG11 . VAL A 1 64 ? -0.641  0.781   -0.116  1.00 0.00 ? 64 VAL A HG11 5  
ATOM 6489  H HG12 . VAL A 1 64 ? 0.044   0.094   1.357   1.00 0.00 ? 64 VAL A HG12 5  
ATOM 6490  H HG13 . VAL A 1 64 ? 1.095   0.497   -0.001  1.00 0.00 ? 64 VAL A HG13 5  
ATOM 6491  H HG21 . VAL A 1 64 ? 0.538   3.132   3.026   1.00 0.00 ? 64 VAL A HG21 5  
ATOM 6492  H HG22 . VAL A 1 64 ? 1.623   1.758   2.813   1.00 0.00 ? 64 VAL A HG22 5  
ATOM 6493  H HG23 . VAL A 1 64 ? -0.102  1.489   3.066   1.00 0.00 ? 64 VAL A HG23 5  
ATOM 6494  N N    . SER A 1 65 ? 0.668   4.584   -1.091  1.00 0.00 ? 65 SER A N    5  
ATOM 6495  C CA   . SER A 1 65 ? 0.200   5.124   -2.357  1.00 0.00 ? 65 SER A CA   5  
ATOM 6496  C C    . SER A 1 65 ? 1.383   5.481   -3.238  1.00 0.00 ? 65 SER A C    5  
ATOM 6497  O O    . SER A 1 65 ? 1.327   5.367   -4.462  1.00 0.00 ? 65 SER A O    5  
ATOM 6498  C CB   . SER A 1 65 ? -0.681  6.353   -2.127  1.00 0.00 ? 65 SER A CB   5  
ATOM 6499  O OG   . SER A 1 65 ? -2.045  5.989   -2.009  1.00 0.00 ? 65 SER A OG   5  
ATOM 6500  H H    . SER A 1 65 ? 0.676   5.158   -0.301  1.00 0.00 ? 65 SER A H    5  
ATOM 6501  H HA   . SER A 1 65 ? -0.375  4.360   -2.843  1.00 0.00 ? 65 SER A HA   5  
ATOM 6502  H HB2  . SER A 1 65 ? -0.374  6.848   -1.218  1.00 0.00 ? 65 SER A HB2  5  
ATOM 6503  H HB3  . SER A 1 65 ? -0.573  7.032   -2.960  1.00 0.00 ? 65 SER A HB3  5  
ATOM 6504  H HG   . SER A 1 65 ? -2.125  5.230   -1.427  1.00 0.00 ? 65 SER A HG   5  
ATOM 6505  N N    . SER A 1 66 ? 2.457   5.899   -2.592  1.00 0.00 ? 66 SER A N    5  
ATOM 6506  C CA   . SER A 1 66 ? 3.678   6.264   -3.282  1.00 0.00 ? 66 SER A CA   5  
ATOM 6507  C C    . SER A 1 66 ? 4.348   5.027   -3.855  1.00 0.00 ? 66 SER A C    5  
ATOM 6508  O O    . SER A 1 66 ? 4.903   5.052   -4.953  1.00 0.00 ? 66 SER A O    5  
ATOM 6509  C CB   . SER A 1 66 ? 4.620   6.967   -2.319  1.00 0.00 ? 66 SER A CB   5  
ATOM 6510  O OG   . SER A 1 66 ? 5.308   8.031   -2.955  1.00 0.00 ? 66 SER A OG   5  
ATOM 6511  H H    . SER A 1 66 ? 2.430   5.953   -1.617  1.00 0.00 ? 66 SER A H    5  
ATOM 6512  H HA   . SER A 1 66 ? 3.430   6.927   -4.077  1.00 0.00 ? 66 SER A HA   5  
ATOM 6513  H HB2  . SER A 1 66 ? 4.053   7.361   -1.491  1.00 0.00 ? 66 SER A HB2  5  
ATOM 6514  H HB3  . SER A 1 66 ? 5.333   6.257   -1.956  1.00 0.00 ? 66 SER A HB3  5  
ATOM 6515  H HG   . SER A 1 66 ? 6.201   7.752   -3.168  1.00 0.00 ? 66 SER A HG   5  
ATOM 6516  N N    . HIS A 1 67 ? 4.283   3.948   -3.094  1.00 0.00 ? 67 HIS A N    5  
ATOM 6517  C CA   . HIS A 1 67 ? 4.874   2.681   -3.502  1.00 0.00 ? 67 HIS A CA   5  
ATOM 6518  C C    . HIS A 1 67 ? 4.157   2.110   -4.719  1.00 0.00 ? 67 HIS A C    5  
ATOM 6519  O O    . HIS A 1 67 ? 4.738   1.351   -5.495  1.00 0.00 ? 67 HIS A O    5  
ATOM 6520  C CB   . HIS A 1 67 ? 4.833   1.678   -2.349  1.00 0.00 ? 67 HIS A CB   5  
ATOM 6521  C CG   . HIS A 1 67 ? 5.759   0.516   -2.534  1.00 0.00 ? 67 HIS A CG   5  
ATOM 6522  N ND1  . HIS A 1 67 ? 7.128   0.651   -2.626  1.00 0.00 ? 67 HIS A ND1  5  
ATOM 6523  C CD2  . HIS A 1 67 ? 5.506   -0.810  -2.644  1.00 0.00 ? 67 HIS A CD2  5  
ATOM 6524  C CE1  . HIS A 1 67 ? 7.677   -0.540  -2.785  1.00 0.00 ? 67 HIS A CE1  5  
ATOM 6525  N NE2  . HIS A 1 67 ? 6.714   -1.443  -2.799  1.00 0.00 ? 67 HIS A NE2  5  
ATOM 6526  H H    . HIS A 1 67 ? 3.823   4.008   -2.233  1.00 0.00 ? 67 HIS A H    5  
ATOM 6527  H HA   . HIS A 1 67 ? 5.898   2.871   -3.767  1.00 0.00 ? 67 HIS A HA   5  
ATOM 6528  H HB2  . HIS A 1 67 ? 5.110   2.180   -1.434  1.00 0.00 ? 67 HIS A HB2  5  
ATOM 6529  H HB3  . HIS A 1 67 ? 3.829   1.292   -2.252  1.00 0.00 ? 67 HIS A HB3  5  
ATOM 6530  H HD1  . HIS A 1 67 ? 7.624   1.495   -2.582  1.00 0.00 ? 67 HIS A HD1  5  
ATOM 6531  H HD2  . HIS A 1 67 ? 4.533   -1.281  -2.615  1.00 0.00 ? 67 HIS A HD2  5  
ATOM 6532  H HE1  . HIS A 1 67 ? 8.733   -0.741  -2.886  1.00 0.00 ? 67 HIS A HE1  5  
ATOM 6533  H HE2  . HIS A 1 67 ? 6.837   -2.396  -2.990  1.00 0.00 ? 67 HIS A HE2  5  
ATOM 6534  N N    . ILE A 1 68 ? 2.894   2.479   -4.884  1.00 0.00 ? 68 ILE A N    5  
ATOM 6535  C CA   . ILE A 1 68 ? 2.109   2.005   -6.012  1.00 0.00 ? 68 ILE A CA   5  
ATOM 6536  C C    . ILE A 1 68 ? 2.482   2.751   -7.289  1.00 0.00 ? 68 ILE A C    5  
ATOM 6537  O O    . ILE A 1 68 ? 2.269   2.254   -8.394  1.00 0.00 ? 68 ILE A O    5  
ATOM 6538  C CB   . ILE A 1 68 ? 0.594   2.152   -5.756  1.00 0.00 ? 68 ILE A CB   5  
ATOM 6539  C CG1  . ILE A 1 68 ? 0.195   1.402   -4.485  1.00 0.00 ? 68 ILE A CG1  5  
ATOM 6540  C CG2  . ILE A 1 68 ? -0.201  1.634   -6.947  1.00 0.00 ? 68 ILE A CG2  5  
ATOM 6541  C CD1  . ILE A 1 68 ? -1.010  1.995   -3.788  1.00 0.00 ? 68 ILE A CD1  5  
ATOM 6542  H H    . ILE A 1 68 ? 2.484   3.085   -4.238  1.00 0.00 ? 68 ILE A H    5  
ATOM 6543  H HA   . ILE A 1 68 ? 2.330   0.961   -6.143  1.00 0.00 ? 68 ILE A HA   5  
ATOM 6544  H HB   . ILE A 1 68 ? 0.372   3.201   -5.633  1.00 0.00 ? 68 ILE A HB   5  
ATOM 6545  H HG12 . ILE A 1 68 ? -0.040  0.379   -4.737  1.00 0.00 ? 68 ILE A HG12 5  
ATOM 6546  H HG13 . ILE A 1 68 ? 1.023   1.416   -3.792  1.00 0.00 ? 68 ILE A HG13 5  
ATOM 6547  H HG21 . ILE A 1 68 ? -1.249  1.597   -6.690  1.00 0.00 ? 68 ILE A HG21 5  
ATOM 6548  H HG22 . ILE A 1 68 ? 0.142   0.643   -7.205  1.00 0.00 ? 68 ILE A HG22 5  
ATOM 6549  H HG23 . ILE A 1 68 ? -0.059  2.295   -7.789  1.00 0.00 ? 68 ILE A HG23 5  
ATOM 6550  H HD11 . ILE A 1 68 ? -1.133  3.023   -4.094  1.00 0.00 ? 68 ILE A HD11 5  
ATOM 6551  H HD12 . ILE A 1 68 ? -0.864  1.953   -2.718  1.00 0.00 ? 68 ILE A HD12 5  
ATOM 6552  H HD13 . ILE A 1 68 ? -1.892  1.432   -4.053  1.00 0.00 ? 68 ILE A HD13 5  
ATOM 6553  N N    . GLN A 1 69 ? 3.040   3.946   -7.129  1.00 0.00 ? 69 GLN A N    5  
ATOM 6554  C CA   . GLN A 1 69 ? 3.441   4.757   -8.267  1.00 0.00 ? 69 GLN A CA   5  
ATOM 6555  C C    . GLN A 1 69 ? 4.761   4.270   -8.843  1.00 0.00 ? 69 GLN A C    5  
ATOM 6556  O O    . GLN A 1 69 ? 4.990   4.343   -10.050 1.00 0.00 ? 69 GLN A O    5  
ATOM 6557  C CB   . GLN A 1 69 ? 3.553   6.229   -7.864  1.00 0.00 ? 69 GLN A CB   5  
ATOM 6558  C CG   . GLN A 1 69 ? 2.367   6.730   -7.056  1.00 0.00 ? 69 GLN A CG   5  
ATOM 6559  C CD   . GLN A 1 69 ? 2.201   8.235   -7.136  1.00 0.00 ? 69 GLN A CD   5  
ATOM 6560  O OE1  . GLN A 1 69 ? 2.666   8.873   -8.081  1.00 0.00 ? 69 GLN A OE1  5  
ATOM 6561  N NE2  . GLN A 1 69 ? 1.536   8.811   -6.141  1.00 0.00 ? 69 GLN A NE2  5  
ATOM 6562  H H    . GLN A 1 69 ? 3.183   4.289   -6.227  1.00 0.00 ? 69 GLN A H    5  
ATOM 6563  H HA   . GLN A 1 69 ? 2.683   4.654   -9.017  1.00 0.00 ? 69 GLN A HA   5  
ATOM 6564  H HB2  . GLN A 1 69 ? 4.446   6.362   -7.272  1.00 0.00 ? 69 GLN A HB2  5  
ATOM 6565  H HB3  . GLN A 1 69 ? 3.631   6.830   -8.758  1.00 0.00 ? 69 GLN A HB3  5  
ATOM 6566  H HG2  . GLN A 1 69 ? 1.469   6.264   -7.432  1.00 0.00 ? 69 GLN A HG2  5  
ATOM 6567  H HG3  . GLN A 1 69 ? 2.510   6.452   -6.022  1.00 0.00 ? 69 GLN A HG3  5  
ATOM 6568  H HE21 . GLN A 1 69 ? 1.194   8.240   -5.421  1.00 0.00 ? 69 GLN A HE21 5  
ATOM 6569  H HE22 . GLN A 1 69 ? 1.414   9.783   -6.168  1.00 0.00 ? 69 GLN A HE22 5  
ATOM 6570  N N    . VAL A 1 70 ? 5.622   3.761   -7.974  1.00 0.00 ? 70 VAL A N    5  
ATOM 6571  C CA   . VAL A 1 70 ? 6.914   3.247   -8.400  1.00 0.00 ? 70 VAL A CA   5  
ATOM 6572  C C    . VAL A 1 70 ? 6.762   1.851   -8.980  1.00 0.00 ? 70 VAL A C    5  
ATOM 6573  O O    . VAL A 1 70 ? 7.495   1.455   -9.886  1.00 0.00 ? 70 VAL A O    5  
ATOM 6574  C CB   . VAL A 1 70 ? 7.959   3.217   -7.256  1.00 0.00 ? 70 VAL A CB   5  
ATOM 6575  C CG1  . VAL A 1 70 ? 8.978   4.330   -7.435  1.00 0.00 ? 70 VAL A CG1  5  
ATOM 6576  C CG2  . VAL A 1 70 ? 7.299   3.314   -5.887  1.00 0.00 ? 70 VAL A CG2  5  
ATOM 6577  H H    . VAL A 1 70 ? 5.376   3.722   -7.034  1.00 0.00 ? 70 VAL A H    5  
ATOM 6578  H HA   . VAL A 1 70 ? 7.276   3.898   -9.174  1.00 0.00 ? 70 VAL A HA   5  
ATOM 6579  H HB   . VAL A 1 70 ? 8.482   2.275   -7.308  1.00 0.00 ? 70 VAL A HB   5  
ATOM 6580  H HG11 . VAL A 1 70 ? 8.713   5.165   -6.804  1.00 0.00 ? 70 VAL A HG11 5  
ATOM 6581  H HG12 . VAL A 1 70 ? 8.988   4.647   -8.467  1.00 0.00 ? 70 VAL A HG12 5  
ATOM 6582  H HG13 . VAL A 1 70 ? 9.958   3.968   -7.160  1.00 0.00 ? 70 VAL A HG13 5  
ATOM 6583  H HG21 . VAL A 1 70 ? 6.556   2.537   -5.790  1.00 0.00 ? 70 VAL A HG21 5  
ATOM 6584  H HG22 . VAL A 1 70 ? 6.827   4.279   -5.783  1.00 0.00 ? 70 VAL A HG22 5  
ATOM 6585  H HG23 . VAL A 1 70 ? 8.047   3.194   -5.117  1.00 0.00 ? 70 VAL A HG23 5  
ATOM 6586  N N    . LEU A 1 71 ? 5.791   1.117   -8.458  1.00 0.00 ? 71 LEU A N    5  
ATOM 6587  C CA   . LEU A 1 71 ? 5.519   -0.230  -8.925  1.00 0.00 ? 71 LEU A CA   5  
ATOM 6588  C C    . LEU A 1 71 ? 4.794   -0.190  -10.264 1.00 0.00 ? 71 LEU A C    5  
ATOM 6589  O O    . LEU A 1 71 ? 4.891   -1.119  -11.065 1.00 0.00 ? 71 LEU A O    5  
ATOM 6590  C CB   . LEU A 1 71 ? 4.693   -0.997  -7.895  1.00 0.00 ? 71 LEU A CB   5  
ATOM 6591  C CG   . LEU A 1 71 ? 5.367   -2.245  -7.323  1.00 0.00 ? 71 LEU A CG   5  
ATOM 6592  C CD1  . LEU A 1 71 ? 6.234   -1.883  -6.128  1.00 0.00 ? 71 LEU A CD1  5  
ATOM 6593  C CD2  . LEU A 1 71 ? 4.324   -3.282  -6.933  1.00 0.00 ? 71 LEU A CD2  5  
ATOM 6594  H H    . LEU A 1 71 ? 5.239   1.495   -7.749  1.00 0.00 ? 71 LEU A H    5  
ATOM 6595  H HA   . LEU A 1 71 ? 6.459   -0.725  -9.056  1.00 0.00 ? 71 LEU A HA   5  
ATOM 6596  H HB2  . LEU A 1 71 ? 4.470   -0.328  -7.078  1.00 0.00 ? 71 LEU A HB2  5  
ATOM 6597  H HB3  . LEU A 1 71 ? 3.767   -1.296  -8.357  1.00 0.00 ? 71 LEU A HB3  5  
ATOM 6598  H HG   . LEU A 1 71 ? 6.006   -2.679  -8.079  1.00 0.00 ? 71 LEU A HG   5  
ATOM 6599  H HD11 . LEU A 1 71 ? 5.848   -0.989  -5.660  1.00 0.00 ? 71 LEU A HD11 5  
ATOM 6600  H HD12 . LEU A 1 71 ? 7.248   -1.707  -6.458  1.00 0.00 ? 71 LEU A HD12 5  
ATOM 6601  H HD13 . LEU A 1 71 ? 6.223   -2.695  -5.416  1.00 0.00 ? 71 LEU A HD13 5  
ATOM 6602  H HD21 . LEU A 1 71 ? 3.860   -2.992  -6.002  1.00 0.00 ? 71 LEU A HD21 5  
ATOM 6603  H HD22 . LEU A 1 71 ? 4.800   -4.244  -6.814  1.00 0.00 ? 71 LEU A HD22 5  
ATOM 6604  H HD23 . LEU A 1 71 ? 3.573   -3.344  -7.706  1.00 0.00 ? 71 LEU A HD23 5  
ATOM 6605  N N    . ALA A 1 72 ? 4.072   0.901   -10.501 1.00 0.00 ? 72 ALA A N    5  
ATOM 6606  C CA   . ALA A 1 72 ? 3.336   1.074   -11.742 1.00 0.00 ? 72 ALA A CA   5  
ATOM 6607  C C    . ALA A 1 72 ? 4.283   1.376   -12.895 1.00 0.00 ? 72 ALA A C    5  
ATOM 6608  O O    . ALA A 1 72 ? 3.993   1.063   -14.050 1.00 0.00 ? 72 ALA A O    5  
ATOM 6609  C CB   . ALA A 1 72 ? 2.303   2.181   -11.596 1.00 0.00 ? 72 ALA A CB   5  
ATOM 6610  H H    . ALA A 1 72 ? 4.039   1.607   -9.826  1.00 0.00 ? 72 ALA A H    5  
ATOM 6611  H HA   . ALA A 1 72 ? 2.820   0.156   -11.946 1.00 0.00 ? 72 ALA A HA   5  
ATOM 6612  H HB1  . ALA A 1 72 ? 1.770   2.056   -10.665 1.00 0.00 ? 72 ALA A HB1  5  
ATOM 6613  H HB2  . ALA A 1 72 ? 1.606   2.134   -12.420 1.00 0.00 ? 72 ALA A HB2  5  
ATOM 6614  H HB3  . ALA A 1 72 ? 2.800   3.140   -11.599 1.00 0.00 ? 72 ALA A HB3  5  
ATOM 6615  N N    . ARG A 1 73 ? 5.417   1.984   -12.572 1.00 0.00 ? 73 ARG A N    5  
ATOM 6616  C CA   . ARG A 1 73 ? 6.412   2.328   -13.577 1.00 0.00 ? 73 ARG A CA   5  
ATOM 6617  C C    . ARG A 1 73 ? 7.128   1.082   -14.080 1.00 0.00 ? 73 ARG A C    5  
ATOM 6618  O O    . ARG A 1 73 ? 7.548   1.015   -15.235 1.00 0.00 ? 73 ARG A O    5  
ATOM 6619  C CB   . ARG A 1 73 ? 7.425   3.323   -13.008 1.00 0.00 ? 73 ARG A CB   5  
ATOM 6620  C CG   . ARG A 1 73 ? 7.041   4.777   -13.231 1.00 0.00 ? 73 ARG A CG   5  
ATOM 6621  C CD   . ARG A 1 73 ? 7.765   5.368   -14.430 1.00 0.00 ? 73 ARG A CD   5  
ATOM 6622  N NE   . ARG A 1 73 ? 7.408   4.690   -15.674 1.00 0.00 ? 73 ARG A NE   5  
ATOM 6623  C CZ   . ARG A 1 73 ? 8.130   4.761   -16.790 1.00 0.00 ? 73 ARG A CZ   5  
ATOM 6624  N NH1  . ARG A 1 73 ? 9.247   5.477   -16.822 1.00 0.00 ? 73 ARG A NH1  5  
ATOM 6625  N NH2  . ARG A 1 73 ? 7.734   4.113   -17.877 1.00 0.00 ? 73 ARG A NH2  5  
ATOM 6626  H H    . ARG A 1 73 ? 5.589   2.206   -11.636 1.00 0.00 ? 73 ARG A H    5  
ATOM 6627  H HA   . ARG A 1 73 ? 5.896   2.784   -14.400 1.00 0.00 ? 73 ARG A HA   5  
ATOM 6628  H HB2  . ARG A 1 73 ? 7.518   3.156   -11.945 1.00 0.00 ? 73 ARG A HB2  5  
ATOM 6629  H HB3  . ARG A 1 73 ? 8.383   3.150   -13.475 1.00 0.00 ? 73 ARG A HB3  5  
ATOM 6630  H HG2  . ARG A 1 73 ? 5.976   4.836   -13.402 1.00 0.00 ? 73 ARG A HG2  5  
ATOM 6631  H HG3  . ARG A 1 73 ? 7.298   5.346   -12.349 1.00 0.00 ? 73 ARG A HG3  5  
ATOM 6632  H HD2  . ARG A 1 73 ? 7.504   6.412   -14.513 1.00 0.00 ? 73 ARG A HD2  5  
ATOM 6633  H HD3  . ARG A 1 73 ? 8.830   5.275   -14.272 1.00 0.00 ? 73 ARG A HD3  5  
ATOM 6634  H HE   . ARG A 1 73 ? 6.588   4.154   -15.678 1.00 0.00 ? 73 ARG A HE   5  
ATOM 6635  H HH11 . ARG A 1 73 ? 9.552   5.967   -16.006 1.00 0.00 ? 73 ARG A HH11 5  
ATOM 6636  H HH12 . ARG A 1 73 ? 9.785   5.526   -17.664 1.00 0.00 ? 73 ARG A HH12 5  
ATOM 6637  H HH21 . ARG A 1 73 ? 6.893   3.572   -17.859 1.00 0.00 ? 73 ARG A HH21 5  
ATOM 6638  H HH22 . ARG A 1 73 ? 8.276   4.166   -18.716 1.00 0.00 ? 73 ARG A HH22 5  
ATOM 6639  N N    . ARG A 1 74 ? 7.259   0.097   -13.203 1.00 0.00 ? 74 ARG A N    5  
ATOM 6640  C CA   . ARG A 1 74 ? 7.919   -1.152  -13.548 1.00 0.00 ? 74 ARG A CA   5  
ATOM 6641  C C    . ARG A 1 74 ? 6.997   -2.043  -14.372 1.00 0.00 ? 74 ARG A C    5  
ATOM 6642  O O    . ARG A 1 74 ? 7.452   -2.844  -15.188 1.00 0.00 ? 74 ARG A O    5  
ATOM 6643  C CB   . ARG A 1 74 ? 8.365   -1.887  -12.283 1.00 0.00 ? 74 ARG A CB   5  
ATOM 6644  C CG   . ARG A 1 74 ? 9.501   -1.195  -11.547 1.00 0.00 ? 74 ARG A CG   5  
ATOM 6645  C CD   . ARG A 1 74 ? 9.372   -1.363  -10.041 1.00 0.00 ? 74 ARG A CD   5  
ATOM 6646  N NE   . ARG A 1 74 ? 9.810   -2.684  -9.598  1.00 0.00 ? 74 ARG A NE   5  
ATOM 6647  C CZ   . ARG A 1 74 ? 11.086  -3.034  -9.458  1.00 0.00 ? 74 ARG A CZ   5  
ATOM 6648  N NH1  . ARG A 1 74 ? 12.053  -2.165  -9.726  1.00 0.00 ? 74 ARG A NH1  5  
ATOM 6649  N NH2  . ARG A 1 74 ? 11.397  -4.257  -9.049  1.00 0.00 ? 74 ARG A NH2  5  
ATOM 6650  H H    . ARG A 1 74 ? 6.901   0.214   -12.304 1.00 0.00 ? 74 ARG A H    5  
ATOM 6651  H HA   . ARG A 1 74 ? 8.782   -0.910  -14.137 1.00 0.00 ? 74 ARG A HA   5  
ATOM 6652  H HB2  . ARG A 1 74 ? 7.524   -1.966  -11.610 1.00 0.00 ? 74 ARG A HB2  5  
ATOM 6653  H HB3  . ARG A 1 74 ? 8.693   -2.880  -12.554 1.00 0.00 ? 74 ARG A HB3  5  
ATOM 6654  H HG2  . ARG A 1 74 ? 10.439  -1.624  -11.867 1.00 0.00 ? 74 ARG A HG2  5  
ATOM 6655  H HG3  . ARG A 1 74 ? 9.483   -0.142  -11.786 1.00 0.00 ? 74 ARG A HG3  5  
ATOM 6656  H HD2  . ARG A 1 74 ? 9.977   -0.612  -9.555  1.00 0.00 ? 74 ARG A HD2  5  
ATOM 6657  H HD3  . ARG A 1 74 ? 8.337   -1.224  -9.764  1.00 0.00 ? 74 ARG A HD3  5  
ATOM 6658  H HE   . ARG A 1 74 ? 9.116   -3.346  -9.393  1.00 0.00 ? 74 ARG A HE   5  
ATOM 6659  H HH11 . ARG A 1 74 ? 11.826  -1.242  -10.034 1.00 0.00 ? 74 ARG A HH11 5  
ATOM 6660  H HH12 . ARG A 1 74 ? 13.010  -2.434  -9.619  1.00 0.00 ? 74 ARG A HH12 5  
ATOM 6661  H HH21 . ARG A 1 74 ? 10.673  -4.915  -8.845  1.00 0.00 ? 74 ARG A HH21 5  
ATOM 6662  H HH22 . ARG A 1 74 ? 12.356  -4.520  -8.944  1.00 0.00 ? 74 ARG A HH22 5  
ATOM 6663  N N    . LYS A 1 75 ? 5.699   -1.894  -14.148 1.00 0.00 ? 75 LYS A N    5  
ATOM 6664  C CA   . LYS A 1 75 ? 4.702   -2.677  -14.860 1.00 0.00 ? 75 LYS A CA   5  
ATOM 6665  C C    . LYS A 1 75 ? 4.375   -2.057  -16.216 1.00 0.00 ? 75 LYS A C    5  
ATOM 6666  O O    . LYS A 1 75 ? 3.831   -2.723  -17.097 1.00 0.00 ? 75 LYS A O    5  
ATOM 6667  C CB   . LYS A 1 75 ? 3.428   -2.802  -14.023 1.00 0.00 ? 75 LYS A CB   5  
ATOM 6668  C CG   . LYS A 1 75 ? 2.712   -4.131  -14.198 1.00 0.00 ? 75 LYS A CG   5  
ATOM 6669  C CD   . LYS A 1 75 ? 1.238   -4.021  -13.842 1.00 0.00 ? 75 LYS A CD   5  
ATOM 6670  C CE   . LYS A 1 75 ? 0.533   -5.362  -13.972 1.00 0.00 ? 75 LYS A CE   5  
ATOM 6671  N NZ   . LYS A 1 75 ? -0.854  -5.212  -14.491 1.00 0.00 ? 75 LYS A NZ   5  
ATOM 6672  H H    . LYS A 1 75 ? 5.405   -1.243  -13.487 1.00 0.00 ? 75 LYS A H    5  
ATOM 6673  H HA   . LYS A 1 75 ? 5.113   -3.657  -15.016 1.00 0.00 ? 75 LYS A HA   5  
ATOM 6674  H HB2  . LYS A 1 75 ? 3.684   -2.689  -12.980 1.00 0.00 ? 75 LYS A HB2  5  
ATOM 6675  H HB3  . LYS A 1 75 ? 2.747   -2.011  -14.304 1.00 0.00 ? 75 LYS A HB3  5  
ATOM 6676  H HG2  . LYS A 1 75 ? 2.801   -4.444  -15.227 1.00 0.00 ? 75 LYS A HG2  5  
ATOM 6677  H HG3  . LYS A 1 75 ? 3.175   -4.865  -13.554 1.00 0.00 ? 75 LYS A HG3  5  
ATOM 6678  H HD2  . LYS A 1 75 ? 1.148   -3.676  -12.823 1.00 0.00 ? 75 LYS A HD2  5  
ATOM 6679  H HD3  . LYS A 1 75 ? 0.770   -3.312  -14.508 1.00 0.00 ? 75 LYS A HD3  5  
ATOM 6680  H HE2  . LYS A 1 75 ? 1.096   -5.986  -14.649 1.00 0.00 ? 75 LYS A HE2  5  
ATOM 6681  H HE3  . LYS A 1 75 ? 0.496   -5.830  -12.999 1.00 0.00 ? 75 LYS A HE3  5  
ATOM 6682  H HZ1  . LYS A 1 75 ? -1.259  -6.146  -14.705 1.00 0.00 ? 75 LYS A HZ1  5  
ATOM 6683  H HZ2  . LYS A 1 75 ? -0.851  -4.641  -15.361 1.00 0.00 ? 75 LYS A HZ2  5  
ATOM 6684  H HZ3  . LYS A 1 75 ? -1.452  -4.740  -13.783 1.00 0.00 ? 75 LYS A HZ3  5  
ATOM 6685  N N    . SER A 1 76 ? 4.708   -0.779  -16.379 1.00 0.00 ? 76 SER A N    5  
ATOM 6686  C CA   . SER A 1 76 ? 4.445   -0.075  -17.630 1.00 0.00 ? 76 SER A CA   5  
ATOM 6687  C C    . SER A 1 76 ? 5.136   -0.758  -18.805 1.00 0.00 ? 76 SER A C    5  
ATOM 6688  O O    . SER A 1 76 ? 4.753   -0.565  -19.959 1.00 0.00 ? 76 SER A O    5  
ATOM 6689  C CB   . SER A 1 76 ? 4.901   1.381   -17.527 1.00 0.00 ? 76 SER A CB   5  
ATOM 6690  O OG   . SER A 1 76 ? 3.875   2.201   -16.997 1.00 0.00 ? 76 SER A OG   5  
ATOM 6691  H H    . SER A 1 76 ? 5.137   -0.298  -15.642 1.00 0.00 ? 76 SER A H    5  
ATOM 6692  H HA   . SER A 1 76 ? 3.381   -0.098  -17.800 1.00 0.00 ? 76 SER A HA   5  
ATOM 6693  H HB2  . SER A 1 76 ? 5.763   1.441   -16.880 1.00 0.00 ? 76 SER A HB2  5  
ATOM 6694  H HB3  . SER A 1 76 ? 5.164   1.744   -18.510 1.00 0.00 ? 76 SER A HB3  5  
ATOM 6695  H HG   . SER A 1 76 ? 4.121   2.493   -16.116 1.00 0.00 ? 76 SER A HG   5  
ATOM 6696  N N    . ARG A 1 77 ? 6.152   -1.560  -18.508 1.00 0.00 ? 77 ARG A N    5  
ATOM 6697  C CA   . ARG A 1 77 ? 6.887   -2.274  -19.545 1.00 0.00 ? 77 ARG A CA   5  
ATOM 6698  C C    . ARG A 1 77 ? 5.967   -3.217  -20.318 1.00 0.00 ? 77 ARG A C    5  
ATOM 6699  O O    . ARG A 1 77 ? 6.306   -3.668  -21.412 1.00 0.00 ? 77 ARG A O    5  
ATOM 6700  C CB   . ARG A 1 77 ? 8.043   -3.063  -18.928 1.00 0.00 ? 77 ARG A CB   5  
ATOM 6701  C CG   . ARG A 1 77 ? 9.251   -2.206  -18.586 1.00 0.00 ? 77 ARG A CG   5  
ATOM 6702  C CD   . ARG A 1 77 ? 9.951   -2.704  -17.332 1.00 0.00 ? 77 ARG A CD   5  
ATOM 6703  N NE   . ARG A 1 77 ? 10.911  -3.765  -17.626 1.00 0.00 ? 77 ARG A NE   5  
ATOM 6704  C CZ   . ARG A 1 77 ? 11.811  -4.213  -16.754 1.00 0.00 ? 77 ARG A CZ   5  
ATOM 6705  N NH1  . ARG A 1 77 ? 11.877  -3.696  -15.533 1.00 0.00 ? 77 ARG A NH1  5  
ATOM 6706  N NH2  . ARG A 1 77 ? 12.647  -5.181  -17.103 1.00 0.00 ? 77 ARG A NH2  5  
ATOM 6707  H H    . ARG A 1 77 ? 6.410   -1.679  -17.572 1.00 0.00 ? 77 ARG A H    5  
ATOM 6708  H HA   . ARG A 1 77 ? 7.287   -1.542  -20.228 1.00 0.00 ? 77 ARG A HA   5  
ATOM 6709  H HB2  . ARG A 1 77 ? 7.697   -3.537  -18.021 1.00 0.00 ? 77 ARG A HB2  5  
ATOM 6710  H HB3  . ARG A 1 77 ? 8.356   -3.826  -19.625 1.00 0.00 ? 77 ARG A HB3  5  
ATOM 6711  H HG2  . ARG A 1 77 ? 9.947   -2.236  -19.411 1.00 0.00 ? 77 ARG A HG2  5  
ATOM 6712  H HG3  . ARG A 1 77 ? 8.924   -1.189  -18.426 1.00 0.00 ? 77 ARG A HG3  5  
ATOM 6713  H HD2  . ARG A 1 77 ? 10.472  -1.877  -16.874 1.00 0.00 ? 77 ARG A HD2  5  
ATOM 6714  H HD3  . ARG A 1 77 ? 9.207   -3.084  -16.647 1.00 0.00 ? 77 ARG A HD3  5  
ATOM 6715  H HE   . ARG A 1 77 ? 10.885  -4.164  -18.521 1.00 0.00 ? 77 ARG A HE   5  
ATOM 6716  H HH11 . ARG A 1 77 ? 11.249  -2.966  -15.264 1.00 0.00 ? 77 ARG A HH11 5  
ATOM 6717  H HH12 . ARG A 1 77 ? 12.555  -4.037  -14.882 1.00 0.00 ? 77 ARG A HH12 5  
ATOM 6718  H HH21 . ARG A 1 77 ? 12.602  -5.574  -18.021 1.00 0.00 ? 77 ARG A HH21 5  
ATOM 6719  H HH22 . ARG A 1 77 ? 13.324  -5.518  -16.448 1.00 0.00 ? 77 ARG A HH22 5  
ATOM 6720  N N    . ASP A 1 78 ? 4.802   -3.513  -19.744 1.00 0.00 ? 78 ASP A N    5  
ATOM 6721  C CA   . ASP A 1 78 ? 3.840   -4.401  -20.383 1.00 0.00 ? 78 ASP A CA   5  
ATOM 6722  C C    . ASP A 1 78 ? 3.237   -3.761  -21.631 1.00 0.00 ? 78 ASP A C    5  
ATOM 6723  O O    . ASP A 1 78 ? 2.703   -4.453  -22.497 1.00 0.00 ? 78 ASP A O    5  
ATOM 6724  C CB   . ASP A 1 78 ? 2.734   -4.778  -19.399 1.00 0.00 ? 78 ASP A CB   5  
ATOM 6725  C CG   . ASP A 1 78 ? 2.695   -6.266  -19.113 1.00 0.00 ? 78 ASP A CG   5  
ATOM 6726  O OD1  . ASP A 1 78 ? 3.403   -6.711  -18.185 1.00 0.00 ? 78 ASP A OD1  5  
ATOM 6727  O OD2  . ASP A 1 78 ? 1.956   -6.987  -19.816 1.00 0.00 ? 78 ASP A OD2  5  
ATOM 6728  H H    . ASP A 1 78 ? 4.585   -3.125  -18.872 1.00 0.00 ? 78 ASP A H    5  
ATOM 6729  H HA   . ASP A 1 78 ? 4.363   -5.293  -20.670 1.00 0.00 ? 78 ASP A HA   5  
ATOM 6730  H HB2  . ASP A 1 78 ? 2.899   -4.257  -18.470 1.00 0.00 ? 78 ASP A HB2  5  
ATOM 6731  H HB3  . ASP A 1 78 ? 1.781   -4.483  -19.809 1.00 0.00 ? 78 ASP A HB3  5  
ATOM 6732  N N    . LEU A 1 79 ? 3.325   -2.438  -21.716 1.00 0.00 ? 79 LEU A N    5  
ATOM 6733  C CA   . LEU A 1 79 ? 2.786   -1.709  -22.858 1.00 0.00 ? 79 LEU A CA   5  
ATOM 6734  C C    . LEU A 1 79 ? 3.462   -2.147  -24.154 1.00 0.00 ? 79 LEU A C    5  
ATOM 6735  O O    . LEU A 1 79 ? 4.437   -1.537  -24.594 1.00 0.00 ? 79 LEU A O    5  
ATOM 6736  C CB   . LEU A 1 79 ? 2.967   -0.203  -22.659 1.00 0.00 ? 79 LEU A CB   5  
ATOM 6737  C CG   . LEU A 1 79 ? 2.197   0.392   -21.479 1.00 0.00 ? 79 LEU A CG   5  
ATOM 6738  C CD1  . LEU A 1 79 ? 2.856   1.677   -21.005 1.00 0.00 ? 79 LEU A CD1  5  
ATOM 6739  C CD2  . LEU A 1 79 ? 0.747   0.644   -21.863 1.00 0.00 ? 79 LEU A CD2  5  
ATOM 6740  H H    . LEU A 1 79 ? 3.760   -1.940  -20.994 1.00 0.00 ? 79 LEU A H    5  
ATOM 6741  H HA   . LEU A 1 79 ? 1.731   -1.929  -22.924 1.00 0.00 ? 79 LEU A HA   5  
ATOM 6742  H HB2  . LEU A 1 79 ? 4.019   -0.004  -22.513 1.00 0.00 ? 79 LEU A HB2  5  
ATOM 6743  H HB3  . LEU A 1 79 ? 2.645   0.299   -23.559 1.00 0.00 ? 79 LEU A HB3  5  
ATOM 6744  H HG   . LEU A 1 79 ? 2.209   -0.312  -20.659 1.00 0.00 ? 79 LEU A HG   5  
ATOM 6745  H HD11 . LEU A 1 79 ? 2.566   2.491   -21.653 1.00 0.00 ? 79 LEU A HD11 5  
ATOM 6746  H HD12 . LEU A 1 79 ? 3.930   1.562   -21.030 1.00 0.00 ? 79 LEU A HD12 5  
ATOM 6747  H HD13 . LEU A 1 79 ? 2.541   1.892   -19.994 1.00 0.00 ? 79 LEU A HD13 5  
ATOM 6748  H HD21 . LEU A 1 79 ? 0.273   1.248   -21.103 1.00 0.00 ? 79 LEU A HD21 5  
ATOM 6749  H HD22 . LEU A 1 79 ? 0.228   -0.299  -21.948 1.00 0.00 ? 79 LEU A HD22 5  
ATOM 6750  H HD23 . LEU A 1 79 ? 0.710   1.162   -22.810 1.00 0.00 ? 79 LEU A HD23 5  
ATOM 6751  N N    . VAL A 1 80 ? 2.938   -3.208  -24.758 1.00 0.00 ? 80 VAL A N    5  
ATOM 6752  C CA   . VAL A 1 80 ? 3.486   -3.730  -25.998 1.00 0.00 ? 80 VAL A CA   5  
ATOM 6753  C C    . VAL A 1 80 ? 2.657   -3.287  -27.201 1.00 0.00 ? 80 VAL A C    5  
ATOM 6754  O O    . VAL A 1 80 ? 1.681   -3.942  -27.565 1.00 0.00 ? 80 VAL A O    5  
ATOM 6755  C CB   . VAL A 1 80 ? 3.565   -5.263  -25.987 1.00 0.00 ? 80 VAL A CB   5  
ATOM 6756  C CG1  . VAL A 1 80 ? 4.605   -5.751  -26.984 1.00 0.00 ? 80 VAL A CG1  5  
ATOM 6757  C CG2  . VAL A 1 80 ? 3.869   -5.786  -24.590 1.00 0.00 ? 80 VAL A CG2  5  
ATOM 6758  H H    . VAL A 1 80 ? 2.168   -3.651  -24.362 1.00 0.00 ? 80 VAL A H    5  
ATOM 6759  H HA   . VAL A 1 80 ? 4.476   -3.352  -26.099 1.00 0.00 ? 80 VAL A HA   5  
ATOM 6760  H HB   . VAL A 1 80 ? 2.610   -5.639  -26.290 1.00 0.00 ? 80 VAL A HB   5  
ATOM 6761  H HG11 . VAL A 1 80 ? 4.518   -5.186  -27.900 1.00 0.00 ? 80 VAL A HG11 5  
ATOM 6762  H HG12 . VAL A 1 80 ? 4.441   -6.799  -27.191 1.00 0.00 ? 80 VAL A HG12 5  
ATOM 6763  H HG13 . VAL A 1 80 ? 5.593   -5.616  -26.570 1.00 0.00 ? 80 VAL A HG13 5  
ATOM 6764  H HG21 . VAL A 1 80 ? 2.944   -6.026  -24.087 1.00 0.00 ? 80 VAL A HG21 5  
ATOM 6765  H HG22 . VAL A 1 80 ? 4.398   -5.029  -24.029 1.00 0.00 ? 80 VAL A HG22 5  
ATOM 6766  H HG23 . VAL A 1 80 ? 4.480   -6.673  -24.663 1.00 0.00 ? 80 VAL A HG23 5  
ATOM 6767  N N    . PRO A 1 81 ? 3.034   -2.163  -27.838 1.00 0.00 ? 81 PRO A N    5  
ATOM 6768  C CA   . PRO A 1 81 ? 2.316   -1.639  -29.005 1.00 0.00 ? 81 PRO A CA   5  
ATOM 6769  C C    . PRO A 1 81 ? 2.415   -2.559  -30.218 1.00 0.00 ? 81 PRO A C    5  
ATOM 6770  O O    . PRO A 1 81 ? 1.681   -2.397  -31.193 1.00 0.00 ? 81 PRO A O    5  
ATOM 6771  C CB   . PRO A 1 81 ? 3.008   -0.305  -29.287 1.00 0.00 ? 81 PRO A CB   5  
ATOM 6772  C CG   . PRO A 1 81 ? 4.360   -0.449  -28.689 1.00 0.00 ? 81 PRO A CG   5  
ATOM 6773  C CD   . PRO A 1 81 ? 4.184   -1.317  -27.476 1.00 0.00 ? 81 PRO A CD   5  
ATOM 6774  H HA   . PRO A 1 81 ? 1.280   -1.463  -28.778 1.00 0.00 ? 81 PRO A HA   5  
ATOM 6775  H HB2  . PRO A 1 81 ? 3.062   -0.143  -30.354 1.00 0.00 ? 81 PRO A HB2  5  
ATOM 6776  H HB3  . PRO A 1 81 ? 2.454   0.497   -28.823 1.00 0.00 ? 81 PRO A HB3  5  
ATOM 6777  H HG2  . PRO A 1 81 ? 5.022   -0.923  -29.395 1.00 0.00 ? 81 PRO A HG2  5  
ATOM 6778  H HG3  . PRO A 1 81 ? 4.739   0.519   -28.404 1.00 0.00 ? 81 PRO A HG3  5  
ATOM 6779  H HD2  . PRO A 1 81 ? 5.068   -1.915  -27.308 1.00 0.00 ? 81 PRO A HD2  5  
ATOM 6780  H HD3  . PRO A 1 81 ? 3.961   -0.715  -26.608 1.00 0.00 ? 81 PRO A HD3  5  
ATOM 6781  N N    . ARG A 1 82 ? 3.327   -3.525  -30.154 1.00 0.00 ? 82 ARG A N    5  
ATOM 6782  C CA   . ARG A 1 82 ? 3.519   -4.468  -31.249 1.00 0.00 ? 82 ARG A CA   5  
ATOM 6783  C C    . ARG A 1 82 ? 2.239   -5.252  -31.523 1.00 0.00 ? 82 ARG A C    5  
ATOM 6784  O O    . ARG A 1 82 ? 1.737   -5.183  -32.665 1.00 0.00 ? 82 ARG A O    5  
ATOM 6785  C CB   . ARG A 1 82 ? 4.661   -5.433  -30.924 1.00 0.00 ? 82 ARG A CB   5  
ATOM 6786  C CG   . ARG A 1 82 ? 6.022   -4.943  -31.392 1.00 0.00 ? 82 ARG A CG   5  
ATOM 6787  C CD   . ARG A 1 82 ? 6.313   -5.384  -32.817 1.00 0.00 ? 82 ARG A CD   5  
ATOM 6788  N NE   . ARG A 1 82 ? 7.437   -4.654  -33.397 1.00 0.00 ? 82 ARG A NE   5  
ATOM 6789  C CZ   . ARG A 1 82 ? 7.346   -3.418  -33.884 1.00 0.00 ? 82 ARG A CZ   5  
ATOM 6790  N NH1  . ARG A 1 82 ? 6.187   -2.773  -33.863 1.00 0.00 ? 82 ARG A NH1  5  
ATOM 6791  N NH2  . ARG A 1 82 ? 8.418   -2.826  -34.394 1.00 0.00 ? 82 ARG A NH2  5  
ATOM 6792  O OXT  . ARG A 1 82 ? 1.750   -5.928  -30.594 1.00 0.00 ? 82 ARG A OXT  5  
ATOM 6793  H H    . ARG A 1 82 ? 3.882   -3.605  -29.352 1.00 0.00 ? 82 ARG A H    5  
ATOM 6794  H HA   . ARG A 1 82 ? 3.777   -3.903  -32.132 1.00 0.00 ? 82 ARG A HA   5  
ATOM 6795  H HB2  . ARG A 1 82 ? 4.702   -5.577  -29.855 1.00 0.00 ? 82 ARG A HB2  5  
ATOM 6796  H HB3  . ARG A 1 82 ? 4.462   -6.382  -31.399 1.00 0.00 ? 82 ARG A HB3  5  
ATOM 6797  H HG2  . ARG A 1 82 ? 6.040   -3.864  -31.349 1.00 0.00 ? 82 ARG A HG2  5  
ATOM 6798  H HG3  . ARG A 1 82 ? 6.782   -5.343  -30.737 1.00 0.00 ? 82 ARG A HG3  5  
ATOM 6799  H HD2  . ARG A 1 82 ? 6.546   -6.439  -32.813 1.00 0.00 ? 82 ARG A HD2  5  
ATOM 6800  H HD3  . ARG A 1 82 ? 5.434   -5.213  -33.420 1.00 0.00 ? 82 ARG A HD3  5  
ATOM 6801  H HE   . ARG A 1 82 ? 8.306   -5.107  -33.426 1.00 0.00 ? 82 ARG A HE   5  
ATOM 6802  H HH11 . ARG A 1 82 ? 5.375   -3.213  -33.479 1.00 0.00 ? 82 ARG A HH11 5  
ATOM 6803  H HH12 . ARG A 1 82 ? 6.125   -1.845  -34.230 1.00 0.00 ? 82 ARG A HH12 5  
ATOM 6804  H HH21 . ARG A 1 82 ? 9.294   -3.308  -34.413 1.00 0.00 ? 82 ARG A HH21 5  
ATOM 6805  H HH22 . ARG A 1 82 ? 8.349   -1.898  -34.760 1.00 0.00 ? 82 ARG A HH22 5  
ATOM 6806  N N    . MET A 1 1  ? 29.805  1.902   5.603   1.00 0.00 ? 1  MET A N    6  
ATOM 6807  C CA   . MET A 1 1  ? 29.695  1.668   7.067   1.00 0.00 ? 1  MET A CA   6  
ATOM 6808  C C    . MET A 1 1  ? 28.739  2.664   7.714   1.00 0.00 ? 1  MET A C    6  
ATOM 6809  O O    . MET A 1 1  ? 28.970  3.125   8.832   1.00 0.00 ? 1  MET A O    6  
ATOM 6810  C CB   . MET A 1 1  ? 31.088  1.795   7.686   1.00 0.00 ? 1  MET A CB   6  
ATOM 6811  C CG   . MET A 1 1  ? 31.883  0.500   7.668   1.00 0.00 ? 1  MET A CG   6  
ATOM 6812  S SD   . MET A 1 1  ? 32.927  0.346   6.206   1.00 0.00 ? 1  MET A SD   6  
ATOM 6813  C CE   . MET A 1 1  ? 34.393  1.224   6.743   1.00 0.00 ? 1  MET A CE   6  
ATOM 6814  H H1   . MET A 1 1  ? 28.937  1.542   5.158   1.00 0.00 ? 1  MET A H1   6  
ATOM 6815  H H2   . MET A 1 1  ? 30.644  1.389   5.262   1.00 0.00 ? 1  MET A H2   6  
ATOM 6816  H H3   . MET A 1 1  ? 29.904  2.926   5.452   1.00 0.00 ? 1  MET A H3   6  
ATOM 6817  H HA   . MET A 1 1  ? 29.324  0.667   7.228   1.00 0.00 ? 1  MET A HA   6  
ATOM 6818  H HB2  . MET A 1 1  ? 31.646  2.542   7.141   1.00 0.00 ? 1  MET A HB2  6  
ATOM 6819  H HB3  . MET A 1 1  ? 30.985  2.115   8.713   1.00 0.00 ? 1  MET A HB3  6  
ATOM 6820  H HG2  . MET A 1 1  ? 32.511  0.466   8.546   1.00 0.00 ? 1  MET A HG2  6  
ATOM 6821  H HG3  . MET A 1 1  ? 31.192  -0.331  7.689   1.00 0.00 ? 1  MET A HG3  6  
ATOM 6822  H HE1  . MET A 1 1  ? 34.589  2.045   6.069   1.00 0.00 ? 1  MET A HE1  6  
ATOM 6823  H HE2  . MET A 1 1  ? 35.236  0.549   6.743   1.00 0.00 ? 1  MET A HE2  6  
ATOM 6824  H HE3  . MET A 1 1  ? 34.238  1.607   7.741   1.00 0.00 ? 1  MET A HE3  6  
ATOM 6825  N N    . ASP A 1 2  ? 27.663  2.991   7.005   1.00 0.00 ? 2  ASP A N    6  
ATOM 6826  C CA   . ASP A 1 2  ? 26.671  3.932   7.511   1.00 0.00 ? 2  ASP A CA   6  
ATOM 6827  C C    . ASP A 1 2  ? 26.037  3.416   8.799   1.00 0.00 ? 2  ASP A C    6  
ATOM 6828  O O    . ASP A 1 2  ? 26.307  2.295   9.230   1.00 0.00 ? 2  ASP A O    6  
ATOM 6829  C CB   . ASP A 1 2  ? 25.594  4.182   6.458   1.00 0.00 ? 2  ASP A CB   6  
ATOM 6830  C CG   . ASP A 1 2  ? 25.544  5.631   6.013   1.00 0.00 ? 2  ASP A CG   6  
ATOM 6831  O OD1  . ASP A 1 2  ? 24.917  6.448   6.719   1.00 0.00 ? 2  ASP A OD1  6  
ATOM 6832  O OD2  . ASP A 1 2  ? 26.133  5.948   4.958   1.00 0.00 ? 2  ASP A OD2  6  
ATOM 6833  H H    . ASP A 1 2  ? 27.534  2.590   6.120   1.00 0.00 ? 2  ASP A H    6  
ATOM 6834  H HA   . ASP A 1 2  ? 27.173  4.860   7.719   1.00 0.00 ? 2  ASP A HA   6  
ATOM 6835  H HB2  . ASP A 1 2  ? 25.797  3.568   5.596   1.00 0.00 ? 2  ASP A HB2  6  
ATOM 6836  H HB3  . ASP A 1 2  ? 24.632  3.917   6.867   1.00 0.00 ? 2  ASP A HB3  6  
ATOM 6837  N N    . ASN A 1 3  ? 25.192  4.241   9.409   1.00 0.00 ? 3  ASN A N    6  
ATOM 6838  C CA   . ASN A 1 3  ? 24.520  3.868   10.648  1.00 0.00 ? 3  ASN A CA   6  
ATOM 6839  C C    . ASN A 1 3  ? 23.640  2.638   10.448  1.00 0.00 ? 3  ASN A C    6  
ATOM 6840  O O    . ASN A 1 3  ? 23.321  1.929   11.403  1.00 0.00 ? 3  ASN A O    6  
ATOM 6841  C CB   . ASN A 1 3  ? 23.682  5.035   11.168  1.00 0.00 ? 3  ASN A CB   6  
ATOM 6842  C CG   . ASN A 1 3  ? 24.151  5.525   12.524  1.00 0.00 ? 3  ASN A CG   6  
ATOM 6843  O OD1  . ASN A 1 3  ? 23.343  5.805   13.409  1.00 0.00 ? 3  ASN A OD1  6  
ATOM 6844  N ND2  . ASN A 1 3  ? 25.464  5.631   12.694  1.00 0.00 ? 3  ASN A ND2  6  
ATOM 6845  H H    . ASN A 1 3  ? 25.017  5.122   9.017   1.00 0.00 ? 3  ASN A H    6  
ATOM 6846  H HA   . ASN A 1 3  ? 25.276  3.636   11.373  1.00 0.00 ? 3  ASN A HA   6  
ATOM 6847  H HB2  . ASN A 1 3  ? 23.748  5.852   10.470  1.00 0.00 ? 3  ASN A HB2  6  
ATOM 6848  H HB3  . ASN A 1 3  ? 22.655  4.721   11.255  1.00 0.00 ? 3  ASN A HB3  6  
ATOM 6849  H HD21 . ASN A 1 3  ? 26.048  5.390   11.945  1.00 0.00 ? 3  ASN A HD21 6  
ATOM 6850  H HD22 . ASN A 1 3  ? 25.795  5.945   13.561  1.00 0.00 ? 3  ASN A HD22 6  
ATOM 6851  N N    . ASP A 1 4  ? 23.251  2.390   9.203   1.00 0.00 ? 4  ASP A N    6  
ATOM 6852  C CA   . ASP A 1 4  ? 22.413  1.253   8.872   1.00 0.00 ? 4  ASP A CA   6  
ATOM 6853  C C    . ASP A 1 4  ? 23.116  -0.065  9.189   1.00 0.00 ? 4  ASP A C    6  
ATOM 6854  O O    . ASP A 1 4  ? 22.473  -1.109  9.301   1.00 0.00 ? 4  ASP A O    6  
ATOM 6855  C CB   . ASP A 1 4  ? 22.040  1.306   7.392   1.00 0.00 ? 4  ASP A CB   6  
ATOM 6856  C CG   . ASP A 1 4  ? 23.233  1.585   6.498   1.00 0.00 ? 4  ASP A CG   6  
ATOM 6857  O OD1  . ASP A 1 4  ? 24.262  0.894   6.648   1.00 0.00 ? 4  ASP A OD1  6  
ATOM 6858  O OD2  . ASP A 1 4  ? 23.138  2.496   5.649   1.00 0.00 ? 4  ASP A OD2  6  
ATOM 6859  H H    . ASP A 1 4  ? 23.535  2.986   8.485   1.00 0.00 ? 4  ASP A H    6  
ATOM 6860  H HA   . ASP A 1 4  ? 21.514  1.320   9.463   1.00 0.00 ? 4  ASP A HA   6  
ATOM 6861  H HB2  . ASP A 1 4  ? 21.621  0.363   7.107   1.00 0.00 ? 4  ASP A HB2  6  
ATOM 6862  H HB3  . ASP A 1 4  ? 21.308  2.084   7.239   1.00 0.00 ? 4  ASP A HB3  6  
ATOM 6863  N N    . ALA A 1 5  ? 24.436  -0.012  9.332   1.00 0.00 ? 5  ALA A N    6  
ATOM 6864  C CA   . ALA A 1 5  ? 25.221  -1.202  9.635   1.00 0.00 ? 5  ALA A CA   6  
ATOM 6865  C C    . ALA A 1 5  ? 24.782  -1.839  10.950  1.00 0.00 ? 5  ALA A C    6  
ATOM 6866  O O    . ALA A 1 5  ? 25.047  -3.016  11.199  1.00 0.00 ? 5  ALA A O    6  
ATOM 6867  C CB   . ALA A 1 5  ? 26.702  -0.859  9.682   1.00 0.00 ? 5  ALA A CB   6  
ATOM 6868  H H    . ALA A 1 5  ? 24.893  0.848   9.231   1.00 0.00 ? 5  ALA A H    6  
ATOM 6869  H HA   . ALA A 1 5  ? 25.067  -1.912  8.838   1.00 0.00 ? 5  ALA A HA   6  
ATOM 6870  H HB1  . ALA A 1 5  ? 26.823  0.175   9.970   1.00 0.00 ? 5  ALA A HB1  6  
ATOM 6871  H HB2  . ALA A 1 5  ? 27.139  -1.013  8.706   1.00 0.00 ? 5  ALA A HB2  6  
ATOM 6872  H HB3  . ALA A 1 5  ? 27.197  -1.494  10.402  1.00 0.00 ? 5  ALA A HB3  6  
ATOM 6873  N N    . GLU A 1 6  ? 24.113  -1.057  11.790  1.00 0.00 ? 6  GLU A N    6  
ATOM 6874  C CA   . GLU A 1 6  ? 23.642  -1.545  13.077  1.00 0.00 ? 6  GLU A CA   6  
ATOM 6875  C C    . GLU A 1 6  ? 22.187  -1.976  13.013  1.00 0.00 ? 6  GLU A C    6  
ATOM 6876  O O    . GLU A 1 6  ? 21.507  -2.099  14.032  1.00 0.00 ? 6  GLU A O    6  
ATOM 6877  C CB   . GLU A 1 6  ? 23.807  -0.468  14.135  1.00 0.00 ? 6  GLU A CB   6  
ATOM 6878  C CG   . GLU A 1 6  ? 24.131  -1.008  15.518  1.00 0.00 ? 6  GLU A CG   6  
ATOM 6879  C CD   . GLU A 1 6  ? 23.672  -0.082  16.627  1.00 0.00 ? 6  GLU A CD   6  
ATOM 6880  O OE1  . GLU A 1 6  ? 24.354  0.936   16.871  1.00 0.00 ? 6  GLU A OE1  6  
ATOM 6881  O OE2  . GLU A 1 6  ? 22.631  -0.374  17.252  1.00 0.00 ? 6  GLU A OE2  6  
ATOM 6882  H H    . GLU A 1 6  ? 23.935  -0.134  11.542  1.00 0.00 ? 6  GLU A H    6  
ATOM 6883  H HA   . GLU A 1 6  ? 24.235  -2.391  13.331  1.00 0.00 ? 6  GLU A HA   6  
ATOM 6884  H HB2  . GLU A 1 6  ? 24.601  0.194   13.831  1.00 0.00 ? 6  GLU A HB2  6  
ATOM 6885  H HB3  . GLU A 1 6  ? 22.886  0.090   14.192  1.00 0.00 ? 6  GLU A HB3  6  
ATOM 6886  H HG2  . GLU A 1 6  ? 23.640  -1.962  15.642  1.00 0.00 ? 6  GLU A HG2  6  
ATOM 6887  H HG3  . GLU A 1 6  ? 25.200  -1.141  15.598  1.00 0.00 ? 6  GLU A HG3  6  
ATOM 6888  N N    . GLY A 1 7  ? 21.730  -2.202  11.805  1.00 0.00 ? 7  GLY A N    6  
ATOM 6889  C CA   . GLY A 1 7  ? 20.358  -2.623  11.578  1.00 0.00 ? 7  GLY A CA   6  
ATOM 6890  C C    . GLY A 1 7  ? 19.347  -1.702  12.235  1.00 0.00 ? 7  GLY A C    6  
ATOM 6891  O O    . GLY A 1 7  ? 18.277  -2.144  12.654  1.00 0.00 ? 7  GLY A O    6  
ATOM 6892  H H    . GLY A 1 7  ? 22.338  -2.081  11.056  1.00 0.00 ? 7  GLY A H    6  
ATOM 6893  H HA2  . GLY A 1 7  ? 20.171  -2.643  10.515  1.00 0.00 ? 7  GLY A HA2  6  
ATOM 6894  H HA3  . GLY A 1 7  ? 20.230  -3.620  11.974  1.00 0.00 ? 7  GLY A HA3  6  
ATOM 6895  N N    . VAL A 1 8  ? 19.685  -0.420  12.325  1.00 0.00 ? 8  VAL A N    6  
ATOM 6896  C CA   . VAL A 1 8  ? 18.798  0.562   12.936  1.00 0.00 ? 8  VAL A CA   6  
ATOM 6897  C C    . VAL A 1 8  ? 17.514  0.723   12.133  1.00 0.00 ? 8  VAL A C    6  
ATOM 6898  O O    . VAL A 1 8  ? 16.466  1.069   12.678  1.00 0.00 ? 8  VAL A O    6  
ATOM 6899  C CB   . VAL A 1 8  ? 19.474  1.931   13.077  1.00 0.00 ? 8  VAL A CB   6  
ATOM 6900  C CG1  . VAL A 1 8  ? 18.704  2.810   14.051  1.00 0.00 ? 8  VAL A CG1  6  
ATOM 6901  C CG2  . VAL A 1 8  ? 20.924  1.780   13.513  1.00 0.00 ? 8  VAL A CG2  6  
ATOM 6902  H H    . VAL A 1 8  ? 20.552  -0.128  11.973  1.00 0.00 ? 8  VAL A H    6  
ATOM 6903  H HA   . VAL A 1 8  ? 18.549  0.217   13.914  1.00 0.00 ? 8  VAL A HA   6  
ATOM 6904  H HB   . VAL A 1 8  ? 19.456  2.402   12.117  1.00 0.00 ? 8  VAL A HB   6  
ATOM 6905  H HG11 . VAL A 1 8  ? 17.905  3.313   13.527  1.00 0.00 ? 8  VAL A HG11 6  
ATOM 6906  H HG12 . VAL A 1 8  ? 19.372  3.543   14.478  1.00 0.00 ? 8  VAL A HG12 6  
ATOM 6907  H HG13 . VAL A 1 8  ? 18.290  2.198   14.838  1.00 0.00 ? 8  VAL A HG13 6  
ATOM 6908  H HG21 . VAL A 1 8  ? 20.990  1.035   14.292  1.00 0.00 ? 8  VAL A HG21 6  
ATOM 6909  H HG22 . VAL A 1 8  ? 21.287  2.726   13.888  1.00 0.00 ? 8  VAL A HG22 6  
ATOM 6910  H HG23 . VAL A 1 8  ? 21.524  1.474   12.669  1.00 0.00 ? 8  VAL A HG23 6  
ATOM 6911  N N    . TRP A 1 9  ? 17.605  0.470   10.834  1.00 0.00 ? 9  TRP A N    6  
ATOM 6912  C CA   . TRP A 1 9  ? 16.456  0.585   9.949   1.00 0.00 ? 9  TRP A CA   6  
ATOM 6913  C C    . TRP A 1 9  ? 15.492  -0.580  10.150  1.00 0.00 ? 9  TRP A C    6  
ATOM 6914  O O    . TRP A 1 9  ? 15.692  -1.664  9.603   1.00 0.00 ? 9  TRP A O    6  
ATOM 6915  C CB   . TRP A 1 9  ? 16.913  0.644   8.493   1.00 0.00 ? 9  TRP A CB   6  
ATOM 6916  C CG   . TRP A 1 9  ? 16.548  1.925   7.807   1.00 0.00 ? 9  TRP A CG   6  
ATOM 6917  C CD1  . TRP A 1 9  ? 16.452  3.162   8.377   1.00 0.00 ? 9  TRP A CD1  6  
ATOM 6918  C CD2  . TRP A 1 9  ? 16.229  2.095   6.421   1.00 0.00 ? 9  TRP A CD2  6  
ATOM 6919  N NE1  . TRP A 1 9  ? 16.094  4.091   7.430   1.00 0.00 ? 9  TRP A NE1  6  
ATOM 6920  C CE2  . TRP A 1 9  ? 15.950  3.461   6.221   1.00 0.00 ? 9  TRP A CE2  6  
ATOM 6921  C CE3  . TRP A 1 9  ? 16.152  1.225   5.329   1.00 0.00 ? 9  TRP A CE3  6  
ATOM 6922  C CZ2  . TRP A 1 9  ? 15.602  3.975   4.975   1.00 0.00 ? 9  TRP A CZ2  6  
ATOM 6923  C CZ3  . TRP A 1 9  ? 15.806  1.738   4.093   1.00 0.00 ? 9  TRP A CZ3  6  
ATOM 6924  C CH2  . TRP A 1 9  ? 15.535  3.101   3.925   1.00 0.00 ? 9  TRP A CH2  6  
ATOM 6925  H H    . TRP A 1 9  ? 18.466  0.201   10.463  1.00 0.00 ? 9  TRP A H    6  
ATOM 6926  H HA   . TRP A 1 9  ? 15.950  1.501   10.189  1.00 0.00 ? 9  TRP A HA   6  
ATOM 6927  H HB2  . TRP A 1 9  ? 17.985  0.542   8.458   1.00 0.00 ? 9  TRP A HB2  6  
ATOM 6928  H HB3  . TRP A 1 9  ? 16.459  -0.168  7.948   1.00 0.00 ? 9  TRP A HB3  6  
ATOM 6929  H HD1  . TRP A 1 9  ? 16.634  3.366   9.421   1.00 0.00 ? 9  TRP A HD1  6  
ATOM 6930  H HE1  . TRP A 1 9  ? 15.962  5.048   7.593   1.00 0.00 ? 9  TRP A HE1  6  
ATOM 6931  H HE3  . TRP A 1 9  ? 16.358  0.171   5.440   1.00 0.00 ? 9  TRP A HE3  6  
ATOM 6932  H HZ2  . TRP A 1 9  ? 15.390  5.024   4.829   1.00 0.00 ? 9  TRP A HZ2  6  
ATOM 6933  H HZ3  . TRP A 1 9  ? 15.741  1.081   3.238   1.00 0.00 ? 9  TRP A HZ3  6  
ATOM 6934  H HH2  . TRP A 1 9  ? 15.267  3.457   2.941   1.00 0.00 ? 9  TRP A HH2  6  
ATOM 6935  N N    . SER A 1 10 ? 14.446  -0.349  10.938  1.00 0.00 ? 10 SER A N    6  
ATOM 6936  C CA   . SER A 1 10 ? 13.450  -1.380  11.212  1.00 0.00 ? 10 SER A CA   6  
ATOM 6937  C C    . SER A 1 10 ? 12.836  -1.906  9.914   1.00 0.00 ? 10 SER A C    6  
ATOM 6938  O O    . SER A 1 10 ? 12.071  -1.203  9.254   1.00 0.00 ? 10 SER A O    6  
ATOM 6939  C CB   . SER A 1 10 ? 12.350  -0.825  12.119  1.00 0.00 ? 10 SER A CB   6  
ATOM 6940  O OG   . SER A 1 10 ? 11.844  -1.829  12.981  1.00 0.00 ? 10 SER A OG   6  
ATOM 6941  H H    . SER A 1 10 ? 14.341  0.536   11.346  1.00 0.00 ? 10 SER A H    6  
ATOM 6942  H HA   . SER A 1 10 ? 13.946  -2.192  11.721  1.00 0.00 ? 10 SER A HA   6  
ATOM 6943  H HB2  . SER A 1 10 ? 12.752  -0.022  12.719  1.00 0.00 ? 10 SER A HB2  6  
ATOM 6944  H HB3  . SER A 1 10 ? 11.541  -0.448  11.510  1.00 0.00 ? 10 SER A HB3  6  
ATOM 6945  H HG   . SER A 1 10 ? 11.000  -1.546  13.341  1.00 0.00 ? 10 SER A HG   6  
ATOM 6946  N N    . PRO A 1 11 ? 13.164  -3.153  9.527   1.00 0.00 ? 11 PRO A N    6  
ATOM 6947  C CA   . PRO A 1 11 ? 12.639  -3.760  8.301   1.00 0.00 ? 11 PRO A CA   6  
ATOM 6948  C C    . PRO A 1 11 ? 11.186  -4.205  8.439   1.00 0.00 ? 11 PRO A C    6  
ATOM 6949  O O    . PRO A 1 11 ? 10.510  -4.466  7.444   1.00 0.00 ? 11 PRO A O    6  
ATOM 6950  C CB   . PRO A 1 11 ? 13.549  -4.966  8.094   1.00 0.00 ? 11 PRO A CB   6  
ATOM 6951  C CG   . PRO A 1 11 ? 13.961  -5.352  9.467   1.00 0.00 ? 11 PRO A CG   6  
ATOM 6952  C CD   . PRO A 1 11 ? 14.071  -4.069  10.246  1.00 0.00 ? 11 PRO A CD   6  
ATOM 6953  H HA   . PRO A 1 11 ? 12.730  -3.095  7.464   1.00 0.00 ? 11 PRO A HA   6  
ATOM 6954  H HB2  . PRO A 1 11 ? 12.998  -5.758  7.606   1.00 0.00 ? 11 PRO A HB2  6  
ATOM 6955  H HB3  . PRO A 1 11 ? 14.398  -4.683  7.491   1.00 0.00 ? 11 PRO A HB3  6  
ATOM 6956  H HG2  . PRO A 1 11 ? 13.212  -5.991  9.905   1.00 0.00 ? 11 PRO A HG2  6  
ATOM 6957  H HG3  . PRO A 1 11 ? 14.915  -5.854  9.436   1.00 0.00 ? 11 PRO A HG3  6  
ATOM 6958  H HD2  . PRO A 1 11 ? 13.742  -4.216  11.264  1.00 0.00 ? 11 PRO A HD2  6  
ATOM 6959  H HD3  . PRO A 1 11 ? 15.086  -3.701  10.226  1.00 0.00 ? 11 PRO A HD3  6  
ATOM 6960  N N    . ASP A 1 12 ? 10.713  -4.291  9.677   1.00 0.00 ? 12 ASP A N    6  
ATOM 6961  C CA   . ASP A 1 12 ? 9.342   -4.708  9.943   1.00 0.00 ? 12 ASP A CA   6  
ATOM 6962  C C    . ASP A 1 12 ? 8.342   -3.694  9.402   1.00 0.00 ? 12 ASP A C    6  
ATOM 6963  O O    . ASP A 1 12 ? 7.189   -4.029  9.129   1.00 0.00 ? 12 ASP A O    6  
ATOM 6964  C CB   . ASP A 1 12 ? 9.129   -4.904  11.443  1.00 0.00 ? 12 ASP A CB   6  
ATOM 6965  C CG   . ASP A 1 12 ? 8.891   -6.356  11.810  1.00 0.00 ? 12 ASP A CG   6  
ATOM 6966  O OD1  . ASP A 1 12 ? 9.876   -7.121  11.871  1.00 0.00 ? 12 ASP A OD1  6  
ATOM 6967  O OD2  . ASP A 1 12 ? 7.721   -6.727  12.036  1.00 0.00 ? 12 ASP A OD2  6  
ATOM 6968  H H    . ASP A 1 12 ? 11.300  -4.073  10.428  1.00 0.00 ? 12 ASP A H    6  
ATOM 6969  H HA   . ASP A 1 12 ? 9.185   -5.645  9.446   1.00 0.00 ? 12 ASP A HA   6  
ATOM 6970  H HB2  . ASP A 1 12 ? 10.004  -4.560  11.965  1.00 0.00 ? 12 ASP A HB2  6  
ATOM 6971  H HB3  . ASP A 1 12 ? 8.274   -4.326  11.759  1.00 0.00 ? 12 ASP A HB3  6  
ATOM 6972  N N    . ILE A 1 13 ? 8.788   -2.455  9.249   1.00 0.00 ? 13 ILE A N    6  
ATOM 6973  C CA   . ILE A 1 13 ? 7.932   -1.397  8.740   1.00 0.00 ? 13 ILE A CA   6  
ATOM 6974  C C    . ILE A 1 13 ? 7.783   -1.514  7.234   1.00 0.00 ? 13 ILE A C    6  
ATOM 6975  O O    . ILE A 1 13 ? 6.677   -1.478  6.696   1.00 0.00 ? 13 ILE A O    6  
ATOM 6976  C CB   . ILE A 1 13 ? 8.468   0.005   9.129   1.00 0.00 ? 13 ILE A CB   6  
ATOM 6977  C CG1  . ILE A 1 13 ? 7.306   0.978   9.332   1.00 0.00 ? 13 ILE A CG1  6  
ATOM 6978  C CG2  . ILE A 1 13 ? 9.448   0.550   8.095   1.00 0.00 ? 13 ILE A CG2  6  
ATOM 6979  C CD1  . ILE A 1 13 ? 6.339   0.550   10.415  1.00 0.00 ? 13 ILE A CD1  6  
ATOM 6980  H H    . ILE A 1 13 ? 9.713   -2.250  9.481   1.00 0.00 ? 13 ILE A H    6  
ATOM 6981  H HA   . ILE A 1 13 ? 6.967   -1.526  9.186   1.00 0.00 ? 13 ILE A HA   6  
ATOM 6982  H HB   . ILE A 1 13 ? 9.002   -0.098  10.057  1.00 0.00 ? 13 ILE A HB   6  
ATOM 6983  H HG12 . ILE A 1 13 ? 7.699   1.946   9.604   1.00 0.00 ? 13 ILE A HG12 6  
ATOM 6984  H HG13 . ILE A 1 13 ? 6.753   1.066   8.408   1.00 0.00 ? 13 ILE A HG13 6  
ATOM 6985  H HG21 . ILE A 1 13 ? 9.783   1.531   8.401   1.00 0.00 ? 13 ILE A HG21 6  
ATOM 6986  H HG22 . ILE A 1 13 ? 8.959   0.621   7.135   1.00 0.00 ? 13 ILE A HG22 6  
ATOM 6987  H HG23 . ILE A 1 13 ? 10.298  -0.112  8.020   1.00 0.00 ? 13 ILE A HG23 6  
ATOM 6988  H HD11 . ILE A 1 13 ? 6.893   0.186   11.268  1.00 0.00 ? 13 ILE A HD11 6  
ATOM 6989  H HD12 . ILE A 1 13 ? 5.702   -0.236  10.038  1.00 0.00 ? 13 ILE A HD12 6  
ATOM 6990  H HD13 . ILE A 1 13 ? 5.734   1.393   10.712  1.00 0.00 ? 13 ILE A HD13 6  
ATOM 6991  N N    . GLU A 1 14 ? 8.910   -1.673  6.571   1.00 0.00 ? 14 GLU A N    6  
ATOM 6992  C CA   . GLU A 1 14 ? 8.932   -1.822  5.127   1.00 0.00 ? 14 GLU A CA   6  
ATOM 6993  C C    . GLU A 1 14 ? 8.338   -3.167  4.733   1.00 0.00 ? 14 GLU A C    6  
ATOM 6994  O O    . GLU A 1 14 ? 7.833   -3.337  3.623   1.00 0.00 ? 14 GLU A O    6  
ATOM 6995  C CB   . GLU A 1 14 ? 10.361  -1.698  4.594   1.00 0.00 ? 14 GLU A CB   6  
ATOM 6996  C CG   . GLU A 1 14 ? 10.443  -1.060  3.217   1.00 0.00 ? 14 GLU A CG   6  
ATOM 6997  C CD   . GLU A 1 14 ? 11.557  -1.643  2.370   1.00 0.00 ? 14 GLU A CD   6  
ATOM 6998  O OE1  . GLU A 1 14 ? 12.718  -1.213  2.536   1.00 0.00 ? 14 GLU A OE1  6  
ATOM 6999  O OE2  . GLU A 1 14 ? 11.269  -2.531  1.540   1.00 0.00 ? 14 GLU A OE2  6  
ATOM 7000  H H    . GLU A 1 14 ? 9.747   -1.704  7.072   1.00 0.00 ? 14 GLU A H    6  
ATOM 7001  H HA   . GLU A 1 14 ? 8.327   -1.039  4.707   1.00 0.00 ? 14 GLU A HA   6  
ATOM 7002  H HB2  . GLU A 1 14 ? 10.938  -1.097  5.281   1.00 0.00 ? 14 GLU A HB2  6  
ATOM 7003  H HB3  . GLU A 1 14 ? 10.798  -2.684  4.537   1.00 0.00 ? 14 GLU A HB3  6  
ATOM 7004  H HG2  . GLU A 1 14 ? 9.505   -1.214  2.706   1.00 0.00 ? 14 GLU A HG2  6  
ATOM 7005  H HG3  . GLU A 1 14 ? 10.618  0.000   3.335   1.00 0.00 ? 14 GLU A HG3  6  
ATOM 7006  N N    . GLN A 1 15 ? 8.394   -4.117  5.660   1.00 0.00 ? 15 GLN A N    6  
ATOM 7007  C CA   . GLN A 1 15 ? 7.857   -5.442  5.429   1.00 0.00 ? 15 GLN A CA   6  
ATOM 7008  C C    . GLN A 1 15 ? 6.346   -5.434  5.560   1.00 0.00 ? 15 GLN A C    6  
ATOM 7009  O O    . GLN A 1 15 ? 5.633   -6.049  4.768   1.00 0.00 ? 15 GLN A O    6  
ATOM 7010  C CB   . GLN A 1 15 ? 8.467   -6.429  6.400   1.00 0.00 ? 15 GLN A CB   6  
ATOM 7011  C CG   . GLN A 1 15 ? 9.656   -7.160  5.817   1.00 0.00 ? 15 GLN A CG   6  
ATOM 7012  C CD   . GLN A 1 15 ? 9.254   -8.353  4.973   1.00 0.00 ? 15 GLN A CD   6  
ATOM 7013  O OE1  . GLN A 1 15 ? 8.395   -8.248  4.098   1.00 0.00 ? 15 GLN A OE1  6  
ATOM 7014  N NE2  . GLN A 1 15 ? 9.876   -9.498  5.232   1.00 0.00 ? 15 GLN A NE2  6  
ATOM 7015  H H    . GLN A 1 15 ? 8.802   -3.917  6.524   1.00 0.00 ? 15 GLN A H    6  
ATOM 7016  H HA   . GLN A 1 15 ? 8.122   -5.732  4.442   1.00 0.00 ? 15 GLN A HA   6  
ATOM 7017  H HB2  . GLN A 1 15 ? 8.791   -5.893  7.272   1.00 0.00 ? 15 GLN A HB2  6  
ATOM 7018  H HB3  . GLN A 1 15 ? 7.722   -7.156  6.684   1.00 0.00 ? 15 GLN A HB3  6  
ATOM 7019  H HG2  . GLN A 1 15 ? 10.215  -6.472  5.202   1.00 0.00 ? 15 GLN A HG2  6  
ATOM 7020  H HG3  . GLN A 1 15 ? 10.273  -7.498  6.622   1.00 0.00 ? 15 GLN A HG3  6  
ATOM 7021  H HE21 . GLN A 1 15 ? 10.550  -9.507  5.943   1.00 0.00 ? 15 GLN A HE21 6  
ATOM 7022  H HE22 . GLN A 1 15 ? 9.637   -10.286 4.701   1.00 0.00 ? 15 GLN A HE22 6  
ATOM 7023  N N    . SER A 1 16 ? 5.871   -4.715  6.563   1.00 0.00 ? 16 SER A N    6  
ATOM 7024  C CA   . SER A 1 16 ? 4.444   -4.597  6.808   1.00 0.00 ? 16 SER A CA   6  
ATOM 7025  C C    . SER A 1 16 ? 3.781   -3.811  5.685   1.00 0.00 ? 16 SER A C    6  
ATOM 7026  O O    . SER A 1 16 ? 2.589   -3.968  5.419   1.00 0.00 ? 16 SER A O    6  
ATOM 7027  C CB   . SER A 1 16 ? 4.185   -3.916  8.152   1.00 0.00 ? 16 SER A CB   6  
ATOM 7028  O OG   . SER A 1 16 ? 4.379   -4.818  9.228   1.00 0.00 ? 16 SER A OG   6  
ATOM 7029  H H    . SER A 1 16 ? 6.499   -4.243  7.146   1.00 0.00 ? 16 SER A H    6  
ATOM 7030  H HA   . SER A 1 16 ? 4.031   -5.590  6.828   1.00 0.00 ? 16 SER A HA   6  
ATOM 7031  H HB2  . SER A 1 16 ? 4.865   -3.085  8.270   1.00 0.00 ? 16 SER A HB2  6  
ATOM 7032  H HB3  . SER A 1 16 ? 3.167   -3.555  8.180   1.00 0.00 ? 16 SER A HB3  6  
ATOM 7033  H HG   . SER A 1 16 ? 5.311   -4.851  9.454   1.00 0.00 ? 16 SER A HG   6  
ATOM 7034  N N    . PHE A 1 17 ? 4.567   -2.965  5.026   1.00 0.00 ? 17 PHE A N    6  
ATOM 7035  C CA   . PHE A 1 17 ? 4.067   -2.154  3.929   1.00 0.00 ? 17 PHE A CA   6  
ATOM 7036  C C    . PHE A 1 17 ? 3.782   -3.013  2.709   1.00 0.00 ? 17 PHE A C    6  
ATOM 7037  O O    . PHE A 1 17 ? 2.806   -2.792  1.994   1.00 0.00 ? 17 PHE A O    6  
ATOM 7038  C CB   . PHE A 1 17 ? 5.066   -1.054  3.584   1.00 0.00 ? 17 PHE A CB   6  
ATOM 7039  C CG   . PHE A 1 17 ? 4.618   0.318   4.001   1.00 0.00 ? 17 PHE A CG   6  
ATOM 7040  C CD1  . PHE A 1 17 ? 4.072   0.529   5.257   1.00 0.00 ? 17 PHE A CD1  6  
ATOM 7041  C CD2  . PHE A 1 17 ? 4.746   1.395   3.139   1.00 0.00 ? 17 PHE A CD2  6  
ATOM 7042  C CE1  . PHE A 1 17 ? 3.660   1.789   5.645   1.00 0.00 ? 17 PHE A CE1  6  
ATOM 7043  C CE2  . PHE A 1 17 ? 4.335   2.658   3.522   1.00 0.00 ? 17 PHE A CE2  6  
ATOM 7044  C CZ   . PHE A 1 17 ? 3.792   2.855   4.777   1.00 0.00 ? 17 PHE A CZ   6  
ATOM 7045  H H    . PHE A 1 17 ? 5.507   -2.888  5.285   1.00 0.00 ? 17 PHE A H    6  
ATOM 7046  H HA   . PHE A 1 17 ? 3.154   -1.706  4.251   1.00 0.00 ? 17 PHE A HA   6  
ATOM 7047  H HB2  . PHE A 1 17 ? 5.995   -1.262  4.085   1.00 0.00 ? 17 PHE A HB2  6  
ATOM 7048  H HB3  . PHE A 1 17 ? 5.231   -1.042  2.517   1.00 0.00 ? 17 PHE A HB3  6  
ATOM 7049  H HD1  . PHE A 1 17 ? 3.969   -0.304  5.937   1.00 0.00 ? 17 PHE A HD1  6  
ATOM 7050  H HD2  . PHE A 1 17 ? 5.170   1.241   2.158   1.00 0.00 ? 17 PHE A HD2  6  
ATOM 7051  H HE1  . PHE A 1 17 ? 3.235   1.941   6.626   1.00 0.00 ? 17 PHE A HE1  6  
ATOM 7052  H HE2  . PHE A 1 17 ? 4.440   3.489   2.841   1.00 0.00 ? 17 PHE A HE2  6  
ATOM 7053  H HZ   . PHE A 1 17 ? 3.470   3.841   5.078   1.00 0.00 ? 17 PHE A HZ   6  
ATOM 7054  N N    . GLN A 1 18 ? 4.635   -4.000  2.485   1.00 0.00 ? 18 GLN A N    6  
ATOM 7055  C CA   . GLN A 1 18 ? 4.463   -4.901  1.355   1.00 0.00 ? 18 GLN A CA   6  
ATOM 7056  C C    . GLN A 1 18 ? 3.214   -5.750  1.542   1.00 0.00 ? 18 GLN A C    6  
ATOM 7057  O O    . GLN A 1 18 ? 2.615   -6.214  0.573   1.00 0.00 ? 18 GLN A O    6  
ATOM 7058  C CB   . GLN A 1 18 ? 5.686   -5.804  1.183   1.00 0.00 ? 18 GLN A CB   6  
ATOM 7059  C CG   . GLN A 1 18 ? 5.467   -6.935  0.188   1.00 0.00 ? 18 GLN A CG   6  
ATOM 7060  C CD   . GLN A 1 18 ? 6.766   -7.558  -0.285  1.00 0.00 ? 18 GLN A CD   6  
ATOM 7061  O OE1  . GLN A 1 18 ? 7.309   -8.455  0.361   1.00 0.00 ? 18 GLN A OE1  6  
ATOM 7062  N NE2  . GLN A 1 18 ? 7.271   -7.085  -1.418  1.00 0.00 ? 18 GLN A NE2  6  
ATOM 7063  H H    . GLN A 1 18 ? 5.387   -4.130  3.097   1.00 0.00 ? 18 GLN A H    6  
ATOM 7064  H HA   . GLN A 1 18 ? 4.343   -4.298  0.473   1.00 0.00 ? 18 GLN A HA   6  
ATOM 7065  H HB2  . GLN A 1 18 ? 6.517   -5.205  0.839   1.00 0.00 ? 18 GLN A HB2  6  
ATOM 7066  H HB3  . GLN A 1 18 ? 5.938   -6.238  2.139   1.00 0.00 ? 18 GLN A HB3  6  
ATOM 7067  H HG2  . GLN A 1 18 ? 4.867   -7.700  0.660   1.00 0.00 ? 18 GLN A HG2  6  
ATOM 7068  H HG3  . GLN A 1 18 ? 4.937   -6.545  -0.669  1.00 0.00 ? 18 GLN A HG3  6  
ATOM 7069  H HE21 . GLN A 1 18 ? 6.785   -6.370  -1.879  1.00 0.00 ? 18 GLN A HE21 6  
ATOM 7070  H HE22 . GLN A 1 18 ? 8.110   -7.470  -1.747  1.00 0.00 ? 18 GLN A HE22 6  
ATOM 7071  N N    . GLU A 1 19 ? 2.831   -5.951  2.794   1.00 0.00 ? 19 GLU A N    6  
ATOM 7072  C CA   . GLU A 1 19 ? 1.656   -6.745  3.109   1.00 0.00 ? 19 GLU A CA   6  
ATOM 7073  C C    . GLU A 1 19 ? 0.394   -6.042  2.641   1.00 0.00 ? 19 GLU A C    6  
ATOM 7074  O O    . GLU A 1 19 ? -0.544  -6.679  2.165   1.00 0.00 ? 19 GLU A O    6  
ATOM 7075  C CB   . GLU A 1 19 ? 1.586   -7.025  4.608   1.00 0.00 ? 19 GLU A CB   6  
ATOM 7076  C CG   . GLU A 1 19 ? 1.614   -8.506  4.952   1.00 0.00 ? 19 GLU A CG   6  
ATOM 7077  C CD   . GLU A 1 19 ? 3.004   -9.102  4.846   1.00 0.00 ? 19 GLU A CD   6  
ATOM 7078  O OE1  . GLU A 1 19 ? 3.750   -9.053  5.846   1.00 0.00 ? 19 GLU A OE1  6  
ATOM 7079  O OE2  . GLU A 1 19 ? 3.346   -9.619  3.762   1.00 0.00 ? 19 GLU A OE2  6  
ATOM 7080  H H    . GLU A 1 19 ? 3.351   -5.558  3.522   1.00 0.00 ? 19 GLU A H    6  
ATOM 7081  H HA   . GLU A 1 19 ? 1.741   -7.671  2.585   1.00 0.00 ? 19 GLU A HA   6  
ATOM 7082  H HB2  . GLU A 1 19 ? 2.427   -6.551  5.089   1.00 0.00 ? 19 GLU A HB2  6  
ATOM 7083  H HB3  . GLU A 1 19 ? 0.674   -6.605  4.999   1.00 0.00 ? 19 GLU A HB3  6  
ATOM 7084  H HG2  . GLU A 1 19 ? 1.261   -8.634  5.965   1.00 0.00 ? 19 GLU A HG2  6  
ATOM 7085  H HG3  . GLU A 1 19 ? 0.959   -9.032  4.274   1.00 0.00 ? 19 GLU A HG3  6  
ATOM 7086  N N    . ALA A 1 20 ? 0.384   -4.726  2.769   1.00 0.00 ? 20 ALA A N    6  
ATOM 7087  C CA   . ALA A 1 20 ? -0.758  -3.936  2.346   1.00 0.00 ? 20 ALA A CA   6  
ATOM 7088  C C    . ALA A 1 20 ? -0.736  -3.731  0.842   1.00 0.00 ? 20 ALA A C    6  
ATOM 7089  O O    . ALA A 1 20 ? -1.780  -3.648  0.196   1.00 0.00 ? 20 ALA A O    6  
ATOM 7090  C CB   . ALA A 1 20 ? -0.785  -2.600  3.073   1.00 0.00 ? 20 ALA A CB   6  
ATOM 7091  H H    . ALA A 1 20 ? 1.164   -4.279  3.147   1.00 0.00 ? 20 ALA A H    6  
ATOM 7092  H HA   . ALA A 1 20 ? -1.642  -4.484  2.605   1.00 0.00 ? 20 ALA A HA   6  
ATOM 7093  H HB1  . ALA A 1 20 ? -0.274  -2.694  4.020   1.00 0.00 ? 20 ALA A HB1  6  
ATOM 7094  H HB2  . ALA A 1 20 ? -1.810  -2.305  3.245   1.00 0.00 ? 20 ALA A HB2  6  
ATOM 7095  H HB3  . ALA A 1 20 ? -0.292  -1.852  2.470   1.00 0.00 ? 20 ALA A HB3  6  
ATOM 7096  N N    . LEU A 1 21 ? 0.466   -3.669  0.289   1.00 0.00 ? 21 LEU A N    6  
ATOM 7097  C CA   . LEU A 1 21 ? 0.638   -3.494  -1.140  1.00 0.00 ? 21 LEU A CA   6  
ATOM 7098  C C    . LEU A 1 21 ? 0.469   -4.826  -1.858  1.00 0.00 ? 21 LEU A C    6  
ATOM 7099  O O    . LEU A 1 21 ? 0.047   -4.874  -3.013  1.00 0.00 ? 21 LEU A O    6  
ATOM 7100  C CB   . LEU A 1 21 ? 2.007   -2.890  -1.446  1.00 0.00 ? 21 LEU A CB   6  
ATOM 7101  C CG   . LEU A 1 21 ? 1.970   -1.507  -2.098  1.00 0.00 ? 21 LEU A CG   6  
ATOM 7102  C CD1  . LEU A 1 21 ? 1.129   -1.539  -3.365  1.00 0.00 ? 21 LEU A CD1  6  
ATOM 7103  C CD2  . LEU A 1 21 ? 1.428   -0.473  -1.122  1.00 0.00 ? 21 LEU A CD2  6  
ATOM 7104  H H    . LEU A 1 21 ? 1.253   -3.753  0.857   1.00 0.00 ? 21 LEU A H    6  
ATOM 7105  H HA   . LEU A 1 21 ? -0.122  -2.822  -1.476  1.00 0.00 ? 21 LEU A HA   6  
ATOM 7106  H HB2  . LEU A 1 21 ? 2.554   -2.814  -0.521  1.00 0.00 ? 21 LEU A HB2  6  
ATOM 7107  H HB3  . LEU A 1 21 ? 2.535   -3.560  -2.106  1.00 0.00 ? 21 LEU A HB3  6  
ATOM 7108  H HG   . LEU A 1 21 ? 2.974   -1.217  -2.371  1.00 0.00 ? 21 LEU A HG   6  
ATOM 7109  H HD11 . LEU A 1 21 ? 0.094   -1.357  -3.116  1.00 0.00 ? 21 LEU A HD11 6  
ATOM 7110  H HD12 . LEU A 1 21 ? 1.222   -2.507  -3.835  1.00 0.00 ? 21 LEU A HD12 6  
ATOM 7111  H HD13 . LEU A 1 21 ? 1.475   -0.774  -4.046  1.00 0.00 ? 21 LEU A HD13 6  
ATOM 7112  H HD21 . LEU A 1 21 ? 1.800   0.504   -1.388  1.00 0.00 ? 21 LEU A HD21 6  
ATOM 7113  H HD22 . LEU A 1 21 ? 1.749   -0.720  -0.120  1.00 0.00 ? 21 LEU A HD22 6  
ATOM 7114  H HD23 . LEU A 1 21 ? 0.348   -0.470  -1.162  1.00 0.00 ? 21 LEU A HD23 6  
ATOM 7115  N N    . SER A 1 22 ? 0.789   -5.906  -1.156  1.00 0.00 ? 22 SER A N    6  
ATOM 7116  C CA   . SER A 1 22 ? 0.660   -7.242  -1.710  1.00 0.00 ? 22 SER A CA   6  
ATOM 7117  C C    . SER A 1 22 ? -0.795  -7.674  -1.690  1.00 0.00 ? 22 SER A C    6  
ATOM 7118  O O    . SER A 1 22 ? -1.272  -8.353  -2.599  1.00 0.00 ? 22 SER A O    6  
ATOM 7119  C CB   . SER A 1 22 ? 1.516   -8.235  -0.921  1.00 0.00 ? 22 SER A CB   6  
ATOM 7120  O OG   . SER A 1 22 ? 1.166   -8.232  0.452   1.00 0.00 ? 22 SER A OG   6  
ATOM 7121  H H    . SER A 1 22 ? 1.108   -5.802  -0.238  1.00 0.00 ? 22 SER A H    6  
ATOM 7122  H HA   . SER A 1 22 ? 1.000   -7.208  -2.725  1.00 0.00 ? 22 SER A HA   6  
ATOM 7123  H HB2  . SER A 1 22 ? 1.364   -9.228  -1.315  1.00 0.00 ? 22 SER A HB2  6  
ATOM 7124  H HB3  . SER A 1 22 ? 2.557   -7.964  -1.016  1.00 0.00 ? 22 SER A HB3  6  
ATOM 7125  H HG   . SER A 1 22 ? 0.816   -9.091  0.695   1.00 0.00 ? 22 SER A HG   6  
ATOM 7126  N N    . ILE A 1 23 ? -1.493  -7.263  -0.642  1.00 0.00 ? 23 ILE A N    6  
ATOM 7127  C CA   . ILE A 1 23 ? -2.901  -7.589  -0.485  1.00 0.00 ? 23 ILE A CA   6  
ATOM 7128  C C    . ILE A 1 23 ? -3.764  -6.650  -1.318  1.00 0.00 ? 23 ILE A C    6  
ATOM 7129  O O    . ILE A 1 23 ? -4.775  -7.053  -1.895  1.00 0.00 ? 23 ILE A O    6  
ATOM 7130  C CB   . ILE A 1 23 ? -3.327  -7.529  1.001   1.00 0.00 ? 23 ILE A CB   6  
ATOM 7131  C CG1  . ILE A 1 23 ? -4.207  -8.731  1.351   1.00 0.00 ? 23 ILE A CG1  6  
ATOM 7132  C CG2  . ILE A 1 23 ? -4.048  -6.227  1.328   1.00 0.00 ? 23 ILE A CG2  6  
ATOM 7133  C CD1  . ILE A 1 23 ? -3.419  -9.981  1.679   1.00 0.00 ? 23 ILE A CD1  6  
ATOM 7134  H H    . ILE A 1 23 ? -1.047  -6.722  0.039   1.00 0.00 ? 23 ILE A H    6  
ATOM 7135  H HA   . ILE A 1 23 ? -3.041  -8.591  -0.838  1.00 0.00 ? 23 ILE A HA   6  
ATOM 7136  H HB   . ILE A 1 23 ? -2.434  -7.566  1.599   1.00 0.00 ? 23 ILE A HB   6  
ATOM 7137  H HG12 . ILE A 1 23 ? -4.814  -8.488  2.210   1.00 0.00 ? 23 ILE A HG12 6  
ATOM 7138  H HG13 . ILE A 1 23 ? -4.850  -8.954  0.512   1.00 0.00 ? 23 ILE A HG13 6  
ATOM 7139  H HG21 . ILE A 1 23 ? -5.019  -6.226  0.857   1.00 0.00 ? 23 ILE A HG21 6  
ATOM 7140  H HG22 . ILE A 1 23 ? -3.468  -5.393  0.960   1.00 0.00 ? 23 ILE A HG22 6  
ATOM 7141  H HG23 . ILE A 1 23 ? -4.165  -6.139  2.398   1.00 0.00 ? 23 ILE A HG23 6  
ATOM 7142  H HD11 . ILE A 1 23 ? -3.587  -10.724 0.913   1.00 0.00 ? 23 ILE A HD11 6  
ATOM 7143  H HD12 . ILE A 1 23 ? -3.742  -10.369 2.634   1.00 0.00 ? 23 ILE A HD12 6  
ATOM 7144  H HD13 . ILE A 1 23 ? -2.367  -9.742  1.725   1.00 0.00 ? 23 ILE A HD13 6  
ATOM 7145  N N    . TYR A 1 24 ? -3.344  -5.396  -1.371  1.00 0.00 ? 24 TYR A N    6  
ATOM 7146  C CA   . TYR A 1 24 ? -4.047  -4.374  -2.127  1.00 0.00 ? 24 TYR A CA   6  
ATOM 7147  C C    . TYR A 1 24 ? -3.173  -3.825  -3.251  1.00 0.00 ? 24 TYR A C    6  
ATOM 7148  O O    . TYR A 1 24 ? -2.508  -2.801  -3.087  1.00 0.00 ? 24 TYR A O    6  
ATOM 7149  C CB   . TYR A 1 24 ? -4.488  -3.238  -1.217  1.00 0.00 ? 24 TYR A CB   6  
ATOM 7150  C CG   . TYR A 1 24 ? -5.263  -3.687  0.000   1.00 0.00 ? 24 TYR A CG   6  
ATOM 7151  C CD1  . TYR A 1 24 ? -6.419  -4.447  -0.128  1.00 0.00 ? 24 TYR A CD1  6  
ATOM 7152  C CD2  . TYR A 1 24 ? -4.838  -3.349  1.278   1.00 0.00 ? 24 TYR A CD2  6  
ATOM 7153  C CE1  . TYR A 1 24 ? -7.129  -4.857  0.984   1.00 0.00 ? 24 TYR A CE1  6  
ATOM 7154  C CE2  . TYR A 1 24 ? -5.542  -3.755  2.395   1.00 0.00 ? 24 TYR A CE2  6  
ATOM 7155  C CZ   . TYR A 1 24 ? -6.687  -4.509  2.243   1.00 0.00 ? 24 TYR A CZ   6  
ATOM 7156  O OH   . TYR A 1 24 ? -7.391  -4.917  3.353   1.00 0.00 ? 24 TYR A OH   6  
ATOM 7157  H H    . TYR A 1 24 ? -2.536  -5.157  -0.889  1.00 0.00 ? 24 TYR A H    6  
ATOM 7158  H HA   . TYR A 1 24 ? -4.911  -4.825  -2.550  1.00 0.00 ? 24 TYR A HA   6  
ATOM 7159  H HB2  . TYR A 1 24 ? -3.618  -2.720  -0.879  1.00 0.00 ? 24 TYR A HB2  6  
ATOM 7160  H HB3  . TYR A 1 24 ? -5.112  -2.557  -1.777  1.00 0.00 ? 24 TYR A HB3  6  
ATOM 7161  H HD1  . TYR A 1 24 ? -6.762  -4.718  -1.116  1.00 0.00 ? 24 TYR A HD1  6  
ATOM 7162  H HD2  . TYR A 1 24 ? -3.942  -2.758  1.393   1.00 0.00 ? 24 TYR A HD2  6  
ATOM 7163  H HE1  . TYR A 1 24 ? -8.026  -5.448  0.865   1.00 0.00 ? 24 TYR A HE1  6  
ATOM 7164  H HE2  . TYR A 1 24 ? -5.195  -3.481  3.381   1.00 0.00 ? 24 TYR A HE2  6  
ATOM 7165  H HH   . TYR A 1 24 ? -7.323  -4.250  4.041   1.00 0.00 ? 24 TYR A HH   6  
ATOM 7166  N N    . PRO A 1 25 ? -3.160  -4.499  -4.414  1.00 0.00 ? 25 PRO A N    6  
ATOM 7167  C CA   . PRO A 1 25 ? -2.369  -4.082  -5.562  1.00 0.00 ? 25 PRO A CA   6  
ATOM 7168  C C    . PRO A 1 25 ? -3.090  -3.040  -6.415  1.00 0.00 ? 25 PRO A C    6  
ATOM 7169  O O    . PRO A 1 25 ? -4.304  -2.866  -6.303  1.00 0.00 ? 25 PRO A O    6  
ATOM 7170  C CB   . PRO A 1 25 ? -2.167  -5.380  -6.356  1.00 0.00 ? 25 PRO A CB   6  
ATOM 7171  C CG   . PRO A 1 25 ? -3.073  -6.408  -5.746  1.00 0.00 ? 25 PRO A CG   6  
ATOM 7172  C CD   . PRO A 1 25 ? -3.912  -5.719  -4.704  1.00 0.00 ? 25 PRO A CD   6  
ATOM 7173  H HA   . PRO A 1 25 ? -1.410  -3.692  -5.258  1.00 0.00 ? 25 PRO A HA   6  
ATOM 7174  H HB2  . PRO A 1 25 ? -2.415  -5.209  -7.392  1.00 0.00 ? 25 PRO A HB2  6  
ATOM 7175  H HB3  . PRO A 1 25 ? -1.136  -5.682  -6.279  1.00 0.00 ? 25 PRO A HB3  6  
ATOM 7176  H HG2  . PRO A 1 25 ? -3.709  -6.828  -6.510  1.00 0.00 ? 25 PRO A HG2  6  
ATOM 7177  H HG3  . PRO A 1 25 ? -2.480  -7.186  -5.289  1.00 0.00 ? 25 PRO A HG3  6  
ATOM 7178  H HD2  . PRO A 1 25 ? -4.888  -5.485  -5.099  1.00 0.00 ? 25 PRO A HD2  6  
ATOM 7179  H HD3  . PRO A 1 25 ? -3.997  -6.336  -3.824  1.00 0.00 ? 25 PRO A HD3  6  
ATOM 7180  N N    . PRO A 1 26 ? -2.348  -2.330  -7.282  1.00 0.00 ? 26 PRO A N    6  
ATOM 7181  C CA   . PRO A 1 26 ? -2.919  -1.301  -8.157  1.00 0.00 ? 26 PRO A CA   6  
ATOM 7182  C C    . PRO A 1 26 ? -3.824  -1.883  -9.239  1.00 0.00 ? 26 PRO A C    6  
ATOM 7183  O O    . PRO A 1 26 ? -4.526  -1.148  -9.934  1.00 0.00 ? 26 PRO A O    6  
ATOM 7184  C CB   . PRO A 1 26 ? -1.691  -0.644  -8.785  1.00 0.00 ? 26 PRO A CB   6  
ATOM 7185  C CG   . PRO A 1 26 ? -0.641  -1.693  -8.737  1.00 0.00 ? 26 PRO A CG   6  
ATOM 7186  C CD   . PRO A 1 26 ? -0.894  -2.474  -7.479  1.00 0.00 ? 26 PRO A CD   6  
ATOM 7187  H HA   . PRO A 1 26 ? -3.466  -0.568  -7.591  1.00 0.00 ? 26 PRO A HA   6  
ATOM 7188  H HB2  . PRO A 1 26 ? -1.915  -0.352  -9.801  1.00 0.00 ? 26 PRO A HB2  6  
ATOM 7189  H HB3  . PRO A 1 26 ? -1.408  0.224   -8.208  1.00 0.00 ? 26 PRO A HB3  6  
ATOM 7190  H HG2  . PRO A 1 26 ? -0.729  -2.334  -9.599  1.00 0.00 ? 26 PRO A HG2  6  
ATOM 7191  H HG3  . PRO A 1 26 ? 0.334   -1.234  -8.704  1.00 0.00 ? 26 PRO A HG3  6  
ATOM 7192  H HD2  . PRO A 1 26 ? -0.624  -3.511  -7.616  1.00 0.00 ? 26 PRO A HD2  6  
ATOM 7193  H HD3  . PRO A 1 26 ? -0.349  -2.045  -6.651  1.00 0.00 ? 26 PRO A HD3  6  
ATOM 7194  N N    . CYS A 1 27 ? -3.806  -3.206  -9.379  1.00 0.00 ? 27 CYS A N    6  
ATOM 7195  C CA   . CYS A 1 27 ? -4.623  -3.878  -10.373 1.00 0.00 ? 27 CYS A CA   6  
ATOM 7196  C C    . CYS A 1 27 ? -5.127  -5.220  -9.851  1.00 0.00 ? 27 CYS A C    6  
ATOM 7197  O O    . CYS A 1 27 ? -4.584  -5.768  -8.892  1.00 0.00 ? 27 CYS A O    6  
ATOM 7198  C CB   . CYS A 1 27 ? -3.832  -4.078  -11.663 1.00 0.00 ? 27 CYS A CB   6  
ATOM 7199  S SG   . CYS A 1 27 ? -4.565  -3.279  -13.110 1.00 0.00 ? 27 CYS A SG   6  
ATOM 7200  H H    . CYS A 1 27 ? -3.233  -3.740  -8.803  1.00 0.00 ? 27 CYS A H    6  
ATOM 7201  H HA   . CYS A 1 27 ? -5.464  -3.249  -10.578 1.00 0.00 ? 27 CYS A HA   6  
ATOM 7202  H HB2  . CYS A 1 27 ? -2.841  -3.674  -11.533 1.00 0.00 ? 27 CYS A HB2  6  
ATOM 7203  H HB3  . CYS A 1 27 ? -3.761  -5.133  -11.871 1.00 0.00 ? 27 CYS A HB3  6  
ATOM 7204  H HG   . CYS A 1 27 ? -3.855  -2.887  -13.624 1.00 0.00 ? 27 CYS A HG   6  
ATOM 7205  N N    . GLY A 1 28 ? -6.170  -5.742  -10.487 1.00 0.00 ? 28 GLY A N    6  
ATOM 7206  C CA   . GLY A 1 28 ? -6.732  -7.014  -10.073 1.00 0.00 ? 28 GLY A CA   6  
ATOM 7207  C C    . GLY A 1 28 ? -8.024  -6.851  -9.297  1.00 0.00 ? 28 GLY A C    6  
ATOM 7208  O O    . GLY A 1 28 ? -8.980  -7.598  -9.504  1.00 0.00 ? 28 GLY A O    6  
ATOM 7209  H H    . GLY A 1 28 ? -6.562  -5.259  -11.245 1.00 0.00 ? 28 GLY A H    6  
ATOM 7210  H HA2  . GLY A 1 28 ? -6.925  -7.614  -10.950 1.00 0.00 ? 28 GLY A HA2  6  
ATOM 7211  H HA3  . GLY A 1 28 ? -6.014  -7.527  -9.450  1.00 0.00 ? 28 GLY A HA3  6  
ATOM 7212  N N    . ARG A 1 29 ? -8.053  -5.869  -8.402  1.00 0.00 ? 29 ARG A N    6  
ATOM 7213  C CA   . ARG A 1 29 ? -9.237  -5.607  -7.592  1.00 0.00 ? 29 ARG A CA   6  
ATOM 7214  C C    . ARG A 1 29 ? -10.422 -5.219  -8.471  1.00 0.00 ? 29 ARG A C    6  
ATOM 7215  O O    . ARG A 1 29 ? -10.355 -5.316  -9.697  1.00 0.00 ? 29 ARG A O    6  
ATOM 7216  C CB   . ARG A 1 29 ? -8.950  -4.497  -6.578  1.00 0.00 ? 29 ARG A CB   6  
ATOM 7217  C CG   . ARG A 1 29 ? -8.669  -3.146  -7.217  1.00 0.00 ? 29 ARG A CG   6  
ATOM 7218  C CD   . ARG A 1 29 ? -9.849  -2.199  -7.064  1.00 0.00 ? 29 ARG A CD   6  
ATOM 7219  N NE   . ARG A 1 29 ? -9.653  -1.253  -5.968  1.00 0.00 ? 29 ARG A NE   6  
ATOM 7220  C CZ   . ARG A 1 29 ? -10.350 -0.128  -5.826  1.00 0.00 ? 29 ARG A CZ   6  
ATOM 7221  N NH1  . ARG A 1 29 ? -11.290 0.194   -6.707  1.00 0.00 ? 29 ARG A NH1  6  
ATOM 7222  N NH2  . ARG A 1 29 ? -10.109 0.677   -4.800  1.00 0.00 ? 29 ARG A NH2  6  
ATOM 7223  H H    . ARG A 1 29 ? -7.260  -5.307  -8.283  1.00 0.00 ? 29 ARG A H    6  
ATOM 7224  H HA   . ARG A 1 29 ? -9.481  -6.514  -7.060  1.00 0.00 ? 29 ARG A HA   6  
ATOM 7225  H HB2  . ARG A 1 29 ? -9.802  -4.393  -5.923  1.00 0.00 ? 29 ARG A HB2  6  
ATOM 7226  H HB3  . ARG A 1 29 ? -8.089  -4.779  -5.990  1.00 0.00 ? 29 ARG A HB3  6  
ATOM 7227  H HG2  . ARG A 1 29 ? -7.805  -2.707  -6.741  1.00 0.00 ? 29 ARG A HG2  6  
ATOM 7228  H HG3  . ARG A 1 29 ? -8.469  -3.291  -8.268  1.00 0.00 ? 29 ARG A HG3  6  
ATOM 7229  H HD2  . ARG A 1 29 ? -9.973  -1.648  -7.984  1.00 0.00 ? 29 ARG A HD2  6  
ATOM 7230  H HD3  . ARG A 1 29 ? -10.738 -2.781  -6.870  1.00 0.00 ? 29 ARG A HD3  6  
ATOM 7231  H HE   . ARG A 1 29 ? -8.965  -1.466  -5.303  1.00 0.00 ? 29 ARG A HE   6  
ATOM 7232  H HH11 . ARG A 1 29 ? -11.477 -0.408  -7.483  1.00 0.00 ? 29 ARG A HH11 6  
ATOM 7233  H HH12 . ARG A 1 29 ? -11.810 1.040   -6.595  1.00 0.00 ? 29 ARG A HH12 6  
ATOM 7234  H HH21 . ARG A 1 29 ? -9.402  0.439   -4.134  1.00 0.00 ? 29 ARG A HH21 6  
ATOM 7235  H HH22 . ARG A 1 29 ? -10.633 1.522   -4.694  1.00 0.00 ? 29 ARG A HH22 6  
ATOM 7236  N N    . ARG A 1 30 ? -11.504 -4.776  -7.839  1.00 0.00 ? 30 ARG A N    6  
ATOM 7237  C CA   . ARG A 1 30 ? -12.697 -4.371  -8.561  1.00 0.00 ? 30 ARG A CA   6  
ATOM 7238  C C    . ARG A 1 30 ? -13.330 -3.140  -7.921  1.00 0.00 ? 30 ARG A C    6  
ATOM 7239  O O    . ARG A 1 30 ? -13.659 -3.144  -6.735  1.00 0.00 ? 30 ARG A O    6  
ATOM 7240  C CB   . ARG A 1 30 ? -13.709 -5.519  -8.605  1.00 0.00 ? 30 ARG A CB   6  
ATOM 7241  C CG   . ARG A 1 30 ? -14.469 -5.609  -9.918  1.00 0.00 ? 30 ARG A CG   6  
ATOM 7242  C CD   . ARG A 1 30 ? -15.442 -6.777  -9.919  1.00 0.00 ? 30 ARG A CD   6  
ATOM 7243  N NE   . ARG A 1 30 ? -15.524 -7.420  -11.228 1.00 0.00 ? 30 ARG A NE   6  
ATOM 7244  C CZ   . ARG A 1 30 ? -14.618 -8.279  -11.690 1.00 0.00 ? 30 ARG A CZ   6  
ATOM 7245  N NH1  . ARG A 1 30 ? -13.561 -8.600  -10.954 1.00 0.00 ? 30 ARG A NH1  6  
ATOM 7246  N NH2  . ARG A 1 30 ? -14.769 -8.820  -12.891 1.00 0.00 ? 30 ARG A NH2  6  
ATOM 7247  H H    . ARG A 1 30 ? -11.498 -4.717  -6.868  1.00 0.00 ? 30 ARG A H    6  
ATOM 7248  H HA   . ARG A 1 30 ? -12.400 -4.127  -9.563  1.00 0.00 ? 30 ARG A HA   6  
ATOM 7249  H HB2  . ARG A 1 30 ? -13.185 -6.451  -8.453  1.00 0.00 ? 30 ARG A HB2  6  
ATOM 7250  H HB3  . ARG A 1 30 ? -14.425 -5.383  -7.808  1.00 0.00 ? 30 ARG A HB3  6  
ATOM 7251  H HG2  . ARG A 1 30 ? -15.022 -4.693  -10.066 1.00 0.00 ? 30 ARG A HG2  6  
ATOM 7252  H HG3  . ARG A 1 30 ? -13.762 -5.739  -10.724 1.00 0.00 ? 30 ARG A HG3  6  
ATOM 7253  H HD2  . ARG A 1 30 ? -15.112 -7.504  -9.192  1.00 0.00 ? 30 ARG A HD2  6  
ATOM 7254  H HD3  . ARG A 1 30 ? -16.421 -6.413  -9.645  1.00 0.00 ? 30 ARG A HD3  6  
ATOM 7255  H HE   . ARG A 1 30 ? -16.294 -7.201  -11.793 1.00 0.00 ? 30 ARG A HE   6  
ATOM 7256  H HH11 . ARG A 1 30 ? -13.441 -8.196  -10.047 1.00 0.00 ? 30 ARG A HH11 6  
ATOM 7257  H HH12 . ARG A 1 30 ? -12.884 -9.246  -11.306 1.00 0.00 ? 30 ARG A HH12 6  
ATOM 7258  H HH21 . ARG A 1 30 ? -15.564 -8.582  -13.450 1.00 0.00 ? 30 ARG A HH21 6  
ATOM 7259  H HH22 . ARG A 1 30 ? -14.089 -9.465  -13.239 1.00 0.00 ? 30 ARG A HH22 6  
ATOM 7260  N N    . LYS A 1 31 ? -13.498 -2.087  -8.715  1.00 0.00 ? 31 LYS A N    6  
ATOM 7261  C CA   . LYS A 1 31 ? -14.091 -0.848  -8.227  1.00 0.00 ? 31 LYS A CA   6  
ATOM 7262  C C    . LYS A 1 31 ? -15.501 -1.089  -7.699  1.00 0.00 ? 31 LYS A C    6  
ATOM 7263  O O    . LYS A 1 31 ? -16.078 -2.157  -7.907  1.00 0.00 ? 31 LYS A O    6  
ATOM 7264  C CB   . LYS A 1 31 ? -14.124 0.200   -9.342  1.00 0.00 ? 31 LYS A CB   6  
ATOM 7265  C CG   . LYS A 1 31 ? -12.850 1.024   -9.439  1.00 0.00 ? 31 LYS A CG   6  
ATOM 7266  C CD   . LYS A 1 31 ? -12.695 1.648   -10.817 1.00 0.00 ? 31 LYS A CD   6  
ATOM 7267  C CE   . LYS A 1 31 ? -11.755 0.836   -11.693 1.00 0.00 ? 31 LYS A CE   6  
ATOM 7268  N NZ   . LYS A 1 31 ? -10.910 1.707   -12.557 1.00 0.00 ? 31 LYS A NZ   6  
ATOM 7269  H H    . LYS A 1 31 ? -13.215 -2.145  -9.652  1.00 0.00 ? 31 LYS A H    6  
ATOM 7270  H HA   . LYS A 1 31 ? -13.475 -0.481  -7.420  1.00 0.00 ? 31 LYS A HA   6  
ATOM 7271  H HB2  . LYS A 1 31 ? -14.276 -0.301  -10.286 1.00 0.00 ? 31 LYS A HB2  6  
ATOM 7272  H HB3  . LYS A 1 31 ? -14.950 0.872   -9.164  1.00 0.00 ? 31 LYS A HB3  6  
ATOM 7273  H HG2  . LYS A 1 31 ? -12.885 1.811   -8.701  1.00 0.00 ? 31 LYS A HG2  6  
ATOM 7274  H HG3  . LYS A 1 31 ? -12.003 0.383   -9.246  1.00 0.00 ? 31 LYS A HG3  6  
ATOM 7275  H HD2  . LYS A 1 31 ? -13.663 1.695   -11.292 1.00 0.00 ? 31 LYS A HD2  6  
ATOM 7276  H HD3  . LYS A 1 31 ? -12.298 2.647   -10.706 1.00 0.00 ? 31 LYS A HD3  6  
ATOM 7277  H HE2  . LYS A 1 31 ? -11.114 0.243   -11.059 1.00 0.00 ? 31 LYS A HE2  6  
ATOM 7278  H HE3  . LYS A 1 31 ? -12.343 0.183   -12.321 1.00 0.00 ? 31 LYS A HE3  6  
ATOM 7279  H HZ1  . LYS A 1 31 ? -10.460 1.140   -13.304 1.00 0.00 ? 31 LYS A HZ1  6  
ATOM 7280  H HZ2  . LYS A 1 31 ? -10.168 2.162   -11.988 1.00 0.00 ? 31 LYS A HZ2  6  
ATOM 7281  H HZ3  . LYS A 1 31 ? -11.493 2.445   -13.000 1.00 0.00 ? 31 LYS A HZ3  6  
ATOM 7282  N N    . ILE A 1 32 ? -16.051 -0.090  -7.016  1.00 0.00 ? 32 ILE A N    6  
ATOM 7283  C CA   . ILE A 1 32 ? -17.390 -0.190  -6.459  1.00 0.00 ? 32 ILE A CA   6  
ATOM 7284  C C    . ILE A 1 32 ? -18.017 1.191   -6.292  1.00 0.00 ? 32 ILE A C    6  
ATOM 7285  O O    . ILE A 1 32 ? -17.437 2.199   -6.695  1.00 0.00 ? 32 ILE A O    6  
ATOM 7286  C CB   . ILE A 1 32 ? -17.401 -0.916  -5.097  1.00 0.00 ? 32 ILE A CB   6  
ATOM 7287  C CG1  . ILE A 1 32 ? -16.035 -1.538  -4.791  1.00 0.00 ? 32 ILE A CG1  6  
ATOM 7288  C CG2  . ILE A 1 32 ? -18.487 -1.981  -5.073  1.00 0.00 ? 32 ILE A CG2  6  
ATOM 7289  C CD1  . ILE A 1 32 ? -15.960 -2.192  -3.429  1.00 0.00 ? 32 ILE A CD1  6  
ATOM 7290  H H    . ILE A 1 32 ? -15.546 0.733   -6.885  1.00 0.00 ? 32 ILE A H    6  
ATOM 7291  H HA   . ILE A 1 32 ? -17.987 -0.757  -7.145  1.00 0.00 ? 32 ILE A HA   6  
ATOM 7292  H HB   . ILE A 1 32 ? -17.634 -0.190  -4.340  1.00 0.00 ? 32 ILE A HB   6  
ATOM 7293  H HG12 . ILE A 1 32 ? -15.815 -2.291  -5.532  1.00 0.00 ? 32 ILE A HG12 6  
ATOM 7294  H HG13 . ILE A 1 32 ? -15.279 -0.767  -4.832  1.00 0.00 ? 32 ILE A HG13 6  
ATOM 7295  H HG21 . ILE A 1 32 ? -18.160 -2.815  -4.469  1.00 0.00 ? 32 ILE A HG21 6  
ATOM 7296  H HG22 . ILE A 1 32 ? -18.682 -2.320  -6.080  1.00 0.00 ? 32 ILE A HG22 6  
ATOM 7297  H HG23 . ILE A 1 32 ? -19.390 -1.565  -4.652  1.00 0.00 ? 32 ILE A HG23 6  
ATOM 7298  H HD11 . ILE A 1 32 ? -16.208 -3.240  -3.519  1.00 0.00 ? 32 ILE A HD11 6  
ATOM 7299  H HD12 . ILE A 1 32 ? -16.660 -1.713  -2.760  1.00 0.00 ? 32 ILE A HD12 6  
ATOM 7300  H HD13 . ILE A 1 32 ? -14.959 -2.092  -3.036  1.00 0.00 ? 32 ILE A HD13 6  
ATOM 7301  N N    . ILE A 1 33 ? -19.203 1.229   -5.694  1.00 0.00 ? 33 ILE A N    6  
ATOM 7302  C CA   . ILE A 1 33 ? -19.908 2.480   -5.472  1.00 0.00 ? 33 ILE A CA   6  
ATOM 7303  C C    . ILE A 1 33 ? -20.691 2.441   -4.163  1.00 0.00 ? 33 ILE A C    6  
ATOM 7304  O O    . ILE A 1 33 ? -21.583 1.611   -3.986  1.00 0.00 ? 33 ILE A O    6  
ATOM 7305  C CB   . ILE A 1 33 ? -20.874 2.819   -6.629  1.00 0.00 ? 33 ILE A CB   6  
ATOM 7306  C CG1  . ILE A 1 33 ? -20.784 1.778   -7.750  1.00 0.00 ? 33 ILE A CG1  6  
ATOM 7307  C CG2  . ILE A 1 33 ? -20.581 4.210   -7.174  1.00 0.00 ? 33 ILE A CG2  6  
ATOM 7308  C CD1  . ILE A 1 33 ? -21.355 0.429   -7.370  1.00 0.00 ? 33 ILE A CD1  6  
ATOM 7309  H H    . ILE A 1 33 ? -19.613 0.399   -5.394  1.00 0.00 ? 33 ILE A H    6  
ATOM 7310  H HA   . ILE A 1 33 ? -19.172 3.257   -5.409  1.00 0.00 ? 33 ILE A HA   6  
ATOM 7311  H HB   . ILE A 1 33 ? -21.874 2.823   -6.234  1.00 0.00 ? 33 ILE A HB   6  
ATOM 7312  H HG12 . ILE A 1 33 ? -21.329 2.137   -8.610  1.00 0.00 ? 33 ILE A HG12 6  
ATOM 7313  H HG13 . ILE A 1 33 ? -19.747 1.637   -8.019  1.00 0.00 ? 33 ILE A HG13 6  
ATOM 7314  H HG21 . ILE A 1 33 ? -19.514 4.340   -7.275  1.00 0.00 ? 33 ILE A HG21 6  
ATOM 7315  H HG22 . ILE A 1 33 ? -20.971 4.952   -6.493  1.00 0.00 ? 33 ILE A HG22 6  
ATOM 7316  H HG23 . ILE A 1 33 ? -21.051 4.325   -8.139  1.00 0.00 ? 33 ILE A HG23 6  
ATOM 7317  H HD11 . ILE A 1 33 ? -22.352 0.334   -7.774  1.00 0.00 ? 33 ILE A HD11 6  
ATOM 7318  H HD12 . ILE A 1 33 ? -21.393 0.345   -6.294  1.00 0.00 ? 33 ILE A HD12 6  
ATOM 7319  H HD13 . ILE A 1 33 ? -20.728 -0.353  -7.770  1.00 0.00 ? 33 ILE A HD13 6  
ATOM 7320  N N    . LEU A 1 34 ? -20.351 3.344   -3.250  1.00 0.00 ? 34 LEU A N    6  
ATOM 7321  C CA   . LEU A 1 34 ? -21.016 3.418   -1.960  1.00 0.00 ? 34 LEU A CA   6  
ATOM 7322  C C    . LEU A 1 34 ? -22.490 3.790   -2.115  1.00 0.00 ? 34 LEU A C    6  
ATOM 7323  O O    . LEU A 1 34 ? -23.284 3.606   -1.193  1.00 0.00 ? 34 LEU A O    6  
ATOM 7324  C CB   . LEU A 1 34 ? -20.313 4.441   -1.067  1.00 0.00 ? 34 LEU A CB   6  
ATOM 7325  C CG   . LEU A 1 34 ? -19.783 5.687   -1.783  1.00 0.00 ? 34 LEU A CG   6  
ATOM 7326  C CD1  . LEU A 1 34 ? -20.062 6.937   -0.962  1.00 0.00 ? 34 LEU A CD1  6  
ATOM 7327  C CD2  . LEU A 1 34 ? -18.293 5.551   -2.057  1.00 0.00 ? 34 LEU A CD2  6  
ATOM 7328  H H    . LEU A 1 34 ? -19.635 3.978   -3.446  1.00 0.00 ? 34 LEU A H    6  
ATOM 7329  H HA   . LEU A 1 34 ? -20.950 2.446   -1.498  1.00 0.00 ? 34 LEU A HA   6  
ATOM 7330  H HB2  . LEU A 1 34 ? -21.011 4.758   -0.316  1.00 0.00 ? 34 LEU A HB2  6  
ATOM 7331  H HB3  . LEU A 1 34 ? -19.482 3.952   -0.580  1.00 0.00 ? 34 LEU A HB3  6  
ATOM 7332  H HG   . LEU A 1 34 ? -20.290 5.791   -2.731  1.00 0.00 ? 34 LEU A HG   6  
ATOM 7333  H HD11 . LEU A 1 34 ? -21.007 7.363   -1.266  1.00 0.00 ? 34 LEU A HD11 6  
ATOM 7334  H HD12 . LEU A 1 34 ? -19.274 7.657   -1.122  1.00 0.00 ? 34 LEU A HD12 6  
ATOM 7335  H HD13 . LEU A 1 34 ? -20.105 6.677   0.086   1.00 0.00 ? 34 LEU A HD13 6  
ATOM 7336  H HD21 . LEU A 1 34 ? -17.736 5.871   -1.189  1.00 0.00 ? 34 LEU A HD21 6  
ATOM 7337  H HD22 . LEU A 1 34 ? -18.025 6.165   -2.904  1.00 0.00 ? 34 LEU A HD22 6  
ATOM 7338  H HD23 . LEU A 1 34 ? -18.059 4.519   -2.274  1.00 0.00 ? 34 LEU A HD23 6  
ATOM 7339  N N    . SER A 1 35 ? -22.850 4.315   -3.282  1.00 0.00 ? 35 SER A N    6  
ATOM 7340  C CA   . SER A 1 35 ? -24.228 4.712   -3.549  1.00 0.00 ? 35 SER A CA   6  
ATOM 7341  C C    . SER A 1 35 ? -25.189 3.539   -3.366  1.00 0.00 ? 35 SER A C    6  
ATOM 7342  O O    . SER A 1 35 ? -26.387 3.734   -3.163  1.00 0.00 ? 35 SER A O    6  
ATOM 7343  C CB   . SER A 1 35 ? -24.353 5.274   -4.968  1.00 0.00 ? 35 SER A CB   6  
ATOM 7344  O OG   . SER A 1 35 ? -23.209 4.964   -5.744  1.00 0.00 ? 35 SER A OG   6  
ATOM 7345  H H    . SER A 1 35 ? -22.175 4.440   -3.980  1.00 0.00 ? 35 SER A H    6  
ATOM 7346  H HA   . SER A 1 35 ? -24.489 5.483   -2.844  1.00 0.00 ? 35 SER A HA   6  
ATOM 7347  H HB2  . SER A 1 35 ? -25.222 4.850   -5.447  1.00 0.00 ? 35 SER A HB2  6  
ATOM 7348  H HB3  . SER A 1 35 ? -24.458 6.348   -4.918  1.00 0.00 ? 35 SER A HB3  6  
ATOM 7349  H HG   . SER A 1 35 ? -23.434 5.004   -6.677  1.00 0.00 ? 35 SER A HG   6  
ATOM 7350  N N    . ASP A 1 36 ? -24.658 2.324   -3.440  1.00 0.00 ? 36 ASP A N    6  
ATOM 7351  C CA   . ASP A 1 36 ? -25.465 1.126   -3.285  1.00 0.00 ? 36 ASP A CA   6  
ATOM 7352  C C    . ASP A 1 36 ? -25.229 0.480   -1.923  1.00 0.00 ? 36 ASP A C    6  
ATOM 7353  O O    . ASP A 1 36 ? -26.099 0.508   -1.052  1.00 0.00 ? 36 ASP A O    6  
ATOM 7354  C CB   . ASP A 1 36 ? -25.168 0.117   -4.402  1.00 0.00 ? 36 ASP A CB   6  
ATOM 7355  C CG   . ASP A 1 36 ? -23.833 0.352   -5.086  1.00 0.00 ? 36 ASP A CG   6  
ATOM 7356  O OD1  . ASP A 1 36 ? -23.753 1.265   -5.935  1.00 0.00 ? 36 ASP A OD1  6  
ATOM 7357  O OD2  . ASP A 1 36 ? -22.868 -0.376  -4.771  1.00 0.00 ? 36 ASP A OD2  6  
ATOM 7358  H H    . ASP A 1 36 ? -23.707 2.229   -3.604  1.00 0.00 ? 36 ASP A H    6  
ATOM 7359  H HA   . ASP A 1 36 ? -26.493 1.425   -3.352  1.00 0.00 ? 36 ASP A HA   6  
ATOM 7360  H HB2  . ASP A 1 36 ? -25.157 -0.875  -3.982  1.00 0.00 ? 36 ASP A HB2  6  
ATOM 7361  H HB3  . ASP A 1 36 ? -25.947 0.177   -5.147  1.00 0.00 ? 36 ASP A HB3  6  
ATOM 7362  N N    . GLU A 1 37 ? -24.049 -0.108  -1.747  1.00 0.00 ? 37 GLU A N    6  
ATOM 7363  C CA   . GLU A 1 37 ? -23.701 -0.767  -0.493  1.00 0.00 ? 37 GLU A CA   6  
ATOM 7364  C C    . GLU A 1 37 ? -23.785 0.200   0.684   1.00 0.00 ? 37 GLU A C    6  
ATOM 7365  O O    . GLU A 1 37 ? -23.974 -0.215  1.828   1.00 0.00 ? 37 GLU A O    6  
ATOM 7366  C CB   . GLU A 1 37 ? -22.299 -1.366  -0.582  1.00 0.00 ? 37 GLU A CB   6  
ATOM 7367  C CG   . GLU A 1 37 ? -22.275 -2.876  -0.439  1.00 0.00 ? 37 GLU A CG   6  
ATOM 7368  C CD   . GLU A 1 37 ? -21.724 -3.573  -1.669  1.00 0.00 ? 37 GLU A CD   6  
ATOM 7369  O OE1  . GLU A 1 37 ? -20.492 -3.767  -1.740  1.00 0.00 ? 37 GLU A OE1  6  
ATOM 7370  O OE2  . GLU A 1 37 ? -22.524 -3.923  -2.561  1.00 0.00 ? 37 GLU A OE2  6  
ATOM 7371  H H    . GLU A 1 37 ? -23.398 -0.100  -2.480  1.00 0.00 ? 37 GLU A H    6  
ATOM 7372  H HA   . GLU A 1 37 ? -24.405 -1.560  -0.336  1.00 0.00 ? 37 GLU A HA   6  
ATOM 7373  H HB2  . GLU A 1 37 ? -21.875 -1.113  -1.537  1.00 0.00 ? 37 GLU A HB2  6  
ATOM 7374  H HB3  . GLU A 1 37 ? -21.689 -0.944  0.199   1.00 0.00 ? 37 GLU A HB3  6  
ATOM 7375  H HG2  . GLU A 1 37 ? -21.658 -3.135  0.408   1.00 0.00 ? 37 GLU A HG2  6  
ATOM 7376  H HG3  . GLU A 1 37 ? -23.281 -3.221  -0.269  1.00 0.00 ? 37 GLU A HG3  6  
ATOM 7377  N N    . GLY A 1 38 ? -23.645 1.487   0.397   1.00 0.00 ? 38 GLY A N    6  
ATOM 7378  C CA   . GLY A 1 38 ? -23.708 2.492   1.443   1.00 0.00 ? 38 GLY A CA   6  
ATOM 7379  C C    . GLY A 1 38 ? -22.627 2.315   2.492   1.00 0.00 ? 38 GLY A C    6  
ATOM 7380  O O    . GLY A 1 38 ? -22.715 2.880   3.582   1.00 0.00 ? 38 GLY A O    6  
ATOM 7381  H H    . GLY A 1 38 ? -23.498 1.757   -0.532  1.00 0.00 ? 38 GLY A H    6  
ATOM 7382  H HA2  . GLY A 1 38 ? -23.603 3.469   0.995   1.00 0.00 ? 38 GLY A HA2  6  
ATOM 7383  H HA3  . GLY A 1 38 ? -24.672 2.431   1.924   1.00 0.00 ? 38 GLY A HA3  6  
ATOM 7384  N N    . LYS A 1 39 ? -21.598 1.543   2.159   1.00 0.00 ? 39 LYS A N    6  
ATOM 7385  C CA   . LYS A 1 39 ? -20.495 1.309   3.064   1.00 0.00 ? 39 LYS A CA   6  
ATOM 7386  C C    . LYS A 1 39 ? -19.197 1.168   2.284   1.00 0.00 ? 39 LYS A C    6  
ATOM 7387  O O    . LYS A 1 39 ? -18.815 0.071   1.877   1.00 0.00 ? 39 LYS A O    6  
ATOM 7388  C CB   . LYS A 1 39 ? -20.745 0.055   3.904   1.00 0.00 ? 39 LYS A CB   6  
ATOM 7389  C CG   . LYS A 1 39 ? -19.706 -0.167  4.991   1.00 0.00 ? 39 LYS A CG   6  
ATOM 7390  C CD   . LYS A 1 39 ? -20.123 -1.276  5.943   1.00 0.00 ? 39 LYS A CD   6  
ATOM 7391  C CE   . LYS A 1 39 ? -19.586 -2.626  5.495   1.00 0.00 ? 39 LYS A CE   6  
ATOM 7392  N NZ   . LYS A 1 39 ? -20.537 -3.731  5.797   1.00 0.00 ? 39 LYS A NZ   6  
ATOM 7393  H H    . LYS A 1 39 ? -21.569 1.142   1.278   1.00 0.00 ? 39 LYS A H    6  
ATOM 7394  H HA   . LYS A 1 39 ? -20.420 2.161   3.715   1.00 0.00 ? 39 LYS A HA   6  
ATOM 7395  H HB2  . LYS A 1 39 ? -21.714 0.137   4.373   1.00 0.00 ? 39 LYS A HB2  6  
ATOM 7396  H HB3  . LYS A 1 39 ? -20.743 -0.807  3.252   1.00 0.00 ? 39 LYS A HB3  6  
ATOM 7397  H HG2  . LYS A 1 39 ? -18.768 -0.437  4.529   1.00 0.00 ? 39 LYS A HG2  6  
ATOM 7398  H HG3  . LYS A 1 39 ? -19.584 0.749   5.550   1.00 0.00 ? 39 LYS A HG3  6  
ATOM 7399  H HD2  . LYS A 1 39 ? -19.739 -1.056  6.927   1.00 0.00 ? 39 LYS A HD2  6  
ATOM 7400  H HD3  . LYS A 1 39 ? -21.202 -1.321  5.976   1.00 0.00 ? 39 LYS A HD3  6  
ATOM 7401  H HE2  . LYS A 1 39 ? -19.411 -2.594  4.430   1.00 0.00 ? 39 LYS A HE2  6  
ATOM 7402  H HE3  . LYS A 1 39 ? -18.653 -2.815  6.006   1.00 0.00 ? 39 LYS A HE3  6  
ATOM 7403  H HZ1  . LYS A 1 39 ? -20.014 -4.597  6.038   1.00 0.00 ? 39 LYS A HZ1  6  
ATOM 7404  H HZ2  . LYS A 1 39 ? -21.138 -3.921  4.970   1.00 0.00 ? 39 LYS A HZ2  6  
ATOM 7405  H HZ3  . LYS A 1 39 ? -21.145 -3.470  6.600   1.00 0.00 ? 39 LYS A HZ3  6  
ATOM 7406  N N    . MET A 1 40 ? -18.523 2.288   2.090   1.00 0.00 ? 40 MET A N    6  
ATOM 7407  C CA   . MET A 1 40 ? -17.263 2.312   1.372   1.00 0.00 ? 40 MET A CA   6  
ATOM 7408  C C    . MET A 1 40 ? -16.365 3.423   1.902   1.00 0.00 ? 40 MET A C    6  
ATOM 7409  O O    . MET A 1 40 ? -16.359 4.537   1.378   1.00 0.00 ? 40 MET A O    6  
ATOM 7410  C CB   . MET A 1 40 ? -17.505 2.501   -0.127  1.00 0.00 ? 40 MET A CB   6  
ATOM 7411  C CG   . MET A 1 40 ? -16.540 1.716   -1.003  1.00 0.00 ? 40 MET A CG   6  
ATOM 7412  S SD   . MET A 1 40 ? -15.340 2.771   -1.838  1.00 0.00 ? 40 MET A SD   6  
ATOM 7413  C CE   . MET A 1 40 ? -16.231 3.177   -3.337  1.00 0.00 ? 40 MET A CE   6  
ATOM 7414  H H    . MET A 1 40 ? -18.882 3.116   2.443   1.00 0.00 ? 40 MET A H    6  
ATOM 7415  H HA   . MET A 1 40 ? -16.779 1.367   1.535   1.00 0.00 ? 40 MET A HA   6  
ATOM 7416  H HB2  . MET A 1 40 ? -18.510 2.181   -0.360  1.00 0.00 ? 40 MET A HB2  6  
ATOM 7417  H HB3  . MET A 1 40 ? -17.405 3.549   -0.367  1.00 0.00 ? 40 MET A HB3  6  
ATOM 7418  H HG2  . MET A 1 40 ? -16.007 1.010   -0.384  1.00 0.00 ? 40 MET A HG2  6  
ATOM 7419  H HG3  . MET A 1 40 ? -17.108 1.180   -1.749  1.00 0.00 ? 40 MET A HG3  6  
ATOM 7420  H HE1  . MET A 1 40 ? -16.164 4.240   -3.519  1.00 0.00 ? 40 MET A HE1  6  
ATOM 7421  H HE2  . MET A 1 40 ? -17.268 2.896   -3.227  1.00 0.00 ? 40 MET A HE2  6  
ATOM 7422  H HE3  . MET A 1 40 ? -15.799 2.642   -4.169  1.00 0.00 ? 40 MET A HE3  6  
ATOM 7423  N N    . TYR A 1 41 ? -15.609 3.109   2.944   1.00 0.00 ? 41 TYR A N    6  
ATOM 7424  C CA   . TYR A 1 41 ? -14.703 4.073   3.553   1.00 0.00 ? 41 TYR A CA   6  
ATOM 7425  C C    . TYR A 1 41 ? -13.527 4.377   2.630   1.00 0.00 ? 41 TYR A C    6  
ATOM 7426  O O    . TYR A 1 41 ? -13.413 3.807   1.545   1.00 0.00 ? 41 TYR A O    6  
ATOM 7427  C CB   . TYR A 1 41 ? -14.196 3.549   4.895   1.00 0.00 ? 41 TYR A CB   6  
ATOM 7428  C CG   . TYR A 1 41 ? -14.594 4.411   6.072   1.00 0.00 ? 41 TYR A CG   6  
ATOM 7429  C CD1  . TYR A 1 41 ? -15.896 4.873   6.211   1.00 0.00 ? 41 TYR A CD1  6  
ATOM 7430  C CD2  . TYR A 1 41 ? -13.666 4.763   7.044   1.00 0.00 ? 41 TYR A CD2  6  
ATOM 7431  C CE1  . TYR A 1 41 ? -16.263 5.662   7.285   1.00 0.00 ? 41 TYR A CE1  6  
ATOM 7432  C CE2  . TYR A 1 41 ? -14.025 5.551   8.121   1.00 0.00 ? 41 TYR A CE2  6  
ATOM 7433  C CZ   . TYR A 1 41 ? -15.324 5.998   8.237   1.00 0.00 ? 41 TYR A CZ   6  
ATOM 7434  O OH   . TYR A 1 41 ? -15.685 6.782   9.308   1.00 0.00 ? 41 TYR A OH   6  
ATOM 7435  H H    . TYR A 1 41 ? -15.665 2.207   3.316   1.00 0.00 ? 41 TYR A H    6  
ATOM 7436  H HA   . TYR A 1 41 ? -15.255 4.978   3.724   1.00 0.00 ? 41 TYR A HA   6  
ATOM 7437  H HB2  . TYR A 1 41 ? -14.596 2.562   5.059   1.00 0.00 ? 41 TYR A HB2  6  
ATOM 7438  H HB3  . TYR A 1 41 ? -13.120 3.497   4.869   1.00 0.00 ? 41 TYR A HB3  6  
ATOM 7439  H HD1  . TYR A 1 41 ? -16.630 4.609   5.463   1.00 0.00 ? 41 TYR A HD1  6  
ATOM 7440  H HD2  . TYR A 1 41 ? -12.648 4.412   6.950   1.00 0.00 ? 41 TYR A HD2  6  
ATOM 7441  H HE1  . TYR A 1 41 ? -17.281 6.011   7.375   1.00 0.00 ? 41 TYR A HE1  6  
ATOM 7442  H HE2  . TYR A 1 41 ? -13.289 5.814   8.867   1.00 0.00 ? 41 TYR A HE2  6  
ATOM 7443  H HH   . TYR A 1 41 ? -15.713 6.246   10.103  1.00 0.00 ? 41 TYR A HH   6  
ATOM 7444  N N    . GLY A 1 42 ? -12.655 5.279   3.069   1.00 0.00 ? 42 GLY A N    6  
ATOM 7445  C CA   . GLY A 1 42 ? -11.499 5.643   2.270   1.00 0.00 ? 42 GLY A CA   6  
ATOM 7446  C C    . GLY A 1 42 ? -10.601 4.457   1.979   1.00 0.00 ? 42 GLY A C    6  
ATOM 7447  O O    . GLY A 1 42 ? -10.322 3.650   2.866   1.00 0.00 ? 42 GLY A O    6  
ATOM 7448  H H    . GLY A 1 42 ? -12.797 5.701   3.942   1.00 0.00 ? 42 GLY A H    6  
ATOM 7449  H HA2  . GLY A 1 42 ? -11.840 6.061   1.334   1.00 0.00 ? 42 GLY A HA2  6  
ATOM 7450  H HA3  . GLY A 1 42 ? -10.929 6.391   2.800   1.00 0.00 ? 42 GLY A HA3  6  
ATOM 7451  N N    . ARG A 1 43 ? -10.147 4.350   0.734   1.00 0.00 ? 43 ARG A N    6  
ATOM 7452  C CA   . ARG A 1 43 ? -9.277  3.253   0.330   1.00 0.00 ? 43 ARG A CA   6  
ATOM 7453  C C    . ARG A 1 43 ? -7.956  3.291   1.091   1.00 0.00 ? 43 ARG A C    6  
ATOM 7454  O O    . ARG A 1 43 ? -7.308  2.262   1.284   1.00 0.00 ? 43 ARG A O    6  
ATOM 7455  C CB   . ARG A 1 43 ? -9.020  3.306   -1.174  1.00 0.00 ? 43 ARG A CB   6  
ATOM 7456  C CG   . ARG A 1 43 ? -9.535  2.087   -1.922  1.00 0.00 ? 43 ARG A CG   6  
ATOM 7457  C CD   . ARG A 1 43 ? -8.782  0.829   -1.521  1.00 0.00 ? 43 ARG A CD   6  
ATOM 7458  N NE   . ARG A 1 43 ? -7.734  0.488   -2.480  1.00 0.00 ? 43 ARG A NE   6  
ATOM 7459  C CZ   . ARG A 1 43 ? -7.168  -0.714  -2.564  1.00 0.00 ? 43 ARG A CZ   6  
ATOM 7460  N NH1  . ARG A 1 43 ? -7.546  -1.692  -1.750  1.00 0.00 ? 43 ARG A NH1  6  
ATOM 7461  N NH2  . ARG A 1 43 ? -6.221  -0.939  -3.464  1.00 0.00 ? 43 ARG A NH2  6  
ATOM 7462  H H    . ARG A 1 43 ? -10.406 5.025   0.072   1.00 0.00 ? 43 ARG A H    6  
ATOM 7463  H HA   . ARG A 1 43 ? -9.779  2.335   0.562   1.00 0.00 ? 43 ARG A HA   6  
ATOM 7464  H HB2  . ARG A 1 43 ? -9.506  4.180   -1.577  1.00 0.00 ? 43 ARG A HB2  6  
ATOM 7465  H HB3  . ARG A 1 43 ? -7.958  3.384   -1.344  1.00 0.00 ? 43 ARG A HB3  6  
ATOM 7466  H HG2  . ARG A 1 43 ? -10.582 1.954   -1.697  1.00 0.00 ? 43 ARG A HG2  6  
ATOM 7467  H HG3  . ARG A 1 43 ? -9.409  2.248   -2.983  1.00 0.00 ? 43 ARG A HG3  6  
ATOM 7468  H HD2  . ARG A 1 43 ? -8.332  0.987   -0.552  1.00 0.00 ? 43 ARG A HD2  6  
ATOM 7469  H HD3  . ARG A 1 43 ? -9.483  0.009   -1.461  1.00 0.00 ? 43 ARG A HD3  6  
ATOM 7470  H HE   . ARG A 1 43 ? -7.436  1.192   -3.093  1.00 0.00 ? 43 ARG A HE   6  
ATOM 7471  H HH11 . ARG A 1 43 ? -8.260  -1.529  -1.068  1.00 0.00 ? 43 ARG A HH11 6  
ATOM 7472  H HH12 . ARG A 1 43 ? -7.117  -2.592  -1.818  1.00 0.00 ? 43 ARG A HH12 6  
ATOM 7473  H HH21 . ARG A 1 43 ? -5.933  -0.206  -4.080  1.00 0.00 ? 43 ARG A HH21 6  
ATOM 7474  H HH22 . ARG A 1 43 ? -5.796  -1.842  -3.527  1.00 0.00 ? 43 ARG A HH22 6  
ATOM 7475  N N    . ASN A 1 44 ? -7.563  4.483   1.519   1.00 0.00 ? 44 ASN A N    6  
ATOM 7476  C CA   . ASN A 1 44 ? -6.321  4.660   2.258   1.00 0.00 ? 44 ASN A CA   6  
ATOM 7477  C C    . ASN A 1 44 ? -6.427  4.067   3.657   1.00 0.00 ? 44 ASN A C    6  
ATOM 7478  O O    . ASN A 1 44 ? -5.432  3.633   4.238   1.00 0.00 ? 44 ASN A O    6  
ATOM 7479  C CB   . ASN A 1 44 ? -5.959  6.142   2.340   1.00 0.00 ? 44 ASN A CB   6  
ATOM 7480  C CG   . ASN A 1 44 ? -4.639  6.457   1.664   1.00 0.00 ? 44 ASN A CG   6  
ATOM 7481  O OD1  . ASN A 1 44 ? -4.231  5.775   0.724   1.00 0.00 ? 44 ASN A OD1  6  
ATOM 7482  N ND2  . ASN A 1 44 ? -3.965  7.497   2.140   1.00 0.00 ? 44 ASN A ND2  6  
ATOM 7483  H H    . ASN A 1 44 ? -8.122  5.262   1.333   1.00 0.00 ? 44 ASN A H    6  
ATOM 7484  H HA   . ASN A 1 44 ? -5.550  4.144   1.725   1.00 0.00 ? 44 ASN A HA   6  
ATOM 7485  H HB2  . ASN A 1 44 ? -6.732  6.719   1.861   1.00 0.00 ? 44 ASN A HB2  6  
ATOM 7486  H HB3  . ASN A 1 44 ? -5.888  6.431   3.377   1.00 0.00 ? 44 ASN A HB3  6  
ATOM 7487  H HD21 . ASN A 1 44 ? -4.351  7.995   2.891   1.00 0.00 ? 44 ASN A HD21 6  
ATOM 7488  H HD22 . ASN A 1 44 ? -3.108  7.724   1.722   1.00 0.00 ? 44 ASN A HD22 6  
ATOM 7489  N N    . GLU A 1 45 ? -7.639  4.050   4.189   1.00 0.00 ? 45 GLU A N    6  
ATOM 7490  C CA   . GLU A 1 45 ? -7.881  3.508   5.516   1.00 0.00 ? 45 GLU A CA   6  
ATOM 7491  C C    . GLU A 1 45 ? -7.817  1.985   5.504   1.00 0.00 ? 45 GLU A C    6  
ATOM 7492  O O    . GLU A 1 45 ? -7.594  1.355   6.537   1.00 0.00 ? 45 GLU A O    6  
ATOM 7493  C CB   . GLU A 1 45 ? -9.242  3.970   6.041   1.00 0.00 ? 45 GLU A CB   6  
ATOM 7494  C CG   . GLU A 1 45 ? -9.498  5.455   5.844   1.00 0.00 ? 45 GLU A CG   6  
ATOM 7495  C CD   . GLU A 1 45 ? -10.689 5.952   6.639   1.00 0.00 ? 45 GLU A CD   6  
ATOM 7496  O OE1  . GLU A 1 45 ? -10.624 5.923   7.886   1.00 0.00 ? 45 GLU A OE1  6  
ATOM 7497  O OE2  . GLU A 1 45 ? -11.687 6.370   6.015   1.00 0.00 ? 45 GLU A OE2  6  
ATOM 7498  H H    . GLU A 1 45 ? -8.388  4.408   3.676   1.00 0.00 ? 45 GLU A H    6  
ATOM 7499  H HA   . GLU A 1 45 ? -7.111  3.882   6.166   1.00 0.00 ? 45 GLU A HA   6  
ATOM 7500  H HB2  . GLU A 1 45 ? -10.018 3.422   5.526   1.00 0.00 ? 45 GLU A HB2  6  
ATOM 7501  H HB3  . GLU A 1 45 ? -9.301  3.753   7.097   1.00 0.00 ? 45 GLU A HB3  6  
ATOM 7502  H HG2  . GLU A 1 45 ? -8.622  6.003   6.157   1.00 0.00 ? 45 GLU A HG2  6  
ATOM 7503  H HG3  . GLU A 1 45 ? -9.681  5.640   4.795   1.00 0.00 ? 45 GLU A HG3  6  
ATOM 7504  N N    . LEU A 1 46 ? -8.016  1.399   4.328   1.00 0.00 ? 46 LEU A N    6  
ATOM 7505  C CA   . LEU A 1 46 ? -7.984  -0.047  4.179   1.00 0.00 ? 46 LEU A CA   6  
ATOM 7506  C C    . LEU A 1 46 ? -6.555  -0.566  4.142   1.00 0.00 ? 46 LEU A C    6  
ATOM 7507  O O    . LEU A 1 46 ? -6.267  -1.658  4.633   1.00 0.00 ? 46 LEU A O    6  
ATOM 7508  C CB   . LEU A 1 46 ? -8.729  -0.470  2.913   1.00 0.00 ? 46 LEU A CB   6  
ATOM 7509  C CG   . LEU A 1 46 ? -9.844  -1.494  3.127   1.00 0.00 ? 46 LEU A CG   6  
ATOM 7510  C CD1  . LEU A 1 46 ? -10.504 -1.845  1.803   1.00 0.00 ? 46 LEU A CD1  6  
ATOM 7511  C CD2  . LEU A 1 46 ? -9.296  -2.745  3.798   1.00 0.00 ? 46 LEU A CD2  6  
ATOM 7512  H H    . LEU A 1 46 ? -8.192  1.952   3.544   1.00 0.00 ? 46 LEU A H    6  
ATOM 7513  H HA   . LEU A 1 46 ? -8.475  -0.469  5.027   1.00 0.00 ? 46 LEU A HA   6  
ATOM 7514  H HB2  . LEU A 1 46 ? -9.159  0.412   2.462   1.00 0.00 ? 46 LEU A HB2  6  
ATOM 7515  H HB3  . LEU A 1 46 ? -8.014  -0.891  2.229   1.00 0.00 ? 46 LEU A HB3  6  
ATOM 7516  H HG   . LEU A 1 46 ? -10.598 -1.068  3.774   1.00 0.00 ? 46 LEU A HG   6  
ATOM 7517  H HD11 . LEU A 1 46 ? -9.742  -2.062  1.068   1.00 0.00 ? 46 LEU A HD11 6  
ATOM 7518  H HD12 . LEU A 1 46 ? -11.102 -1.011  1.466   1.00 0.00 ? 46 LEU A HD12 6  
ATOM 7519  H HD13 . LEU A 1 46 ? -11.135 -2.711  1.933   1.00 0.00 ? 46 LEU A HD13 6  
ATOM 7520  H HD21 . LEU A 1 46 ? -8.378  -2.504  4.314   1.00 0.00 ? 46 LEU A HD21 6  
ATOM 7521  H HD22 . LEU A 1 46 ? -9.100  -3.498  3.049   1.00 0.00 ? 46 LEU A HD22 6  
ATOM 7522  H HD23 . LEU A 1 46 ? -10.020 -3.120  4.506   1.00 0.00 ? 46 LEU A HD23 6  
ATOM 7523  N N    . ILE A 1 47 ? -5.665  0.221   3.561   1.00 0.00 ? 47 ILE A N    6  
ATOM 7524  C CA   . ILE A 1 47 ? -4.265  -0.163  3.468   1.00 0.00 ? 47 ILE A CA   6  
ATOM 7525  C C    . ILE A 1 47 ? -3.553  0.091   4.785   1.00 0.00 ? 47 ILE A C    6  
ATOM 7526  O O    . ILE A 1 47 ? -2.617  -0.622  5.146   1.00 0.00 ? 47 ILE A O    6  
ATOM 7527  C CB   . ILE A 1 47 ? -3.509  0.566   2.326   1.00 0.00 ? 47 ILE A CB   6  
ATOM 7528  C CG1  . ILE A 1 47 ? -4.308  1.760   1.795   1.00 0.00 ? 47 ILE A CG1  6  
ATOM 7529  C CG2  . ILE A 1 47 ? -3.198  -0.403  1.195   1.00 0.00 ? 47 ILE A CG2  6  
ATOM 7530  C CD1  . ILE A 1 47 ? -3.585  2.539   0.719   1.00 0.00 ? 47 ILE A CD1  6  
ATOM 7531  H H    . ILE A 1 47 ? -5.956  1.075   3.196   1.00 0.00 ? 47 ILE A H    6  
ATOM 7532  H HA   . ILE A 1 47 ? -4.240  -1.219  3.272   1.00 0.00 ? 47 ILE A HA   6  
ATOM 7533  H HB   . ILE A 1 47 ? -2.571  0.922   2.721   1.00 0.00 ? 47 ILE A HB   6  
ATOM 7534  H HG12 . ILE A 1 47 ? -5.239  1.406   1.377   1.00 0.00 ? 47 ILE A HG12 6  
ATOM 7535  H HG13 . ILE A 1 47 ? -4.519  2.435   2.610   1.00 0.00 ? 47 ILE A HG13 6  
ATOM 7536  H HG21 . ILE A 1 47 ? -2.566  -1.197  1.565   1.00 0.00 ? 47 ILE A HG21 6  
ATOM 7537  H HG22 . ILE A 1 47 ? -2.689  0.122   0.401   1.00 0.00 ? 47 ILE A HG22 6  
ATOM 7538  H HG23 . ILE A 1 47 ? -4.119  -0.823  0.817   1.00 0.00 ? 47 ILE A HG23 6  
ATOM 7539  H HD11 . ILE A 1 47 ? -3.946  3.557   0.707   1.00 0.00 ? 47 ILE A HD11 6  
ATOM 7540  H HD12 . ILE A 1 47 ? -3.768  2.081   -0.242  1.00 0.00 ? 47 ILE A HD12 6  
ATOM 7541  H HD13 . ILE A 1 47 ? -2.524  2.536   0.923   1.00 0.00 ? 47 ILE A HD13 6  
ATOM 7542  N N    . ALA A 1 48 ? -4.012  1.103   5.504   1.00 0.00 ? 48 ALA A N    6  
ATOM 7543  C CA   . ALA A 1 48 ? -3.431  1.443   6.789   1.00 0.00 ? 48 ALA A CA   6  
ATOM 7544  C C    . ALA A 1 48 ? -3.947  0.510   7.873   1.00 0.00 ? 48 ALA A C    6  
ATOM 7545  O O    . ALA A 1 48 ? -3.281  0.288   8.884   1.00 0.00 ? 48 ALA A O    6  
ATOM 7546  C CB   . ALA A 1 48 ? -3.720  2.894   7.140   1.00 0.00 ? 48 ALA A CB   6  
ATOM 7547  H H    . ALA A 1 48 ? -4.763  1.624   5.167   1.00 0.00 ? 48 ALA A H    6  
ATOM 7548  H HA   . ALA A 1 48 ? -2.368  1.318   6.705   1.00 0.00 ? 48 ALA A HA   6  
ATOM 7549  H HB1  . ALA A 1 48 ? -4.787  3.063   7.121   1.00 0.00 ? 48 ALA A HB1  6  
ATOM 7550  H HB2  . ALA A 1 48 ? -3.240  3.540   6.420   1.00 0.00 ? 48 ALA A HB2  6  
ATOM 7551  H HB3  . ALA A 1 48 ? -3.339  3.108   8.127   1.00 0.00 ? 48 ALA A HB3  6  
ATOM 7552  N N    . ARG A 1 49 ? -5.129  -0.051  7.649   1.00 0.00 ? 49 ARG A N    6  
ATOM 7553  C CA   . ARG A 1 49 ? -5.716  -0.976  8.601   1.00 0.00 ? 49 ARG A CA   6  
ATOM 7554  C C    . ARG A 1 49 ? -4.989  -2.310  8.543   1.00 0.00 ? 49 ARG A C    6  
ATOM 7555  O O    . ARG A 1 49 ? -4.906  -3.031  9.538   1.00 0.00 ? 49 ARG A O    6  
ATOM 7556  C CB   . ARG A 1 49 ? -7.209  -1.168  8.321   1.00 0.00 ? 49 ARG A CB   6  
ATOM 7557  C CG   . ARG A 1 49 ? -8.111  -0.592  9.402   1.00 0.00 ? 49 ARG A CG   6  
ATOM 7558  C CD   . ARG A 1 49 ? -7.809  0.876   9.657   1.00 0.00 ? 49 ARG A CD   6  
ATOM 7559  N NE   . ARG A 1 49 ? -9.011  1.629   10.005  1.00 0.00 ? 49 ARG A NE   6  
ATOM 7560  C CZ   . ARG A 1 49 ? -10.029 1.828   9.171   1.00 0.00 ? 49 ARG A CZ   6  
ATOM 7561  N NH1  . ARG A 1 49 ? -9.995  1.330   7.941   1.00 0.00 ? 49 ARG A NH1  6  
ATOM 7562  N NH2  . ARG A 1 49 ? -11.085 2.525   9.568   1.00 0.00 ? 49 ARG A NH2  6  
ATOM 7563  H H    . ARG A 1 49 ? -5.609  0.152   6.822   1.00 0.00 ? 49 ARG A H    6  
ATOM 7564  H HA   . ARG A 1 49 ? -5.588  -0.557  9.581   1.00 0.00 ? 49 ARG A HA   6  
ATOM 7565  H HB2  . ARG A 1 49 ? -7.453  -0.688  7.386   1.00 0.00 ? 49 ARG A HB2  6  
ATOM 7566  H HB3  . ARG A 1 49 ? -7.416  -2.225  8.236   1.00 0.00 ? 49 ARG A HB3  6  
ATOM 7567  H HG2  . ARG A 1 49 ? -9.139  -0.688  9.087   1.00 0.00 ? 49 ARG A HG2  6  
ATOM 7568  H HG3  . ARG A 1 49 ? -7.959  -1.147  10.316  1.00 0.00 ? 49 ARG A HG3  6  
ATOM 7569  H HD2  . ARG A 1 49 ? -7.102  0.948   10.471  1.00 0.00 ? 49 ARG A HD2  6  
ATOM 7570  H HD3  . ARG A 1 49 ? -7.374  1.301   8.765   1.00 0.00 ? 49 ARG A HD3  6  
ATOM 7571  H HE   . ARG A 1 49 ? -9.062  2.008   10.908  1.00 0.00 ? 49 ARG A HE   6  
ATOM 7572  H HH11 . ARG A 1 49 ? -9.202  0.804   7.635   1.00 0.00 ? 49 ARG A HH11 6  
ATOM 7573  H HH12 . ARG A 1 49 ? -10.763 1.483   7.319   1.00 0.00 ? 49 ARG A HH12 6  
ATOM 7574  H HH21 . ARG A 1 49 ? -11.116 2.901   10.494  1.00 0.00 ? 49 ARG A HH21 6  
ATOM 7575  H HH22 . ARG A 1 49 ? -11.850 2.674   8.942   1.00 0.00 ? 49 ARG A HH22 6  
ATOM 7576  N N    . TYR A 1 50 ? -4.449  -2.622  7.372   1.00 0.00 ? 50 TYR A N    6  
ATOM 7577  C CA   . TYR A 1 50 ? -3.711  -3.858  7.180   1.00 0.00 ? 50 TYR A CA   6  
ATOM 7578  C C    . TYR A 1 50 ? -2.402  -3.814  7.939   1.00 0.00 ? 50 TYR A C    6  
ATOM 7579  O O    . TYR A 1 50 ? -2.093  -4.706  8.729   1.00 0.00 ? 50 TYR A O    6  
ATOM 7580  C CB   . TYR A 1 50 ? -3.442  -4.093  5.704   1.00 0.00 ? 50 TYR A CB   6  
ATOM 7581  C CG   . TYR A 1 50 ? -3.222  -5.546  5.351   1.00 0.00 ? 50 TYR A CG   6  
ATOM 7582  C CD1  . TYR A 1 50 ? -1.969  -6.127  5.492   1.00 0.00 ? 50 TYR A CD1  6  
ATOM 7583  C CD2  . TYR A 1 50 ? -4.264  -6.335  4.880   1.00 0.00 ? 50 TYR A CD2  6  
ATOM 7584  C CE1  . TYR A 1 50 ? -1.758  -7.453  5.173   1.00 0.00 ? 50 TYR A CE1  6  
ATOM 7585  C CE2  . TYR A 1 50 ? -4.061  -7.664  4.559   1.00 0.00 ? 50 TYR A CE2  6  
ATOM 7586  C CZ   . TYR A 1 50 ? -2.807  -8.218  4.707   1.00 0.00 ? 50 TYR A CZ   6  
ATOM 7587  O OH   . TYR A 1 50 ? -2.601  -9.541  4.388   1.00 0.00 ? 50 TYR A OH   6  
ATOM 7588  H H    . TYR A 1 50 ? -4.541  -1.999  6.621   1.00 0.00 ? 50 TYR A H    6  
ATOM 7589  H HA   . TYR A 1 50 ? -4.298  -4.655  7.558   1.00 0.00 ? 50 TYR A HA   6  
ATOM 7590  H HB2  . TYR A 1 50 ? -4.277  -3.729  5.127   1.00 0.00 ? 50 TYR A HB2  6  
ATOM 7591  H HB3  . TYR A 1 50 ? -2.561  -3.551  5.432   1.00 0.00 ? 50 TYR A HB3  6  
ATOM 7592  H HD1  . TYR A 1 50 ? -1.150  -5.526  5.858   1.00 0.00 ? 50 TYR A HD1  6  
ATOM 7593  H HD2  . TYR A 1 50 ? -5.244  -5.897  4.766   1.00 0.00 ? 50 TYR A HD2  6  
ATOM 7594  H HE1  . TYR A 1 50 ? -0.776  -7.885  5.290   1.00 0.00 ? 50 TYR A HE1  6  
ATOM 7595  H HE2  . TYR A 1 50 ? -4.883  -8.262  4.194   1.00 0.00 ? 50 TYR A HE2  6  
ATOM 7596  H HH   . TYR A 1 50 ? -1.761  -9.633  3.933   1.00 0.00 ? 50 TYR A HH   6  
ATOM 7597  N N    . ILE A 1 51 ? -1.645  -2.763  7.697   1.00 0.00 ? 51 ILE A N    6  
ATOM 7598  C CA   . ILE A 1 51 ? -0.369  -2.579  8.356   1.00 0.00 ? 51 ILE A CA   6  
ATOM 7599  C C    . ILE A 1 51 ? -0.569  -2.357  9.845   1.00 0.00 ? 51 ILE A C    6  
ATOM 7600  O O    . ILE A 1 51 ? 0.233   -2.797  10.669  1.00 0.00 ? 51 ILE A O    6  
ATOM 7601  C CB   . ILE A 1 51 ? 0.416   -1.394  7.764   1.00 0.00 ? 51 ILE A CB   6  
ATOM 7602  C CG1  . ILE A 1 51 ? -0.524  -0.279  7.299   1.00 0.00 ? 51 ILE A CG1  6  
ATOM 7603  C CG2  . ILE A 1 51 ? 1.294   -1.867  6.616   1.00 0.00 ? 51 ILE A CG2  6  
ATOM 7604  C CD1  . ILE A 1 51 ? 0.026   1.111   7.534   1.00 0.00 ? 51 ILE A CD1  6  
ATOM 7605  H H    . ILE A 1 51 ? -1.957  -2.090  7.063   1.00 0.00 ? 51 ILE A H    6  
ATOM 7606  H HA   . ILE A 1 51 ? 0.207   -3.475  8.214   1.00 0.00 ? 51 ILE A HA   6  
ATOM 7607  H HB   . ILE A 1 51 ? 1.051   -1.010  8.536   1.00 0.00 ? 51 ILE A HB   6  
ATOM 7608  H HG12 . ILE A 1 51 ? -0.706  -0.388  6.241   1.00 0.00 ? 51 ILE A HG12 6  
ATOM 7609  H HG13 . ILE A 1 51 ? -1.460  -0.360  7.832   1.00 0.00 ? 51 ILE A HG13 6  
ATOM 7610  H HG21 . ILE A 1 51 ? 1.339   -1.101  5.857   1.00 0.00 ? 51 ILE A HG21 6  
ATOM 7611  H HG22 . ILE A 1 51 ? 0.876   -2.770  6.193   1.00 0.00 ? 51 ILE A HG22 6  
ATOM 7612  H HG23 . ILE A 1 51 ? 2.289   -2.070  6.984   1.00 0.00 ? 51 ILE A HG23 6  
ATOM 7613  H HD11 . ILE A 1 51 ? -0.181  1.414   8.550   1.00 0.00 ? 51 ILE A HD11 6  
ATOM 7614  H HD12 . ILE A 1 51 ? -0.442  1.803   6.849   1.00 0.00 ? 51 ILE A HD12 6  
ATOM 7615  H HD13 . ILE A 1 51 ? 1.093   1.108   7.369   1.00 0.00 ? 51 ILE A HD13 6  
ATOM 7616  N N    . LYS A 1 52 ? -1.654  -1.677  10.178  1.00 0.00 ? 52 LYS A N    6  
ATOM 7617  C CA   . LYS A 1 52 ? -1.986  -1.395  11.564  1.00 0.00 ? 52 LYS A CA   6  
ATOM 7618  C C    . LYS A 1 52 ? -2.469  -2.655  12.272  1.00 0.00 ? 52 LYS A C    6  
ATOM 7619  O O    . LYS A 1 52 ? -2.352  -2.778  13.492  1.00 0.00 ? 52 LYS A O    6  
ATOM 7620  C CB   . LYS A 1 52 ? -3.058  -0.306  11.644  1.00 0.00 ? 52 LYS A CB   6  
ATOM 7621  C CG   . LYS A 1 52 ? -2.523  1.095   11.394  1.00 0.00 ? 52 LYS A CG   6  
ATOM 7622  C CD   . LYS A 1 52 ? -2.442  1.901   12.680  1.00 0.00 ? 52 LYS A CD   6  
ATOM 7623  C CE   . LYS A 1 52 ? -3.817  2.117   13.291  1.00 0.00 ? 52 LYS A CE   6  
ATOM 7624  N NZ   . LYS A 1 52 ? -3.793  1.989   14.775  1.00 0.00 ? 52 LYS A NZ   6  
ATOM 7625  H H    . LYS A 1 52 ? -2.248  -1.363  9.470   1.00 0.00 ? 52 LYS A H    6  
ATOM 7626  H HA   . LYS A 1 52 ? -1.094  -1.045  12.048  1.00 0.00 ? 52 LYS A HA   6  
ATOM 7627  H HB2  . LYS A 1 52 ? -3.821  -0.514  10.909  1.00 0.00 ? 52 LYS A HB2  6  
ATOM 7628  H HB3  . LYS A 1 52 ? -3.504  -0.328  12.628  1.00 0.00 ? 52 LYS A HB3  6  
ATOM 7629  H HG2  . LYS A 1 52 ? -1.535  1.021   10.965  1.00 0.00 ? 52 LYS A HG2  6  
ATOM 7630  H HG3  . LYS A 1 52 ? -3.181  1.602   10.702  1.00 0.00 ? 52 LYS A HG3  6  
ATOM 7631  H HD2  . LYS A 1 52 ? -1.824  1.369   13.389  1.00 0.00 ? 52 LYS A HD2  6  
ATOM 7632  H HD3  . LYS A 1 52 ? -1.999  2.862   12.464  1.00 0.00 ? 52 LYS A HD3  6  
ATOM 7633  H HE2  . LYS A 1 52 ? -4.162  3.106   13.030  1.00 0.00 ? 52 LYS A HE2  6  
ATOM 7634  H HE3  . LYS A 1 52 ? -4.497  1.381   12.886  1.00 0.00 ? 52 LYS A HE3  6  
ATOM 7635  H HZ1  . LYS A 1 52 ? -4.468  2.655   15.202  1.00 0.00 ? 52 LYS A HZ1  6  
ATOM 7636  H HZ2  . LYS A 1 52 ? -2.841  2.199   15.136  1.00 0.00 ? 52 LYS A HZ2  6  
ATOM 7637  H HZ3  . LYS A 1 52 ? -4.051  1.021   15.054  1.00 0.00 ? 52 LYS A HZ3  6  
ATOM 7638  N N    . LEU A 1 53 ? -3.014  -3.588  11.499  1.00 0.00 ? 53 LEU A N    6  
ATOM 7639  C CA   . LEU A 1 53 ? -3.516  -4.837  12.049  1.00 0.00 ? 53 LEU A CA   6  
ATOM 7640  C C    . LEU A 1 53 ? -2.409  -5.881  12.149  1.00 0.00 ? 53 LEU A C    6  
ATOM 7641  O O    . LEU A 1 53 ? -2.471  -6.789  12.978  1.00 0.00 ? 53 LEU A O    6  
ATOM 7642  C CB   . LEU A 1 53 ? -4.663  -5.372  11.190  1.00 0.00 ? 53 LEU A CB   6  
ATOM 7643  C CG   . LEU A 1 53 ? -5.246  -6.709  11.650  1.00 0.00 ? 53 LEU A CG   6  
ATOM 7644  C CD1  . LEU A 1 53 ? -6.735  -6.775  11.345  1.00 0.00 ? 53 LEU A CD1  6  
ATOM 7645  C CD2  . LEU A 1 53 ? -4.513  -7.866  10.987  1.00 0.00 ? 53 LEU A CD2  6  
ATOM 7646  H H    . LEU A 1 53 ? -3.081  -3.432  10.539  1.00 0.00 ? 53 LEU A H    6  
ATOM 7647  H HA   . LEU A 1 53 ? -3.884  -4.628  13.033  1.00 0.00 ? 53 LEU A HA   6  
ATOM 7648  H HB2  . LEU A 1 53 ? -5.456  -4.638  11.188  1.00 0.00 ? 53 LEU A HB2  6  
ATOM 7649  H HB3  . LEU A 1 53 ? -4.303  -5.491  10.179  1.00 0.00 ? 53 LEU A HB3  6  
ATOM 7650  H HG   . LEU A 1 53 ? -5.121  -6.801  12.719  1.00 0.00 ? 53 LEU A HG   6  
ATOM 7651  H HD11 . LEU A 1 53 ? -6.951  -6.170  10.477  1.00 0.00 ? 53 LEU A HD11 6  
ATOM 7652  H HD12 . LEU A 1 53 ? -7.292  -6.402  12.191  1.00 0.00 ? 53 LEU A HD12 6  
ATOM 7653  H HD13 . LEU A 1 53 ? -7.017  -7.798  11.149  1.00 0.00 ? 53 LEU A HD13 6  
ATOM 7654  H HD21 . LEU A 1 53 ? -3.540  -7.534  10.658  1.00 0.00 ? 53 LEU A HD21 6  
ATOM 7655  H HD22 . LEU A 1 53 ? -5.082  -8.212  10.136  1.00 0.00 ? 53 LEU A HD22 6  
ATOM 7656  H HD23 . LEU A 1 53 ? -4.398  -8.672  11.695  1.00 0.00 ? 53 LEU A HD23 6  
ATOM 7657  N N    . ARG A 1 54 ? -1.401  -5.748  11.297  1.00 0.00 ? 54 ARG A N    6  
ATOM 7658  C CA   . ARG A 1 54 ? -0.283  -6.680  11.282  1.00 0.00 ? 54 ARG A CA   6  
ATOM 7659  C C    . ARG A 1 54 ? 0.664   -6.423  12.444  1.00 0.00 ? 54 ARG A C    6  
ATOM 7660  O O    . ARG A 1 54 ? 0.901   -7.298  13.277  1.00 0.00 ? 54 ARG A O    6  
ATOM 7661  C CB   . ARG A 1 54 ? 0.476   -6.578  9.958   1.00 0.00 ? 54 ARG A CB   6  
ATOM 7662  C CG   . ARG A 1 54 ? 1.099   -7.891  9.512   1.00 0.00 ? 54 ARG A CG   6  
ATOM 7663  C CD   . ARG A 1 54 ? 2.554   -7.990  9.942   1.00 0.00 ? 54 ARG A CD   6  
ATOM 7664  N NE   . ARG A 1 54 ? 3.003   -9.377  10.038  1.00 0.00 ? 54 ARG A NE   6  
ATOM 7665  C CZ   . ARG A 1 54 ? 4.283   -9.743  10.046  1.00 0.00 ? 54 ARG A CZ   6  
ATOM 7666  N NH1  . ARG A 1 54 ? 5.242   -8.829  9.963   1.00 0.00 ? 54 ARG A NH1  6  
ATOM 7667  N NH2  . ARG A 1 54 ? 4.604   -11.026 10.137  1.00 0.00 ? 54 ARG A NH2  6  
ATOM 7668  H H    . ARG A 1 54 ? -1.413  -5.009  10.660  1.00 0.00 ? 54 ARG A H    6  
ATOM 7669  H HA   . ARG A 1 54 ? -0.682  -7.665  11.379  1.00 0.00 ? 54 ARG A HA   6  
ATOM 7670  H HB2  . ARG A 1 54 ? -0.208  -6.250  9.189   1.00 0.00 ? 54 ARG A HB2  6  
ATOM 7671  H HB3  . ARG A 1 54 ? 1.263   -5.847  10.063  1.00 0.00 ? 54 ARG A HB3  6  
ATOM 7672  H HG2  . ARG A 1 54 ? 0.548   -8.708  9.952   1.00 0.00 ? 54 ARG A HG2  6  
ATOM 7673  H HG3  . ARG A 1 54 ? 1.046   -7.956  8.435   1.00 0.00 ? 54 ARG A HG3  6  
ATOM 7674  H HD2  . ARG A 1 54 ? 3.166   -7.473  9.218   1.00 0.00 ? 54 ARG A HD2  6  
ATOM 7675  H HD3  . ARG A 1 54 ? 2.664   -7.518  10.907  1.00 0.00 ? 54 ARG A HD3  6  
ATOM 7676  H HE   . ARG A 1 54 ? 2.315   -10.072 10.100  1.00 0.00 ? 54 ARG A HE   6  
ATOM 7677  H HH11 . ARG A 1 54 ? 5.007   -7.860  9.895   1.00 0.00 ? 54 ARG A HH11 6  
ATOM 7678  H HH12 . ARG A 1 54 ? 6.202   -9.111  9.970   1.00 0.00 ? 54 ARG A HH12 6  
ATOM 7679  H HH21 . ARG A 1 54 ? 3.886   -11.718 10.199  1.00 0.00 ? 54 ARG A HH21 6  
ATOM 7680  H HH22 . ARG A 1 54 ? 5.566   -11.302 10.142  1.00 0.00 ? 54 ARG A HH22 6  
ATOM 7681  N N    . THR A 1 55 ? 1.203   -5.219  12.485  1.00 0.00 ? 55 THR A N    6  
ATOM 7682  C CA   . THR A 1 55 ? 2.132   -4.825  13.533  1.00 0.00 ? 55 THR A CA   6  
ATOM 7683  C C    . THR A 1 55 ? 1.397   -4.505  14.831  1.00 0.00 ? 55 THR A C    6  
ATOM 7684  O O    . THR A 1 55 ? 1.968   -4.591  15.918  1.00 0.00 ? 55 THR A O    6  
ATOM 7685  C CB   . THR A 1 55 ? 2.958   -3.617  13.086  1.00 0.00 ? 55 THR A CB   6  
ATOM 7686  O OG1  . THR A 1 55 ? 2.314   -2.933  12.026  1.00 0.00 ? 55 THR A OG1  6  
ATOM 7687  C CG2  . THR A 1 55 ? 4.349   -3.984  12.616  1.00 0.00 ? 55 THR A CG2  6  
ATOM 7688  H H    . THR A 1 55 ? 0.972   -4.580  11.788  1.00 0.00 ? 55 THR A H    6  
ATOM 7689  H HA   . THR A 1 55 ? 2.792   -5.654  13.707  1.00 0.00 ? 55 THR A HA   6  
ATOM 7690  H HB   . THR A 1 55 ? 3.060   -2.934  13.917  1.00 0.00 ? 55 THR A HB   6  
ATOM 7691  H HG1  . THR A 1 55 ? 1.490   -2.554  12.343  1.00 0.00 ? 55 THR A HG1  6  
ATOM 7692  H HG21 . THR A 1 55 ? 4.423   -5.057  12.516  1.00 0.00 ? 55 THR A HG21 6  
ATOM 7693  H HG22 . THR A 1 55 ? 5.076   -3.639  13.336  1.00 0.00 ? 55 THR A HG22 6  
ATOM 7694  H HG23 . THR A 1 55 ? 4.540   -3.520  11.660  1.00 0.00 ? 55 THR A HG23 6  
ATOM 7695  N N    . GLY A 1 56 ? 0.129   -4.135  14.707  1.00 0.00 ? 56 GLY A N    6  
ATOM 7696  C CA   . GLY A 1 56 ? -0.667  -3.807  15.873  1.00 0.00 ? 56 GLY A CA   6  
ATOM 7697  C C    . GLY A 1 56 ? -0.282  -2.477  16.499  1.00 0.00 ? 56 GLY A C    6  
ATOM 7698  O O    . GLY A 1 56 ? -0.802  -2.111  17.553  1.00 0.00 ? 56 GLY A O    6  
ATOM 7699  H H    . GLY A 1 56 ? -0.270  -4.087  13.818  1.00 0.00 ? 56 GLY A H    6  
ATOM 7700  H HA2  . GLY A 1 56 ? -1.707  -3.767  15.583  1.00 0.00 ? 56 GLY A HA2  6  
ATOM 7701  H HA3  . GLY A 1 56 ? -0.541  -4.587  16.605  1.00 0.00 ? 56 GLY A HA3  6  
ATOM 7702  N N    . LYS A 1 57 ? 0.628   -1.752  15.852  1.00 0.00 ? 57 LYS A N    6  
ATOM 7703  C CA   . LYS A 1 57 ? 1.073   -0.462  16.355  1.00 0.00 ? 57 LYS A CA   6  
ATOM 7704  C C    . LYS A 1 57 ? 1.877   0.287   15.296  1.00 0.00 ? 57 LYS A C    6  
ATOM 7705  O O    . LYS A 1 57 ? 3.103   0.189   15.247  1.00 0.00 ? 57 LYS A O    6  
ATOM 7706  C CB   . LYS A 1 57 ? 1.911   -0.651  17.614  1.00 0.00 ? 57 LYS A CB   6  
ATOM 7707  C CG   . LYS A 1 57 ? 1.527   0.285   18.748  1.00 0.00 ? 57 LYS A CG   6  
ATOM 7708  C CD   . LYS A 1 57 ? 1.937   1.718   18.451  1.00 0.00 ? 57 LYS A CD   6  
ATOM 7709  C CE   . LYS A 1 57 ? 1.796   2.604   19.679  1.00 0.00 ? 57 LYS A CE   6  
ATOM 7710  N NZ   . LYS A 1 57 ? 0.467   3.273   19.731  1.00 0.00 ? 57 LYS A NZ   6  
ATOM 7711  H H    . LYS A 1 57 ? 1.008   -2.089  15.020  1.00 0.00 ? 57 LYS A H    6  
ATOM 7712  H HA   . LYS A 1 57 ? 0.203   0.115   16.602  1.00 0.00 ? 57 LYS A HA   6  
ATOM 7713  H HB2  . LYS A 1 57 ? 1.800   -1.668  17.959  1.00 0.00 ? 57 LYS A HB2  6  
ATOM 7714  H HB3  . LYS A 1 57 ? 2.939   -0.475  17.364  1.00 0.00 ? 57 LYS A HB3  6  
ATOM 7715  H HG2  . LYS A 1 57 ? 0.457   0.248   18.886  1.00 0.00 ? 57 LYS A HG2  6  
ATOM 7716  H HG3  . LYS A 1 57 ? 2.019   -0.041  19.653  1.00 0.00 ? 57 LYS A HG3  6  
ATOM 7717  H HD2  . LYS A 1 57 ? 2.967   1.728   18.130  1.00 0.00 ? 57 LYS A HD2  6  
ATOM 7718  H HD3  . LYS A 1 57 ? 1.308   2.106   17.664  1.00 0.00 ? 57 LYS A HD3  6  
ATOM 7719  H HE2  . LYS A 1 57 ? 1.916   1.995   20.562  1.00 0.00 ? 57 LYS A HE2  6  
ATOM 7720  H HE3  . LYS A 1 57 ? 2.569   3.358   19.654  1.00 0.00 ? 57 LYS A HE3  6  
ATOM 7721  H HZ1  . LYS A 1 57 ? -0.214  2.677   20.245  1.00 0.00 ? 57 LYS A HZ1  6  
ATOM 7722  H HZ2  . LYS A 1 57 ? 0.110   3.436   18.768  1.00 0.00 ? 57 LYS A HZ2  6  
ATOM 7723  H HZ3  . LYS A 1 57 ? 0.546   4.189   20.218  1.00 0.00 ? 57 LYS A HZ3  6  
ATOM 7724  N N    . THR A 1 58 ? 1.176   1.036   14.452  1.00 0.00 ? 58 THR A N    6  
ATOM 7725  C CA   . THR A 1 58 ? 1.816   1.804   13.397  1.00 0.00 ? 58 THR A CA   6  
ATOM 7726  C C    . THR A 1 58 ? 1.032   3.076   13.094  1.00 0.00 ? 58 THR A C    6  
ATOM 7727  O O    . THR A 1 58 ? -0.090  3.254   13.567  1.00 0.00 ? 58 THR A O    6  
ATOM 7728  C CB   . THR A 1 58 ? 1.962   0.965   12.131  1.00 0.00 ? 58 THR A CB   6  
ATOM 7729  O OG1  . THR A 1 58 ? 1.686   -0.400  12.391  1.00 0.00 ? 58 THR A OG1  6  
ATOM 7730  C CG2  . THR A 1 58 ? 3.343   1.047   11.514  1.00 0.00 ? 58 THR A CG2  6  
ATOM 7731  H H    . THR A 1 58 ? 0.207   1.076   14.543  1.00 0.00 ? 58 THR A H    6  
ATOM 7732  H HA   . THR A 1 58 ? 2.790   2.077   13.742  1.00 0.00 ? 58 THR A HA   6  
ATOM 7733  H HB   . THR A 1 58 ? 1.257   1.321   11.402  1.00 0.00 ? 58 THR A HB   6  
ATOM 7734  H HG1  . THR A 1 58 ? 0.884   -0.658  11.930  1.00 0.00 ? 58 THR A HG1  6  
ATOM 7735  H HG21 . THR A 1 58 ? 3.384   1.886   10.834  1.00 0.00 ? 58 THR A HG21 6  
ATOM 7736  H HG22 . THR A 1 58 ? 3.551   0.135   10.975  1.00 0.00 ? 58 THR A HG22 6  
ATOM 7737  H HG23 . THR A 1 58 ? 4.078   1.180   12.294  1.00 0.00 ? 58 THR A HG23 6  
ATOM 7738  N N    . ARG A 1 59 ? 1.625   3.948   12.287  1.00 0.00 ? 59 ARG A N    6  
ATOM 7739  C CA   . ARG A 1 59 ? 0.985   5.189   11.899  1.00 0.00 ? 59 ARG A CA   6  
ATOM 7740  C C    . ARG A 1 59 ? 1.548   5.670   10.569  1.00 0.00 ? 59 ARG A C    6  
ATOM 7741  O O    . ARG A 1 59 ? 2.211   6.705   10.493  1.00 0.00 ? 59 ARG A O    6  
ATOM 7742  C CB   . ARG A 1 59 ? 1.184   6.257   12.977  1.00 0.00 ? 59 ARG A CB   6  
ATOM 7743  C CG   . ARG A 1 59 ? 0.027   6.353   13.959  1.00 0.00 ? 59 ARG A CG   6  
ATOM 7744  C CD   . ARG A 1 59 ? -0.925  7.479   13.591  1.00 0.00 ? 59 ARG A CD   6  
ATOM 7745  N NE   . ARG A 1 59 ? -2.105  6.989   12.883  1.00 0.00 ? 59 ARG A NE   6  
ATOM 7746  C CZ   . ARG A 1 59 ? -3.149  6.423   13.485  1.00 0.00 ? 59 ARG A CZ   6  
ATOM 7747  N NH1  . ARG A 1 59 ? -3.163  6.274   14.804  1.00 0.00 ? 59 ARG A NH1  6  
ATOM 7748  N NH2  . ARG A 1 59 ? -4.182  6.005   12.766  1.00 0.00 ? 59 ARG A NH2  6  
ATOM 7749  H H    . ARG A 1 59 ? 2.505   3.742   11.925  1.00 0.00 ? 59 ARG A H    6  
ATOM 7750  H HA   . ARG A 1 59 ? -0.067  4.994   11.782  1.00 0.00 ? 59 ARG A HA   6  
ATOM 7751  H HB2  . ARG A 1 59 ? 2.081   6.028   13.533  1.00 0.00 ? 59 ARG A HB2  6  
ATOM 7752  H HB3  . ARG A 1 59 ? 1.303   7.218   12.499  1.00 0.00 ? 59 ARG A HB3  6  
ATOM 7753  H HG2  . ARG A 1 59 ? -0.516  5.420   13.954  1.00 0.00 ? 59 ARG A HG2  6  
ATOM 7754  H HG3  . ARG A 1 59 ? 0.422   6.536   14.948  1.00 0.00 ? 59 ARG A HG3  6  
ATOM 7755  H HD2  . ARG A 1 59 ? -1.241  7.977   14.496  1.00 0.00 ? 59 ARG A HD2  6  
ATOM 7756  H HD3  . ARG A 1 59 ? -0.403  8.182   12.958  1.00 0.00 ? 59 ARG A HD3  6  
ATOM 7757  H HE   . ARG A 1 59 ? -2.121  7.086   11.908  1.00 0.00 ? 59 ARG A HE   6  
ATOM 7758  H HH11 . ARG A 1 59 ? -2.388  6.587   15.352  1.00 0.00 ? 59 ARG A HH11 6  
ATOM 7759  H HH12 . ARG A 1 59 ? -3.951  5.849   15.250  1.00 0.00 ? 59 ARG A HH12 6  
ATOM 7760  H HH21 . ARG A 1 59 ? -4.176  6.115   11.772  1.00 0.00 ? 59 ARG A HH21 6  
ATOM 7761  H HH22 . ARG A 1 59 ? -4.966  5.580   13.218  1.00 0.00 ? 59 ARG A HH22 6  
ATOM 7762  N N    . THR A 1 60 ? 1.273   4.903   9.526   1.00 0.00 ? 60 THR A N    6  
ATOM 7763  C CA   . THR A 1 60 ? 1.735   5.224   8.189   1.00 0.00 ? 60 THR A CA   6  
ATOM 7764  C C    . THR A 1 60 ? 0.650   4.931   7.157   1.00 0.00 ? 60 THR A C    6  
ATOM 7765  O O    . THR A 1 60 ? 0.531   3.806   6.673   1.00 0.00 ? 60 THR A O    6  
ATOM 7766  C CB   . THR A 1 60 ? 3.004   4.436   7.858   1.00 0.00 ? 60 THR A CB   6  
ATOM 7767  O OG1  . THR A 1 60 ? 3.329   3.539   8.905   1.00 0.00 ? 60 THR A OG1  6  
ATOM 7768  C CG2  . THR A 1 60 ? 4.210   5.319   7.619   1.00 0.00 ? 60 THR A CG2  6  
ATOM 7769  H H    . THR A 1 60 ? 0.747   4.096   9.661   1.00 0.00 ? 60 THR A H    6  
ATOM 7770  H HA   . THR A 1 60 ? 1.959   6.271   8.169   1.00 0.00 ? 60 THR A HA   6  
ATOM 7771  H HB   . THR A 1 60 ? 2.832   3.862   6.962   1.00 0.00 ? 60 THR A HB   6  
ATOM 7772  H HG1  . THR A 1 60 ? 4.084   3.005   8.647   1.00 0.00 ? 60 THR A HG1  6  
ATOM 7773  H HG21 . THR A 1 60 ? 4.870   4.841   6.910   1.00 0.00 ? 60 THR A HG21 6  
ATOM 7774  H HG22 . THR A 1 60 ? 4.733   5.474   8.550   1.00 0.00 ? 60 THR A HG22 6  
ATOM 7775  H HG23 . THR A 1 60 ? 3.887   6.271   7.224   1.00 0.00 ? 60 THR A HG23 6  
ATOM 7776  N N    . ARG A 1 61 ? -0.143  5.946   6.826   1.00 0.00 ? 61 ARG A N    6  
ATOM 7777  C CA   . ARG A 1 61 ? -1.215  5.789   5.858   1.00 0.00 ? 61 ARG A CA   6  
ATOM 7778  C C    . ARG A 1 61 ? -0.901  6.531   4.569   1.00 0.00 ? 61 ARG A C    6  
ATOM 7779  O O    . ARG A 1 61 ? -1.210  6.061   3.474   1.00 0.00 ? 61 ARG A O    6  
ATOM 7780  C CB   . ARG A 1 61 ? -2.539  6.284   6.443   1.00 0.00 ? 61 ARG A CB   6  
ATOM 7781  C CG   . ARG A 1 61 ? -3.720  6.121   5.501   1.00 0.00 ? 61 ARG A CG   6  
ATOM 7782  C CD   . ARG A 1 61 ? -4.997  6.679   6.108   1.00 0.00 ? 61 ARG A CD   6  
ATOM 7783  N NE   . ARG A 1 61 ? -5.494  5.845   7.200   1.00 0.00 ? 61 ARG A NE   6  
ATOM 7784  C CZ   . ARG A 1 61 ? -6.579  6.131   7.916   1.00 0.00 ? 61 ARG A CZ   6  
ATOM 7785  N NH1  . ARG A 1 61 ? -7.283  7.227   7.660   1.00 0.00 ? 61 ARG A NH1  6  
ATOM 7786  N NH2  . ARG A 1 61 ? -6.962  5.318   8.892   1.00 0.00 ? 61 ARG A NH2  6  
ATOM 7787  H H    . ARG A 1 61 ? -0.006  6.814   7.241   1.00 0.00 ? 61 ARG A H    6  
ATOM 7788  H HA   . ARG A 1 61 ? -1.296  4.748   5.640   1.00 0.00 ? 61 ARG A HA   6  
ATOM 7789  H HB2  . ARG A 1 61 ? -2.748  5.733   7.347   1.00 0.00 ? 61 ARG A HB2  6  
ATOM 7790  H HB3  . ARG A 1 61 ? -2.442  7.332   6.686   1.00 0.00 ? 61 ARG A HB3  6  
ATOM 7791  H HG2  . ARG A 1 61 ? -3.511  6.647   4.581   1.00 0.00 ? 61 ARG A HG2  6  
ATOM 7792  H HG3  . ARG A 1 61 ? -3.860  5.070   5.293   1.00 0.00 ? 61 ARG A HG3  6  
ATOM 7793  H HD2  . ARG A 1 61 ? -4.797  7.670   6.487   1.00 0.00 ? 61 ARG A HD2  6  
ATOM 7794  H HD3  . ARG A 1 61 ? -5.752  6.735   5.338   1.00 0.00 ? 61 ARG A HD3  6  
ATOM 7795  H HE   . ARG A 1 61 ? -4.993  5.030   7.411   1.00 0.00 ? 61 ARG A HE   6  
ATOM 7796  H HH11 . ARG A 1 61 ? -7.000  7.844   6.926   1.00 0.00 ? 61 ARG A HH11 6  
ATOM 7797  H HH12 . ARG A 1 61 ? -8.097  7.436   8.201   1.00 0.00 ? 61 ARG A HH12 6  
ATOM 7798  H HH21 . ARG A 1 61 ? -6.436  4.491   9.089   1.00 0.00 ? 61 ARG A HH21 6  
ATOM 7799  H HH22 . ARG A 1 61 ? -7.777  5.533   9.430   1.00 0.00 ? 61 ARG A HH22 6  
ATOM 7800  N N    . LYS A 1 62 ? -0.282  7.691   4.710   1.00 0.00 ? 62 LYS A N    6  
ATOM 7801  C CA   . LYS A 1 62 ? 0.083   8.506   3.563   1.00 0.00 ? 62 LYS A CA   6  
ATOM 7802  C C    . LYS A 1 62 ? 1.246   7.882   2.806   1.00 0.00 ? 62 LYS A C    6  
ATOM 7803  O O    . LYS A 1 62 ? 1.357   8.021   1.588   1.00 0.00 ? 62 LYS A O    6  
ATOM 7804  C CB   . LYS A 1 62 ? 0.438   9.923   4.008   1.00 0.00 ? 62 LYS A CB   6  
ATOM 7805  C CG   . LYS A 1 62 ? -0.413  10.998  3.352   1.00 0.00 ? 62 LYS A CG   6  
ATOM 7806  C CD   . LYS A 1 62 ? -1.721  11.205  4.098   1.00 0.00 ? 62 LYS A CD   6  
ATOM 7807  C CE   . LYS A 1 62 ? -2.750  11.912  3.231   1.00 0.00 ? 62 LYS A CE   6  
ATOM 7808  N NZ   . LYS A 1 62 ? -3.599  12.844  4.024   1.00 0.00 ? 62 LYS A NZ   6  
ATOM 7809  H H    . LYS A 1 62 ? -0.064  8.003   5.608   1.00 0.00 ? 62 LYS A H    6  
ATOM 7810  H HA   . LYS A 1 62 ? -0.764  8.549   2.911   1.00 0.00 ? 62 LYS A HA   6  
ATOM 7811  H HB2  . LYS A 1 62 ? 0.309   9.994   5.077   1.00 0.00 ? 62 LYS A HB2  6  
ATOM 7812  H HB3  . LYS A 1 62 ? 1.469   10.113  3.766   1.00 0.00 ? 62 LYS A HB3  6  
ATOM 7813  H HG2  . LYS A 1 62 ? 0.138   11.927  3.348   1.00 0.00 ? 62 LYS A HG2  6  
ATOM 7814  H HG3  . LYS A 1 62 ? -0.630  10.702  2.337   1.00 0.00 ? 62 LYS A HG3  6  
ATOM 7815  H HD2  . LYS A 1 62 ? -2.113  10.243  4.391   1.00 0.00 ? 62 LYS A HD2  6  
ATOM 7816  H HD3  . LYS A 1 62 ? -1.532  11.803  4.978   1.00 0.00 ? 62 LYS A HD3  6  
ATOM 7817  H HE2  . LYS A 1 62 ? -2.234  12.473  2.467   1.00 0.00 ? 62 LYS A HE2  6  
ATOM 7818  H HE3  . LYS A 1 62 ? -3.382  11.170  2.767   1.00 0.00 ? 62 LYS A HE3  6  
ATOM 7819  H HZ1  . LYS A 1 62 ? -4.510  12.993  3.546   1.00 0.00 ? 62 LYS A HZ1  6  
ATOM 7820  H HZ2  . LYS A 1 62 ? -3.121  13.762  4.129   1.00 0.00 ? 62 LYS A HZ2  6  
ATOM 7821  H HZ3  . LYS A 1 62 ? -3.776  12.448  4.970   1.00 0.00 ? 62 LYS A HZ3  6  
ATOM 7822  N N    . GLN A 1 63 ? 2.104   7.188   3.538   1.00 0.00 ? 63 GLN A N    6  
ATOM 7823  C CA   . GLN A 1 63 ? 3.255   6.531   2.944   1.00 0.00 ? 63 GLN A CA   6  
ATOM 7824  C C    . GLN A 1 63 ? 2.830   5.277   2.190   1.00 0.00 ? 63 GLN A C    6  
ATOM 7825  O O    . GLN A 1 63 ? 3.504   4.842   1.255   1.00 0.00 ? 63 GLN A O    6  
ATOM 7826  C CB   . GLN A 1 63 ? 4.284   6.183   4.018   1.00 0.00 ? 63 GLN A CB   6  
ATOM 7827  C CG   . GLN A 1 63 ? 5.604   6.919   3.858   1.00 0.00 ? 63 GLN A CG   6  
ATOM 7828  C CD   . GLN A 1 63 ? 5.573   8.309   4.463   1.00 0.00 ? 63 GLN A CD   6  
ATOM 7829  O OE1  . GLN A 1 63 ? 4.512   8.919   4.593   1.00 0.00 ? 63 GLN A OE1  6  
ATOM 7830  N NE2  . GLN A 1 63 ? 6.742   8.817   4.838   1.00 0.00 ? 63 GLN A NE2  6  
ATOM 7831  H H    . GLN A 1 63 ? 1.954   7.112   4.499   1.00 0.00 ? 63 GLN A H    6  
ATOM 7832  H HA   . GLN A 1 63 ? 3.697   7.218   2.252   1.00 0.00 ? 63 GLN A HA   6  
ATOM 7833  H HB2  . GLN A 1 63 ? 3.873   6.432   4.982   1.00 0.00 ? 63 GLN A HB2  6  
ATOM 7834  H HB3  . GLN A 1 63 ? 4.481   5.123   3.981   1.00 0.00 ? 63 GLN A HB3  6  
ATOM 7835  H HG2  . GLN A 1 63 ? 6.381   6.349   4.344   1.00 0.00 ? 63 GLN A HG2  6  
ATOM 7836  H HG3  . GLN A 1 63 ? 5.827   7.006   2.804   1.00 0.00 ? 63 GLN A HG3  6  
ATOM 7837  H HE21 . GLN A 1 63 ? 7.547   8.274   4.704   1.00 0.00 ? 63 GLN A HE21 6  
ATOM 7838  H HE22 . GLN A 1 63 ? 6.751   9.714   5.233   1.00 0.00 ? 63 GLN A HE22 6  
ATOM 7839  N N    . VAL A 1 64 ? 1.707   4.701   2.603   1.00 0.00 ? 64 VAL A N    6  
ATOM 7840  C CA   . VAL A 1 64 ? 1.188   3.499   1.970   1.00 0.00 ? 64 VAL A CA   6  
ATOM 7841  C C    . VAL A 1 64 ? 0.460   3.825   0.672   1.00 0.00 ? 64 VAL A C    6  
ATOM 7842  O O    . VAL A 1 64 ? 0.284   2.957   -0.182  1.00 0.00 ? 64 VAL A O    6  
ATOM 7843  C CB   . VAL A 1 64 ? 0.231   2.732   2.903   1.00 0.00 ? 64 VAL A CB   6  
ATOM 7844  C CG1  . VAL A 1 64 ? -0.160  1.397   2.288   1.00 0.00 ? 64 VAL A CG1  6  
ATOM 7845  C CG2  . VAL A 1 64 ? 0.863   2.530   4.271   1.00 0.00 ? 64 VAL A CG2  6  
ATOM 7846  H H    . VAL A 1 64 ? 1.217   5.093   3.350   1.00 0.00 ? 64 VAL A H    6  
ATOM 7847  H HA   . VAL A 1 64 ? 2.025   2.864   1.747   1.00 0.00 ? 64 VAL A HA   6  
ATOM 7848  H HB   . VAL A 1 64 ? -0.666  3.321   3.028   1.00 0.00 ? 64 VAL A HB   6  
ATOM 7849  H HG11 . VAL A 1 64 ? -0.873  1.562   1.494   1.00 0.00 ? 64 VAL A HG11 6  
ATOM 7850  H HG12 . VAL A 1 64 ? -0.604  0.768   3.045   1.00 0.00 ? 64 VAL A HG12 6  
ATOM 7851  H HG13 . VAL A 1 64 ? 0.719   0.913   1.888   1.00 0.00 ? 64 VAL A HG13 6  
ATOM 7852  H HG21 . VAL A 1 64 ? 0.103   2.231   4.978   1.00 0.00 ? 64 VAL A HG21 6  
ATOM 7853  H HG22 . VAL A 1 64 ? 1.316   3.454   4.599   1.00 0.00 ? 64 VAL A HG22 6  
ATOM 7854  H HG23 . VAL A 1 64 ? 1.618   1.761   4.208   1.00 0.00 ? 64 VAL A HG23 6  
ATOM 7855  N N    . SER A 1 65 ? 0.047   5.078   0.520   1.00 0.00 ? 65 SER A N    6  
ATOM 7856  C CA   . SER A 1 65 ? -0.647  5.504   -0.682  1.00 0.00 ? 65 SER A CA   6  
ATOM 7857  C C    . SER A 1 65 ? 0.360   5.890   -1.749  1.00 0.00 ? 65 SER A C    6  
ATOM 7858  O O    . SER A 1 65 ? 0.133   5.699   -2.943  1.00 0.00 ? 65 SER A O    6  
ATOM 7859  C CB   . SER A 1 65 ? -1.580  6.678   -0.381  1.00 0.00 ? 65 SER A CB   6  
ATOM 7860  O OG   . SER A 1 65 ? -2.524  6.860   -1.423  1.00 0.00 ? 65 SER A OG   6  
ATOM 7861  H H    . SER A 1 65 ? 0.223   5.730   1.223   1.00 0.00 ? 65 SER A H    6  
ATOM 7862  H HA   . SER A 1 65 ? -1.223  4.672   -1.035  1.00 0.00 ? 65 SER A HA   6  
ATOM 7863  H HB2  . SER A 1 65 ? -2.112  6.485   0.539   1.00 0.00 ? 65 SER A HB2  6  
ATOM 7864  H HB3  . SER A 1 65 ? -0.997  7.581   -0.278  1.00 0.00 ? 65 SER A HB3  6  
ATOM 7865  H HG   . SER A 1 65 ? -2.794  7.781   -1.452  1.00 0.00 ? 65 SER A HG   6  
ATOM 7866  N N    . SER A 1 66 ? 1.481   6.422   -1.294  1.00 0.00 ? 66 SER A N    6  
ATOM 7867  C CA   . SER A 1 66 ? 2.555   6.830   -2.177  1.00 0.00 ? 66 SER A CA   6  
ATOM 7868  C C    . SER A 1 66 ? 3.254   5.612   -2.757  1.00 0.00 ? 66 SER A C    6  
ATOM 7869  O O    . SER A 1 66 ? 3.733   5.630   -3.891  1.00 0.00 ? 66 SER A O    6  
ATOM 7870  C CB   . SER A 1 66 ? 3.549   7.690   -1.412  1.00 0.00 ? 66 SER A CB   6  
ATOM 7871  O OG   . SER A 1 66 ? 3.904   8.847   -2.149  1.00 0.00 ? 66 SER A OG   6  
ATOM 7872  H H    . SER A 1 66 ? 1.594   6.532   -0.331  1.00 0.00 ? 66 SER A H    6  
ATOM 7873  H HA   . SER A 1 66 ? 2.135   7.403   -2.973  1.00 0.00 ? 66 SER A HA   6  
ATOM 7874  H HB2  . SER A 1 66 ? 3.109   7.993   -0.474  1.00 0.00 ? 66 SER A HB2  6  
ATOM 7875  H HB3  . SER A 1 66 ? 4.432   7.113   -1.221  1.00 0.00 ? 66 SER A HB3  6  
ATOM 7876  H HG   . SER A 1 66 ? 4.785   8.736   -2.515  1.00 0.00 ? 66 SER A HG   6  
ATOM 7877  N N    . HIS A 1 67 ? 3.308   4.554   -1.961  1.00 0.00 ? 67 HIS A N    6  
ATOM 7878  C CA   . HIS A 1 67 ? 3.948   3.314   -2.375  1.00 0.00 ? 67 HIS A CA   6  
ATOM 7879  C C    . HIS A 1 67 ? 3.151   2.624   -3.472  1.00 0.00 ? 67 HIS A C    6  
ATOM 7880  O O    . HIS A 1 67 ? 3.718   1.988   -4.360  1.00 0.00 ? 67 HIS A O    6  
ATOM 7881  C CB   . HIS A 1 67 ? 4.117   2.376   -1.179  1.00 0.00 ? 67 HIS A CB   6  
ATOM 7882  C CG   . HIS A 1 67 ? 5.043   1.230   -1.443  1.00 0.00 ? 67 HIS A CG   6  
ATOM 7883  N ND1  . HIS A 1 67 ? 6.299   1.388   -1.991  1.00 0.00 ? 67 HIS A ND1  6  
ATOM 7884  C CD2  . HIS A 1 67 ? 4.892   -0.099  -1.231  1.00 0.00 ? 67 HIS A CD2  6  
ATOM 7885  C CE1  . HIS A 1 67 ? 6.879   0.206   -2.105  1.00 0.00 ? 67 HIS A CE1  6  
ATOM 7886  N NE2  . HIS A 1 67 ? 6.047   -0.712  -1.651  1.00 0.00 ? 67 HIS A NE2  6  
ATOM 7887  H H    . HIS A 1 67 ? 2.909   4.613   -1.069  1.00 0.00 ? 67 HIS A H    6  
ATOM 7888  H HA   . HIS A 1 67 ? 4.916   3.564   -2.763  1.00 0.00 ? 67 HIS A HA   6  
ATOM 7889  H HB2  . HIS A 1 67 ? 4.511   2.935   -0.344  1.00 0.00 ? 67 HIS A HB2  6  
ATOM 7890  H HB3  . HIS A 1 67 ? 3.152   1.969   -0.910  1.00 0.00 ? 67 HIS A HB3  6  
ATOM 7891  H HD1  . HIS A 1 67 ? 6.704   2.239   -2.257  1.00 0.00 ? 67 HIS A HD1  6  
ATOM 7892  H HD2  . HIS A 1 67 ? 4.023   -0.586  -0.810  1.00 0.00 ? 67 HIS A HD2  6  
ATOM 7893  H HE1  . HIS A 1 67 ? 7.867   0.023   -2.502  1.00 0.00 ? 67 HIS A HE1  6  
ATOM 7894  H HE2  . HIS A 1 67 ? 6.191   -1.680  -1.701  1.00 0.00 ? 67 HIS A HE2  6  
ATOM 7895  N N    . ILE A 1 68 ? 1.835   2.756   -3.407  1.00 0.00 ? 68 ILE A N    6  
ATOM 7896  C CA   . ILE A 1 68 ? 0.962   2.147   -4.399  1.00 0.00 ? 68 ILE A CA   6  
ATOM 7897  C C    . ILE A 1 68 ? 1.035   2.897   -5.722  1.00 0.00 ? 68 ILE A C    6  
ATOM 7898  O O    . ILE A 1 68 ? 0.798   2.325   -6.786  1.00 0.00 ? 68 ILE A O    6  
ATOM 7899  C CB   . ILE A 1 68 ? -0.503  2.101   -3.922  1.00 0.00 ? 68 ILE A CB   6  
ATOM 7900  C CG1  . ILE A 1 68 ? -0.591  1.477   -2.529  1.00 0.00 ? 68 ILE A CG1  6  
ATOM 7901  C CG2  . ILE A 1 68 ? -1.359  1.319   -4.908  1.00 0.00 ? 68 ILE A CG2  6  
ATOM 7902  C CD1  . ILE A 1 68 ? -1.764  1.980   -1.717  1.00 0.00 ? 68 ILE A CD1  6  
ATOM 7903  H H    . ILE A 1 68 ? 1.445   3.276   -2.678  1.00 0.00 ? 68 ILE A H    6  
ATOM 7904  H HA   . ILE A 1 68 ? 1.300   1.139   -4.554  1.00 0.00 ? 68 ILE A HA   6  
ATOM 7905  H HB   . ILE A 1 68 ? -0.878  3.112   -3.880  1.00 0.00 ? 68 ILE A HB   6  
ATOM 7906  H HG12 . ILE A 1 68 ? -0.691  0.406   -2.626  1.00 0.00 ? 68 ILE A HG12 6  
ATOM 7907  H HG13 . ILE A 1 68 ? 0.313   1.701   -1.983  1.00 0.00 ? 68 ILE A HG13 6  
ATOM 7908  H HG21 . ILE A 1 68 ? -2.107  0.756   -4.368  1.00 0.00 ? 68 ILE A HG21 6  
ATOM 7909  H HG22 . ILE A 1 68 ? -0.733  0.640   -5.468  1.00 0.00 ? 68 ILE A HG22 6  
ATOM 7910  H HG23 . ILE A 1 68 ? -1.844  2.004   -5.587  1.00 0.00 ? 68 ILE A HG23 6  
ATOM 7911  H HD11 . ILE A 1 68 ? -1.571  1.819   -0.667  1.00 0.00 ? 68 ILE A HD11 6  
ATOM 7912  H HD12 . ILE A 1 68 ? -2.657  1.444   -2.005  1.00 0.00 ? 68 ILE A HD12 6  
ATOM 7913  H HD13 . ILE A 1 68 ? -1.903  3.035   -1.901  1.00 0.00 ? 68 ILE A HD13 6  
ATOM 7914  N N    . GLN A 1 69 ? 1.369   4.178   -5.647  1.00 0.00 ? 69 GLN A N    6  
ATOM 7915  C CA   . GLN A 1 69 ? 1.480   5.008   -6.835  1.00 0.00 ? 69 GLN A CA   6  
ATOM 7916  C C    . GLN A 1 69 ? 2.767   4.702   -7.588  1.00 0.00 ? 69 GLN A C    6  
ATOM 7917  O O    . GLN A 1 69 ? 2.833   4.839   -8.809  1.00 0.00 ? 69 GLN A O    6  
ATOM 7918  C CB   . GLN A 1 69 ? 1.427   6.490   -6.459  1.00 0.00 ? 69 GLN A CB   6  
ATOM 7919  C CG   . GLN A 1 69 ? 0.107   6.912   -5.836  1.00 0.00 ? 69 GLN A CG   6  
ATOM 7920  C CD   . GLN A 1 69 ? -0.382  8.250   -6.355  1.00 0.00 ? 69 GLN A CD   6  
ATOM 7921  O OE1  . GLN A 1 69 ? 0.001   8.685   -7.440  1.00 0.00 ? 69 GLN A OE1  6  
ATOM 7922  N NE2  . GLN A 1 69 ? -1.234  8.910   -5.579  1.00 0.00 ? 69 GLN A NE2  6  
ATOM 7923  H H    . GLN A 1 69 ? 1.547   4.572   -4.773  1.00 0.00 ? 69 GLN A H    6  
ATOM 7924  H HA   . GLN A 1 69 ? 0.647   4.776   -7.470  1.00 0.00 ? 69 GLN A HA   6  
ATOM 7925  H HB2  . GLN A 1 69 ? 2.218   6.699   -5.754  1.00 0.00 ? 69 GLN A HB2  6  
ATOM 7926  H HB3  . GLN A 1 69 ? 1.586   7.081   -7.349  1.00 0.00 ? 69 GLN A HB3  6  
ATOM 7927  H HG2  . GLN A 1 69 ? -0.638  6.163   -6.059  1.00 0.00 ? 69 GLN A HG2  6  
ATOM 7928  H HG3  . GLN A 1 69 ? 0.235   6.982   -4.765  1.00 0.00 ? 69 GLN A HG3  6  
ATOM 7929  H HE21 . GLN A 1 69 ? -1.495  8.503   -4.727  1.00 0.00 ? 69 GLN A HE21 6  
ATOM 7930  H HE22 . GLN A 1 69 ? -1.566  9.778   -5.890  1.00 0.00 ? 69 GLN A HE22 6  
ATOM 7931  N N    . VAL A 1 70 ? 3.785   4.279   -6.851  1.00 0.00 ? 70 VAL A N    6  
ATOM 7932  C CA   . VAL A 1 70 ? 5.069   3.945   -7.447  1.00 0.00 ? 70 VAL A CA   6  
ATOM 7933  C C    . VAL A 1 70 ? 4.990   2.624   -8.197  1.00 0.00 ? 70 VAL A C    6  
ATOM 7934  O O    . VAL A 1 70 ? 5.716   2.402   -9.167  1.00 0.00 ? 70 VAL A O    6  
ATOM 7935  C CB   . VAL A 1 70 ? 6.187   3.862   -6.400  1.00 0.00 ? 70 VAL A CB   6  
ATOM 7936  C CG1  . VAL A 1 70 ? 7.548   4.035   -7.057  1.00 0.00 ? 70 VAL A CG1  6  
ATOM 7937  C CG2  . VAL A 1 70 ? 5.982   4.894   -5.299  1.00 0.00 ? 70 VAL A CG2  6  
ATOM 7938  H H    . VAL A 1 70 ? 3.667   4.186   -5.886  1.00 0.00 ? 70 VAL A H    6  
ATOM 7939  H HA   . VAL A 1 70 ? 5.319   4.716   -8.137  1.00 0.00 ? 70 VAL A HA   6  
ATOM 7940  H HB   . VAL A 1 70 ? 6.150   2.887   -5.961  1.00 0.00 ? 70 VAL A HB   6  
ATOM 7941  H HG11 . VAL A 1 70 ? 7.509   3.660   -8.069  1.00 0.00 ? 70 VAL A HG11 6  
ATOM 7942  H HG12 . VAL A 1 70 ? 8.290   3.485   -6.498  1.00 0.00 ? 70 VAL A HG12 6  
ATOM 7943  H HG13 . VAL A 1 70 ? 7.811   5.082   -7.071  1.00 0.00 ? 70 VAL A HG13 6  
ATOM 7944  H HG21 . VAL A 1 70 ? 5.332   5.678   -5.657  1.00 0.00 ? 70 VAL A HG21 6  
ATOM 7945  H HG22 . VAL A 1 70 ? 6.936   5.316   -5.019  1.00 0.00 ? 70 VAL A HG22 6  
ATOM 7946  H HG23 . VAL A 1 70 ? 5.533   4.419   -4.439  1.00 0.00 ? 70 VAL A HG23 6  
ATOM 7947  N N    . LEU A 1 71 ? 4.099   1.752   -7.744  1.00 0.00 ? 71 LEU A N    6  
ATOM 7948  C CA   . LEU A 1 71 ? 3.915   0.454   -8.373  1.00 0.00 ? 71 LEU A CA   6  
ATOM 7949  C C    . LEU A 1 71 ? 3.215   0.602   -9.717  1.00 0.00 ? 71 LEU A C    6  
ATOM 7950  O O    . LEU A 1 71 ? 3.414   -0.204  -10.626 1.00 0.00 ? 71 LEU A O    6  
ATOM 7951  C CB   . LEU A 1 71 ? 3.117   -0.474  -7.458  1.00 0.00 ? 71 LEU A CB   6  
ATOM 7952  C CG   . LEU A 1 71 ? 3.859   -1.733  -7.008  1.00 0.00 ? 71 LEU A CG   6  
ATOM 7953  C CD1  . LEU A 1 71 ? 4.693   -1.448  -5.769  1.00 0.00 ? 71 LEU A CD1  6  
ATOM 7954  C CD2  . LEU A 1 71 ? 2.876   -2.863  -6.743  1.00 0.00 ? 71 LEU A CD2  6  
ATOM 7955  H H    . LEU A 1 71 ? 3.550   1.991   -6.972  1.00 0.00 ? 71 LEU A H    6  
ATOM 7956  H HA   . LEU A 1 71 ? 4.885   0.032   -8.535  1.00 0.00 ? 71 LEU A HA   6  
ATOM 7957  H HB2  . LEU A 1 71 ? 2.832   0.084   -6.580  1.00 0.00 ? 71 LEU A HB2  6  
ATOM 7958  H HB3  . LEU A 1 71 ? 2.223   -0.777  -7.978  1.00 0.00 ? 71 LEU A HB3  6  
ATOM 7959  H HG   . LEU A 1 71 ? 4.528   -2.049  -7.795  1.00 0.00 ? 71 LEU A HG   6  
ATOM 7960  H HD11 . LEU A 1 71 ? 4.803   -2.354  -5.192  1.00 0.00 ? 71 LEU A HD11 6  
ATOM 7961  H HD12 . LEU A 1 71 ? 4.200   -0.697  -5.169  1.00 0.00 ? 71 LEU A HD12 6  
ATOM 7962  H HD13 . LEU A 1 71 ? 5.667   -1.089  -6.066  1.00 0.00 ? 71 LEU A HD13 6  
ATOM 7963  H HD21 . LEU A 1 71 ? 2.361   -2.681  -5.811  1.00 0.00 ? 71 LEU A HD21 6  
ATOM 7964  H HD22 . LEU A 1 71 ? 3.411   -3.799  -6.682  1.00 0.00 ? 71 LEU A HD22 6  
ATOM 7965  H HD23 . LEU A 1 71 ? 2.157   -2.912  -7.548  1.00 0.00 ? 71 LEU A HD23 6  
ATOM 7966  N N    . ALA A 1 72 ? 2.400   1.642   -9.835  1.00 0.00 ? 72 ALA A N    6  
ATOM 7967  C CA   . ALA A 1 72 ? 1.672   1.905   -11.066 1.00 0.00 ? 72 ALA A CA   6  
ATOM 7968  C C    . ALA A 1 72 ? 2.613   2.389   -12.161 1.00 0.00 ? 72 ALA A C    6  
ATOM 7969  O O    . ALA A 1 72 ? 2.361   2.182   -13.348 1.00 0.00 ? 72 ALA A O    6  
ATOM 7970  C CB   . ALA A 1 72 ? 0.568   2.924   -10.823 1.00 0.00 ? 72 ALA A CB   6  
ATOM 7971  H H    . ALA A 1 72 ? 2.288   2.246   -9.076  1.00 0.00 ? 72 ALA A H    6  
ATOM 7972  H HA   . ALA A 1 72 ? 1.218   0.984   -11.381 1.00 0.00 ? 72 ALA A HA   6  
ATOM 7973  H HB1  . ALA A 1 72 ? -0.347  2.409   -10.572 1.00 0.00 ? 72 ALA A HB1  6  
ATOM 7974  H HB2  . ALA A 1 72 ? 0.418   3.511   -11.716 1.00 0.00 ? 72 ALA A HB2  6  
ATOM 7975  H HB3  . ALA A 1 72 ? 0.851   3.574   -10.008 1.00 0.00 ? 72 ALA A HB3  6  
ATOM 7976  N N    . ARG A 1 73 ? 3.699   3.030   -11.751 1.00 0.00 ? 73 ARG A N    6  
ATOM 7977  C CA   . ARG A 1 73 ? 4.684   3.543   -12.691 1.00 0.00 ? 73 ARG A CA   6  
ATOM 7978  C C    . ARG A 1 73 ? 5.480   2.405   -13.316 1.00 0.00 ? 73 ARG A C    6  
ATOM 7979  O O    . ARG A 1 73 ? 5.958   2.512   -14.445 1.00 0.00 ? 73 ARG A O    6  
ATOM 7980  C CB   . ARG A 1 73 ? 5.629   4.523   -11.993 1.00 0.00 ? 73 ARG A CB   6  
ATOM 7981  C CG   . ARG A 1 73 ? 5.139   5.962   -12.017 1.00 0.00 ? 73 ARG A CG   6  
ATOM 7982  C CD   . ARG A 1 73 ? 6.296   6.942   -12.126 1.00 0.00 ? 73 ARG A CD   6  
ATOM 7983  N NE   . ARG A 1 73 ? 5.976   8.071   -12.996 1.00 0.00 ? 73 ARG A NE   6  
ATOM 7984  C CZ   . ARG A 1 73 ? 5.193   9.086   -12.637 1.00 0.00 ? 73 ARG A CZ   6  
ATOM 7985  N NH1  . ARG A 1 73 ? 4.649   9.117   -11.427 1.00 0.00 ? 73 ARG A NH1  6  
ATOM 7986  N NH2  . ARG A 1 73 ? 4.953   10.073  -13.490 1.00 0.00 ? 73 ARG A NH2  6  
ATOM 7987  H H    . ARG A 1 73 ? 3.840   3.160   -10.793 1.00 0.00 ? 73 ARG A H    6  
ATOM 7988  H HA   . ARG A 1 73 ? 4.153   4.060   -13.468 1.00 0.00 ? 73 ARG A HA   6  
ATOM 7989  H HB2  . ARG A 1 73 ? 5.744   4.222   -10.962 1.00 0.00 ? 73 ARG A HB2  6  
ATOM 7990  H HB3  . ARG A 1 73 ? 6.592   4.485   -12.480 1.00 0.00 ? 73 ARG A HB3  6  
ATOM 7991  H HG2  . ARG A 1 73 ? 4.486   6.096   -12.866 1.00 0.00 ? 73 ARG A HG2  6  
ATOM 7992  H HG3  . ARG A 1 73 ? 4.594   6.161   -11.106 1.00 0.00 ? 73 ARG A HG3  6  
ATOM 7993  H HD2  . ARG A 1 73 ? 6.529   7.315   -11.140 1.00 0.00 ? 73 ARG A HD2  6  
ATOM 7994  H HD3  . ARG A 1 73 ? 7.155   6.423   -12.526 1.00 0.00 ? 73 ARG A HD3  6  
ATOM 7995  H HE   . ARG A 1 73 ? 6.365   8.074   -13.896 1.00 0.00 ? 73 ARG A HE   6  
ATOM 7996  H HH11 . ARG A 1 73 ? 4.826   8.376   -10.779 1.00 0.00 ? 73 ARG A HH11 6  
ATOM 7997  H HH12 . ARG A 1 73 ? 4.061   9.882   -11.162 1.00 0.00 ? 73 ARG A HH12 6  
ATOM 7998  H HH21 . ARG A 1 73 ? 5.361   10.054  -14.403 1.00 0.00 ? 73 ARG A HH21 6  
ATOM 7999  H HH22 . ARG A 1 73 ? 4.364   10.835  -13.220 1.00 0.00 ? 73 ARG A HH22 6  
ATOM 8000  N N    . ARG A 1 74 ? 5.616   1.315   -12.572 1.00 0.00 ? 74 ARG A N    6  
ATOM 8001  C CA   . ARG A 1 74 ? 6.350   0.152   -13.046 1.00 0.00 ? 74 ARG A CA   6  
ATOM 8002  C C    . ARG A 1 74 ? 5.562   -0.588  -14.120 1.00 0.00 ? 74 ARG A C    6  
ATOM 8003  O O    . ARG A 1 74 ? 6.137   -1.243  -14.989 1.00 0.00 ? 74 ARG A O    6  
ATOM 8004  C CB   . ARG A 1 74 ? 6.665   -0.791  -11.883 1.00 0.00 ? 74 ARG A CB   6  
ATOM 8005  C CG   . ARG A 1 74 ? 7.954   -0.448  -11.154 1.00 0.00 ? 74 ARG A CG   6  
ATOM 8006  C CD   . ARG A 1 74 ? 8.662   -1.699  -10.659 1.00 0.00 ? 74 ARG A CD   6  
ATOM 8007  N NE   . ARG A 1 74 ? 9.275   -2.450  -11.752 1.00 0.00 ? 74 ARG A NE   6  
ATOM 8008  C CZ   . ARG A 1 74 ? 9.737   -3.692  -11.630 1.00 0.00 ? 74 ARG A CZ   6  
ATOM 8009  N NH1  . ARG A 1 74 ? 9.660   -4.325  -10.466 1.00 0.00 ? 74 ARG A NH1  6  
ATOM 8010  N NH2  . ARG A 1 74 ? 10.279  -4.304  -12.675 1.00 0.00 ? 74 ARG A NH2  6  
ATOM 8011  H H    . ARG A 1 74 ? 5.211   1.294   -11.684 1.00 0.00 ? 74 ARG A H    6  
ATOM 8012  H HA   . ARG A 1 74 ? 7.271   0.501   -13.473 1.00 0.00 ? 74 ARG A HA   6  
ATOM 8013  H HB2  . ARG A 1 74 ? 5.853   -0.750  -11.172 1.00 0.00 ? 74 ARG A HB2  6  
ATOM 8014  H HB3  . ARG A 1 74 ? 6.748   -1.798  -12.264 1.00 0.00 ? 74 ARG A HB3  6  
ATOM 8015  H HG2  . ARG A 1 74 ? 8.609   0.080   -11.830 1.00 0.00 ? 74 ARG A HG2  6  
ATOM 8016  H HG3  . ARG A 1 74 ? 7.721   0.182   -10.308 1.00 0.00 ? 74 ARG A HG3  6  
ATOM 8017  H HD2  . ARG A 1 74 ? 9.433   -1.408  -9.960  1.00 0.00 ? 74 ARG A HD2  6  
ATOM 8018  H HD3  . ARG A 1 74 ? 7.943   -2.330  -10.159 1.00 0.00 ? 74 ARG A HD3  6  
ATOM 8019  H HE   . ARG A 1 74 ? 9.344   -2.007  -12.623 1.00 0.00 ? 74 ARG A HE   6  
ATOM 8020  H HH11 . ARG A 1 74 ? 9.253   -3.870  -9.674  1.00 0.00 ? 74 ARG A HH11 6  
ATOM 8021  H HH12 . ARG A 1 74 ? 10.010  -5.258  -10.380 1.00 0.00 ? 74 ARG A HH12 6  
ATOM 8022  H HH21 . ARG A 1 74 ? 10.339  -3.831  -13.554 1.00 0.00 ? 74 ARG A HH21 6  
ATOM 8023  H HH22 . ARG A 1 74 ? 10.627  -5.237  -12.583 1.00 0.00 ? 74 ARG A HH22 6  
ATOM 8024  N N    . LYS A 1 75 ? 4.242   -0.478  -14.050 1.00 0.00 ? 75 LYS A N    6  
ATOM 8025  C CA   . LYS A 1 75 ? 3.367   -1.134  -15.011 1.00 0.00 ? 75 LYS A CA   6  
ATOM 8026  C C    . LYS A 1 75 ? 3.373   -0.401  -16.348 1.00 0.00 ? 75 LYS A C    6  
ATOM 8027  O O    . LYS A 1 75 ? 3.095   -0.990  -17.392 1.00 0.00 ? 75 LYS A O    6  
ATOM 8028  C CB   . LYS A 1 75 ? 1.941   -1.214  -14.463 1.00 0.00 ? 75 LYS A CB   6  
ATOM 8029  C CG   . LYS A 1 75 ? 1.631   -2.528  -13.765 1.00 0.00 ? 75 LYS A CG   6  
ATOM 8030  C CD   . LYS A 1 75 ? 0.719   -2.323  -12.566 1.00 0.00 ? 75 LYS A CD   6  
ATOM 8031  C CE   . LYS A 1 75 ? 1.500   -2.342  -11.262 1.00 0.00 ? 75 LYS A CE   6  
ATOM 8032  N NZ   . LYS A 1 75 ? 1.455   -3.679  -10.607 1.00 0.00 ? 75 LYS A NZ   6  
ATOM 8033  H H    . LYS A 1 75 ? 3.848   0.056   -13.335 1.00 0.00 ? 75 LYS A H    6  
ATOM 8034  H HA   . LYS A 1 75 ? 3.740   -2.129  -15.162 1.00 0.00 ? 75 LYS A HA   6  
ATOM 8035  H HB2  . LYS A 1 75 ? 1.794   -0.412  -13.755 1.00 0.00 ? 75 LYS A HB2  6  
ATOM 8036  H HB3  . LYS A 1 75 ? 1.245   -1.092  -15.280 1.00 0.00 ? 75 LYS A HB3  6  
ATOM 8037  H HG2  . LYS A 1 75 ? 1.143   -3.190  -14.465 1.00 0.00 ? 75 LYS A HG2  6  
ATOM 8038  H HG3  . LYS A 1 75 ? 2.556   -2.974  -13.430 1.00 0.00 ? 75 LYS A HG3  6  
ATOM 8039  H HD2  . LYS A 1 75 ? 0.223   -1.368  -12.662 1.00 0.00 ? 75 LYS A HD2  6  
ATOM 8040  H HD3  . LYS A 1 75 ? -0.017  -3.113  -12.546 1.00 0.00 ? 75 LYS A HD3  6  
ATOM 8041  H HE2  . LYS A 1 75 ? 2.528   -2.087  -11.469 1.00 0.00 ? 75 LYS A HE2  6  
ATOM 8042  H HE3  . LYS A 1 75 ? 1.076   -1.608  -10.592 1.00 0.00 ? 75 LYS A HE3  6  
ATOM 8043  H HZ1  . LYS A 1 75 ? 0.699   -3.702  -9.894  1.00 0.00 ? 75 LYS A HZ1  6  
ATOM 8044  H HZ2  . LYS A 1 75 ? 2.363   -3.879  -10.141 1.00 0.00 ? 75 LYS A HZ2  6  
ATOM 8045  H HZ3  . LYS A 1 75 ? 1.273   -4.418  -11.316 1.00 0.00 ? 75 LYS A HZ3  6  
ATOM 8046  N N    . SER A 1 76 ? 3.690   0.887   -16.308 1.00 0.00 ? 76 SER A N    6  
ATOM 8047  C CA   . SER A 1 76 ? 3.732   1.703   -17.516 1.00 0.00 ? 76 SER A CA   6  
ATOM 8048  C C    . SER A 1 76 ? 4.820   1.222   -18.472 1.00 0.00 ? 76 SER A C    6  
ATOM 8049  O O    . SER A 1 76 ? 4.810   1.561   -19.655 1.00 0.00 ? 76 SER A O    6  
ATOM 8050  C CB   . SER A 1 76 ? 3.966   3.172   -17.157 1.00 0.00 ? 76 SER A CB   6  
ATOM 8051  O OG   . SER A 1 76 ? 5.299   3.387   -16.727 1.00 0.00 ? 76 SER A OG   6  
ATOM 8052  H H    . SER A 1 76 ? 3.901   1.299   -15.446 1.00 0.00 ? 76 SER A H    6  
ATOM 8053  H HA   . SER A 1 76 ? 2.777   1.610   -18.006 1.00 0.00 ? 76 SER A HA   6  
ATOM 8054  H HB2  . SER A 1 76 ? 3.777   3.787   -18.024 1.00 0.00 ? 76 SER A HB2  6  
ATOM 8055  H HB3  . SER A 1 76 ? 3.293   3.457   -16.361 1.00 0.00 ? 76 SER A HB3  6  
ATOM 8056  H HG   . SER A 1 76 ? 5.826   3.705   -17.464 1.00 0.00 ? 76 SER A HG   6  
ATOM 8057  N N    . ARG A 1 77 ? 5.753   0.428   -17.957 1.00 0.00 ? 77 ARG A N    6  
ATOM 8058  C CA   . ARG A 1 77 ? 6.840   -0.099  -18.772 1.00 0.00 ? 77 ARG A CA   6  
ATOM 8059  C C    . ARG A 1 77 ? 6.305   -0.966  -19.910 1.00 0.00 ? 77 ARG A C    6  
ATOM 8060  O O    . ARG A 1 77 ? 7.013   -1.236  -20.880 1.00 0.00 ? 77 ARG A O    6  
ATOM 8061  C CB   . ARG A 1 77 ? 7.806   -0.912  -17.908 1.00 0.00 ? 77 ARG A CB   6  
ATOM 8062  C CG   . ARG A 1 77 ? 8.708   -0.055  -17.034 1.00 0.00 ? 77 ARG A CG   6  
ATOM 8063  C CD   . ARG A 1 77 ? 10.090  -0.671  -16.887 1.00 0.00 ? 77 ARG A CD   6  
ATOM 8064  N NE   . ARG A 1 77 ? 11.144  0.341   -16.898 1.00 0.00 ? 77 ARG A NE   6  
ATOM 8065  C CZ   . ARG A 1 77 ? 11.301  1.259   -15.947 1.00 0.00 ? 77 ARG A CZ   6  
ATOM 8066  N NH1  . ARG A 1 77 ? 10.474  1.297   -14.909 1.00 0.00 ? 77 ARG A NH1  6  
ATOM 8067  N NH2  . ARG A 1 77 ? 12.286  2.142   -16.034 1.00 0.00 ? 77 ARG A NH2  6  
ATOM 8068  H H    . ARG A 1 77 ? 5.709   0.189   -17.008 1.00 0.00 ? 77 ARG A H    6  
ATOM 8069  H HA   . ARG A 1 77 ? 7.370   0.739   -19.196 1.00 0.00 ? 77 ARG A HA   6  
ATOM 8070  H HB2  . ARG A 1 77 ? 7.234   -1.565  -17.266 1.00 0.00 ? 77 ARG A HB2  6  
ATOM 8071  H HB3  . ARG A 1 77 ? 8.431   -1.512  -18.554 1.00 0.00 ? 77 ARG A HB3  6  
ATOM 8072  H HG2  . ARG A 1 77 ? 8.807   0.922   -17.484 1.00 0.00 ? 77 ARG A HG2  6  
ATOM 8073  H HG3  . ARG A 1 77 ? 8.260   0.040   -16.056 1.00 0.00 ? 77 ARG A HG3  6  
ATOM 8074  H HD2  . ARG A 1 77 ? 10.132  -1.210  -15.953 1.00 0.00 ? 77 ARG A HD2  6  
ATOM 8075  H HD3  . ARG A 1 77 ? 10.254  -1.357  -17.706 1.00 0.00 ? 77 ARG A HD3  6  
ATOM 8076  H HE   . ARG A 1 77 ? 11.769  0.335   -17.654 1.00 0.00 ? 77 ARG A HE   6  
ATOM 8077  H HH11 . ARG A 1 77 ? 9.729   0.634   -14.837 1.00 0.00 ? 77 ARG A HH11 6  
ATOM 8078  H HH12 . ARG A 1 77 ? 10.597  1.989   -14.198 1.00 0.00 ? 77 ARG A HH12 6  
ATOM 8079  H HH21 . ARG A 1 77 ? 12.912  2.118   -16.814 1.00 0.00 ? 77 ARG A HH21 6  
ATOM 8080  H HH22 . ARG A 1 77 ? 12.404  2.832   -15.320 1.00 0.00 ? 77 ARG A HH22 6  
ATOM 8081  N N    . ASP A 1 78 ? 5.053   -1.400  -19.787 1.00 0.00 ? 78 ASP A N    6  
ATOM 8082  C CA   . ASP A 1 78 ? 4.431   -2.235  -20.807 1.00 0.00 ? 78 ASP A CA   6  
ATOM 8083  C C    . ASP A 1 78 ? 4.279   -1.478  -22.122 1.00 0.00 ? 78 ASP A C    6  
ATOM 8084  O O    . ASP A 1 78 ? 4.188   -2.082  -23.191 1.00 0.00 ? 78 ASP A O    6  
ATOM 8085  C CB   . ASP A 1 78 ? 3.070   -2.734  -20.326 1.00 0.00 ? 78 ASP A CB   6  
ATOM 8086  C CG   . ASP A 1 78 ? 3.013   -4.245  -20.213 1.00 0.00 ? 78 ASP A CG   6  
ATOM 8087  O OD1  . ASP A 1 78 ? 3.368   -4.774  -19.139 1.00 0.00 ? 78 ASP A OD1  6  
ATOM 8088  O OD2  . ASP A 1 78 ? 2.614   -4.899  -21.200 1.00 0.00 ? 78 ASP A OD2  6  
ATOM 8089  H H    . ASP A 1 78 ? 4.536   -1.154  -18.992 1.00 0.00 ? 78 ASP A H    6  
ATOM 8090  H HA   . ASP A 1 78 ? 5.071   -3.081  -20.969 1.00 0.00 ? 78 ASP A HA   6  
ATOM 8091  H HB2  . ASP A 1 78 ? 2.866   -2.313  -19.355 1.00 0.00 ? 78 ASP A HB2  6  
ATOM 8092  H HB3  . ASP A 1 78 ? 2.311   -2.415  -21.021 1.00 0.00 ? 78 ASP A HB3  6  
ATOM 8093  N N    . LEU A 1 79 ? 4.250   -0.154  -22.036 1.00 0.00 ? 79 LEU A N    6  
ATOM 8094  C CA   . LEU A 1 79 ? 4.108   0.688   -23.217 1.00 0.00 ? 79 LEU A CA   6  
ATOM 8095  C C    . LEU A 1 79 ? 5.334   0.576   -24.118 1.00 0.00 ? 79 LEU A C    6  
ATOM 8096  O O    . LEU A 1 79 ? 6.180   1.470   -24.145 1.00 0.00 ? 79 LEU A O    6  
ATOM 8097  C CB   . LEU A 1 79 ? 3.891   2.146   -22.807 1.00 0.00 ? 79 LEU A CB   6  
ATOM 8098  C CG   . LEU A 1 79 ? 2.442   2.523   -22.498 1.00 0.00 ? 79 LEU A CG   6  
ATOM 8099  C CD1  . LEU A 1 79 ? 2.001   1.913   -21.177 1.00 0.00 ? 79 LEU A CD1  6  
ATOM 8100  C CD2  . LEU A 1 79 ? 2.280   4.036   -22.470 1.00 0.00 ? 79 LEU A CD2  6  
ATOM 8101  H H    . LEU A 1 79 ? 4.326   0.268   -21.157 1.00 0.00 ? 79 LEU A H    6  
ATOM 8102  H HA   . LEU A 1 79 ? 3.243   0.345   -23.762 1.00 0.00 ? 79 LEU A HA   6  
ATOM 8103  H HB2  . LEU A 1 79 ? 4.488   2.343   -21.928 1.00 0.00 ? 79 LEU A HB2  6  
ATOM 8104  H HB3  . LEU A 1 79 ? 4.241   2.779   -23.609 1.00 0.00 ? 79 LEU A HB3  6  
ATOM 8105  H HG   . LEU A 1 79 ? 1.801   2.132   -23.276 1.00 0.00 ? 79 LEU A HG   6  
ATOM 8106  H HD11 . LEU A 1 79 ? 2.180   0.849   -21.195 1.00 0.00 ? 79 LEU A HD11 6  
ATOM 8107  H HD12 . LEU A 1 79 ? 0.948   2.099   -21.028 1.00 0.00 ? 79 LEU A HD12 6  
ATOM 8108  H HD13 . LEU A 1 79 ? 2.563   2.359   -20.370 1.00 0.00 ? 79 LEU A HD13 6  
ATOM 8109  H HD21 . LEU A 1 79 ? 3.161   4.484   -22.033 1.00 0.00 ? 79 LEU A HD21 6  
ATOM 8110  H HD22 . LEU A 1 79 ? 1.414   4.294   -21.879 1.00 0.00 ? 79 LEU A HD22 6  
ATOM 8111  H HD23 . LEU A 1 79 ? 2.152   4.403   -23.477 1.00 0.00 ? 79 LEU A HD23 6  
ATOM 8112  N N    . VAL A 1 80 ? 5.423   -0.527  -24.854 1.00 0.00 ? 80 VAL A N    6  
ATOM 8113  C CA   . VAL A 1 80 ? 6.545   -0.756  -25.755 1.00 0.00 ? 80 VAL A CA   6  
ATOM 8114  C C    . VAL A 1 80 ? 6.604   0.318   -26.843 1.00 0.00 ? 80 VAL A C    6  
ATOM 8115  O O    . VAL A 1 80 ? 5.749   0.361   -27.728 1.00 0.00 ? 80 VAL A O    6  
ATOM 8116  C CB   . VAL A 1 80 ? 6.455   -2.145  -26.419 1.00 0.00 ? 80 VAL A CB   6  
ATOM 8117  C CG1  . VAL A 1 80 ? 5.180   -2.268  -27.240 1.00 0.00 ? 80 VAL A CG1  6  
ATOM 8118  C CG2  . VAL A 1 80 ? 7.681   -2.408  -27.282 1.00 0.00 ? 80 VAL A CG2  6  
ATOM 8119  H H    . VAL A 1 80 ? 4.717   -1.203  -24.789 1.00 0.00 ? 80 VAL A H    6  
ATOM 8120  H HA   . VAL A 1 80 ? 7.452   -0.718  -25.172 1.00 0.00 ? 80 VAL A HA   6  
ATOM 8121  H HB   . VAL A 1 80 ? 6.425   -2.891  -25.639 1.00 0.00 ? 80 VAL A HB   6  
ATOM 8122  H HG11 . VAL A 1 80 ? 5.400   -2.074  -28.279 1.00 0.00 ? 80 VAL A HG11 6  
ATOM 8123  H HG12 . VAL A 1 80 ? 4.454   -1.551  -26.886 1.00 0.00 ? 80 VAL A HG12 6  
ATOM 8124  H HG13 . VAL A 1 80 ? 4.780   -3.266  -27.136 1.00 0.00 ? 80 VAL A HG13 6  
ATOM 8125  H HG21 . VAL A 1 80 ? 8.484   -1.755  -26.975 1.00 0.00 ? 80 VAL A HG21 6  
ATOM 8126  H HG22 . VAL A 1 80 ? 7.439   -2.219  -28.318 1.00 0.00 ? 80 VAL A HG22 6  
ATOM 8127  H HG23 . VAL A 1 80 ? 7.988   -3.437  -27.166 1.00 0.00 ? 80 VAL A HG23 6  
ATOM 8128  N N    . PRO A 1 81 ? 7.615   1.205   -26.793 1.00 0.00 ? 81 PRO A N    6  
ATOM 8129  C CA   . PRO A 1 81 ? 7.772   2.278   -27.781 1.00 0.00 ? 81 PRO A CA   6  
ATOM 8130  C C    . PRO A 1 81 ? 8.150   1.746   -29.161 1.00 0.00 ? 81 PRO A C    6  
ATOM 8131  O O    . PRO A 1 81 ? 9.227   2.043   -29.678 1.00 0.00 ? 81 PRO A O    6  
ATOM 8132  C CB   . PRO A 1 81 ? 8.902   3.132   -27.207 1.00 0.00 ? 81 PRO A CB   6  
ATOM 8133  C CG   . PRO A 1 81 ? 9.682   2.195   -26.358 1.00 0.00 ? 81 PRO A CG   6  
ATOM 8134  C CD   . PRO A 1 81 ? 8.682   1.236   -25.776 1.00 0.00 ? 81 PRO A CD   6  
ATOM 8135  H HA   . PRO A 1 81 ? 6.879   2.872   -27.860 1.00 0.00 ? 81 PRO A HA   6  
ATOM 8136  H HB2  . PRO A 1 81 ? 9.502   3.530   -28.013 1.00 0.00 ? 81 PRO A HB2  6  
ATOM 8137  H HB3  . PRO A 1 81 ? 8.487   3.940   -26.624 1.00 0.00 ? 81 PRO A HB3  6  
ATOM 8138  H HG2  . PRO A 1 81 ? 10.399  1.666   -26.965 1.00 0.00 ? 81 PRO A HG2  6  
ATOM 8139  H HG3  . PRO A 1 81 ? 10.179  2.741   -25.573 1.00 0.00 ? 81 PRO A HG3  6  
ATOM 8140  H HD2  . PRO A 1 81 ? 9.125   0.259   -25.650 1.00 0.00 ? 81 PRO A HD2  6  
ATOM 8141  H HD3  . PRO A 1 81 ? 8.306   1.607   -24.834 1.00 0.00 ? 81 PRO A HD3  6  
ATOM 8142  N N    . ARG A 1 82 ? 7.254   0.962   -29.752 1.00 0.00 ? 82 ARG A N    6  
ATOM 8143  C CA   . ARG A 1 82 ? 7.489   0.391   -31.069 1.00 0.00 ? 82 ARG A CA   6  
ATOM 8144  C C    . ARG A 1 82 ? 6.175   -0.024  -31.724 1.00 0.00 ? 82 ARG A C    6  
ATOM 8145  O O    . ARG A 1 82 ? 5.912   0.427   -32.859 1.00 0.00 ? 82 ARG A O    6  
ATOM 8146  C CB   . ARG A 1 82 ? 8.426   -0.815  -30.970 1.00 0.00 ? 82 ARG A CB   6  
ATOM 8147  C CG   . ARG A 1 82 ? 9.853   -0.449  -30.597 1.00 0.00 ? 82 ARG A CG   6  
ATOM 8148  C CD   . ARG A 1 82 ? 10.788  -1.639  -30.737 1.00 0.00 ? 82 ARG A CD   6  
ATOM 8149  N NE   . ARG A 1 82 ? 12.100  -1.247  -31.247 1.00 0.00 ? 82 ARG A NE   6  
ATOM 8150  C CZ   . ARG A 1 82 ? 12.959  -0.483  -30.576 1.00 0.00 ? 82 ARG A CZ   6  
ATOM 8151  N NH1  . ARG A 1 82 ? 12.649  -0.027  -29.369 1.00 0.00 ? 82 ARG A NH1  6  
ATOM 8152  N NH2  . ARG A 1 82 ? 14.131  -0.174  -31.113 1.00 0.00 ? 82 ARG A NH2  6  
ATOM 8153  O OXT  . ARG A 1 82 ? 5.421   -0.797  -31.097 1.00 0.00 ? 82 ARG A OXT  6  
ATOM 8154  H H    . ARG A 1 82 ? 6.416   0.766   -29.293 1.00 0.00 ? 82 ARG A H    6  
ATOM 8155  H HA   . ARG A 1 82 ? 7.954   1.149   -31.675 1.00 0.00 ? 82 ARG A HA   6  
ATOM 8156  H HB2  . ARG A 1 82 ? 8.044   -1.492  -30.220 1.00 0.00 ? 82 ARG A HB2  6  
ATOM 8157  H HB3  . ARG A 1 82 ? 8.444   -1.321  -31.924 1.00 0.00 ? 82 ARG A HB3  6  
ATOM 8158  H HG2  . ARG A 1 82 ? 10.193  0.342   -31.249 1.00 0.00 ? 82 ARG A HG2  6  
ATOM 8159  H HG3  . ARG A 1 82 ? 9.870   -0.106  -29.573 1.00 0.00 ? 82 ARG A HG3  6  
ATOM 8160  H HD2  . ARG A 1 82 ? 10.913  -2.098  -29.768 1.00 0.00 ? 82 ARG A HD2  6  
ATOM 8161  H HD3  . ARG A 1 82 ? 10.345  -2.351  -31.418 1.00 0.00 ? 82 ARG A HD3  6  
ATOM 8162  H HE   . ARG A 1 82 ? 12.354  -1.570  -32.137 1.00 0.00 ? 82 ARG A HE   6  
ATOM 8163  H HH11 . ARG A 1 82 ? 11.767  -0.257  -28.958 1.00 0.00 ? 82 ARG A HH11 6  
ATOM 8164  H HH12 . ARG A 1 82 ? 13.299  0.546   -28.869 1.00 0.00 ? 82 ARG A HH12 6  
ATOM 8165  H HH21 . ARG A 1 82 ? 14.369  -0.515  -32.023 1.00 0.00 ? 82 ARG A HH21 6  
ATOM 8166  H HH22 . ARG A 1 82 ? 14.776  0.400   -30.610 1.00 0.00 ? 82 ARG A HH22 6  
ATOM 8167  N N    . MET A 1 1  ? 26.657  11.461  8.482   1.00 0.00 ? 1  MET A N    7  
ATOM 8168  C CA   . MET A 1 1  ? 26.690  10.894  9.856   1.00 0.00 ? 1  MET A CA   7  
ATOM 8169  C C    . MET A 1 1  ? 25.347  11.071  10.558  1.00 0.00 ? 1  MET A C    7  
ATOM 8170  O O    . MET A 1 1  ? 25.068  12.126  11.128  1.00 0.00 ? 1  MET A O    7  
ATOM 8171  C CB   . MET A 1 1  ? 27.796  11.596  10.646  1.00 0.00 ? 1  MET A CB   7  
ATOM 8172  C CG   . MET A 1 1  ? 28.383  10.743  11.759  1.00 0.00 ? 1  MET A CG   7  
ATOM 8173  S SD   . MET A 1 1  ? 30.123  11.104  12.065  1.00 0.00 ? 1  MET A SD   7  
ATOM 8174  C CE   . MET A 1 1  ? 30.862  9.503   11.752  1.00 0.00 ? 1  MET A CE   7  
ATOM 8175  H H1   . MET A 1 1  ? 25.764  11.165  8.039   1.00 0.00 ? 1  MET A H1   7  
ATOM 8176  H H2   . MET A 1 1  ? 27.477  11.084  7.965   1.00 0.00 ? 1  MET A H2   7  
ATOM 8177  H H3   . MET A 1 1  ? 26.708  12.496  8.565   1.00 0.00 ? 1  MET A H3   7  
ATOM 8178  H HA   . MET A 1 1  ? 26.915  9.840   9.788   1.00 0.00 ? 1  MET A HA   7  
ATOM 8179  H HB2  . MET A 1 1  ? 28.592  11.863  9.968   1.00 0.00 ? 1  MET A HB2  7  
ATOM 8180  H HB3  . MET A 1 1  ? 27.392  12.495  11.087  1.00 0.00 ? 1  MET A HB3  7  
ATOM 8181  H HG2  . MET A 1 1  ? 27.828  10.926  12.666  1.00 0.00 ? 1  MET A HG2  7  
ATOM 8182  H HG3  . MET A 1 1  ? 28.289  9.703   11.484  1.00 0.00 ? 1  MET A HG3  7  
ATOM 8183  H HE1  . MET A 1 1  ? 31.347  9.513   10.787  1.00 0.00 ? 1  MET A HE1  7  
ATOM 8184  H HE2  . MET A 1 1  ? 30.093  8.744   11.760  1.00 0.00 ? 1  MET A HE2  7  
ATOM 8185  H HE3  . MET A 1 1  ? 31.590  9.286   12.519  1.00 0.00 ? 1  MET A HE3  7  
ATOM 8186  N N    . ASP A 1 2  ? 24.520  10.032  10.514  1.00 0.00 ? 2  ASP A N    7  
ATOM 8187  C CA   . ASP A 1 2  ? 23.213  10.069  11.143  1.00 0.00 ? 2  ASP A CA   7  
ATOM 8188  C C    . ASP A 1 2  ? 22.798  8.682   11.624  1.00 0.00 ? 2  ASP A C    7  
ATOM 8189  O O    . ASP A 1 2  ? 22.784  7.724   10.851  1.00 0.00 ? 2  ASP A O    7  
ATOM 8190  C CB   . ASP A 1 2  ? 22.173  10.621  10.172  1.00 0.00 ? 2  ASP A CB   7  
ATOM 8191  C CG   . ASP A 1 2  ? 21.465  11.847  10.715  1.00 0.00 ? 2  ASP A CG   7  
ATOM 8192  O OD1  . ASP A 1 2  ? 20.665  11.700  11.662  1.00 0.00 ? 2  ASP A OD1  7  
ATOM 8193  O OD2  . ASP A 1 2  ? 21.711  12.955  10.192  1.00 0.00 ? 2  ASP A OD2  7  
ATOM 8194  H H    . ASP A 1 2  ? 24.797  9.222   10.050  1.00 0.00 ? 2  ASP A H    7  
ATOM 8195  H HA   . ASP A 1 2  ? 23.278  10.722  11.989  1.00 0.00 ? 2  ASP A HA   7  
ATOM 8196  H HB2  . ASP A 1 2  ? 22.661  10.891  9.248   1.00 0.00 ? 2  ASP A HB2  7  
ATOM 8197  H HB3  . ASP A 1 2  ? 21.438  9.860   9.977   1.00 0.00 ? 2  ASP A HB3  7  
ATOM 8198  N N    . ASN A 1 3  ? 22.462  8.581   12.906  1.00 0.00 ? 3  ASN A N    7  
ATOM 8199  C CA   . ASN A 1 3  ? 22.048  7.311   13.490  1.00 0.00 ? 3  ASN A CA   7  
ATOM 8200  C C    . ASN A 1 3  ? 20.786  6.780   12.817  1.00 0.00 ? 3  ASN A C    7  
ATOM 8201  O O    . ASN A 1 3  ? 20.505  5.582   12.859  1.00 0.00 ? 3  ASN A O    7  
ATOM 8202  C CB   . ASN A 1 3  ? 21.817  7.468   14.992  1.00 0.00 ? 3  ASN A CB   7  
ATOM 8203  C CG   . ASN A 1 3  ? 22.755  6.608   15.816  1.00 0.00 ? 3  ASN A CG   7  
ATOM 8204  O OD1  . ASN A 1 3  ? 22.326  5.894   16.723  1.00 0.00 ? 3  ASN A OD1  7  
ATOM 8205  N ND2  . ASN A 1 3  ? 24.044  6.672   15.505  1.00 0.00 ? 3  ASN A ND2  7  
ATOM 8206  H H    . ASN A 1 3  ? 22.494  9.380   13.473  1.00 0.00 ? 3  ASN A H    7  
ATOM 8207  H HA   . ASN A 1 3  ? 22.842  6.605   13.336  1.00 0.00 ? 3  ASN A HA   7  
ATOM 8208  H HB2  . ASN A 1 3  ? 21.973  8.499   15.264  1.00 0.00 ? 3  ASN A HB2  7  
ATOM 8209  H HB3  . ASN A 1 3  ? 20.802  7.187   15.224  1.00 0.00 ? 3  ASN A HB3  7  
ATOM 8210  H HD21 . ASN A 1 3  ? 24.314  7.263   14.771  1.00 0.00 ? 3  ASN A HD21 7  
ATOM 8211  H HD22 . ASN A 1 3  ? 24.673  6.127   16.021  1.00 0.00 ? 3  ASN A HD22 7  
ATOM 8212  N N    . ASP A 1 4  ? 20.028  7.678   12.198  1.00 0.00 ? 4  ASP A N    7  
ATOM 8213  C CA   . ASP A 1 4  ? 18.796  7.299   11.517  1.00 0.00 ? 4  ASP A CA   7  
ATOM 8214  C C    . ASP A 1 4  ? 19.077  6.357   10.349  1.00 0.00 ? 4  ASP A C    7  
ATOM 8215  O O    . ASP A 1 4  ? 18.190  5.634   9.896   1.00 0.00 ? 4  ASP A O    7  
ATOM 8216  C CB   . ASP A 1 4  ? 18.061  8.543   11.022  1.00 0.00 ? 4  ASP A CB   7  
ATOM 8217  C CG   . ASP A 1 4  ? 16.697  8.704   11.664  1.00 0.00 ? 4  ASP A CG   7  
ATOM 8218  O OD1  . ASP A 1 4  ? 15.735  8.069   11.183  1.00 0.00 ? 4  ASP A OD1  7  
ATOM 8219  O OD2  . ASP A 1 4  ? 16.590  9.466   12.648  1.00 0.00 ? 4  ASP A OD2  7  
ATOM 8220  H H    . ASP A 1 4  ? 20.304  8.616   12.200  1.00 0.00 ? 4  ASP A H    7  
ATOM 8221  H HA   . ASP A 1 4  ? 18.172  6.791   12.227  1.00 0.00 ? 4  ASP A HA   7  
ATOM 8222  H HB2  . ASP A 1 4  ? 18.651  9.415   11.255  1.00 0.00 ? 4  ASP A HB2  7  
ATOM 8223  H HB3  . ASP A 1 4  ? 17.930  8.475   9.954   1.00 0.00 ? 4  ASP A HB3  7  
ATOM 8224  N N    . ALA A 1 5  ? 20.315  6.372   9.866   1.00 0.00 ? 5  ALA A N    7  
ATOM 8225  C CA   . ALA A 1 5  ? 20.712  5.525   8.754   1.00 0.00 ? 5  ALA A CA   7  
ATOM 8226  C C    . ALA A 1 5  ? 21.324  4.213   9.241   1.00 0.00 ? 5  ALA A C    7  
ATOM 8227  O O    . ALA A 1 5  ? 22.100  3.579   8.525   1.00 0.00 ? 5  ALA A O    7  
ATOM 8228  C CB   . ALA A 1 5  ? 21.690  6.263   7.853   1.00 0.00 ? 5  ALA A CB   7  
ATOM 8229  H H    . ALA A 1 5  ? 20.973  6.967   10.263  1.00 0.00 ? 5  ALA A H    7  
ATOM 8230  H HA   . ALA A 1 5  ? 19.829  5.308   8.182   1.00 0.00 ? 5  ALA A HA   7  
ATOM 8231  H HB1  . ALA A 1 5  ? 22.700  5.980   8.110   1.00 0.00 ? 5  ALA A HB1  7  
ATOM 8232  H HB2  . ALA A 1 5  ? 21.569  7.328   7.987   1.00 0.00 ? 5  ALA A HB2  7  
ATOM 8233  H HB3  . ALA A 1 5  ? 21.495  6.005   6.823   1.00 0.00 ? 5  ALA A HB3  7  
ATOM 8234  N N    . GLU A 1 6  ? 20.974  3.811   10.459  1.00 0.00 ? 6  GLU A N    7  
ATOM 8235  C CA   . GLU A 1 6  ? 21.492  2.579   11.034  1.00 0.00 ? 6  GLU A CA   7  
ATOM 8236  C C    . GLU A 1 6  ? 20.512  1.431   10.867  1.00 0.00 ? 6  GLU A C    7  
ATOM 8237  O O    . GLU A 1 6  ? 20.577  0.424   11.572  1.00 0.00 ? 6  GLU A O    7  
ATOM 8238  C CB   . GLU A 1 6  ? 21.790  2.777   12.508  1.00 0.00 ? 6  GLU A CB   7  
ATOM 8239  C CG   . GLU A 1 6  ? 23.136  3.429   12.782  1.00 0.00 ? 6  GLU A CG   7  
ATOM 8240  C CD   . GLU A 1 6  ? 23.691  3.070   14.147  1.00 0.00 ? 6  GLU A CD   7  
ATOM 8241  O OE1  . GLU A 1 6  ? 23.303  3.726   15.136  1.00 0.00 ? 6  GLU A OE1  7  
ATOM 8242  O OE2  . GLU A 1 6  ? 24.512  2.133   14.226  1.00 0.00 ? 6  GLU A OE2  7  
ATOM 8243  H H    . GLU A 1 6  ? 20.359  4.352   10.983  1.00 0.00 ? 6  GLU A H    7  
ATOM 8244  H HA   . GLU A 1 6  ? 22.390  2.339   10.515  1.00 0.00 ? 6  GLU A HA   7  
ATOM 8245  H HB2  . GLU A 1 6  ? 21.016  3.401   12.926  1.00 0.00 ? 6  GLU A HB2  7  
ATOM 8246  H HB3  . GLU A 1 6  ? 21.769  1.816   12.996  1.00 0.00 ? 6  GLU A HB3  7  
ATOM 8247  H HG2  . GLU A 1 6  ? 23.839  3.104   12.029  1.00 0.00 ? 6  GLU A HG2  7  
ATOM 8248  H HG3  . GLU A 1 6  ? 23.020  4.501   12.727  1.00 0.00 ? 6  GLU A HG3  7  
ATOM 8249  N N    . GLY A 1 7  ? 19.613  1.603   9.929   1.00 0.00 ? 7  GLY A N    7  
ATOM 8250  C CA   . GLY A 1 7  ? 18.608  0.594   9.651   1.00 0.00 ? 7  GLY A CA   7  
ATOM 8251  C C    . GLY A 1 7  ? 17.749  0.280   10.860  1.00 0.00 ? 7  GLY A C    7  
ATOM 8252  O O    . GLY A 1 7  ? 17.238  -0.832  10.995  1.00 0.00 ? 7  GLY A O    7  
ATOM 8253  H H    . GLY A 1 7  ? 19.635  2.430   9.420   1.00 0.00 ? 7  GLY A H    7  
ATOM 8254  H HA2  . GLY A 1 7  ? 17.972  0.946   8.852   1.00 0.00 ? 7  GLY A HA2  7  
ATOM 8255  H HA3  . GLY A 1 7  ? 19.103  -0.311  9.330   1.00 0.00 ? 7  GLY A HA3  7  
ATOM 8256  N N    . VAL A 1 8  ? 17.589  1.263   11.740  1.00 0.00 ? 8  VAL A N    7  
ATOM 8257  C CA   . VAL A 1 8  ? 16.792  1.095   12.939  1.00 0.00 ? 8  VAL A CA   7  
ATOM 8258  C C    . VAL A 1 8  ? 15.335  0.791   12.604  1.00 0.00 ? 8  VAL A C    7  
ATOM 8259  O O    . VAL A 1 8  ? 14.600  0.242   13.425  1.00 0.00 ? 8  VAL A O    7  
ATOM 8260  C CB   . VAL A 1 8  ? 16.856  2.355   13.816  1.00 0.00 ? 8  VAL A CB   7  
ATOM 8261  C CG1  . VAL A 1 8  ? 18.168  2.409   14.584  1.00 0.00 ? 8  VAL A CG1  7  
ATOM 8262  C CG2  . VAL A 1 8  ? 16.670  3.610   12.975  1.00 0.00 ? 8  VAL A CG2  7  
ATOM 8263  H H    . VAL A 1 8  ? 18.017  2.125   11.582  1.00 0.00 ? 8  VAL A H    7  
ATOM 8264  H HA   . VAL A 1 8  ? 17.201  0.270   13.499  1.00 0.00 ? 8  VAL A HA   7  
ATOM 8265  H HB   . VAL A 1 8  ? 16.055  2.307   14.524  1.00 0.00 ? 8  VAL A HB   7  
ATOM 8266  H HG11 . VAL A 1 8  ? 18.922  1.853   14.047  1.00 0.00 ? 8  VAL A HG11 7  
ATOM 8267  H HG12 . VAL A 1 8  ? 18.029  1.974   15.563  1.00 0.00 ? 8  VAL A HG12 7  
ATOM 8268  H HG13 . VAL A 1 8  ? 18.483  3.436   14.687  1.00 0.00 ? 8  VAL A HG13 7  
ATOM 8269  H HG21 . VAL A 1 8  ? 16.234  4.389   13.582  1.00 0.00 ? 8  VAL A HG21 7  
ATOM 8270  H HG22 . VAL A 1 8  ? 16.015  3.392   12.144  1.00 0.00 ? 8  VAL A HG22 7  
ATOM 8271  H HG23 . VAL A 1 8  ? 17.628  3.939   12.601  1.00 0.00 ? 8  VAL A HG23 7  
ATOM 8272  N N    . TRP A 1 9  ? 14.924  1.150   11.394  1.00 0.00 ? 9  TRP A N    7  
ATOM 8273  C CA   . TRP A 1 9  ? 13.556  0.916   10.950  1.00 0.00 ? 9  TRP A CA   7  
ATOM 8274  C C    . TRP A 1 9  ? 13.251  -0.578  10.886  1.00 0.00 ? 9  TRP A C    7  
ATOM 8275  O O    . TRP A 1 9  ? 13.905  -1.324  10.158  1.00 0.00 ? 9  TRP A O    7  
ATOM 8276  C CB   . TRP A 1 9  ? 13.325  1.558   9.584   1.00 0.00 ? 9  TRP A CB   7  
ATOM 8277  C CG   . TRP A 1 9  ? 12.272  2.624   9.598   1.00 0.00 ? 9  TRP A CG   7  
ATOM 8278  C CD1  . TRP A 1 9  ? 12.459  3.964   9.419   1.00 0.00 ? 9  TRP A CD1  7  
ATOM 8279  C CD2  . TRP A 1 9  ? 10.867  2.438   9.804   1.00 0.00 ? 9  TRP A CD2  7  
ATOM 8280  N NE1  . TRP A 1 9  ? 11.257  4.624   9.501   1.00 0.00 ? 9  TRP A NE1  7  
ATOM 8281  C CE2  . TRP A 1 9  ? 10.264  3.709   9.737   1.00 0.00 ? 9  TRP A CE2  7  
ATOM 8282  C CE3  . TRP A 1 9  ? 10.060  1.321   10.038  1.00 0.00 ? 9  TRP A CE3  7  
ATOM 8283  C CZ2  . TRP A 1 9  ? 8.893   3.892   9.895   1.00 0.00 ? 9  TRP A CZ2  7  
ATOM 8284  C CZ3  . TRP A 1 9  ? 8.699   1.504   10.195  1.00 0.00 ? 9  TRP A CZ3  7  
ATOM 8285  C CH2  . TRP A 1 9  ? 8.127   2.781   10.122  1.00 0.00 ? 9  TRP A CH2  7  
ATOM 8286  H H    . TRP A 1 9  ? 15.556  1.583   10.785  1.00 0.00 ? 9  TRP A H    7  
ATOM 8287  H HA   . TRP A 1 9  ? 12.895  1.375   11.663  1.00 0.00 ? 9  TRP A HA   7  
ATOM 8288  H HB2  . TRP A 1 9  ? 14.246  2.006   9.247   1.00 0.00 ? 9  TRP A HB2  7  
ATOM 8289  H HB3  . TRP A 1 9  ? 13.021  0.797   8.883   1.00 0.00 ? 9  TRP A HB3  7  
ATOM 8290  H HD1  . TRP A 1 9  ? 13.420  4.426   9.241   1.00 0.00 ? 9  TRP A HD1  7  
ATOM 8291  H HE1  . TRP A 1 9  ? 11.130  5.591   9.406   1.00 0.00 ? 9  TRP A HE1  7  
ATOM 8292  H HE3  . TRP A 1 9  ? 10.482  0.329   10.097  1.00 0.00 ? 9  TRP A HE3  7  
ATOM 8293  H HZ2  . TRP A 1 9  ? 8.436   4.869   9.841   1.00 0.00 ? 9  TRP A HZ2  7  
ATOM 8294  H HZ3  . TRP A 1 9  ? 8.059   0.653   10.377  1.00 0.00 ? 9  TRP A HZ3  7  
ATOM 8295  H HH2  . TRP A 1 9  ? 7.059   2.877   10.252  1.00 0.00 ? 9  TRP A HH2  7  
ATOM 8296  N N    . SER A 1 10 ? 12.253  -1.006  11.652  1.00 0.00 ? 10 SER A N    7  
ATOM 8297  C CA   . SER A 1 10 ? 11.861  -2.411  11.683  1.00 0.00 ? 10 SER A CA   7  
ATOM 8298  C C    . SER A 1 10 ? 11.461  -2.896  10.289  1.00 0.00 ? 10 SER A C    7  
ATOM 8299  O O    . SER A 1 10 ? 10.416  -2.508  9.767   1.00 0.00 ? 10 SER A O    7  
ATOM 8300  C CB   . SER A 1 10 ? 10.698  -2.614  12.656  1.00 0.00 ? 10 SER A CB   7  
ATOM 8301  O OG   . SER A 1 10 ? 11.054  -2.211  13.967  1.00 0.00 ? 10 SER A OG   7  
ATOM 8302  H H    . SER A 1 10 ? 11.769  -0.363  12.211  1.00 0.00 ? 10 SER A H    7  
ATOM 8303  H HA   . SER A 1 10 ? 12.708  -2.984  12.026  1.00 0.00 ? 10 SER A HA   7  
ATOM 8304  H HB2  . SER A 1 10 ? 9.852   -2.027  12.331  1.00 0.00 ? 10 SER A HB2  7  
ATOM 8305  H HB3  . SER A 1 10 ? 10.426  -3.659  12.675  1.00 0.00 ? 10 SER A HB3  7  
ATOM 8306  H HG   . SER A 1 10 ? 10.271  -2.202  14.523  1.00 0.00 ? 10 SER A HG   7  
ATOM 8307  N N    . PRO A 1 11 ? 12.288  -3.755  9.663   1.00 0.00 ? 11 PRO A N    7  
ATOM 8308  C CA   . PRO A 1 11 ? 12.007  -4.285  8.325   1.00 0.00 ? 11 PRO A CA   7  
ATOM 8309  C C    . PRO A 1 11 ? 10.812  -5.233  8.308   1.00 0.00 ? 11 PRO A C    7  
ATOM 8310  O O    . PRO A 1 11 ? 10.277  -5.554  7.247   1.00 0.00 ? 11 PRO A O    7  
ATOM 8311  C CB   . PRO A 1 11 ? 13.288  -5.033  7.958   1.00 0.00 ? 11 PRO A CB   7  
ATOM 8312  C CG   . PRO A 1 11 ? 13.893  -5.399  9.264   1.00 0.00 ? 11 PRO A CG   7  
ATOM 8313  C CD   . PRO A 1 11 ? 13.557  -4.276  10.204  1.00 0.00 ? 11 PRO A CD   7  
ATOM 8314  H HA   . PRO A 1 11 ? 11.841  -3.493  7.619   1.00 0.00 ? 11 PRO A HA   7  
ATOM 8315  H HB2  . PRO A 1 11 ? 13.043  -5.909  7.375   1.00 0.00 ? 11 PRO A HB2  7  
ATOM 8316  H HB3  . PRO A 1 11 ? 13.938  -4.384  7.390   1.00 0.00 ? 11 PRO A HB3  7  
ATOM 8317  H HG2  . PRO A 1 11 ? 13.464  -6.323  9.617   1.00 0.00 ? 11 PRO A HG2  7  
ATOM 8318  H HG3  . PRO A 1 11 ? 14.962  -5.493  9.159   1.00 0.00 ? 11 PRO A HG3  7  
ATOM 8319  H HD2  . PRO A 1 11 ? 13.424  -4.650  11.208  1.00 0.00 ? 11 PRO A HD2  7  
ATOM 8320  H HD3  . PRO A 1 11 ? 14.326  -3.519  10.179  1.00 0.00 ? 11 PRO A HD3  7  
ATOM 8321  N N    . ASP A 1 12 ? 10.398  -5.679  9.489   1.00 0.00 ? 12 ASP A N    7  
ATOM 8322  C CA   . ASP A 1 12 ? 9.266   -6.591  9.607   1.00 0.00 ? 12 ASP A CA   7  
ATOM 8323  C C    . ASP A 1 12 ? 7.978   -5.932  9.130   1.00 0.00 ? 12 ASP A C    7  
ATOM 8324  O O    . ASP A 1 12 ? 7.033   -6.610  8.728   1.00 0.00 ? 12 ASP A O    7  
ATOM 8325  C CB   . ASP A 1 12 ? 9.111   -7.058  11.052  1.00 0.00 ? 12 ASP A CB   7  
ATOM 8326  C CG   . ASP A 1 12 ? 9.430   -8.531  11.222  1.00 0.00 ? 12 ASP A CG   7  
ATOM 8327  O OD1  . ASP A 1 12 ? 8.540   -9.366  10.953  1.00 0.00 ? 12 ASP A OD1  7  
ATOM 8328  O OD2  . ASP A 1 12 ? 10.568  -8.849  11.625  1.00 0.00 ? 12 ASP A OD2  7  
ATOM 8329  H H    . ASP A 1 12 ? 10.863  -5.389  10.299  1.00 0.00 ? 12 ASP A H    7  
ATOM 8330  H HA   . ASP A 1 12 ? 9.467   -7.442  8.986   1.00 0.00 ? 12 ASP A HA   7  
ATOM 8331  H HB2  . ASP A 1 12 ? 9.782   -6.491  11.674  1.00 0.00 ? 12 ASP A HB2  7  
ATOM 8332  H HB3  . ASP A 1 12 ? 8.095   -6.888  11.375  1.00 0.00 ? 12 ASP A HB3  7  
ATOM 8333  N N    . ILE A 1 13 ? 7.950   -4.607  9.173   1.00 0.00 ? 13 ILE A N    7  
ATOM 8334  C CA   . ILE A 1 13 ? 6.783   -3.857  8.741   1.00 0.00 ? 13 ILE A CA   7  
ATOM 8335  C C    . ILE A 1 13 ? 6.691   -3.856  7.228   1.00 0.00 ? 13 ILE A C    7  
ATOM 8336  O O    . ILE A 1 13 ? 5.634   -4.108  6.650   1.00 0.00 ? 13 ILE A O    7  
ATOM 8337  C CB   . ILE A 1 13 ? 6.809   -2.407  9.284   1.00 0.00 ? 13 ILE A CB   7  
ATOM 8338  C CG1  . ILE A 1 13 ? 5.385   -1.916  9.550   1.00 0.00 ? 13 ILE A CG1  7  
ATOM 8339  C CG2  . ILE A 1 13 ? 7.534   -1.456  8.336   1.00 0.00 ? 13 ILE A CG2  7  
ATOM 8340  C CD1  . ILE A 1 13 ? 4.675   -2.687  10.641  1.00 0.00 ? 13 ILE A CD1  7  
ATOM 8341  H H    . ILE A 1 13 ? 8.733   -4.126  9.496   1.00 0.00 ? 13 ILE A H    7  
ATOM 8342  H HA   . ILE A 1 13 ? 5.918   -4.353  9.135   1.00 0.00 ? 13 ILE A HA   7  
ATOM 8343  H HB   . ILE A 1 13 ? 7.354   -2.416  10.211  1.00 0.00 ? 13 ILE A HB   7  
ATOM 8344  H HG12 . ILE A 1 13 ? 5.419   -0.878  9.846   1.00 0.00 ? 13 ILE A HG12 7  
ATOM 8345  H HG13 . ILE A 1 13 ? 4.804   -2.009  8.644   1.00 0.00 ? 13 ILE A HG13 7  
ATOM 8346  H HG21 . ILE A 1 13 ? 8.549   -1.795  8.193   1.00 0.00 ? 13 ILE A HG21 7  
ATOM 8347  H HG22 . ILE A 1 13 ? 7.543   -0.463  8.761   1.00 0.00 ? 13 ILE A HG22 7  
ATOM 8348  H HG23 . ILE A 1 13 ? 7.023   -1.434  7.385   1.00 0.00 ? 13 ILE A HG23 7  
ATOM 8349  H HD11 . ILE A 1 13 ? 3.833   -2.112  10.998  1.00 0.00 ? 13 ILE A HD11 7  
ATOM 8350  H HD12 . ILE A 1 13 ? 5.358   -2.868  11.457  1.00 0.00 ? 13 ILE A HD12 7  
ATOM 8351  H HD13 . ILE A 1 13 ? 4.326   -3.630  10.247  1.00 0.00 ? 13 ILE A HD13 7  
ATOM 8352  N N    . GLU A 1 14 ? 7.820   -3.590  6.601   1.00 0.00 ? 14 GLU A N    7  
ATOM 8353  C CA   . GLU A 1 14 ? 7.903   -3.573  5.149   1.00 0.00 ? 14 GLU A CA   7  
ATOM 8354  C C    . GLU A 1 14 ? 7.554   -4.946  4.591   1.00 0.00 ? 14 GLU A C    7  
ATOM 8355  O O    . GLU A 1 14 ? 7.132   -5.075  3.441   1.00 0.00 ? 14 GLU A O    7  
ATOM 8356  C CB   . GLU A 1 14 ? 9.304   -3.159  4.696   1.00 0.00 ? 14 GLU A CB   7  
ATOM 8357  C CG   . GLU A 1 14 ? 9.308   -2.303  3.440   1.00 0.00 ? 14 GLU A CG   7  
ATOM 8358  C CD   . GLU A 1 14 ? 9.537   -3.116  2.181   1.00 0.00 ? 14 GLU A CD   7  
ATOM 8359  O OE1  . GLU A 1 14 ? 10.171  -4.188  2.274   1.00 0.00 ? 14 GLU A OE1  7  
ATOM 8360  O OE2  . GLU A 1 14 ? 9.081   -2.681  1.102   1.00 0.00 ? 14 GLU A OE2  7  
ATOM 8361  H H    . GLU A 1 14 ? 8.621   -3.414  7.134   1.00 0.00 ? 14 GLU A H    7  
ATOM 8362  H HA   . GLU A 1 14 ? 7.185   -2.857  4.786   1.00 0.00 ? 14 GLU A HA   7  
ATOM 8363  H HB2  . GLU A 1 14 ? 9.775   -2.598  5.489   1.00 0.00 ? 14 GLU A HB2  7  
ATOM 8364  H HB3  . GLU A 1 14 ? 9.885   -4.048  4.501   1.00 0.00 ? 14 GLU A HB3  7  
ATOM 8365  H HG2  . GLU A 1 14 ? 8.355   -1.802  3.358   1.00 0.00 ? 14 GLU A HG2  7  
ATOM 8366  H HG3  . GLU A 1 14 ? 10.094  -1.567  3.524   1.00 0.00 ? 14 GLU A HG3  7  
ATOM 8367  N N    . GLN A 1 15 ? 7.726   -5.970  5.422   1.00 0.00 ? 15 GLN A N    7  
ATOM 8368  C CA   . GLN A 1 15 ? 7.424   -7.331  5.027   1.00 0.00 ? 15 GLN A CA   7  
ATOM 8369  C C    . GLN A 1 15 ? 5.926   -7.554  4.980   1.00 0.00 ? 15 GLN A C    7  
ATOM 8370  O O    . GLN A 1 15 ? 5.374   -7.967  3.960   1.00 0.00 ? 15 GLN A O    7  
ATOM 8371  C CB   . GLN A 1 15 ? 8.077   -8.307  5.982   1.00 0.00 ? 15 GLN A CB   7  
ATOM 8372  C CG   . GLN A 1 15 ? 9.429   -8.780  5.496   1.00 0.00 ? 15 GLN A CG   7  
ATOM 8373  C CD   . GLN A 1 15 ? 9.331   -9.951  4.538   1.00 0.00 ? 15 GLN A CD   7  
ATOM 8374  O OE1  . GLN A 1 15 ? 9.318   -11.110 4.954   1.00 0.00 ? 15 GLN A OE1  7  
ATOM 8375  N NE2  . GLN A 1 15 ? 9.261   -9.654  3.245   1.00 0.00 ? 15 GLN A NE2  7  
ATOM 8376  H H    . GLN A 1 15 ? 8.059   -5.803  6.325   1.00 0.00 ? 15 GLN A H    7  
ATOM 8377  H HA   . GLN A 1 15 ? 7.828   -7.485  4.060   1.00 0.00 ? 15 GLN A HA   7  
ATOM 8378  H HB2  . GLN A 1 15 ? 8.209   -7.819  6.930   1.00 0.00 ? 15 GLN A HB2  7  
ATOM 8379  H HB3  . GLN A 1 15 ? 7.437   -9.165  6.108   1.00 0.00 ? 15 GLN A HB3  7  
ATOM 8380  H HG2  . GLN A 1 15 ? 9.921   -7.961  4.993   1.00 0.00 ? 15 GLN A HG2  7  
ATOM 8381  H HG3  . GLN A 1 15 ? 10.011  -9.075  6.344   1.00 0.00 ? 15 GLN A HG3  7  
ATOM 8382  H HE21 . GLN A 1 15 ? 9.276   -8.709  2.986   1.00 0.00 ? 15 GLN A HE21 7  
ATOM 8383  H HE22 . GLN A 1 15 ? 9.196   -10.392 2.604   1.00 0.00 ? 15 GLN A HE22 7  
ATOM 8384  N N    . SER A 1 16 ? 5.273   -7.252  6.088   1.00 0.00 ? 16 SER A N    7  
ATOM 8385  C CA   . SER A 1 16 ? 3.831   -7.391  6.179   1.00 0.00 ? 16 SER A CA   7  
ATOM 8386  C C    . SER A 1 16 ? 3.156   -6.384  5.260   1.00 0.00 ? 16 SER A C    7  
ATOM 8387  O O    . SER A 1 16 ? 2.009   -6.566  4.852   1.00 0.00 ? 16 SER A O    7  
ATOM 8388  C CB   . SER A 1 16 ? 3.360   -7.191  7.621   1.00 0.00 ? 16 SER A CB   7  
ATOM 8389  O OG   . SER A 1 16 ? 3.715   -8.298  8.432   1.00 0.00 ? 16 SER A OG   7  
ATOM 8390  H H    . SER A 1 16 ? 5.775   -6.912  6.853   1.00 0.00 ? 16 SER A H    7  
ATOM 8391  H HA   . SER A 1 16 ? 3.573   -8.385  5.854   1.00 0.00 ? 16 SER A HA   7  
ATOM 8392  H HB2  . SER A 1 16 ? 3.819   -6.302  8.027   1.00 0.00 ? 16 SER A HB2  7  
ATOM 8393  H HB3  . SER A 1 16 ? 2.286   -7.080  7.635   1.00 0.00 ? 16 SER A HB3  7  
ATOM 8394  H HG   . SER A 1 16 ? 4.661   -8.449  8.371   1.00 0.00 ? 16 SER A HG   7  
ATOM 8395  N N    . PHE A 1 17 ? 3.887   -5.323  4.929   1.00 0.00 ? 17 PHE A N    7  
ATOM 8396  C CA   . PHE A 1 17 ? 3.374   -4.290  4.050   1.00 0.00 ? 17 PHE A CA   7  
ATOM 8397  C C    . PHE A 1 17 ? 3.343   -4.783  2.613   1.00 0.00 ? 17 PHE A C    7  
ATOM 8398  O O    . PHE A 1 17 ? 2.496   -4.369  1.821   1.00 0.00 ? 17 PHE A O    7  
ATOM 8399  C CB   . PHE A 1 17 ? 4.220   -3.025  4.161   1.00 0.00 ? 17 PHE A CB   7  
ATOM 8400  C CG   . PHE A 1 17 ? 3.566   -1.930  4.954   1.00 0.00 ? 17 PHE A CG   7  
ATOM 8401  C CD1  . PHE A 1 17 ? 2.220   -1.645  4.791   1.00 0.00 ? 17 PHE A CD1  7  
ATOM 8402  C CD2  . PHE A 1 17 ? 4.299   -1.187  5.866   1.00 0.00 ? 17 PHE A CD2  7  
ATOM 8403  C CE1  . PHE A 1 17 ? 1.617   -0.640  5.521   1.00 0.00 ? 17 PHE A CE1  7  
ATOM 8404  C CE2  . PHE A 1 17 ? 3.701   -0.180  6.599   1.00 0.00 ? 17 PHE A CE2  7  
ATOM 8405  C CZ   . PHE A 1 17 ? 2.358   0.094   6.427   1.00 0.00 ? 17 PHE A CZ   7  
ATOM 8406  H H    . PHE A 1 17 ? 4.794   -5.238  5.281   1.00 0.00 ? 17 PHE A H    7  
ATOM 8407  H HA   . PHE A 1 17 ? 2.377   -4.069  4.362   1.00 0.00 ? 17 PHE A HA   7  
ATOM 8408  H HB2  . PHE A 1 17 ? 5.146   -3.273  4.644   1.00 0.00 ? 17 PHE A HB2  7  
ATOM 8409  H HB3  . PHE A 1 17 ? 4.425   -2.645  3.170   1.00 0.00 ? 17 PHE A HB3  7  
ATOM 8410  H HD1  . PHE A 1 17 ? 1.639   -2.219  4.084   1.00 0.00 ? 17 PHE A HD1  7  
ATOM 8411  H HD2  . PHE A 1 17 ? 5.349   -1.400  6.001   1.00 0.00 ? 17 PHE A HD2  7  
ATOM 8412  H HE1  . PHE A 1 17 ? 0.567   -0.428  5.384   1.00 0.00 ? 17 PHE A HE1  7  
ATOM 8413  H HE2  . PHE A 1 17 ? 4.283   0.393   7.306   1.00 0.00 ? 17 PHE A HE2  7  
ATOM 8414  H HZ   . PHE A 1 17 ? 1.888   0.880   6.999   1.00 0.00 ? 17 PHE A HZ   7  
ATOM 8415  N N    . GLN A 1 18 ? 4.267   -5.678  2.282   1.00 0.00 ? 18 GLN A N    7  
ATOM 8416  C CA   . GLN A 1 18 ? 4.330   -6.230  0.938   1.00 0.00 ? 18 GLN A CA   7  
ATOM 8417  C C    . GLN A 1 18 ? 3.096   -7.068  0.652   1.00 0.00 ? 18 GLN A C    7  
ATOM 8418  O O    . GLN A 1 18 ? 2.591   -7.088  -0.468  1.00 0.00 ? 18 GLN A O    7  
ATOM 8419  C CB   . GLN A 1 18 ? 5.588   -7.079  0.746   1.00 0.00 ? 18 GLN A CB   7  
ATOM 8420  C CG   . GLN A 1 18 ? 5.555   -7.927  -0.519  1.00 0.00 ? 18 GLN A CG   7  
ATOM 8421  C CD   . GLN A 1 18 ? 6.921   -8.463  -0.901  1.00 0.00 ? 18 GLN A CD   7  
ATOM 8422  O OE1  . GLN A 1 18 ? 7.428   -9.400  -0.285  1.00 0.00 ? 18 GLN A OE1  7  
ATOM 8423  N NE2  . GLN A 1 18 ? 7.525   -7.868  -1.924  1.00 0.00 ? 18 GLN A NE2  7  
ATOM 8424  H H    . GLN A 1 18 ? 4.913   -5.976  2.957   1.00 0.00 ? 18 GLN A H    7  
ATOM 8425  H HA   . GLN A 1 18 ? 4.352   -5.408  0.250   1.00 0.00 ? 18 GLN A HA   7  
ATOM 8426  H HB2  . GLN A 1 18 ? 6.447   -6.425  0.694   1.00 0.00 ? 18 GLN A HB2  7  
ATOM 8427  H HB3  . GLN A 1 18 ? 5.698   -7.738  1.594   1.00 0.00 ? 18 GLN A HB3  7  
ATOM 8428  H HG2  . GLN A 1 18 ? 4.888   -8.762  -0.358  1.00 0.00 ? 18 GLN A HG2  7  
ATOM 8429  H HG3  . GLN A 1 18 ? 5.178   -7.322  -1.332  1.00 0.00 ? 18 GLN A HG3  7  
ATOM 8430  H HE21 . GLN A 1 18 ? 7.061   -7.127  -2.368  1.00 0.00 ? 18 GLN A HE21 7  
ATOM 8431  H HE22 . GLN A 1 18 ? 8.409   -8.194  -2.192  1.00 0.00 ? 18 GLN A HE22 7  
ATOM 8432  N N    . GLU A 1 19 ? 2.617   -7.757  1.674   1.00 0.00 ? 19 GLU A N    7  
ATOM 8433  C CA   . GLU A 1 19 ? 1.437   -8.596  1.530   1.00 0.00 ? 19 GLU A CA   7  
ATOM 8434  C C    . GLU A 1 19 ? 0.249   -7.759  1.094   1.00 0.00 ? 19 GLU A C    7  
ATOM 8435  O O    . GLU A 1 19 ? -0.589  -8.205  0.313   1.00 0.00 ? 19 GLU A O    7  
ATOM 8436  C CB   . GLU A 1 19 ? 1.129   -9.324  2.837   1.00 0.00 ? 19 GLU A CB   7  
ATOM 8437  C CG   . GLU A 1 19 ? 1.194   -10.838 2.719   1.00 0.00 ? 19 GLU A CG   7  
ATOM 8438  C CD   . GLU A 1 19 ? -0.104  -11.440 2.218   1.00 0.00 ? 19 GLU A CD   7  
ATOM 8439  O OE1  . GLU A 1 19 ? -0.347  -11.393 0.994   1.00 0.00 ? 19 GLU A OE1  7  
ATOM 8440  O OE2  . GLU A 1 19 ? -0.879  -11.958 3.050   1.00 0.00 ? 19 GLU A OE2  7  
ATOM 8441  H H    . GLU A 1 19 ? 3.066   -7.696  2.542   1.00 0.00 ? 19 GLU A H    7  
ATOM 8442  H HA   . GLU A 1 19 ? 1.642   -9.318  0.766   1.00 0.00 ? 19 GLU A HA   7  
ATOM 8443  H HB2  . GLU A 1 19 ? 1.842   -9.012  3.582   1.00 0.00 ? 19 GLU A HB2  7  
ATOM 8444  H HB3  . GLU A 1 19 ? 0.138   -9.053  3.162   1.00 0.00 ? 19 GLU A HB3  7  
ATOM 8445  H HG2  . GLU A 1 19 ? 1.983   -11.100 2.031   1.00 0.00 ? 19 GLU A HG2  7  
ATOM 8446  H HG3  . GLU A 1 19 ? 1.414   -11.253 3.692   1.00 0.00 ? 19 GLU A HG3  7  
ATOM 8447  N N    . ALA A 1 20 ? 0.201   -6.535  1.590   1.00 0.00 ? 20 ALA A N    7  
ATOM 8448  C CA   . ALA A 1 20 ? -0.864  -5.615  1.242   1.00 0.00 ? 20 ALA A CA   7  
ATOM 8449  C C    . ALA A 1 20 ? -0.588  -4.977  -0.112  1.00 0.00 ? 20 ALA A C    7  
ATOM 8450  O O    . ALA A 1 20 ? -1.510  -4.620  -0.845  1.00 0.00 ? 20 ALA A O    7  
ATOM 8451  C CB   . ALA A 1 20 ? -1.022  -4.551  2.318   1.00 0.00 ? 20 ALA A CB   7  
ATOM 8452  H H    . ALA A 1 20 ? 0.908   -6.241  2.192   1.00 0.00 ? 20 ALA A H    7  
ATOM 8453  H HA   . ALA A 1 20 ? -1.775  -6.178  1.183   1.00 0.00 ? 20 ALA A HA   7  
ATOM 8454  H HB1  . ALA A 1 20 ? -0.448  -3.677  2.048   1.00 0.00 ? 20 ALA A HB1  7  
ATOM 8455  H HB2  . ALA A 1 20 ? -0.667  -4.938  3.262   1.00 0.00 ? 20 ALA A HB2  7  
ATOM 8456  H HB3  . ALA A 1 20 ? -2.064  -4.283  2.408   1.00 0.00 ? 20 ALA A HB3  7  
ATOM 8457  N N    . LEU A 1 21 ? 0.692   -4.851  -0.438  1.00 0.00 ? 21 LEU A N    7  
ATOM 8458  C CA   . LEU A 1 21 ? 1.107   -4.274  -1.704  1.00 0.00 ? 21 LEU A CA   7  
ATOM 8459  C C    . LEU A 1 21 ? 0.966   -5.292  -2.826  1.00 0.00 ? 21 LEU A C    7  
ATOM 8460  O O    . LEU A 1 21 ? 0.669   -4.941  -3.968  1.00 0.00 ? 21 LEU A O    7  
ATOM 8461  C CB   . LEU A 1 21 ? 2.548   -3.774  -1.620  1.00 0.00 ? 21 LEU A CB   7  
ATOM 8462  C CG   . LEU A 1 21 ? 2.745   -2.296  -1.965  1.00 0.00 ? 21 LEU A CG   7  
ATOM 8463  C CD1  . LEU A 1 21 ? 2.124   -1.975  -3.316  1.00 0.00 ? 21 LEU A CD1  7  
ATOM 8464  C CD2  . LEU A 1 21 ? 2.152   -1.410  -0.880  1.00 0.00 ? 21 LEU A CD2  7  
ATOM 8465  H H    . LEU A 1 21 ? 1.372   -5.163  0.186   1.00 0.00 ? 21 LEU A H    7  
ATOM 8466  H HA   . LEU A 1 21 ? 0.463   -3.446  -1.909  1.00 0.00 ? 21 LEU A HA   7  
ATOM 8467  H HB2  . LEU A 1 21 ? 2.906   -3.939  -0.615  1.00 0.00 ? 21 LEU A HB2  7  
ATOM 8468  H HB3  . LEU A 1 21 ? 3.146   -4.359  -2.298  1.00 0.00 ? 21 LEU A HB3  7  
ATOM 8469  H HG   . LEU A 1 21 ? 3.802   -2.087  -2.027  1.00 0.00 ? 21 LEU A HG   7  
ATOM 8470  H HD11 . LEU A 1 21 ? 1.052   -2.085  -3.254  1.00 0.00 ? 21 LEU A HD11 7  
ATOM 8471  H HD12 . LEU A 1 21 ? 2.514   -2.653  -4.061  1.00 0.00 ? 21 LEU A HD12 7  
ATOM 8472  H HD13 . LEU A 1 21 ? 2.367   -0.959  -3.591  1.00 0.00 ? 21 LEU A HD13 7  
ATOM 8473  H HD21 . LEU A 1 21 ? 1.186   -1.048  -1.198  1.00 0.00 ? 21 LEU A HD21 7  
ATOM 8474  H HD22 . LEU A 1 21 ? 2.810   -0.571  -0.702  1.00 0.00 ? 21 LEU A HD22 7  
ATOM 8475  H HD23 . LEU A 1 21 ? 2.042   -1.980  0.031   1.00 0.00 ? 21 LEU A HD23 7  
ATOM 8476  N N    . SER A 1 22 ? 1.170   -6.558  -2.486  1.00 0.00 ? 22 SER A N    7  
ATOM 8477  C CA   . SER A 1 22 ? 1.056   -7.635  -3.453  1.00 0.00 ? 22 SER A CA   7  
ATOM 8478  C C    . SER A 1 22 ? -0.408  -7.942  -3.719  1.00 0.00 ? 22 SER A C    7  
ATOM 8479  O O    . SER A 1 22 ? -0.795  -8.292  -4.834  1.00 0.00 ? 22 SER A O    7  
ATOM 8480  C CB   . SER A 1 22 ? 1.776   -8.887  -2.951  1.00 0.00 ? 22 SER A CB   7  
ATOM 8481  O OG   . SER A 1 22 ? 3.164   -8.826  -3.233  1.00 0.00 ? 22 SER A OG   7  
ATOM 8482  H H    . SER A 1 22 ? 1.394   -6.772  -1.559  1.00 0.00 ? 22 SER A H    7  
ATOM 8483  H HA   . SER A 1 22 ? 1.513   -7.304  -4.364  1.00 0.00 ? 22 SER A HA   7  
ATOM 8484  H HB2  . SER A 1 22 ? 1.642   -8.973  -1.883  1.00 0.00 ? 22 SER A HB2  7  
ATOM 8485  H HB3  . SER A 1 22 ? 1.361   -9.758  -3.437  1.00 0.00 ? 22 SER A HB3  7  
ATOM 8486  H HG   . SER A 1 22 ? 3.294   -8.553  -4.144  1.00 0.00 ? 22 SER A HG   7  
ATOM 8487  N N    . ILE A 1 23 ? -1.215  -7.800  -2.679  1.00 0.00 ? 23 ILE A N    7  
ATOM 8488  C CA   . ILE A 1 23 ? -2.645  -8.051  -2.775  1.00 0.00 ? 23 ILE A CA   7  
ATOM 8489  C C    . ILE A 1 23 ? -3.365  -6.850  -3.378  1.00 0.00 ? 23 ILE A C    7  
ATOM 8490  O O    . ILE A 1 23 ? -4.346  -6.997  -4.108  1.00 0.00 ? 23 ILE A O    7  
ATOM 8491  C CB   . ILE A 1 23 ? -3.248  -8.397  -1.392  1.00 0.00 ? 23 ILE A CB   7  
ATOM 8492  C CG1  . ILE A 1 23 ? -4.109  -9.658  -1.488  1.00 0.00 ? 23 ILE A CG1  7  
ATOM 8493  C CG2  . ILE A 1 23 ? -4.061  -7.238  -0.825  1.00 0.00 ? 23 ILE A CG2  7  
ATOM 8494  C CD1  . ILE A 1 23 ? -3.303  -10.933 -1.601  1.00 0.00 ? 23 ILE A CD1  7  
ATOM 8495  H H    . ILE A 1 23 ? -0.835  -7.517  -1.824  1.00 0.00 ? 23 ILE A H    7  
ATOM 8496  H HA   . ILE A 1 23 ? -2.779  -8.894  -3.423  1.00 0.00 ? 23 ILE A HA   7  
ATOM 8497  H HB   . ILE A 1 23 ? -2.432  -8.583  -0.716  1.00 0.00 ? 23 ILE A HB   7  
ATOM 8498  H HG12 . ILE A 1 23 ? -4.726  -9.733  -0.604  1.00 0.00 ? 23 ILE A HG12 7  
ATOM 8499  H HG13 . ILE A 1 23 ? -4.744  -9.587  -2.359  1.00 0.00 ? 23 ILE A HG13 7  
ATOM 8500  H HG21 . ILE A 1 23 ? -3.488  -6.325  -0.901  1.00 0.00 ? 23 ILE A HG21 7  
ATOM 8501  H HG22 . ILE A 1 23 ? -4.291  -7.433  0.212   1.00 0.00 ? 23 ILE A HG22 7  
ATOM 8502  H HG23 . ILE A 1 23 ? -4.979  -7.135  -1.384  1.00 0.00 ? 23 ILE A HG23 7  
ATOM 8503  H HD11 . ILE A 1 23 ? -3.036  -11.100 -2.634  1.00 0.00 ? 23 ILE A HD11 7  
ATOM 8504  H HD12 . ILE A 1 23 ? -3.892  -11.764 -1.242  1.00 0.00 ? 23 ILE A HD12 7  
ATOM 8505  H HD13 . ILE A 1 23 ? -2.405  -10.845 -1.007  1.00 0.00 ? 23 ILE A HD13 7  
ATOM 8506  N N    . TYR A 1 24 ? -2.863  -5.667  -3.060  1.00 0.00 ? 24 TYR A N    7  
ATOM 8507  C CA   . TYR A 1 24 ? -3.435  -4.426  -3.555  1.00 0.00 ? 24 TYR A CA   7  
ATOM 8508  C C    . TYR A 1 24 ? -2.571  -3.824  -4.662  1.00 0.00 ? 24 TYR A C    7  
ATOM 8509  O O    . TYR A 1 24 ? -1.851  -2.850  -4.439  1.00 0.00 ? 24 TYR A O    7  
ATOM 8510  C CB   . TYR A 1 24 ? -3.599  -3.421  -2.424  1.00 0.00 ? 24 TYR A CB   7  
ATOM 8511  C CG   . TYR A 1 24 ? -4.360  -3.954  -1.232  1.00 0.00 ? 24 TYR A CG   7  
ATOM 8512  C CD1  . TYR A 1 24 ? -5.518  -4.702  -1.400  1.00 0.00 ? 24 TYR A CD1  7  
ATOM 8513  C CD2  . TYR A 1 24 ? -3.918  -3.708  0.061   1.00 0.00 ? 24 TYR A CD2  7  
ATOM 8514  C CE1  . TYR A 1 24 ? -6.214  -5.191  -0.311  1.00 0.00 ? 24 TYR A CE1  7  
ATOM 8515  C CE2  . TYR A 1 24 ? -4.608  -4.194  1.155   1.00 0.00 ? 24 TYR A CE2  7  
ATOM 8516  C CZ   . TYR A 1 24 ? -5.755  -4.934  0.964   1.00 0.00 ? 24 TYR A CZ   7  
ATOM 8517  O OH   . TYR A 1 24 ? -6.445  -5.420  2.052   1.00 0.00 ? 24 TYR A OH   7  
ATOM 8518  H H    . TYR A 1 24 ? -2.088  -5.632  -2.477  1.00 0.00 ? 24 TYR A H    7  
ATOM 8519  H HA   . TYR A 1 24 ? -4.395  -4.650  -3.950  1.00 0.00 ? 24 TYR A HA   7  
ATOM 8520  H HB2  . TYR A 1 24 ? -2.629  -3.128  -2.090  1.00 0.00 ? 24 TYR A HB2  7  
ATOM 8521  H HB3  . TYR A 1 24 ? -4.125  -2.553  -2.794  1.00 0.00 ? 24 TYR A HB3  7  
ATOM 8522  H HD1  . TYR A 1 24 ? -5.874  -4.902  -2.400  1.00 0.00 ? 24 TYR A HD1  7  
ATOM 8523  H HD2  . TYR A 1 24 ? -3.019  -3.127  0.206   1.00 0.00 ? 24 TYR A HD2  7  
ATOM 8524  H HE1  . TYR A 1 24 ? -7.113  -5.771  -0.461  1.00 0.00 ? 24 TYR A HE1  7  
ATOM 8525  H HE2  . TYR A 1 24 ? -4.248  -3.991  2.153   1.00 0.00 ? 24 TYR A HE2  7  
ATOM 8526  H HH   . TYR A 1 24 ? -7.384  -5.439  1.855   1.00 0.00 ? 24 TYR A HH   7  
ATOM 8527  N N    . PRO A 1 25 ? -2.630  -4.399  -5.875  1.00 0.00 ? 25 PRO A N    7  
ATOM 8528  C CA   . PRO A 1 25 ? -1.853  -3.919  -7.019  1.00 0.00 ? 25 PRO A CA   7  
ATOM 8529  C C    . PRO A 1 25 ? -2.118  -2.447  -7.326  1.00 0.00 ? 25 PRO A C    7  
ATOM 8530  O O    . PRO A 1 25 ? -2.987  -1.825  -6.716  1.00 0.00 ? 25 PRO A O    7  
ATOM 8531  C CB   . PRO A 1 25 ? -2.323  -4.804  -8.180  1.00 0.00 ? 25 PRO A CB   7  
ATOM 8532  C CG   . PRO A 1 25 ? -3.588  -5.428  -7.713  1.00 0.00 ? 25 PRO A CG   7  
ATOM 8533  C CD   . PRO A 1 25 ? -3.456  -5.558  -6.229  1.00 0.00 ? 25 PRO A CD   7  
ATOM 8534  H HA   . PRO A 1 25 ? -0.798  -4.066  -6.863  1.00 0.00 ? 25 PRO A HA   7  
ATOM 8535  H HB2  . PRO A 1 25 ? -2.491  -4.196  -9.049  1.00 0.00 ? 25 PRO A HB2  7  
ATOM 8536  H HB3  . PRO A 1 25 ? -1.573  -5.550  -8.394  1.00 0.00 ? 25 PRO A HB3  7  
ATOM 8537  H HG2  . PRO A 1 25 ? -4.422  -4.792  -7.960  1.00 0.00 ? 25 PRO A HG2  7  
ATOM 8538  H HG3  . PRO A 1 25 ? -3.706  -6.400  -8.165  1.00 0.00 ? 25 PRO A HG3  7  
ATOM 8539  H HD2  . PRO A 1 25 ? -4.424  -5.503  -5.758  1.00 0.00 ? 25 PRO A HD2  7  
ATOM 8540  H HD3  . PRO A 1 25 ? -2.956  -6.478  -5.975  1.00 0.00 ? 25 PRO A HD3  7  
ATOM 8541  N N    . PRO A 1 26 ? -1.367  -1.869  -8.280  1.00 0.00 ? 26 PRO A N    7  
ATOM 8542  C CA   . PRO A 1 26 ? -1.523  -0.462  -8.665  1.00 0.00 ? 26 PRO A CA   7  
ATOM 8543  C C    . PRO A 1 26 ? -2.849  -0.186  -9.371  1.00 0.00 ? 26 PRO A C    7  
ATOM 8544  O O    . PRO A 1 26 ? -3.214  0.969   -9.591  1.00 0.00 ? 26 PRO A O    7  
ATOM 8545  C CB   . PRO A 1 26 ? -0.352  -0.219  -9.616  1.00 0.00 ? 26 PRO A CB   7  
ATOM 8546  C CG   . PRO A 1 26 ? -0.029  -1.561  -10.163 1.00 0.00 ? 26 PRO A CG   7  
ATOM 8547  C CD   . PRO A 1 26 ? -0.307  -2.537  -9.055  1.00 0.00 ? 26 PRO A CD   7  
ATOM 8548  H HA   . PRO A 1 26 ? -1.432  0.188   -7.814  1.00 0.00 ? 26 PRO A HA   7  
ATOM 8549  H HB2  . PRO A 1 26 ? -0.654  0.466   -10.396 1.00 0.00 ? 26 PRO A HB2  7  
ATOM 8550  H HB3  . PRO A 1 26 ? 0.481   0.195   -9.069  1.00 0.00 ? 26 PRO A HB3  7  
ATOM 8551  H HG2  . PRO A 1 26 ? -0.661  -1.769  -11.012 1.00 0.00 ? 26 PRO A HG2  7  
ATOM 8552  H HG3  . PRO A 1 26 ? 1.010   -1.601  -10.446 1.00 0.00 ? 26 PRO A HG3  7  
ATOM 8553  H HD2  . PRO A 1 26 ? -0.656  -3.476  -9.458  1.00 0.00 ? 26 PRO A HD2  7  
ATOM 8554  H HD3  . PRO A 1 26 ? 0.576   -2.686  -8.452  1.00 0.00 ? 26 PRO A HD3  7  
ATOM 8555  N N    . CYS A 1 27 ? -3.567  -1.248  -9.724  1.00 0.00 ? 27 CYS A N    7  
ATOM 8556  C CA   . CYS A 1 27 ? -4.844  -1.112  -10.401 1.00 0.00 ? 27 CYS A CA   7  
ATOM 8557  C C    . CYS A 1 27 ? -5.819  -2.197  -9.953  1.00 0.00 ? 27 CYS A C    7  
ATOM 8558  O O    . CYS A 1 27 ? -5.418  -3.322  -9.655  1.00 0.00 ? 27 CYS A O    7  
ATOM 8559  C CB   . CYS A 1 27 ? -4.652  -1.168  -11.914 1.00 0.00 ? 27 CYS A CB   7  
ATOM 8560  S SG   . CYS A 1 27 ? -5.208  0.316   -12.784 1.00 0.00 ? 27 CYS A SG   7  
ATOM 8561  H H    . CYS A 1 27 ? -3.232  -2.139  -9.526  1.00 0.00 ? 27 CYS A H    7  
ATOM 8562  H HA   . CYS A 1 27 ? -5.248  -0.157  -10.139 1.00 0.00 ? 27 CYS A HA   7  
ATOM 8563  H HB2  . CYS A 1 27 ? -3.603  -1.300  -12.130 1.00 0.00 ? 27 CYS A HB2  7  
ATOM 8564  H HB3  . CYS A 1 27 ? -5.203  -2.006  -12.307 1.00 0.00 ? 27 CYS A HB3  7  
ATOM 8565  H HG   . CYS A 1 27 ? -5.888  0.055   -13.410 1.00 0.00 ? 27 CYS A HG   7  
ATOM 8566  N N    . GLY A 1 28 ? -7.102  -1.850  -9.909  1.00 0.00 ? 28 GLY A N    7  
ATOM 8567  C CA   . GLY A 1 28 ? -8.116  -2.803  -9.497  1.00 0.00 ? 28 GLY A CA   7  
ATOM 8568  C C    . GLY A 1 28 ? -8.986  -2.276  -8.373  1.00 0.00 ? 28 GLY A C    7  
ATOM 8569  O O    . GLY A 1 28 ? -9.323  -3.009  -7.444  1.00 0.00 ? 28 GLY A O    7  
ATOM 8570  H H    . GLY A 1 28 ? -7.361  -0.939  -10.158 1.00 0.00 ? 28 GLY A H    7  
ATOM 8571  H HA2  . GLY A 1 28 ? -8.743  -3.034  -10.345 1.00 0.00 ? 28 GLY A HA2  7  
ATOM 8572  H HA3  . GLY A 1 28 ? -7.630  -3.710  -9.166  1.00 0.00 ? 28 GLY A HA3  7  
ATOM 8573  N N    . ARG A 1 29 ? -9.349  -1.000  -8.457  1.00 0.00 ? 29 ARG A N    7  
ATOM 8574  C CA   . ARG A 1 29 ? -10.184 -0.374  -7.439  1.00 0.00 ? 29 ARG A CA   7  
ATOM 8575  C C    . ARG A 1 29 ? -11.555 -1.039  -7.374  1.00 0.00 ? 29 ARG A C    7  
ATOM 8576  O O    . ARG A 1 29 ? -12.408 -0.811  -8.232  1.00 0.00 ? 29 ARG A O    7  
ATOM 8577  C CB   . ARG A 1 29 ? -10.343 1.120   -7.727  1.00 0.00 ? 29 ARG A CB   7  
ATOM 8578  C CG   . ARG A 1 29 ? -10.898 1.417   -9.111  1.00 0.00 ? 29 ARG A CG   7  
ATOM 8579  C CD   . ARG A 1 29 ? -10.326 2.707   -9.678  1.00 0.00 ? 29 ARG A CD   7  
ATOM 8580  N NE   . ARG A 1 29 ? -11.329 3.768   -9.743  1.00 0.00 ? 29 ARG A NE   7  
ATOM 8581  C CZ   . ARG A 1 29 ? -11.698 4.505   -8.698  1.00 0.00 ? 29 ARG A CZ   7  
ATOM 8582  N NH1  . ARG A 1 29 ? -11.151 4.301   -7.506  1.00 0.00 ? 29 ARG A NH1  7  
ATOM 8583  N NH2  . ARG A 1 29 ? -12.617 5.450   -8.845  1.00 0.00 ? 29 ARG A NH2  7  
ATOM 8584  H H    . ARG A 1 29 ? -9.048  -0.467  -9.221  1.00 0.00 ? 29 ARG A H    7  
ATOM 8585  H HA   . ARG A 1 29 ? -9.692  -0.497  -6.487  1.00 0.00 ? 29 ARG A HA   7  
ATOM 8586  H HB2  . ARG A 1 29 ? -11.011 1.547   -6.995  1.00 0.00 ? 29 ARG A HB2  7  
ATOM 8587  H HB3  . ARG A 1 29 ? -9.377  1.596   -7.641  1.00 0.00 ? 29 ARG A HB3  7  
ATOM 8588  H HG2  . ARG A 1 29 ? -10.645 0.602   -9.772  1.00 0.00 ? 29 ARG A HG2  7  
ATOM 8589  H HG3  . ARG A 1 29 ? -11.973 1.509   -9.044  1.00 0.00 ? 29 ARG A HG3  7  
ATOM 8590  H HD2  . ARG A 1 29 ? -9.511  3.034   -9.049  1.00 0.00 ? 29 ARG A HD2  7  
ATOM 8591  H HD3  . ARG A 1 29 ? -9.956  2.514   -10.674 1.00 0.00 ? 29 ARG A HD3  7  
ATOM 8592  H HE   . ARG A 1 29 ? -11.749 3.940   -10.612 1.00 0.00 ? 29 ARG A HE   7  
ATOM 8593  H HH11 . ARG A 1 29 ? -10.457 3.591   -7.388  1.00 0.00 ? 29 ARG A HH11 7  
ATOM 8594  H HH12 . ARG A 1 29 ? -11.433 4.859   -6.725  1.00 0.00 ? 29 ARG A HH12 7  
ATOM 8595  H HH21 . ARG A 1 29 ? -13.032 5.608   -9.741  1.00 0.00 ? 29 ARG A HH21 7  
ATOM 8596  H HH22 . ARG A 1 29 ? -12.895 6.004   -8.060  1.00 0.00 ? 29 ARG A HH22 7  
ATOM 8597  N N    . ARG A 1 30 ? -11.761 -1.862  -6.351  1.00 0.00 ? 30 ARG A N    7  
ATOM 8598  C CA   . ARG A 1 30 ? -13.029 -2.560  -6.174  1.00 0.00 ? 30 ARG A CA   7  
ATOM 8599  C C    . ARG A 1 30 ? -14.173 -1.569  -5.984  1.00 0.00 ? 30 ARG A C    7  
ATOM 8600  O O    . ARG A 1 30 ? -13.963 -0.442  -5.534  1.00 0.00 ? 30 ARG A O    7  
ATOM 8601  C CB   . ARG A 1 30 ? -12.952 -3.504  -4.973  1.00 0.00 ? 30 ARG A CB   7  
ATOM 8602  C CG   . ARG A 1 30 ? -13.895 -4.692  -5.072  1.00 0.00 ? 30 ARG A CG   7  
ATOM 8603  C CD   . ARG A 1 30 ? -15.230 -4.400  -4.405  1.00 0.00 ? 30 ARG A CD   7  
ATOM 8604  N NE   . ARG A 1 30 ? -16.349 -4.984  -5.139  1.00 0.00 ? 30 ARG A NE   7  
ATOM 8605  C CZ   . ARG A 1 30 ? -17.556 -5.184  -4.616  1.00 0.00 ? 30 ARG A CZ   7  
ATOM 8606  N NH1  . ARG A 1 30 ? -17.804 -4.848  -3.356  1.00 0.00 ? 30 ARG A NH1  7  
ATOM 8607  N NH2  . ARG A 1 30 ? -18.518 -5.721  -5.354  1.00 0.00 ? 30 ARG A NH2  7  
ATOM 8608  H H    . ARG A 1 30 ? -11.043 -2.003  -5.699  1.00 0.00 ? 30 ARG A H    7  
ATOM 8609  H HA   . ARG A 1 30 ? -13.215 -3.139  -7.065  1.00 0.00 ? 30 ARG A HA   7  
ATOM 8610  H HB2  . ARG A 1 30 ? -11.943 -3.880  -4.890  1.00 0.00 ? 30 ARG A HB2  7  
ATOM 8611  H HB3  . ARG A 1 30 ? -13.196 -2.951  -4.078  1.00 0.00 ? 30 ARG A HB3  7  
ATOM 8612  H HG2  . ARG A 1 30 ? -14.068 -4.917  -6.114  1.00 0.00 ? 30 ARG A HG2  7  
ATOM 8613  H HG3  . ARG A 1 30 ? -13.439 -5.543  -4.589  1.00 0.00 ? 30 ARG A HG3  7  
ATOM 8614  H HD2  . ARG A 1 30 ? -15.215 -4.810  -3.406  1.00 0.00 ? 30 ARG A HD2  7  
ATOM 8615  H HD3  . ARG A 1 30 ? -15.365 -3.330  -4.352  1.00 0.00 ? 30 ARG A HD3  7  
ATOM 8616  H HE   . ARG A 1 30 ? -16.193 -5.242  -6.072  1.00 0.00 ? 30 ARG A HE   7  
ATOM 8617  H HH11 . ARG A 1 30 ? -17.084 -4.443  -2.794  1.00 0.00 ? 30 ARG A HH11 7  
ATOM 8618  H HH12 . ARG A 1 30 ? -18.714 -5.000  -2.968  1.00 0.00 ? 30 ARG A HH12 7  
ATOM 8619  H HH21 . ARG A 1 30 ? -18.337 -5.975  -6.303  1.00 0.00 ? 30 ARG A HH21 7  
ATOM 8620  H HH22 . ARG A 1 30 ? -19.425 -5.871  -4.960  1.00 0.00 ? 30 ARG A HH22 7  
ATOM 8621  N N    . LYS A 1 31 ? -15.383 -1.996  -6.329  1.00 0.00 ? 31 LYS A N    7  
ATOM 8622  C CA   . LYS A 1 31 ? -16.560 -1.146  -6.196  1.00 0.00 ? 31 LYS A CA   7  
ATOM 8623  C C    . LYS A 1 31 ? -16.773 -0.734  -4.742  1.00 0.00 ? 31 LYS A C    7  
ATOM 8624  O O    . LYS A 1 31 ? -15.927 -0.990  -3.884  1.00 0.00 ? 31 LYS A O    7  
ATOM 8625  C CB   . LYS A 1 31 ? -17.801 -1.871  -6.721  1.00 0.00 ? 31 LYS A CB   7  
ATOM 8626  C CG   . LYS A 1 31 ? -18.747 -0.971  -7.499  1.00 0.00 ? 31 LYS A CG   7  
ATOM 8627  C CD   . LYS A 1 31 ? -20.200 -1.343  -7.251  1.00 0.00 ? 31 LYS A CD   7  
ATOM 8628  C CE   . LYS A 1 31 ? -21.119 -0.143  -7.417  1.00 0.00 ? 31 LYS A CE   7  
ATOM 8629  N NZ   . LYS A 1 31 ? -22.404 -0.322  -6.688  1.00 0.00 ? 31 LYS A NZ   7  
ATOM 8630  H H    . LYS A 1 31 ? -15.487 -2.904  -6.682  1.00 0.00 ? 31 LYS A H    7  
ATOM 8631  H HA   . LYS A 1 31 ? -16.396 -0.258  -6.788  1.00 0.00 ? 31 LYS A HA   7  
ATOM 8632  H HB2  . LYS A 1 31 ? -17.486 -2.674  -7.371  1.00 0.00 ? 31 LYS A HB2  7  
ATOM 8633  H HB3  . LYS A 1 31 ? -18.342 -2.288  -5.884  1.00 0.00 ? 31 LYS A HB3  7  
ATOM 8634  H HG2  . LYS A 1 31 ? -18.591 0.052   -7.191  1.00 0.00 ? 31 LYS A HG2  7  
ATOM 8635  H HG3  . LYS A 1 31 ? -18.535 -1.069  -8.554  1.00 0.00 ? 31 LYS A HG3  7  
ATOM 8636  H HD2  . LYS A 1 31 ? -20.492 -2.107  -7.955  1.00 0.00 ? 31 LYS A HD2  7  
ATOM 8637  H HD3  . LYS A 1 31 ? -20.297 -1.723  -6.244  1.00 0.00 ? 31 LYS A HD3  7  
ATOM 8638  H HE2  . LYS A 1 31 ? -20.618 0.733   -7.035  1.00 0.00 ? 31 LYS A HE2  7  
ATOM 8639  H HE3  . LYS A 1 31 ? -21.327 -0.009  -8.469  1.00 0.00 ? 31 LYS A HE3  7  
ATOM 8640  H HZ1  . LYS A 1 31 ? -22.247 -0.244  -5.662  1.00 0.00 ? 31 LYS A HZ1  7  
ATOM 8641  H HZ2  . LYS A 1 31 ? -22.806 -1.259  -6.895  1.00 0.00 ? 31 LYS A HZ2  7  
ATOM 8642  H HZ3  . LYS A 1 31 ? -23.086 0.407   -6.980  1.00 0.00 ? 31 LYS A HZ3  7  
ATOM 8643  N N    . ILE A 1 32 ? -17.907 -0.096  -4.472  1.00 0.00 ? 32 ILE A N    7  
ATOM 8644  C CA   . ILE A 1 32 ? -18.231 0.350   -3.127  1.00 0.00 ? 32 ILE A CA   7  
ATOM 8645  C C    . ILE A 1 32 ? -19.706 0.721   -3.008  1.00 0.00 ? 32 ILE A C    7  
ATOM 8646  O O    . ILE A 1 32 ? -20.332 1.138   -3.983  1.00 0.00 ? 32 ILE A O    7  
ATOM 8647  C CB   . ILE A 1 32 ? -17.366 1.557   -2.716  1.00 0.00 ? 32 ILE A CB   7  
ATOM 8648  C CG1  . ILE A 1 32 ? -17.576 1.885   -1.237  1.00 0.00 ? 32 ILE A CG1  7  
ATOM 8649  C CG2  . ILE A 1 32 ? -17.684 2.766   -3.585  1.00 0.00 ? 32 ILE A CG2  7  
ATOM 8650  C CD1  . ILE A 1 32 ? -17.141 0.775   -0.304  1.00 0.00 ? 32 ILE A CD1  7  
ATOM 8651  H H    . ILE A 1 32 ? -18.539 0.079   -5.195  1.00 0.00 ? 32 ILE A H    7  
ATOM 8652  H HA   . ILE A 1 32 ? -18.021 -0.464  -2.452  1.00 0.00 ? 32 ILE A HA   7  
ATOM 8653  H HB   . ILE A 1 32 ? -16.331 1.296   -2.876  1.00 0.00 ? 32 ILE A HB   7  
ATOM 8654  H HG12 . ILE A 1 32 ? -17.008 2.769   -0.986  1.00 0.00 ? 32 ILE A HG12 7  
ATOM 8655  H HG13 . ILE A 1 32 ? -18.624 2.075   -1.062  1.00 0.00 ? 32 ILE A HG13 7  
ATOM 8656  H HG21 . ILE A 1 32 ? -17.847 2.444   -4.603  1.00 0.00 ? 32 ILE A HG21 7  
ATOM 8657  H HG22 . ILE A 1 32 ? -16.856 3.459   -3.555  1.00 0.00 ? 32 ILE A HG22 7  
ATOM 8658  H HG23 . ILE A 1 32 ? -18.574 3.252   -3.214  1.00 0.00 ? 32 ILE A HG23 7  
ATOM 8659  H HD11 . ILE A 1 32 ? -16.201 0.367   -0.644  1.00 0.00 ? 32 ILE A HD11 7  
ATOM 8660  H HD12 . ILE A 1 32 ? -17.890 -0.003  -0.296  1.00 0.00 ? 32 ILE A HD12 7  
ATOM 8661  H HD13 . ILE A 1 32 ? -17.022 1.170   0.694   1.00 0.00 ? 32 ILE A HD13 7  
ATOM 8662  N N    . ILE A 1 33 ? -20.256 0.567   -1.807  1.00 0.00 ? 33 ILE A N    7  
ATOM 8663  C CA   . ILE A 1 33 ? -21.650 0.883   -1.558  1.00 0.00 ? 33 ILE A CA   7  
ATOM 8664  C C    . ILE A 1 33 ? -21.782 2.136   -0.697  1.00 0.00 ? 33 ILE A C    7  
ATOM 8665  O O    . ILE A 1 33 ? -21.769 2.061   0.532   1.00 0.00 ? 33 ILE A O    7  
ATOM 8666  C CB   . ILE A 1 33 ? -22.402 -0.284  -0.872  1.00 0.00 ? 33 ILE A CB   7  
ATOM 8667  C CG1  . ILE A 1 33 ? -21.424 -1.304  -0.277  1.00 0.00 ? 33 ILE A CG1  7  
ATOM 8668  C CG2  . ILE A 1 33 ? -23.339 -0.964  -1.859  1.00 0.00 ? 33 ILE A CG2  7  
ATOM 8669  C CD1  . ILE A 1 33 ? -20.699 -0.801  0.952   1.00 0.00 ? 33 ILE A CD1  7  
ATOM 8670  H H    . ILE A 1 33 ? -19.713 0.234   -1.075  1.00 0.00 ? 33 ILE A H    7  
ATOM 8671  H HA   . ILE A 1 33 ? -22.111 1.068   -2.510  1.00 0.00 ? 33 ILE A HA   7  
ATOM 8672  H HB   . ILE A 1 33 ? -23.002 0.128   -0.076  1.00 0.00 ? 33 ILE A HB   7  
ATOM 8673  H HG12 . ILE A 1 33 ? -21.969 -2.194  0.002   1.00 0.00 ? 33 ILE A HG12 7  
ATOM 8674  H HG13 . ILE A 1 33 ? -20.683 -1.560  -1.020  1.00 0.00 ? 33 ILE A HG13 7  
ATOM 8675  H HG21 . ILE A 1 33 ? -22.823 -1.780  -2.342  1.00 0.00 ? 33 ILE A HG21 7  
ATOM 8676  H HG22 . ILE A 1 33 ? -23.658 -0.249  -2.604  1.00 0.00 ? 33 ILE A HG22 7  
ATOM 8677  H HG23 . ILE A 1 33 ? -24.202 -1.344  -1.333  1.00 0.00 ? 33 ILE A HG23 7  
ATOM 8678  H HD11 . ILE A 1 33 ? -19.780 -1.353  1.079   1.00 0.00 ? 33 ILE A HD11 7  
ATOM 8679  H HD12 . ILE A 1 33 ? -21.325 -0.939  1.821   1.00 0.00 ? 33 ILE A HD12 7  
ATOM 8680  H HD13 . ILE A 1 33 ? -20.474 0.249   0.833   1.00 0.00 ? 33 ILE A HD13 7  
ATOM 8681  N N    . LEU A 1 34 ? -21.908 3.286   -1.351  1.00 0.00 ? 34 LEU A N    7  
ATOM 8682  C CA   . LEU A 1 34 ? -22.042 4.553   -0.652  1.00 0.00 ? 34 LEU A CA   7  
ATOM 8683  C C    . LEU A 1 34 ? -23.326 4.599   0.171   1.00 0.00 ? 34 LEU A C    7  
ATOM 8684  O O    . LEU A 1 34 ? -23.457 5.408   1.089   1.00 0.00 ? 34 LEU A O    7  
ATOM 8685  C CB   . LEU A 1 34 ? -22.022 5.708   -1.655  1.00 0.00 ? 34 LEU A CB   7  
ATOM 8686  C CG   . LEU A 1 34 ? -22.720 5.432   -2.991  1.00 0.00 ? 34 LEU A CG   7  
ATOM 8687  C CD1  . LEU A 1 34 ? -23.543 6.636   -3.423  1.00 0.00 ? 34 LEU A CD1  7  
ATOM 8688  C CD2  . LEU A 1 34 ? -21.699 5.070   -4.061  1.00 0.00 ? 34 LEU A CD2  7  
ATOM 8689  H H    . LEU A 1 34 ? -21.911 3.284   -2.327  1.00 0.00 ? 34 LEU A H    7  
ATOM 8690  H HA   . LEU A 1 34 ? -21.200 4.654   0.013   1.00 0.00 ? 34 LEU A HA   7  
ATOM 8691  H HB2  . LEU A 1 34 ? -22.501 6.551   -1.195  1.00 0.00 ? 34 LEU A HB2  7  
ATOM 8692  H HB3  . LEU A 1 34 ? -20.993 5.965   -1.858  1.00 0.00 ? 34 LEU A HB3  7  
ATOM 8693  H HG   . LEU A 1 34 ? -23.392 4.595   -2.872  1.00 0.00 ? 34 LEU A HG   7  
ATOM 8694  H HD11 . LEU A 1 34 ? -24.238 6.898   -2.639  1.00 0.00 ? 34 LEU A HD11 7  
ATOM 8695  H HD12 . LEU A 1 34 ? -24.091 6.394   -4.322  1.00 0.00 ? 34 LEU A HD12 7  
ATOM 8696  H HD13 . LEU A 1 34 ? -22.886 7.471   -3.616  1.00 0.00 ? 34 LEU A HD13 7  
ATOM 8697  H HD21 . LEU A 1 34 ? -21.654 3.996   -4.166  1.00 0.00 ? 34 LEU A HD21 7  
ATOM 8698  H HD22 . LEU A 1 34 ? -20.728 5.445   -3.774  1.00 0.00 ? 34 LEU A HD22 7  
ATOM 8699  H HD23 . LEU A 1 34 ? -21.992 5.512   -5.002  1.00 0.00 ? 34 LEU A HD23 7  
ATOM 8700  N N    . SER A 1 35 ? -24.273 3.728   -0.162  1.00 0.00 ? 35 SER A N    7  
ATOM 8701  C CA   . SER A 1 35 ? -25.544 3.674   0.550   1.00 0.00 ? 35 SER A CA   7  
ATOM 8702  C C    . SER A 1 35 ? -25.346 3.302   2.018   1.00 0.00 ? 35 SER A C    7  
ATOM 8703  O O    . SER A 1 35 ? -26.236 3.506   2.843   1.00 0.00 ? 35 SER A O    7  
ATOM 8704  C CB   . SER A 1 35 ? -26.482 2.673   -0.122  1.00 0.00 ? 35 SER A CB   7  
ATOM 8705  O OG   . SER A 1 35 ? -27.646 3.315   -0.612  1.00 0.00 ? 35 SER A OG   7  
ATOM 8706  H H    . SER A 1 35 ? -24.113 3.108   -0.902  1.00 0.00 ? 35 SER A H    7  
ATOM 8707  H HA   . SER A 1 35 ? -25.990 4.650   0.498   1.00 0.00 ? 35 SER A HA   7  
ATOM 8708  H HB2  . SER A 1 35 ? -25.970 2.206   -0.947  1.00 0.00 ? 35 SER A HB2  7  
ATOM 8709  H HB3  . SER A 1 35 ? -26.775 1.922   0.594   1.00 0.00 ? 35 SER A HB3  7  
ATOM 8710  H HG   . SER A 1 35 ? -28.116 2.721   -1.202  1.00 0.00 ? 35 SER A HG   7  
ATOM 8711  N N    . ASP A 1 36 ? -24.178 2.753   2.339   1.00 0.00 ? 36 ASP A N    7  
ATOM 8712  C CA   . ASP A 1 36 ? -23.872 2.353   3.704   1.00 0.00 ? 36 ASP A CA   7  
ATOM 8713  C C    . ASP A 1 36 ? -23.582 3.567   4.581   1.00 0.00 ? 36 ASP A C    7  
ATOM 8714  O O    . ASP A 1 36 ? -24.333 3.869   5.508   1.00 0.00 ? 36 ASP A O    7  
ATOM 8715  C CB   . ASP A 1 36 ? -22.677 1.398   3.721   1.00 0.00 ? 36 ASP A CB   7  
ATOM 8716  C CG   . ASP A 1 36 ? -23.098 -0.053  3.843   1.00 0.00 ? 36 ASP A CG   7  
ATOM 8717  O OD1  . ASP A 1 36 ? -23.567 -0.622  2.834   1.00 0.00 ? 36 ASP A OD1  7  
ATOM 8718  O OD2  . ASP A 1 36 ? -22.960 -0.621  4.947   1.00 0.00 ? 36 ASP A OD2  7  
ATOM 8719  H H    . ASP A 1 36 ? -23.508 2.611   1.644   1.00 0.00 ? 36 ASP A H    7  
ATOM 8720  H HA   . ASP A 1 36 ? -24.735 1.839   4.094   1.00 0.00 ? 36 ASP A HA   7  
ATOM 8721  H HB2  . ASP A 1 36 ? -22.118 1.514   2.804   1.00 0.00 ? 36 ASP A HB2  7  
ATOM 8722  H HB3  . ASP A 1 36 ? -22.040 1.641   4.558   1.00 0.00 ? 36 ASP A HB3  7  
ATOM 8723  N N    . GLU A 1 37 ? -22.485 4.257   4.284   1.00 0.00 ? 37 GLU A N    7  
ATOM 8724  C CA   . GLU A 1 37 ? -22.092 5.430   5.046   1.00 0.00 ? 37 GLU A CA   7  
ATOM 8725  C C    . GLU A 1 37 ? -22.105 6.690   4.184   1.00 0.00 ? 37 GLU A C    7  
ATOM 8726  O O    . GLU A 1 37 ? -22.246 7.801   4.696   1.00 0.00 ? 37 GLU A O    7  
ATOM 8727  C CB   . GLU A 1 37 ? -20.707 5.226   5.658   1.00 0.00 ? 37 GLU A CB   7  
ATOM 8728  C CG   . GLU A 1 37 ? -20.705 5.245   7.175   1.00 0.00 ? 37 GLU A CG   7  
ATOM 8729  C CD   . GLU A 1 37 ? -19.852 6.362   7.746   1.00 0.00 ? 37 GLU A CD   7  
ATOM 8730  O OE1  . GLU A 1 37 ? -18.636 6.145   7.928   1.00 0.00 ? 37 GLU A OE1  7  
ATOM 8731  O OE2  . GLU A 1 37 ? -20.401 7.452   8.011   1.00 0.00 ? 37 GLU A OE2  7  
ATOM 8732  H H    . GLU A 1 37 ? -21.928 3.966   3.543   1.00 0.00 ? 37 GLU A H    7  
ATOM 8733  H HA   . GLU A 1 37 ? -22.800 5.548   5.834   1.00 0.00 ? 37 GLU A HA   7  
ATOM 8734  H HB2  . GLU A 1 37 ? -20.322 4.274   5.333   1.00 0.00 ? 37 GLU A HB2  7  
ATOM 8735  H HB3  . GLU A 1 37 ? -20.054 6.008   5.311   1.00 0.00 ? 37 GLU A HB3  7  
ATOM 8736  H HG2  . GLU A 1 37 ? -21.718 5.377   7.517   1.00 0.00 ? 37 GLU A HG2  7  
ATOM 8737  H HG3  . GLU A 1 37 ? -20.324 4.301   7.533   1.00 0.00 ? 37 GLU A HG3  7  
ATOM 8738  N N    . GLY A 1 38 ? -21.959 6.512   2.877   1.00 0.00 ? 38 GLY A N    7  
ATOM 8739  C CA   . GLY A 1 38 ? -21.959 7.639   1.970   1.00 0.00 ? 38 GLY A CA   7  
ATOM 8740  C C    . GLY A 1 38 ? -20.581 8.250   1.785   1.00 0.00 ? 38 GLY A C    7  
ATOM 8741  O O    . GLY A 1 38 ? -20.367 9.040   0.866   1.00 0.00 ? 38 GLY A O    7  
ATOM 8742  H H    . GLY A 1 38 ? -21.854 5.611   2.527   1.00 0.00 ? 38 GLY A H    7  
ATOM 8743  H HA2  . GLY A 1 38 ? -22.326 7.313   1.009   1.00 0.00 ? 38 GLY A HA2  7  
ATOM 8744  H HA3  . GLY A 1 38 ? -22.624 8.389   2.360   1.00 0.00 ? 38 GLY A HA3  7  
ATOM 8745  N N    . LYS A 1 39 ? -19.640 7.875   2.648   1.00 0.00 ? 39 LYS A N    7  
ATOM 8746  C CA   . LYS A 1 39 ? -18.286 8.376   2.563   1.00 0.00 ? 39 LYS A CA   7  
ATOM 8747  C C    . LYS A 1 39 ? -17.303 7.299   2.998   1.00 0.00 ? 39 LYS A C    7  
ATOM 8748  O O    . LYS A 1 39 ? -16.959 7.189   4.174   1.00 0.00 ? 39 LYS A O    7  
ATOM 8749  C CB   . LYS A 1 39 ? -18.119 9.625   3.430   1.00 0.00 ? 39 LYS A CB   7  
ATOM 8750  C CG   . LYS A 1 39 ? -18.460 10.918  2.706   1.00 0.00 ? 39 LYS A CG   7  
ATOM 8751  C CD   . LYS A 1 39 ? -19.901 11.333  2.959   1.00 0.00 ? 39 LYS A CD   7  
ATOM 8752  C CE   . LYS A 1 39 ? -20.417 12.248  1.860   1.00 0.00 ? 39 LYS A CE   7  
ATOM 8753  N NZ   . LYS A 1 39 ? -21.216 11.505  0.848   1.00 0.00 ? 39 LYS A NZ   7  
ATOM 8754  H H    . LYS A 1 39 ? -19.855 7.233   3.341   1.00 0.00 ? 39 LYS A H    7  
ATOM 8755  H HA   . LYS A 1 39 ? -18.095 8.628   1.536   1.00 0.00 ? 39 LYS A HA   7  
ATOM 8756  H HB2  . LYS A 1 39 ? -18.762 9.540   4.292   1.00 0.00 ? 39 LYS A HB2  7  
ATOM 8757  H HB3  . LYS A 1 39 ? -17.093 9.685   3.762   1.00 0.00 ? 39 LYS A HB3  7  
ATOM 8758  H HG2  . LYS A 1 39 ? -17.804 11.700  3.057   1.00 0.00 ? 39 LYS A HG2  7  
ATOM 8759  H HG3  . LYS A 1 39 ? -18.317 10.773  1.645   1.00 0.00 ? 39 LYS A HG3  7  
ATOM 8760  H HD2  . LYS A 1 39 ? -20.519 10.449  2.996   1.00 0.00 ? 39 LYS A HD2  7  
ATOM 8761  H HD3  . LYS A 1 39 ? -19.954 11.853  3.904   1.00 0.00 ? 39 LYS A HD3  7  
ATOM 8762  H HE2  . LYS A 1 39 ? -21.038 13.011  2.307   1.00 0.00 ? 39 LYS A HE2  7  
ATOM 8763  H HE3  . LYS A 1 39 ? -19.574 12.713  1.371   1.00 0.00 ? 39 LYS A HE3  7  
ATOM 8764  H HZ1  . LYS A 1 39 ? -21.406 12.113  0.026   1.00 0.00 ? 39 LYS A HZ1  7  
ATOM 8765  H HZ2  . LYS A 1 39 ? -22.123 11.204  1.259   1.00 0.00 ? 39 LYS A HZ2  7  
ATOM 8766  H HZ3  . LYS A 1 39 ? -20.696 10.662  0.530   1.00 0.00 ? 39 LYS A HZ3  7  
ATOM 8767  N N    . MET A 1 40 ? -16.853 6.517   2.033   1.00 0.00 ? 40 MET A N    7  
ATOM 8768  C CA   . MET A 1 40 ? -15.903 5.450   2.287   1.00 0.00 ? 40 MET A CA   7  
ATOM 8769  C C    . MET A 1 40 ? -15.011 5.228   1.072   1.00 0.00 ? 40 MET A C    7  
ATOM 8770  O O    . MET A 1 40 ? -15.300 4.388   0.220   1.00 0.00 ? 40 MET A O    7  
ATOM 8771  C CB   . MET A 1 40 ? -16.636 4.155   2.646   1.00 0.00 ? 40 MET A CB   7  
ATOM 8772  C CG   . MET A 1 40 ? -17.760 3.806   1.685   1.00 0.00 ? 40 MET A CG   7  
ATOM 8773  S SD   . MET A 1 40 ? -19.172 3.049   2.513   1.00 0.00 ? 40 MET A SD   7  
ATOM 8774  C CE   . MET A 1 40 ? -18.634 1.343   2.608   1.00 0.00 ? 40 MET A CE   7  
ATOM 8775  H H    . MET A 1 40 ? -17.165 6.665   1.128   1.00 0.00 ? 40 MET A H    7  
ATOM 8776  H HA   . MET A 1 40 ? -15.291 5.751   3.117   1.00 0.00 ? 40 MET A HA   7  
ATOM 8777  H HB2  . MET A 1 40 ? -15.926 3.342   2.646   1.00 0.00 ? 40 MET A HB2  7  
ATOM 8778  H HB3  . MET A 1 40 ? -17.055 4.255   3.636   1.00 0.00 ? 40 MET A HB3  7  
ATOM 8779  H HG2  . MET A 1 40 ? -18.092 4.710   1.195   1.00 0.00 ? 40 MET A HG2  7  
ATOM 8780  H HG3  . MET A 1 40 ? -17.382 3.116   0.945   1.00 0.00 ? 40 MET A HG3  7  
ATOM 8781  H HE1  . MET A 1 40 ? -19.227 0.819   3.342   1.00 0.00 ? 40 MET A HE1  7  
ATOM 8782  H HE2  . MET A 1 40 ? -17.593 1.309   2.894   1.00 0.00 ? 40 MET A HE2  7  
ATOM 8783  H HE3  . MET A 1 40 ? -18.757 0.873   1.643   1.00 0.00 ? 40 MET A HE3  7  
ATOM 8784  N N    . TYR A 1 41 ? -13.927 5.988   1.002   1.00 0.00 ? 41 TYR A N    7  
ATOM 8785  C CA   . TYR A 1 41 ? -12.989 5.882   -0.101  1.00 0.00 ? 41 TYR A CA   7  
ATOM 8786  C C    . TYR A 1 41 ? -11.561 6.151   0.366   1.00 0.00 ? 41 TYR A C    7  
ATOM 8787  O O    . TYR A 1 41 ? -11.099 7.291   0.358   1.00 0.00 ? 41 TYR A O    7  
ATOM 8788  C CB   . TYR A 1 41 ? -13.370 6.852   -1.216  1.00 0.00 ? 41 TYR A CB   7  
ATOM 8789  C CG   . TYR A 1 41 ? -13.638 6.177   -2.542  1.00 0.00 ? 41 TYR A CG   7  
ATOM 8790  C CD1  . TYR A 1 41 ? -12.636 5.473   -3.199  1.00 0.00 ? 41 TYR A CD1  7  
ATOM 8791  C CD2  . TYR A 1 41 ? -14.891 6.243   -3.137  1.00 0.00 ? 41 TYR A CD2  7  
ATOM 8792  C CE1  . TYR A 1 41 ? -12.876 4.855   -4.412  1.00 0.00 ? 41 TYR A CE1  7  
ATOM 8793  C CE2  . TYR A 1 41 ? -15.139 5.627   -4.349  1.00 0.00 ? 41 TYR A CE2  7  
ATOM 8794  C CZ   . TYR A 1 41 ? -14.129 4.935   -4.982  1.00 0.00 ? 41 TYR A CZ   7  
ATOM 8795  O OH   . TYR A 1 41 ? -14.372 4.320   -6.189  1.00 0.00 ? 41 TYR A OH   7  
ATOM 8796  H H    . TYR A 1 41 ? -13.757 6.635   1.707   1.00 0.00 ? 41 TYR A H    7  
ATOM 8797  H HA   . TYR A 1 41 ? -13.046 4.882   -0.478  1.00 0.00 ? 41 TYR A HA   7  
ATOM 8798  H HB2  . TYR A 1 41 ? -14.264 7.384   -0.929  1.00 0.00 ? 41 TYR A HB2  7  
ATOM 8799  H HB3  . TYR A 1 41 ? -12.567 7.555   -1.357  1.00 0.00 ? 41 TYR A HB3  7  
ATOM 8800  H HD1  . TYR A 1 41 ? -11.656 5.412   -2.750  1.00 0.00 ? 41 TYR A HD1  7  
ATOM 8801  H HD2  . TYR A 1 41 ? -15.681 6.787   -2.639  1.00 0.00 ? 41 TYR A HD2  7  
ATOM 8802  H HE1  . TYR A 1 41 ? -12.085 4.312   -4.907  1.00 0.00 ? 41 TYR A HE1  7  
ATOM 8803  H HE2  . TYR A 1 41 ? -16.121 5.690   -4.796  1.00 0.00 ? 41 TYR A HE2  7  
ATOM 8804  H HH   . TYR A 1 41 ? -13.614 4.438   -6.767  1.00 0.00 ? 41 TYR A HH   7  
ATOM 8805  N N    . GLY A 1 42 ? -10.867 5.091   0.767   1.00 0.00 ? 42 GLY A N    7  
ATOM 8806  C CA   . GLY A 1 42 ? -9.503  5.227   1.225   1.00 0.00 ? 42 GLY A CA   7  
ATOM 8807  C C    . GLY A 1 42 ? -8.695  3.960   1.023   1.00 0.00 ? 42 GLY A C    7  
ATOM 8808  O O    . GLY A 1 42 ? -8.819  3.008   1.793   1.00 0.00 ? 42 GLY A O    7  
ATOM 8809  H H    . GLY A 1 42 ? -11.283 4.210   0.747   1.00 0.00 ? 42 GLY A H    7  
ATOM 8810  H HA2  . GLY A 1 42 ? -9.038  6.027   0.677   1.00 0.00 ? 42 GLY A HA2  7  
ATOM 8811  H HA3  . GLY A 1 42 ? -9.508  5.477   2.275   1.00 0.00 ? 42 GLY A HA3  7  
ATOM 8812  N N    . ARG A 1 43 ? -7.868  3.948   -0.016  1.00 0.00 ? 43 ARG A N    7  
ATOM 8813  C CA   . ARG A 1 43 ? -7.040  2.789   -0.320  1.00 0.00 ? 43 ARG A CA   7  
ATOM 8814  C C    . ARG A 1 43 ? -5.925  2.623   0.707   1.00 0.00 ? 43 ARG A C    7  
ATOM 8815  O O    . ARG A 1 43 ? -5.437  1.516   0.936   1.00 0.00 ? 43 ARG A O    7  
ATOM 8816  C CB   . ARG A 1 43 ? -6.449  2.913   -1.723  1.00 0.00 ? 43 ARG A CB   7  
ATOM 8817  C CG   . ARG A 1 43 ? -6.901  1.815   -2.672  1.00 0.00 ? 43 ARG A CG   7  
ATOM 8818  C CD   . ARG A 1 43 ? -8.016  2.294   -3.588  1.00 0.00 ? 43 ARG A CD   7  
ATOM 8819  N NE   . ARG A 1 43 ? -7.870  1.774   -4.946  1.00 0.00 ? 43 ARG A NE   7  
ATOM 8820  C CZ   . ARG A 1 43 ? -6.891  2.131   -5.775  1.00 0.00 ? 43 ARG A CZ   7  
ATOM 8821  N NH1  . ARG A 1 43 ? -5.972  3.007   -5.389  1.00 0.00 ? 43 ARG A NH1  7  
ATOM 8822  N NH2  . ARG A 1 43 ? -6.831  1.609   -6.992  1.00 0.00 ? 43 ARG A NH2  7  
ATOM 8823  H H    . ARG A 1 43 ? -7.815  4.735   -0.594  1.00 0.00 ? 43 ARG A H    7  
ATOM 8824  H HA   . ARG A 1 43 ? -7.669  1.924   -0.287  1.00 0.00 ? 43 ARG A HA   7  
ATOM 8825  H HB2  . ARG A 1 43 ? -6.743  3.863   -2.139  1.00 0.00 ? 43 ARG A HB2  7  
ATOM 8826  H HB3  . ARG A 1 43 ? -5.373  2.877   -1.653  1.00 0.00 ? 43 ARG A HB3  7  
ATOM 8827  H HG2  . ARG A 1 43 ? -6.061  1.506   -3.276  1.00 0.00 ? 43 ARG A HG2  7  
ATOM 8828  H HG3  . ARG A 1 43 ? -7.258  0.976   -2.093  1.00 0.00 ? 43 ARG A HG3  7  
ATOM 8829  H HD2  . ARG A 1 43 ? -8.962  1.962   -3.187  1.00 0.00 ? 43 ARG A HD2  7  
ATOM 8830  H HD3  . ARG A 1 43 ? -7.999  3.373   -3.622  1.00 0.00 ? 43 ARG A HD3  7  
ATOM 8831  H HE   . ARG A 1 43 ? -8.536  1.125   -5.257  1.00 0.00 ? 43 ARG A HE   7  
ATOM 8832  H HH11 . ARG A 1 43 ? -6.011  3.404   -4.472  1.00 0.00 ? 43 ARG A HH11 7  
ATOM 8833  H HH12 . ARG A 1 43 ? -5.239  3.271   -6.016  1.00 0.00 ? 43 ARG A HH12 7  
ATOM 8834  H HH21 . ARG A 1 43 ? -7.521  0.948   -7.288  1.00 0.00 ? 43 ARG A HH21 7  
ATOM 8835  H HH22 . ARG A 1 43 ? -6.096  1.877   -7.615  1.00 0.00 ? 43 ARG A HH22 7  
ATOM 8836  N N    . ASN A 1 44 ? -5.525  3.729   1.319   1.00 0.00 ? 44 ASN A N    7  
ATOM 8837  C CA   . ASN A 1 44 ? -4.467  3.710   2.318   1.00 0.00 ? 44 ASN A CA   7  
ATOM 8838  C C    . ASN A 1 44 ? -4.942  3.056   3.608   1.00 0.00 ? 44 ASN A C    7  
ATOM 8839  O O    . ASN A 1 44 ? -4.162  2.433   4.327   1.00 0.00 ? 44 ASN A O    7  
ATOM 8840  C CB   . ASN A 1 44 ? -3.970  5.127   2.596   1.00 0.00 ? 44 ASN A CB   7  
ATOM 8841  C CG   . ASN A 1 44 ? -2.511  5.312   2.224   1.00 0.00 ? 44 ASN A CG   7  
ATOM 8842  O OD1  . ASN A 1 44 ? -1.726  4.365   2.250   1.00 0.00 ? 44 ASN A OD1  7  
ATOM 8843  N ND2  . ASN A 1 44 ? -2.141  6.539   1.875   1.00 0.00 ? 44 ASN A ND2  7  
ATOM 8844  H H    . ASN A 1 44 ? -5.951  4.578   1.091   1.00 0.00 ? 44 ASN A H    7  
ATOM 8845  H HA   . ASN A 1 44 ? -3.659  3.132   1.921   1.00 0.00 ? 44 ASN A HA   7  
ATOM 8846  H HB2  . ASN A 1 44 ? -4.558  5.823   2.021   1.00 0.00 ? 44 ASN A HB2  7  
ATOM 8847  H HB3  . ASN A 1 44 ? -4.084  5.343   3.646   1.00 0.00 ? 44 ASN A HB3  7  
ATOM 8848  H HD21 . ASN A 1 44 ? -2.821  7.246   1.877   1.00 0.00 ? 44 ASN A HD21 7  
ATOM 8849  H HD22 . ASN A 1 44 ? -1.204  6.688   1.629   1.00 0.00 ? 44 ASN A HD22 7  
ATOM 8850  N N    . GLU A 1 45 ? -6.227  3.200   3.892   1.00 0.00 ? 45 GLU A N    7  
ATOM 8851  C CA   . GLU A 1 45 ? -6.813  2.622   5.092   1.00 0.00 ? 45 GLU A CA   7  
ATOM 8852  C C    . GLU A 1 45 ? -6.950  1.113   4.950   1.00 0.00 ? 45 GLU A C    7  
ATOM 8853  O O    . GLU A 1 45 ? -6.889  0.375   5.934   1.00 0.00 ? 45 GLU A O    7  
ATOM 8854  C CB   . GLU A 1 45 ? -8.177  3.251   5.380   1.00 0.00 ? 45 GLU A CB   7  
ATOM 8855  C CG   . GLU A 1 45 ? -8.488  3.381   6.862   1.00 0.00 ? 45 GLU A CG   7  
ATOM 8856  C CD   . GLU A 1 45 ? -9.977  3.415   7.145   1.00 0.00 ? 45 GLU A CD   7  
ATOM 8857  O OE1  . GLU A 1 45 ? -10.596 4.479   6.936   1.00 0.00 ? 45 GLU A OE1  7  
ATOM 8858  O OE2  . GLU A 1 45 ? -10.523 2.378   7.576   1.00 0.00 ? 45 GLU A OE2  7  
ATOM 8859  H H    . GLU A 1 45 ? -6.794  3.705   3.280   1.00 0.00 ? 45 GLU A H    7  
ATOM 8860  H HA   . GLU A 1 45 ? -6.149  2.832   5.909   1.00 0.00 ? 45 GLU A HA   7  
ATOM 8861  H HB2  . GLU A 1 45 ? -8.206  4.237   4.940   1.00 0.00 ? 45 GLU A HB2  7  
ATOM 8862  H HB3  . GLU A 1 45 ? -8.944  2.642   4.925   1.00 0.00 ? 45 GLU A HB3  7  
ATOM 8863  H HG2  . GLU A 1 45 ? -8.058  2.538   7.382   1.00 0.00 ? 45 GLU A HG2  7  
ATOM 8864  H HG3  . GLU A 1 45 ? -8.044  4.294   7.231   1.00 0.00 ? 45 GLU A HG3  7  
ATOM 8865  N N    . LEU A 1 46 ? -7.130  0.664   3.717   1.00 0.00 ? 46 LEU A N    7  
ATOM 8866  C CA   . LEU A 1 46 ? -7.269  -0.755  3.432   1.00 0.00 ? 46 LEU A CA   7  
ATOM 8867  C C    . LEU A 1 46 ? -5.937  -1.469  3.591   1.00 0.00 ? 46 LEU A C    7  
ATOM 8868  O O    . LEU A 1 46 ? -5.883  -2.631  3.994   1.00 0.00 ? 46 LEU A O    7  
ATOM 8869  C CB   . LEU A 1 46 ? -7.810  -0.963  2.019   1.00 0.00 ? 46 LEU A CB   7  
ATOM 8870  C CG   . LEU A 1 46 ? -8.999  -1.918  1.912   1.00 0.00 ? 46 LEU A CG   7  
ATOM 8871  C CD1  . LEU A 1 46 ? -9.534  -1.944  0.489   1.00 0.00 ? 46 LEU A CD1  7  
ATOM 8872  C CD2  . LEU A 1 46 ? -8.598  -3.316  2.358   1.00 0.00 ? 46 LEU A CD2  7  
ATOM 8873  H H    . LEU A 1 46 ? -7.164  1.304   2.980   1.00 0.00 ? 46 LEU A H    7  
ATOM 8874  H HA   . LEU A 1 46 ? -7.962  -1.163  4.133   1.00 0.00 ? 46 LEU A HA   7  
ATOM 8875  H HB2  . LEU A 1 46 ? -8.106  -0.003  1.623   1.00 0.00 ? 46 LEU A HB2  7  
ATOM 8876  H HB3  . LEU A 1 46 ? -7.012  -1.353  1.413   1.00 0.00 ? 46 LEU A HB3  7  
ATOM 8877  H HG   . LEU A 1 46 ? -9.791  -1.572  2.561   1.00 0.00 ? 46 LEU A HG   7  
ATOM 8878  H HD11 . LEU A 1 46 ? -10.259 -2.738  0.392   1.00 0.00 ? 46 LEU A HD11 7  
ATOM 8879  H HD12 . LEU A 1 46 ? -8.719  -2.114  -0.199  1.00 0.00 ? 46 LEU A HD12 7  
ATOM 8880  H HD13 . LEU A 1 46 ? -10.004 -0.998  0.264   1.00 0.00 ? 46 LEU A HD13 7  
ATOM 8881  H HD21 . LEU A 1 46 ? -9.189  -4.047  1.826   1.00 0.00 ? 46 LEU A HD21 7  
ATOM 8882  H HD22 . LEU A 1 46 ? -8.768  -3.418  3.419   1.00 0.00 ? 46 LEU A HD22 7  
ATOM 8883  H HD23 . LEU A 1 46 ? -7.551  -3.475  2.144   1.00 0.00 ? 46 LEU A HD23 7  
ATOM 8884  N N    . ILE A 1 47 ? -4.865  -0.761  3.273   1.00 0.00 ? 47 ILE A N    7  
ATOM 8885  C CA   . ILE A 1 47 ? -3.527  -1.315  3.378   1.00 0.00 ? 47 ILE A CA   7  
ATOM 8886  C C    . ILE A 1 47 ? -3.103  -1.423  4.832   1.00 0.00 ? 47 ILE A C    7  
ATOM 8887  O O    . ILE A 1 47 ? -2.512  -2.418  5.252   1.00 0.00 ? 47 ILE A O    7  
ATOM 8888  C CB   . ILE A 1 47 ? -2.506  -0.467  2.579   1.00 0.00 ? 47 ILE A CB   7  
ATOM 8889  C CG1  . ILE A 1 47 ? -1.547  -1.377  1.810   1.00 0.00 ? 47 ILE A CG1  7  
ATOM 8890  C CG2  . ILE A 1 47 ? -1.731  0.484   3.486   1.00 0.00 ? 47 ILE A CG2  7  
ATOM 8891  C CD1  . ILE A 1 47 ? -1.238  -0.887  0.413   1.00 0.00 ? 47 ILE A CD1  7  
ATOM 8892  H H    . ILE A 1 47 ? -4.979  0.157   2.960   1.00 0.00 ? 47 ILE A H    7  
ATOM 8893  H HA   . ILE A 1 47 ? -3.553  -2.301  2.960   1.00 0.00 ? 47 ILE A HA   7  
ATOM 8894  H HB   . ILE A 1 47 ? -3.058  0.132   1.873   1.00 0.00 ? 47 ILE A HB   7  
ATOM 8895  H HG12 . ILE A 1 47 ? -0.614  -1.446  2.350   1.00 0.00 ? 47 ILE A HG12 7  
ATOM 8896  H HG13 . ILE A 1 47 ? -1.984  -2.361  1.728   1.00 0.00 ? 47 ILE A HG13 7  
ATOM 8897  H HG21 . ILE A 1 47 ? -1.136  1.152   2.882   1.00 0.00 ? 47 ILE A HG21 7  
ATOM 8898  H HG22 . ILE A 1 47 ? -1.085  -0.086  4.137   1.00 0.00 ? 47 ILE A HG22 7  
ATOM 8899  H HG23 . ILE A 1 47 ? -2.425  1.059   4.080   1.00 0.00 ? 47 ILE A HG23 7  
ATOM 8900  H HD11 . ILE A 1 47 ? -1.731  -1.522  -0.309  1.00 0.00 ? 47 ILE A HD11 7  
ATOM 8901  H HD12 . ILE A 1 47 ? -0.172  -0.916  0.248   1.00 0.00 ? 47 ILE A HD12 7  
ATOM 8902  H HD13 . ILE A 1 47 ? -1.593  0.127   0.300   1.00 0.00 ? 47 ILE A HD13 7  
ATOM 8903  N N    . ALA A 1 48 ? -3.422  -0.393  5.594   1.00 0.00 ? 48 ALA A N    7  
ATOM 8904  C CA   . ALA A 1 48 ? -3.091  -0.364  7.007   1.00 0.00 ? 48 ALA A CA   7  
ATOM 8905  C C    . ALA A 1 48 ? -3.966  -1.337  7.778   1.00 0.00 ? 48 ALA A C    7  
ATOM 8906  O O    . ALA A 1 48 ? -3.563  -1.867  8.811   1.00 0.00 ? 48 ALA A O    7  
ATOM 8907  C CB   . ALA A 1 48 ? -3.231  1.046   7.560   1.00 0.00 ? 48 ALA A CB   7  
ATOM 8908  H H    . ALA A 1 48 ? -3.898  0.360   5.194   1.00 0.00 ? 48 ALA A H    7  
ATOM 8909  H HA   . ALA A 1 48 ? -2.065  -0.670  7.107   1.00 0.00 ? 48 ALA A HA   7  
ATOM 8910  H HB1  . ALA A 1 48 ? -3.075  1.030   8.629   1.00 0.00 ? 48 ALA A HB1  7  
ATOM 8911  H HB2  . ALA A 1 48 ? -4.221  1.420   7.346   1.00 0.00 ? 48 ALA A HB2  7  
ATOM 8912  H HB3  . ALA A 1 48 ? -2.495  1.688   7.098   1.00 0.00 ? 48 ALA A HB3  7  
ATOM 8913  N N    . ARG A 1 49 ? -5.160  -1.582  7.258   1.00 0.00 ? 49 ARG A N    7  
ATOM 8914  C CA   . ARG A 1 49 ? -6.082  -2.509  7.888   1.00 0.00 ? 49 ARG A CA   7  
ATOM 8915  C C    . ARG A 1 49 ? -5.581  -3.936  7.725   1.00 0.00 ? 49 ARG A C    7  
ATOM 8916  O O    . ARG A 1 49 ? -5.870  -4.807  8.545   1.00 0.00 ? 49 ARG A O    7  
ATOM 8917  C CB   . ARG A 1 49 ? -7.483  -2.367  7.290   1.00 0.00 ? 49 ARG A CB   7  
ATOM 8918  C CG   . ARG A 1 49 ? -8.574  -3.002  8.136   1.00 0.00 ? 49 ARG A CG   7  
ATOM 8919  C CD   . ARG A 1 49 ? -9.728  -3.497  7.279   1.00 0.00 ? 49 ARG A CD   7  
ATOM 8920  N NE   . ARG A 1 49 ? -11.013 -3.367  7.962   1.00 0.00 ? 49 ARG A NE   7  
ATOM 8921  C CZ   . ARG A 1 49 ? -12.160 -3.837  7.478   1.00 0.00 ? 49 ARG A CZ   7  
ATOM 8922  N NH1  . ARG A 1 49 ? -12.187 -4.468  6.311   1.00 0.00 ? 49 ARG A NH1  7  
ATOM 8923  N NH2  . ARG A 1 49 ? -13.284 -3.677  8.164   1.00 0.00 ? 49 ARG A NH2  7  
ATOM 8924  H H    . ARG A 1 49 ? -5.420  -1.140  6.426   1.00 0.00 ? 49 ARG A H    7  
ATOM 8925  H HA   . ARG A 1 49 ? -6.117  -2.273  8.935   1.00 0.00 ? 49 ARG A HA   7  
ATOM 8926  H HB2  . ARG A 1 49 ? -7.710  -1.317  7.178   1.00 0.00 ? 49 ARG A HB2  7  
ATOM 8927  H HB3  . ARG A 1 49 ? -7.495  -2.834  6.316   1.00 0.00 ? 49 ARG A HB3  7  
ATOM 8928  H HG2  . ARG A 1 49 ? -8.156  -3.839  8.676   1.00 0.00 ? 49 ARG A HG2  7  
ATOM 8929  H HG3  . ARG A 1 49 ? -8.946  -2.268  8.837   1.00 0.00 ? 49 ARG A HG3  7  
ATOM 8930  H HD2  . ARG A 1 49 ? -9.756  -2.918  6.368   1.00 0.00 ? 49 ARG A HD2  7  
ATOM 8931  H HD3  . ARG A 1 49 ? -9.561  -4.537  7.039   1.00 0.00 ? 49 ARG A HD3  7  
ATOM 8932  H HE   . ARG A 1 49 ? -11.021 -2.906  8.827   1.00 0.00 ? 49 ARG A HE   7  
ATOM 8933  H HH11 . ARG A 1 49 ? -11.344 -4.592  5.788   1.00 0.00 ? 49 ARG A HH11 7  
ATOM 8934  H HH12 . ARG A 1 49 ? -13.053 -4.819  5.953   1.00 0.00 ? 49 ARG A HH12 7  
ATOM 8935  H HH21 . ARG A 1 49 ? -13.269 -3.203  9.045   1.00 0.00 ? 49 ARG A HH21 7  
ATOM 8936  H HH22 . ARG A 1 49 ? -14.146 -4.030  7.801   1.00 0.00 ? 49 ARG A HH22 7  
ATOM 8937  N N    . TYR A 1 50 ? -4.816  -4.162  6.663   1.00 0.00 ? 50 TYR A N    7  
ATOM 8938  C CA   . TYR A 1 50 ? -4.259  -5.476  6.392   1.00 0.00 ? 50 TYR A CA   7  
ATOM 8939  C C    . TYR A 1 50 ? -3.200  -5.830  7.415   1.00 0.00 ? 50 TYR A C    7  
ATOM 8940  O O    . TYR A 1 50 ? -3.247  -6.888  8.043   1.00 0.00 ? 50 TYR A O    7  
ATOM 8941  C CB   . TYR A 1 50 ? -3.660  -5.521  4.997   1.00 0.00 ? 50 TYR A CB   7  
ATOM 8942  C CG   . TYR A 1 50 ? -3.599  -6.911  4.405   1.00 0.00 ? 50 TYR A CG   7  
ATOM 8943  C CD1  . TYR A 1 50 ? -4.669  -7.433  3.690   1.00 0.00 ? 50 TYR A CD1  7  
ATOM 8944  C CD2  . TYR A 1 50 ? -2.468  -7.700  4.563   1.00 0.00 ? 50 TYR A CD2  7  
ATOM 8945  C CE1  . TYR A 1 50 ? -4.613  -8.703  3.149   1.00 0.00 ? 50 TYR A CE1  7  
ATOM 8946  C CE2  . TYR A 1 50 ? -2.403  -8.970  4.025   1.00 0.00 ? 50 TYR A CE2  7  
ATOM 8947  C CZ   . TYR A 1 50 ? -3.478  -9.468  3.319   1.00 0.00 ? 50 TYR A CZ   7  
ATOM 8948  O OH   . TYR A 1 50 ? -3.418  -10.733 2.783   1.00 0.00 ? 50 TYR A OH   7  
ATOM 8949  H H    . TYR A 1 50 ? -4.617  -3.424  6.050   1.00 0.00 ? 50 TYR A H    7  
ATOM 8950  H HA   . TYR A 1 50 ? -5.043  -6.187  6.456   1.00 0.00 ? 50 TYR A HA   7  
ATOM 8951  H HB2  . TYR A 1 50 ? -4.243  -4.899  4.339   1.00 0.00 ? 50 TYR A HB2  7  
ATOM 8952  H HB3  . TYR A 1 50 ? -2.660  -5.142  5.048   1.00 0.00 ? 50 TYR A HB3  7  
ATOM 8953  H HD1  . TYR A 1 50 ? -5.556  -6.831  3.557   1.00 0.00 ? 50 TYR A HD1  7  
ATOM 8954  H HD2  . TYR A 1 50 ? -1.627  -7.308  5.117   1.00 0.00 ? 50 TYR A HD2  7  
ATOM 8955  H HE1  . TYR A 1 50 ? -5.455  -9.092  2.596   1.00 0.00 ? 50 TYR A HE1  7  
ATOM 8956  H HE2  . TYR A 1 50 ? -1.513  -9.568  4.160   1.00 0.00 ? 50 TYR A HE2  7  
ATOM 8957  H HH   . TYR A 1 50 ? -3.110  -10.682 1.875   1.00 0.00 ? 50 TYR A HH   7  
ATOM 8958  N N    . ILE A 1 51 ? -2.248  -4.932  7.577   1.00 0.00 ? 51 ILE A N    7  
ATOM 8959  C CA   . ILE A 1 51 ? -1.169  -5.134  8.526   1.00 0.00 ? 51 ILE A CA   7  
ATOM 8960  C C    . ILE A 1 51 ? -1.697  -5.103  9.950   1.00 0.00 ? 51 ILE A C    7  
ATOM 8961  O O    . ILE A 1 51 ? -1.204  -5.813  10.826  1.00 0.00 ? 51 ILE A O    7  
ATOM 8962  C CB   . ILE A 1 51 ? -0.051  -4.084  8.370   1.00 0.00 ? 51 ILE A CB   7  
ATOM 8963  C CG1  . ILE A 1 51 ? -0.594  -2.769  7.804   1.00 0.00 ? 51 ILE A CG1  7  
ATOM 8964  C CG2  . ILE A 1 51 ? 1.062   -4.625  7.485   1.00 0.00 ? 51 ILE A CG2  7  
ATOM 8965  C CD1  . ILE A 1 51 ? 0.324   -1.590  8.033   1.00 0.00 ? 51 ILE A CD1  7  
ATOM 8966  H H    . ILE A 1 51 ? -2.275  -4.113  7.048   1.00 0.00 ? 51 ILE A H    7  
ATOM 8967  H HA   . ILE A 1 51 ? -0.750  -6.106  8.338   1.00 0.00 ? 51 ILE A HA   7  
ATOM 8968  H HB   . ILE A 1 51 ? 0.359   -3.897  9.344   1.00 0.00 ? 51 ILE A HB   7  
ATOM 8969  H HG12 . ILE A 1 51 ? -0.738  -2.874  6.739   1.00 0.00 ? 51 ILE A HG12 7  
ATOM 8970  H HG13 . ILE A 1 51 ? -1.542  -2.548  8.271   1.00 0.00 ? 51 ILE A HG13 7  
ATOM 8971  H HG21 . ILE A 1 51 ? 0.666   -5.396  6.839   1.00 0.00 ? 51 ILE A HG21 7  
ATOM 8972  H HG22 . ILE A 1 51 ? 1.844   -5.041  8.104   1.00 0.00 ? 51 ILE A HG22 7  
ATOM 8973  H HG23 . ILE A 1 51 ? 1.466   -3.825  6.884   1.00 0.00 ? 51 ILE A HG23 7  
ATOM 8974  H HD11 . ILE A 1 51 ? 1.335   -1.864  7.772   1.00 0.00 ? 51 ILE A HD11 7  
ATOM 8975  H HD12 . ILE A 1 51 ? 0.287   -1.301  9.073   1.00 0.00 ? 51 ILE A HD12 7  
ATOM 8976  H HD13 . ILE A 1 51 ? 0.006   -0.761  7.418   1.00 0.00 ? 51 ILE A HD13 7  
ATOM 8977  N N    . LYS A 1 52 ? -2.712  -4.283  10.170  1.00 0.00 ? 52 LYS A N    7  
ATOM 8978  C CA   . LYS A 1 52 ? -3.324  -4.162  11.482  1.00 0.00 ? 52 LYS A CA   7  
ATOM 8979  C C    . LYS A 1 52 ? -4.212  -5.366  11.775  1.00 0.00 ? 52 LYS A C    7  
ATOM 8980  O O    . LYS A 1 52 ? -4.455  -5.704  12.933  1.00 0.00 ? 52 LYS A O    7  
ATOM 8981  C CB   . LYS A 1 52 ? -4.138  -2.870  11.579  1.00 0.00 ? 52 LYS A CB   7  
ATOM 8982  C CG   . LYS A 1 52 ? -4.276  -2.341  12.997  1.00 0.00 ? 52 LYS A CG   7  
ATOM 8983  C CD   . LYS A 1 52 ? -5.171  -3.233  13.841  1.00 0.00 ? 52 LYS A CD   7  
ATOM 8984  C CE   . LYS A 1 52 ? -5.941  -2.430  14.877  1.00 0.00 ? 52 LYS A CE   7  
ATOM 8985  N NZ   . LYS A 1 52 ? -7.261  -1.976  14.358  1.00 0.00 ? 52 LYS A NZ   7  
ATOM 8986  H H    . LYS A 1 52 ? -3.061  -3.753  9.429   1.00 0.00 ? 52 LYS A H    7  
ATOM 8987  H HA   . LYS A 1 52 ? -2.532  -4.132  12.207  1.00 0.00 ? 52 LYS A HA   7  
ATOM 8988  H HB2  . LYS A 1 52 ? -3.658  -2.110  10.981  1.00 0.00 ? 52 LYS A HB2  7  
ATOM 8989  H HB3  . LYS A 1 52 ? -5.128  -3.052  11.188  1.00 0.00 ? 52 LYS A HB3  7  
ATOM 8990  H HG2  . LYS A 1 52 ? -3.297  -2.298  13.451  1.00 0.00 ? 52 LYS A HG2  7  
ATOM 8991  H HG3  . LYS A 1 52 ? -4.702  -1.349  12.961  1.00 0.00 ? 52 LYS A HG3  7  
ATOM 8992  H HD2  . LYS A 1 52 ? -5.874  -3.736  13.194  1.00 0.00 ? 52 LYS A HD2  7  
ATOM 8993  H HD3  . LYS A 1 52 ? -4.558  -3.964  14.347  1.00 0.00 ? 52 LYS A HD3  7  
ATOM 8994  H HE2  . LYS A 1 52 ? -6.100  -3.048  15.747  1.00 0.00 ? 52 LYS A HE2  7  
ATOM 8995  H HE3  . LYS A 1 52 ? -5.354  -1.566  15.152  1.00 0.00 ? 52 LYS A HE3  7  
ATOM 8996  H HZ1  . LYS A 1 52 ? -7.546  -1.095  14.831  1.00 0.00 ? 52 LYS A HZ1  7  
ATOM 8997  H HZ2  . LYS A 1 52 ? -7.984  -2.701  14.536  1.00 0.00 ? 52 LYS A HZ2  7  
ATOM 8998  H HZ3  . LYS A 1 52 ? -7.203  -1.804  13.334  1.00 0.00 ? 52 LYS A HZ3  7  
ATOM 8999  N N    . LEU A 1 53 ? -4.692  -6.010  10.717  1.00 0.00 ? 53 LEU A N    7  
ATOM 9000  C CA   . LEU A 1 53 ? -5.552  -7.173  10.860  1.00 0.00 ? 53 LEU A CA   7  
ATOM 9001  C C    . LEU A 1 53 ? -4.736  -8.435  11.121  1.00 0.00 ? 53 LEU A C    7  
ATOM 9002  O O    . LEU A 1 53 ? -5.229  -9.391  11.719  1.00 0.00 ? 53 LEU A O    7  
ATOM 9003  C CB   . LEU A 1 53 ? -6.411  -7.356  9.607   1.00 0.00 ? 53 LEU A CB   7  
ATOM 9004  C CG   . LEU A 1 53 ? -7.319  -8.587  9.618   1.00 0.00 ? 53 LEU A CG   7  
ATOM 9005  C CD1  . LEU A 1 53 ? -8.605  -8.308  8.855   1.00 0.00 ? 53 LEU A CD1  7  
ATOM 9006  C CD2  . LEU A 1 53 ? -6.596  -9.788  9.026   1.00 0.00 ? 53 LEU A CD2  7  
ATOM 9007  H H    . LEU A 1 53 ? -4.466  -5.695  9.821   1.00 0.00 ? 53 LEU A H    7  
ATOM 9008  H HA   . LEU A 1 53 ? -6.194  -6.997  11.700  1.00 0.00 ? 53 LEU A HA   7  
ATOM 9009  H HB2  . LEU A 1 53 ? -7.030  -6.478  9.489   1.00 0.00 ? 53 LEU A HB2  7  
ATOM 9010  H HB3  . LEU A 1 53 ? -5.754  -7.430  8.753   1.00 0.00 ? 53 LEU A HB3  7  
ATOM 9011  H HG   . LEU A 1 53 ? -7.583  -8.823  10.639  1.00 0.00 ? 53 LEU A HG   7  
ATOM 9012  H HD11 . LEU A 1 53 ? -9.363  -7.962  9.541   1.00 0.00 ? 53 LEU A HD11 7  
ATOM 9013  H HD12 . LEU A 1 53 ? -8.941  -9.214  8.372   1.00 0.00 ? 53 LEU A HD12 7  
ATOM 9014  H HD13 . LEU A 1 53 ? -8.422  -7.549  8.108   1.00 0.00 ? 53 LEU A HD13 7  
ATOM 9015  H HD21 . LEU A 1 53 ? -6.894  -9.916  7.996   1.00 0.00 ? 53 LEU A HD21 7  
ATOM 9016  H HD22 . LEU A 1 53 ? -6.852  -10.674 9.587   1.00 0.00 ? 53 LEU A HD22 7  
ATOM 9017  H HD23 . LEU A 1 53 ? -5.530  -9.626  9.075   1.00 0.00 ? 53 LEU A HD23 7  
ATOM 9018  N N    . ARG A 1 54 ? -3.490  -8.433  10.663  1.00 0.00 ? 54 ARG A N    7  
ATOM 9019  C CA   . ARG A 1 54 ? -2.612  -9.578  10.840  1.00 0.00 ? 54 ARG A CA   7  
ATOM 9020  C C    . ARG A 1 54 ? -1.505  -9.286  11.844  1.00 0.00 ? 54 ARG A C    7  
ATOM 9021  O O    . ARG A 1 54 ? -1.372  -9.969  12.859  1.00 0.00 ? 54 ARG A O    7  
ATOM 9022  C CB   . ARG A 1 54 ? -2.003  -9.992  9.499   1.00 0.00 ? 54 ARG A CB   7  
ATOM 9023  C CG   . ARG A 1 54 ? -1.777  -11.489 9.371   1.00 0.00 ? 54 ARG A CG   7  
ATOM 9024  C CD   . ARG A 1 54 ? -1.373  -11.872 7.957   1.00 0.00 ? 54 ARG A CD   7  
ATOM 9025  N NE   . ARG A 1 54 ? -2.511  -12.342 7.170   1.00 0.00 ? 54 ARG A NE   7  
ATOM 9026  C CZ   . ARG A 1 54 ? -3.028  -13.564 7.271   1.00 0.00 ? 54 ARG A CZ   7  
ATOM 9027  N NH1  . ARG A 1 54 ? -2.514  -14.442 8.124   1.00 0.00 ? 54 ARG A NH1  7  
ATOM 9028  N NH2  . ARG A 1 54 ? -4.064  -13.909 6.519   1.00 0.00 ? 54 ARG A NH2  7  
ATOM 9029  H H    . ARG A 1 54 ? -3.159  -7.651  10.193  1.00 0.00 ? 54 ARG A H    7  
ATOM 9030  H HA   . ARG A 1 54 ? -3.205  -10.378 11.213  1.00 0.00 ? 54 ARG A HA   7  
ATOM 9031  H HB2  . ARG A 1 54 ? -2.666  -9.681  8.705   1.00 0.00 ? 54 ARG A HB2  7  
ATOM 9032  H HB3  . ARG A 1 54 ? -1.052  -9.494  9.379   1.00 0.00 ? 54 ARG A HB3  7  
ATOM 9033  H HG2  . ARG A 1 54 ? -0.992  -11.785 10.051  1.00 0.00 ? 54 ARG A HG2  7  
ATOM 9034  H HG3  . ARG A 1 54 ? -2.691  -12.005 9.628   1.00 0.00 ? 54 ARG A HG3  7  
ATOM 9035  H HD2  . ARG A 1 54 ? -0.945  -11.008 7.472   1.00 0.00 ? 54 ARG A HD2  7  
ATOM 9036  H HD3  . ARG A 1 54 ? -0.633  -12.658 8.008   1.00 0.00 ? 54 ARG A HD3  7  
ATOM 9037  H HE   . ARG A 1 54 ? -2.910  -11.713 6.533   1.00 0.00 ? 54 ARG A HE   7  
ATOM 9038  H HH11 . ARG A 1 54 ? -1.733  -14.188 8.694   1.00 0.00 ? 54 ARG A HH11 7  
ATOM 9039  H HH12 . ARG A 1 54 ? -2.907  -15.358 8.195   1.00 0.00 ? 54 ARG A HH12 7  
ATOM 9040  H HH21 . ARG A 1 54 ? -4.456  -13.252 5.875   1.00 0.00 ? 54 ARG A HH21 7  
ATOM 9041  H HH22 . ARG A 1 54 ? -4.453  -14.827 6.595   1.00 0.00 ? 54 ARG A HH22 7  
ATOM 9042  N N    . THR A 1 55 ? -0.710  -8.276  11.541  1.00 0.00 ? 55 THR A N    7  
ATOM 9043  C CA   . THR A 1 55 ? 0.402   -7.886  12.397  1.00 0.00 ? 55 THR A CA   7  
ATOM 9044  C C    . THR A 1 55 ? -0.072  -7.071  13.592  1.00 0.00 ? 55 THR A C    7  
ATOM 9045  O O    . THR A 1 55 ? -0.006  -7.522  14.735  1.00 0.00 ? 55 THR A O    7  
ATOM 9046  C CB   . THR A 1 55 ? 1.439   -7.092  11.597  1.00 0.00 ? 55 THR A CB   7  
ATOM 9047  O OG1  . THR A 1 55 ? 0.976   -6.836  10.283  1.00 0.00 ? 55 THR A OG1  7  
ATOM 9048  C CG2  . THR A 1 55 ? 2.773   -7.798  11.483  1.00 0.00 ? 55 THR A CG2  7  
ATOM 9049  H H    . THR A 1 55 ? -0.871  -7.788  10.714  1.00 0.00 ? 55 THR A H    7  
ATOM 9050  H HA   . THR A 1 55 ? 0.859   -8.780  12.757  1.00 0.00 ? 55 THR A HA   7  
ATOM 9051  H HB   . THR A 1 55 ? 1.608   -6.145  12.088  1.00 0.00 ? 55 THR A HB   7  
ATOM 9052  H HG1  . THR A 1 55 ? 0.910   -7.663  9.800   1.00 0.00 ? 55 THR A HG1  7  
ATOM 9053  H HG21 . THR A 1 55 ? 2.670   -8.662  10.844  1.00 0.00 ? 55 THR A HG21 7  
ATOM 9054  H HG22 . THR A 1 55 ? 3.099   -8.112  12.464  1.00 0.00 ? 55 THR A HG22 7  
ATOM 9055  H HG23 . THR A 1 55 ? 3.502   -7.122  11.061  1.00 0.00 ? 55 THR A HG23 7  
ATOM 9056  N N    . GLY A 1 56 ? -0.539  -5.869  13.312  1.00 0.00 ? 56 GLY A N    7  
ATOM 9057  C CA   . GLY A 1 56 ? -1.013  -4.989  14.355  1.00 0.00 ? 56 GLY A CA   7  
ATOM 9058  C C    . GLY A 1 56 ? -0.058  -3.840  14.630  1.00 0.00 ? 56 GLY A C    7  
ATOM 9059  O O    . GLY A 1 56 ? -0.401  -2.897  15.344  1.00 0.00 ? 56 GLY A O    7  
ATOM 9060  H H    . GLY A 1 56 ? -0.557  -5.577  12.389  1.00 0.00 ? 56 GLY A H    7  
ATOM 9061  H HA2  . GLY A 1 56 ? -1.972  -4.586  14.064  1.00 0.00 ? 56 GLY A HA2  7  
ATOM 9062  H HA3  . GLY A 1 56 ? -1.135  -5.563  15.253  1.00 0.00 ? 56 GLY A HA3  7  
ATOM 9063  N N    . LYS A 1 57 ? 1.142   -3.918  14.061  1.00 0.00 ? 57 LYS A N    7  
ATOM 9064  C CA   . LYS A 1 57 ? 2.149   -2.881  14.243  1.00 0.00 ? 57 LYS A CA   7  
ATOM 9065  C C    . LYS A 1 57 ? 1.766   -1.613  13.487  1.00 0.00 ? 57 LYS A C    7  
ATOM 9066  O O    . LYS A 1 57 ? 0.650   -1.495  12.980  1.00 0.00 ? 57 LYS A O    7  
ATOM 9067  C CB   . LYS A 1 57 ? 3.514   -3.381  13.777  1.00 0.00 ? 57 LYS A CB   7  
ATOM 9068  C CG   . LYS A 1 57 ? 4.551   -3.440  14.887  1.00 0.00 ? 57 LYS A CG   7  
ATOM 9069  C CD   . LYS A 1 57 ? 4.259   -4.569  15.862  1.00 0.00 ? 57 LYS A CD   7  
ATOM 9070  C CE   . LYS A 1 57 ? 5.538   -5.244  16.331  1.00 0.00 ? 57 LYS A CE   7  
ATOM 9071  N NZ   . LYS A 1 57 ? 5.822   -6.489  15.565  1.00 0.00 ? 57 LYS A NZ   7  
ATOM 9072  H H    . LYS A 1 57 ? 1.357   -4.691  13.504  1.00 0.00 ? 57 LYS A H    7  
ATOM 9073  H HA   . LYS A 1 57 ? 2.202   -2.658  15.292  1.00 0.00 ? 57 LYS A HA   7  
ATOM 9074  H HB2  . LYS A 1 57 ? 3.399   -4.372  13.369  1.00 0.00 ? 57 LYS A HB2  7  
ATOM 9075  H HB3  . LYS A 1 57 ? 3.882   -2.723  13.006  1.00 0.00 ? 57 LYS A HB3  7  
ATOM 9076  H HG2  . LYS A 1 57 ? 5.525   -3.600  14.449  1.00 0.00 ? 57 LYS A HG2  7  
ATOM 9077  H HG3  . LYS A 1 57 ? 4.545   -2.502  15.423  1.00 0.00 ? 57 LYS A HG3  7  
ATOM 9078  H HD2  . LYS A 1 57 ? 3.741   -4.166  16.720  1.00 0.00 ? 57 LYS A HD2  7  
ATOM 9079  H HD3  . LYS A 1 57 ? 3.634   -5.301  15.373  1.00 0.00 ? 57 LYS A HD3  7  
ATOM 9080  H HE2  . LYS A 1 57 ? 6.361   -4.558  16.202  1.00 0.00 ? 57 LYS A HE2  7  
ATOM 9081  H HE3  . LYS A 1 57 ? 5.436   -5.491  17.378  1.00 0.00 ? 57 LYS A HE3  7  
ATOM 9082  H HZ1  . LYS A 1 57 ? 6.274   -7.193  16.183  1.00 0.00 ? 57 LYS A HZ1  7  
ATOM 9083  H HZ2  . LYS A 1 57 ? 6.459   -6.282  14.770  1.00 0.00 ? 57 LYS A HZ2  7  
ATOM 9084  H HZ3  . LYS A 1 57 ? 4.937   -6.889  15.191  1.00 0.00 ? 57 LYS A HZ3  7  
ATOM 9085  N N    . THR A 1 58 ? 2.697   -0.664  13.416  1.00 0.00 ? 58 THR A N    7  
ATOM 9086  C CA   . THR A 1 58 ? 2.456   0.600   12.722  1.00 0.00 ? 58 THR A CA   7  
ATOM 9087  C C    . THR A 1 58 ? 1.827   0.358   11.352  1.00 0.00 ? 58 THR A C    7  
ATOM 9088  O O    . THR A 1 58 ? 1.773   -0.777  10.878  1.00 0.00 ? 58 THR A O    7  
ATOM 9089  C CB   . THR A 1 58 ? 3.766   1.375   12.567  1.00 0.00 ? 58 THR A CB   7  
ATOM 9090  O OG1  . THR A 1 58 ? 3.529   2.659   12.015  1.00 0.00 ? 58 THR A OG1  7  
ATOM 9091  C CG2  . THR A 1 58 ? 4.778   0.673   11.684  1.00 0.00 ? 58 THR A CG2  7  
ATOM 9092  H H    . THR A 1 58 ? 3.567   -0.816  13.842  1.00 0.00 ? 58 THR A H    7  
ATOM 9093  H HA   . THR A 1 58 ? 1.772   1.182   13.321  1.00 0.00 ? 58 THR A HA   7  
ATOM 9094  H HB   . THR A 1 58 ? 4.213   1.504   13.542  1.00 0.00 ? 58 THR A HB   7  
ATOM 9095  H HG1  . THR A 1 58 ? 3.385   2.582   11.068  1.00 0.00 ? 58 THR A HG1  7  
ATOM 9096  H HG21 . THR A 1 58 ? 4.578   -0.388  11.680  1.00 0.00 ? 58 THR A HG21 7  
ATOM 9097  H HG22 . THR A 1 58 ? 5.773   0.850   12.066  1.00 0.00 ? 58 THR A HG22 7  
ATOM 9098  H HG23 . THR A 1 58 ? 4.705   1.058   10.677  1.00 0.00 ? 58 THR A HG23 7  
ATOM 9099  N N    . ARG A 1 59 ? 1.361   1.429   10.716  1.00 0.00 ? 59 ARG A N    7  
ATOM 9100  C CA   . ARG A 1 59 ? 0.747   1.330   9.406   1.00 0.00 ? 59 ARG A CA   7  
ATOM 9101  C C    . ARG A 1 59 ? 0.889   2.647   8.657   1.00 0.00 ? 59 ARG A C    7  
ATOM 9102  O O    . ARG A 1 59 ? -0.096  3.334   8.384   1.00 0.00 ? 59 ARG A O    7  
ATOM 9103  C CB   . ARG A 1 59 ? -0.740  0.961   9.519   1.00 0.00 ? 59 ARG A CB   7  
ATOM 9104  C CG   . ARG A 1 59 ? -1.092  0.118   10.737  1.00 0.00 ? 59 ARG A CG   7  
ATOM 9105  C CD   . ARG A 1 59 ? -1.103  0.948   12.012  1.00 0.00 ? 59 ARG A CD   7  
ATOM 9106  N NE   . ARG A 1 59 ? -2.349  0.788   12.758  1.00 0.00 ? 59 ARG A NE   7  
ATOM 9107  C CZ   . ARG A 1 59 ? -3.480  1.423   12.459  1.00 0.00 ? 59 ARG A CZ   7  
ATOM 9108  N NH1  . ARG A 1 59 ? -3.528  2.262   11.431  1.00 0.00 ? 59 ARG A NH1  7  
ATOM 9109  N NH2  . ARG A 1 59 ? -4.568  1.219   13.190  1.00 0.00 ? 59 ARG A NH2  7  
ATOM 9110  H H    . ARG A 1 59 ? 1.446   2.306   11.128  1.00 0.00 ? 59 ARG A H    7  
ATOM 9111  H HA   . ARG A 1 59 ? 1.263   0.560   8.860   1.00 0.00 ? 59 ARG A HA   7  
ATOM 9112  H HB2  . ARG A 1 59 ? -1.318  1.871   9.565   1.00 0.00 ? 59 ARG A HB2  7  
ATOM 9113  H HB3  . ARG A 1 59 ? -1.028  0.412   8.635   1.00 0.00 ? 59 ARG A HB3  7  
ATOM 9114  H HG2  . ARG A 1 59 ? -2.072  -0.310  10.593  1.00 0.00 ? 59 ARG A HG2  7  
ATOM 9115  H HG3  . ARG A 1 59 ? -0.366  -0.674  10.839  1.00 0.00 ? 59 ARG A HG3  7  
ATOM 9116  H HD2  . ARG A 1 59 ? -0.280  0.636   12.637  1.00 0.00 ? 59 ARG A HD2  7  
ATOM 9117  H HD3  . ARG A 1 59 ? -0.981  1.989   11.751  1.00 0.00 ? 59 ARG A HD3  7  
ATOM 9118  H HE   . ARG A 1 59 ? -2.343  0.175   13.523  1.00 0.00 ? 59 ARG A HE   7  
ATOM 9119  H HH11 . ARG A 1 59 ? -2.712  2.420   10.876  1.00 0.00 ? 59 ARG A HH11 7  
ATOM 9120  H HH12 . ARG A 1 59 ? -4.381  2.735   11.212  1.00 0.00 ? 59 ARG A HH12 7  
ATOM 9121  H HH21 . ARG A 1 59 ? -4.538  0.589   13.965  1.00 0.00 ? 59 ARG A HH21 7  
ATOM 9122  H HH22 . ARG A 1 59 ? -5.418  1.696   12.966  1.00 0.00 ? 59 ARG A HH22 7  
ATOM 9123  N N    . THR A 1 60 ? 2.124   2.985   8.319   1.00 0.00 ? 60 THR A N    7  
ATOM 9124  C CA   . THR A 1 60 ? 2.409   4.216   7.589   1.00 0.00 ? 60 THR A CA   7  
ATOM 9125  C C    . THR A 1 60 ? 1.583   4.279   6.306   1.00 0.00 ? 60 THR A C    7  
ATOM 9126  O O    . THR A 1 60 ? 1.251   3.246   5.725   1.00 0.00 ? 60 THR A O    7  
ATOM 9127  C CB   . THR A 1 60 ? 3.900   4.305   7.257   1.00 0.00 ? 60 THR A CB   7  
ATOM 9128  O OG1  . THR A 1 60 ? 4.202   5.542   6.634   1.00 0.00 ? 60 THR A OG1  7  
ATOM 9129  C CG2  . THR A 1 60 ? 4.376   3.201   6.338   1.00 0.00 ? 60 THR A CG2  7  
ATOM 9130  H H    . THR A 1 60 ? 2.860   2.392   8.571   1.00 0.00 ? 60 THR A H    7  
ATOM 9131  H HA   . THR A 1 60 ? 2.138   5.048   8.221   1.00 0.00 ? 60 THR A HA   7  
ATOM 9132  H HB   . THR A 1 60 ? 4.467   4.240   8.174   1.00 0.00 ? 60 THR A HB   7  
ATOM 9133  H HG1  . THR A 1 60 ? 4.658   6.111   7.258   1.00 0.00 ? 60 THR A HG1  7  
ATOM 9134  H HG21 . THR A 1 60 ? 5.415   2.987   6.541   1.00 0.00 ? 60 THR A HG21 7  
ATOM 9135  H HG22 . THR A 1 60 ? 4.266   3.515   5.311   1.00 0.00 ? 60 THR A HG22 7  
ATOM 9136  H HG23 . THR A 1 60 ? 3.786   2.312   6.508   1.00 0.00 ? 60 THR A HG23 7  
ATOM 9137  N N    . ARG A 1 61 ? 1.244   5.488   5.872   1.00 0.00 ? 61 ARG A N    7  
ATOM 9138  C CA   . ARG A 1 61 ? 0.452   5.667   4.668   1.00 0.00 ? 61 ARG A CA   7  
ATOM 9139  C C    . ARG A 1 61 ? 1.276   6.280   3.545   1.00 0.00 ? 61 ARG A C    7  
ATOM 9140  O O    . ARG A 1 61 ? 1.041   6.010   2.367   1.00 0.00 ? 61 ARG A O    7  
ATOM 9141  C CB   . ARG A 1 61 ? -0.771  6.539   4.957   1.00 0.00 ? 61 ARG A CB   7  
ATOM 9142  C CG   . ARG A 1 61 ? -1.819  5.851   5.816   1.00 0.00 ? 61 ARG A CG   7  
ATOM 9143  C CD   . ARG A 1 61 ? -2.506  6.833   6.751   1.00 0.00 ? 61 ARG A CD   7  
ATOM 9144  N NE   . ARG A 1 61 ? -3.913  6.500   6.957   1.00 0.00 ? 61 ARG A NE   7  
ATOM 9145  C CZ   . ARG A 1 61 ? -4.878  6.784   6.085   1.00 0.00 ? 61 ARG A CZ   7  
ATOM 9146  N NH1  . ARG A 1 61 ? -4.592  7.405   4.947   1.00 0.00 ? 61 ARG A NH1  7  
ATOM 9147  N NH2  . ARG A 1 61 ? -6.132  6.446   6.351   1.00 0.00 ? 61 ARG A NH2  7  
ATOM 9148  H H    . ARG A 1 61 ? 1.527   6.273   6.373   1.00 0.00 ? 61 ARG A H    7  
ATOM 9149  H HA   . ARG A 1 61 ? 0.124   4.698   4.359   1.00 0.00 ? 61 ARG A HA   7  
ATOM 9150  H HB2  . ARG A 1 61 ? -0.448  7.433   5.469   1.00 0.00 ? 61 ARG A HB2  7  
ATOM 9151  H HB3  . ARG A 1 61 ? -1.230  6.817   4.020   1.00 0.00 ? 61 ARG A HB3  7  
ATOM 9152  H HG2  . ARG A 1 61 ? -2.562  5.404   5.172   1.00 0.00 ? 61 ARG A HG2  7  
ATOM 9153  H HG3  . ARG A 1 61 ? -1.340  5.082   6.404   1.00 0.00 ? 61 ARG A HG3  7  
ATOM 9154  H HD2  . ARG A 1 61 ? -1.999  6.817   7.704   1.00 0.00 ? 61 ARG A HD2  7  
ATOM 9155  H HD3  . ARG A 1 61 ? -2.438  7.823   6.324   1.00 0.00 ? 61 ARG A HD3  7  
ATOM 9156  H HE   . ARG A 1 61 ? -4.153  6.041   7.789   1.00 0.00 ? 61 ARG A HE   7  
ATOM 9157  H HH11 . ARG A 1 61 ? -3.648  7.663   4.740   1.00 0.00 ? 61 ARG A HH11 7  
ATOM 9158  H HH12 . ARG A 1 61 ? -5.321  7.616   4.296   1.00 0.00 ? 61 ARG A HH12 7  
ATOM 9159  H HH21 . ARG A 1 61 ? -6.353  5.978   7.206   1.00 0.00 ? 61 ARG A HH21 7  
ATOM 9160  H HH22 . ARG A 1 61 ? -6.857  6.660   5.696   1.00 0.00 ? 61 ARG A HH22 7  
ATOM 9161  N N    . LYS A 1 62 ? 2.236   7.110   3.918   1.00 0.00 ? 62 LYS A N    7  
ATOM 9162  C CA   . LYS A 1 62 ? 3.094   7.771   2.947   1.00 0.00 ? 62 LYS A CA   7  
ATOM 9163  C C    . LYS A 1 62 ? 4.104   6.800   2.354   1.00 0.00 ? 62 LYS A C    7  
ATOM 9164  O O    . LYS A 1 62 ? 4.459   6.895   1.179   1.00 0.00 ? 62 LYS A O    7  
ATOM 9165  C CB   . LYS A 1 62 ? 3.811   8.954   3.591   1.00 0.00 ? 62 LYS A CB   7  
ATOM 9166  C CG   . LYS A 1 62 ? 3.557   10.277  2.887   1.00 0.00 ? 62 LYS A CG   7  
ATOM 9167  C CD   . LYS A 1 62 ? 4.101   10.266  1.468   1.00 0.00 ? 62 LYS A CD   7  
ATOM 9168  C CE   . LYS A 1 62 ? 3.225   11.080  0.529   1.00 0.00 ? 62 LYS A CE   7  
ATOM 9169  N NZ   . LYS A 1 62 ? 3.451   12.543  0.687   1.00 0.00 ? 62 LYS A NZ   7  
ATOM 9170  H H    . LYS A 1 62 ? 2.368   7.285   4.869   1.00 0.00 ? 62 LYS A H    7  
ATOM 9171  H HA   . LYS A 1 62 ? 2.470   8.131   2.158   1.00 0.00 ? 62 LYS A HA   7  
ATOM 9172  H HB2  . LYS A 1 62 ? 3.481   9.046   4.615   1.00 0.00 ? 62 LYS A HB2  7  
ATOM 9173  H HB3  . LYS A 1 62 ? 4.870   8.764   3.580   1.00 0.00 ? 62 LYS A HB3  7  
ATOM 9174  H HG2  . LYS A 1 62 ? 2.493   10.457  2.852   1.00 0.00 ? 62 LYS A HG2  7  
ATOM 9175  H HG3  . LYS A 1 62 ? 4.039   11.068  3.442   1.00 0.00 ? 62 LYS A HG3  7  
ATOM 9176  H HD2  . LYS A 1 62 ? 5.095   10.686  1.470   1.00 0.00 ? 62 LYS A HD2  7  
ATOM 9177  H HD3  . LYS A 1 62 ? 4.140   9.246   1.116   1.00 0.00 ? 62 LYS A HD3  7  
ATOM 9178  H HE2  . LYS A 1 62 ? 3.450   10.798  -0.489  1.00 0.00 ? 62 LYS A HE2  7  
ATOM 9179  H HE3  . LYS A 1 62 ? 2.189   10.859  0.742   1.00 0.00 ? 62 LYS A HE3  7  
ATOM 9180  H HZ1  . LYS A 1 62 ? 3.831   12.746  1.633   1.00 0.00 ? 62 LYS A HZ1  7  
ATOM 9181  H HZ2  . LYS A 1 62 ? 2.556   13.058  0.567   1.00 0.00 ? 62 LYS A HZ2  7  
ATOM 9182  H HZ3  . LYS A 1 62 ? 4.129   12.879  -0.027  1.00 0.00 ? 62 LYS A HZ3  7  
ATOM 9183  N N    . GLN A 1 63 ? 4.558   5.867   3.173   1.00 0.00 ? 63 GLN A N    7  
ATOM 9184  C CA   . GLN A 1 63 ? 5.524   4.875   2.732   1.00 0.00 ? 63 GLN A CA   7  
ATOM 9185  C C    . GLN A 1 63 ? 4.846   3.797   1.901   1.00 0.00 ? 63 GLN A C    7  
ATOM 9186  O O    . GLN A 1 63 ? 5.456   3.209   1.008   1.00 0.00 ? 63 GLN A O    7  
ATOM 9187  C CB   . GLN A 1 63 ? 6.239   4.253   3.930   1.00 0.00 ? 63 GLN A CB   7  
ATOM 9188  C CG   . GLN A 1 63 ? 7.739   4.498   3.936   1.00 0.00 ? 63 GLN A CG   7  
ATOM 9189  C CD   . GLN A 1 63 ? 8.147   5.593   4.901   1.00 0.00 ? 63 GLN A CD   7  
ATOM 9190  O OE1  . GLN A 1 63 ? 7.367   6.499   5.196   1.00 0.00 ? 63 GLN A OE1  7  
ATOM 9191  N NE2  . GLN A 1 63 ? 9.376   5.516   5.399   1.00 0.00 ? 63 GLN A NE2  7  
ATOM 9192  H H    . GLN A 1 63 ? 4.235   5.845   4.092   1.00 0.00 ? 63 GLN A H    7  
ATOM 9193  H HA   . GLN A 1 63 ? 6.242   5.376   2.120   1.00 0.00 ? 63 GLN A HA   7  
ATOM 9194  H HB2  . GLN A 1 63 ? 5.825   4.669   4.834   1.00 0.00 ? 63 GLN A HB2  7  
ATOM 9195  H HB3  . GLN A 1 63 ? 6.070   3.188   3.922   1.00 0.00 ? 63 GLN A HB3  7  
ATOM 9196  H HG2  . GLN A 1 63 ? 8.239   3.584   4.221   1.00 0.00 ? 63 GLN A HG2  7  
ATOM 9197  H HG3  . GLN A 1 63 ? 8.049   4.781   2.940   1.00 0.00 ? 63 GLN A HG3  7  
ATOM 9198  H HE21 . GLN A 1 63 ? 9.942   4.767   5.120   1.00 0.00 ? 63 GLN A HE21 7  
ATOM 9199  H HE22 . GLN A 1 63 ? 9.666   6.211   6.026   1.00 0.00 ? 63 GLN A HE22 7  
ATOM 9200  N N    . VAL A 1 64 ? 3.579   3.549   2.195   1.00 0.00 ? 64 VAL A N    7  
ATOM 9201  C CA   . VAL A 1 64 ? 2.813   2.551   1.472   1.00 0.00 ? 64 VAL A CA   7  
ATOM 9202  C C    . VAL A 1 64 ? 2.305   3.106   0.148   1.00 0.00 ? 64 VAL A C    7  
ATOM 9203  O O    . VAL A 1 64 ? 1.960   2.349   -0.757  1.00 0.00 ? 64 VAL A O    7  
ATOM 9204  C CB   . VAL A 1 64 ? 1.617   2.041   2.295   1.00 0.00 ? 64 VAL A CB   7  
ATOM 9205  C CG1  . VAL A 1 64 ? 0.943   0.874   1.589   1.00 0.00 ? 64 VAL A CG1  7  
ATOM 9206  C CG2  . VAL A 1 64 ? 2.064   1.643   3.691   1.00 0.00 ? 64 VAL A CG2  7  
ATOM 9207  H H    . VAL A 1 64 ? 3.149   4.053   2.911   1.00 0.00 ? 64 VAL A H    7  
ATOM 9208  H HA   . VAL A 1 64 ? 3.466   1.721   1.274   1.00 0.00 ? 64 VAL A HA   7  
ATOM 9209  H HB   . VAL A 1 64 ? 0.898   2.843   2.384   1.00 0.00 ? 64 VAL A HB   7  
ATOM 9210  H HG11 . VAL A 1 64 ? 1.670   0.349   0.987   1.00 0.00 ? 64 VAL A HG11 7  
ATOM 9211  H HG12 . VAL A 1 64 ? 0.152   1.245   0.955   1.00 0.00 ? 64 VAL A HG12 7  
ATOM 9212  H HG13 . VAL A 1 64 ? 0.530   0.199   2.324   1.00 0.00 ? 64 VAL A HG13 7  
ATOM 9213  H HG21 . VAL A 1 64 ? 2.625   0.722   3.641   1.00 0.00 ? 64 VAL A HG21 7  
ATOM 9214  H HG22 . VAL A 1 64 ? 1.197   1.502   4.320   1.00 0.00 ? 64 VAL A HG22 7  
ATOM 9215  H HG23 . VAL A 1 64 ? 2.687   2.422   4.106   1.00 0.00 ? 64 VAL A HG23 7  
ATOM 9216  N N    . SER A 1 65 ? 2.271   4.430   0.034   1.00 0.00 ? 65 SER A N    7  
ATOM 9217  C CA   . SER A 1 65 ? 1.817   5.072   -1.185  1.00 0.00 ? 65 SER A CA   7  
ATOM 9218  C C    . SER A 1 65 ? 2.955   5.149   -2.185  1.00 0.00 ? 65 SER A C    7  
ATOM 9219  O O    . SER A 1 65 ? 2.749   5.076   -3.396  1.00 0.00 ? 65 SER A O    7  
ATOM 9220  C CB   . SER A 1 65 ? 1.274   6.472   -0.889  1.00 0.00 ? 65 SER A CB   7  
ATOM 9221  O OG   . SER A 1 65 ? 1.978   7.075   0.183   1.00 0.00 ? 65 SER A OG   7  
ATOM 9222  H H    . SER A 1 65 ? 2.569   4.985   0.779   1.00 0.00 ? 65 SER A H    7  
ATOM 9223  H HA   . SER A 1 65 ? 1.034   4.467   -1.598  1.00 0.00 ? 65 SER A HA   7  
ATOM 9224  H HB2  . SER A 1 65 ? 1.383   7.091   -1.767  1.00 0.00 ? 65 SER A HB2  7  
ATOM 9225  H HB3  . SER A 1 65 ? 0.230   6.402   -0.625  1.00 0.00 ? 65 SER A HB3  7  
ATOM 9226  H HG   . SER A 1 65 ? 2.007   8.026   0.052   1.00 0.00 ? 65 SER A HG   7  
ATOM 9227  N N    . SER A 1 66 ? 4.161   5.281   -1.657  1.00 0.00 ? 66 SER A N    7  
ATOM 9228  C CA   . SER A 1 66 ? 5.354   5.353   -2.477  1.00 0.00 ? 66 SER A CA   7  
ATOM 9229  C C    . SER A 1 66 ? 5.660   3.996   -3.088  1.00 0.00 ? 66 SER A C    7  
ATOM 9230  O O    . SER A 1 66 ? 6.146   3.899   -4.215  1.00 0.00 ? 66 SER A O    7  
ATOM 9231  C CB   . SER A 1 66 ? 6.528   5.823   -1.633  1.00 0.00 ? 66 SER A CB   7  
ATOM 9232  O OG   . SER A 1 66 ? 7.310   6.781   -2.326  1.00 0.00 ? 66 SER A OG   7  
ATOM 9233  H H    . SER A 1 66 ? 4.252   5.321   -0.684  1.00 0.00 ? 66 SER A H    7  
ATOM 9234  H HA   . SER A 1 66 ? 5.180   6.056   -3.259  1.00 0.00 ? 66 SER A HA   7  
ATOM 9235  H HB2  . SER A 1 66 ? 6.157   6.266   -0.723  1.00 0.00 ? 66 SER A HB2  7  
ATOM 9236  H HB3  . SER A 1 66 ? 7.142   4.978   -1.394  1.00 0.00 ? 66 SER A HB3  7  
ATOM 9237  H HG   . SER A 1 66 ? 7.232   7.633   -1.891  1.00 0.00 ? 66 SER A HG   7  
ATOM 9238  N N    . HIS A 1 67 ? 5.370   2.954   -2.328  1.00 0.00 ? 67 HIS A N    7  
ATOM 9239  C CA   . HIS A 1 67 ? 5.607   1.589   -2.774  1.00 0.00 ? 67 HIS A CA   7  
ATOM 9240  C C    . HIS A 1 67 ? 4.670   1.212   -3.912  1.00 0.00 ? 67 HIS A C    7  
ATOM 9241  O O    . HIS A 1 67 ? 5.050   0.483   -4.828  1.00 0.00 ? 67 HIS A O    7  
ATOM 9242  C CB   . HIS A 1 67 ? 5.442   0.609   -1.611  1.00 0.00 ? 67 HIS A CB   7  
ATOM 9243  C CG   . HIS A 1 67 ? 6.125   -0.704  -1.837  1.00 0.00 ? 67 HIS A CG   7  
ATOM 9244  N ND1  . HIS A 1 67 ? 7.000   -1.265  -0.930  1.00 0.00 ? 67 HIS A ND1  7  
ATOM 9245  C CD2  . HIS A 1 67 ? 6.058   -1.569  -2.877  1.00 0.00 ? 67 HIS A CD2  7  
ATOM 9246  C CE1  . HIS A 1 67 ? 7.442   -2.416  -1.403  1.00 0.00 ? 67 HIS A CE1  7  
ATOM 9247  N NE2  . HIS A 1 67 ? 6.886   -2.624  -2.582  1.00 0.00 ? 67 HIS A NE2  7  
ATOM 9248  H H    . HIS A 1 67 ? 4.988   3.110   -1.441  1.00 0.00 ? 67 HIS A H    7  
ATOM 9249  H HA   . HIS A 1 67 ? 6.616   1.537   -3.133  1.00 0.00 ? 67 HIS A HA   7  
ATOM 9250  H HB2  . HIS A 1 67 ? 5.856   1.049   -0.716  1.00 0.00 ? 67 HIS A HB2  7  
ATOM 9251  H HB3  . HIS A 1 67 ? 4.390   0.416   -1.458  1.00 0.00 ? 67 HIS A HB3  7  
ATOM 9252  H HD1  . HIS A 1 67 ? 7.258   -0.876  -0.069  1.00 0.00 ? 67 HIS A HD1  7  
ATOM 9253  H HD2  . HIS A 1 67 ? 5.461   -1.451  -3.771  1.00 0.00 ? 67 HIS A HD2  7  
ATOM 9254  H HE1  . HIS A 1 67 ? 8.140   -3.076  -0.909  1.00 0.00 ? 67 HIS A HE1  7  
ATOM 9255  H HE2  . HIS A 1 67 ? 7.107   -3.361  -3.189  1.00 0.00 ? 67 HIS A HE2  7  
ATOM 9256  N N    . ILE A 1 68 ? 3.446   1.714   -3.850  1.00 0.00 ? 68 ILE A N    7  
ATOM 9257  C CA   . ILE A 1 68 ? 2.457   1.432   -4.879  1.00 0.00 ? 68 ILE A CA   7  
ATOM 9258  C C    . ILE A 1 68 ? 2.792   2.170   -6.167  1.00 0.00 ? 68 ILE A C    7  
ATOM 9259  O O    . ILE A 1 68 ? 2.508   1.691   -7.264  1.00 0.00 ? 68 ILE A O    7  
ATOM 9260  C CB   . ILE A 1 68 ? 1.033   1.813   -4.429  1.00 0.00 ? 68 ILE A CB   7  
ATOM 9261  C CG1  . ILE A 1 68 ? 0.714   1.175   -3.077  1.00 0.00 ? 68 ILE A CG1  7  
ATOM 9262  C CG2  . ILE A 1 68 ? 0.010   1.384   -5.472  1.00 0.00 ? 68 ILE A CG2  7  
ATOM 9263  C CD1  . ILE A 1 68 ? -0.268  1.976   -2.251  1.00 0.00 ? 68 ILE A CD1  7  
ATOM 9264  H H    . ILE A 1 68 ? 3.207   2.289   -3.097  1.00 0.00 ? 68 ILE A H    7  
ATOM 9265  H HA   . ILE A 1 68 ? 2.481   0.376   -5.072  1.00 0.00 ? 68 ILE A HA   7  
ATOM 9266  H HB   . ILE A 1 68 ? 0.984   2.887   -4.333  1.00 0.00 ? 68 ILE A HB   7  
ATOM 9267  H HG12 . ILE A 1 68 ? 0.289   0.196   -3.239  1.00 0.00 ? 68 ILE A HG12 7  
ATOM 9268  H HG13 . ILE A 1 68 ? 1.627   1.077   -2.508  1.00 0.00 ? 68 ILE A HG13 7  
ATOM 9269  H HG21 . ILE A 1 68 ? -0.704  2.180   -5.625  1.00 0.00 ? 68 ILE A HG21 7  
ATOM 9270  H HG22 . ILE A 1 68 ? -0.507  0.499   -5.127  1.00 0.00 ? 68 ILE A HG22 7  
ATOM 9271  H HG23 . ILE A 1 68 ? 0.512   1.167   -6.403  1.00 0.00 ? 68 ILE A HG23 7  
ATOM 9272  H HD11 . ILE A 1 68 ? -0.085  3.031   -2.399  1.00 0.00 ? 68 ILE A HD11 7  
ATOM 9273  H HD12 . ILE A 1 68 ? -0.143  1.732   -1.207  1.00 0.00 ? 68 ILE A HD12 7  
ATOM 9274  H HD13 . ILE A 1 68 ? -1.275  1.739   -2.559  1.00 0.00 ? 68 ILE A HD13 7  
ATOM 9275  N N    . GLN A 1 69 ? 3.406   3.335   -6.022  1.00 0.00 ? 69 GLN A N    7  
ATOM 9276  C CA   . GLN A 1 69 ? 3.793   4.140   -7.169  1.00 0.00 ? 69 GLN A CA   7  
ATOM 9277  C C    . GLN A 1 69 ? 4.990   3.521   -7.879  1.00 0.00 ? 69 GLN A C    7  
ATOM 9278  O O    . GLN A 1 69 ? 5.179   3.706   -9.081  1.00 0.00 ? 69 GLN A O    7  
ATOM 9279  C CB   . GLN A 1 69 ? 4.118   5.570   -6.733  1.00 0.00 ? 69 GLN A CB   7  
ATOM 9280  C CG   . GLN A 1 69 ? 2.911   6.337   -6.218  1.00 0.00 ? 69 GLN A CG   7  
ATOM 9281  C CD   . GLN A 1 69 ? 2.816   7.735   -6.798  1.00 0.00 ? 69 GLN A CD   7  
ATOM 9282  O OE1  . GLN A 1 69 ? 3.353   8.012   -7.870  1.00 0.00 ? 69 GLN A OE1  7  
ATOM 9283  N NE2  . GLN A 1 69 ? 2.129   8.624   -6.090  1.00 0.00 ? 69 GLN A NE2  7  
ATOM 9284  H H    . GLN A 1 69 ? 3.610   3.655   -5.122  1.00 0.00 ? 69 GLN A H    7  
ATOM 9285  H HA   . GLN A 1 69 ? 2.961   4.159   -7.847  1.00 0.00 ? 69 GLN A HA   7  
ATOM 9286  H HB2  . GLN A 1 69 ? 4.858   5.535   -5.948  1.00 0.00 ? 69 GLN A HB2  7  
ATOM 9287  H HB3  . GLN A 1 69 ? 4.526   6.107   -7.577  1.00 0.00 ? 69 GLN A HB3  7  
ATOM 9288  H HG2  . GLN A 1 69 ? 2.016   5.793   -6.481  1.00 0.00 ? 69 GLN A HG2  7  
ATOM 9289  H HG3  . GLN A 1 69 ? 2.981   6.413   -5.143  1.00 0.00 ? 69 GLN A HG3  7  
ATOM 9290  H HE21 . GLN A 1 69 ? 1.728   8.332   -5.244  1.00 0.00 ? 69 GLN A HE21 7  
ATOM 9291  H HE22 . GLN A 1 69 ? 2.051   9.535   -6.441  1.00 0.00 ? 69 GLN A HE22 7  
ATOM 9292  N N    . VAL A 1 70 ? 5.790   2.778   -7.124  1.00 0.00 ? 70 VAL A N    7  
ATOM 9293  C CA   . VAL A 1 70 ? 6.964   2.119   -7.671  1.00 0.00 ? 70 VAL A CA   7  
ATOM 9294  C C    . VAL A 1 70 ? 6.570   0.924   -8.527  1.00 0.00 ? 70 VAL A C    7  
ATOM 9295  O O    . VAL A 1 70 ? 7.256   0.581   -9.490  1.00 0.00 ? 70 VAL A O    7  
ATOM 9296  C CB   . VAL A 1 70 ? 7.914   1.656   -6.560  1.00 0.00 ? 70 VAL A CB   7  
ATOM 9297  C CG1  . VAL A 1 70 ? 9.183   1.056   -7.146  1.00 0.00 ? 70 VAL A CG1  7  
ATOM 9298  C CG2  . VAL A 1 70 ? 8.240   2.806   -5.617  1.00 0.00 ? 70 VAL A CG2  7  
ATOM 9299  H H    . VAL A 1 70 ? 5.581   2.666   -6.177  1.00 0.00 ? 70 VAL A H    7  
ATOM 9300  H HA   . VAL A 1 70 ? 7.482   2.822   -8.277  1.00 0.00 ? 70 VAL A HA   7  
ATOM 9301  H HB   . VAL A 1 70 ? 7.411   0.896   -6.003  1.00 0.00 ? 70 VAL A HB   7  
ATOM 9302  H HG11 . VAL A 1 70 ? 9.340   1.445   -8.141  1.00 0.00 ? 70 VAL A HG11 7  
ATOM 9303  H HG12 . VAL A 1 70 ? 9.084   -0.019  -7.191  1.00 0.00 ? 70 VAL A HG12 7  
ATOM 9304  H HG13 . VAL A 1 70 ? 10.025  1.314   -6.521  1.00 0.00 ? 70 VAL A HG13 7  
ATOM 9305  H HG21 . VAL A 1 70 ? 8.032   2.507   -4.600  1.00 0.00 ? 70 VAL A HG21 7  
ATOM 9306  H HG22 . VAL A 1 70 ? 7.634   3.664   -5.870  1.00 0.00 ? 70 VAL A HG22 7  
ATOM 9307  H HG23 . VAL A 1 70 ? 9.284   3.064   -5.710  1.00 0.00 ? 70 VAL A HG23 7  
ATOM 9308  N N    . LEU A 1 71 ? 5.457   0.301   -8.170  1.00 0.00 ? 71 LEU A N    7  
ATOM 9309  C CA   . LEU A 1 71 ? 4.959   -0.853  -8.902  1.00 0.00 ? 71 LEU A CA   7  
ATOM 9310  C C    . LEU A 1 71 ? 4.405   -0.433  -10.258 1.00 0.00 ? 71 LEU A C    7  
ATOM 9311  O O    . LEU A 1 71 ? 4.405   -1.212  -11.211 1.00 0.00 ? 71 LEU A O    7  
ATOM 9312  C CB   . LEU A 1 71 ? 3.884   -1.575  -8.092  1.00 0.00 ? 71 LEU A CB   7  
ATOM 9313  C CG   . LEU A 1 71 ? 4.224   -3.016  -7.707  1.00 0.00 ? 71 LEU A CG   7  
ATOM 9314  C CD1  . LEU A 1 71 ? 5.049   -3.047  -6.430  1.00 0.00 ? 71 LEU A CD1  7  
ATOM 9315  C CD2  . LEU A 1 71 ? 2.953   -3.836  -7.543  1.00 0.00 ? 71 LEU A CD2  7  
ATOM 9316  H H    . LEU A 1 71 ? 4.958   0.627   -7.397  1.00 0.00 ? 71 LEU A H    7  
ATOM 9317  H HA   . LEU A 1 71 ? 5.782   -1.519  -9.058  1.00 0.00 ? 71 LEU A HA   7  
ATOM 9318  H HB2  . LEU A 1 71 ? 3.712   -1.014  -7.187  1.00 0.00 ? 71 LEU A HB2  7  
ATOM 9319  H HB3  . LEU A 1 71 ? 2.974   -1.586  -8.668  1.00 0.00 ? 71 LEU A HB3  7  
ATOM 9320  H HG   . LEU A 1 71 ? 4.812   -3.463  -8.495  1.00 0.00 ? 71 LEU A HG   7  
ATOM 9321  H HD11 . LEU A 1 71 ? 6.098   -2.981  -6.677  1.00 0.00 ? 71 LEU A HD11 7  
ATOM 9322  H HD12 . LEU A 1 71 ? 4.861   -3.970  -5.902  1.00 0.00 ? 71 LEU A HD12 7  
ATOM 9323  H HD13 . LEU A 1 71 ? 4.774   -2.212  -5.803  1.00 0.00 ? 71 LEU A HD13 7  
ATOM 9324  H HD21 . LEU A 1 71 ? 2.431   -3.517  -6.653  1.00 0.00 ? 71 LEU A HD21 7  
ATOM 9325  H HD22 . LEU A 1 71 ? 3.208   -4.882  -7.455  1.00 0.00 ? 71 LEU A HD22 7  
ATOM 9326  H HD23 . LEU A 1 71 ? 2.317   -3.692  -8.404  1.00 0.00 ? 71 LEU A HD23 7  
ATOM 9327  N N    . ALA A 1 72 ? 3.936   0.806   -10.335 1.00 0.00 ? 72 ALA A N    7  
ATOM 9328  C CA   . ALA A 1 72 ? 3.381   1.338   -11.569 1.00 0.00 ? 72 ALA A CA   7  
ATOM 9329  C C    . ALA A 1 72 ? 4.479   1.628   -12.584 1.00 0.00 ? 72 ALA A C    7  
ATOM 9330  O O    . ALA A 1 72 ? 4.253   1.578   -13.793 1.00 0.00 ? 72 ALA A O    7  
ATOM 9331  C CB   . ALA A 1 72 ? 2.571   2.594   -11.288 1.00 0.00 ? 72 ALA A CB   7  
ATOM 9332  H H    . ALA A 1 72 ? 3.966   1.375   -9.543  1.00 0.00 ? 72 ALA A H    7  
ATOM 9333  H HA   . ALA A 1 72 ? 2.721   0.596   -11.976 1.00 0.00 ? 72 ALA A HA   7  
ATOM 9334  H HB1  . ALA A 1 72 ? 1.831   2.383   -10.530 1.00 0.00 ? 72 ALA A HB1  7  
ATOM 9335  H HB2  . ALA A 1 72 ? 2.078   2.915   -12.193 1.00 0.00 ? 72 ALA A HB2  7  
ATOM 9336  H HB3  . ALA A 1 72 ? 3.229   3.377   -10.939 1.00 0.00 ? 72 ALA A HB3  7  
ATOM 9337  N N    . ARG A 1 73 ? 5.669   1.932   -12.082 1.00 0.00 ? 73 ARG A N    7  
ATOM 9338  C CA   . ARG A 1 73 ? 6.806   2.231   -12.939 1.00 0.00 ? 73 ARG A CA   7  
ATOM 9339  C C    . ARG A 1 73 ? 7.362   0.961   -13.567 1.00 0.00 ? 73 ARG A C    7  
ATOM 9340  O O    . ARG A 1 73 ? 7.890   0.983   -14.679 1.00 0.00 ? 73 ARG A O    7  
ATOM 9341  C CB   . ARG A 1 73 ? 7.900   2.947   -12.144 1.00 0.00 ? 73 ARG A CB   7  
ATOM 9342  C CG   . ARG A 1 73 ? 7.556   4.386   -11.796 1.00 0.00 ? 73 ARG A CG   7  
ATOM 9343  C CD   . ARG A 1 73 ? 8.789   5.163   -11.363 1.00 0.00 ? 73 ARG A CD   7  
ATOM 9344  N NE   . ARG A 1 73 ? 8.951   5.167   -9.911  1.00 0.00 ? 73 ARG A NE   7  
ATOM 9345  C CZ   . ARG A 1 73 ? 9.763   5.995   -9.258  1.00 0.00 ? 73 ARG A CZ   7  
ATOM 9346  N NH1  . ARG A 1 73 ? 10.488  6.886   -9.923  1.00 0.00 ? 73 ARG A NH1  7  
ATOM 9347  N NH2  . ARG A 1 73 ? 9.851   5.932   -7.937  1.00 0.00 ? 73 ARG A NH2  7  
ATOM 9348  H H    . ARG A 1 73 ? 5.783   1.956   -11.112 1.00 0.00 ? 73 ARG A H    7  
ATOM 9349  H HA   . ARG A 1 73 ? 6.460   2.878   -13.721 1.00 0.00 ? 73 ARG A HA   7  
ATOM 9350  H HB2  . ARG A 1 73 ? 8.072   2.407   -11.225 1.00 0.00 ? 73 ARG A HB2  7  
ATOM 9351  H HB3  . ARG A 1 73 ? 8.810   2.947   -12.727 1.00 0.00 ? 73 ARG A HB3  7  
ATOM 9352  H HG2  . ARG A 1 73 ? 7.128   4.864   -12.664 1.00 0.00 ? 73 ARG A HG2  7  
ATOM 9353  H HG3  . ARG A 1 73 ? 6.837   4.389   -10.990 1.00 0.00 ? 73 ARG A HG3  7  
ATOM 9354  H HD2  . ARG A 1 73 ? 9.660   4.711   -11.811 1.00 0.00 ? 73 ARG A HD2  7  
ATOM 9355  H HD3  . ARG A 1 73 ? 8.695   6.182   -11.708 1.00 0.00 ? 73 ARG A HD3  7  
ATOM 9356  H HE   . ARG A 1 73 ? 8.427   4.519   -9.395  1.00 0.00 ? 73 ARG A HE   7  
ATOM 9357  H HH11 . ARG A 1 73 ? 10.427  6.939   -10.920 1.00 0.00 ? 73 ARG A HH11 7  
ATOM 9358  H HH12 . ARG A 1 73 ? 11.097  7.506   -9.427  1.00 0.00 ? 73 ARG A HH12 7  
ATOM 9359  H HH21 . ARG A 1 73 ? 9.307   5.263   -7.431  1.00 0.00 ? 73 ARG A HH21 7  
ATOM 9360  H HH22 . ARG A 1 73 ? 10.462  6.554   -7.446  1.00 0.00 ? 73 ARG A HH22 7  
ATOM 9361  N N    . ARG A 1 74 ? 7.237   -0.144  -12.847 1.00 0.00 ? 74 ARG A N    7  
ATOM 9362  C CA   . ARG A 1 74 ? 7.722   -1.429  -13.325 1.00 0.00 ? 74 ARG A CA   7  
ATOM 9363  C C    . ARG A 1 74 ? 6.783   -2.006  -14.377 1.00 0.00 ? 74 ARG A C    7  
ATOM 9364  O O    . ARG A 1 74 ? 7.203   -2.755  -15.259 1.00 0.00 ? 74 ARG A O    7  
ATOM 9365  C CB   . ARG A 1 74 ? 7.872   -2.410  -12.161 1.00 0.00 ? 74 ARG A CB   7  
ATOM 9366  C CG   . ARG A 1 74 ? 9.107   -3.290  -12.262 1.00 0.00 ? 74 ARG A CG   7  
ATOM 9367  C CD   . ARG A 1 74 ? 8.774   -4.651  -12.852 1.00 0.00 ? 74 ARG A CD   7  
ATOM 9368  N NE   . ARG A 1 74 ? 9.549   -5.722  -12.230 1.00 0.00 ? 74 ARG A NE   7  
ATOM 9369  C CZ   . ARG A 1 74 ? 9.719   -6.926  -12.773 1.00 0.00 ? 74 ARG A CZ   7  
ATOM 9370  N NH1  . ARG A 1 74 ? 9.171   -7.216  -13.946 1.00 0.00 ? 74 ARG A NH1  7  
ATOM 9371  N NH2  . ARG A 1 74 ? 10.440  -7.842  -12.140 1.00 0.00 ? 74 ARG A NH2  7  
ATOM 9372  H H    . ARG A 1 74 ? 6.808   -0.092  -11.973 1.00 0.00 ? 74 ARG A H    7  
ATOM 9373  H HA   . ARG A 1 74 ? 8.684   -1.266  -13.772 1.00 0.00 ? 74 ARG A HA   7  
ATOM 9374  H HB2  . ARG A 1 74 ? 7.930   -1.850  -11.239 1.00 0.00 ? 74 ARG A HB2  7  
ATOM 9375  H HB3  . ARG A 1 74 ? 7.002   -3.049  -12.129 1.00 0.00 ? 74 ARG A HB3  7  
ATOM 9376  H HG2  . ARG A 1 74 ? 9.833   -2.803  -12.895 1.00 0.00 ? 74 ARG A HG2  7  
ATOM 9377  H HG3  . ARG A 1 74 ? 9.521   -3.427  -11.274 1.00 0.00 ? 74 ARG A HG3  7  
ATOM 9378  H HD2  . ARG A 1 74 ? 7.723   -4.847  -12.702 1.00 0.00 ? 74 ARG A HD2  7  
ATOM 9379  H HD3  . ARG A 1 74 ? 8.988   -4.633  -13.911 1.00 0.00 ? 74 ARG A HD3  7  
ATOM 9380  H HE   . ARG A 1 74 ? 9.965   -5.535  -11.363 1.00 0.00 ? 74 ARG A HE   7  
ATOM 9381  H HH11 . ARG A 1 74 ? 8.627   -6.530  -14.428 1.00 0.00 ? 74 ARG A HH11 7  
ATOM 9382  H HH12 . ARG A 1 74 ? 9.303   -8.122  -14.349 1.00 0.00 ? 74 ARG A HH12 7  
ATOM 9383  H HH21 . ARG A 1 74 ? 10.855  -7.628  -11.256 1.00 0.00 ? 74 ARG A HH21 7  
ATOM 9384  H HH22 . ARG A 1 74 ? 10.568  -8.746  -12.547 1.00 0.00 ? 74 ARG A HH22 7  
ATOM 9385  N N    . LYS A 1 75 ? 5.511   -1.649  -14.275 1.00 0.00 ? 75 LYS A N    7  
ATOM 9386  C CA   . LYS A 1 75 ? 4.503   -2.123  -15.210 1.00 0.00 ? 75 LYS A CA   7  
ATOM 9387  C C    . LYS A 1 75 ? 4.522   -1.312  -16.502 1.00 0.00 ? 75 LYS A C    7  
ATOM 9388  O O    . LYS A 1 75 ? 4.051   -1.772  -17.542 1.00 0.00 ? 75 LYS A O    7  
ATOM 9389  C CB   . LYS A 1 75 ? 3.114   -2.058  -14.573 1.00 0.00 ? 75 LYS A CB   7  
ATOM 9390  C CG   . LYS A 1 75 ? 2.887   -3.110  -13.500 1.00 0.00 ? 75 LYS A CG   7  
ATOM 9391  C CD   . LYS A 1 75 ? 1.444   -3.586  -13.482 1.00 0.00 ? 75 LYS A CD   7  
ATOM 9392  C CE   . LYS A 1 75 ? 1.345   -5.051  -13.092 1.00 0.00 ? 75 LYS A CE   7  
ATOM 9393  N NZ   . LYS A 1 75 ? 0.230   -5.741  -13.798 1.00 0.00 ? 75 LYS A NZ   7  
ATOM 9394  H H    . LYS A 1 75 ? 5.243   -1.053  -13.553 1.00 0.00 ? 75 LYS A H    7  
ATOM 9395  H HA   . LYS A 1 75 ? 4.734   -3.146  -15.441 1.00 0.00 ? 75 LYS A HA   7  
ATOM 9396  H HB2  . LYS A 1 75 ? 2.981   -1.084  -14.127 1.00 0.00 ? 75 LYS A HB2  7  
ATOM 9397  H HB3  . LYS A 1 75 ? 2.370   -2.196  -15.344 1.00 0.00 ? 75 LYS A HB3  7  
ATOM 9398  H HG2  . LYS A 1 75 ? 3.531   -3.954  -13.694 1.00 0.00 ? 75 LYS A HG2  7  
ATOM 9399  H HG3  . LYS A 1 75 ? 3.129   -2.684  -12.537 1.00 0.00 ? 75 LYS A HG3  7  
ATOM 9400  H HD2  . LYS A 1 75 ? 0.889   -2.996  -12.768 1.00 0.00 ? 75 LYS A HD2  7  
ATOM 9401  H HD3  . LYS A 1 75 ? 1.020   -3.455  -14.467 1.00 0.00 ? 75 LYS A HD3  7  
ATOM 9402  H HE2  . LYS A 1 75 ? 2.274   -5.541  -13.342 1.00 0.00 ? 75 LYS A HE2  7  
ATOM 9403  H HE3  . LYS A 1 75 ? 1.181   -5.117  -12.026 1.00 0.00 ? 75 LYS A HE3  7  
ATOM 9404  H HZ1  . LYS A 1 75 ? 0.388   -5.716  -14.825 1.00 0.00 ? 75 LYS A HZ1  7  
ATOM 9405  H HZ2  . LYS A 1 75 ? -0.673  -5.270  -13.586 1.00 0.00 ? 75 LYS A HZ2  7  
ATOM 9406  H HZ3  . LYS A 1 75 ? 0.171   -6.733  -13.490 1.00 0.00 ? 75 LYS A HZ3  7  
ATOM 9407  N N    . SER A 1 76 ? 5.068   -0.102  -16.430 1.00 0.00 ? 76 SER A N    7  
ATOM 9408  C CA   . SER A 1 76 ? 5.146   0.771   -17.596 1.00 0.00 ? 76 SER A CA   7  
ATOM 9409  C C    . SER A 1 76 ? 5.964   0.131   -18.712 1.00 0.00 ? 76 SER A C    7  
ATOM 9410  O O    . SER A 1 76 ? 5.850   0.516   -19.876 1.00 0.00 ? 76 SER A O    7  
ATOM 9411  C CB   . SER A 1 76 ? 5.752   2.122   -17.211 1.00 0.00 ? 76 SER A CB   7  
ATOM 9412  O OG   . SER A 1 76 ? 4.747   3.034   -16.803 1.00 0.00 ? 76 SER A OG   7  
ATOM 9413  H H    . SER A 1 76 ? 5.426   0.210   -15.574 1.00 0.00 ? 76 SER A H    7  
ATOM 9414  H HA   . SER A 1 76 ? 4.142   0.927   -17.955 1.00 0.00 ? 76 SER A HA   7  
ATOM 9415  H HB2  . SER A 1 76 ? 6.446   1.983   -16.395 1.00 0.00 ? 76 SER A HB2  7  
ATOM 9416  H HB3  . SER A 1 76 ? 6.273   2.535   -18.061 1.00 0.00 ? 76 SER A HB3  7  
ATOM 9417  H HG   . SER A 1 76 ? 4.877   3.263   -15.880 1.00 0.00 ? 76 SER A HG   7  
ATOM 9418  N N    . ARG A 1 77 ? 6.785   -0.850  -18.354 1.00 0.00 ? 77 ARG A N    7  
ATOM 9419  C CA   . ARG A 1 77 ? 7.613   -1.544  -19.332 1.00 0.00 ? 77 ARG A CA   7  
ATOM 9420  C C    . ARG A 1 77 ? 6.753   -2.267  -20.366 1.00 0.00 ? 77 ARG A C    7  
ATOM 9421  O O    . ARG A 1 77 ? 7.241   -2.658  -21.427 1.00 0.00 ? 77 ARG A O    7  
ATOM 9422  C CB   . ARG A 1 77 ? 8.536   -2.543  -18.631 1.00 0.00 ? 77 ARG A CB   7  
ATOM 9423  C CG   . ARG A 1 77 ? 9.374   -1.925  -17.524 1.00 0.00 ? 77 ARG A CG   7  
ATOM 9424  C CD   . ARG A 1 77 ? 10.378  -0.927  -18.076 1.00 0.00 ? 77 ARG A CD   7  
ATOM 9425  N NE   . ARG A 1 77 ? 11.708  -1.513  -18.224 1.00 0.00 ? 77 ARG A NE   7  
ATOM 9426  C CZ   . ARG A 1 77 ? 12.765  -0.848  -18.685 1.00 0.00 ? 77 ARG A CZ   7  
ATOM 9427  N NH1  . ARG A 1 77 ? 12.651  0.425   -19.044 1.00 0.00 ? 77 ARG A NH1  7  
ATOM 9428  N NH2  . ARG A 1 77 ? 13.938  -1.456  -18.788 1.00 0.00 ? 77 ARG A NH2  7  
ATOM 9429  H H    . ARG A 1 77 ? 6.831   -1.117  -17.414 1.00 0.00 ? 77 ARG A H    7  
ATOM 9430  H HA   . ARG A 1 77 ? 8.216   -0.805  -19.836 1.00 0.00 ? 77 ARG A HA   7  
ATOM 9431  H HB2  . ARG A 1 77 ? 7.934   -3.331  -18.201 1.00 0.00 ? 77 ARG A HB2  7  
ATOM 9432  H HB3  . ARG A 1 77 ? 9.205   -2.972  -19.363 1.00 0.00 ? 77 ARG A HB3  7  
ATOM 9433  H HG2  . ARG A 1 77 ? 8.720   -1.416  -16.832 1.00 0.00 ? 77 ARG A HG2  7  
ATOM 9434  H HG3  . ARG A 1 77 ? 9.906   -2.711  -17.007 1.00 0.00 ? 77 ARG A HG3  7  
ATOM 9435  H HD2  . ARG A 1 77 ? 10.036  -0.588  -19.042 1.00 0.00 ? 77 ARG A HD2  7  
ATOM 9436  H HD3  . ARG A 1 77 ? 10.439  -0.086  -17.401 1.00 0.00 ? 77 ARG A HD3  7  
ATOM 9437  H HE   . ARG A 1 77 ? 11.820  -2.452  -17.966 1.00 0.00 ? 77 ARG A HE   7  
ATOM 9438  H HH11 . ARG A 1 77 ? 11.769  0.890   -18.969 1.00 0.00 ? 77 ARG A HH11 7  
ATOM 9439  H HH12 . ARG A 1 77 ? 13.449  0.920   -19.390 1.00 0.00 ? 77 ARG A HH12 7  
ATOM 9440  H HH21 . ARG A 1 77 ? 14.030  -2.415  -18.518 1.00 0.00 ? 77 ARG A HH21 7  
ATOM 9441  H HH22 . ARG A 1 77 ? 14.732  -0.956  -19.134 1.00 0.00 ? 77 ARG A HH22 7  
ATOM 9442  N N    . ASP A 1 78 ? 5.471   -2.443  -20.054 1.00 0.00 ? 78 ASP A N    7  
ATOM 9443  C CA   . ASP A 1 78 ? 4.551   -3.119  -20.959 1.00 0.00 ? 78 ASP A CA   7  
ATOM 9444  C C    . ASP A 1 78 ? 4.305   -2.293  -22.218 1.00 0.00 ? 78 ASP A C    7  
ATOM 9445  O O    . ASP A 1 78 ? 3.890   -2.823  -23.248 1.00 0.00 ? 78 ASP A O    7  
ATOM 9446  C CB   . ASP A 1 78 ? 3.227   -3.405  -20.252 1.00 0.00 ? 78 ASP A CB   7  
ATOM 9447  C CG   . ASP A 1 78 ? 2.935   -4.889  -20.148 1.00 0.00 ? 78 ASP A CG   7  
ATOM 9448  O OD1  . ASP A 1 78 ? 3.433   -5.527  -19.196 1.00 0.00 ? 78 ASP A OD1  7  
ATOM 9449  O OD2  . ASP A 1 78 ? 2.209   -5.414  -21.018 1.00 0.00 ? 78 ASP A OD2  7  
ATOM 9450  H H    . ASP A 1 78 ? 5.136   -2.112  -19.196 1.00 0.00 ? 78 ASP A H    7  
ATOM 9451  H HA   . ASP A 1 78 ? 4.999   -4.052  -21.241 1.00 0.00 ? 78 ASP A HA   7  
ATOM 9452  H HB2  . ASP A 1 78 ? 3.266   -2.996  -19.256 1.00 0.00 ? 78 ASP A HB2  7  
ATOM 9453  H HB3  . ASP A 1 78 ? 2.426   -2.937  -20.800 1.00 0.00 ? 78 ASP A HB3  7  
ATOM 9454  N N    . LEU A 1 79 ? 4.562   -0.992  -22.128 1.00 0.00 ? 79 LEU A N    7  
ATOM 9455  C CA   . LEU A 1 79 ? 4.367   -0.094  -23.259 1.00 0.00 ? 79 LEU A CA   7  
ATOM 9456  C C    . LEU A 1 79 ? 5.327   -0.430  -24.396 1.00 0.00 ? 79 LEU A C    7  
ATOM 9457  O O    . LEU A 1 79 ? 6.339   0.245   -24.588 1.00 0.00 ? 79 LEU A O    7  
ATOM 9458  C CB   . LEU A 1 79 ? 4.564   1.359   -22.822 1.00 0.00 ? 79 LEU A CB   7  
ATOM 9459  C CG   . LEU A 1 79 ? 3.346   2.008   -22.163 1.00 0.00 ? 79 LEU A CG   7  
ATOM 9460  C CD1  . LEU A 1 79 ? 3.321   1.704   -20.673 1.00 0.00 ? 79 LEU A CD1  7  
ATOM 9461  C CD2  . LEU A 1 79 ? 3.349   3.510   -22.403 1.00 0.00 ? 79 LEU A CD2  7  
ATOM 9462  H H    . LEU A 1 79 ? 4.888   -0.628  -21.282 1.00 0.00 ? 79 LEU A H    7  
ATOM 9463  H HA   . LEU A 1 79 ? 3.355   -0.220  -23.610 1.00 0.00 ? 79 LEU A HA   7  
ATOM 9464  H HB2  . LEU A 1 79 ? 5.388   1.394   -22.124 1.00 0.00 ? 79 LEU A HB2  7  
ATOM 9465  H HB3  . LEU A 1 79 ? 4.827   1.942   -23.692 1.00 0.00 ? 79 LEU A HB3  7  
ATOM 9466  H HG   . LEU A 1 79 ? 2.447   1.600   -22.602 1.00 0.00 ? 79 LEU A HG   7  
ATOM 9467  H HD11 . LEU A 1 79 ? 4.142   2.210   -20.188 1.00 0.00 ? 79 LEU A HD11 7  
ATOM 9468  H HD12 . LEU A 1 79 ? 3.414   0.639   -20.522 1.00 0.00 ? 79 LEU A HD12 7  
ATOM 9469  H HD13 . LEU A 1 79 ? 2.387   2.047   -20.252 1.00 0.00 ? 79 LEU A HD13 7  
ATOM 9470  H HD21 . LEU A 1 79 ? 4.061   3.979   -21.740 1.00 0.00 ? 79 LEU A HD21 7  
ATOM 9471  H HD22 . LEU A 1 79 ? 2.363   3.908   -22.210 1.00 0.00 ? 79 LEU A HD22 7  
ATOM 9472  H HD23 . LEU A 1 79 ? 3.624   3.711   -23.427 1.00 0.00 ? 79 LEU A HD23 7  
ATOM 9473  N N    . VAL A 1 80 ? 5.003   -1.477  -25.147 1.00 0.00 ? 80 VAL A N    7  
ATOM 9474  C CA   . VAL A 1 80 ? 5.835   -1.903  -26.264 1.00 0.00 ? 80 VAL A CA   7  
ATOM 9475  C C    . VAL A 1 80 ? 5.871   -0.837  -27.359 1.00 0.00 ? 80 VAL A C    7  
ATOM 9476  O O    . VAL A 1 80 ? 4.841   -0.260  -27.706 1.00 0.00 ? 80 VAL A O    7  
ATOM 9477  C CB   . VAL A 1 80 ? 5.330   -3.230  -26.865 1.00 0.00 ? 80 VAL A CB   7  
ATOM 9478  C CG1  . VAL A 1 80 ? 3.913   -3.074  -27.397 1.00 0.00 ? 80 VAL A CG1  7  
ATOM 9479  C CG2  . VAL A 1 80 ? 6.268   -3.717  -27.960 1.00 0.00 ? 80 VAL A CG2  7  
ATOM 9480  H H    . VAL A 1 80 ? 4.185   -1.975  -24.945 1.00 0.00 ? 80 VAL A H    7  
ATOM 9481  H HA   . VAL A 1 80 ? 6.835   -2.059  -25.890 1.00 0.00 ? 80 VAL A HA   7  
ATOM 9482  H HB   . VAL A 1 80 ? 5.313   -3.972  -26.080 1.00 0.00 ? 80 VAL A HB   7  
ATOM 9483  H HG11 . VAL A 1 80 ? 3.949   -2.817  -28.446 1.00 0.00 ? 80 VAL A HG11 7  
ATOM 9484  H HG12 . VAL A 1 80 ? 3.408   -2.290  -26.852 1.00 0.00 ? 80 VAL A HG12 7  
ATOM 9485  H HG13 . VAL A 1 80 ? 3.377   -4.003  -27.272 1.00 0.00 ? 80 VAL A HG13 7  
ATOM 9486  H HG21 . VAL A 1 80 ? 6.410   -2.931  -28.688 1.00 0.00 ? 80 VAL A HG21 7  
ATOM 9487  H HG22 . VAL A 1 80 ? 5.839   -4.582  -28.443 1.00 0.00 ? 80 VAL A HG22 7  
ATOM 9488  H HG23 . VAL A 1 80 ? 7.221   -3.982  -27.526 1.00 0.00 ? 80 VAL A HG23 7  
ATOM 9489  N N    . PRO A 1 81 ? 7.062   -0.558  -27.921 1.00 0.00 ? 81 PRO A N    7  
ATOM 9490  C CA   . PRO A 1 81 ? 7.219   0.444   -28.980 1.00 0.00 ? 81 PRO A CA   7  
ATOM 9491  C C    . PRO A 1 81 ? 6.568   0.013   -30.291 1.00 0.00 ? 81 PRO A C    7  
ATOM 9492  O O    . PRO A 1 81 ? 7.246   -0.169  -31.303 1.00 0.00 ? 81 PRO A O    7  
ATOM 9493  C CB   . PRO A 1 81 ? 8.734   0.557   -29.145 1.00 0.00 ? 81 PRO A CB   7  
ATOM 9494  C CG   . PRO A 1 81 ? 9.258   -0.754  -28.682 1.00 0.00 ? 81 PRO A CG   7  
ATOM 9495  C CD   . PRO A 1 81 ? 8.345   -1.194  -27.573 1.00 0.00 ? 81 PRO A CD   7  
ATOM 9496  H HA   . PRO A 1 81 ? 6.820   1.397   -28.679 1.00 0.00 ? 81 PRO A HA   7  
ATOM 9497  H HB2  . PRO A 1 81 ? 8.974   0.736   -30.183 1.00 0.00 ? 81 PRO A HB2  7  
ATOM 9498  H HB3  . PRO A 1 81 ? 9.107   1.368   -28.537 1.00 0.00 ? 81 PRO A HB3  7  
ATOM 9499  H HG2  . PRO A 1 81 ? 9.230   -1.463  -29.493 1.00 0.00 ? 81 PRO A HG2  7  
ATOM 9500  H HG3  . PRO A 1 81 ? 10.265  -0.637  -28.315 1.00 0.00 ? 81 PRO A HG3  7  
ATOM 9501  H HD2  . PRO A 1 81 ? 8.254   -2.270  -27.563 1.00 0.00 ? 81 PRO A HD2  7  
ATOM 9502  H HD3  . PRO A 1 81 ? 8.707   -0.835  -26.620 1.00 0.00 ? 81 PRO A HD3  7  
ATOM 9503  N N    . ARG A 1 82 ? 5.249   -0.149  -30.265 1.00 0.00 ? 82 ARG A N    7  
ATOM 9504  C CA   . ARG A 1 82 ? 4.506   -0.560  -31.451 1.00 0.00 ? 82 ARG A CA   7  
ATOM 9505  C C    . ARG A 1 82 ? 4.997   -1.911  -31.961 1.00 0.00 ? 82 ARG A C    7  
ATOM 9506  O O    . ARG A 1 82 ? 5.973   -1.929  -32.740 1.00 0.00 ? 82 ARG A O    7  
ATOM 9507  C CB   . ARG A 1 82 ? 4.640   0.494   -32.552 1.00 0.00 ? 82 ARG A CB   7  
ATOM 9508  C CG   . ARG A 1 82 ? 3.539   1.542   -32.526 1.00 0.00 ? 82 ARG A CG   7  
ATOM 9509  C CD   . ARG A 1 82 ? 4.066   2.914   -32.916 1.00 0.00 ? 82 ARG A CD   7  
ATOM 9510  N NE   . ARG A 1 82 ? 4.346   3.745   -31.748 1.00 0.00 ? 82 ARG A NE   7  
ATOM 9511  C CZ   . ARG A 1 82 ? 3.412   4.174   -30.902 1.00 0.00 ? 82 ARG A CZ   7  
ATOM 9512  N NH1  . ARG A 1 82 ? 2.138   3.854   -31.091 1.00 0.00 ? 82 ARG A NH1  7  
ATOM 9513  N NH2  . ARG A 1 82 ? 3.753   4.925   -29.864 1.00 0.00 ? 82 ARG A NH2  7  
ATOM 9514  O OXT  . ARG A 1 82 ? 4.401   -2.939  -31.576 1.00 0.00 ? 82 ARG A OXT  7  
ATOM 9515  H H    . ARG A 1 82 ? 4.764   0.011   -29.429 1.00 0.00 ? 82 ARG A H    7  
ATOM 9516  H HA   . ARG A 1 82 ? 3.466   -0.649  -31.175 1.00 0.00 ? 82 ARG A HA   7  
ATOM 9517  H HB2  . ARG A 1 82 ? 5.589   0.997   -32.440 1.00 0.00 ? 82 ARG A HB2  7  
ATOM 9518  H HB3  . ARG A 1 82 ? 4.615   0.000   -33.512 1.00 0.00 ? 82 ARG A HB3  7  
ATOM 9519  H HG2  . ARG A 1 82 ? 2.765   1.255   -33.222 1.00 0.00 ? 82 ARG A HG2  7  
ATOM 9520  H HG3  . ARG A 1 82 ? 3.128   1.595   -31.529 1.00 0.00 ? 82 ARG A HG3  7  
ATOM 9521  H HD2  . ARG A 1 82 ? 4.977   2.788   -33.482 1.00 0.00 ? 82 ARG A HD2  7  
ATOM 9522  H HD3  . ARG A 1 82 ? 3.328   3.408   -33.530 1.00 0.00 ? 82 ARG A HD3  7  
ATOM 9523  H HE   . ARG A 1 82 ? 5.279   3.997   -31.585 1.00 0.00 ? 82 ARG A HE   7  
ATOM 9524  H HH11 . ARG A 1 82 ? 1.874   3.287   -31.872 1.00 0.00 ? 82 ARG A HH11 7  
ATOM 9525  H HH12 . ARG A 1 82 ? 1.441   4.179   -30.452 1.00 0.00 ? 82 ARG A HH12 7  
ATOM 9526  H HH21 . ARG A 1 82 ? 4.711   5.170   -29.717 1.00 0.00 ? 82 ARG A HH21 7  
ATOM 9527  H HH22 . ARG A 1 82 ? 3.051   5.248   -29.229 1.00 0.00 ? 82 ARG A HH22 7  
ATOM 9528  N N    . MET A 1 1  ? 17.915  13.056  17.857  1.00 0.00 ? 1  MET A N    8  
ATOM 9529  C CA   . MET A 1 1  ? 18.655  11.946  17.201  1.00 0.00 ? 1  MET A CA   8  
ATOM 9530  C C    . MET A 1 1  ? 17.716  11.067  16.381  1.00 0.00 ? 1  MET A C    8  
ATOM 9531  O O    . MET A 1 1  ? 16.687  10.608  16.878  1.00 0.00 ? 1  MET A O    8  
ATOM 9532  C CB   . MET A 1 1  ? 19.346  11.114  18.283  1.00 0.00 ? 1  MET A CB   8  
ATOM 9533  C CG   . MET A 1 1  ? 20.681  10.534  17.845  1.00 0.00 ? 1  MET A CG   8  
ATOM 9534  S SD   . MET A 1 1  ? 20.503  8.975   16.957  1.00 0.00 ? 1  MET A SD   8  
ATOM 9535  C CE   . MET A 1 1  ? 22.130  8.814   16.226  1.00 0.00 ? 1  MET A CE   8  
ATOM 9536  H H1   . MET A 1 1  ? 18.598  13.603  18.418  1.00 0.00 ? 1  MET A H1   8  
ATOM 9537  H H2   . MET A 1 1  ? 17.183  12.633  18.463  1.00 0.00 ? 1  MET A H2   8  
ATOM 9538  H H3   . MET A 1 1  ? 17.493  13.641  17.109  1.00 0.00 ? 1  MET A H3   8  
ATOM 9539  H HA   . MET A 1 1  ? 19.402  12.369  16.547  1.00 0.00 ? 1  MET A HA   8  
ATOM 9540  H HB2  . MET A 1 1  ? 19.515  11.739  19.148  1.00 0.00 ? 1  MET A HB2  8  
ATOM 9541  H HB3  . MET A 1 1  ? 18.697  10.297  18.562  1.00 0.00 ? 1  MET A HB3  8  
ATOM 9542  H HG2  . MET A 1 1  ? 21.172  11.246  17.199  1.00 0.00 ? 1  MET A HG2  8  
ATOM 9543  H HG3  . MET A 1 1  ? 21.289  10.366  18.722  1.00 0.00 ? 1  MET A HG3  8  
ATOM 9544  H HE1  . MET A 1 1  ? 22.065  8.985   15.162  1.00 0.00 ? 1  MET A HE1  8  
ATOM 9545  H HE2  . MET A 1 1  ? 22.510  7.820   16.409  1.00 0.00 ? 1  MET A HE2  8  
ATOM 9546  H HE3  . MET A 1 1  ? 22.796  9.541   16.667  1.00 0.00 ? 1  MET A HE3  8  
ATOM 9547  N N    . ASP A 1 2  ? 18.077  10.836  15.123  1.00 0.00 ? 2  ASP A N    8  
ATOM 9548  C CA   . ASP A 1 2  ? 17.267  10.012  14.234  1.00 0.00 ? 2  ASP A CA   8  
ATOM 9549  C C    . ASP A 1 2  ? 17.137  8.591   14.775  1.00 0.00 ? 2  ASP A C    8  
ATOM 9550  O O    . ASP A 1 2  ? 17.935  7.715   14.445  1.00 0.00 ? 2  ASP A O    8  
ATOM 9551  C CB   . ASP A 1 2  ? 17.876  9.988   12.834  1.00 0.00 ? 2  ASP A CB   8  
ATOM 9552  C CG   . ASP A 1 2  ? 16.951  10.580  11.789  1.00 0.00 ? 2  ASP A CG   8  
ATOM 9553  O OD1  . ASP A 1 2  ? 16.082  9.842   11.279  1.00 0.00 ? 2  ASP A OD1  8  
ATOM 9554  O OD2  . ASP A 1 2  ? 17.095  11.782  11.481  1.00 0.00 ? 2  ASP A OD2  8  
ATOM 9555  H H    . ASP A 1 2  ? 18.909  11.230  14.785  1.00 0.00 ? 2  ASP A H    8  
ATOM 9556  H HA   . ASP A 1 2  ? 16.288  10.453  14.177  1.00 0.00 ? 2  ASP A HA   8  
ATOM 9557  H HB2  . ASP A 1 2  ? 18.791  10.557  12.840  1.00 0.00 ? 2  ASP A HB2  8  
ATOM 9558  H HB3  . ASP A 1 2  ? 18.091  8.967   12.560  1.00 0.00 ? 2  ASP A HB3  8  
ATOM 9559  N N    . ASN A 1 3  ? 16.124  8.371   15.607  1.00 0.00 ? 3  ASN A N    8  
ATOM 9560  C CA   . ASN A 1 3  ? 15.889  7.057   16.193  1.00 0.00 ? 3  ASN A CA   8  
ATOM 9561  C C    . ASN A 1 3  ? 15.658  6.004   15.113  1.00 0.00 ? 3  ASN A C    8  
ATOM 9562  O O    . ASN A 1 3  ? 15.828  4.808   15.352  1.00 0.00 ? 3  ASN A O    8  
ATOM 9563  C CB   . ASN A 1 3  ? 14.693  7.107   17.142  1.00 0.00 ? 3  ASN A CB   8  
ATOM 9564  C CG   . ASN A 1 3  ? 15.075  6.778   18.573  1.00 0.00 ? 3  ASN A CG   8  
ATOM 9565  O OD1  . ASN A 1 3  ? 15.070  5.615   18.977  1.00 0.00 ? 3  ASN A OD1  8  
ATOM 9566  N ND2  . ASN A 1 3  ? 15.408  7.804   19.347  1.00 0.00 ? 3  ASN A ND2  8  
ATOM 9567  H H    . ASN A 1 3  ? 15.521  9.110   15.832  1.00 0.00 ? 3  ASN A H    8  
ATOM 9568  H HA   . ASN A 1 3  ? 16.763  6.787   16.755  1.00 0.00 ? 3  ASN A HA   8  
ATOM 9569  H HB2  . ASN A 1 3  ? 14.271  8.098   17.122  1.00 0.00 ? 3  ASN A HB2  8  
ATOM 9570  H HB3  . ASN A 1 3  ? 13.952  6.396   16.814  1.00 0.00 ? 3  ASN A HB3  8  
ATOM 9571  H HD21 . ASN A 1 3  ? 15.389  8.703   18.958  1.00 0.00 ? 3  ASN A HD21 8  
ATOM 9572  H HD22 . ASN A 1 3  ? 15.659  7.620   20.277  1.00 0.00 ? 3  ASN A HD22 8  
ATOM 9573  N N    . ASP A 1 4  ? 15.271  6.455   13.925  1.00 0.00 ? 4  ASP A N    8  
ATOM 9574  C CA   . ASP A 1 4  ? 15.018  5.550   12.809  1.00 0.00 ? 4  ASP A CA   8  
ATOM 9575  C C    . ASP A 1 4  ? 16.272  4.760   12.442  1.00 0.00 ? 4  ASP A C    8  
ATOM 9576  O O    . ASP A 1 4  ? 16.191  3.715   11.797  1.00 0.00 ? 4  ASP A O    8  
ATOM 9577  C CB   . ASP A 1 4  ? 14.517  6.333   11.597  1.00 0.00 ? 4  ASP A CB   8  
ATOM 9578  C CG   . ASP A 1 4  ? 13.117  5.925   11.182  1.00 0.00 ? 4  ASP A CG   8  
ATOM 9579  O OD1  . ASP A 1 4  ? 12.157  6.287   11.895  1.00 0.00 ? 4  ASP A OD1  8  
ATOM 9580  O OD2  . ASP A 1 4  ? 12.980  5.243   10.145  1.00 0.00 ? 4  ASP A OD2  8  
ATOM 9581  H H    . ASP A 1 4  ? 15.153  7.418   13.795  1.00 0.00 ? 4  ASP A H    8  
ATOM 9582  H HA   . ASP A 1 4  ? 14.253  4.860   13.113  1.00 0.00 ? 4  ASP A HA   8  
ATOM 9583  H HB2  . ASP A 1 4  ? 14.508  7.383   11.837  1.00 0.00 ? 4  ASP A HB2  8  
ATOM 9584  H HB3  . ASP A 1 4  ? 15.183  6.162   10.766  1.00 0.00 ? 4  ASP A HB3  8  
ATOM 9585  N N    . ALA A 1 5  ? 17.430  5.266   12.854  1.00 0.00 ? 5  ALA A N    8  
ATOM 9586  C CA   . ALA A 1 5  ? 18.695  4.612   12.567  1.00 0.00 ? 5  ALA A CA   8  
ATOM 9587  C C    . ALA A 1 5  ? 19.118  3.687   13.706  1.00 0.00 ? 5  ALA A C    8  
ATOM 9588  O O    . ALA A 1 5  ? 20.303  3.397   13.872  1.00 0.00 ? 5  ALA A O    8  
ATOM 9589  C CB   . ALA A 1 5  ? 19.776  5.649   12.299  1.00 0.00 ? 5  ALA A CB   8  
ATOM 9590  H H    . ALA A 1 5  ? 17.434  6.098   13.358  1.00 0.00 ? 5  ALA A H    8  
ATOM 9591  H HA   . ALA A 1 5  ? 18.563  4.030   11.674  1.00 0.00 ? 5  ALA A HA   8  
ATOM 9592  H HB1  . ALA A 1 5  ? 19.511  6.227   11.427  1.00 0.00 ? 5  ALA A HB1  8  
ATOM 9593  H HB2  . ALA A 1 5  ? 20.718  5.151   12.128  1.00 0.00 ? 5  ALA A HB2  8  
ATOM 9594  H HB3  . ALA A 1 5  ? 19.865  6.305   13.153  1.00 0.00 ? 5  ALA A HB3  8  
ATOM 9595  N N    . GLU A 1 6  ? 18.146  3.227   14.489  1.00 0.00 ? 6  GLU A N    8  
ATOM 9596  C CA   . GLU A 1 6  ? 18.422  2.339   15.608  1.00 0.00 ? 6  GLU A CA   8  
ATOM 9597  C C    . GLU A 1 6  ? 18.177  0.887   15.238  1.00 0.00 ? 6  GLU A C    8  
ATOM 9598  O O    . GLU A 1 6  ? 17.993  0.027   16.100  1.00 0.00 ? 6  GLU A O    8  
ATOM 9599  C CB   . GLU A 1 6  ? 17.554  2.712   16.795  1.00 0.00 ? 6  GLU A CB   8  
ATOM 9600  C CG   . GLU A 1 6  ? 18.104  3.862   17.623  1.00 0.00 ? 6  GLU A CG   8  
ATOM 9601  C CD   . GLU A 1 6  ? 17.775  3.728   19.097  1.00 0.00 ? 6  GLU A CD   8  
ATOM 9602  O OE1  . GLU A 1 6  ? 17.900  2.607   19.633  1.00 0.00 ? 6  GLU A OE1  8  
ATOM 9603  O OE2  . GLU A 1 6  ? 17.394  4.745   19.715  1.00 0.00 ? 6  GLU A OE2  8  
ATOM 9604  H H    . GLU A 1 6  ? 17.226  3.490   14.314  1.00 0.00 ? 6  GLU A H    8  
ATOM 9605  H HA   . GLU A 1 6  ? 19.450  2.458   15.862  1.00 0.00 ? 6  GLU A HA   8  
ATOM 9606  H HB2  . GLU A 1 6  ? 16.581  2.990   16.424  1.00 0.00 ? 6  GLU A HB2  8  
ATOM 9607  H HB3  . GLU A 1 6  ? 17.454  1.848   17.432  1.00 0.00 ? 6  GLU A HB3  8  
ATOM 9608  H HG2  . GLU A 1 6  ? 19.177  3.889   17.510  1.00 0.00 ? 6  GLU A HG2  8  
ATOM 9609  H HG3  . GLU A 1 6  ? 17.681  4.786   17.257  1.00 0.00 ? 6  GLU A HG3  8  
ATOM 9610  N N    . GLY A 1 7  ? 18.178  0.636   13.952  1.00 0.00 ? 7  GLY A N    8  
ATOM 9611  C CA   . GLY A 1 7  ? 17.957  -0.705  13.444  1.00 0.00 ? 7  GLY A CA   8  
ATOM 9612  C C    . GLY A 1 7  ? 16.496  -1.111  13.490  1.00 0.00 ? 7  GLY A C    8  
ATOM 9613  O O    . GLY A 1 7  ? 16.177  -2.299  13.535  1.00 0.00 ? 7  GLY A O    8  
ATOM 9614  H H    . GLY A 1 7  ? 18.331  1.376   13.342  1.00 0.00 ? 7  GLY A H    8  
ATOM 9615  H HA2  . GLY A 1 7  ? 18.299  -0.751  12.420  1.00 0.00 ? 7  GLY A HA2  8  
ATOM 9616  H HA3  . GLY A 1 7  ? 18.531  -1.402  14.036  1.00 0.00 ? 7  GLY A HA3  8  
ATOM 9617  N N    . VAL A 1 8  ? 15.607  -0.123  13.479  1.00 0.00 ? 8  VAL A N    8  
ATOM 9618  C CA   . VAL A 1 8  ? 14.174  -0.384  13.520  1.00 0.00 ? 8  VAL A CA   8  
ATOM 9619  C C    . VAL A 1 8  ? 13.713  -1.149  12.281  1.00 0.00 ? 8  VAL A C    8  
ATOM 9620  O O    . VAL A 1 8  ? 12.650  -1.771  12.285  1.00 0.00 ? 8  VAL A O    8  
ATOM 9621  C CB   . VAL A 1 8  ? 13.368  0.925   13.638  1.00 0.00 ? 8  VAL A CB   8  
ATOM 9622  C CG1  . VAL A 1 8  ? 13.625  1.825   12.438  1.00 0.00 ? 8  VAL A CG1  8  
ATOM 9623  C CG2  . VAL A 1 8  ? 11.882  0.630   13.786  1.00 0.00 ? 8  VAL A CG2  8  
ATOM 9624  H H    . VAL A 1 8  ? 15.922  0.804   13.442  1.00 0.00 ? 8  VAL A H    8  
ATOM 9625  H HA   . VAL A 1 8  ? 13.973  -0.984  14.393  1.00 0.00 ? 8  VAL A HA   8  
ATOM 9626  H HB   . VAL A 1 8  ? 13.698  1.447   14.525  1.00 0.00 ? 8  VAL A HB   8  
ATOM 9627  H HG11 . VAL A 1 8  ? 12.706  2.315   12.151  1.00 0.00 ? 8  VAL A HG11 8  
ATOM 9628  H HG12 . VAL A 1 8  ? 13.988  1.231   11.613  1.00 0.00 ? 8  VAL A HG12 8  
ATOM 9629  H HG13 . VAL A 1 8  ? 14.363  2.569   12.698  1.00 0.00 ? 8  VAL A HG13 8  
ATOM 9630  H HG21 . VAL A 1 8  ? 11.748  -0.224  14.434  1.00 0.00 ? 8  VAL A HG21 8  
ATOM 9631  H HG22 . VAL A 1 8  ? 11.460  0.415   12.815  1.00 0.00 ? 8  VAL A HG22 8  
ATOM 9632  H HG23 . VAL A 1 8  ? 11.385  1.488   14.213  1.00 0.00 ? 8  VAL A HG23 8  
ATOM 9633  N N    . TRP A 1 9  ? 14.516  -1.098  11.224  1.00 0.00 ? 9  TRP A N    8  
ATOM 9634  C CA   . TRP A 1 9  ? 14.189  -1.785  9.981   1.00 0.00 ? 9  TRP A CA   8  
ATOM 9635  C C    . TRP A 1 9  ? 14.033  -3.286  10.209  1.00 0.00 ? 9  TRP A C    8  
ATOM 9636  O O    . TRP A 1 9  ? 14.932  -3.940  10.737  1.00 0.00 ? 9  TRP A O    8  
ATOM 9637  C CB   . TRP A 1 9  ? 15.267  -1.523  8.932   1.00 0.00 ? 9  TRP A CB   8  
ATOM 9638  C CG   . TRP A 1 9  ? 14.756  -0.803  7.721   1.00 0.00 ? 9  TRP A CG   8  
ATOM 9639  C CD1  . TRP A 1 9  ? 15.146  0.425   7.272   1.00 0.00 ? 9  TRP A CD1  8  
ATOM 9640  C CD2  . TRP A 1 9  ? 13.759  -1.269  6.804   1.00 0.00 ? 9  TRP A CD2  8  
ATOM 9641  N NE1  . TRP A 1 9  ? 14.453  0.753   6.131   1.00 0.00 ? 9  TRP A NE1  8  
ATOM 9642  C CE2  . TRP A 1 9  ? 13.596  -0.271  5.824   1.00 0.00 ? 9  TRP A CE2  8  
ATOM 9643  C CE3  . TRP A 1 9  ? 12.990  -2.432  6.716   1.00 0.00 ? 9  TRP A CE3  8  
ATOM 9644  C CZ2  . TRP A 1 9  ? 12.695  -0.403  4.770   1.00 0.00 ? 9  TRP A CZ2  8  
ATOM 9645  C CZ3  . TRP A 1 9  ? 12.096  -2.562  5.669   1.00 0.00 ? 9  TRP A CZ3  8  
ATOM 9646  C CH2  . TRP A 1 9  ? 11.955  -1.552  4.709   1.00 0.00 ? 9  TRP A CH2  8  
ATOM 9647  H H    . TRP A 1 9  ? 15.349  -0.586  11.282  1.00 0.00 ? 9  TRP A H    8  
ATOM 9648  H HA   . TRP A 1 9  ? 13.255  -1.390  9.622   1.00 0.00 ? 9  TRP A HA   8  
ATOM 9649  H HB2  . TRP A 1 9  ? 16.045  -0.921  9.372   1.00 0.00 ? 9  TRP A HB2  8  
ATOM 9650  H HB3  . TRP A 1 9  ? 15.683  -2.464  8.611   1.00 0.00 ? 9  TRP A HB3  8  
ATOM 9651  H HD1  . TRP A 1 9  ? 15.892  1.041   7.753   1.00 0.00 ? 9  TRP A HD1  8  
ATOM 9652  H HE1  . TRP A 1 9  ? 14.556  1.583   5.621   1.00 0.00 ? 9  TRP A HE1  8  
ATOM 9653  H HE3  . TRP A 1 9  ? 13.085  -3.222  7.447   1.00 0.00 ? 9  TRP A HE3  8  
ATOM 9654  H HZ2  . TRP A 1 9  ? 12.575  0.366   4.021   1.00 0.00 ? 9  TRP A HZ2  8  
ATOM 9655  H HZ3  . TRP A 1 9  ? 11.492  -3.454  5.585   1.00 0.00 ? 9  TRP A HZ3  8  
ATOM 9656  H HH2  . TRP A 1 9  ? 11.244  -1.696  3.909   1.00 0.00 ? 9  TRP A HH2  8  
ATOM 9657  N N    . SER A 1 10 ? 12.887  -3.824  9.806   1.00 0.00 ? 10 SER A N    8  
ATOM 9658  C CA   . SER A 1 10 ? 12.612  -5.241  9.962   1.00 0.00 ? 10 SER A CA   8  
ATOM 9659  C C    . SER A 1 10 ? 11.979  -5.815  8.697   1.00 0.00 ? 10 SER A C    8  
ATOM 9660  O O    . SER A 1 10 ? 11.255  -5.119  7.984   1.00 0.00 ? 10 SER A O    8  
ATOM 9661  C CB   . SER A 1 10 ? 11.694  -5.478  11.162  1.00 0.00 ? 10 SER A CB   8  
ATOM 9662  O OG   . SER A 1 10 ? 10.869  -4.352  11.405  1.00 0.00 ? 10 SER A OG   8  
ATOM 9663  H H    . SER A 1 10 ? 12.214  -3.256  9.393   1.00 0.00 ? 10 SER A H    8  
ATOM 9664  H HA   . SER A 1 10 ? 13.549  -5.733  10.134  1.00 0.00 ? 10 SER A HA   8  
ATOM 9665  H HB2  . SER A 1 10 ? 11.064  -6.334  10.968  1.00 0.00 ? 10 SER A HB2  8  
ATOM 9666  H HB3  . SER A 1 10 ? 12.294  -5.665  12.040  1.00 0.00 ? 10 SER A HB3  8  
ATOM 9667  H HG   . SER A 1 10 ? 11.294  -3.775  12.044  1.00 0.00 ? 10 SER A HG   8  
ATOM 9668  N N    . PRO A 1 11 ? 12.243  -7.099  8.399   1.00 0.00 ? 11 PRO A N    8  
ATOM 9669  C CA   . PRO A 1 11 ? 11.696  -7.764  7.213   1.00 0.00 ? 11 PRO A CA   8  
ATOM 9670  C C    . PRO A 1 11 ? 10.183  -7.932  7.283   1.00 0.00 ? 11 PRO A C    8  
ATOM 9671  O O    . PRO A 1 11 ? 9.521   -8.122  6.262   1.00 0.00 ? 11 PRO A O    8  
ATOM 9672  C CB   . PRO A 1 11 ? 12.387  -9.128  7.212   1.00 0.00 ? 11 PRO A CB   8  
ATOM 9673  C CG   . PRO A 1 11 ? 12.770  -9.356  8.629   1.00 0.00 ? 11 PRO A CG   8  
ATOM 9674  C CD   . PRO A 1 11 ? 13.095  -8.002  9.192   1.00 0.00 ? 11 PRO A CD   8  
ATOM 9675  H HA   . PRO A 1 11 ? 11.951  -7.233  6.317   1.00 0.00 ? 11 PRO A HA   8  
ATOM 9676  H HB2  . PRO A 1 11 ? 11.699  -9.883  6.860   1.00 0.00 ? 11 PRO A HB2  8  
ATOM 9677  H HB3  . PRO A 1 11 ? 13.254  -9.096  6.569   1.00 0.00 ? 11 PRO A HB3  8  
ATOM 9678  H HG2  . PRO A 1 11 ? 11.942  -9.795  9.163   1.00 0.00 ? 11 PRO A HG2  8  
ATOM 9679  H HG3  . PRO A 1 11 ? 13.634  -9.999  8.676   1.00 0.00 ? 11 PRO A HG3  8  
ATOM 9680  H HD2  . PRO A 1 11 ? 12.837  -7.956  10.240  1.00 0.00 ? 11 PRO A HD2  8  
ATOM 9681  H HD3  . PRO A 1 11 ? 14.140  -7.773  9.048   1.00 0.00 ? 11 PRO A HD3  8  
ATOM 9682  N N    . ASP A 1 12 ? 9.642   -7.861  8.492   1.00 0.00 ? 12 ASP A N    8  
ATOM 9683  C CA   . ASP A 1 12 ? 8.208   -8.004  8.698   1.00 0.00 ? 12 ASP A CA   8  
ATOM 9684  C C    . ASP A 1 12 ? 7.457   -6.780  8.189   1.00 0.00 ? 12 ASP A C    8  
ATOM 9685  O O    . ASP A 1 12 ? 6.274   -6.859  7.856   1.00 0.00 ? 12 ASP A O    8  
ATOM 9686  C CB   . ASP A 1 12 ? 7.904   -8.229  10.177  1.00 0.00 ? 12 ASP A CB   8  
ATOM 9687  C CG   . ASP A 1 12 ? 7.373   -9.622  10.454  1.00 0.00 ? 12 ASP A CG   8  
ATOM 9688  O OD1  . ASP A 1 12 ? 7.845   -10.578 9.803   1.00 0.00 ? 12 ASP A OD1  8  
ATOM 9689  O OD2  . ASP A 1 12 ? 6.485   -9.757  11.323  1.00 0.00 ? 12 ASP A OD2  8  
ATOM 9690  H H    . ASP A 1 12 ? 10.222  -7.709  9.263   1.00 0.00 ? 12 ASP A H    8  
ATOM 9691  H HA   . ASP A 1 12 ? 7.886   -8.862  8.143   1.00 0.00 ? 12 ASP A HA   8  
ATOM 9692  H HB2  . ASP A 1 12 ? 8.808   -8.090  10.743  1.00 0.00 ? 12 ASP A HB2  8  
ATOM 9693  H HB3  . ASP A 1 12 ? 7.166   -7.510  10.502  1.00 0.00 ? 12 ASP A HB3  8  
ATOM 9694  N N    . ILE A 1 13 ? 8.152   -5.653  8.125   1.00 0.00 ? 13 ILE A N    8  
ATOM 9695  C CA   . ILE A 1 13 ? 7.555   -4.416  7.652   1.00 0.00 ? 13 ILE A CA   8  
ATOM 9696  C C    . ILE A 1 13 ? 7.459   -4.416  6.139   1.00 0.00 ? 13 ILE A C    8  
ATOM 9697  O O    . ILE A 1 13 ? 6.425   -4.072  5.566   1.00 0.00 ? 13 ILE A O    8  
ATOM 9698  C CB   . ILE A 1 13 ? 8.345   -3.185  8.109   1.00 0.00 ? 13 ILE A CB   8  
ATOM 9699  C CG1  . ILE A 1 13 ? 8.775   -3.329  9.571   1.00 0.00 ? 13 ILE A CG1  8  
ATOM 9700  C CG2  . ILE A 1 13 ? 7.520   -1.922  7.914   1.00 0.00 ? 13 ILE A CG2  8  
ATOM 9701  C CD1  . ILE A 1 13 ? 7.620   -3.563  10.521  1.00 0.00 ? 13 ILE A CD1  8  
ATOM 9702  H H    . ILE A 1 13 ? 9.088   -5.656  8.398   1.00 0.00 ? 13 ILE A H    8  
ATOM 9703  H HA   . ILE A 1 13 ? 6.576   -4.351  8.056   1.00 0.00 ? 13 ILE A HA   8  
ATOM 9704  H HB   . ILE A 1 13 ? 9.214   -3.113  7.492   1.00 0.00 ? 13 ILE A HB   8  
ATOM 9705  H HG12 . ILE A 1 13 ? 9.451   -4.166  9.661   1.00 0.00 ? 13 ILE A HG12 8  
ATOM 9706  H HG13 . ILE A 1 13 ? 9.283   -2.427  9.881   1.00 0.00 ? 13 ILE A HG13 8  
ATOM 9707  H HG21 . ILE A 1 13 ? 7.197   -1.859  6.886   1.00 0.00 ? 13 ILE A HG21 8  
ATOM 9708  H HG22 . ILE A 1 13 ? 8.121   -1.058  8.157   1.00 0.00 ? 13 ILE A HG22 8  
ATOM 9709  H HG23 . ILE A 1 13 ? 6.657   -1.953  8.562   1.00 0.00 ? 13 ILE A HG23 8  
ATOM 9710  H HD11 . ILE A 1 13 ? 7.638   -4.587  10.864  1.00 0.00 ? 13 ILE A HD11 8  
ATOM 9711  H HD12 . ILE A 1 13 ? 6.689   -3.371  10.009  1.00 0.00 ? 13 ILE A HD12 8  
ATOM 9712  H HD13 . ILE A 1 13 ? 7.710   -2.898  11.367  1.00 0.00 ? 13 ILE A HD13 8  
ATOM 9713  N N    . GLU A 1 14 ? 8.541   -4.825  5.502   1.00 0.00 ? 14 GLU A N    8  
ATOM 9714  C CA   . GLU A 1 14 ? 8.589   -4.899  4.052   1.00 0.00 ? 14 GLU A CA   8  
ATOM 9715  C C    . GLU A 1 14 ? 7.661   -5.998  3.553   1.00 0.00 ? 14 GLU A C    8  
ATOM 9716  O O    . GLU A 1 14 ? 7.193   -5.963  2.415   1.00 0.00 ? 14 GLU A O    8  
ATOM 9717  C CB   . GLU A 1 14 ? 10.020  -5.157  3.574   1.00 0.00 ? 14 GLU A CB   8  
ATOM 9718  C CG   . GLU A 1 14 ? 10.355  -4.471  2.260   1.00 0.00 ? 14 GLU A CG   8  
ATOM 9719  C CD   . GLU A 1 14 ? 10.226  -5.399  1.068   1.00 0.00 ? 14 GLU A CD   8  
ATOM 9720  O OE1  . GLU A 1 14 ? 9.108   -5.901  0.824   1.00 0.00 ? 14 GLU A OE1  8  
ATOM 9721  O OE2  . GLU A 1 14 ? 11.243  -5.626  0.379   1.00 0.00 ? 14 GLU A OE2  8  
ATOM 9722  H H    . GLU A 1 14 ? 9.320   -5.097  6.023   1.00 0.00 ? 14 GLU A H    8  
ATOM 9723  H HA   . GLU A 1 14 ? 8.250   -3.955  3.664   1.00 0.00 ? 14 GLU A HA   8  
ATOM 9724  H HB2  . GLU A 1 14 ? 10.708  -4.801  4.326   1.00 0.00 ? 14 GLU A HB2  8  
ATOM 9725  H HB3  . GLU A 1 14 ? 10.158  -6.220  3.446   1.00 0.00 ? 14 GLU A HB3  8  
ATOM 9726  H HG2  . GLU A 1 14 ? 9.682   -3.638  2.121   1.00 0.00 ? 14 GLU A HG2  8  
ATOM 9727  H HG3  . GLU A 1 14 ? 11.371  -4.108  2.307   1.00 0.00 ? 14 GLU A HG3  8  
ATOM 9728  N N    . GLN A 1 15 ? 7.393   -6.968  4.421   1.00 0.00 ? 15 GLN A N    8  
ATOM 9729  C CA   . GLN A 1 15 ? 6.517   -8.072  4.083   1.00 0.00 ? 15 GLN A CA   8  
ATOM 9730  C C    . GLN A 1 15 ? 5.070   -7.619  4.079   1.00 0.00 ? 15 GLN A C    8  
ATOM 9731  O O    . GLN A 1 15 ? 4.294   -7.969  3.189   1.00 0.00 ? 15 GLN A O    8  
ATOM 9732  C CB   . GLN A 1 15 ? 6.714   -9.213  5.059   1.00 0.00 ? 15 GLN A CB   8  
ATOM 9733  C CG   . GLN A 1 15 ? 7.691   -10.250 4.551   1.00 0.00 ? 15 GLN A CG   8  
ATOM 9734  C CD   . GLN A 1 15 ? 7.041   -11.269 3.635   1.00 0.00 ? 15 GLN A CD   8  
ATOM 9735  O OE1  . GLN A 1 15 ? 6.170   -10.933 2.832   1.00 0.00 ? 15 GLN A OE1  8  
ATOM 9736  N NE2  . GLN A 1 15 ? 7.462   -12.523 3.751   1.00 0.00 ? 15 GLN A NE2  8  
ATOM 9737  H H    . GLN A 1 15 ? 7.792   -6.936  5.312   1.00 0.00 ? 15 GLN A H    8  
ATOM 9738  H HA   . GLN A 1 15 ? 6.780   -8.410  3.111   1.00 0.00 ? 15 GLN A HA   8  
ATOM 9739  H HB2  . GLN A 1 15 ? 7.093   -8.812  5.979   1.00 0.00 ? 15 GLN A HB2  8  
ATOM 9740  H HB3  . GLN A 1 15 ? 5.766   -9.693  5.241   1.00 0.00 ? 15 GLN A HB3  8  
ATOM 9741  H HG2  . GLN A 1 15 ? 8.477   -9.747  4.008   1.00 0.00 ? 15 GLN A HG2  8  
ATOM 9742  H HG3  . GLN A 1 15 ? 8.112   -10.761 5.392   1.00 0.00 ? 15 GLN A HG3  8  
ATOM 9743  H HE21 . GLN A 1 15 ? 8.159   -12.718 4.412   1.00 0.00 ? 15 GLN A HE21 8  
ATOM 9744  H HE22 . GLN A 1 15 ? 7.059   -13.203 3.171   1.00 0.00 ? 15 GLN A HE22 8  
ATOM 9745  N N    . SER A 1 16 ? 4.723   -6.821  5.074   1.00 0.00 ? 16 SER A N    8  
ATOM 9746  C CA   . SER A 1 16 ? 3.376   -6.289  5.189   1.00 0.00 ? 16 SER A CA   8  
ATOM 9747  C C    . SER A 1 16 ? 3.074   -5.372  4.011   1.00 0.00 ? 16 SER A C    8  
ATOM 9748  O O    . SER A 1 16 ? 1.914   -5.132  3.675   1.00 0.00 ? 16 SER A O    8  
ATOM 9749  C CB   . SER A 1 16 ? 3.212   -5.527  6.506   1.00 0.00 ? 16 SER A CB   8  
ATOM 9750  O OG   . SER A 1 16 ? 1.852   -5.476  6.900   1.00 0.00 ? 16 SER A OG   8  
ATOM 9751  H H    . SER A 1 16 ? 5.397   -6.572  5.737   1.00 0.00 ? 16 SER A H    8  
ATOM 9752  H HA   . SER A 1 16 ? 2.690   -7.119  5.172   1.00 0.00 ? 16 SER A HA   8  
ATOM 9753  H HB2  . SER A 1 16 ? 3.779   -6.022  7.280   1.00 0.00 ? 16 SER A HB2  8  
ATOM 9754  H HB3  . SER A 1 16 ? 3.577   -4.518  6.383   1.00 0.00 ? 16 SER A HB3  8  
ATOM 9755  H HG   . SER A 1 16 ? 1.305   -5.265  6.139   1.00 0.00 ? 16 SER A HG   8  
ATOM 9756  N N    . PHE A 1 17 ? 4.133   -4.866  3.382   1.00 0.00 ? 17 PHE A N    8  
ATOM 9757  C CA   . PHE A 1 17 ? 3.994   -3.982  2.238   1.00 0.00 ? 17 PHE A CA   8  
ATOM 9758  C C    . PHE A 1 17 ? 3.455   -4.737  1.038   1.00 0.00 ? 17 PHE A C    8  
ATOM 9759  O O    . PHE A 1 17 ? 2.550   -4.267  0.347   1.00 0.00 ? 17 PHE A O    8  
ATOM 9760  C CB   . PHE A 1 17 ? 5.335   -3.339  1.900   1.00 0.00 ? 17 PHE A CB   8  
ATOM 9761  C CG   . PHE A 1 17 ? 5.448   -1.907  2.337   1.00 0.00 ? 17 PHE A CG   8  
ATOM 9762  C CD1  . PHE A 1 17 ? 5.192   -1.548  3.651   1.00 0.00 ? 17 PHE A CD1  8  
ATOM 9763  C CD2  . PHE A 1 17 ? 5.813   -0.921  1.435   1.00 0.00 ? 17 PHE A CD2  8  
ATOM 9764  C CE1  . PHE A 1 17 ? 5.299   -0.232  4.057   1.00 0.00 ? 17 PHE A CE1  8  
ATOM 9765  C CE2  . PHE A 1 17 ? 5.921   0.397   1.835   1.00 0.00 ? 17 PHE A CE2  8  
ATOM 9766  C CZ   . PHE A 1 17 ? 5.664   0.742   3.148   1.00 0.00 ? 17 PHE A CZ   8  
ATOM 9767  H H    . PHE A 1 17 ? 5.030   -5.098  3.697   1.00 0.00 ? 17 PHE A H    8  
ATOM 9768  H HA   . PHE A 1 17 ? 3.299   -3.219  2.501   1.00 0.00 ? 17 PHE A HA   8  
ATOM 9769  H HB2  . PHE A 1 17 ? 6.114   -3.893  2.390   1.00 0.00 ? 17 PHE A HB2  8  
ATOM 9770  H HB3  . PHE A 1 17 ? 5.490   -3.376  0.831   1.00 0.00 ? 17 PHE A HB3  8  
ATOM 9771  H HD1  . PHE A 1 17 ? 4.908   -2.309  4.362   1.00 0.00 ? 17 PHE A HD1  8  
ATOM 9772  H HD2  . PHE A 1 17 ? 6.014   -1.190  0.409   1.00 0.00 ? 17 PHE A HD2  8  
ATOM 9773  H HE1  . PHE A 1 17 ? 5.097   0.035   5.084   1.00 0.00 ? 17 PHE A HE1  8  
ATOM 9774  H HE2  . PHE A 1 17 ? 6.206   1.156   1.122   1.00 0.00 ? 17 PHE A HE2  8  
ATOM 9775  H HZ   . PHE A 1 17 ? 5.748   1.772   3.463   1.00 0.00 ? 17 PHE A HZ   8  
ATOM 9776  N N    . GLN A 1 18 ? 4.008   -5.914  0.801   1.00 0.00 ? 18 GLN A N    8  
ATOM 9777  C CA   . GLN A 1 18 ? 3.570   -6.740  -0.313  1.00 0.00 ? 18 GLN A CA   8  
ATOM 9778  C C    . GLN A 1 18 ? 2.149   -7.225  -0.081  1.00 0.00 ? 18 GLN A C    8  
ATOM 9779  O O    . GLN A 1 18 ? 1.398   -7.460  -1.025  1.00 0.00 ? 18 GLN A O    8  
ATOM 9780  C CB   . GLN A 1 18 ? 4.502   -7.938  -0.511  1.00 0.00 ? 18 GLN A CB   8  
ATOM 9781  C CG   . GLN A 1 18 ? 3.943   -8.983  -1.467  1.00 0.00 ? 18 GLN A CG   8  
ATOM 9782  C CD   . GLN A 1 18 ? 4.999   -9.957  -1.952  1.00 0.00 ? 18 GLN A CD   8  
ATOM 9783  O OE1  . GLN A 1 18 ? 6.112   -9.561  -2.301  1.00 0.00 ? 18 GLN A OE1  8  
ATOM 9784  N NE2  . GLN A 1 18 ? 4.656   -11.239 -1.976  1.00 0.00 ? 18 GLN A NE2  8  
ATOM 9785  H H    . GLN A 1 18 ? 4.717   -6.235  1.394   1.00 0.00 ? 18 GLN A H    8  
ATOM 9786  H HA   . GLN A 1 18 ? 3.587   -6.130  -1.197  1.00 0.00 ? 18 GLN A HA   8  
ATOM 9787  H HB2  . GLN A 1 18 ? 5.444   -7.586  -0.905  1.00 0.00 ? 18 GLN A HB2  8  
ATOM 9788  H HB3  . GLN A 1 18 ? 4.673   -8.410  0.445   1.00 0.00 ? 18 GLN A HB3  8  
ATOM 9789  H HG2  . GLN A 1 18 ? 3.168   -9.538  -0.959  1.00 0.00 ? 18 GLN A HG2  8  
ATOM 9790  H HG3  . GLN A 1 18 ? 3.517   -8.478  -2.322  1.00 0.00 ? 18 GLN A HG3  8  
ATOM 9791  H HE21 . GLN A 1 18 ? 3.752   -11.482 -1.684  1.00 0.00 ? 18 GLN A HE21 8  
ATOM 9792  H HE22 . GLN A 1 18 ? 5.319   -11.891 -2.285  1.00 0.00 ? 18 GLN A HE22 8  
ATOM 9793  N N    . GLU A 1 19 ? 1.789   -7.374  1.185   1.00 0.00 ? 19 GLU A N    8  
ATOM 9794  C CA   . GLU A 1 19 ? 0.460   -7.830  1.544   1.00 0.00 ? 19 GLU A CA   8  
ATOM 9795  C C    . GLU A 1 19 ? -0.578  -6.777  1.200   1.00 0.00 ? 19 GLU A C    8  
ATOM 9796  O O    . GLU A 1 19 ? -1.705  -7.099  0.831   1.00 0.00 ? 19 GLU A O    8  
ATOM 9797  C CB   . GLU A 1 19 ? 0.395   -8.182  3.028   1.00 0.00 ? 19 GLU A CB   8  
ATOM 9798  C CG   . GLU A 1 19 ? 0.039   -9.635  3.294   1.00 0.00 ? 19 GLU A CG   8  
ATOM 9799  C CD   . GLU A 1 19 ? 1.250   -10.546 3.271   1.00 0.00 ? 19 GLU A CD   8  
ATOM 9800  O OE1  . GLU A 1 19 ? 1.628   -11.004 2.173   1.00 0.00 ? 19 GLU A OE1  8  
ATOM 9801  O OE2  . GLU A 1 19 ? 1.822   -10.801 4.352   1.00 0.00 ? 19 GLU A OE2  8  
ATOM 9802  H H    . GLU A 1 19 ? 2.434   -7.171  1.890   1.00 0.00 ? 19 GLU A H    8  
ATOM 9803  H HA   . GLU A 1 19 ? 0.254   -8.708  0.969   1.00 0.00 ? 19 GLU A HA   8  
ATOM 9804  H HB2  . GLU A 1 19 ? 1.357   -7.983  3.473   1.00 0.00 ? 19 GLU A HB2  8  
ATOM 9805  H HB3  . GLU A 1 19 ? -0.347  -7.560  3.500   1.00 0.00 ? 19 GLU A HB3  8  
ATOM 9806  H HG2  . GLU A 1 19 ? -0.427  -9.706  4.266   1.00 0.00 ? 19 GLU A HG2  8  
ATOM 9807  H HG3  . GLU A 1 19 ? -0.657  -9.966  2.537   1.00 0.00 ? 19 GLU A HG3  8  
ATOM 9808  N N    . ALA A 1 20 ? -0.186  -5.518  1.310   1.00 0.00 ? 20 ALA A N    8  
ATOM 9809  C CA   . ALA A 1 20 ? -1.081  -4.421  0.995   1.00 0.00 ? 20 ALA A CA   8  
ATOM 9810  C C    . ALA A 1 20 ? -1.090  -4.158  -0.501  1.00 0.00 ? 20 ALA A C    8  
ATOM 9811  O O    . ALA A 1 20 ? -2.100  -3.739  -1.067  1.00 0.00 ? 20 ALA A O    8  
ATOM 9812  C CB   . ALA A 1 20 ? -0.690  -3.168  1.763   1.00 0.00 ? 20 ALA A CB   8  
ATOM 9813  H H    . ALA A 1 20 ? 0.726   -5.325  1.599   1.00 0.00 ? 20 ALA A H    8  
ATOM 9814  H HA   . ALA A 1 20 ? -2.067  -4.714  1.297   1.00 0.00 ? 20 ALA A HA   8  
ATOM 9815  H HB1  . ALA A 1 20 ? -0.529  -3.418  2.802   1.00 0.00 ? 20 ALA A HB1  8  
ATOM 9816  H HB2  . ALA A 1 20 ? -1.481  -2.437  1.688   1.00 0.00 ? 20 ALA A HB2  8  
ATOM 9817  H HB3  . ALA A 1 20 ? 0.219   -2.759  1.347   1.00 0.00 ? 20 ALA A HB3  8  
ATOM 9818  N N    . LEU A 1 21 ? 0.041   -4.422  -1.137  1.00 0.00 ? 21 LEU A N    8  
ATOM 9819  C CA   . LEU A 1 21 ? 0.171   -4.234  -2.568  1.00 0.00 ? 21 LEU A CA   8  
ATOM 9820  C C    . LEU A 1 21 ? -0.389  -5.439  -3.311  1.00 0.00 ? 21 LEU A C    8  
ATOM 9821  O O    . LEU A 1 21 ? -0.887  -5.318  -4.430  1.00 0.00 ? 21 LEU A O    8  
ATOM 9822  C CB   . LEU A 1 21 ? 1.631   -3.999  -2.948  1.00 0.00 ? 21 LEU A CB   8  
ATOM 9823  C CG   . LEU A 1 21 ? 1.931   -2.621  -3.540  1.00 0.00 ? 21 LEU A CG   8  
ATOM 9824  C CD1  . LEU A 1 21 ? 1.239   -2.456  -4.884  1.00 0.00 ? 21 LEU A CD1  8  
ATOM 9825  C CD2  . LEU A 1 21 ? 1.501   -1.524  -2.577  1.00 0.00 ? 21 LEU A CD2  8  
ATOM 9826  H H    . LEU A 1 21 ? 0.801   -4.762  -0.631  1.00 0.00 ? 21 LEU A H    8  
ATOM 9827  H HA   . LEU A 1 21 ? -0.402  -3.372  -2.831  1.00 0.00 ? 21 LEU A HA   8  
ATOM 9828  H HB2  . LEU A 1 21 ? 2.232   -4.125  -2.062  1.00 0.00 ? 21 LEU A HB2  8  
ATOM 9829  H HB3  . LEU A 1 21 ? 1.920   -4.746  -3.670  1.00 0.00 ? 21 LEU A HB3  8  
ATOM 9830  H HG   . LEU A 1 21 ? 2.995   -2.529  -3.699  1.00 0.00 ? 21 LEU A HG   8  
ATOM 9831  H HD11 . LEU A 1 21 ? 0.933   -1.429  -5.008  1.00 0.00 ? 21 LEU A HD11 8  
ATOM 9832  H HD12 . LEU A 1 21 ? 0.371   -3.098  -4.923  1.00 0.00 ? 21 LEU A HD12 8  
ATOM 9833  H HD13 . LEU A 1 21 ? 1.922   -2.726  -5.676  1.00 0.00 ? 21 LEU A HD13 8  
ATOM 9834  H HD21 . LEU A 1 21 ? 0.476   -1.249  -2.779  1.00 0.00 ? 21 LEU A HD21 8  
ATOM 9835  H HD22 . LEU A 1 21 ? 2.137   -0.661  -2.708  1.00 0.00 ? 21 LEU A HD22 8  
ATOM 9836  H HD23 . LEU A 1 21 ? 1.585   -1.882  -1.562  1.00 0.00 ? 21 LEU A HD23 8  
ATOM 9837  N N    . SER A 1 22 ? -0.316  -6.599  -2.670  1.00 0.00 ? 22 SER A N    8  
ATOM 9838  C CA   . SER A 1 22 ? -0.828  -7.824  -3.255  1.00 0.00 ? 22 SER A CA   8  
ATOM 9839  C C    . SER A 1 22 ? -2.342  -7.866  -3.127  1.00 0.00 ? 22 SER A C    8  
ATOM 9840  O O    . SER A 1 22 ? -3.040  -8.405  -3.986  1.00 0.00 ? 22 SER A O    8  
ATOM 9841  C CB   . SER A 1 22 ? -0.206  -9.046  -2.577  1.00 0.00 ? 22 SER A CB   8  
ATOM 9842  O OG   . SER A 1 22 ? -0.717  -10.249 -3.124  1.00 0.00 ? 22 SER A OG   8  
ATOM 9843  H H    . SER A 1 22 ? 0.080   -6.628  -1.778  1.00 0.00 ? 22 SER A H    8  
ATOM 9844  H HA   . SER A 1 22 ? -0.567  -7.824  -4.294  1.00 0.00 ? 22 SER A HA   8  
ATOM 9845  H HB2  . SER A 1 22 ? 0.864   -9.028  -2.718  1.00 0.00 ? 22 SER A HB2  8  
ATOM 9846  H HB3  . SER A 1 22 ? -0.430  -9.022  -1.520  1.00 0.00 ? 22 SER A HB3  8  
ATOM 9847  H HG   . SER A 1 22 ? -1.625  -10.372 -2.836  1.00 0.00 ? 22 SER A HG   8  
ATOM 9848  N N    . ILE A 1 23 ? -2.839  -7.283  -2.045  1.00 0.00 ? 23 ILE A N    8  
ATOM 9849  C CA   . ILE A 1 23 ? -4.269  -7.236  -1.789  1.00 0.00 ? 23 ILE A CA   8  
ATOM 9850  C C    . ILE A 1 23 ? -4.915  -6.078  -2.535  1.00 0.00 ? 23 ILE A C    8  
ATOM 9851  O O    . ILE A 1 23 ? -6.011  -6.201  -3.082  1.00 0.00 ? 23 ILE A O    8  
ATOM 9852  C CB   . ILE A 1 23 ? -4.567  -7.118  -0.276  1.00 0.00 ? 23 ILE A CB   8  
ATOM 9853  C CG1  . ILE A 1 23 ? -5.784  -7.968  0.092   1.00 0.00 ? 23 ILE A CG1  8  
ATOM 9854  C CG2  . ILE A 1 23 ? -4.778  -5.668  0.144   1.00 0.00 ? 23 ILE A CG2  8  
ATOM 9855  C CD1  . ILE A 1 23 ? -5.728  -8.527  1.497   1.00 0.00 ? 23 ILE A CD1  8  
ATOM 9856  H H    . ILE A 1 23 ? -2.225  -6.870  -1.404  1.00 0.00 ? 23 ILE A H    8  
ATOM 9857  H HA   . ILE A 1 23 ? -4.690  -8.153  -2.146  1.00 0.00 ? 23 ILE A HA   8  
ATOM 9858  H HB   . ILE A 1 23 ? -3.709  -7.489  0.254   1.00 0.00 ? 23 ILE A HB   8  
ATOM 9859  H HG12 . ILE A 1 23 ? -6.675  -7.363  0.013   1.00 0.00 ? 23 ILE A HG12 8  
ATOM 9860  H HG13 . ILE A 1 23 ? -5.856  -8.799  -0.594  1.00 0.00 ? 23 ILE A HG13 8  
ATOM 9861  H HG21 . ILE A 1 23 ? -5.689  -5.293  -0.299  1.00 0.00 ? 23 ILE A HG21 8  
ATOM 9862  H HG22 . ILE A 1 23 ? -3.943  -5.070  -0.190  1.00 0.00 ? 23 ILE A HG22 8  
ATOM 9863  H HG23 . ILE A 1 23 ? -4.852  -5.612  1.220   1.00 0.00 ? 23 ILE A HG23 8  
ATOM 9864  H HD11 . ILE A 1 23 ? -6.638  -8.276  2.022   1.00 0.00 ? 23 ILE A HD11 8  
ATOM 9865  H HD12 . ILE A 1 23 ? -4.883  -8.103  2.020   1.00 0.00 ? 23 ILE A HD12 8  
ATOM 9866  H HD13 . ILE A 1 23 ? -5.622  -9.601  1.453   1.00 0.00 ? 23 ILE A HD13 8  
ATOM 9867  N N    . TYR A 1 24 ? -4.218  -4.954  -2.541  1.00 0.00 ? 24 TYR A N    8  
ATOM 9868  C CA   . TYR A 1 24 ? -4.697  -3.754  -3.205  1.00 0.00 ? 24 TYR A CA   8  
ATOM 9869  C C    . TYR A 1 24 ? -3.954  -3.509  -4.517  1.00 0.00 ? 24 TYR A C    8  
ATOM 9870  O O    . TYR A 1 24 ? -3.091  -2.634  -4.597  1.00 0.00 ? 24 TYR A O    8  
ATOM 9871  C CB   . TYR A 1 24 ? -4.553  -2.547  -2.291  1.00 0.00 ? 24 TYR A CB   8  
ATOM 9872  C CG   . TYR A 1 24 ? -5.196  -2.728  -0.935  1.00 0.00 ? 24 TYR A CG   8  
ATOM 9873  C CD1  . TYR A 1 24 ? -6.551  -3.013  -0.820  1.00 0.00 ? 24 TYR A CD1  8  
ATOM 9874  C CD2  . TYR A 1 24 ? -4.448  -2.615  0.229   1.00 0.00 ? 24 TYR A CD2  8  
ATOM 9875  C CE1  . TYR A 1 24 ? -7.142  -3.180  0.418   1.00 0.00 ? 24 TYR A CE1  8  
ATOM 9876  C CE2  . TYR A 1 24 ? -5.031  -2.780  1.471   1.00 0.00 ? 24 TYR A CE2  8  
ATOM 9877  C CZ   . TYR A 1 24 ? -6.378  -3.063  1.560   1.00 0.00 ? 24 TYR A CZ   8  
ATOM 9878  O OH   . TYR A 1 24 ? -6.962  -3.228  2.795   1.00 0.00 ? 24 TYR A OH   8  
ATOM 9879  H H    . TYR A 1 24 ? -3.362  -4.934  -2.082  1.00 0.00 ? 24 TYR A H    8  
ATOM 9880  H HA   . TYR A 1 24 ? -5.729  -3.896  -3.416  1.00 0.00 ? 24 TYR A HA   8  
ATOM 9881  H HB2  . TYR A 1 24 ? -3.513  -2.360  -2.141  1.00 0.00 ? 24 TYR A HB2  8  
ATOM 9882  H HB3  . TYR A 1 24 ? -5.006  -1.688  -2.764  1.00 0.00 ? 24 TYR A HB3  8  
ATOM 9883  H HD1  . TYR A 1 24 ? -7.146  -3.105  -1.717  1.00 0.00 ? 24 TYR A HD1  8  
ATOM 9884  H HD2  . TYR A 1 24 ? -3.393  -2.393  0.156   1.00 0.00 ? 24 TYR A HD2  8  
ATOM 9885  H HE1  . TYR A 1 24 ? -8.197  -3.401  0.487   1.00 0.00 ? 24 TYR A HE1  8  
ATOM 9886  H HE2  . TYR A 1 24 ? -4.432  -2.688  2.365   1.00 0.00 ? 24 TYR A HE2  8  
ATOM 9887  H HH   . TYR A 1 24 ? -6.726  -2.491  3.363   1.00 0.00 ? 24 TYR A HH   8  
ATOM 9888  N N    . PRO A 1 25 ? -4.283  -4.279  -5.568  1.00 0.00 ? 25 PRO A N    8  
ATOM 9889  C CA   . PRO A 1 25 ? -3.647  -4.142  -6.881  1.00 0.00 ? 25 PRO A CA   8  
ATOM 9890  C C    . PRO A 1 25 ? -3.972  -2.807  -7.545  1.00 0.00 ? 25 PRO A C    8  
ATOM 9891  O O    . PRO A 1 25 ? -4.988  -2.183  -7.239  1.00 0.00 ? 25 PRO A O    8  
ATOM 9892  C CB   . PRO A 1 25 ? -4.241  -5.298  -7.686  1.00 0.00 ? 25 PRO A CB   8  
ATOM 9893  C CG   . PRO A 1 25 ? -5.530  -5.599  -7.020  1.00 0.00 ? 25 PRO A CG   8  
ATOM 9894  C CD   . PRO A 1 25 ? -5.300  -5.343  -5.563  1.00 0.00 ? 25 PRO A CD   8  
ATOM 9895  H HA   . PRO A 1 25 ? -2.580  -4.261  -6.816  1.00 0.00 ? 25 PRO A HA   8  
ATOM 9896  H HB2  . PRO A 1 25 ? -4.392  -4.988  -8.703  1.00 0.00 ? 25 PRO A HB2  8  
ATOM 9897  H HB3  . PRO A 1 25 ? -3.573  -6.146  -7.655  1.00 0.00 ? 25 PRO A HB3  8  
ATOM 9898  H HG2  . PRO A 1 25 ? -6.298  -4.944  -7.399  1.00 0.00 ? 25 PRO A HG2  8  
ATOM 9899  H HG3  . PRO A 1 25 ? -5.796  -6.630  -7.183  1.00 0.00 ? 25 PRO A HG3  8  
ATOM 9900  H HD2  . PRO A 1 25 ? -6.209  -5.007  -5.092  1.00 0.00 ? 25 PRO A HD2  8  
ATOM 9901  H HD3  . PRO A 1 25 ? -4.925  -6.230  -5.083  1.00 0.00 ? 25 PRO A HD3  8  
ATOM 9902  N N    . PRO A 1 26 ? -3.109  -2.349  -8.468  1.00 0.00 ? 26 PRO A N    8  
ATOM 9903  C CA   . PRO A 1 26 ? -3.313  -1.081  -9.175  1.00 0.00 ? 26 PRO A CA   8  
ATOM 9904  C C    . PRO A 1 26 ? -4.638  -1.039  -9.927  1.00 0.00 ? 26 PRO A C    8  
ATOM 9905  O O    . PRO A 1 26 ? -5.149  0.034   -10.247 1.00 0.00 ? 26 PRO A O    8  
ATOM 9906  C CB   . PRO A 1 26 ? -2.144  -1.011  -10.155 1.00 0.00 ? 26 PRO A CB   8  
ATOM 9907  C CG   . PRO A 1 26 ? -1.121  -1.957  -9.625  1.00 0.00 ? 26 PRO A CG   8  
ATOM 9908  C CD   . PRO A 1 26 ? -1.876  -3.030  -8.893  1.00 0.00 ? 26 PRO A CD   8  
ATOM 9909  H HA   . PRO A 1 26 ? -3.264  -0.248  -8.507  1.00 0.00 ? 26 PRO A HA   8  
ATOM 9910  H HB2  . PRO A 1 26 ? -2.486  -1.302  -11.129 1.00 0.00 ? 26 PRO A HB2  8  
ATOM 9911  H HB3  . PRO A 1 26 ? -1.764  -0.001  -10.191 1.00 0.00 ? 26 PRO A HB3  8  
ATOM 9912  H HG2  . PRO A 1 26 ? -0.561  -2.386  -10.443 1.00 0.00 ? 26 PRO A HG2  8  
ATOM 9913  H HG3  . PRO A 1 26 ? -0.458  -1.438  -8.948  1.00 0.00 ? 26 PRO A HG3  8  
ATOM 9914  H HD2  . PRO A 1 26 ? -2.099  -3.854  -9.555  1.00 0.00 ? 26 PRO A HD2  8  
ATOM 9915  H HD3  . PRO A 1 26 ? -1.311  -3.372  -8.039  1.00 0.00 ? 26 PRO A HD3  8  
ATOM 9916  N N    . CYS A 1 27 ? -5.188  -2.213  -10.205 1.00 0.00 ? 27 CYS A N    8  
ATOM 9917  C CA   . CYS A 1 27 ? -6.450  -2.318  -10.917 1.00 0.00 ? 27 CYS A CA   8  
ATOM 9918  C C    . CYS A 1 27 ? -7.096  -3.681  -10.687 1.00 0.00 ? 27 CYS A C    8  
ATOM 9919  O O    . CYS A 1 27 ? -6.509  -4.558  -10.053 1.00 0.00 ? 27 CYS A O    8  
ATOM 9920  C CB   . CYS A 1 27 ? -6.233  -2.087  -12.408 1.00 0.00 ? 27 CYS A CB   8  
ATOM 9921  S SG   . CYS A 1 27 ? -7.321  -0.836  -13.129 1.00 0.00 ? 27 CYS A SG   8  
ATOM 9922  H H    . CYS A 1 27 ? -4.735  -3.028  -9.925  1.00 0.00 ? 27 CYS A H    8  
ATOM 9923  H HA   . CYS A 1 27 ? -7.104  -1.558  -10.540 1.00 0.00 ? 27 CYS A HA   8  
ATOM 9924  H HB2  . CYS A 1 27 ? -5.214  -1.770  -12.572 1.00 0.00 ? 27 CYS A HB2  8  
ATOM 9925  H HB3  . CYS A 1 27 ? -6.404  -3.011  -12.928 1.00 0.00 ? 27 CYS A HB3  8  
ATOM 9926  H HG   . CYS A 1 27 ? -8.029  -0.663  -12.505 1.00 0.00 ? 27 CYS A HG   8  
ATOM 9927  N N    . GLY A 1 28 ? -8.307  -3.852  -11.208 1.00 0.00 ? 28 GLY A N    8  
ATOM 9928  C CA   . GLY A 1 28 ? -9.011  -5.111  -11.050 1.00 0.00 ? 28 GLY A CA   8  
ATOM 9929  C C    . GLY A 1 28 ? -10.209 -4.996  -10.128 1.00 0.00 ? 28 GLY A C    8  
ATOM 9930  O O    . GLY A 1 28 ? -11.272 -5.548  -10.410 1.00 0.00 ? 28 GLY A O    8  
ATOM 9931  H H    . GLY A 1 28 ? -8.724  -3.118  -11.704 1.00 0.00 ? 28 GLY A H    8  
ATOM 9932  H HA2  . GLY A 1 28 ? -9.349  -5.444  -12.020 1.00 0.00 ? 28 GLY A HA2  8  
ATOM 9933  H HA3  . GLY A 1 28 ? -8.330  -5.845  -10.647 1.00 0.00 ? 28 GLY A HA3  8  
ATOM 9934  N N    . ARG A 1 29 ? -10.038 -4.276  -9.024  1.00 0.00 ? 29 ARG A N    8  
ATOM 9935  C CA   . ARG A 1 29 ? -11.112 -4.091  -8.060  1.00 0.00 ? 29 ARG A CA   8  
ATOM 9936  C C    . ARG A 1 29 ? -10.858 -2.866  -7.187  1.00 0.00 ? 29 ARG A C    8  
ATOM 9937  O O    . ARG A 1 29 ? -9.763  -2.304  -7.190  1.00 0.00 ? 29 ARG A O    8  
ATOM 9938  C CB   . ARG A 1 29 ? -11.264 -5.336  -7.185  1.00 0.00 ? 29 ARG A CB   8  
ATOM 9939  C CG   . ARG A 1 29 ? -11.869 -6.523  -7.916  1.00 0.00 ? 29 ARG A CG   8  
ATOM 9940  C CD   . ARG A 1 29 ? -12.285 -7.620  -6.949  1.00 0.00 ? 29 ARG A CD   8  
ATOM 9941  N NE   . ARG A 1 29 ? -12.383 -8.921  -7.606  1.00 0.00 ? 29 ARG A NE   8  
ATOM 9942  C CZ   . ARG A 1 29 ? -12.393 -10.082 -6.955  1.00 0.00 ? 29 ARG A CZ   8  
ATOM 9943  N NH1  . ARG A 1 29 ? -12.313 -10.108 -5.630  1.00 0.00 ? 29 ARG A NH1  8  
ATOM 9944  N NH2  . ARG A 1 29 ? -12.486 -11.220 -7.629  1.00 0.00 ? 29 ARG A NH2  8  
ATOM 9945  H H    . ARG A 1 29 ? -9.172  -3.859  -8.855  1.00 0.00 ? 29 ARG A H    8  
ATOM 9946  H HA   . ARG A 1 29 ? -12.022 -3.938  -8.614  1.00 0.00 ? 29 ARG A HA   8  
ATOM 9947  H HB2  . ARG A 1 29 ? -10.290 -5.625  -6.818  1.00 0.00 ? 29 ARG A HB2  8  
ATOM 9948  H HB3  . ARG A 1 29 ? -11.899 -5.096  -6.345  1.00 0.00 ? 29 ARG A HB3  8  
ATOM 9949  H HG2  . ARG A 1 29 ? -12.738 -6.192  -8.464  1.00 0.00 ? 29 ARG A HG2  8  
ATOM 9950  H HG3  . ARG A 1 29 ? -11.137 -6.921  -8.604  1.00 0.00 ? 29 ARG A HG3  8  
ATOM 9951  H HD2  . ARG A 1 29 ? -11.552 -7.682  -6.158  1.00 0.00 ? 29 ARG A HD2  8  
ATOM 9952  H HD3  . ARG A 1 29 ? -13.246 -7.365  -6.529  1.00 0.00 ? 29 ARG A HD3  8  
ATOM 9953  H HE   . ARG A 1 29 ? -12.444 -8.931  -8.584  1.00 0.00 ? 29 ARG A HE   8  
ATOM 9954  H HH11 . ARG A 1 29 ? -12.243 -9.254  -5.115  1.00 0.00 ? 29 ARG A HH11 8  
ATOM 9955  H HH12 . ARG A 1 29 ? -12.321 -10.983 -5.146  1.00 0.00 ? 29 ARG A HH12 8  
ATOM 9956  H HH21 . ARG A 1 29 ? -12.547 -11.205 -8.627  1.00 0.00 ? 29 ARG A HH21 8  
ATOM 9957  H HH22 . ARG A 1 29 ? -12.493 -12.092 -7.140  1.00 0.00 ? 29 ARG A HH22 8  
ATOM 9958  N N    . ARG A 1 30 ? -11.878 -2.460  -6.437  1.00 0.00 ? 30 ARG A N    8  
ATOM 9959  C CA   . ARG A 1 30 ? -11.770 -1.310  -5.557  1.00 0.00 ? 30 ARG A CA   8  
ATOM 9960  C C    . ARG A 1 30 ? -12.511 -1.558  -4.246  1.00 0.00 ? 30 ARG A C    8  
ATOM 9961  O O    . ARG A 1 30 ? -13.699 -1.261  -4.127  1.00 0.00 ? 30 ARG A O    8  
ATOM 9962  C CB   . ARG A 1 30 ? -12.320 -0.058  -6.244  1.00 0.00 ? 30 ARG A CB   8  
ATOM 9963  C CG   . ARG A 1 30 ? -11.469 1.181   -6.022  1.00 0.00 ? 30 ARG A CG   8  
ATOM 9964  C CD   . ARG A 1 30 ? -10.038 0.967   -6.489  1.00 0.00 ? 30 ARG A CD   8  
ATOM 9965  N NE   . ARG A 1 30 ? -9.518  2.127   -7.209  1.00 0.00 ? 30 ARG A NE   8  
ATOM 9966  C CZ   . ARG A 1 30 ? -9.803  2.399   -8.481  1.00 0.00 ? 30 ARG A CZ   8  
ATOM 9967  N NH1  . ARG A 1 30 ? -10.603 1.599   -9.175  1.00 0.00 ? 30 ARG A NH1  8  
ATOM 9968  N NH2  . ARG A 1 30 ? -9.288  3.475   -9.060  1.00 0.00 ? 30 ARG A NH2  8  
ATOM 9969  H H    . ARG A 1 30 ? -12.719 -2.948  -6.474  1.00 0.00 ? 30 ARG A H    8  
ATOM 9970  H HA   . ARG A 1 30 ? -10.729 -1.165  -5.344  1.00 0.00 ? 30 ARG A HA   8  
ATOM 9971  H HB2  . ARG A 1 30 ? -12.379 -0.242  -7.307  1.00 0.00 ? 30 ARG A HB2  8  
ATOM 9972  H HB3  . ARG A 1 30 ? -13.312 0.140   -5.867  1.00 0.00 ? 30 ARG A HB3  8  
ATOM 9973  H HG2  . ARG A 1 30 ? -11.897 2.004   -6.574  1.00 0.00 ? 30 ARG A HG2  8  
ATOM 9974  H HG3  . ARG A 1 30 ? -11.463 1.417   -4.968  1.00 0.00 ? 30 ARG A HG3  8  
ATOM 9975  H HD2  . ARG A 1 30 ? -9.415  0.783   -5.626  1.00 0.00 ? 30 ARG A HD2  8  
ATOM 9976  H HD3  . ARG A 1 30 ? -10.011 0.107   -7.142  1.00 0.00 ? 30 ARG A HD3  8  
ATOM 9977  H HE   . ARG A 1 30 ? -8.925  2.735   -6.720  1.00 0.00 ? 30 ARG A HE   8  
ATOM 9978  H HH11 . ARG A 1 30 ? -10.995 0.786   -8.744  1.00 0.00 ? 30 ARG A HH11 8  
ATOM 9979  H HH12 . ARG A 1 30 ? -10.813 1.809   -10.130 1.00 0.00 ? 30 ARG A HH12 8  
ATOM 9980  H HH21 . ARG A 1 30 ? -8.685  4.081   -8.541  1.00 0.00 ? 30 ARG A HH21 8  
ATOM 9981  H HH22 . ARG A 1 30 ? -9.502  3.680   -10.015 1.00 0.00 ? 30 ARG A HH22 8  
ATOM 9982  N N    . LYS A 1 31 ? -11.801 -2.107  -3.266  1.00 0.00 ? 31 LYS A N    8  
ATOM 9983  C CA   . LYS A 1 31 ? -12.389 -2.399  -1.966  1.00 0.00 ? 31 LYS A CA   8  
ATOM 9984  C C    . LYS A 1 31 ? -12.707 -1.115  -1.205  1.00 0.00 ? 31 LYS A C    8  
ATOM 9985  O O    . LYS A 1 31 ? -11.811 -0.334  -0.885  1.00 0.00 ? 31 LYS A O    8  
ATOM 9986  C CB   . LYS A 1 31 ? -11.443 -3.273  -1.140  1.00 0.00 ? 31 LYS A CB   8  
ATOM 9987  C CG   . LYS A 1 31 ? -11.563 -4.757  -1.447  1.00 0.00 ? 31 LYS A CG   8  
ATOM 9988  C CD   . LYS A 1 31 ? -12.984 -5.256  -1.240  1.00 0.00 ? 31 LYS A CD   8  
ATOM 9989  C CE   . LYS A 1 31 ? -13.007 -6.714  -0.813  1.00 0.00 ? 31 LYS A CE   8  
ATOM 9990  N NZ   . LYS A 1 31 ? -13.152 -6.860  0.661   1.00 0.00 ? 31 LYS A NZ   8  
ATOM 9991  H H    . LYS A 1 31 ? -10.860 -2.325  -3.422  1.00 0.00 ? 31 LYS A H    8  
ATOM 9992  H HA   . LYS A 1 31 ? -13.306 -2.940  -2.135  1.00 0.00 ? 31 LYS A HA   8  
ATOM 9993  H HB2  . LYS A 1 31 ? -10.426 -2.968  -1.337  1.00 0.00 ? 31 LYS A HB2  8  
ATOM 9994  H HB3  . LYS A 1 31 ? -11.658 -3.126  -0.092  1.00 0.00 ? 31 LYS A HB3  8  
ATOM 9995  H HG2  . LYS A 1 31 ? -11.279 -4.927  -2.474  1.00 0.00 ? 31 LYS A HG2  8  
ATOM 9996  H HG3  . LYS A 1 31 ? -10.900 -5.305  -0.793  1.00 0.00 ? 31 LYS A HG3  8  
ATOM 9997  H HD2  . LYS A 1 31 ? -13.457 -4.660  -0.473  1.00 0.00 ? 31 LYS A HD2  8  
ATOM 9998  H HD3  . LYS A 1 31 ? -13.530 -5.152  -2.167  1.00 0.00 ? 31 LYS A HD3  8  
ATOM 9999  H HE2  . LYS A 1 31 ? -13.837 -7.205  -1.298  1.00 0.00 ? 31 LYS A HE2  8  
ATOM 10000 H HE3  . LYS A 1 31 ? -12.083 -7.181  -1.124  1.00 0.00 ? 31 LYS A HE3  8  
ATOM 10001 H HZ1  . LYS A 1 31 ? -12.215 -6.877  1.113   1.00 0.00 ? 31 LYS A HZ1  8  
ATOM 10002 H HZ2  . LYS A 1 31 ? -13.648 -7.745  0.886   1.00 0.00 ? 31 LYS A HZ2  8  
ATOM 10003 H HZ3  . LYS A 1 31 ? -13.697 -6.062  1.047   1.00 0.00 ? 31 LYS A HZ3  8  
ATOM 10004 N N    . ILE A 1 32 ? -13.987 -0.907  -0.914  1.00 0.00 ? 32 ILE A N    8  
ATOM 10005 C CA   . ILE A 1 32 ? -14.426 0.273   -0.189  1.00 0.00 ? 32 ILE A CA   8  
ATOM 10006 C C    . ILE A 1 32 ? -15.573 -0.068  0.758   1.00 0.00 ? 32 ILE A C    8  
ATOM 10007 O O    . ILE A 1 32 ? -16.662 -0.439  0.322   1.00 0.00 ? 32 ILE A O    8  
ATOM 10008 C CB   . ILE A 1 32 ? -14.876 1.412   -1.134  1.00 0.00 ? 32 ILE A CB   8  
ATOM 10009 C CG1  . ILE A 1 32 ? -14.724 1.013   -2.606  1.00 0.00 ? 32 ILE A CG1  8  
ATOM 10010 C CG2  . ILE A 1 32 ? -14.087 2.681   -0.846  1.00 0.00 ? 32 ILE A CG2  8  
ATOM 10011 C CD1  . ILE A 1 32 ? -15.838 0.121   -3.109  1.00 0.00 ? 32 ILE A CD1  8  
ATOM 10012 H H    . ILE A 1 32 ? -14.651 -1.562  -1.189  1.00 0.00 ? 32 ILE A H    8  
ATOM 10013 H HA   . ILE A 1 32 ? -13.595 0.623   0.389   1.00 0.00 ? 32 ILE A HA   8  
ATOM 10014 H HB   . ILE A 1 32 ? -15.914 1.616   -0.933  1.00 0.00 ? 32 ILE A HB   8  
ATOM 10015 H HG12 . ILE A 1 32 ? -14.718 1.906   -3.214  1.00 0.00 ? 32 ILE A HG12 8  
ATOM 10016 H HG13 . ILE A 1 32 ? -13.790 0.489   -2.738  1.00 0.00 ? 32 ILE A HG13 8  
ATOM 10017 H HG21 . ILE A 1 32 ? -13.231 2.729   -1.502  1.00 0.00 ? 32 ILE A HG21 8  
ATOM 10018 H HG22 . ILE A 1 32 ? -13.754 2.673   0.181   1.00 0.00 ? 32 ILE A HG22 8  
ATOM 10019 H HG23 . ILE A 1 32 ? -14.717 3.542   -1.014  1.00 0.00 ? 32 ILE A HG23 8  
ATOM 10020 H HD11 . ILE A 1 32 ? -15.885 -0.773  -2.505  1.00 0.00 ? 32 ILE A HD11 8  
ATOM 10021 H HD12 . ILE A 1 32 ? -15.646 -0.150  -4.137  1.00 0.00 ? 32 ILE A HD12 8  
ATOM 10022 H HD13 . ILE A 1 32 ? -16.778 0.648   -3.046  1.00 0.00 ? 32 ILE A HD13 8  
ATOM 10023 N N    . ILE A 1 33 ? -15.319 0.057   2.057   1.00 0.00 ? 33 ILE A N    8  
ATOM 10024 C CA   . ILE A 1 33 ? -16.329 -0.240  3.064   1.00 0.00 ? 33 ILE A CA   8  
ATOM 10025 C C    . ILE A 1 33 ? -17.378 0.864   3.135   1.00 0.00 ? 33 ILE A C    8  
ATOM 10026 O O    . ILE A 1 33 ? -17.353 1.702   4.038   1.00 0.00 ? 33 ILE A O    8  
ATOM 10027 C CB   . ILE A 1 33 ? -15.715 -0.435  4.460   1.00 0.00 ? 33 ILE A CB   8  
ATOM 10028 C CG1  . ILE A 1 33 ? -14.303 -1.020  4.363   1.00 0.00 ? 33 ILE A CG1  8  
ATOM 10029 C CG2  . ILE A 1 33 ? -16.607 -1.330  5.308   1.00 0.00 ? 33 ILE A CG2  8  
ATOM 10030 C CD1  . ILE A 1 33 ? -13.210 0.019   4.494   1.00 0.00 ? 33 ILE A CD1  8  
ATOM 10031 H H    . ILE A 1 33 ? -14.434 0.354   2.344   1.00 0.00 ? 33 ILE A H    8  
ATOM 10032 H HA   . ILE A 1 33 ? -16.809 -1.154  2.786   1.00 0.00 ? 33 ILE A HA   8  
ATOM 10033 H HB   . ILE A 1 33 ? -15.669 0.525   4.929   1.00 0.00 ? 33 ILE A HB   8  
ATOM 10034 H HG12 . ILE A 1 33 ? -14.165 -1.745  5.151   1.00 0.00 ? 33 ILE A HG12 8  
ATOM 10035 H HG13 . ILE A 1 33 ? -14.186 -1.507  3.407   1.00 0.00 ? 33 ILE A HG13 8  
ATOM 10036 H HG21 . ILE A 1 33 ? -16.717 -2.290  4.825   1.00 0.00 ? 33 ILE A HG21 8  
ATOM 10037 H HG22 . ILE A 1 33 ? -17.578 -0.869  5.419   1.00 0.00 ? 33 ILE A HG22 8  
ATOM 10038 H HG23 . ILE A 1 33 ? -16.159 -1.465  6.281   1.00 0.00 ? 33 ILE A HG23 8  
ATOM 10039 H HD11 . ILE A 1 33 ? -12.694 -0.116  5.433   1.00 0.00 ? 33 ILE A HD11 8  
ATOM 10040 H HD12 . ILE A 1 33 ? -13.647 1.007   4.462   1.00 0.00 ? 33 ILE A HD12 8  
ATOM 10041 H HD13 . ILE A 1 33 ? -12.510 -0.091  3.679   1.00 0.00 ? 33 ILE A HD13 8  
ATOM 10042 N N    . LEU A 1 34 ? -18.299 0.862   2.177   1.00 0.00 ? 34 LEU A N    8  
ATOM 10043 C CA   . LEU A 1 34 ? -19.354 1.861   2.130   1.00 0.00 ? 34 LEU A CA   8  
ATOM 10044 C C    . LEU A 1 34 ? -20.528 1.467   3.022   1.00 0.00 ? 34 LEU A C    8  
ATOM 10045 O O    . LEU A 1 34 ? -21.308 2.317   3.449   1.00 0.00 ? 34 LEU A O    8  
ATOM 10046 C CB   . LEU A 1 34 ? -19.828 2.064   0.692   1.00 0.00 ? 34 LEU A CB   8  
ATOM 10047 C CG   . LEU A 1 34 ? -19.544 3.450   0.106   1.00 0.00 ? 34 LEU A CG   8  
ATOM 10048 C CD1  . LEU A 1 34 ? -18.440 3.376   -0.938  1.00 0.00 ? 34 LEU A CD1  8  
ATOM 10049 C CD2  . LEU A 1 34 ? -20.808 4.046   -0.497  1.00 0.00 ? 34 LEU A CD2  8  
ATOM 10050 H H    . LEU A 1 34 ? -18.266 0.174   1.486   1.00 0.00 ? 34 LEU A H    8  
ATOM 10051 H HA   . LEU A 1 34 ? -18.941 2.780   2.489   1.00 0.00 ? 34 LEU A HA   8  
ATOM 10052 H HB2  . LEU A 1 34 ? -19.340 1.327   0.074   1.00 0.00 ? 34 LEU A HB2  8  
ATOM 10053 H HB3  . LEU A 1 34 ? -20.892 1.892   0.656   1.00 0.00 ? 34 LEU A HB3  8  
ATOM 10054 H HG   . LEU A 1 34 ? -19.209 4.106   0.897   1.00 0.00 ? 34 LEU A HG   8  
ATOM 10055 H HD11 . LEU A 1 34 ? -18.541 2.462   -1.505  1.00 0.00 ? 34 LEU A HD11 8  
ATOM 10056 H HD12 . LEU A 1 34 ? -17.478 3.389   -0.446  1.00 0.00 ? 34 LEU A HD12 8  
ATOM 10057 H HD13 . LEU A 1 34 ? -18.516 4.223   -1.604  1.00 0.00 ? 34 LEU A HD13 8  
ATOM 10058 H HD21 . LEU A 1 34 ? -21.012 3.573   -1.446  1.00 0.00 ? 34 LEU A HD21 8  
ATOM 10059 H HD22 . LEU A 1 34 ? -20.671 5.107   -0.646  1.00 0.00 ? 34 LEU A HD22 8  
ATOM 10060 H HD23 . LEU A 1 34 ? -21.639 3.881   0.174   1.00 0.00 ? 34 LEU A HD23 8  
ATOM 10061 N N    . SER A 1 35 ? -20.647 0.174   3.298   1.00 0.00 ? 35 SER A N    8  
ATOM 10062 C CA   . SER A 1 35 ? -21.726 -0.331  4.138   1.00 0.00 ? 35 SER A CA   8  
ATOM 10063 C C    . SER A 1 35 ? -21.628 0.228   5.554   1.00 0.00 ? 35 SER A C    8  
ATOM 10064 O O    . SER A 1 35 ? -22.624 0.300   6.273   1.00 0.00 ? 35 SER A O    8  
ATOM 10065 C CB   . SER A 1 35 ? -21.701 -1.858  4.173   1.00 0.00 ? 35 SER A CB   8  
ATOM 10066 O OG   . SER A 1 35 ? -22.891 -2.400  3.627   1.00 0.00 ? 35 SER A OG   8  
ATOM 10067 H H    . SER A 1 35 ? -19.995 -0.455  2.928   1.00 0.00 ? 35 SER A H    8  
ATOM 10068 H HA   . SER A 1 35 ? -22.654 -0.012  3.705   1.00 0.00 ? 35 SER A HA   8  
ATOM 10069 H HB2  . SER A 1 35 ? -20.863 -2.212  3.596   1.00 0.00 ? 35 SER A HB2  8  
ATOM 10070 H HB3  . SER A 1 35 ? -21.604 -2.190  5.194   1.00 0.00 ? 35 SER A HB3  8  
ATOM 10071 H HG   . SER A 1 35 ? -22.852 -2.358  2.668   1.00 0.00 ? 35 SER A HG   8  
ATOM 10072 N N    . ASP A 1 36 ? -20.423 0.621   5.945   1.00 0.00 ? 36 ASP A N    8  
ATOM 10073 C CA   . ASP A 1 36 ? -20.192 1.172   7.271   1.00 0.00 ? 36 ASP A CA   8  
ATOM 10074 C C    . ASP A 1 36 ? -20.665 2.620   7.351   1.00 0.00 ? 36 ASP A C    8  
ATOM 10075 O O    . ASP A 1 36 ? -21.631 2.930   8.048   1.00 0.00 ? 36 ASP A O    8  
ATOM 10076 C CB   . ASP A 1 36 ? -18.707 1.088   7.631   1.00 0.00 ? 36 ASP A CB   8  
ATOM 10077 C CG   . ASP A 1 36 ? -18.484 0.839   9.110   1.00 0.00 ? 36 ASP A CG   8  
ATOM 10078 O OD1  . ASP A 1 36 ? -18.746 -0.293  9.568   1.00 0.00 ? 36 ASP A OD1  8  
ATOM 10079 O OD2  . ASP A 1 36 ? -18.046 1.776   9.810   1.00 0.00 ? 36 ASP A OD2  8  
ATOM 10080 H H    . ASP A 1 36 ? -19.672 0.537   5.330   1.00 0.00 ? 36 ASP A H    8  
ATOM 10081 H HA   . ASP A 1 36 ? -20.756 0.582   7.973   1.00 0.00 ? 36 ASP A HA   8  
ATOM 10082 H HB2  . ASP A 1 36 ? -18.254 0.279   7.077   1.00 0.00 ? 36 ASP A HB2  8  
ATOM 10083 H HB3  . ASP A 1 36 ? -18.225 2.016   7.363   1.00 0.00 ? 36 ASP A HB3  8  
ATOM 10084 N N    . GLU A 1 37 ? -19.976 3.502   6.633   1.00 0.00 ? 37 GLU A N    8  
ATOM 10085 C CA   . GLU A 1 37 ? -20.321 4.913   6.622   1.00 0.00 ? 37 GLU A CA   8  
ATOM 10086 C C    . GLU A 1 37 ? -20.832 5.350   5.252   1.00 0.00 ? 37 GLU A C    8  
ATOM 10087 O O    . GLU A 1 37 ? -21.579 6.322   5.139   1.00 0.00 ? 37 GLU A O    8  
ATOM 10088 C CB   . GLU A 1 37 ? -19.114 5.758   7.028   1.00 0.00 ? 37 GLU A CB   8  
ATOM 10089 C CG   . GLU A 1 37 ? -19.327 6.543   8.308   1.00 0.00 ? 37 GLU A CG   8  
ATOM 10090 C CD   . GLU A 1 37 ? -19.223 8.042   8.100   1.00 0.00 ? 37 GLU A CD   8  
ATOM 10091 O OE1  . GLU A 1 37 ? -18.102 8.580   8.211   1.00 0.00 ? 37 GLU A OE1  8  
ATOM 10092 O OE2  . GLU A 1 37 ? -20.263 8.677   7.826   1.00 0.00 ? 37 GLU A OE2  8  
ATOM 10093 H H    . GLU A 1 37 ? -19.221 3.197   6.103   1.00 0.00 ? 37 GLU A H    8  
ATOM 10094 H HA   . GLU A 1 37 ? -21.097 5.056   7.339   1.00 0.00 ? 37 GLU A HA   8  
ATOM 10095 H HB2  . GLU A 1 37 ? -18.268 5.106   7.170   1.00 0.00 ? 37 GLU A HB2  8  
ATOM 10096 H HB3  . GLU A 1 37 ? -18.895 6.455   6.238   1.00 0.00 ? 37 GLU A HB3  8  
ATOM 10097 H HG2  . GLU A 1 37 ? -20.308 6.316   8.691   1.00 0.00 ? 37 GLU A HG2  8  
ATOM 10098 H HG3  . GLU A 1 37 ? -18.581 6.241   9.028   1.00 0.00 ? 37 GLU A HG3  8  
ATOM 10099 N N    . GLY A 1 38 ? -20.427 4.626   4.216   1.00 0.00 ? 38 GLY A N    8  
ATOM 10100 C CA   . GLY A 1 38 ? -20.853 4.950   2.870   1.00 0.00 ? 38 GLY A CA   8  
ATOM 10101 C C    . GLY A 1 38 ? -20.127 6.152   2.290   1.00 0.00 ? 38 GLY A C    8  
ATOM 10102 O O    . GLY A 1 38 ? -20.384 6.545   1.152   1.00 0.00 ? 38 GLY A O    8  
ATOM 10103 H H    . GLY A 1 38 ? -19.837 3.864   4.366   1.00 0.00 ? 38 GLY A H    8  
ATOM 10104 H HA2  . GLY A 1 38 ? -20.675 4.096   2.234   1.00 0.00 ? 38 GLY A HA2  8  
ATOM 10105 H HA3  . GLY A 1 38 ? -21.910 5.156   2.887   1.00 0.00 ? 38 GLY A HA3  8  
ATOM 10106 N N    . LYS A 1 39 ? -19.209 6.729   3.062   1.00 0.00 ? 39 LYS A N    8  
ATOM 10107 C CA   . LYS A 1 39 ? -18.442 7.870   2.609   1.00 0.00 ? 39 LYS A CA   8  
ATOM 10108 C C    . LYS A 1 39 ? -17.037 7.822   3.191   1.00 0.00 ? 39 LYS A C    8  
ATOM 10109 O O    . LYS A 1 39 ? -16.778 8.352   4.271   1.00 0.00 ? 39 LYS A O    8  
ATOM 10110 C CB   . LYS A 1 39 ? -19.135 9.175   3.008   1.00 0.00 ? 39 LYS A CB   8  
ATOM 10111 C CG   . LYS A 1 39 ? -20.086 9.707   1.949   1.00 0.00 ? 39 LYS A CG   8  
ATOM 10112 C CD   . LYS A 1 39 ? -20.235 11.217  2.043   1.00 0.00 ? 39 LYS A CD   8  
ATOM 10113 C CE   . LYS A 1 39 ? -18.961 11.929  1.618   1.00 0.00 ? 39 LYS A CE   8  
ATOM 10114 N NZ   . LYS A 1 39 ? -19.036 12.410  0.211   1.00 0.00 ? 39 LYS A NZ   8  
ATOM 10115 H H    . LYS A 1 39 ? -19.026 6.368   3.942   1.00 0.00 ? 39 LYS A H    8  
ATOM 10116 H HA   . LYS A 1 39 ? -18.378 7.816   1.538   1.00 0.00 ? 39 LYS A HA   8  
ATOM 10117 H HB2  . LYS A 1 39 ? -19.697 9.008   3.915   1.00 0.00 ? 39 LYS A HB2  8  
ATOM 10118 H HB3  . LYS A 1 39 ? -18.382 9.926   3.195   1.00 0.00 ? 39 LYS A HB3  8  
ATOM 10119 H HG2  . LYS A 1 39 ? -19.701 9.453   0.973   1.00 0.00 ? 39 LYS A HG2  8  
ATOM 10120 H HG3  . LYS A 1 39 ? -21.055 9.249   2.087   1.00 0.00 ? 39 LYS A HG3  8  
ATOM 10121 H HD2  . LYS A 1 39 ? -21.043 11.530  1.398   1.00 0.00 ? 39 LYS A HD2  8  
ATOM 10122 H HD3  . LYS A 1 39 ? -20.463 11.483  3.065   1.00 0.00 ? 39 LYS A HD3  8  
ATOM 10123 H HE2  . LYS A 1 39 ? -18.803 12.776  2.270   1.00 0.00 ? 39 LYS A HE2  8  
ATOM 10124 H HE3  . LYS A 1 39 ? -18.132 11.244  1.712   1.00 0.00 ? 39 LYS A HE3  8  
ATOM 10125 H HZ1  . LYS A 1 39 ? -19.461 11.679  -0.394  1.00 0.00 ? 39 LYS A HZ1  8  
ATOM 10126 H HZ2  . LYS A 1 39 ? -18.083 12.627  -0.144  1.00 0.00 ? 39 LYS A HZ2  8  
ATOM 10127 H HZ3  . LYS A 1 39 ? -19.618 13.271  0.158   1.00 0.00 ? 39 LYS A HZ3  8  
ATOM 10128 N N    . MET A 1 40 ? -16.137 7.192   2.458   1.00 0.00 ? 40 MET A N    8  
ATOM 10129 C CA   . MET A 1 40 ? -14.753 7.073   2.877   1.00 0.00 ? 40 MET A CA   8  
ATOM 10130 C C    . MET A 1 40 ? -13.828 7.026   1.667   1.00 0.00 ? 40 MET A C    8  
ATOM 10131 O O    . MET A 1 40 ? -13.476 5.951   1.182   1.00 0.00 ? 40 MET A O    8  
ATOM 10132 C CB   . MET A 1 40 ? -14.559 5.822   3.736   1.00 0.00 ? 40 MET A CB   8  
ATOM 10133 C CG   . MET A 1 40 ? -13.464 5.965   4.780   1.00 0.00 ? 40 MET A CG   8  
ATOM 10134 S SD   . MET A 1 40 ? -12.754 4.379   5.263   1.00 0.00 ? 40 MET A SD   8  
ATOM 10135 C CE   . MET A 1 40 ? -14.233 3.461   5.686   1.00 0.00 ? 40 MET A CE   8  
ATOM 10136 H H    . MET A 1 40 ? -16.410 6.801   1.614   1.00 0.00 ? 40 MET A H    8  
ATOM 10137 H HA   . MET A 1 40 ? -14.515 7.942   3.462   1.00 0.00 ? 40 MET A HA   8  
ATOM 10138 H HB2  . MET A 1 40 ? -15.486 5.602   4.245   1.00 0.00 ? 40 MET A HB2  8  
ATOM 10139 H HB3  . MET A 1 40 ? -14.307 4.992   3.092   1.00 0.00 ? 40 MET A HB3  8  
ATOM 10140 H HG2  . MET A 1 40 ? -12.678 6.585   4.375   1.00 0.00 ? 40 MET A HG2  8  
ATOM 10141 H HG3  . MET A 1 40 ? -13.880 6.439   5.656   1.00 0.00 ? 40 MET A HG3  8  
ATOM 10142 H HE1  . MET A 1 40 ? -15.026 4.151   5.933   1.00 0.00 ? 40 MET A HE1  8  
ATOM 10143 H HE2  . MET A 1 40 ? -14.031 2.825   6.535   1.00 0.00 ? 40 MET A HE2  8  
ATOM 10144 H HE3  . MET A 1 40 ? -14.532 2.854   4.844   1.00 0.00 ? 40 MET A HE3  8  
ATOM 10145 N N    . TYR A 1 41 ? -13.440 8.199   1.186   1.00 0.00 ? 41 TYR A N    8  
ATOM 10146 C CA   . TYR A 1 41 ? -12.559 8.298   0.035   1.00 0.00 ? 41 TYR A CA   8  
ATOM 10147 C C    . TYR A 1 41 ? -11.097 8.353   0.467   1.00 0.00 ? 41 TYR A C    8  
ATOM 10148 O O    . TYR A 1 41 ? -10.512 9.430   0.578   1.00 0.00 ? 41 TYR A O    8  
ATOM 10149 C CB   . TYR A 1 41 ? -12.910 9.530   -0.797  1.00 0.00 ? 41 TYR A CB   8  
ATOM 10150 C CG   . TYR A 1 41 ? -13.368 9.203   -2.200  1.00 0.00 ? 41 TYR A CG   8  
ATOM 10151 C CD1  . TYR A 1 41 ? -14.651 8.725   -2.439  1.00 0.00 ? 41 TYR A CD1  8  
ATOM 10152 C CD2  . TYR A 1 41 ? -12.518 9.373   -3.286  1.00 0.00 ? 41 TYR A CD2  8  
ATOM 10153 C CE1  . TYR A 1 41 ? -15.073 8.425   -3.720  1.00 0.00 ? 41 TYR A CE1  8  
ATOM 10154 C CE2  . TYR A 1 41 ? -12.933 9.075   -4.570  1.00 0.00 ? 41 TYR A CE2  8  
ATOM 10155 C CZ   . TYR A 1 41 ? -14.211 8.602   -4.782  1.00 0.00 ? 41 TYR A CZ   8  
ATOM 10156 O OH   . TYR A 1 41 ? -14.627 8.304   -6.059  1.00 0.00 ? 41 TYR A OH   8  
ATOM 10157 H H    . TYR A 1 41 ? -13.759 9.014   1.611   1.00 0.00 ? 41 TYR A H    8  
ATOM 10158 H HA   . TYR A 1 41 ? -12.712 7.425   -0.564  1.00 0.00 ? 41 TYR A HA   8  
ATOM 10159 H HB2  . TYR A 1 41 ? -13.705 10.069  -0.307  1.00 0.00 ? 41 TYR A HB2  8  
ATOM 10160 H HB3  . TYR A 1 41 ? -12.042 10.165  -0.870  1.00 0.00 ? 41 TYR A HB3  8  
ATOM 10161 H HD1  . TYR A 1 41 ? -15.324 8.588   -1.606  1.00 0.00 ? 41 TYR A HD1  8  
ATOM 10162 H HD2  . TYR A 1 41 ? -11.518 9.744   -3.117  1.00 0.00 ? 41 TYR A HD2  8  
ATOM 10163 H HE1  . TYR A 1 41 ? -16.074 8.054   -3.886  1.00 0.00 ? 41 TYR A HE1  8  
ATOM 10164 H HE2  . TYR A 1 41 ? -12.258 9.213   -5.401  1.00 0.00 ? 41 TYR A HE2  8  
ATOM 10165 H HH   . TYR A 1 41 ? -15.528 8.613   -6.183  1.00 0.00 ? 41 TYR A HH   8  
ATOM 10166 N N    . GLY A 1 42 ? -10.512 7.184   0.705   1.00 0.00 ? 42 GLY A N    8  
ATOM 10167 C CA   . GLY A 1 42 ? -9.127  7.118   1.116   1.00 0.00 ? 42 GLY A CA   8  
ATOM 10168 C C    . GLY A 1 42 ? -8.471  5.806   0.736   1.00 0.00 ? 42 GLY A C    8  
ATOM 10169 O O    . GLY A 1 42 ? -8.675  4.789   1.399   1.00 0.00 ? 42 GLY A O    8  
ATOM 10170 H H    . GLY A 1 42 ? -11.022 6.361   0.596   1.00 0.00 ? 42 GLY A H    8  
ATOM 10171 H HA2  . GLY A 1 42 ? -8.594  7.923   0.643   1.00 0.00 ? 42 GLY A HA2  8  
ATOM 10172 H HA3  . GLY A 1 42 ? -9.072  7.241   2.187   1.00 0.00 ? 42 GLY A HA3  8  
ATOM 10173 N N    . ARG A 1 43 ? -7.683  5.826   -0.334  1.00 0.00 ? 43 ARG A N    8  
ATOM 10174 C CA   . ARG A 1 43 ? -7.000  4.630   -0.798  1.00 0.00 ? 43 ARG A CA   8  
ATOM 10175 C C    . ARG A 1 43 ? -5.701  4.409   -0.035  1.00 0.00 ? 43 ARG A C    8  
ATOM 10176 O O    . ARG A 1 43 ? -5.286  3.273   0.194   1.00 0.00 ? 43 ARG A O    8  
ATOM 10177 C CB   . ARG A 1 43 ? -6.723  4.722   -2.297  1.00 0.00 ? 43 ARG A CB   8  
ATOM 10178 C CG   . ARG A 1 43 ? -7.420  3.644   -3.111  1.00 0.00 ? 43 ARG A CG   8  
ATOM 10179 C CD   . ARG A 1 43 ? -6.995  3.685   -4.570  1.00 0.00 ? 43 ARG A CD   8  
ATOM 10180 N NE   . ARG A 1 43 ? -5.714  3.017   -4.786  1.00 0.00 ? 43 ARG A NE   8  
ATOM 10181 C CZ   . ARG A 1 43 ? -5.570  1.696   -4.865  1.00 0.00 ? 43 ARG A CZ   8  
ATOM 10182 N NH1  . ARG A 1 43 ? -6.625  0.899   -4.747  1.00 0.00 ? 43 ARG A NH1  8  
ATOM 10183 N NH2  . ARG A 1 43 ? -4.369  1.171   -5.063  1.00 0.00 ? 43 ARG A NH2  8  
ATOM 10184 H H    . ARG A 1 43 ? -7.560  6.662   -0.822  1.00 0.00 ? 43 ARG A H    8  
ATOM 10185 H HA   . ARG A 1 43 ? -7.647  3.801   -0.617  1.00 0.00 ? 43 ARG A HA   8  
ATOM 10186 H HB2  . ARG A 1 43 ? -7.058  5.683   -2.652  1.00 0.00 ? 43 ARG A HB2  8  
ATOM 10187 H HB3  . ARG A 1 43 ? -5.661  4.636   -2.462  1.00 0.00 ? 43 ARG A HB3  8  
ATOM 10188 H HG2  . ARG A 1 43 ? -7.169  2.677   -2.701  1.00 0.00 ? 43 ARG A HG2  8  
ATOM 10189 H HG3  . ARG A 1 43 ? -8.488  3.796   -3.052  1.00 0.00 ? 43 ARG A HG3  8  
ATOM 10190 H HD2  . ARG A 1 43 ? -7.750  3.194   -5.166  1.00 0.00 ? 43 ARG A HD2  8  
ATOM 10191 H HD3  . ARG A 1 43 ? -6.909  4.717   -4.878  1.00 0.00 ? 43 ARG A HD3  8  
ATOM 10192 H HE   . ARG A 1 43 ? -4.918  3.582   -4.877  1.00 0.00 ? 43 ARG A HE   8  
ATOM 10193 H HH11 . ARG A 1 43 ? -7.533  1.288   -4.598  1.00 0.00 ? 43 ARG A HH11 8  
ATOM 10194 H HH12 . ARG A 1 43 ? -6.510  -0.093  -4.807  1.00 0.00 ? 43 ARG A HH12 8  
ATOM 10195 H HH21 . ARG A 1 43 ? -3.571  1.767   -5.153  1.00 0.00 ? 43 ARG A HH21 8  
ATOM 10196 H HH22 . ARG A 1 43 ? -4.261  0.178   -5.122  1.00 0.00 ? 43 ARG A HH22 8  
ATOM 10197 N N    . ASN A 1 44 ? -5.067  5.504   0.355   1.00 0.00 ? 44 ASN A N    8  
ATOM 10198 C CA   . ASN A 1 44 ? -3.815  5.440   1.094   1.00 0.00 ? 44 ASN A CA   8  
ATOM 10199 C C    . ASN A 1 44 ? -4.054  5.017   2.537   1.00 0.00 ? 44 ASN A C    8  
ATOM 10200 O O    . ASN A 1 44 ? -3.165  4.473   3.192   1.00 0.00 ? 44 ASN A O    8  
ATOM 10201 C CB   . ASN A 1 44 ? -3.100  6.789   1.049   1.00 0.00 ? 44 ASN A CB   8  
ATOM 10202 C CG   . ASN A 1 44 ? -1.795  6.729   0.281   1.00 0.00 ? 44 ASN A CG   8  
ATOM 10203 O OD1  . ASN A 1 44 ? -1.631  5.911   -0.624  1.00 0.00 ? 44 ASN A OD1  8  
ATOM 10204 N ND2  . ASN A 1 44 ? -0.857  7.598   0.638   1.00 0.00 ? 44 ASN A ND2  8  
ATOM 10205 H H    . ASN A 1 44 ? -5.451  6.374   0.141   1.00 0.00 ? 44 ASN A H    8  
ATOM 10206 H HA   . ASN A 1 44 ? -3.198  4.704   0.619   1.00 0.00 ? 44 ASN A HA   8  
ATOM 10207 H HB2  . ASN A 1 44 ? -3.743  7.507   0.570   1.00 0.00 ? 44 ASN A HB2  8  
ATOM 10208 H HB3  . ASN A 1 44 ? -2.890  7.113   2.057   1.00 0.00 ? 44 ASN A HB3  8  
ATOM 10209 H HD21 . ASN A 1 44 ? -1.058  8.221   1.368   1.00 0.00 ? 44 ASN A HD21 8  
ATOM 10210 H HD22 . ASN A 1 44 ? -0.003  7.582   0.158   1.00 0.00 ? 44 ASN A HD22 8  
ATOM 10211 N N    . GLU A 1 45 ? -5.261  5.262   3.024   1.00 0.00 ? 45 GLU A N    8  
ATOM 10212 C CA   . GLU A 1 45 ? -5.618  4.896   4.383   1.00 0.00 ? 45 GLU A CA   8  
ATOM 10213 C C    . GLU A 1 45 ? -5.943  3.410   4.467   1.00 0.00 ? 45 GLU A C    8  
ATOM 10214 O O    . GLU A 1 45 ? -5.849  2.802   5.533   1.00 0.00 ? 45 GLU A O    8  
ATOM 10215 C CB   . GLU A 1 45 ? -6.808  5.726   4.867   1.00 0.00 ? 45 GLU A CB   8  
ATOM 10216 C CG   . GLU A 1 45 ? -6.425  7.115   5.351   1.00 0.00 ? 45 GLU A CG   8  
ATOM 10217 C CD   . GLU A 1 45 ? -7.411  8.178   4.910   1.00 0.00 ? 45 GLU A CD   8  
ATOM 10218 O OE1  . GLU A 1 45 ? -7.275  8.680   3.774   1.00 0.00 ? 45 GLU A OE1  8  
ATOM 10219 O OE2  . GLU A 1 45 ? -8.320  8.509   5.700   1.00 0.00 ? 45 GLU A OE2  8  
ATOM 10220 H H    . GLU A 1 45 ? -5.926  5.692   2.457   1.00 0.00 ? 45 GLU A H    8  
ATOM 10221 H HA   . GLU A 1 45 ? -4.767  5.100   5.006   1.00 0.00 ? 45 GLU A HA   8  
ATOM 10222 H HB2  . GLU A 1 45 ? -7.512  5.832   4.055   1.00 0.00 ? 45 GLU A HB2  8  
ATOM 10223 H HB3  . GLU A 1 45 ? -7.288  5.204   5.682   1.00 0.00 ? 45 GLU A HB3  8  
ATOM 10224 H HG2  . GLU A 1 45 ? -6.385  7.108   6.430   1.00 0.00 ? 45 GLU A HG2  8  
ATOM 10225 H HG3  . GLU A 1 45 ? -5.450  7.363   4.957   1.00 0.00 ? 45 GLU A HG3  8  
ATOM 10226 N N    . LEU A 1 46 ? -6.321  2.830   3.333   1.00 0.00 ? 46 LEU A N    8  
ATOM 10227 C CA   . LEU A 1 46 ? -6.655  1.418   3.273   1.00 0.00 ? 46 LEU A CA   8  
ATOM 10228 C C    . LEU A 1 46 ? -5.398  0.563   3.285   1.00 0.00 ? 46 LEU A C    8  
ATOM 10229 O O    . LEU A 1 46 ? -5.355  -0.491  3.919   1.00 0.00 ? 46 LEU A O    8  
ATOM 10230 C CB   . LEU A 1 46 ? -7.489  1.116   2.029   1.00 0.00 ? 46 LEU A CB   8  
ATOM 10231 C CG   . LEU A 1 46 ? -8.855  0.485   2.301   1.00 0.00 ? 46 LEU A CG   8  
ATOM 10232 C CD1  . LEU A 1 46 ? -9.662  0.388   1.015   1.00 0.00 ? 46 LEU A CD1  8  
ATOM 10233 C CD2  . LEU A 1 46 ? -8.690  -0.889  2.933   1.00 0.00 ? 46 LEU A CD2  8  
ATOM 10234 H H    . LEU A 1 46 ? -6.374  3.365   2.518   1.00 0.00 ? 46 LEU A H    8  
ATOM 10235 H HA   . LEU A 1 46 ? -7.228  1.186   4.142   1.00 0.00 ? 46 LEU A HA   8  
ATOM 10236 H HB2  . LEU A 1 46 ? -7.642  2.040   1.493   1.00 0.00 ? 46 LEU A HB2  8  
ATOM 10237 H HB3  . LEU A 1 46 ? -6.928  0.444   1.402   1.00 0.00 ? 46 LEU A HB3  8  
ATOM 10238 H HG   . LEU A 1 46 ? -9.402  1.110   2.992   1.00 0.00 ? 46 LEU A HG   8  
ATOM 10239 H HD11 . LEU A 1 46 ? -10.007 1.371   0.732   1.00 0.00 ? 46 LEU A HD11 8  
ATOM 10240 H HD12 . LEU A 1 46 ? -10.511 -0.260  1.171   1.00 0.00 ? 46 LEU A HD12 8  
ATOM 10241 H HD13 . LEU A 1 46 ? -9.040  -0.016  0.230   1.00 0.00 ? 46 LEU A HD13 8  
ATOM 10242 H HD21 . LEU A 1 46 ? -8.371  -1.595  2.181   1.00 0.00 ? 46 LEU A HD21 8  
ATOM 10243 H HD22 . LEU A 1 46 ? -9.633  -1.209  3.351   1.00 0.00 ? 46 LEU A HD22 8  
ATOM 10244 H HD23 . LEU A 1 46 ? -7.948  -0.838  3.717   1.00 0.00 ? 46 LEU A HD23 8  
ATOM 10245 N N    . ILE A 1 47 ? -4.375  1.028   2.586   1.00 0.00 ? 47 ILE A N    8  
ATOM 10246 C CA   . ILE A 1 47 ? -3.117  0.314   2.523   1.00 0.00 ? 47 ILE A CA   8  
ATOM 10247 C C    . ILE A 1 47 ? -2.346  0.483   3.818   1.00 0.00 ? 47 ILE A C    8  
ATOM 10248 O O    . ILE A 1 47 ? -1.682  -0.440  4.288   1.00 0.00 ? 47 ILE A O    8  
ATOM 10249 C CB   . ILE A 1 47 ? -2.240  0.778   1.342   1.00 0.00 ? 47 ILE A CB   8  
ATOM 10250 C CG1  . ILE A 1 47 ? -2.455  2.263   1.039   1.00 0.00 ? 47 ILE A CG1  8  
ATOM 10251 C CG2  . ILE A 1 47 ? -2.521  -0.064  0.108   1.00 0.00 ? 47 ILE A CG2  8  
ATOM 10252 C CD1  . ILE A 1 47 ? -1.227  2.948   0.478   1.00 0.00 ? 47 ILE A CD1  8  
ATOM 10253 H H    . ILE A 1 47 ? -4.468  1.872   2.110   1.00 0.00 ? 47 ILE A H    8  
ATOM 10254 H HA   . ILE A 1 47 ? -3.342  -0.727  2.394   1.00 0.00 ? 47 ILE A HA   8  
ATOM 10255 H HB   . ILE A 1 47 ? -1.216  0.629   1.621   1.00 0.00 ? 47 ILE A HB   8  
ATOM 10256 H HG12 . ILE A 1 47 ? -3.250  2.366   0.316   1.00 0.00 ? 47 ILE A HG12 8  
ATOM 10257 H HG13 . ILE A 1 47 ? -2.733  2.772   1.948   1.00 0.00 ? 47 ILE A HG13 8  
ATOM 10258 H HG21 . ILE A 1 47 ? -2.216  0.479   -0.775  1.00 0.00 ? 47 ILE A HG21 8  
ATOM 10259 H HG22 . ILE A 1 47 ? -3.578  -0.279  0.051   1.00 0.00 ? 47 ILE A HG22 8  
ATOM 10260 H HG23 . ILE A 1 47 ? -1.968  -0.990  0.170   1.00 0.00 ? 47 ILE A HG23 8  
ATOM 10261 H HD11 . ILE A 1 47 ? -1.351  4.019   0.542   1.00 0.00 ? 47 ILE A HD11 8  
ATOM 10262 H HD12 . ILE A 1 47 ? -1.095  2.662   -0.554  1.00 0.00 ? 47 ILE A HD12 8  
ATOM 10263 H HD13 . ILE A 1 47 ? -0.359  2.653   1.048   1.00 0.00 ? 47 ILE A HD13 8  
ATOM 10264 N N    . ALA A 1 48 ? -2.452  1.668   4.395   1.00 0.00 ? 48 ALA A N    8  
ATOM 10265 C CA   . ALA A 1 48 ? -1.781  1.965   5.646   1.00 0.00 ? 48 ALA A CA   8  
ATOM 10266 C C    . ALA A 1 48 ? -2.495  1.296   6.808   1.00 0.00 ? 48 ALA A C    8  
ATOM 10267 O O    . ALA A 1 48 ? -1.883  0.975   7.827   1.00 0.00 ? 48 ALA A O    8  
ATOM 10268 C CB   . ALA A 1 48 ? -1.689  3.468   5.860   1.00 0.00 ? 48 ALA A CB   8  
ATOM 10269 H H    . ALA A 1 48 ? -3.004  2.352   3.973   1.00 0.00 ? 48 ALA A H    8  
ATOM 10270 H HA   . ALA A 1 48 ? -0.784  1.569   5.581   1.00 0.00 ? 48 ALA A HA   8  
ATOM 10271 H HB1  . ALA A 1 48 ? -2.645  3.844   6.192   1.00 0.00 ? 48 ALA A HB1  8  
ATOM 10272 H HB2  . ALA A 1 48 ? -1.417  3.947   4.931   1.00 0.00 ? 48 ALA A HB2  8  
ATOM 10273 H HB3  . ALA A 1 48 ? -0.939  3.680   6.607   1.00 0.00 ? 48 ALA A HB3  8  
ATOM 10274 N N    . ARG A 1 49 ? -3.792  1.069   6.642   1.00 0.00 ? 49 ARG A N    8  
ATOM 10275 C CA   . ARG A 1 49 ? -4.581  0.415   7.671   1.00 0.00 ? 49 ARG A CA   8  
ATOM 10276 C C    . ARG A 1 49 ? -4.225  -1.061  7.736   1.00 0.00 ? 49 ARG A C    8  
ATOM 10277 O O    . ARG A 1 49 ? -4.328  -1.694  8.787   1.00 0.00 ? 49 ARG A O    8  
ATOM 10278 C CB   . ARG A 1 49 ? -6.077  0.591   7.400   1.00 0.00 ? 49 ARG A CB   8  
ATOM 10279 C CG   . ARG A 1 49 ? -6.967  -0.079  8.434   1.00 0.00 ? 49 ARG A CG   8  
ATOM 10280 C CD   . ARG A 1 49 ? -8.355  -0.359  7.881   1.00 0.00 ? 49 ARG A CD   8  
ATOM 10281 N NE   . ARG A 1 49 ? -9.365  0.522   8.464   1.00 0.00 ? 49 ARG A NE   8  
ATOM 10282 C CZ   . ARG A 1 49 ? -9.581  1.772   8.060   1.00 0.00 ? 49 ARG A CZ   8  
ATOM 10283 N NH1  . ARG A 1 49 ? -8.862  2.293   7.074   1.00 0.00 ? 49 ARG A NH1  8  
ATOM 10284 N NH2  . ARG A 1 49 ? -10.520 2.503   8.645   1.00 0.00 ? 49 ARG A NH2  8  
ATOM 10285 H H    . ARG A 1 49 ? -4.223  1.334   5.805   1.00 0.00 ? 49 ARG A H    8  
ATOM 10286 H HA   . ARG A 1 49 ? -4.333  0.872   8.611   1.00 0.00 ? 49 ARG A HA   8  
ATOM 10287 H HB2  . ARG A 1 49 ? -6.307  1.646   7.389   1.00 0.00 ? 49 ARG A HB2  8  
ATOM 10288 H HB3  . ARG A 1 49 ? -6.308  0.171   6.432   1.00 0.00 ? 49 ARG A HB3  8  
ATOM 10289 H HG2  . ARG A 1 49 ? -6.515  -1.014  8.732   1.00 0.00 ? 49 ARG A HG2  8  
ATOM 10290 H HG3  . ARG A 1 49 ? -7.055  0.570   9.293   1.00 0.00 ? 49 ARG A HG3  8  
ATOM 10291 H HD2  . ARG A 1 49 ? -8.340  -0.215  6.811   1.00 0.00 ? 49 ARG A HD2  8  
ATOM 10292 H HD3  . ARG A 1 49 ? -8.616  -1.384  8.101   1.00 0.00 ? 49 ARG A HD3  8  
ATOM 10293 H HE   . ARG A 1 49 ? -9.910  0.163   9.195   1.00 0.00 ? 49 ARG A HE   8  
ATOM 10294 H HH11 . ARG A 1 49 ? -8.152  1.748   6.629   1.00 0.00 ? 49 ARG A HH11 8  
ATOM 10295 H HH12 . ARG A 1 49 ? -9.031  3.233   6.776   1.00 0.00 ? 49 ARG A HH12 8  
ATOM 10296 H HH21 . ARG A 1 49 ? -11.065 2.115   9.388   1.00 0.00 ? 49 ARG A HH21 8  
ATOM 10297 H HH22 . ARG A 1 49 ? -10.683 3.442   8.342   1.00 0.00 ? 49 ARG A HH22 8  
ATOM 10298 N N    . TYR A 1 50 ? -3.790  -1.600  6.603   1.00 0.00 ? 50 TYR A N    8  
ATOM 10299 C CA   . TYR A 1 50 ? -3.398  -2.995  6.524   1.00 0.00 ? 50 TYR A CA   8  
ATOM 10300 C C    . TYR A 1 50 ? -2.118  -3.231  7.297   1.00 0.00 ? 50 TYR A C    8  
ATOM 10301 O O    . TYR A 1 50 ? -2.049  -4.098  8.169   1.00 0.00 ? 50 TYR A O    8  
ATOM 10302 C CB   . TYR A 1 50 ? -3.202  -3.410  5.077   1.00 0.00 ? 50 TYR A CB   8  
ATOM 10303 C CG   . TYR A 1 50 ? -3.283  -4.903  4.862   1.00 0.00 ? 50 TYR A CG   8  
ATOM 10304 C CD1  . TYR A 1 50 ? -2.203  -5.721  5.165   1.00 0.00 ? 50 TYR A CD1  8  
ATOM 10305 C CD2  . TYR A 1 50 ? -4.435  -5.495  4.360   1.00 0.00 ? 50 TYR A CD2  8  
ATOM 10306 C CE1  . TYR A 1 50 ? -2.266  -7.086  4.974   1.00 0.00 ? 50 TYR A CE1  8  
ATOM 10307 C CE2  . TYR A 1 50 ? -4.507  -6.862  4.167   1.00 0.00 ? 50 TYR A CE2  8  
ATOM 10308 C CZ   . TYR A 1 50 ? -3.420  -7.653  4.475   1.00 0.00 ? 50 TYR A CZ   8  
ATOM 10309 O OH   . TYR A 1 50 ? -3.488  -9.014  4.284   1.00 0.00 ? 50 TYR A OH   8  
ATOM 10310 H H    . TYR A 1 50 ? -3.722  -1.039  5.803   1.00 0.00 ? 50 TYR A H    8  
ATOM 10311 H HA   . TYR A 1 50 ? -4.170  -3.582  6.950   1.00 0.00 ? 50 TYR A HA   8  
ATOM 10312 H HB2  . TYR A 1 50 ? -3.952  -2.938  4.466   1.00 0.00 ? 50 TYR A HB2  8  
ATOM 10313 H HB3  . TYR A 1 50 ? -2.233  -3.084  4.762   1.00 0.00 ? 50 TYR A HB3  8  
ATOM 10314 H HD1  . TYR A 1 50 ? -1.300  -5.275  5.556   1.00 0.00 ? 50 TYR A HD1  8  
ATOM 10315 H HD2  . TYR A 1 50 ? -5.284  -4.872  4.120   1.00 0.00 ? 50 TYR A HD2  8  
ATOM 10316 H HE1  . TYR A 1 50 ? -1.414  -7.704  5.216   1.00 0.00 ? 50 TYR A HE1  8  
ATOM 10317 H HE2  . TYR A 1 50 ? -5.411  -7.304  3.776   1.00 0.00 ? 50 TYR A HE2  8  
ATOM 10318 H HH   . TYR A 1 50 ? -3.270  -9.221  3.372   1.00 0.00 ? 50 TYR A HH   8  
ATOM 10319 N N    . ILE A 1 51 ? -1.110  -2.447  6.969   1.00 0.00 ? 51 ILE A N    8  
ATOM 10320 C CA   . ILE A 1 51 ? 0.181   -2.553  7.628   1.00 0.00 ? 51 ILE A CA   8  
ATOM 10321 C C    . ILE A 1 51 ? 0.050   -2.256  9.115   1.00 0.00 ? 51 ILE A C    8  
ATOM 10322 O O    . ILE A 1 51 ? 0.796   -2.789  9.936   1.00 0.00 ? 51 ILE A O    8  
ATOM 10323 C CB   . ILE A 1 51 ? 1.241   -1.612  7.010   1.00 0.00 ? 51 ILE A CB   8  
ATOM 10324 C CG1  . ILE A 1 51 ? 0.591   -0.469  6.224   1.00 0.00 ? 51 ILE A CG1  8  
ATOM 10325 C CG2  . ILE A 1 51 ? 2.187   -2.401  6.116   1.00 0.00 ? 51 ILE A CG2  8  
ATOM 10326 C CD1  . ILE A 1 51 ? 1.514   0.708   5.994   1.00 0.00 ? 51 ILE A CD1  8  
ATOM 10327 H H    . ILE A 1 51 ? -1.243  -1.778  6.268   1.00 0.00 ? 51 ILE A H    8  
ATOM 10328 H HA   . ILE A 1 51 ? 0.522   -3.567  7.513   1.00 0.00 ? 51 ILE A HA   8  
ATOM 10329 H HB   . ILE A 1 51 ? 1.817   -1.193  7.816   1.00 0.00 ? 51 ILE A HB   8  
ATOM 10330 H HG12 . ILE A 1 51 ? 0.279   -0.837  5.258   1.00 0.00 ? 51 ILE A HG12 8  
ATOM 10331 H HG13 . ILE A 1 51 ? -0.273  -0.114  6.765   1.00 0.00 ? 51 ILE A HG13 8  
ATOM 10332 H HG21 . ILE A 1 51 ? 1.721   -3.335  5.834   1.00 0.00 ? 51 ILE A HG21 8  
ATOM 10333 H HG22 . ILE A 1 51 ? 3.103   -2.603  6.651   1.00 0.00 ? 51 ILE A HG22 8  
ATOM 10334 H HG23 . ILE A 1 51 ? 2.408   -1.827  5.228   1.00 0.00 ? 51 ILE A HG23 8  
ATOM 10335 H HD11 . ILE A 1 51 ? 2.534   0.407   6.183   1.00 0.00 ? 51 ILE A HD11 8  
ATOM 10336 H HD12 . ILE A 1 51 ? 1.246   1.511   6.664   1.00 0.00 ? 51 ILE A HD12 8  
ATOM 10337 H HD13 . ILE A 1 51 ? 1.421   1.045   4.973   1.00 0.00 ? 51 ILE A HD13 8  
ATOM 10338 N N    . LYS A 1 52 ? -0.912  -1.409  9.453   1.00 0.00 ? 52 LYS A N    8  
ATOM 10339 C CA   . LYS A 1 52 ? -1.156  -1.045  10.840  1.00 0.00 ? 52 LYS A CA   8  
ATOM 10340 C C    . LYS A 1 52 ? -1.783  -2.209  11.599  1.00 0.00 ? 52 LYS A C    8  
ATOM 10341 O O    . LYS A 1 52 ? -1.620  -2.335  12.812  1.00 0.00 ? 52 LYS A O    8  
ATOM 10342 C CB   . LYS A 1 52 ? -2.065  0.184   10.917  1.00 0.00 ? 52 LYS A CB   8  
ATOM 10343 C CG   . LYS A 1 52 ? -2.326  0.658   12.338  1.00 0.00 ? 52 LYS A CG   8  
ATOM 10344 C CD   . LYS A 1 52 ? -1.168  1.485   12.871  1.00 0.00 ? 52 LYS A CD   8  
ATOM 10345 C CE   . LYS A 1 52 ? -1.479  2.059   14.244  1.00 0.00 ? 52 LYS A CE   8  
ATOM 10346 N NZ   . LYS A 1 52 ? -2.131  3.395   14.153  1.00 0.00 ? 52 LYS A NZ   8  
ATOM 10347 H H    . LYS A 1 52 ? -1.473  -1.024  8.752   1.00 0.00 ? 52 LYS A H    8  
ATOM 10348 H HA   . LYS A 1 52 ? -0.209  -0.810  11.287  1.00 0.00 ? 52 LYS A HA   8  
ATOM 10349 H HB2  . LYS A 1 52 ? -1.605  0.993   10.370  1.00 0.00 ? 52 LYS A HB2  8  
ATOM 10350 H HB3  . LYS A 1 52 ? -3.014  -0.055  10.460  1.00 0.00 ? 52 LYS A HB3  8  
ATOM 10351 H HG2  . LYS A 1 52 ? -3.221  1.262   12.346  1.00 0.00 ? 52 LYS A HG2  8  
ATOM 10352 H HG3  . LYS A 1 52 ? -2.465  -0.204  12.974  1.00 0.00 ? 52 LYS A HG3  8  
ATOM 10353 H HD2  . LYS A 1 52 ? -0.293  0.857   12.944  1.00 0.00 ? 52 LYS A HD2  8  
ATOM 10354 H HD3  . LYS A 1 52 ? -0.974  2.298   12.186  1.00 0.00 ? 52 LYS A HD3  8  
ATOM 10355 H HE2  . LYS A 1 52 ? -2.140  1.381   14.762  1.00 0.00 ? 52 LYS A HE2  8  
ATOM 10356 H HE3  . LYS A 1 52 ? -0.556  2.155   14.797  1.00 0.00 ? 52 LYS A HE3  8  
ATOM 10357 H HZ1  . LYS A 1 52 ? -1.892  3.849   13.248  1.00 0.00 ? 52 LYS A HZ1  8  
ATOM 10358 H HZ2  . LYS A 1 52 ? -1.807  4.005   14.930  1.00 0.00 ? 52 LYS A HZ2  8  
ATOM 10359 H HZ3  . LYS A 1 52 ? -3.165  3.293   14.215  1.00 0.00 ? 52 LYS A HZ3  8  
ATOM 10360 N N    . LEU A 1 53 ? -2.501  -3.055  10.871  1.00 0.00 ? 53 LEU A N    8  
ATOM 10361 C CA   . LEU A 1 53 ? -3.157  -4.212  11.462  1.00 0.00 ? 53 LEU A CA   8  
ATOM 10362 C C    . LEU A 1 53 ? -2.213  -5.412  11.528  1.00 0.00 ? 53 LEU A C    8  
ATOM 10363 O O    . LEU A 1 53 ? -2.471  -6.375  12.251  1.00 0.00 ? 53 LEU A O    8  
ATOM 10364 C CB   . LEU A 1 53 ? -4.410  -4.574  10.659  1.00 0.00 ? 53 LEU A CB   8  
ATOM 10365 C CG   . LEU A 1 53 ? -5.729  -4.450  11.426  1.00 0.00 ? 53 LEU A CG   8  
ATOM 10366 C CD1  . LEU A 1 53 ? -6.734  -3.627  10.634  1.00 0.00 ? 53 LEU A CD1  8  
ATOM 10367 C CD2  . LEU A 1 53 ? -6.296  -5.827  11.740  1.00 0.00 ? 53 LEU A CD2  8  
ATOM 10368 H H    . LEU A 1 53 ? -2.593  -2.898  9.914   1.00 0.00 ? 53 LEU A H    8  
ATOM 10369 H HA   . LEU A 1 53 ? -3.449  -3.942  12.460  1.00 0.00 ? 53 LEU A HA   8  
ATOM 10370 H HB2  . LEU A 1 53 ? -4.455  -3.926  9.795   1.00 0.00 ? 53 LEU A HB2  8  
ATOM 10371 H HB3  . LEU A 1 53 ? -4.312  -5.593  10.316  1.00 0.00 ? 53 LEU A HB3  8  
ATOM 10372 H HG   . LEU A 1 53 ? -5.547  -3.942  12.361  1.00 0.00 ? 53 LEU A HG   8  
ATOM 10373 H HD11 . LEU A 1 53 ? -6.208  -2.982  9.946   1.00 0.00 ? 53 LEU A HD11 8  
ATOM 10374 H HD12 . LEU A 1 53 ? -7.322  -3.027  11.312  1.00 0.00 ? 53 LEU A HD12 8  
ATOM 10375 H HD13 . LEU A 1 53 ? -7.385  -4.289  10.081  1.00 0.00 ? 53 LEU A HD13 8  
ATOM 10376 H HD21 . LEU A 1 53 ? -5.778  -6.244  12.591  1.00 0.00 ? 53 LEU A HD21 8  
ATOM 10377 H HD22 . LEU A 1 53 ? -6.163  -6.474  10.885  1.00 0.00 ? 53 LEU A HD22 8  
ATOM 10378 H HD23 . LEU A 1 53 ? -7.349  -5.740  11.965  1.00 0.00 ? 53 LEU A HD23 8  
ATOM 10379 N N    . ARG A 1 54 ? -1.124  -5.353  10.765  1.00 0.00 ? 54 ARG A N    8  
ATOM 10380 C CA   . ARG A 1 54 ? -0.147  -6.438  10.733  1.00 0.00 ? 54 ARG A CA   8  
ATOM 10381 C C    . ARG A 1 54 ? 0.282   -6.847  12.135  1.00 0.00 ? 54 ARG A C    8  
ATOM 10382 O O    . ARG A 1 54 ? 0.120   -7.999  12.539  1.00 0.00 ? 54 ARG A O    8  
ATOM 10383 C CB   . ARG A 1 54 ? 1.078   -6.023  9.915   1.00 0.00 ? 54 ARG A CB   8  
ATOM 10384 C CG   . ARG A 1 54 ? 1.771   -7.187  9.225   1.00 0.00 ? 54 ARG A CG   8  
ATOM 10385 C CD   . ARG A 1 54 ? 2.176   -8.263  10.219  1.00 0.00 ? 54 ARG A CD   8  
ATOM 10386 N NE   . ARG A 1 54 ? 2.951   -9.329  9.587   1.00 0.00 ? 54 ARG A NE   8  
ATOM 10387 C CZ   . ARG A 1 54 ? 3.687   -10.209 10.261  1.00 0.00 ? 54 ARG A CZ   8  
ATOM 10388 N NH1  . ARG A 1 54 ? 3.752   -10.154 11.586  1.00 0.00 ? 54 ARG A NH1  8  
ATOM 10389 N NH2  . ARG A 1 54 ? 4.361   -11.146 9.609   1.00 0.00 ? 54 ARG A NH2  8  
ATOM 10390 H H    . ARG A 1 54 ? -0.975  -4.563  10.206  1.00 0.00 ? 54 ARG A H    8  
ATOM 10391 H HA   . ARG A 1 54 ? -0.609  -7.280  10.261  1.00 0.00 ? 54 ARG A HA   8  
ATOM 10392 H HB2  . ARG A 1 54 ? 0.769   -5.317  9.159   1.00 0.00 ? 54 ARG A HB2  8  
ATOM 10393 H HB3  . ARG A 1 54 ? 1.790   -5.546  10.572  1.00 0.00 ? 54 ARG A HB3  8  
ATOM 10394 H HG2  . ARG A 1 54 ? 1.097   -7.616  8.499   1.00 0.00 ? 54 ARG A HG2  8  
ATOM 10395 H HG3  . ARG A 1 54 ? 2.656   -6.820  8.725   1.00 0.00 ? 54 ARG A HG3  8  
ATOM 10396 H HD2  . ARG A 1 54 ? 2.772   -7.811  10.997  1.00 0.00 ? 54 ARG A HD2  8  
ATOM 10397 H HD3  . ARG A 1 54 ? 1.283   -8.689  10.653  1.00 0.00 ? 54 ARG A HD3  8  
ATOM 10398 H HE   . ARG A 1 54 ? 2.921   -9.392  8.610   1.00 0.00 ? 54 ARG A HE   8  
ATOM 10399 H HH11 . ARG A 1 54 ? 3.247   -9.450  12.084  1.00 0.00 ? 54 ARG A HH11 8  
ATOM 10400 H HH12 . ARG A 1 54 ? 4.308   -10.819 12.086  1.00 0.00 ? 54 ARG A HH12 8  
ATOM 10401 H HH21 . ARG A 1 54 ? 4.315   -11.192 8.611   1.00 0.00 ? 54 ARG A HH21 8  
ATOM 10402 H HH22 . ARG A 1 54 ? 4.915   -11.808 10.115  1.00 0.00 ? 54 ARG A HH22 8  
ATOM 10403 N N    . THR A 1 55 ? 0.831   -5.895  12.865  1.00 0.00 ? 55 THR A N    8  
ATOM 10404 C CA   . THR A 1 55 ? 1.293   -6.138  14.223  1.00 0.00 ? 55 THR A CA   8  
ATOM 10405 C C    . THR A 1 55 ? 1.493   -4.827  14.978  1.00 0.00 ? 55 THR A C    8  
ATOM 10406 O O    . THR A 1 55 ? 2.350   -4.731  15.857  1.00 0.00 ? 55 THR A O    8  
ATOM 10407 C CB   . THR A 1 55 ? 2.598   -6.934  14.201  1.00 0.00 ? 55 THR A CB   8  
ATOM 10408 O OG1  . THR A 1 55 ? 2.993   -7.287  15.515  1.00 0.00 ? 55 THR A OG1  8  
ATOM 10409 C CG2  . THR A 1 55 ? 3.747   -6.185  13.560  1.00 0.00 ? 55 THR A CG2  8  
ATOM 10410 H H    . THR A 1 55 ? 0.928   -5.008  12.478  1.00 0.00 ? 55 THR A H    8  
ATOM 10411 H HA   . THR A 1 55 ? 0.537   -6.716  14.726  1.00 0.00 ? 55 THR A HA   8  
ATOM 10412 H HB   . THR A 1 55 ? 2.441   -7.843  13.638  1.00 0.00 ? 55 THR A HB   8  
ATOM 10413 H HG1  . THR A 1 55 ? 3.368   -8.170  15.511  1.00 0.00 ? 55 THR A HG1  8  
ATOM 10414 H HG21 . THR A 1 55 ? 4.661   -6.744  13.696  1.00 0.00 ? 55 THR A HG21 8  
ATOM 10415 H HG22 . THR A 1 55 ? 3.846   -5.214  14.022  1.00 0.00 ? 55 THR A HG22 8  
ATOM 10416 H HG23 . THR A 1 55 ? 3.553   -6.063  12.504  1.00 0.00 ? 55 THR A HG23 8  
ATOM 10417 N N    . GLY A 1 56 ? 0.698   -3.821  14.630  1.00 0.00 ? 56 GLY A N    8  
ATOM 10418 C CA   . GLY A 1 56 ? 0.804   -2.531  15.284  1.00 0.00 ? 56 GLY A CA   8  
ATOM 10419 C C    . GLY A 1 56 ? 2.127   -1.837  15.009  1.00 0.00 ? 56 GLY A C    8  
ATOM 10420 O O    . GLY A 1 56 ? 2.458   -0.845  15.659  1.00 0.00 ? 56 GLY A O    8  
ATOM 10421 H H    . GLY A 1 56 ? 0.034   -3.956  13.924  1.00 0.00 ? 56 GLY A H    8  
ATOM 10422 H HA2  . GLY A 1 56 ? 0.001   -1.899  14.937  1.00 0.00 ? 56 GLY A HA2  8  
ATOM 10423 H HA3  . GLY A 1 56 ? 0.700   -2.674  16.348  1.00 0.00 ? 56 GLY A HA3  8  
ATOM 10424 N N    . LYS A 1 57 ? 2.883   -2.355  14.045  1.00 0.00 ? 57 LYS A N    8  
ATOM 10425 C CA   . LYS A 1 57 ? 4.169   -1.776  13.690  1.00 0.00 ? 57 LYS A CA   8  
ATOM 10426 C C    . LYS A 1 57 ? 3.983   -0.538  12.820  1.00 0.00 ? 57 LYS A C    8  
ATOM 10427 O O    . LYS A 1 57 ? 2.863   -0.061  12.636  1.00 0.00 ? 57 LYS A O    8  
ATOM 10428 C CB   . LYS A 1 57 ? 5.033   -2.806  12.965  1.00 0.00 ? 57 LYS A CB   8  
ATOM 10429 C CG   . LYS A 1 57 ? 6.327   -3.133  13.694  1.00 0.00 ? 57 LYS A CG   8  
ATOM 10430 C CD   . LYS A 1 57 ? 6.667   -4.611  13.591  1.00 0.00 ? 57 LYS A CD   8  
ATOM 10431 C CE   . LYS A 1 57 ? 8.059   -4.902  14.128  1.00 0.00 ? 57 LYS A CE   8  
ATOM 10432 N NZ   . LYS A 1 57 ? 9.063   -3.921  13.630  1.00 0.00 ? 57 LYS A NZ   8  
ATOM 10433 H H    . LYS A 1 57 ? 2.570   -3.142  13.561  1.00 0.00 ? 57 LYS A H    8  
ATOM 10434 H HA   . LYS A 1 57 ? 4.661   -1.492  14.600  1.00 0.00 ? 57 LYS A HA   8  
ATOM 10435 H HB2  . LYS A 1 57 ? 4.467   -3.716  12.855  1.00 0.00 ? 57 LYS A HB2  8  
ATOM 10436 H HB3  . LYS A 1 57 ? 5.283   -2.425  11.988  1.00 0.00 ? 57 LYS A HB3  8  
ATOM 10437 H HG2  . LYS A 1 57 ? 7.130   -2.559  13.256  1.00 0.00 ? 57 LYS A HG2  8  
ATOM 10438 H HG3  . LYS A 1 57 ? 6.219   -2.869  14.735  1.00 0.00 ? 57 LYS A HG3  8  
ATOM 10439 H HD2  . LYS A 1 57 ? 5.947   -5.177  14.164  1.00 0.00 ? 57 LYS A HD2  8  
ATOM 10440 H HD3  . LYS A 1 57 ? 6.621   -4.910  12.554  1.00 0.00 ? 57 LYS A HD3  8  
ATOM 10441 H HE2  . LYS A 1 57 ? 8.032   -4.858  15.207  1.00 0.00 ? 57 LYS A HE2  8  
ATOM 10442 H HE3  . LYS A 1 57 ? 8.352   -5.894  13.816  1.00 0.00 ? 57 LYS A HE3  8  
ATOM 10443 H HZ1  . LYS A 1 57 ? 8.903   -2.992  14.068  1.00 0.00 ? 57 LYS A HZ1  8  
ATOM 10444 H HZ2  . LYS A 1 57 ? 8.985   -3.823  12.597  1.00 0.00 ? 57 LYS A HZ2  8  
ATOM 10445 H HZ3  . LYS A 1 57 ? 10.024  -4.243  13.864  1.00 0.00 ? 57 LYS A HZ3  8  
ATOM 10446 N N    . THR A 1 58 ? 5.086   -0.022  12.284  1.00 0.00 ? 58 THR A N    8  
ATOM 10447 C CA   . THR A 1 58 ? 5.041   1.162   11.430  1.00 0.00 ? 58 THR A CA   8  
ATOM 10448 C C    . THR A 1 58 ? 3.948   1.026   10.371  1.00 0.00 ? 58 THR A C    8  
ATOM 10449 O O    . THR A 1 58 ? 3.396   -0.056  10.174  1.00 0.00 ? 58 THR A O    8  
ATOM 10450 C CB   . THR A 1 58 ? 6.400   1.384   10.759  1.00 0.00 ? 58 THR A CB   8  
ATOM 10451 O OG1  . THR A 1 58 ? 6.444   2.647   10.118  1.00 0.00 ? 58 THR A OG1  8  
ATOM 10452 C CG2  . THR A 1 58 ? 6.742   0.329   9.726   1.00 0.00 ? 58 THR A CG2  8  
ATOM 10453 H H    . THR A 1 58 ? 5.950   -0.447  12.466  1.00 0.00 ? 58 THR A H    8  
ATOM 10454 H HA   . THR A 1 58 ? 4.815   2.013   12.055  1.00 0.00 ? 58 THR A HA   8  
ATOM 10455 H HB   . THR A 1 58 ? 7.169   1.363   11.518  1.00 0.00 ? 58 THR A HB   8  
ATOM 10456 H HG1  . THR A 1 58 ? 5.968   2.603   9.285   1.00 0.00 ? 58 THR A HG1  8  
ATOM 10457 H HG21 . THR A 1 58 ? 6.247   -0.597  9.979   1.00 0.00 ? 58 THR A HG21 8  
ATOM 10458 H HG22 . THR A 1 58 ? 7.810   0.174   9.710   1.00 0.00 ? 58 THR A HG22 8  
ATOM 10459 H HG23 . THR A 1 58 ? 6.411   0.659   8.752   1.00 0.00 ? 58 THR A HG23 8  
ATOM 10460 N N    . ARG A 1 59 ? 3.649   2.124   9.686   1.00 0.00 ? 59 ARG A N    8  
ATOM 10461 C CA   . ARG A 1 59 ? 2.638   2.117   8.648   1.00 0.00 ? 59 ARG A CA   8  
ATOM 10462 C C    . ARG A 1 59 ? 2.896   3.238   7.653   1.00 0.00 ? 59 ARG A C    8  
ATOM 10463 O O    . ARG A 1 59 ? 2.119   4.187   7.546   1.00 0.00 ? 59 ARG A O    8  
ATOM 10464 C CB   . ARG A 1 59 ? 1.242   2.262   9.258   1.00 0.00 ? 59 ARG A CB   8  
ATOM 10465 C CG   . ARG A 1 59 ? 1.082   3.502   10.123  1.00 0.00 ? 59 ARG A CG   8  
ATOM 10466 C CD   . ARG A 1 59 ? -0.309  4.100   9.987   1.00 0.00 ? 59 ARG A CD   8  
ATOM 10467 N NE   . ARG A 1 59 ? -0.281  5.560   10.004  1.00 0.00 ? 59 ARG A NE   8  
ATOM 10468 C CZ   . ARG A 1 59 ? 0.071   6.283   11.065  1.00 0.00 ? 59 ARG A CZ   8  
ATOM 10469 N NH1  . ARG A 1 59 ? 0.425   5.685   12.196  1.00 0.00 ? 59 ARG A NH1  8  
ATOM 10470 N NH2  . ARG A 1 59 ? 0.069   7.607   10.995  1.00 0.00 ? 59 ARG A NH2  8  
ATOM 10471 H H    . ARG A 1 59 ? 4.129   2.951   9.870   1.00 0.00 ? 59 ARG A H    8  
ATOM 10472 H HA   . ARG A 1 59 ? 2.704   1.174   8.135   1.00 0.00 ? 59 ARG A HA   8  
ATOM 10473 H HB2  . ARG A 1 59 ? 0.516   2.309   8.460   1.00 0.00 ? 59 ARG A HB2  8  
ATOM 10474 H HB3  . ARG A 1 59 ? 1.037   1.395   9.869   1.00 0.00 ? 59 ARG A HB3  8  
ATOM 10475 H HG2  . ARG A 1 59 ? 1.248   3.233   11.155  1.00 0.00 ? 59 ARG A HG2  8  
ATOM 10476 H HG3  . ARG A 1 59 ? 1.812   4.237   9.818   1.00 0.00 ? 59 ARG A HG3  8  
ATOM 10477 H HD2  . ARG A 1 59 ? -0.740  3.768   9.054   1.00 0.00 ? 59 ARG A HD2  8  
ATOM 10478 H HD3  . ARG A 1 59 ? -0.918  3.751   10.808  1.00 0.00 ? 59 ARG A HD3  8  
ATOM 10479 H HE   . ARG A 1 59 ? -0.538  6.027   9.182   1.00 0.00 ? 59 ARG A HE   8  
ATOM 10480 H HH11 . ARG A 1 59 ? 0.429   4.687   12.255  1.00 0.00 ? 59 ARG A HH11 8  
ATOM 10481 H HH12 . ARG A 1 59 ? 0.689   6.234   12.989  1.00 0.00 ? 59 ARG A HH12 8  
ATOM 10482 H HH21 . ARG A 1 59 ? -0.197  8.063   10.145  1.00 0.00 ? 59 ARG A HH21 8  
ATOM 10483 H HH22 . ARG A 1 59 ? 0.333   8.150   11.792  1.00 0.00 ? 59 ARG A HH22 8  
ATOM 10484 N N    . THR A 1 60 ? 3.993   3.112   6.923   1.00 0.00 ? 60 THR A N    8  
ATOM 10485 C CA   . THR A 1 60 ? 4.366   4.104   5.923   1.00 0.00 ? 60 THR A CA   8  
ATOM 10486 C C    . THR A 1 60 ? 3.284   4.216   4.853   1.00 0.00 ? 60 THR A C    8  
ATOM 10487 O O    . THR A 1 60 ? 2.710   3.211   4.435   1.00 0.00 ? 60 THR A O    8  
ATOM 10488 C CB   . THR A 1 60 ? 5.707   3.735   5.281   1.00 0.00 ? 60 THR A CB   8  
ATOM 10489 O OG1  . THR A 1 60 ? 6.061   2.398   5.589   1.00 0.00 ? 60 THR A OG1  8  
ATOM 10490 C CG2  . THR A 1 60 ? 6.847   4.625   5.727   1.00 0.00 ? 60 THR A CG2  8  
ATOM 10491 H H    . THR A 1 60 ? 4.567   2.332   7.065   1.00 0.00 ? 60 THR A H    8  
ATOM 10492 H HA   . THR A 1 60 ? 4.465   5.056   6.422   1.00 0.00 ? 60 THR A HA   8  
ATOM 10493 H HB   . THR A 1 60 ? 5.618   3.824   4.208   1.00 0.00 ? 60 THR A HB   8  
ATOM 10494 H HG1  . THR A 1 60 ? 6.886   2.176   5.150   1.00 0.00 ? 60 THR A HG1  8  
ATOM 10495 H HG21 . THR A 1 60 ? 7.738   4.375   5.170   1.00 0.00 ? 60 THR A HG21 8  
ATOM 10496 H HG22 . THR A 1 60 ? 7.028   4.477   6.781   1.00 0.00 ? 60 THR A HG22 8  
ATOM 10497 H HG23 . THR A 1 60 ? 6.589   5.658   5.547   1.00 0.00 ? 60 THR A HG23 8  
ATOM 10498 N N    . ARG A 1 61 ? 3.004   5.440   4.416   1.00 0.00 ? 61 ARG A N    8  
ATOM 10499 C CA   . ARG A 1 61 ? 1.988   5.670   3.403   1.00 0.00 ? 61 ARG A CA   8  
ATOM 10500 C C    . ARG A 1 61 ? 2.610   6.117   2.088   1.00 0.00 ? 61 ARG A C    8  
ATOM 10501 O O    . ARG A 1 61 ? 2.119   5.786   1.009   1.00 0.00 ? 61 ARG A O    8  
ATOM 10502 C CB   . ARG A 1 61 ? 0.977   6.711   3.886   1.00 0.00 ? 61 ARG A CB   8  
ATOM 10503 C CG   . ARG A 1 61 ? -0.209  6.112   4.623   1.00 0.00 ? 61 ARG A CG   8  
ATOM 10504 C CD   . ARG A 1 61 ? -1.060  7.188   5.277   1.00 0.00 ? 61 ARG A CD   8  
ATOM 10505 N NE   . ARG A 1 61 ? -1.586  8.140   4.300   1.00 0.00 ? 61 ARG A NE   8  
ATOM 10506 C CZ   . ARG A 1 61 ? -2.446  9.110   4.600   1.00 0.00 ? 61 ARG A CZ   8  
ATOM 10507 N NH1  . ARG A 1 61 ? -2.880  9.261   5.845   1.00 0.00 ? 61 ARG A NH1  8  
ATOM 10508 N NH2  . ARG A 1 61 ? -2.873  9.933   3.651   1.00 0.00 ? 61 ARG A NH2  8  
ATOM 10509 H H    . ARG A 1 61 ? 3.485   6.200   4.783   1.00 0.00 ? 61 ARG A H    8  
ATOM 10510 H HA   . ARG A 1 61 ? 1.485   4.743   3.242   1.00 0.00 ? 61 ARG A HA   8  
ATOM 10511 H HB2  . ARG A 1 61 ? 1.477   7.399   4.552   1.00 0.00 ? 61 ARG A HB2  8  
ATOM 10512 H HB3  . ARG A 1 61 ? 0.604   7.258   3.032   1.00 0.00 ? 61 ARG A HB3  8  
ATOM 10513 H HG2  . ARG A 1 61 ? -0.818  5.564   3.919   1.00 0.00 ? 61 ARG A HG2  8  
ATOM 10514 H HG3  . ARG A 1 61 ? 0.156   5.440   5.386   1.00 0.00 ? 61 ARG A HG3  8  
ATOM 10515 H HD2  . ARG A 1 61 ? -1.887  6.716   5.785   1.00 0.00 ? 61 ARG A HD2  8  
ATOM 10516 H HD3  . ARG A 1 61 ? -0.454  7.721   5.995   1.00 0.00 ? 61 ARG A HD3  8  
ATOM 10517 H HE   . ARG A 1 61 ? -1.282  8.050   3.373   1.00 0.00 ? 61 ARG A HE   8  
ATOM 10518 H HH11 . ARG A 1 61 ? -2.562  8.645   6.565   1.00 0.00 ? 61 ARG A HH11 8  
ATOM 10519 H HH12 . ARG A 1 61 ? -3.526  9.993   6.063   1.00 0.00 ? 61 ARG A HH12 8  
ATOM 10520 H HH21 . ARG A 1 61 ? -2.549  9.824   2.712   1.00 0.00 ? 61 ARG A HH21 8  
ATOM 10521 H HH22 . ARG A 1 61 ? -3.519  10.662  3.876   1.00 0.00 ? 61 ARG A HH22 8  
ATOM 10522 N N    . LYS A 1 62 ? 3.690   6.873   2.189   1.00 0.00 ? 62 LYS A N    8  
ATOM 10523 C CA   . LYS A 1 62 ? 4.385   7.375   1.014   1.00 0.00 ? 62 LYS A CA   8  
ATOM 10524 C C    . LYS A 1 62 ? 5.106   6.252   0.286   1.00 0.00 ? 62 LYS A C    8  
ATOM 10525 O O    . LYS A 1 62 ? 5.129   6.203   -0.944  1.00 0.00 ? 62 LYS A O    8  
ATOM 10526 C CB   . LYS A 1 62 ? 5.372   8.471   1.408   1.00 0.00 ? 62 LYS A CB   8  
ATOM 10527 C CG   . LYS A 1 62 ? 5.125   9.795   0.702   1.00 0.00 ? 62 LYS A CG   8  
ATOM 10528 C CD   . LYS A 1 62 ? 4.325   10.750  1.573   1.00 0.00 ? 62 LYS A CD   8  
ATOM 10529 C CE   . LYS A 1 62 ? 4.717   12.196  1.319   1.00 0.00 ? 62 LYS A CE   8  
ATOM 10530 N NZ   . LYS A 1 62 ? 4.637   13.019  2.557   1.00 0.00 ? 62 LYS A NZ   8  
ATOM 10531 H H    . LYS A 1 62 ? 4.026   7.101   3.077   1.00 0.00 ? 62 LYS A H    8  
ATOM 10532 H HA   . LYS A 1 62 ? 3.652   7.788   0.356   1.00 0.00 ? 62 LYS A HA   8  
ATOM 10533 H HB2  . LYS A 1 62 ? 5.302   8.636   2.472   1.00 0.00 ? 62 LYS A HB2  8  
ATOM 10534 H HB3  . LYS A 1 62 ? 6.368   8.141   1.168   1.00 0.00 ? 62 LYS A HB3  8  
ATOM 10535 H HG2  . LYS A 1 62 ? 6.076   10.249  0.468   1.00 0.00 ? 62 LYS A HG2  8  
ATOM 10536 H HG3  . LYS A 1 62 ? 4.578   9.609   -0.210  1.00 0.00 ? 62 LYS A HG3  8  
ATOM 10537 H HD2  . LYS A 1 62 ? 3.275   10.628  1.353   1.00 0.00 ? 62 LYS A HD2  8  
ATOM 10538 H HD3  . LYS A 1 62 ? 4.507   10.513  2.611   1.00 0.00 ? 62 LYS A HD3  8  
ATOM 10539 H HE2  . LYS A 1 62 ? 5.729   12.221  0.945   1.00 0.00 ? 62 LYS A HE2  8  
ATOM 10540 H HE3  . LYS A 1 62 ? 4.050   12.611  0.577   1.00 0.00 ? 62 LYS A HE3  8  
ATOM 10541 H HZ1  . LYS A 1 62 ? 3.660   13.038  2.912   1.00 0.00 ? 62 LYS A HZ1  8  
ATOM 10542 H HZ2  . LYS A 1 62 ? 4.941   13.994  2.359   1.00 0.00 ? 62 LYS A HZ2  8  
ATOM 10543 H HZ3  . LYS A 1 62 ? 5.254   12.619  3.293   1.00 0.00 ? 62 LYS A HZ3  8  
ATOM 10544 N N    . GLN A 1 63 ? 5.691   5.351   1.056   1.00 0.00 ? 63 GLN A N    8  
ATOM 10545 C CA   . GLN A 1 63 ? 6.412   4.224   0.505   1.00 0.00 ? 63 GLN A CA   8  
ATOM 10546 C C    . GLN A 1 63 ? 5.454   3.202   -0.089  1.00 0.00 ? 63 GLN A C    8  
ATOM 10547 O O    . GLN A 1 63 ? 5.797   2.487   -1.031  1.00 0.00 ? 63 GLN A O    8  
ATOM 10548 C CB   . GLN A 1 63 ? 7.278   3.576   1.575   1.00 0.00 ? 63 GLN A CB   8  
ATOM 10549 C CG   . GLN A 1 63 ? 7.812   4.541   2.625   1.00 0.00 ? 63 GLN A CG   8  
ATOM 10550 C CD   . GLN A 1 63 ? 8.462   5.768   2.014   1.00 0.00 ? 63 GLN A CD   8  
ATOM 10551 O OE1  . GLN A 1 63 ? 8.586   5.877   0.794   1.00 0.00 ? 63 GLN A OE1  8  
ATOM 10552 N NE2  . GLN A 1 63 ? 8.882   6.700   2.862   1.00 0.00 ? 63 GLN A NE2  8  
ATOM 10553 H H    . GLN A 1 63 ? 5.635   5.447   2.021   1.00 0.00 ? 63 GLN A H    8  
ATOM 10554 H HA   . GLN A 1 63 ? 7.044   4.589   -0.272  1.00 0.00 ? 63 GLN A HA   8  
ATOM 10555 H HB2  . GLN A 1 63 ? 6.697   2.826   2.069   1.00 0.00 ? 63 GLN A HB2  8  
ATOM 10556 H HB3  . GLN A 1 63 ? 8.114   3.109   1.096   1.00 0.00 ? 63 GLN A HB3  8  
ATOM 10557 H HG2  . GLN A 1 63 ? 6.995   4.862   3.252   1.00 0.00 ? 63 GLN A HG2  8  
ATOM 10558 H HG3  . GLN A 1 63 ? 8.546   4.026   3.227   1.00 0.00 ? 63 GLN A HG3  8  
ATOM 10559 H HE21 . GLN A 1 63 ? 8.751   6.545   3.821   1.00 0.00 ? 63 GLN A HE21 8  
ATOM 10560 H HE22 . GLN A 1 63 ? 9.306   7.503   2.495   1.00 0.00 ? 63 GLN A HE22 8  
ATOM 10561 N N    . VAL A 1 64 ? 4.250   3.141   0.464   1.00 0.00 ? 64 VAL A N    8  
ATOM 10562 C CA   . VAL A 1 64 ? 3.241   2.212   -0.014  1.00 0.00 ? 64 VAL A CA   8  
ATOM 10563 C C    . VAL A 1 64 ? 2.527   2.760   -1.244  1.00 0.00 ? 64 VAL A C    8  
ATOM 10564 O O    . VAL A 1 64 ? 1.911   2.009   -1.998  1.00 0.00 ? 64 VAL A O    8  
ATOM 10565 C CB   . VAL A 1 64 ? 2.199   1.890   1.073   1.00 0.00 ? 64 VAL A CB   8  
ATOM 10566 C CG1  . VAL A 1 64 ? 1.247   0.802   0.598   1.00 0.00 ? 64 VAL A CG1  8  
ATOM 10567 C CG2  . VAL A 1 64 ? 2.886   1.475   2.364   1.00 0.00 ? 64 VAL A CG2  8  
ATOM 10568 H H    . VAL A 1 64 ? 4.037   3.736   1.206   1.00 0.00 ? 64 VAL A H    8  
ATOM 10569 H HA   . VAL A 1 64 ? 3.743   1.300   -0.283  1.00 0.00 ? 64 VAL A HA   8  
ATOM 10570 H HB   . VAL A 1 64 ? 1.622   2.782   1.268   1.00 0.00 ? 64 VAL A HB   8  
ATOM 10571 H HG11 . VAL A 1 64 ? 0.750   0.361   1.449   1.00 0.00 ? 64 VAL A HG11 8  
ATOM 10572 H HG12 . VAL A 1 64 ? 1.804   0.041   0.072   1.00 0.00 ? 64 VAL A HG12 8  
ATOM 10573 H HG13 . VAL A 1 64 ? 0.511   1.232   -0.066  1.00 0.00 ? 64 VAL A HG13 8  
ATOM 10574 H HG21 . VAL A 1 64 ? 2.159   1.426   3.160   1.00 0.00 ? 64 VAL A HG21 8  
ATOM 10575 H HG22 . VAL A 1 64 ? 3.647   2.199   2.615   1.00 0.00 ? 64 VAL A HG22 8  
ATOM 10576 H HG23 . VAL A 1 64 ? 3.342   0.505   2.233   1.00 0.00 ? 64 VAL A HG23 8  
ATOM 10577 N N    . SER A 1 65 ? 2.625   4.069   -1.453  1.00 0.00 ? 65 SER A N    8  
ATOM 10578 C CA   . SER A 1 65 ? 2.002   4.701   -2.601  1.00 0.00 ? 65 SER A CA   8  
ATOM 10579 C C    . SER A 1 65 ? 2.948   4.658   -3.787  1.00 0.00 ? 65 SER A C    8  
ATOM 10580 O O    . SER A 1 65 ? 2.526   4.572   -4.940  1.00 0.00 ? 65 SER A O    8  
ATOM 10581 C CB   . SER A 1 65 ? 1.616   6.146   -2.280  1.00 0.00 ? 65 SER A CB   8  
ATOM 10582 O OG   . SER A 1 65 ? 0.808   6.213   -1.117  1.00 0.00 ? 65 SER A OG   8  
ATOM 10583 H H    . SER A 1 65 ? 3.139   4.618   -0.832  1.00 0.00 ? 65 SER A H    8  
ATOM 10584 H HA   . SER A 1 65 ? 1.121   4.141   -2.840  1.00 0.00 ? 65 SER A HA   8  
ATOM 10585 H HB2  . SER A 1 65 ? 2.510   6.727   -2.115  1.00 0.00 ? 65 SER A HB2  8  
ATOM 10586 H HB3  . SER A 1 65 ? 1.064   6.562   -3.111  1.00 0.00 ? 65 SER A HB3  8  
ATOM 10587 H HG   . SER A 1 65 ? 0.030   5.663   -1.236  1.00 0.00 ? 65 SER A HG   8  
ATOM 10588 N N    . SER A 1 66 ? 4.236   4.701   -3.481  1.00 0.00 ? 66 SER A N    8  
ATOM 10589 C CA   . SER A 1 66 ? 5.269   4.649   -4.494  1.00 0.00 ? 66 SER A CA   8  
ATOM 10590 C C    . SER A 1 66 ? 5.382   3.243   -5.062  1.00 0.00 ? 66 SER A C    8  
ATOM 10591 O O    . SER A 1 66 ? 5.699   3.054   -6.236  1.00 0.00 ? 66 SER A O    8  
ATOM 10592 C CB   . SER A 1 66 ? 6.600   5.081   -3.895  1.00 0.00 ? 66 SER A CB   8  
ATOM 10593 O OG   . SER A 1 66 ? 7.258   6.021   -4.727  1.00 0.00 ? 66 SER A OG   8  
ATOM 10594 H H    . SER A 1 66 ? 4.497   4.756   -2.542  1.00 0.00 ? 66 SER A H    8  
ATOM 10595 H HA   . SER A 1 66 ? 5.002   5.322   -5.278  1.00 0.00 ? 66 SER A HA   8  
ATOM 10596 H HB2  . SER A 1 66 ? 6.426   5.530   -2.929  1.00 0.00 ? 66 SER A HB2  8  
ATOM 10597 H HB3  . SER A 1 66 ? 7.225   4.218   -3.780  1.00 0.00 ? 66 SER A HB3  8  
ATOM 10598 H HG   . SER A 1 66 ? 8.064   5.631   -5.074  1.00 0.00 ? 66 SER A HG   8  
ATOM 10599 N N    . HIS A 1 67 ? 5.118   2.263   -4.210  1.00 0.00 ? 67 HIS A N    8  
ATOM 10600 C CA   . HIS A 1 67 ? 5.185   0.864   -4.606  1.00 0.00 ? 67 HIS A CA   8  
ATOM 10601 C C    . HIS A 1 67 ? 4.061   0.513   -5.570  1.00 0.00 ? 67 HIS A C    8  
ATOM 10602 O O    . HIS A 1 67 ? 4.233   -0.312  -6.467  1.00 0.00 ? 67 HIS A O    8  
ATOM 10603 C CB   . HIS A 1 67 ? 5.124   -0.043  -3.376  1.00 0.00 ? 67 HIS A CB   8  
ATOM 10604 C CG   . HIS A 1 67 ? 5.681   -1.412  -3.614  1.00 0.00 ? 67 HIS A CG   8  
ATOM 10605 N ND1  . HIS A 1 67 ? 6.721   -1.940  -2.877  1.00 0.00 ? 67 HIS A ND1  8  
ATOM 10606 C CD2  . HIS A 1 67 ? 5.339   -2.364  -4.514  1.00 0.00 ? 67 HIS A CD2  8  
ATOM 10607 C CE1  . HIS A 1 67 ? 6.994   -3.157  -3.315  1.00 0.00 ? 67 HIS A CE1  8  
ATOM 10608 N NE2  . HIS A 1 67 ? 6.169   -3.437  -4.306  1.00 0.00 ? 67 HIS A NE2  8  
ATOM 10609 H H    . HIS A 1 67 ? 4.875   2.489   -3.290  1.00 0.00 ? 67 HIS A H    8  
ATOM 10610 H HA   . HIS A 1 67 ? 6.122   0.713   -5.105  1.00 0.00 ? 67 HIS A HA   8  
ATOM 10611 H HB2  . HIS A 1 67 ? 5.688   0.410   -2.574  1.00 0.00 ? 67 HIS A HB2  8  
ATOM 10612 H HB3  . HIS A 1 67 ? 4.094   -0.152  -3.068  1.00 0.00 ? 67 HIS A HB3  8  
ATOM 10613 H HD1  . HIS A 1 67 ? 7.190   -1.490  -2.144  1.00 0.00 ? 67 HIS A HD1  8  
ATOM 10614 H HD2  . HIS A 1 67 ? 4.556   -2.292  -5.256  1.00 0.00 ? 67 HIS A HD2  8  
ATOM 10615 H HE1  . HIS A 1 67 ? 7.761   -3.811  -2.926  1.00 0.00 ? 67 HIS A HE1  8  
ATOM 10616 H HE2  . HIS A 1 67 ? 6.095   -4.308  -4.749  1.00 0.00 ? 67 HIS A HE2  8  
ATOM 10617 N N    . ILE A 1 68 ? 2.912   1.145   -5.381  1.00 0.00 ? 68 ILE A N    8  
ATOM 10618 C CA   . ILE A 1 68 ? 1.761   0.901   -6.237  1.00 0.00 ? 68 ILE A CA   8  
ATOM 10619 C C    . ILE A 1 68 ? 1.964   1.526   -7.609  1.00 0.00 ? 68 ILE A C    8  
ATOM 10620 O O    . ILE A 1 68 ? 1.446   1.034   -8.612  1.00 0.00 ? 68 ILE A O    8  
ATOM 10621 C CB   . ILE A 1 68 ? 0.459   1.446   -5.614  1.00 0.00 ? 68 ILE A CB   8  
ATOM 10622 C CG1  . ILE A 1 68 ? 0.302   0.940   -4.180  1.00 0.00 ? 68 ILE A CG1  8  
ATOM 10623 C CG2  . ILE A 1 68 ? -0.745  1.043   -6.455  1.00 0.00 ? 68 ILE A CG2  8  
ATOM 10624 C CD1  . ILE A 1 68 ? -0.501  1.870   -3.297  1.00 0.00 ? 68 ILE A CD1  8  
ATOM 10625 H H    . ILE A 1 68 ? 2.840   1.791   -4.651  1.00 0.00 ? 68 ILE A H    8  
ATOM 10626 H HA   . ILE A 1 68 ? 1.663   -0.162  -6.353  1.00 0.00 ? 68 ILE A HA   8  
ATOM 10627 H HB   . ILE A 1 68 ? 0.515   2.524   -5.604  1.00 0.00 ? 68 ILE A HB   8  
ATOM 10628 H HG12 . ILE A 1 68 ? -0.199  -0.016  -4.196  1.00 0.00 ? 68 ILE A HG12 8  
ATOM 10629 H HG13 . ILE A 1 68 ? 1.280   0.821   -3.737  1.00 0.00 ? 68 ILE A HG13 8  
ATOM 10630 H HG21 . ILE A 1 68 ? -0.410  0.699   -7.422  1.00 0.00 ? 68 ILE A HG21 8  
ATOM 10631 H HG22 . ILE A 1 68 ? -1.396  1.895   -6.582  1.00 0.00 ? 68 ILE A HG22 8  
ATOM 10632 H HG23 . ILE A 1 68 ? -1.283  0.250   -5.956  1.00 0.00 ? 68 ILE A HG23 8  
ATOM 10633 H HD11 . ILE A 1 68 ? -0.247  2.893   -3.527  1.00 0.00 ? 68 ILE A HD11 8  
ATOM 10634 H HD12 . ILE A 1 68 ? -0.275  1.667   -2.260  1.00 0.00 ? 68 ILE A HD12 8  
ATOM 10635 H HD13 . ILE A 1 68 ? -1.555  1.712   -3.473  1.00 0.00 ? 68 ILE A HD13 8  
ATOM 10636 N N    . GLN A 1 69 ? 2.728   2.608   -7.646  1.00 0.00 ? 69 GLN A N    8  
ATOM 10637 C CA   . GLN A 1 69 ? 3.012   3.299   -8.893  1.00 0.00 ? 69 GLN A CA   8  
ATOM 10638 C C    . GLN A 1 69 ? 4.004   2.506   -9.732  1.00 0.00 ? 69 GLN A C    8  
ATOM 10639 O O    . GLN A 1 69 ? 3.998   2.583   -10.961 1.00 0.00 ? 69 GLN A O    8  
ATOM 10640 C CB   . GLN A 1 69 ? 3.557   4.701   -8.616  1.00 0.00 ? 69 GLN A CB   8  
ATOM 10641 C CG   . GLN A 1 69 ? 2.563   5.612   -7.913  1.00 0.00 ? 69 GLN A CG   8  
ATOM 10642 C CD   . GLN A 1 69 ? 2.549   7.014   -8.490  1.00 0.00 ? 69 GLN A CD   8  
ATOM 10643 O OE1  . GLN A 1 69 ? 2.857   7.218   -9.664  1.00 0.00 ? 69 GLN A OE1  8  
ATOM 10644 N NE2  . GLN A 1 69 ? 2.188   7.990   -7.664  1.00 0.00 ? 69 GLN A NE2  8  
ATOM 10645 H H    . GLN A 1 69 ? 3.113   2.944   -6.816  1.00 0.00 ? 69 GLN A H    8  
ATOM 10646 H HA   . GLN A 1 69 ? 2.089   3.380   -9.436  1.00 0.00 ? 69 GLN A HA   8  
ATOM 10647 H HB2  . GLN A 1 69 ? 4.437   4.617   -7.995  1.00 0.00 ? 69 GLN A HB2  8  
ATOM 10648 H HB3  . GLN A 1 69 ? 3.832   5.160   -9.555  1.00 0.00 ? 69 GLN A HB3  8  
ATOM 10649 H HG2  . GLN A 1 69 ? 1.575   5.189   -8.011  1.00 0.00 ? 69 GLN A HG2  8  
ATOM 10650 H HG3  . GLN A 1 69 ? 2.827   5.671   -6.867  1.00 0.00 ? 69 GLN A HG3  8  
ATOM 10651 H HE21 . GLN A 1 69 ? 1.956   7.753   -6.742  1.00 0.00 ? 69 GLN A HE21 8  
ATOM 10652 H HE22 . GLN A 1 69 ? 2.170   8.906   -8.010  1.00 0.00 ? 69 GLN A HE22 8  
ATOM 10653 N N    . VAL A 1 70 ? 4.849   1.738   -9.058  1.00 0.00 ? 70 VAL A N    8  
ATOM 10654 C CA   . VAL A 1 70 ? 5.844   0.921   -9.734  1.00 0.00 ? 70 VAL A CA   8  
ATOM 10655 C C    . VAL A 1 70 ? 5.193   -0.265  -10.428 1.00 0.00 ? 70 VAL A C    8  
ATOM 10656 O O    . VAL A 1 70 ? 5.687   -0.752  -11.446 1.00 0.00 ? 70 VAL A O    8  
ATOM 10657 C CB   . VAL A 1 70 ? 6.916   0.410   -8.764  1.00 0.00 ? 70 VAL A CB   8  
ATOM 10658 C CG1  . VAL A 1 70 ? 8.111   -0.138  -9.528  1.00 0.00 ? 70 VAL A CG1  8  
ATOM 10659 C CG2  . VAL A 1 70 ? 7.343   1.506   -7.798  1.00 0.00 ? 70 VAL A CG2  8  
ATOM 10660 H H    . VAL A 1 70 ? 4.799   1.718   -8.082  1.00 0.00 ? 70 VAL A H    8  
ATOM 10661 H HA   . VAL A 1 70 ? 6.324   1.527   -10.465 1.00 0.00 ? 70 VAL A HA   8  
ATOM 10662 H HB   . VAL A 1 70 ? 6.486   -0.390  -8.200  1.00 0.00 ? 70 VAL A HB   8  
ATOM 10663 H HG11 . VAL A 1 70 ? 7.806   -0.412  -10.527 1.00 0.00 ? 70 VAL A HG11 8  
ATOM 10664 H HG12 . VAL A 1 70 ? 8.496   -1.009  -9.018  1.00 0.00 ? 70 VAL A HG12 8  
ATOM 10665 H HG13 . VAL A 1 70 ? 8.881   0.617   -9.582  1.00 0.00 ? 70 VAL A HG13 8  
ATOM 10666 H HG21 . VAL A 1 70 ? 6.959   2.457   -8.138  1.00 0.00 ? 70 VAL A HG21 8  
ATOM 10667 H HG22 . VAL A 1 70 ? 8.421   1.548   -7.753  1.00 0.00 ? 70 VAL A HG22 8  
ATOM 10668 H HG23 . VAL A 1 70 ? 6.951   1.292   -6.815  1.00 0.00 ? 70 VAL A HG23 8  
ATOM 10669 N N    . LEU A 1 71 ? 4.078   -0.721  -9.874  1.00 0.00 ? 71 LEU A N    8  
ATOM 10670 C CA   . LEU A 1 71 ? 3.350   -1.846  -10.439 1.00 0.00 ? 71 LEU A CA   8  
ATOM 10671 C C    . LEU A 1 71 ? 2.675   -1.450  -11.744 1.00 0.00 ? 71 LEU A C    8  
ATOM 10672 O O    . LEU A 1 71 ? 2.488   -2.276  -12.637 1.00 0.00 ? 71 LEU A O    8  
ATOM 10673 C CB   . LEU A 1 71 ? 2.317   -2.367  -9.442  1.00 0.00 ? 71 LEU A CB   8  
ATOM 10674 C CG   . LEU A 1 71 ? 2.527   -3.813  -8.988  1.00 0.00 ? 71 LEU A CG   8  
ATOM 10675 C CD1  . LEU A 1 71 ? 3.564   -3.877  -7.877  1.00 0.00 ? 71 LEU A CD1  8  
ATOM 10676 C CD2  . LEU A 1 71 ? 1.212   -4.422  -8.528  1.00 0.00 ? 71 LEU A CD2  8  
ATOM 10677 H H    . LEU A 1 71 ? 3.736   -0.287  -9.067  1.00 0.00 ? 71 LEU A H    8  
ATOM 10678 H HA   . LEU A 1 71 ? 4.059   -2.622  -10.641 1.00 0.00 ? 71 LEU A HA   8  
ATOM 10679 H HB2  . LEU A 1 71 ? 2.339   -1.731  -8.572  1.00 0.00 ? 71 LEU A HB2  8  
ATOM 10680 H HB3  . LEU A 1 71 ? 1.342   -2.296  -9.896  1.00 0.00 ? 71 LEU A HB3  8  
ATOM 10681 H HG   . LEU A 1 71 ? 2.894   -4.395  -9.821  1.00 0.00 ? 71 LEU A HG   8  
ATOM 10682 H HD11 . LEU A 1 71 ? 4.228   -3.029  -7.955  1.00 0.00 ? 71 LEU A HD11 8  
ATOM 10683 H HD12 . LEU A 1 71 ? 4.134   -4.790  -7.969  1.00 0.00 ? 71 LEU A HD12 8  
ATOM 10684 H HD13 . LEU A 1 71 ? 3.067   -3.858  -6.919  1.00 0.00 ? 71 LEU A HD13 8  
ATOM 10685 H HD21 . LEU A 1 71 ? 1.392   -5.411  -8.133  1.00 0.00 ? 71 LEU A HD21 8  
ATOM 10686 H HD22 . LEU A 1 71 ? 0.532   -4.487  -9.365  1.00 0.00 ? 71 LEU A HD22 8  
ATOM 10687 H HD23 . LEU A 1 71 ? 0.777   -3.802  -7.758  1.00 0.00 ? 71 LEU A HD23 8  
ATOM 10688 N N    . ALA A 1 72 ? 2.318   -0.177  -11.849 1.00 0.00 ? 72 ALA A N    8  
ATOM 10689 C CA   . ALA A 1 72 ? 1.671   0.338   -13.045 1.00 0.00 ? 72 ALA A CA   8  
ATOM 10690 C C    . ALA A 1 72 ? 2.648   0.385   -14.211 1.00 0.00 ? 72 ALA A C    8  
ATOM 10691 O O    . ALA A 1 72 ? 2.254   0.277   -15.373 1.00 0.00 ? 72 ALA A O    8  
ATOM 10692 C CB   . ALA A 1 72 ? 1.086   1.717   -12.782 1.00 0.00 ? 72 ALA A CB   8  
ATOM 10693 H H    . ALA A 1 72 ? 2.500   0.430   -11.105 1.00 0.00 ? 72 ALA A H    8  
ATOM 10694 H HA   . ALA A 1 72 ? 0.866   -0.329  -13.295 1.00 0.00 ? 72 ALA A HA   8  
ATOM 10695 H HB1  . ALA A 1 72 ? 0.218   1.865   -13.406 1.00 0.00 ? 72 ALA A HB1  8  
ATOM 10696 H HB2  . ALA A 1 72 ? 1.826   2.471   -13.009 1.00 0.00 ? 72 ALA A HB2  8  
ATOM 10697 H HB3  . ALA A 1 72 ? 0.800   1.795   -11.743 1.00 0.00 ? 72 ALA A HB3  8  
ATOM 10698 N N    . ARG A 1 73 ? 3.925   0.543   -13.890 1.00 0.00 ? 73 ARG A N    8  
ATOM 10699 C CA   . ARG A 1 73 ? 4.967   0.600   -14.904 1.00 0.00 ? 73 ARG A CA   8  
ATOM 10700 C C    . ARG A 1 73 ? 5.171   -0.767  -15.545 1.00 0.00 ? 73 ARG A C    8  
ATOM 10701 O O    . ARG A 1 73 ? 5.587   -0.869  -16.700 1.00 0.00 ? 73 ARG A O    8  
ATOM 10702 C CB   . ARG A 1 73 ? 6.279   1.094   -14.293 1.00 0.00 ? 73 ARG A CB   8  
ATOM 10703 C CG   . ARG A 1 73 ? 6.443   2.604   -14.344 1.00 0.00 ? 73 ARG A CG   8  
ATOM 10704 C CD   . ARG A 1 73 ? 7.901   3.001   -14.510 1.00 0.00 ? 73 ARG A CD   8  
ATOM 10705 N NE   . ARG A 1 73 ? 8.775   2.275   -13.591 1.00 0.00 ? 73 ARG A NE   8  
ATOM 10706 C CZ   . ARG A 1 73 ? 10.093  2.177   -13.742 1.00 0.00 ? 73 ARG A CZ   8  
ATOM 10707 N NH1  . ARG A 1 73 ? 10.695  2.758   -14.773 1.00 0.00 ? 73 ARG A NH1  8  
ATOM 10708 N NH2  . ARG A 1 73 ? 10.813  1.498   -12.860 1.00 0.00 ? 73 ARG A NH2  8  
ATOM 10709 H H    . ARG A 1 73 ? 4.171   0.620   -12.948 1.00 0.00 ? 73 ARG A H    8  
ATOM 10710 H HA   . ARG A 1 73 ? 4.648   1.292   -15.660 1.00 0.00 ? 73 ARG A HA   8  
ATOM 10711 H HB2  . ARG A 1 73 ? 6.322   0.783   -13.260 1.00 0.00 ? 73 ARG A HB2  8  
ATOM 10712 H HB3  . ARG A 1 73 ? 7.103   0.646   -14.829 1.00 0.00 ? 73 ARG A HB3  8  
ATOM 10713 H HG2  . ARG A 1 73 ? 5.878   2.990   -15.179 1.00 0.00 ? 73 ARG A HG2  8  
ATOM 10714 H HG3  . ARG A 1 73 ? 6.067   3.028   -13.425 1.00 0.00 ? 73 ARG A HG3  8  
ATOM 10715 H HD2  . ARG A 1 73 ? 8.206   2.787   -15.524 1.00 0.00 ? 73 ARG A HD2  8  
ATOM 10716 H HD3  . ARG A 1 73 ? 7.997   4.060   -14.322 1.00 0.00 ? 73 ARG A HD3  8  
ATOM 10717 H HE   . ARG A 1 73 ? 8.356   1.836   -12.821 1.00 0.00 ? 73 ARG A HE   8  
ATOM 10718 H HH11 . ARG A 1 73 ? 10.158  3.272   -15.442 1.00 0.00 ? 73 ARG A HH11 8  
ATOM 10719 H HH12 . ARG A 1 73 ? 11.686  2.681   -14.881 1.00 0.00 ? 73 ARG A HH12 8  
ATOM 10720 H HH21 . ARG A 1 73 ? 10.365  1.058   -12.081 1.00 0.00 ? 73 ARG A HH21 8  
ATOM 10721 H HH22 . ARG A 1 73 ? 11.804  1.424   -12.974 1.00 0.00 ? 73 ARG A HH22 8  
ATOM 10722 N N    . ARG A 1 74 ? 4.874   -1.814  -14.787 1.00 0.00 ? 74 ARG A N    8  
ATOM 10723 C CA   . ARG A 1 74 ? 5.020   -3.178  -15.275 1.00 0.00 ? 74 ARG A CA   8  
ATOM 10724 C C    . ARG A 1 74 ? 3.967   -3.493  -16.329 1.00 0.00 ? 74 ARG A C    8  
ATOM 10725 O O    . ARG A 1 74 ? 4.204   -4.279  -17.246 1.00 0.00 ? 74 ARG A O    8  
ATOM 10726 C CB   . ARG A 1 74 ? 4.916   -4.173  -14.117 1.00 0.00 ? 74 ARG A CB   8  
ATOM 10727 C CG   . ARG A 1 74 ? 5.770   -5.416  -14.305 1.00 0.00 ? 74 ARG A CG   8  
ATOM 10728 C CD   . ARG A 1 74 ? 5.686   -6.337  -13.099 1.00 0.00 ? 74 ARG A CD   8  
ATOM 10729 N NE   . ARG A 1 74 ? 6.254   -7.654  -13.374 1.00 0.00 ? 74 ARG A NE   8  
ATOM 10730 C CZ   . ARG A 1 74 ? 7.560   -7.909  -13.396 1.00 0.00 ? 74 ARG A CZ   8  
ATOM 10731 N NH1  . ARG A 1 74 ? 8.436   -6.941  -13.158 1.00 0.00 ? 74 ARG A NH1  8  
ATOM 10732 N NH2  . ARG A 1 74 ? 7.992   -9.136  -13.655 1.00 0.00 ? 74 ARG A NH2  8  
ATOM 10733 H H    . ARG A 1 74 ? 4.548   -1.665  -13.879 1.00 0.00 ? 74 ARG A H    8  
ATOM 10734 H HA   . ARG A 1 74 ? 5.992   -3.260  -15.723 1.00 0.00 ? 74 ARG A HA   8  
ATOM 10735 H HB2  . ARG A 1 74 ? 5.229   -3.682  -13.207 1.00 0.00 ? 74 ARG A HB2  8  
ATOM 10736 H HB3  . ARG A 1 74 ? 3.887   -4.481  -14.014 1.00 0.00 ? 74 ARG A HB3  8  
ATOM 10737 H HG2  . ARG A 1 74 ? 5.424   -5.950  -15.177 1.00 0.00 ? 74 ARG A HG2  8  
ATOM 10738 H HG3  . ARG A 1 74 ? 6.798   -5.117  -14.448 1.00 0.00 ? 74 ARG A HG3  8  
ATOM 10739 H HD2  . ARG A 1 74 ? 6.228   -5.887  -12.280 1.00 0.00 ? 74 ARG A HD2  8  
ATOM 10740 H HD3  . ARG A 1 74 ? 4.649   -6.453  -12.822 1.00 0.00 ? 74 ARG A HD3  8  
ATOM 10741 H HE   . ARG A 1 74 ? 5.629   -8.388  -13.553 1.00 0.00 ? 74 ARG A HE   8  
ATOM 10742 H HH11 . ARG A 1 74 ? 8.118   -6.014  -12.962 1.00 0.00 ? 74 ARG A HH11 8  
ATOM 10743 H HH12 . ARG A 1 74 ? 9.416   -7.139  -13.176 1.00 0.00 ? 74 ARG A HH12 8  
ATOM 10744 H HH21 . ARG A 1 74 ? 7.336   -9.869  -13.834 1.00 0.00 ? 74 ARG A HH21 8  
ATOM 10745 H HH22 . ARG A 1 74 ? 8.973   -9.327  -13.672 1.00 0.00 ? 74 ARG A HH22 8  
ATOM 10746 N N    . LYS A 1 75 ? 2.806   -2.871  -16.189 1.00 0.00 ? 75 LYS A N    8  
ATOM 10747 C CA   . LYS A 1 75 ? 1.709   -3.076  -17.123 1.00 0.00 ? 75 LYS A CA   8  
ATOM 10748 C C    . LYS A 1 75 ? 1.946   -2.308  -18.418 1.00 0.00 ? 75 LYS A C    8  
ATOM 10749 O O    . LYS A 1 75 ? 1.488   -2.712  -19.487 1.00 0.00 ? 75 LYS A O    8  
ATOM 10750 C CB   . LYS A 1 75 ? 0.384   -2.646  -16.493 1.00 0.00 ? 75 LYS A CB   8  
ATOM 10751 C CG   . LYS A 1 75 ? -0.832  -3.306  -17.123 1.00 0.00 ? 75 LYS A CG   8  
ATOM 10752 C CD   . LYS A 1 75 ? -1.915  -3.578  -16.091 1.00 0.00 ? 75 LYS A CD   8  
ATOM 10753 C CE   . LYS A 1 75 ? -2.424  -2.290  -15.464 1.00 0.00 ? 75 LYS A CE   8  
ATOM 10754 N NZ   . LYS A 1 75 ? -2.778  -2.473  -14.030 1.00 0.00 ? 75 LYS A NZ   8  
ATOM 10755 H H    . LYS A 1 75 ? 2.684   -2.260  -15.438 1.00 0.00 ? 75 LYS A H    8  
ATOM 10756 H HA   . LYS A 1 75 ? 1.667   -4.125  -17.347 1.00 0.00 ? 75 LYS A HA   8  
ATOM 10757 H HB2  . LYS A 1 75 ? 0.399   -2.897  -15.443 1.00 0.00 ? 75 LYS A HB2  8  
ATOM 10758 H HB3  . LYS A 1 75 ? 0.280   -1.576  -16.597 1.00 0.00 ? 75 LYS A HB3  8  
ATOM 10759 H HG2  . LYS A 1 75 ? -1.231  -2.653  -17.884 1.00 0.00 ? 75 LYS A HG2  8  
ATOM 10760 H HG3  . LYS A 1 75 ? -0.530  -4.242  -17.570 1.00 0.00 ? 75 LYS A HG3  8  
ATOM 10761 H HD2  . LYS A 1 75 ? -2.739  -4.082  -16.573 1.00 0.00 ? 75 LYS A HD2  8  
ATOM 10762 H HD3  . LYS A 1 75 ? -1.509  -4.210  -15.315 1.00 0.00 ? 75 LYS A HD3  8  
ATOM 10763 H HE2  . LYS A 1 75 ? -1.653  -1.538  -15.542 1.00 0.00 ? 75 LYS A HE2  8  
ATOM 10764 H HE3  . LYS A 1 75 ? -3.300  -1.964  -16.005 1.00 0.00 ? 75 LYS A HE3  8  
ATOM 10765 H HZ1  . LYS A 1 75 ? -3.459  -1.744  -13.734 1.00 0.00 ? 75 LYS A HZ1  8  
ATOM 10766 H HZ2  . LYS A 1 75 ? -1.927  -2.396  -13.438 1.00 0.00 ? 75 LYS A HZ2  8  
ATOM 10767 H HZ3  . LYS A 1 75 ? -3.205  -3.410  -13.883 1.00 0.00 ? 75 LYS A HZ3  8  
ATOM 10768 N N    . SER A 1 76 ? 2.663   -1.199  -18.309 1.00 0.00 ? 76 SER A N    8  
ATOM 10769 C CA   . SER A 1 76 ? 2.967   -0.364  -19.463 1.00 0.00 ? 76 SER A CA   8  
ATOM 10770 C C    . SER A 1 76 ? 4.051   -0.993  -20.337 1.00 0.00 ? 76 SER A C    8  
ATOM 10771 O O    . SER A 1 76 ? 4.312   -0.525  -21.445 1.00 0.00 ? 76 SER A O    8  
ATOM 10772 C CB   . SER A 1 76 ? 3.407   1.028   -19.008 1.00 0.00 ? 76 SER A CB   8  
ATOM 10773 O OG   . SER A 1 76 ? 2.902   2.031   -19.872 1.00 0.00 ? 76 SER A OG   8  
ATOM 10774 H H    . SER A 1 76 ? 2.995   -0.935  -17.432 1.00 0.00 ? 76 SER A H    8  
ATOM 10775 H HA   . SER A 1 76 ? 2.065   -0.272  -20.043 1.00 0.00 ? 76 SER A HA   8  
ATOM 10776 H HB2  . SER A 1 76 ? 3.039   1.212   -18.010 1.00 0.00 ? 76 SER A HB2  8  
ATOM 10777 H HB3  . SER A 1 76 ? 4.486   1.080   -19.008 1.00 0.00 ? 76 SER A HB3  8  
ATOM 10778 H HG   . SER A 1 76 ? 2.497   2.728   -19.351 1.00 0.00 ? 76 SER A HG   8  
ATOM 10779 N N    . ARG A 1 77 ? 4.682   -2.053  -19.835 1.00 0.00 ? 77 ARG A N    8  
ATOM 10780 C CA   . ARG A 1 77 ? 5.737   -2.737  -20.577 1.00 0.00 ? 77 ARG A CA   8  
ATOM 10781 C C    . ARG A 1 77 ? 5.262   -3.142  -21.969 1.00 0.00 ? 77 ARG A C    8  
ATOM 10782 O O    . ARG A 1 77 ? 6.068   -3.317  -22.883 1.00 0.00 ? 77 ARG A O    8  
ATOM 10783 C CB   . ARG A 1 77 ? 6.212   -3.971  -19.808 1.00 0.00 ? 77 ARG A CB   8  
ATOM 10784 C CG   . ARG A 1 77 ? 7.273   -3.666  -18.763 1.00 0.00 ? 77 ARG A CG   8  
ATOM 10785 C CD   . ARG A 1 77 ? 8.673   -3.909  -19.303 1.00 0.00 ? 77 ARG A CD   8  
ATOM 10786 N NE   . ARG A 1 77 ? 9.170   -2.768  -20.067 1.00 0.00 ? 77 ARG A NE   8  
ATOM 10787 C CZ   . ARG A 1 77 ? 10.252  -2.809  -20.842 1.00 0.00 ? 77 ARG A CZ   8  
ATOM 10788 N NH1  . ARG A 1 77 ? 10.951  -3.931  -20.958 1.00 0.00 ? 77 ARG A NH1  8  
ATOM 10789 N NH2  . ARG A 1 77 ? 10.636  -1.725  -21.503 1.00 0.00 ? 77 ARG A NH2  8  
ATOM 10790 H H    . ARG A 1 77 ? 4.435   -2.383  -18.947 1.00 0.00 ? 77 ARG A H    8  
ATOM 10791 H HA   . ARG A 1 77 ? 6.561   -2.051  -20.680 1.00 0.00 ? 77 ARG A HA   8  
ATOM 10792 H HB2  . ARG A 1 77 ? 5.364   -4.418  -19.309 1.00 0.00 ? 77 ARG A HB2  8  
ATOM 10793 H HB3  . ARG A 1 77 ? 6.622   -4.682  -20.509 1.00 0.00 ? 77 ARG A HB3  8  
ATOM 10794 H HG2  . ARG A 1 77 ? 7.187   -2.631  -18.468 1.00 0.00 ? 77 ARG A HG2  8  
ATOM 10795 H HG3  . ARG A 1 77 ? 7.112   -4.302  -17.905 1.00 0.00 ? 77 ARG A HG3  8  
ATOM 10796 H HD2  . ARG A 1 77 ? 9.338   -4.092  -18.473 1.00 0.00 ? 77 ARG A HD2  8  
ATOM 10797 H HD3  . ARG A 1 77 ? 8.651   -4.778  -19.945 1.00 0.00 ? 77 ARG A HD3  8  
ATOM 10798 H HE   . ARG A 1 77 ? 8.673   -1.926  -20.000 1.00 0.00 ? 77 ARG A HE   8  
ATOM 10799 H HH11 . ARG A 1 77 ? 10.668  -4.752  -20.463 1.00 0.00 ? 77 ARG A HH11 8  
ATOM 10800 H HH12 . ARG A 1 77 ? 11.763  -3.956  -21.542 1.00 0.00 ? 77 ARG A HH12 8  
ATOM 10801 H HH21 . ARG A 1 77 ? 10.112  -0.877  -21.419 1.00 0.00 ? 77 ARG A HH21 8  
ATOM 10802 H HH22 . ARG A 1 77 ? 11.448  -1.756  -22.085 1.00 0.00 ? 77 ARG A HH22 8  
ATOM 10803 N N    . ASP A 1 78 ? 3.952   -3.288  -22.122 1.00 0.00 ? 78 ASP A N    8  
ATOM 10804 C CA   . ASP A 1 78 ? 3.372   -3.671  -23.402 1.00 0.00 ? 78 ASP A CA   8  
ATOM 10805 C C    . ASP A 1 78 ? 3.515   -2.549  -24.423 1.00 0.00 ? 78 ASP A C    8  
ATOM 10806 O O    . ASP A 1 78 ? 3.620   -2.795  -25.624 1.00 0.00 ? 78 ASP A O    8  
ATOM 10807 C CB   . ASP A 1 78 ? 1.900   -4.041  -23.228 1.00 0.00 ? 78 ASP A CB   8  
ATOM 10808 C CG   . ASP A 1 78 ? 1.622   -5.489  -23.582 1.00 0.00 ? 78 ASP A CG   8  
ATOM 10809 O OD1  . ASP A 1 78 ? 1.718   -6.350  -22.682 1.00 0.00 ? 78 ASP A OD1  8  
ATOM 10810 O OD2  . ASP A 1 78 ? 1.310   -5.763  -24.760 1.00 0.00 ? 78 ASP A OD2  8  
ATOM 10811 H H    . ASP A 1 78 ? 3.363   -3.135  -21.358 1.00 0.00 ? 78 ASP A H    8  
ATOM 10812 H HA   . ASP A 1 78 ? 3.905   -4.528  -23.756 1.00 0.00 ? 78 ASP A HA   8  
ATOM 10813 H HB2  . ASP A 1 78 ? 1.618   -3.882  -22.201 1.00 0.00 ? 78 ASP A HB2  8  
ATOM 10814 H HB3  . ASP A 1 78 ? 1.300   -3.412  -23.866 1.00 0.00 ? 78 ASP A HB3  8  
ATOM 10815 N N    . LEU A 1 79 ? 3.517   -1.318  -23.932 1.00 0.00 ? 79 LEU A N    8  
ATOM 10816 C CA   . LEU A 1 79 ? 3.646   -0.150  -24.790 1.00 0.00 ? 79 LEU A CA   8  
ATOM 10817 C C    . LEU A 1 79 ? 5.097   0.056   -25.214 1.00 0.00 ? 79 LEU A C    8  
ATOM 10818 O O    . LEU A 1 79 ? 5.790   0.927   -24.687 1.00 0.00 ? 79 LEU A O    8  
ATOM 10819 C CB   . LEU A 1 79 ? 3.128   1.097   -24.071 1.00 0.00 ? 79 LEU A CB   8  
ATOM 10820 C CG   . LEU A 1 79 ? 1.627   1.353   -24.219 1.00 0.00 ? 79 LEU A CG   8  
ATOM 10821 C CD1  . LEU A 1 79 ? 0.839   0.476   -23.259 1.00 0.00 ? 79 LEU A CD1  8  
ATOM 10822 C CD2  . LEU A 1 79 ? 1.313   2.823   -23.982 1.00 0.00 ? 79 LEU A CD2  8  
ATOM 10823 H H    . LEU A 1 79 ? 3.429   -1.193  -22.970 1.00 0.00 ? 79 LEU A H    8  
ATOM 10824 H HA   . LEU A 1 79 ? 3.047   -0.323  -25.667 1.00 0.00 ? 79 LEU A HA   8  
ATOM 10825 H HB2  . LEU A 1 79 ? 3.354   1.000   -23.019 1.00 0.00 ? 79 LEU A HB2  8  
ATOM 10826 H HB3  . LEU A 1 79 ? 3.656   1.955   -24.458 1.00 0.00 ? 79 LEU A HB3  8  
ATOM 10827 H HG   . LEU A 1 79 ? 1.324   1.103   -25.226 1.00 0.00 ? 79 LEU A HG   8  
ATOM 10828 H HD11 . LEU A 1 79 ? -0.076  0.154   -23.734 1.00 0.00 ? 79 LEU A HD11 8  
ATOM 10829 H HD12 . LEU A 1 79 ? 0.603   1.039   -22.368 1.00 0.00 ? 79 LEU A HD12 8  
ATOM 10830 H HD13 . LEU A 1 79 ? 1.430   -0.388  -22.994 1.00 0.00 ? 79 LEU A HD13 8  
ATOM 10831 H HD21 . LEU A 1 79 ? 0.523   3.134   -24.650 1.00 0.00 ? 79 LEU A HD21 8  
ATOM 10832 H HD22 . LEU A 1 79 ? 2.196   3.415   -24.170 1.00 0.00 ? 79 LEU A HD22 8  
ATOM 10833 H HD23 . LEU A 1 79 ? 0.996   2.963   -22.960 1.00 0.00 ? 79 LEU A HD23 8  
ATOM 10834 N N    . VAL A 1 80 ? 5.550   -0.750  -26.168 1.00 0.00 ? 80 VAL A N    8  
ATOM 10835 C CA   . VAL A 1 80 ? 6.919   -0.656  -26.662 1.00 0.00 ? 80 VAL A CA   8  
ATOM 10836 C C    . VAL A 1 80 ? 7.221   0.749   -27.183 1.00 0.00 ? 80 VAL A C    8  
ATOM 10837 O O    . VAL A 1 80 ? 6.407   1.344   -27.890 1.00 0.00 ? 80 VAL A O    8  
ATOM 10838 C CB   . VAL A 1 80 ? 7.182   -1.681  -27.784 1.00 0.00 ? 80 VAL A CB   8  
ATOM 10839 C CG1  . VAL A 1 80 ? 6.266   -1.423  -28.971 1.00 0.00 ? 80 VAL A CG1  8  
ATOM 10840 C CG2  . VAL A 1 80 ? 8.642   -1.648  -28.209 1.00 0.00 ? 80 VAL A CG2  8  
ATOM 10841 H H    . VAL A 1 80 ? 4.950   -1.425  -26.548 1.00 0.00 ? 80 VAL A H    8  
ATOM 10842 H HA   . VAL A 1 80 ? 7.583   -0.877  -25.839 1.00 0.00 ? 80 VAL A HA   8  
ATOM 10843 H HB   . VAL A 1 80 ? 6.964   -2.666  -27.400 1.00 0.00 ? 80 VAL A HB   8  
ATOM 10844 H HG11 . VAL A 1 80 ? 5.250   -1.306  -28.624 1.00 0.00 ? 80 VAL A HG11 8  
ATOM 10845 H HG12 . VAL A 1 80 ? 6.320   -2.258  -29.655 1.00 0.00 ? 80 VAL A HG12 8  
ATOM 10846 H HG13 . VAL A 1 80 ? 6.579   -0.522  -29.478 1.00 0.00 ? 80 VAL A HG13 8  
ATOM 10847 H HG21 . VAL A 1 80 ? 9.263   -1.990  -27.394 1.00 0.00 ? 80 VAL A HG21 8  
ATOM 10848 H HG22 . VAL A 1 80 ? 8.918   -0.638  -28.472 1.00 0.00 ? 80 VAL A HG22 8  
ATOM 10849 H HG23 . VAL A 1 80 ? 8.783   -2.294  -29.064 1.00 0.00 ? 80 VAL A HG23 8  
ATOM 10850 N N    . PRO A 1 81 ? 8.400   1.302   -26.842 1.00 0.00 ? 81 PRO A N    8  
ATOM 10851 C CA   . PRO A 1 81 ? 8.799   2.643   -27.282 1.00 0.00 ? 81 PRO A CA   8  
ATOM 10852 C C    . PRO A 1 81 ? 9.068   2.707   -28.781 1.00 0.00 ? 81 PRO A C    8  
ATOM 10853 O O    . PRO A 1 81 ? 9.959   2.028   -29.292 1.00 0.00 ? 81 PRO A O    8  
ATOM 10854 C CB   . PRO A 1 81 ? 10.082  2.911   -26.497 1.00 0.00 ? 81 PRO A CB   8  
ATOM 10855 C CG   . PRO A 1 81 ? 10.626  1.561   -26.200 1.00 0.00 ? 81 PRO A CG   8  
ATOM 10856 C CD   . PRO A 1 81 ? 9.434   0.669   -26.003 1.00 0.00 ? 81 PRO A CD   8  
ATOM 10857 H HA   . PRO A 1 81 ? 8.059   3.378   -27.020 1.00 0.00 ? 81 PRO A HA   8  
ATOM 10858 H HB2  . PRO A 1 81 ? 10.765  3.490   -27.103 1.00 0.00 ? 81 PRO A HB2  8  
ATOM 10859 H HB3  . PRO A 1 81 ? 9.849   3.450   -25.591 1.00 0.00 ? 81 PRO A HB3  8  
ATOM 10860 H HG2  . PRO A 1 81 ? 11.218  1.217   -27.033 1.00 0.00 ? 81 PRO A HG2  8  
ATOM 10861 H HG3  . PRO A 1 81 ? 11.221  1.596   -25.302 1.00 0.00 ? 81 PRO A HG3  8  
ATOM 10862 H HD2  . PRO A 1 81 ? 9.650   -0.332  -26.346 1.00 0.00 ? 81 PRO A HD2  8  
ATOM 10863 H HD3  . PRO A 1 81 ? 9.135   0.660   -24.966 1.00 0.00 ? 81 PRO A HD3  8  
ATOM 10864 N N    . ARG A 1 82 ? 8.292   3.528   -29.482 1.00 0.00 ? 82 ARG A N    8  
ATOM 10865 C CA   . ARG A 1 82 ? 8.447   3.681   -30.924 1.00 0.00 ? 82 ARG A CA   8  
ATOM 10866 C C    . ARG A 1 82 ? 8.241   2.349   -31.639 1.00 0.00 ? 82 ARG A C    8  
ATOM 10867 O O    . ARG A 1 82 ? 8.799   2.179   -32.743 1.00 0.00 ? 82 ARG A O    8  
ATOM 10868 C CB   . ARG A 1 82 ? 9.833   4.240   -31.253 1.00 0.00 ? 82 ARG A CB   8  
ATOM 10869 C CG   . ARG A 1 82 ? 10.231  5.425   -30.388 1.00 0.00 ? 82 ARG A CG   8  
ATOM 10870 C CD   . ARG A 1 82 ? 11.466  6.123   -30.934 1.00 0.00 ? 82 ARG A CD   8  
ATOM 10871 N NE   . ARG A 1 82 ? 11.634  7.460   -30.370 1.00 0.00 ? 82 ARG A NE   8  
ATOM 10872 C CZ   . ARG A 1 82 ? 12.091  7.695   -29.142 1.00 0.00 ? 82 ARG A CZ   8  
ATOM 10873 N NH1  . ARG A 1 82 ? 12.428  6.686   -28.347 1.00 0.00 ? 82 ARG A NH1  8  
ATOM 10874 N NH2  . ARG A 1 82 ? 12.213  8.941   -28.707 1.00 0.00 ? 82 ARG A NH2  8  
ATOM 10875 O OXT  . ARG A 1 82 ? 7.524   1.488   -31.088 1.00 0.00 ? 82 ARG A OXT  8  
ATOM 10876 H H    . ARG A 1 82 ? 7.599   4.043   -29.019 1.00 0.00 ? 82 ARG A H    8  
ATOM 10877 H HA   . ARG A 1 82 ? 7.697   4.379   -31.266 1.00 0.00 ? 82 ARG A HA   8  
ATOM 10878 H HB2  . ARG A 1 82 ? 10.566  3.459   -31.115 1.00 0.00 ? 82 ARG A HB2  8  
ATOM 10879 H HB3  . ARG A 1 82 ? 9.845   4.555   -32.286 1.00 0.00 ? 82 ARG A HB3  8  
ATOM 10880 H HG2  . ARG A 1 82 ? 9.414   6.131   -30.362 1.00 0.00 ? 82 ARG A HG2  8  
ATOM 10881 H HG3  . ARG A 1 82 ? 10.438  5.075   -29.388 1.00 0.00 ? 82 ARG A HG3  8  
ATOM 10882 H HD2  . ARG A 1 82 ? 12.335  5.529   -30.692 1.00 0.00 ? 82 ARG A HD2  8  
ATOM 10883 H HD3  . ARG A 1 82 ? 11.373  6.204   -32.007 1.00 0.00 ? 82 ARG A HD3  8  
ATOM 10884 H HE   . ARG A 1 82 ? 11.393  8.223   -30.935 1.00 0.00 ? 82 ARG A HE   8  
ATOM 10885 H HH11 . ARG A 1 82 ? 12.339  5.744   -28.669 1.00 0.00 ? 82 ARG A HH11 8  
ATOM 10886 H HH12 . ARG A 1 82 ? 12.771  6.869   -27.426 1.00 0.00 ? 82 ARG A HH12 8  
ATOM 10887 H HH21 . ARG A 1 82 ? 11.962  9.705   -29.302 1.00 0.00 ? 82 ARG A HH21 8  
ATOM 10888 H HH22 . ARG A 1 82 ? 12.557  9.118   -27.785 1.00 0.00 ? 82 ARG A HH22 8  
ATOM 10889 N N    . MET A 1 1  ? 13.370  13.491  14.112  1.00 0.00 ? 1  MET A N    9  
ATOM 10890 C CA   . MET A 1 1  ? 13.880  12.606  15.192  1.00 0.00 ? 1  MET A CA   9  
ATOM 10891 C C    . MET A 1 1  ? 13.258  11.216  15.106  1.00 0.00 ? 1  MET A C    9  
ATOM 10892 O O    . MET A 1 1  ? 12.925  10.610  16.124  1.00 0.00 ? 1  MET A O    9  
ATOM 10893 C CB   . MET A 1 1  ? 13.553  13.248  16.542  1.00 0.00 ? 1  MET A CB   9  
ATOM 10894 C CG   . MET A 1 1  ? 14.636  13.046  17.589  1.00 0.00 ? 1  MET A CG   9  
ATOM 10895 S SD   . MET A 1 1  ? 16.075  14.095  17.312  1.00 0.00 ? 1  MET A SD   9  
ATOM 10896 C CE   . MET A 1 1  ? 15.527  15.627  18.060  1.00 0.00 ? 1  MET A CE   9  
ATOM 10897 H H1   . MET A 1 1  ? 12.338  13.373  14.066  1.00 0.00 ? 1  MET A H1   9  
ATOM 10898 H H2   . MET A 1 1  ? 13.823  13.197  13.222  1.00 0.00 ? 1  MET A H2   9  
ATOM 10899 H H3   . MET A 1 1  ? 13.623  14.469  14.357  1.00 0.00 ? 1  MET A H3   9  
ATOM 10900 H HA   . MET A 1 1  ? 14.951  12.520  15.089  1.00 0.00 ? 1  MET A HA   9  
ATOM 10901 H HB2  . MET A 1 1  ? 13.415  14.310  16.399  1.00 0.00 ? 1  MET A HB2  9  
ATOM 10902 H HB3  . MET A 1 1  ? 12.635  12.822  16.918  1.00 0.00 ? 1  MET A HB3  9  
ATOM 10903 H HG2  . MET A 1 1  ? 14.225  13.274  18.562  1.00 0.00 ? 1  MET A HG2  9  
ATOM 10904 H HG3  . MET A 1 1  ? 14.951  12.013  17.567  1.00 0.00 ? 1  MET A HG3  9  
ATOM 10905 H HE1  . MET A 1 1  ? 15.508  15.516  19.135  1.00 0.00 ? 1  MET A HE1  9  
ATOM 10906 H HE2  . MET A 1 1  ? 14.535  15.866  17.706  1.00 0.00 ? 1  MET A HE2  9  
ATOM 10907 H HE3  . MET A 1 1  ? 16.207  16.422  17.792  1.00 0.00 ? 1  MET A HE3  9  
ATOM 10908 N N    . ASP A 1 2  ? 13.104  10.717  13.884  1.00 0.00 ? 2  ASP A N    9  
ATOM 10909 C CA   . ASP A 1 2  ? 12.522  9.398   13.665  1.00 0.00 ? 2  ASP A CA   9  
ATOM 10910 C C    . ASP A 1 2  ? 13.350  8.316   14.350  1.00 0.00 ? 2  ASP A C    9  
ATOM 10911 O O    . ASP A 1 2  ? 14.398  7.910   13.847  1.00 0.00 ? 2  ASP A O    9  
ATOM 10912 C CB   . ASP A 1 2  ? 12.414  9.110   12.169  1.00 0.00 ? 2  ASP A CB   9  
ATOM 10913 C CG   . ASP A 1 2  ? 10.979  8.916   11.719  1.00 0.00 ? 2  ASP A CG   9  
ATOM 10914 O OD1  . ASP A 1 2  ? 10.472  7.779   11.821  1.00 0.00 ? 2  ASP A OD1  9  
ATOM 10915 O OD2  . ASP A 1 2  ? 10.361  9.902   11.265  1.00 0.00 ? 2  ASP A OD2  9  
ATOM 10916 H H    . ASP A 1 2  ? 13.389  11.248  13.111  1.00 0.00 ? 2  ASP A H    9  
ATOM 10917 H HA   . ASP A 1 2  ? 11.534  9.399   14.089  1.00 0.00 ? 2  ASP A HA   9  
ATOM 10918 H HB2  . ASP A 1 2  ? 12.833  9.937   11.621  1.00 0.00 ? 2  ASP A HB2  9  
ATOM 10919 H HB3  . ASP A 1 2  ? 12.967  8.213   11.942  1.00 0.00 ? 2  ASP A HB3  9  
ATOM 10920 N N    . ASN A 1 3  ? 12.873  7.852   15.500  1.00 0.00 ? 3  ASN A N    9  
ATOM 10921 C CA   . ASN A 1 3  ? 13.560  6.822   16.256  1.00 0.00 ? 3  ASN A CA   9  
ATOM 10922 C C    . ASN A 1 3  ? 13.680  5.530   15.451  1.00 0.00 ? 3  ASN A C    9  
ATOM 10923 O O    . ASN A 1 3  ? 14.522  4.681   15.745  1.00 0.00 ? 3  ASN A O    9  
ATOM 10924 C CB   . ASN A 1 3  ? 12.813  6.560   17.561  1.00 0.00 ? 3  ASN A CB   9  
ATOM 10925 C CG   . ASN A 1 3  ? 11.317  6.409   17.358  1.00 0.00 ? 3  ASN A CG   9  
ATOM 10926 O OD1  . ASN A 1 3  ? 10.851  6.171   16.244  1.00 0.00 ? 3  ASN A OD1  9  
ATOM 10927 N ND2  . ASN A 1 3  ? 10.556  6.548   18.437  1.00 0.00 ? 3  ASN A ND2  9  
ATOM 10928 H H    . ASN A 1 3  ? 12.036  8.210   15.853  1.00 0.00 ? 3  ASN A H    9  
ATOM 10929 H HA   . ASN A 1 3  ? 14.549  7.182   16.484  1.00 0.00 ? 3  ASN A HA   9  
ATOM 10930 H HB2  . ASN A 1 3  ? 13.185  5.656   17.997  1.00 0.00 ? 3  ASN A HB2  9  
ATOM 10931 H HB3  . ASN A 1 3  ? 12.985  7.382   18.240  1.00 0.00 ? 3  ASN A HB3  9  
ATOM 10932 H HD21 . ASN A 1 3  ? 10.996  6.738   19.292  1.00 0.00 ? 3  ASN A HD21 9  
ATOM 10933 H HD22 . ASN A 1 3  ? 9.586   6.456   18.335  1.00 0.00 ? 3  ASN A HD22 9  
ATOM 10934 N N    . ASP A 1 4  ? 12.835  5.387   14.436  1.00 0.00 ? 4  ASP A N    9  
ATOM 10935 C CA   . ASP A 1 4  ? 12.849  4.199   13.591  1.00 0.00 ? 4  ASP A CA   9  
ATOM 10936 C C    . ASP A 1 4  ? 14.206  4.017   12.916  1.00 0.00 ? 4  ASP A C    9  
ATOM 10937 O O    . ASP A 1 4  ? 14.565  2.912   12.510  1.00 0.00 ? 4  ASP A O    9  
ATOM 10938 C CB   . ASP A 1 4  ? 11.746  4.284   12.538  1.00 0.00 ? 4  ASP A CB   9  
ATOM 10939 C CG   . ASP A 1 4  ? 10.723  3.174   12.679  1.00 0.00 ? 4  ASP A CG   9  
ATOM 10940 O OD1  . ASP A 1 4  ? 9.740   3.363   13.427  1.00 0.00 ? 4  ASP A OD1  9  
ATOM 10941 O OD2  . ASP A 1 4  ? 10.904  2.115   12.042  1.00 0.00 ? 4  ASP A OD2  9  
ATOM 10942 H H    . ASP A 1 4  ? 12.187  6.097   14.250  1.00 0.00 ? 4  ASP A H    9  
ATOM 10943 H HA   . ASP A 1 4  ? 12.661  3.349   14.219  1.00 0.00 ? 4  ASP A HA   9  
ATOM 10944 H HB2  . ASP A 1 4  ? 11.238  5.229   12.639  1.00 0.00 ? 4  ASP A HB2  9  
ATOM 10945 H HB3  . ASP A 1 4  ? 12.188  4.219   11.557  1.00 0.00 ? 4  ASP A HB3  9  
ATOM 10946 N N    . ALA A 1 5  ? 14.954  5.108   12.799  1.00 0.00 ? 5  ALA A N    9  
ATOM 10947 C CA   . ALA A 1 5  ? 16.265  5.072   12.174  1.00 0.00 ? 5  ALA A CA   9  
ATOM 10948 C C    . ALA A 1 5  ? 17.372  4.900   13.211  1.00 0.00 ? 5  ALA A C    9  
ATOM 10949 O O    . ALA A 1 5  ? 18.520  5.277   12.973  1.00 0.00 ? 5  ALA A O    9  
ATOM 10950 C CB   . ALA A 1 5  ? 16.495  6.335   11.358  1.00 0.00 ? 5  ALA A CB   9  
ATOM 10951 H H    . ALA A 1 5  ? 14.616  5.954   13.136  1.00 0.00 ? 5  ALA A H    9  
ATOM 10952 H HA   . ALA A 1 5  ? 16.280  4.233   11.503  1.00 0.00 ? 5  ALA A HA   9  
ATOM 10953 H HB1  . ALA A 1 5  ? 15.828  6.341   10.508  1.00 0.00 ? 5  ALA A HB1  9  
ATOM 10954 H HB2  . ALA A 1 5  ? 17.518  6.360   11.013  1.00 0.00 ? 5  ALA A HB2  9  
ATOM 10955 H HB3  . ALA A 1 5  ? 16.301  7.201   11.973  1.00 0.00 ? 5  ALA A HB3  9  
ATOM 10956 N N    . GLU A 1 6  ? 17.023  4.332   14.362  1.00 0.00 ? 6  GLU A N    9  
ATOM 10957 C CA   . GLU A 1 6  ? 17.987  4.115   15.430  1.00 0.00 ? 6  GLU A CA   9  
ATOM 10958 C C    . GLU A 1 6  ? 18.507  2.688   15.428  1.00 0.00 ? 6  GLU A C    9  
ATOM 10959 O O    . GLU A 1 6  ? 19.035  2.196   16.425  1.00 0.00 ? 6  GLU A O    9  
ATOM 10960 C CB   . GLU A 1 6  ? 17.352  4.422   16.773  1.00 0.00 ? 6  GLU A CB   9  
ATOM 10961 C CG   . GLU A 1 6  ? 18.315  5.015   17.789  1.00 0.00 ? 6  GLU A CG   9  
ATOM 10962 C CD   . GLU A 1 6  ? 17.650  5.312   19.118  1.00 0.00 ? 6  GLU A CD   9  
ATOM 10963 O OE1  . GLU A 1 6  ? 17.521  4.380   19.940  1.00 0.00 ? 6  GLU A OE1  9  
ATOM 10964 O OE2  . GLU A 1 6  ? 17.259  6.478   19.339  1.00 0.00 ? 6  GLU A OE2  9  
ATOM 10965 H H    . GLU A 1 6  ? 16.101  4.056   14.498  1.00 0.00 ? 6  GLU A H    9  
ATOM 10966 H HA   . GLU A 1 6  ? 18.804  4.776   15.258  1.00 0.00 ? 6  GLU A HA   9  
ATOM 10967 H HB2  . GLU A 1 6  ? 16.543  5.119   16.620  1.00 0.00 ? 6  GLU A HB2  9  
ATOM 10968 H HB3  . GLU A 1 6  ? 16.954  3.504   17.174  1.00 0.00 ? 6  GLU A HB3  9  
ATOM 10969 H HG2  . GLU A 1 6  ? 19.119  4.313   17.956  1.00 0.00 ? 6  GLU A HG2  9  
ATOM 10970 H HG3  . GLU A 1 6  ? 18.718  5.934   17.390  1.00 0.00 ? 6  GLU A HG3  9  
ATOM 10971 N N    . GLY A 1 7  ? 18.348  2.044   14.298  1.00 0.00 ? 7  GLY A N    9  
ATOM 10972 C CA   . GLY A 1 7  ? 18.794  0.672   14.142  1.00 0.00 ? 7  GLY A CA   9  
ATOM 10973 C C    . GLY A 1 7  ? 17.647  -0.320  14.164  1.00 0.00 ? 7  GLY A C    9  
ATOM 10974 O O    . GLY A 1 7  ? 17.767  -1.429  13.644  1.00 0.00 ? 7  GLY A O    9  
ATOM 10975 H H    . GLY A 1 7  ? 17.919  2.511   13.561  1.00 0.00 ? 7  GLY A H    9  
ATOM 10976 H HA2  . GLY A 1 7  ? 19.316  0.580   13.201  1.00 0.00 ? 7  GLY A HA2  9  
ATOM 10977 H HA3  . GLY A 1 7  ? 19.476  0.434   14.945  1.00 0.00 ? 7  GLY A HA3  9  
ATOM 10978 N N    . VAL A 1 8  ? 16.531  0.078   14.768  1.00 0.00 ? 8  VAL A N    9  
ATOM 10979 C CA   . VAL A 1 8  ? 15.362  -0.775  14.858  1.00 0.00 ? 8  VAL A CA   9  
ATOM 10980 C C    . VAL A 1 8  ? 14.829  -1.146  13.477  1.00 0.00 ? 8  VAL A C    9  
ATOM 10981 O O    . VAL A 1 8  ? 14.088  -2.117  13.329  1.00 0.00 ? 8  VAL A O    9  
ATOM 10982 C CB   . VAL A 1 8  ? 14.248  -0.086  15.661  1.00 0.00 ? 8  VAL A CB   9  
ATOM 10983 C CG1  . VAL A 1 8  ? 14.532  -0.167  17.153  1.00 0.00 ? 8  VAL A CG1  9  
ATOM 10984 C CG2  . VAL A 1 8  ? 14.079  1.362   15.220  1.00 0.00 ? 8  VAL A CG2  9  
ATOM 10985 H H    . VAL A 1 8  ? 16.490  0.969   15.165  1.00 0.00 ? 8  VAL A H    9  
ATOM 10986 H HA   . VAL A 1 8  ? 15.646  -1.676  15.377  1.00 0.00 ? 8  VAL A HA   9  
ATOM 10987 H HB   . VAL A 1 8  ? 13.331  -0.603  15.466  1.00 0.00 ? 8  VAL A HB   9  
ATOM 10988 H HG11 . VAL A 1 8  ? 13.599  -0.169  17.697  1.00 0.00 ? 8  VAL A HG11 9  
ATOM 10989 H HG12 . VAL A 1 8  ? 15.123  0.685   17.454  1.00 0.00 ? 8  VAL A HG12 9  
ATOM 10990 H HG13 . VAL A 1 8  ? 15.075  -1.076  17.367  1.00 0.00 ? 8  VAL A HG13 9  
ATOM 10991 H HG21 . VAL A 1 8  ? 14.178  1.425   14.147  1.00 0.00 ? 8  VAL A HG21 9  
ATOM 10992 H HG22 . VAL A 1 8  ? 14.838  1.972   15.688  1.00 0.00 ? 8  VAL A HG22 9  
ATOM 10993 H HG23 . VAL A 1 8  ? 13.102  1.716   15.513  1.00 0.00 ? 8  VAL A HG23 9  
ATOM 10994 N N    . TRP A 1 9  ? 15.211  -0.368  12.469  1.00 0.00 ? 9  TRP A N    9  
ATOM 10995 C CA   . TRP A 1 9  ? 14.770  -0.617  11.101  1.00 0.00 ? 9  TRP A CA   9  
ATOM 10996 C C    . TRP A 1 9  ? 15.162  -2.020  10.647  1.00 0.00 ? 9  TRP A C    9  
ATOM 10997 O O    . TRP A 1 9  ? 16.335  -2.392  10.689  1.00 0.00 ? 9  TRP A O    9  
ATOM 10998 C CB   . TRP A 1 9  ? 15.363  0.426   10.157  1.00 0.00 ? 9  TRP A CB   9  
ATOM 10999 C CG   . TRP A 1 9  ? 14.327  1.263   9.469   1.00 0.00 ? 9  TRP A CG   9  
ATOM 11000 C CD1  . TRP A 1 9  ? 13.064  0.881   9.120   1.00 0.00 ? 9  TRP A CD1  9  
ATOM 11001 C CD2  . TRP A 1 9  ? 14.467  2.624   9.046   1.00 0.00 ? 9  TRP A CD2  9  
ATOM 11002 N NE1  . TRP A 1 9  ? 12.410  1.921   8.506   1.00 0.00 ? 9  TRP A NE1  9  
ATOM 11003 C CE2  . TRP A 1 9  ? 13.250  3.003   8.449   1.00 0.00 ? 9  TRP A CE2  9  
ATOM 11004 C CE3  . TRP A 1 9  ? 15.503  3.560   9.115   1.00 0.00 ? 9  TRP A CE3  9  
ATOM 11005 C CZ2  . TRP A 1 9  ? 13.041  4.276   7.924   1.00 0.00 ? 9  TRP A CZ2  9  
ATOM 11006 C CZ3  . TRP A 1 9  ? 15.295  4.824   8.594   1.00 0.00 ? 9  TRP A CZ3  9  
ATOM 11007 C CH2  . TRP A 1 9  ? 14.072  5.171   8.006   1.00 0.00 ? 9  TRP A CH2  9  
ATOM 11008 H H    . TRP A 1 9  ? 15.802  0.391   12.649  1.00 0.00 ? 9  TRP A H    9  
ATOM 11009 H HA   . TRP A 1 9  ? 13.698  -0.532  11.080  1.00 0.00 ? 9  TRP A HA   9  
ATOM 11010 H HB2  . TRP A 1 9  ? 16.003  1.085   10.720  1.00 0.00 ? 9  TRP A HB2  9  
ATOM 11011 H HB3  . TRP A 1 9  ? 15.944  -0.074  9.399   1.00 0.00 ? 9  TRP A HB3  9  
ATOM 11012 H HD1  . TRP A 1 9  ? 12.652  -0.100  9.306   1.00 0.00 ? 9  TRP A HD1  9  
ATOM 11013 H HE1  . TRP A 1 9  ? 11.491  1.894   8.165   1.00 0.00 ? 9  TRP A HE1  9  
ATOM 11014 H HE3  . TRP A 1 9  ? 16.453  3.311   9.564   1.00 0.00 ? 9  TRP A HE3  9  
ATOM 11015 H HZ2  . TRP A 1 9  ? 12.105  4.560   7.468   1.00 0.00 ? 9  TRP A HZ2  9  
ATOM 11016 H HZ3  . TRP A 1 9  ? 16.084  5.560   8.637   1.00 0.00 ? 9  TRP A HZ3  9  
ATOM 11017 H HH2  . TRP A 1 9  ? 13.955  6.170   7.611   1.00 0.00 ? 9  TRP A HH2  9  
ATOM 11018 N N    . SER A 1 10 ? 14.172  -2.793  10.212  1.00 0.00 ? 10 SER A N    9  
ATOM 11019 C CA   . SER A 1 10 ? 14.409  -4.148  9.749   1.00 0.00 ? 10 SER A CA   9  
ATOM 11020 C C    . SER A 1 10 ? 13.631  -4.431  8.466   1.00 0.00 ? 10 SER A C    9  
ATOM 11021 O O    . SER A 1 10 ? 12.654  -3.748  8.159   1.00 0.00 ? 10 SER A O    9  
ATOM 11022 C CB   . SER A 1 10 ? 14.019  -5.157  10.832  1.00 0.00 ? 10 SER A CB   9  
ATOM 11023 O OG   . SER A 1 10 ? 14.042  -4.561  12.117  1.00 0.00 ? 10 SER A OG   9  
ATOM 11024 H H    . SER A 1 10 ? 13.266  -2.443  10.199  1.00 0.00 ? 10 SER A H    9  
ATOM 11025 H HA   . SER A 1 10 ? 15.458  -4.240  9.546   1.00 0.00 ? 10 SER A HA   9  
ATOM 11026 H HB2  . SER A 1 10 ? 13.023  -5.525  10.637  1.00 0.00 ? 10 SER A HB2  9  
ATOM 11027 H HB3  . SER A 1 10 ? 14.716  -5.983  10.818  1.00 0.00 ? 10 SER A HB3  9  
ATOM 11028 H HG   . SER A 1 10 ? 13.390  -3.857  12.155  1.00 0.00 ? 10 SER A HG   9  
ATOM 11029 N N    . PRO A 1 11 ? 14.058  -5.446  7.697   1.00 0.00 ? 11 PRO A N    9  
ATOM 11030 C CA   . PRO A 1 11 ? 13.399  -5.818  6.441   1.00 0.00 ? 11 PRO A CA   9  
ATOM 11031 C C    . PRO A 1 11 ? 12.007  -6.404  6.658   1.00 0.00 ? 11 PRO A C    9  
ATOM 11032 O O    . PRO A 1 11 ? 11.240  -6.571  5.709   1.00 0.00 ? 11 PRO A O    9  
ATOM 11033 C CB   . PRO A 1 11 ? 14.334  -6.870  5.843   1.00 0.00 ? 11 PRO A CB   9  
ATOM 11034 C CG   . PRO A 1 11 ? 15.056  -7.438  7.011   1.00 0.00 ? 11 PRO A CG   9  
ATOM 11035 C CD   . PRO A 1 11 ? 15.215  -6.309  7.989   1.00 0.00 ? 11 PRO A CD   9  
ATOM 11036 H HA   . PRO A 1 11 ? 13.332  -4.980  5.772   1.00 0.00 ? 11 PRO A HA   9  
ATOM 11037 H HB2  . PRO A 1 11 ? 13.753  -7.623  5.331   1.00 0.00 ? 11 PRO A HB2  9  
ATOM 11038 H HB3  . PRO A 1 11 ? 15.015  -6.399  5.150   1.00 0.00 ? 11 PRO A HB3  9  
ATOM 11039 H HG2  . PRO A 1 11 ? 14.472  -8.231  7.447   1.00 0.00 ? 11 PRO A HG2  9  
ATOM 11040 H HG3  . PRO A 1 11 ? 16.021  -7.804  6.701   1.00 0.00 ? 11 PRO A HG3  9  
ATOM 11041 H HD2  . PRO A 1 11 ? 15.174  -6.679  9.003   1.00 0.00 ? 11 PRO A HD2  9  
ATOM 11042 H HD3  . PRO A 1 11 ? 16.142  -5.783  7.814   1.00 0.00 ? 11 PRO A HD3  9  
ATOM 11043 N N    . ASP A 1 12 ? 11.684  -6.714  7.910   1.00 0.00 ? 12 ASP A N    9  
ATOM 11044 C CA   . ASP A 1 12 ? 10.382  -7.280  8.246   1.00 0.00 ? 12 ASP A CA   9  
ATOM 11045 C C    . ASP A 1 12 ? 9.251   -6.356  7.809   1.00 0.00 ? 12 ASP A C    9  
ATOM 11046 O O    . ASP A 1 12 ? 8.122   -6.797  7.595   1.00 0.00 ? 12 ASP A O    9  
ATOM 11047 C CB   . ASP A 1 12 ? 10.291  -7.541  9.747   1.00 0.00 ? 12 ASP A CB   9  
ATOM 11048 C CG   . ASP A 1 12 ? 10.246  -9.020  10.077  1.00 0.00 ? 12 ASP A CG   9  
ATOM 11049 O OD1  . ASP A 1 12 ? 9.138   -9.598  10.065  1.00 0.00 ? 12 ASP A OD1  9  
ATOM 11050 O OD2  . ASP A 1 12 ? 11.318  -9.601  10.347  1.00 0.00 ? 12 ASP A OD2  9  
ATOM 11051 H H    . ASP A 1 12 ? 12.335  -6.559  8.625   1.00 0.00 ? 12 ASP A H    9  
ATOM 11052 H HA   . ASP A 1 12 ? 10.286  -8.213  7.724   1.00 0.00 ? 12 ASP A HA   9  
ATOM 11053 H HB2  . ASP A 1 12 ? 11.152  -7.111  10.227  1.00 0.00 ? 12 ASP A HB2  9  
ATOM 11054 H HB3  . ASP A 1 12 ? 9.397   -7.076  10.136  1.00 0.00 ? 12 ASP A HB3  9  
ATOM 11055 N N    . ILE A 1 13 ? 9.565   -5.075  7.676   1.00 0.00 ? 13 ILE A N    9  
ATOM 11056 C CA   . ILE A 1 13 ? 8.580   -4.089  7.262   1.00 0.00 ? 13 ILE A CA   9  
ATOM 11057 C C    . ILE A 1 13 ? 8.305   -4.211  5.776   1.00 0.00 ? 13 ILE A C    9  
ATOM 11058 O O    . ILE A 1 13 ? 7.155   -4.245  5.336   1.00 0.00 ? 13 ILE A O    9  
ATOM 11059 C CB   . ILE A 1 13 ? 9.038   -2.652  7.611   1.00 0.00 ? 13 ILE A CB   9  
ATOM 11060 C CG1  . ILE A 1 13 ? 7.826   -1.759  7.878   1.00 0.00 ? 13 ILE A CG1  9  
ATOM 11061 C CG2  . ILE A 1 13 ? 9.914   -2.051  6.516   1.00 0.00 ? 13 ILE A CG2  9  
ATOM 11062 C CD1  . ILE A 1 13 ? 6.948   -2.253  9.007   1.00 0.00 ? 13 ILE A CD1  9  
ATOM 11063 H H    . ILE A 1 13 ? 10.478  -4.789  7.856   1.00 0.00 ? 13 ILE A H    9  
ATOM 11064 H HA   . ILE A 1 13 ? 7.674   -4.295  7.795   1.00 0.00 ? 13 ILE A HA   9  
ATOM 11065 H HB   . ILE A 1 13 ? 9.634   -2.709  8.504   1.00 0.00 ? 13 ILE A HB   9  
ATOM 11066 H HG12 . ILE A 1 13 ? 8.168   -0.767  8.134   1.00 0.00 ? 13 ILE A HG12 9  
ATOM 11067 H HG13 . ILE A 1 13 ? 7.221   -1.707  6.985   1.00 0.00 ? 13 ILE A HG13 9  
ATOM 11068 H HG21 . ILE A 1 13 ? 10.795  -2.661  6.385   1.00 0.00 ? 13 ILE A HG21 9  
ATOM 11069 H HG22 . ILE A 1 13 ? 10.209  -1.052  6.801   1.00 0.00 ? 13 ILE A HG22 9  
ATOM 11070 H HG23 . ILE A 1 13 ? 9.361   -2.012  5.590   1.00 0.00 ? 13 ILE A HG23 9  
ATOM 11071 H HD11 . ILE A 1 13 ? 6.356   -3.088  8.664   1.00 0.00 ? 13 ILE A HD11 9  
ATOM 11072 H HD12 . ILE A 1 13 ? 6.293   -1.456  9.329   1.00 0.00 ? 13 ILE A HD12 9  
ATOM 11073 H HD13 . ILE A 1 13 ? 7.567   -2.566  9.835   1.00 0.00 ? 13 ILE A HD13 9  
ATOM 11074 N N    . GLU A 1 14 ? 9.379   -4.293  5.016   1.00 0.00 ? 14 GLU A N    9  
ATOM 11075 C CA   . GLU A 1 14 ? 9.285   -4.433  3.572   1.00 0.00 ? 14 GLU A CA   9  
ATOM 11076 C C    . GLU A 1 14 ? 8.595   -5.742  3.217   1.00 0.00 ? 14 GLU A C    9  
ATOM 11077 O O    . GLU A 1 14 ? 7.986   -5.871  2.155   1.00 0.00 ? 14 GLU A O    9  
ATOM 11078 C CB   . GLU A 1 14 ? 10.675  -4.378  2.935   1.00 0.00 ? 14 GLU A CB   9  
ATOM 11079 C CG   . GLU A 1 14 ? 11.157  -2.966  2.648   1.00 0.00 ? 14 GLU A CG   9  
ATOM 11080 C CD   . GLU A 1 14 ? 10.998  -2.580  1.191   1.00 0.00 ? 14 GLU A CD   9  
ATOM 11081 O OE1  . GLU A 1 14 ? 11.874  -2.948  0.380   1.00 0.00 ? 14 GLU A OE1  9  
ATOM 11082 O OE2  . GLU A 1 14 ? 9.998   -1.909  0.860   1.00 0.00 ? 14 GLU A OE2  9  
ATOM 11083 H H    . GLU A 1 14 ? 10.257  -4.270  5.445   1.00 0.00 ? 14 GLU A H    9  
ATOM 11084 H HA   . GLU A 1 14 ? 8.690   -3.617  3.200   1.00 0.00 ? 14 GLU A HA   9  
ATOM 11085 H HB2  . GLU A 1 14 ? 11.382  -4.849  3.601   1.00 0.00 ? 14 GLU A HB2  9  
ATOM 11086 H HB3  . GLU A 1 14 ? 10.653  -4.924  2.003   1.00 0.00 ? 14 GLU A HB3  9  
ATOM 11087 H HG2  . GLU A 1 14 ? 10.587  -2.275  3.251   1.00 0.00 ? 14 GLU A HG2  9  
ATOM 11088 H HG3  . GLU A 1 14 ? 12.202  -2.895  2.913   1.00 0.00 ? 14 GLU A HG3  9  
ATOM 11089 N N    . GLN A 1 15 ? 8.688   -6.709  4.123   1.00 0.00 ? 15 GLN A N    9  
ATOM 11090 C CA   . GLN A 1 15 ? 8.069   -8.003  3.924   1.00 0.00 ? 15 GLN A CA   9  
ATOM 11091 C C    . GLN A 1 15 ? 6.571   -7.909  4.120   1.00 0.00 ? 15 GLN A C    9  
ATOM 11092 O O    . GLN A 1 15 ? 5.787   -8.344  3.276   1.00 0.00 ? 15 GLN A O    9  
ATOM 11093 C CB   . GLN A 1 15 ? 8.669   -9.016  4.874   1.00 0.00 ? 15 GLN A CB   9  
ATOM 11094 C CG   . GLN A 1 15 ? 9.832   -9.767  4.265   1.00 0.00 ? 15 GLN A CG   9  
ATOM 11095 C CD   . GLN A 1 15 ? 9.393   -10.964 3.445   1.00 0.00 ? 15 GLN A CD   9  
ATOM 11096 O OE1  . GLN A 1 15 ? 8.898   -11.954 3.985   1.00 0.00 ? 15 GLN A OE1  9  
ATOM 11097 N NE2  . GLN A 1 15 ? 9.573   -10.881 2.132   1.00 0.00 ? 15 GLN A NE2  9  
ATOM 11098 H H    . GLN A 1 15 ? 9.179   -6.543  4.951   1.00 0.00 ? 15 GLN A H    9  
ATOM 11099 H HA   . GLN A 1 15 ? 8.272   -8.311  2.930   1.00 0.00 ? 15 GLN A HA   9  
ATOM 11100 H HB2  . GLN A 1 15 ? 9.018   -8.499  5.747   1.00 0.00 ? 15 GLN A HB2  9  
ATOM 11101 H HB3  . GLN A 1 15 ? 7.912   -9.728  5.159   1.00 0.00 ? 15 GLN A HB3  9  
ATOM 11102 H HG2  . GLN A 1 15 ? 10.381  -9.091  3.626   1.00 0.00 ? 15 GLN A HG2  9  
ATOM 11103 H HG3  . GLN A 1 15 ? 10.470  -10.103 5.055   1.00 0.00 ? 15 GLN A HG3  9  
ATOM 11104 H HE21 . GLN A 1 15 ? 9.973   -10.062 1.771   1.00 0.00 ? 15 GLN A HE21 9  
ATOM 11105 H HE22 . GLN A 1 15 ? 9.298   -11.641 1.578   1.00 0.00 ? 15 GLN A HE22 9  
ATOM 11106 N N    . SER A 1 16 ? 6.184   -7.312  5.233   1.00 0.00 ? 16 SER A N    9  
ATOM 11107 C CA   . SER A 1 16 ? 4.779   -7.123  5.545   1.00 0.00 ? 16 SER A CA   9  
ATOM 11108 C C    . SER A 1 16 ? 4.140   -6.211  4.505   1.00 0.00 ? 16 SER A C    9  
ATOM 11109 O O    . SER A 1 16 ? 2.928   -6.240  4.293   1.00 0.00 ? 16 SER A O    9  
ATOM 11110 C CB   . SER A 1 16 ? 4.615   -6.525  6.944   1.00 0.00 ? 16 SER A CB   9  
ATOM 11111 O OG   . SER A 1 16 ? 5.324   -7.283  7.909   1.00 0.00 ? 16 SER A OG   9  
ATOM 11112 H H    . SER A 1 16 ? 6.864   -6.975  5.848   1.00 0.00 ? 16 SER A H    9  
ATOM 11113 H HA   . SER A 1 16 ? 4.298   -8.086  5.509   1.00 0.00 ? 16 SER A HA   9  
ATOM 11114 H HB2  . SER A 1 16 ? 4.996   -5.515  6.948   1.00 0.00 ? 16 SER A HB2  9  
ATOM 11115 H HB3  . SER A 1 16 ? 3.568   -6.517  7.209   1.00 0.00 ? 16 SER A HB3  9  
ATOM 11116 H HG   . SER A 1 16 ? 5.185   -8.219  7.747   1.00 0.00 ? 16 SER A HG   9  
ATOM 11117 N N    . PHE A 1 17 ? 4.975   -5.406  3.853   1.00 0.00 ? 17 PHE A N    9  
ATOM 11118 C CA   . PHE A 1 17 ? 4.511   -4.488  2.828   1.00 0.00 ? 17 PHE A CA   9  
ATOM 11119 C C    . PHE A 1 17 ? 4.012   -5.249  1.611   1.00 0.00 ? 17 PHE A C    9  
ATOM 11120 O O    . PHE A 1 17 ? 3.037   -4.851  0.973   1.00 0.00 ? 17 PHE A O    9  
ATOM 11121 C CB   . PHE A 1 17 ? 5.628   -3.527  2.429   1.00 0.00 ? 17 PHE A CB   9  
ATOM 11122 C CG   . PHE A 1 17 ? 5.310   -2.087  2.712   1.00 0.00 ? 17 PHE A CG   9  
ATOM 11123 C CD1  . PHE A 1 17 ? 4.355   -1.417  1.966   1.00 0.00 ? 17 PHE A CD1  9  
ATOM 11124 C CD2  . PHE A 1 17 ? 5.966   -1.405  3.723   1.00 0.00 ? 17 PHE A CD2  9  
ATOM 11125 C CE1  . PHE A 1 17 ? 4.060   -0.092  2.222   1.00 0.00 ? 17 PHE A CE1  9  
ATOM 11126 C CE2  . PHE A 1 17 ? 5.676   -0.079  3.985   1.00 0.00 ? 17 PHE A CE2  9  
ATOM 11127 C CZ   . PHE A 1 17 ? 4.721   0.578   3.233   1.00 0.00 ? 17 PHE A CZ   9  
ATOM 11128 H H    . PHE A 1 17 ? 5.930   -5.436  4.065   1.00 0.00 ? 17 PHE A H    9  
ATOM 11129 H HA   . PHE A 1 17 ? 3.700   -3.927  3.236   1.00 0.00 ? 17 PHE A HA   9  
ATOM 11130 H HB2  . PHE A 1 17 ? 6.521   -3.782  2.976   1.00 0.00 ? 17 PHE A HB2  9  
ATOM 11131 H HB3  . PHE A 1 17 ? 5.818   -3.625  1.372   1.00 0.00 ? 17 PHE A HB3  9  
ATOM 11132 H HD1  . PHE A 1 17 ? 3.837   -1.940  1.175   1.00 0.00 ? 17 PHE A HD1  9  
ATOM 11133 H HD2  . PHE A 1 17 ? 6.713   -1.918  4.311   1.00 0.00 ? 17 PHE A HD2  9  
ATOM 11134 H HE1  . PHE A 1 17 ? 3.313   0.418   1.633   1.00 0.00 ? 17 PHE A HE1  9  
ATOM 11135 H HE2  . PHE A 1 17 ? 6.194   0.442   4.776   1.00 0.00 ? 17 PHE A HE2  9  
ATOM 11136 H HZ   . PHE A 1 17 ? 4.492   1.614   3.436   1.00 0.00 ? 17 PHE A HZ   9  
ATOM 11137 N N    . GLN A 1 18 ? 4.680   -6.350  1.299   1.00 0.00 ? 18 GLN A N    9  
ATOM 11138 C CA   . GLN A 1 18 ? 4.290   -7.168  0.160   1.00 0.00 ? 18 GLN A CA   9  
ATOM 11139 C C    . GLN A 1 18 ? 2.915   -7.771  0.391   1.00 0.00 ? 18 GLN A C    9  
ATOM 11140 O O    . GLN A 1 18 ? 2.126   -7.927  -0.539  1.00 0.00 ? 18 GLN A O    9  
ATOM 11141 C CB   . GLN A 1 18 ? 5.310   -8.280  -0.095  1.00 0.00 ? 18 GLN A CB   9  
ATOM 11142 C CG   . GLN A 1 18 ? 4.798   -9.366  -1.032  1.00 0.00 ? 18 GLN A CG   9  
ATOM 11143 C CD   . GLN A 1 18 ? 5.911   -10.231 -1.590  1.00 0.00 ? 18 GLN A CD   9  
ATOM 11144 O OE1  . GLN A 1 18 ? 6.450   -11.093 -0.897  1.00 0.00 ? 18 GLN A OE1  9  
ATOM 11145 N NE2  . GLN A 1 18 ? 6.262   -10.003 -2.851  1.00 0.00 ? 18 GLN A NE2  9  
ATOM 11146 H H    . GLN A 1 18 ? 5.445   -6.619  1.850   1.00 0.00 ? 18 GLN A H    9  
ATOM 11147 H HA   . GLN A 1 18 ? 4.244   -6.528  -0.701  1.00 0.00 ? 18 GLN A HA   9  
ATOM 11148 H HB2  . GLN A 1 18 ? 6.198   -7.846  -0.531  1.00 0.00 ? 18 GLN A HB2  9  
ATOM 11149 H HB3  . GLN A 1 18 ? 5.569   -8.740  0.847   1.00 0.00 ? 18 GLN A HB3  9  
ATOM 11150 H HG2  . GLN A 1 18 ? 4.109   -9.996  -0.489  1.00 0.00 ? 18 GLN A HG2  9  
ATOM 11151 H HG3  . GLN A 1 18 ? 4.277   -8.896  -1.855  1.00 0.00 ? 18 GLN A HG3  9  
ATOM 11152 H HE21 . GLN A 1 18 ? 5.790   -9.300  -3.343  1.00 0.00 ? 18 GLN A HE21 9  
ATOM 11153 H HE22 . GLN A 1 18 ? 6.980   -10.548 -3.237  1.00 0.00 ? 18 GLN A HE22 9  
ATOM 11154 N N    . GLU A 1 19 ? 2.642   -8.109  1.639   1.00 0.00 ? 19 GLU A N    9  
ATOM 11155 C CA   . GLU A 1 19 ? 1.363   -8.697  2.004   1.00 0.00 ? 19 GLU A CA   9  
ATOM 11156 C C    . GLU A 1 19 ? 0.230   -7.732  1.708   1.00 0.00 ? 19 GLU A C    9  
ATOM 11157 O O    . GLU A 1 19 ? -0.828  -8.126  1.221   1.00 0.00 ? 19 GLU A O    9  
ATOM 11158 C CB   . GLU A 1 19 ? 1.357   -9.091  3.479   1.00 0.00 ? 19 GLU A CB   9  
ATOM 11159 C CG   . GLU A 1 19 ? 1.127   -10.576 3.711   1.00 0.00 ? 19 GLU A CG   9  
ATOM 11160 C CD   . GLU A 1 19 ? -0.145  -11.078 3.057   1.00 0.00 ? 19 GLU A CD   9  
ATOM 11161 O OE1  . GLU A 1 19 ? -1.099  -10.282 2.926   1.00 0.00 ? 19 GLU A OE1  9  
ATOM 11162 O OE2  . GLU A 1 19 ? -0.187  -12.267 2.676   1.00 0.00 ? 19 GLU A OE2  9  
ATOM 11163 H H    . GLU A 1 19 ? 3.317   -7.957  2.330   1.00 0.00 ? 19 GLU A H    9  
ATOM 11164 H HA   . GLU A 1 19 ? 1.226   -9.574  1.408   1.00 0.00 ? 19 GLU A HA   9  
ATOM 11165 H HB2  . GLU A 1 19 ? 2.307   -8.824  3.913   1.00 0.00 ? 19 GLU A HB2  9  
ATOM 11166 H HB3  . GLU A 1 19 ? 0.574   -8.546  3.980   1.00 0.00 ? 19 GLU A HB3  9  
ATOM 11167 H HG2  . GLU A 1 19 ? 1.963   -11.124 3.304   1.00 0.00 ? 19 GLU A HG2  9  
ATOM 11168 H HG3  . GLU A 1 19 ? 1.064   -10.755 4.774   1.00 0.00 ? 19 GLU A HG3  9  
ATOM 11169 N N    . ALA A 1 20 ? 0.466   -6.465  1.996   1.00 0.00 ? 20 ALA A N    9  
ATOM 11170 C CA   . ALA A 1 20 ? -0.527  -5.433  1.754   1.00 0.00 ? 20 ALA A CA   9  
ATOM 11171 C C    . ALA A 1 20 ? -0.612  -5.106  0.271   1.00 0.00 ? 20 ALA A C    9  
ATOM 11172 O O    . ALA A 1 20 ? -1.656  -4.684  -0.224  1.00 0.00 ? 20 ALA A O    9  
ATOM 11173 C CB   . ALA A 1 20 ? -0.210  -4.185  2.563   1.00 0.00 ? 20 ALA A CB   9  
ATOM 11174 H H    . ALA A 1 20 ? 1.330   -6.219  2.373   1.00 0.00 ? 20 ALA A H    9  
ATOM 11175 H HA   . ALA A 1 20 ? -1.477  -5.816  2.077   1.00 0.00 ? 20 ALA A HA   9  
ATOM 11176 H HB1  . ALA A 1 20 ? 0.472   -4.437  3.362   1.00 0.00 ? 20 ALA A HB1  9  
ATOM 11177 H HB2  . ALA A 1 20 ? -1.122  -3.785  2.981   1.00 0.00 ? 20 ALA A HB2  9  
ATOM 11178 H HB3  . ALA A 1 20 ? 0.246   -3.445  1.922   1.00 0.00 ? 20 ALA A HB3  9  
ATOM 11179 N N    . LEU A 1 21 ? 0.491   -5.314  -0.434  1.00 0.00 ? 21 LEU A N    9  
ATOM 11180 C CA   . LEU A 1 21 ? 0.540   -5.055  -1.861  1.00 0.00 ? 21 LEU A CA   9  
ATOM 11181 C C    . LEU A 1 21 ? -0.034  -6.234  -2.631  1.00 0.00 ? 21 LEU A C    9  
ATOM 11182 O O    . LEU A 1 21 ? -0.665  -6.064  -3.675  1.00 0.00 ? 21 LEU A O    9  
ATOM 11183 C CB   . LEU A 1 21 ? 1.972   -4.768  -2.307  1.00 0.00 ? 21 LEU A CB   9  
ATOM 11184 C CG   . LEU A 1 21 ? 2.205   -3.365  -2.872  1.00 0.00 ? 21 LEU A CG   9  
ATOM 11185 C CD1  . LEU A 1 21 ? 1.239   -3.082  -4.012  1.00 0.00 ? 21 LEU A CD1  9  
ATOM 11186 C CD2  . LEU A 1 21 ? 2.060   -2.320  -1.776  1.00 0.00 ? 21 LEU A CD2  9  
ATOM 11187 H H    . LEU A 1 21 ? 1.284   -5.657  0.014   1.00 0.00 ? 21 LEU A H    9  
ATOM 11188 H HA   . LEU A 1 21 ? -0.065  -4.196  -2.050  1.00 0.00 ? 21 LEU A HA   9  
ATOM 11189 H HB2  . LEU A 1 21 ? 2.621   -4.903  -1.457  1.00 0.00 ? 21 LEU A HB2  9  
ATOM 11190 H HB3  . LEU A 1 21 ? 2.242   -5.485  -3.065  1.00 0.00 ? 21 LEU A HB3  9  
ATOM 11191 H HG   . LEU A 1 21 ? 3.210   -3.304  -3.263  1.00 0.00 ? 21 LEU A HG   9  
ATOM 11192 H HD11 . LEU A 1 21 ? 1.636   -2.293  -4.633  1.00 0.00 ? 21 LEU A HD11 9  
ATOM 11193 H HD12 . LEU A 1 21 ? 0.285   -2.778  -3.609  1.00 0.00 ? 21 LEU A HD12 9  
ATOM 11194 H HD13 . LEU A 1 21 ? 1.110   -3.976  -4.605  1.00 0.00 ? 21 LEU A HD13 9  
ATOM 11195 H HD21 . LEU A 1 21 ? 2.934   -2.338  -1.143  1.00 0.00 ? 21 LEU A HD21 9  
ATOM 11196 H HD22 . LEU A 1 21 ? 1.183   -2.538  -1.184  1.00 0.00 ? 21 LEU A HD22 9  
ATOM 11197 H HD23 . LEU A 1 21 ? 1.959   -1.342  -2.223  1.00 0.00 ? 21 LEU A HD23 9  
ATOM 11198 N N    . SER A 1 22 ? 0.176   -7.427  -2.094  1.00 0.00 ? 22 SER A N    9  
ATOM 11199 C CA   . SER A 1 22 ? -0.331  -8.639  -2.709  1.00 0.00 ? 22 SER A CA   9  
ATOM 11200 C C    . SER A 1 22 ? -1.817  -8.779  -2.425  1.00 0.00 ? 22 SER A C    9  
ATOM 11201 O O    . SER A 1 22 ? -2.580  -9.284  -3.249  1.00 0.00 ? 22 SER A O    9  
ATOM 11202 C CB   . SER A 1 22 ? 0.425   -9.864  -2.189  1.00 0.00 ? 22 SER A CB   9  
ATOM 11203 O OG   . SER A 1 22 ? 0.015   -11.041 -2.863  1.00 0.00 ? 22 SER A OG   9  
ATOM 11204 H H    . SER A 1 22 ? 0.673   -7.489  -1.257  1.00 0.00 ? 22 SER A H    9  
ATOM 11205 H HA   . SER A 1 22 ? -0.184  -8.555  -3.768  1.00 0.00 ? 22 SER A HA   9  
ATOM 11206 H HB2  . SER A 1 22 ? 1.484   -9.725  -2.347  1.00 0.00 ? 22 SER A HB2  9  
ATOM 11207 H HB3  . SER A 1 22 ? 0.231   -9.982  -1.133  1.00 0.00 ? 22 SER A HB3  9  
ATOM 11208 H HG   . SER A 1 22 ? 0.244   -10.975 -3.793  1.00 0.00 ? 22 SER A HG   9  
ATOM 11209 N N    . ILE A 1 23 ? -2.216  -8.313  -1.250  1.00 0.00 ? 23 ILE A N    9  
ATOM 11210 C CA   . ILE A 1 23 ? -3.608  -8.363  -0.836  1.00 0.00 ? 23 ILE A CA   9  
ATOM 11211 C C    . ILE A 1 23 ? -4.349  -7.111  -1.282  1.00 0.00 ? 23 ILE A C    9  
ATOM 11212 O O    . ILE A 1 23 ? -5.518  -7.161  -1.664  1.00 0.00 ? 23 ILE A O    9  
ATOM 11213 C CB   . ILE A 1 23 ? -3.732  -8.527  0.697   1.00 0.00 ? 23 ILE A CB   9  
ATOM 11214 C CG1  . ILE A 1 23 ? -4.843  -9.521  1.038   1.00 0.00 ? 23 ILE A CG1  9  
ATOM 11215 C CG2  . ILE A 1 23 ? -3.980  -7.188  1.384   1.00 0.00 ? 23 ILE A CG2  9  
ATOM 11216 C CD1  . ILE A 1 23 ? -6.225  -9.038  0.654   1.00 0.00 ? 23 ILE A CD1  9  
ATOM 11217 H H    . ILE A 1 23 ? -1.554  -7.920  -0.649  1.00 0.00 ? 23 ILE A H    9  
ATOM 11218 H HA   . ILE A 1 23 ? -4.053  -9.216  -1.305  1.00 0.00 ? 23 ILE A HA   9  
ATOM 11219 H HB   . ILE A 1 23 ? -2.796  -8.910  1.060   1.00 0.00 ? 23 ILE A HB   9  
ATOM 11220 H HG12 . ILE A 1 23 ? -4.660  -10.448 0.516   1.00 0.00 ? 23 ILE A HG12 9  
ATOM 11221 H HG13 . ILE A 1 23 ? -4.839  -9.704  2.102   1.00 0.00 ? 23 ILE A HG13 9  
ATOM 11222 H HG21 . ILE A 1 23 ? -3.237  -6.474  1.062   1.00 0.00 ? 23 ILE A HG21 9  
ATOM 11223 H HG22 . ILE A 1 23 ? -3.916  -7.315  2.455   1.00 0.00 ? 23 ILE A HG22 9  
ATOM 11224 H HG23 . ILE A 1 23 ? -4.964  -6.826  1.124   1.00 0.00 ? 23 ILE A HG23 9  
ATOM 11225 H HD11 . ILE A 1 23 ? -6.428  -9.307  -0.372  1.00 0.00 ? 23 ILE A HD11 9  
ATOM 11226 H HD12 . ILE A 1 23 ? -6.273  -7.964  0.761   1.00 0.00 ? 23 ILE A HD12 9  
ATOM 11227 H HD13 . ILE A 1 23 ? -6.959  -9.498  1.299   1.00 0.00 ? 23 ILE A HD13 9  
ATOM 11228 N N    . TYR A 1 24 ? -3.648  -5.991  -1.219  1.00 0.00 ? 24 TYR A N    9  
ATOM 11229 C CA   . TYR A 1 24 ? -4.206  -4.706  -1.603  1.00 0.00 ? 24 TYR A CA   9  
ATOM 11230 C C    . TYR A 1 24 ? -3.428  -4.087  -2.763  1.00 0.00 ? 24 TYR A C    9  
ATOM 11231 O O    . TYR A 1 24 ? -2.594  -3.204  -2.561  1.00 0.00 ? 24 TYR A O    9  
ATOM 11232 C CB   . TYR A 1 24 ? -4.210  -3.756  -0.411  1.00 0.00 ? 24 TYR A CB   9  
ATOM 11233 C CG   . TYR A 1 24 ? -5.425  -2.859  -0.346  1.00 0.00 ? 24 TYR A CG   9  
ATOM 11234 C CD1  . TYR A 1 24 ? -6.709  -3.388  -0.394  1.00 0.00 ? 24 TYR A CD1  9  
ATOM 11235 C CD2  . TYR A 1 24 ? -5.286  -1.482  -0.233  1.00 0.00 ? 24 TYR A CD2  9  
ATOM 11236 C CE1  . TYR A 1 24 ? -7.820  -2.568  -0.333  1.00 0.00 ? 24 TYR A CE1  9  
ATOM 11237 C CE2  . TYR A 1 24 ? -6.391  -0.655  -0.169  1.00 0.00 ? 24 TYR A CE2  9  
ATOM 11238 C CZ   . TYR A 1 24 ? -7.656  -1.203  -0.220  1.00 0.00 ? 24 TYR A CZ   9  
ATOM 11239 O OH   . TYR A 1 24 ? -8.760  -0.384  -0.158  1.00 0.00 ? 24 TYR A OH   9  
ATOM 11240 H H    . TYR A 1 24 ? -2.730  -6.033  -0.900  1.00 0.00 ? 24 TYR A H    9  
ATOM 11241 H HA   . TYR A 1 24 ? -5.211  -4.871  -1.912  1.00 0.00 ? 24 TYR A HA   9  
ATOM 11242 H HB2  . TYR A 1 24 ? -4.172  -4.331  0.502   1.00 0.00 ? 24 TYR A HB2  9  
ATOM 11243 H HB3  . TYR A 1 24 ? -3.343  -3.130  -0.471  1.00 0.00 ? 24 TYR A HB3  9  
ATOM 11244 H HD1  . TYR A 1 24 ? -6.834  -4.457  -0.482  1.00 0.00 ? 24 TYR A HD1  9  
ATOM 11245 H HD2  . TYR A 1 24 ? -4.294  -1.055  -0.194  1.00 0.00 ? 24 TYR A HD2  9  
ATOM 11246 H HE1  . TYR A 1 24 ? -8.810  -2.997  -0.372  1.00 0.00 ? 24 TYR A HE1  9  
ATOM 11247 H HE2  . TYR A 1 24 ? -6.261  0.413   -0.081  1.00 0.00 ? 24 TYR A HE2  9  
ATOM 11248 H HH   . TYR A 1 24 ? -9.058  -0.180  -1.047  1.00 0.00 ? 24 TYR A HH   9  
ATOM 11249 N N    . PRO A 1 25 ? -3.691  -4.543  -4.002  1.00 0.00 ? 25 PRO A N    9  
ATOM 11250 C CA   . PRO A 1 25 ? -3.024  -4.041  -5.192  1.00 0.00 ? 25 PRO A CA   9  
ATOM 11251 C C    . PRO A 1 25 ? -3.754  -2.848  -5.804  1.00 0.00 ? 25 PRO A C    9  
ATOM 11252 O O    . PRO A 1 25 ? -4.903  -2.570  -5.458  1.00 0.00 ? 25 PRO A O    9  
ATOM 11253 C CB   . PRO A 1 25 ? -3.060  -5.239  -6.148  1.00 0.00 ? 25 PRO A CB   9  
ATOM 11254 C CG   . PRO A 1 25 ? -4.053  -6.210  -5.580  1.00 0.00 ? 25 PRO A CG   9  
ATOM 11255 C CD   . PRO A 1 25 ? -4.656  -5.583  -4.349  1.00 0.00 ? 25 PRO A CD   9  
ATOM 11256 H HA   . PRO A 1 25 ? -2.000  -3.772  -4.988  1.00 0.00 ? 25 PRO A HA   9  
ATOM 11257 H HB2  . PRO A 1 25 ? -3.359  -4.906  -7.130  1.00 0.00 ? 25 PRO A HB2  9  
ATOM 11258 H HB3  . PRO A 1 25 ? -2.077  -5.679  -6.202  1.00 0.00 ? 25 PRO A HB3  9  
ATOM 11259 H HG2  . PRO A 1 25 ? -4.824  -6.407  -6.308  1.00 0.00 ? 25 PRO A HG2  9  
ATOM 11260 H HG3  . PRO A 1 25 ? -3.548  -7.127  -5.318  1.00 0.00 ? 25 PRO A HG3  9  
ATOM 11261 H HD2  . PRO A 1 25 ? -5.620  -5.155  -4.577  1.00 0.00 ? 25 PRO A HD2  9  
ATOM 11262 H HD3  . PRO A 1 25 ? -4.740  -6.312  -3.560  1.00 0.00 ? 25 PRO A HD3  9  
ATOM 11263 N N    . PRO A 1 26 ? -3.097  -2.125  -6.728  1.00 0.00 ? 26 PRO A N    9  
ATOM 11264 C CA   . PRO A 1 26 ? -3.693  -0.961  -7.388  1.00 0.00 ? 26 PRO A CA   9  
ATOM 11265 C C    . PRO A 1 26 ? -4.991  -1.303  -8.102  1.00 0.00 ? 26 PRO A C    9  
ATOM 11266 O O    . PRO A 1 26 ? -6.070  -0.857  -7.710  1.00 0.00 ? 26 PRO A O    9  
ATOM 11267 C CB   . PRO A 1 26 ? -2.626  -0.518  -8.397  1.00 0.00 ? 26 PRO A CB   9  
ATOM 11268 C CG   . PRO A 1 26 ? -1.693  -1.672  -8.520  1.00 0.00 ? 26 PRO A CG   9  
ATOM 11269 C CD   . PRO A 1 26 ? -1.730  -2.385  -7.200  1.00 0.00 ? 26 PRO A CD   9  
ATOM 11270 H HA   . PRO A 1 26 ? -3.873  -0.170  -6.693  1.00 0.00 ? 26 PRO A HA   9  
ATOM 11271 H HB2  . PRO A 1 26 ? -3.096  -0.290  -9.343  1.00 0.00 ? 26 PRO A HB2  9  
ATOM 11272 H HB3  . PRO A 1 26 ? -2.119  0.359   -8.024  1.00 0.00 ? 26 PRO A HB3  9  
ATOM 11273 H HG2  . PRO A 1 26 ? -2.027  -2.328  -9.308  1.00 0.00 ? 26 PRO A HG2  9  
ATOM 11274 H HG3  . PRO A 1 26 ? -0.696  -1.315  -8.724  1.00 0.00 ? 26 PRO A HG3  9  
ATOM 11275 H HD2  . PRO A 1 26 ? -1.561  -3.443  -7.336  1.00 0.00 ? 26 PRO A HD2  9  
ATOM 11276 H HD3  . PRO A 1 26 ? -1.001  -1.966  -6.523  1.00 0.00 ? 26 PRO A HD3  9  
ATOM 11277 N N    . CYS A 1 27 ? -4.872  -2.098  -9.150  1.00 0.00 ? 27 CYS A N    9  
ATOM 11278 C CA   . CYS A 1 27 ? -6.023  -2.515  -9.936  1.00 0.00 ? 27 CYS A CA   9  
ATOM 11279 C C    . CYS A 1 27 ? -6.769  -3.656  -9.251  1.00 0.00 ? 27 CYS A C    9  
ATOM 11280 O O    . CYS A 1 27 ? -6.289  -4.224  -8.270  1.00 0.00 ? 27 CYS A O    9  
ATOM 11281 C CB   . CYS A 1 27 ? -5.583  -2.938  -11.335 1.00 0.00 ? 27 CYS A CB   9  
ATOM 11282 S SG   . CYS A 1 27 ? -6.272  -1.924  -12.664 1.00 0.00 ? 27 CYS A SG   9  
ATOM 11283 H H    . CYS A 1 27 ? -3.986  -2.409  -9.401  1.00 0.00 ? 27 CYS A H    9  
ATOM 11284 H HA   . CYS A 1 27 ? -6.680  -1.672  -10.022 1.00 0.00 ? 27 CYS A HA   9  
ATOM 11285 H HB2  . CYS A 1 27 ? -4.509  -2.874  -11.398 1.00 0.00 ? 27 CYS A HB2  9  
ATOM 11286 H HB3  . CYS A 1 27 ? -5.890  -3.958  -11.507 1.00 0.00 ? 27 CYS A HB3  9  
ATOM 11287 H HG   . CYS A 1 27 ? -6.457  -1.053  -12.306 1.00 0.00 ? 27 CYS A HG   9  
ATOM 11288 N N    . GLY A 1 28 ? -7.945  -3.988  -9.777  1.00 0.00 ? 28 GLY A N    9  
ATOM 11289 C CA   . GLY A 1 28 ? -8.738  -5.061  -9.205  1.00 0.00 ? 28 GLY A CA   9  
ATOM 11290 C C    . GLY A 1 28 ? -9.042  -4.841  -7.736  1.00 0.00 ? 28 GLY A C    9  
ATOM 11291 O O    . GLY A 1 28 ? -9.006  -5.780  -6.940  1.00 0.00 ? 28 GLY A O    9  
ATOM 11292 H H    . GLY A 1 28 ? -8.276  -3.500  -10.560 1.00 0.00 ? 28 GLY A H    9  
ATOM 11293 H HA2  . GLY A 1 28 ? -9.669  -5.133  -9.747  1.00 0.00 ? 28 GLY A HA2  9  
ATOM 11294 H HA3  . GLY A 1 28 ? -8.198  -5.990  -9.314  1.00 0.00 ? 28 GLY A HA3  9  
ATOM 11295 N N    . ARG A 1 29 ? -9.340  -3.597  -7.375  1.00 0.00 ? 29 ARG A N    9  
ATOM 11296 C CA   . ARG A 1 29 ? -9.651  -3.257  -5.992  1.00 0.00 ? 29 ARG A CA   9  
ATOM 11297 C C    . ARG A 1 29 ? -10.874 -4.025  -5.502  1.00 0.00 ? 29 ARG A C    9  
ATOM 11298 O O    . ARG A 1 29 ? -11.897 -4.084  -6.184  1.00 0.00 ? 29 ARG A O    9  
ATOM 11299 C CB   . ARG A 1 29 ? -9.892  -1.752  -5.857  1.00 0.00 ? 29 ARG A CB   9  
ATOM 11300 C CG   . ARG A 1 29 ? -8.629  -0.957  -5.569  1.00 0.00 ? 29 ARG A CG   9  
ATOM 11301 C CD   . ARG A 1 29 ? -8.954  0.446   -5.080  1.00 0.00 ? 29 ARG A CD   9  
ATOM 11302 N NE   . ARG A 1 29 ? -8.876  1.432   -6.155  1.00 0.00 ? 29 ARG A NE   9  
ATOM 11303 C CZ   . ARG A 1 29 ? -8.841  2.747   -5.954  1.00 0.00 ? 29 ARG A CZ   9  
ATOM 11304 N NH1  . ARG A 1 29 ? -8.877  3.238   -4.721  1.00 0.00 ? 29 ARG A NH1  9  
ATOM 11305 N NH2  . ARG A 1 29 ? -8.770  3.574   -6.988  1.00 0.00 ? 29 ARG A NH2  9  
ATOM 11306 H H    . ARG A 1 29 ? -9.352  -2.892  -8.055  1.00 0.00 ? 29 ARG A H    9  
ATOM 11307 H HA   . ARG A 1 29 ? -8.801  -3.531  -5.384  1.00 0.00 ? 29 ARG A HA   9  
ATOM 11308 H HB2  . ARG A 1 29 ? -10.321 -1.384  -6.778  1.00 0.00 ? 29 ARG A HB2  9  
ATOM 11309 H HB3  . ARG A 1 29 ? -10.591 -1.582  -5.052  1.00 0.00 ? 29 ARG A HB3  9  
ATOM 11310 H HG2  . ARG A 1 29 ? -8.059  -1.469  -4.809  1.00 0.00 ? 29 ARG A HG2  9  
ATOM 11311 H HG3  . ARG A 1 29 ? -8.045  -0.887  -6.475  1.00 0.00 ? 29 ARG A HG3  9  
ATOM 11312 H HD2  . ARG A 1 29 ? -9.954  0.449   -4.674  1.00 0.00 ? 29 ARG A HD2  9  
ATOM 11313 H HD3  . ARG A 1 29 ? -8.250  0.715   -4.306  1.00 0.00 ? 29 ARG A HD3  9  
ATOM 11314 H HE   . ARG A 1 29 ? -8.848  1.097   -7.076  1.00 0.00 ? 29 ARG A HE   9  
ATOM 11315 H HH11 . ARG A 1 29 ? -8.930  2.620   -3.937  1.00 0.00 ? 29 ARG A HH11 9  
ATOM 11316 H HH12 . ARG A 1 29 ? -8.850  4.227   -4.576  1.00 0.00 ? 29 ARG A HH12 9  
ATOM 11317 H HH21 . ARG A 1 29 ? -8.743  3.210   -7.919  1.00 0.00 ? 29 ARG A HH21 9  
ATOM 11318 H HH22 . ARG A 1 29 ? -8.745  4.562   -6.837  1.00 0.00 ? 29 ARG A HH22 9  
ATOM 11319 N N    . ARG A 1 30 ? -10.761 -4.610  -4.314  1.00 0.00 ? 30 ARG A N    9  
ATOM 11320 C CA   . ARG A 1 30 ? -11.858 -5.374  -3.729  1.00 0.00 ? 30 ARG A CA   9  
ATOM 11321 C C    . ARG A 1 30 ? -13.101 -4.504  -3.571  1.00 0.00 ? 30 ARG A C    9  
ATOM 11322 O O    . ARG A 1 30 ? -13.138 -3.366  -4.039  1.00 0.00 ? 30 ARG A O    9  
ATOM 11323 C CB   . ARG A 1 30 ? -11.442 -5.946  -2.372  1.00 0.00 ? 30 ARG A CB   9  
ATOM 11324 C CG   . ARG A 1 30 ? -11.817 -7.408  -2.187  1.00 0.00 ? 30 ARG A CG   9  
ATOM 11325 C CD   . ARG A 1 30 ? -10.892 -8.325  -2.971  1.00 0.00 ? 30 ARG A CD   9  
ATOM 11326 N NE   . ARG A 1 30 ? -11.617 -9.426  -3.601  1.00 0.00 ? 30 ARG A NE   9  
ATOM 11327 C CZ   . ARG A 1 30 ? -12.146 -10.446 -2.928  1.00 0.00 ? 30 ARG A CZ   9  
ATOM 11328 N NH1  . ARG A 1 30 ? -12.033 -10.508 -1.607  1.00 0.00 ? 30 ARG A NH1  9  
ATOM 11329 N NH2  . ARG A 1 30 ? -12.789 -11.406 -3.578  1.00 0.00 ? 30 ARG A NH2  9  
ATOM 11330 H H    . ARG A 1 30 ? -9.920  -4.526  -3.817  1.00 0.00 ? 30 ARG A H    9  
ATOM 11331 H HA   . ARG A 1 30 ? -12.087 -6.190  -4.398  1.00 0.00 ? 30 ARG A HA   9  
ATOM 11332 H HB2  . ARG A 1 30 ? -10.370 -5.857  -2.270  1.00 0.00 ? 30 ARG A HB2  9  
ATOM 11333 H HB3  . ARG A 1 30 ? -11.917 -5.373  -1.589  1.00 0.00 ? 30 ARG A HB3  9  
ATOM 11334 H HG2  . ARG A 1 30 ? -11.751 -7.657  -1.139  1.00 0.00 ? 30 ARG A HG2  9  
ATOM 11335 H HG3  . ARG A 1 30 ? -12.831 -7.555  -2.531  1.00 0.00 ? 30 ARG A HG3  9  
ATOM 11336 H HD2  . ARG A 1 30 ? -10.399 -7.747  -3.739  1.00 0.00 ? 30 ARG A HD2  9  
ATOM 11337 H HD3  . ARG A 1 30 ? -10.153 -8.731  -2.297  1.00 0.00 ? 30 ARG A HD3  9  
ATOM 11338 H HE   . ARG A 1 30 ? -11.715 -9.405  -4.575  1.00 0.00 ? 30 ARG A HE   9  
ATOM 11339 H HH11 . ARG A 1 30 ? -11.549 -9.787  -1.111  1.00 0.00 ? 30 ARG A HH11 9  
ATOM 11340 H HH12 . ARG A 1 30 ? -12.433 -11.277 -1.107  1.00 0.00 ? 30 ARG A HH12 9  
ATOM 11341 H HH21 . ARG A 1 30 ? -12.877 -11.363 -4.573  1.00 0.00 ? 30 ARG A HH21 9  
ATOM 11342 H HH22 . ARG A 1 30 ? -13.186 -12.172 -3.073  1.00 0.00 ? 30 ARG A HH22 9  
ATOM 11343 N N    . LYS A 1 31 ? -14.120 -5.046  -2.908  1.00 0.00 ? 31 LYS A N    9  
ATOM 11344 C CA   . LYS A 1 31 ? -15.366 -4.318  -2.688  1.00 0.00 ? 31 LYS A CA   9  
ATOM 11345 C C    . LYS A 1 31 ? -15.095 -2.926  -2.125  1.00 0.00 ? 31 LYS A C    9  
ATOM 11346 O O    . LYS A 1 31 ? -14.729 -2.776  -0.959  1.00 0.00 ? 31 LYS A O    9  
ATOM 11347 C CB   . LYS A 1 31 ? -16.275 -5.099  -1.736  1.00 0.00 ? 31 LYS A CB   9  
ATOM 11348 C CG   . LYS A 1 31 ? -17.746 -5.042  -2.116  1.00 0.00 ? 31 LYS A CG   9  
ATOM 11349 C CD   . LYS A 1 31 ? -18.345 -3.676  -1.821  1.00 0.00 ? 31 LYS A CD   9  
ATOM 11350 C CE   . LYS A 1 31 ? -19.531 -3.381  -2.726  1.00 0.00 ? 31 LYS A CE   9  
ATOM 11351 N NZ   . LYS A 1 31 ? -19.127 -2.625  -3.943  1.00 0.00 ? 31 LYS A NZ   9  
ATOM 11352 H H    . LYS A 1 31 ? -14.031 -5.957  -2.558  1.00 0.00 ? 31 LYS A H    9  
ATOM 11353 H HA   . LYS A 1 31 ? -15.862 -4.217  -3.642  1.00 0.00 ? 31 LYS A HA   9  
ATOM 11354 H HB2  . LYS A 1 31 ? -15.967 -6.134  -1.730  1.00 0.00 ? 31 LYS A HB2  9  
ATOM 11355 H HB3  . LYS A 1 31 ? -16.167 -4.694  -0.740  1.00 0.00 ? 31 LYS A HB3  9  
ATOM 11356 H HG2  . LYS A 1 31 ? -17.843 -5.246  -3.172  1.00 0.00 ? 31 LYS A HG2  9  
ATOM 11357 H HG3  . LYS A 1 31 ? -18.283 -5.790  -1.552  1.00 0.00 ? 31 LYS A HG3  9  
ATOM 11358 H HD2  . LYS A 1 31 ? -18.675 -3.653  -0.794  1.00 0.00 ? 31 LYS A HD2  9  
ATOM 11359 H HD3  . LYS A 1 31 ? -17.589 -2.921  -1.976  1.00 0.00 ? 31 LYS A HD3  9  
ATOM 11360 H HE2  . LYS A 1 31 ? -19.980 -4.317  -3.026  1.00 0.00 ? 31 LYS A HE2  9  
ATOM 11361 H HE3  . LYS A 1 31 ? -20.253 -2.798  -2.173  1.00 0.00 ? 31 LYS A HE3  9  
ATOM 11362 H HZ1  . LYS A 1 31 ? -19.276 -1.606  -3.797  1.00 0.00 ? 31 LYS A HZ1  9  
ATOM 11363 H HZ2  . LYS A 1 31 ? -19.693 -2.933  -4.759  1.00 0.00 ? 31 LYS A HZ2  9  
ATOM 11364 H HZ3  . LYS A 1 31 ? -18.121 -2.792  -4.150  1.00 0.00 ? 31 LYS A HZ3  9  
ATOM 11365 N N    . ILE A 1 32 ? -15.273 -1.911  -2.964  1.00 0.00 ? 32 ILE A N    9  
ATOM 11366 C CA   . ILE A 1 32 ? -15.043 -0.532  -2.557  1.00 0.00 ? 32 ILE A CA   9  
ATOM 11367 C C    . ILE A 1 32 ? -16.105 -0.064  -1.564  1.00 0.00 ? 32 ILE A C    9  
ATOM 11368 O O    . ILE A 1 32 ? -17.191 -0.638  -1.484  1.00 0.00 ? 32 ILE A O    9  
ATOM 11369 C CB   . ILE A 1 32 ? -15.025 0.413   -3.778  1.00 0.00 ? 32 ILE A CB   9  
ATOM 11370 C CG1  . ILE A 1 32 ? -14.518 1.801   -3.377  1.00 0.00 ? 32 ILE A CG1  9  
ATOM 11371 C CG2  . ILE A 1 32 ? -16.409 0.509   -4.406  1.00 0.00 ? 32 ILE A CG2  9  
ATOM 11372 C CD1  . ILE A 1 32 ? -13.139 1.785   -2.751  1.00 0.00 ? 32 ILE A CD1  9  
ATOM 11373 H H    . ILE A 1 32 ? -15.560 -2.094  -3.881  1.00 0.00 ? 32 ILE A H    9  
ATOM 11374 H HA   . ILE A 1 32 ? -14.076 -0.488  -2.082  1.00 0.00 ? 32 ILE A HA   9  
ATOM 11375 H HB   . ILE A 1 32 ? -14.355 -0.004  -4.515  1.00 0.00 ? 32 ILE A HB   9  
ATOM 11376 H HG12 . ILE A 1 32 ? -14.474 2.427   -4.256  1.00 0.00 ? 32 ILE A HG12 9  
ATOM 11377 H HG13 . ILE A 1 32 ? -15.203 2.237   -2.665  1.00 0.00 ? 32 ILE A HG13 9  
ATOM 11378 H HG21 . ILE A 1 32 ? -16.321 0.875   -5.418  1.00 0.00 ? 32 ILE A HG21 9  
ATOM 11379 H HG22 . ILE A 1 32 ? -17.020 1.187   -3.829  1.00 0.00 ? 32 ILE A HG22 9  
ATOM 11380 H HG23 . ILE A 1 32 ? -16.868 -0.469  -4.416  1.00 0.00 ? 32 ILE A HG23 9  
ATOM 11381 H HD11 . ILE A 1 32 ? -12.445 1.304   -3.424  1.00 0.00 ? 32 ILE A HD11 9  
ATOM 11382 H HD12 . ILE A 1 32 ? -13.172 1.242   -1.819  1.00 0.00 ? 32 ILE A HD12 9  
ATOM 11383 H HD13 . ILE A 1 32 ? -12.817 2.799   -2.566  1.00 0.00 ? 32 ILE A HD13 9  
ATOM 11384 N N    . ILE A 1 33 ? -15.781 0.981   -0.811  1.00 0.00 ? 33 ILE A N    9  
ATOM 11385 C CA   . ILE A 1 33 ? -16.703 1.529   0.177   1.00 0.00 ? 33 ILE A CA   9  
ATOM 11386 C C    . ILE A 1 33 ? -17.819 2.323   -0.497  1.00 0.00 ? 33 ILE A C    9  
ATOM 11387 O O    . ILE A 1 33 ? -17.850 2.451   -1.721  1.00 0.00 ? 33 ILE A O    9  
ATOM 11388 C CB   . ILE A 1 33 ? -15.997 2.431   1.213   1.00 0.00 ? 33 ILE A CB   9  
ATOM 11389 C CG1  . ILE A 1 33 ? -14.493 2.129   1.286   1.00 0.00 ? 33 ILE A CG1  9  
ATOM 11390 C CG2  . ILE A 1 33 ? -16.644 2.264   2.583   1.00 0.00 ? 33 ILE A CG2  9  
ATOM 11391 C CD1  . ILE A 1 33 ? -13.789 2.807   2.443   1.00 0.00 ? 33 ILE A CD1  9  
ATOM 11392 H H    . ILE A 1 33 ? -14.905 1.393   -0.923  1.00 0.00 ? 33 ILE A H    9  
ATOM 11393 H HA   . ILE A 1 33 ? -17.140 0.706   0.704   1.00 0.00 ? 33 ILE A HA   9  
ATOM 11394 H HB   . ILE A 1 33 ? -16.138 3.448   0.905   1.00 0.00 ? 33 ILE A HB   9  
ATOM 11395 H HG12 . ILE A 1 33 ? -14.351 1.064   1.392   1.00 0.00 ? 33 ILE A HG12 9  
ATOM 11396 H HG13 . ILE A 1 33 ? -14.022 2.460   0.373   1.00 0.00 ? 33 ILE A HG13 9  
ATOM 11397 H HG21 . ILE A 1 33 ? -17.518 1.635   2.496   1.00 0.00 ? 33 ILE A HG21 9  
ATOM 11398 H HG22 . ILE A 1 33 ? -16.934 3.232   2.964   1.00 0.00 ? 33 ILE A HG22 9  
ATOM 11399 H HG23 . ILE A 1 33 ? -15.938 1.807   3.262   1.00 0.00 ? 33 ILE A HG23 9  
ATOM 11400 H HD11 . ILE A 1 33 ? -14.187 2.434   3.376   1.00 0.00 ? 33 ILE A HD11 9  
ATOM 11401 H HD12 . ILE A 1 33 ? -13.947 3.874   2.386   1.00 0.00 ? 33 ILE A HD12 9  
ATOM 11402 H HD13 . ILE A 1 33 ? -12.731 2.597   2.394   1.00 0.00 ? 33 ILE A HD13 9  
ATOM 11403 N N    . LEU A 1 34 ? -18.737 2.849   0.309   1.00 0.00 ? 34 LEU A N    9  
ATOM 11404 C CA   . LEU A 1 34 ? -19.861 3.625   -0.200  1.00 0.00 ? 34 LEU A CA   9  
ATOM 11405 C C    . LEU A 1 34 ? -19.472 5.078   -0.481  1.00 0.00 ? 34 LEU A C    9  
ATOM 11406 O O    . LEU A 1 34 ? -20.281 5.988   -0.300  1.00 0.00 ? 34 LEU A O    9  
ATOM 11407 C CB   . LEU A 1 34 ? -21.024 3.575   0.790   1.00 0.00 ? 34 LEU A CB   9  
ATOM 11408 C CG   . LEU A 1 34 ? -22.287 2.885   0.271   1.00 0.00 ? 34 LEU A CG   9  
ATOM 11409 C CD1  . LEU A 1 34 ? -23.392 2.942   1.313   1.00 0.00 ? 34 LEU A CD1  9  
ATOM 11410 C CD2  . LEU A 1 34 ? -22.745 3.526   -1.031  1.00 0.00 ? 34 LEU A CD2  9  
ATOM 11411 H H    . LEU A 1 34 ? -18.661 2.707   1.270   1.00 0.00 ? 34 LEU A H    9  
ATOM 11412 H HA   . LEU A 1 34 ? -20.175 3.168   -1.118  1.00 0.00 ? 34 LEU A HA   9  
ATOM 11413 H HB2  . LEU A 1 34 ? -20.691 3.052   1.672   1.00 0.00 ? 34 LEU A HB2  9  
ATOM 11414 H HB3  . LEU A 1 34 ? -21.281 4.585   1.066   1.00 0.00 ? 34 LEU A HB3  9  
ATOM 11415 H HG   . LEU A 1 34 ? -22.066 1.846   0.074   1.00 0.00 ? 34 LEU A HG   9  
ATOM 11416 H HD11 . LEU A 1 34 ? -24.352 2.977   0.819   1.00 0.00 ? 34 LEU A HD11 9  
ATOM 11417 H HD12 . LEU A 1 34 ? -23.268 3.825   1.922   1.00 0.00 ? 34 LEU A HD12 9  
ATOM 11418 H HD13 . LEU A 1 34 ? -23.342 2.063   1.939   1.00 0.00 ? 34 LEU A HD13 9  
ATOM 11419 H HD21 . LEU A 1 34 ? -22.420 4.556   -1.059  1.00 0.00 ? 34 LEU A HD21 9  
ATOM 11420 H HD22 . LEU A 1 34 ? -23.823 3.487   -1.091  1.00 0.00 ? 34 LEU A HD22 9  
ATOM 11421 H HD23 . LEU A 1 34 ? -22.318 2.990   -1.866  1.00 0.00 ? 34 LEU A HD23 9  
ATOM 11422 N N    . SER A 1 35 ? -18.233 5.295   -0.923  1.00 0.00 ? 35 SER A N    9  
ATOM 11423 C CA   . SER A 1 35 ? -17.743 6.639   -1.227  1.00 0.00 ? 35 SER A CA   9  
ATOM 11424 C C    . SER A 1 35 ? -18.775 7.449   -2.005  1.00 0.00 ? 35 SER A C    9  
ATOM 11425 O O    . SER A 1 35 ? -18.829 8.674   -1.899  1.00 0.00 ? 35 SER A O    9  
ATOM 11426 C CB   . SER A 1 35 ? -16.437 6.560   -2.021  1.00 0.00 ? 35 SER A CB   9  
ATOM 11427 O OG   . SER A 1 35 ? -16.148 5.226   -2.404  1.00 0.00 ? 35 SER A OG   9  
ATOM 11428 H H    . SER A 1 35 ? -17.632 4.535   -1.050  1.00 0.00 ? 35 SER A H    9  
ATOM 11429 H HA   . SER A 1 35 ? -17.552 7.136   -0.293  1.00 0.00 ? 35 SER A HA   9  
ATOM 11430 H HB2  . SER A 1 35 ? -16.521 7.164   -2.911  1.00 0.00 ? 35 SER A HB2  9  
ATOM 11431 H HB3  . SER A 1 35 ? -15.626 6.929   -1.413  1.00 0.00 ? 35 SER A HB3  9  
ATOM 11432 H HG   . SER A 1 35 ? -16.463 5.074   -3.298  1.00 0.00 ? 35 SER A HG   9  
ATOM 11433 N N    . ASP A 1 36 ? -19.592 6.754   -2.783  1.00 0.00 ? 36 ASP A N    9  
ATOM 11434 C CA   . ASP A 1 36 ? -20.627 7.402   -3.580  1.00 0.00 ? 36 ASP A CA   9  
ATOM 11435 C C    . ASP A 1 36 ? -21.590 8.182   -2.689  1.00 0.00 ? 36 ASP A C    9  
ATOM 11436 O O    . ASP A 1 36 ? -21.881 9.350   -2.947  1.00 0.00 ? 36 ASP A O    9  
ATOM 11437 C CB   . ASP A 1 36 ? -21.397 6.363   -4.396  1.00 0.00 ? 36 ASP A CB   9  
ATOM 11438 C CG   . ASP A 1 36 ? -21.805 6.885   -5.760  1.00 0.00 ? 36 ASP A CG   9  
ATOM 11439 O OD1  . ASP A 1 36 ? -22.875 7.523   -5.856  1.00 0.00 ? 36 ASP A OD1  9  
ATOM 11440 O OD2  . ASP A 1 36 ? -21.055 6.656   -6.732  1.00 0.00 ? 36 ASP A OD2  9  
ATOM 11441 H H    . ASP A 1 36 ? -19.497 5.782   -2.821  1.00 0.00 ? 36 ASP A H    9  
ATOM 11442 H HA   . ASP A 1 36 ? -20.143 8.091   -4.256  1.00 0.00 ? 36 ASP A HA   9  
ATOM 11443 H HB2  . ASP A 1 36 ? -20.776 5.491   -4.537  1.00 0.00 ? 36 ASP A HB2  9  
ATOM 11444 H HB3  . ASP A 1 36 ? -22.290 6.080   -3.857  1.00 0.00 ? 36 ASP A HB3  9  
ATOM 11445 N N    . GLU A 1 37 ? -22.083 7.527   -1.643  1.00 0.00 ? 37 GLU A N    9  
ATOM 11446 C CA   . GLU A 1 37 ? -23.012 8.156   -0.717  1.00 0.00 ? 37 GLU A CA   9  
ATOM 11447 C C    . GLU A 1 37 ? -22.289 9.107   0.227   1.00 0.00 ? 37 GLU A C    9  
ATOM 11448 O O    . GLU A 1 37 ? -22.807 10.166  0.583   1.00 0.00 ? 37 GLU A O    9  
ATOM 11449 C CB   . GLU A 1 37 ? -23.769 7.096   0.080   1.00 0.00 ? 37 GLU A CB   9  
ATOM 11450 C CG   . GLU A 1 37 ? -25.269 7.119   -0.147  1.00 0.00 ? 37 GLU A CG   9  
ATOM 11451 C CD   . GLU A 1 37 ? -26.050 7.398   1.122   1.00 0.00 ? 37 GLU A CD   9  
ATOM 11452 O OE1  . GLU A 1 37 ? -25.900 8.505   1.681   1.00 0.00 ? 37 GLU A OE1  9  
ATOM 11453 O OE2  . GLU A 1 37 ? -26.812 6.510   1.558   1.00 0.00 ? 37 GLU A OE2  9  
ATOM 11454 H H    . GLU A 1 37 ? -21.817 6.599   -1.491  1.00 0.00 ? 37 GLU A H    9  
ATOM 11455 H HA   . GLU A 1 37 ? -23.713 8.717   -1.296  1.00 0.00 ? 37 GLU A HA   9  
ATOM 11456 H HB2  . GLU A 1 37 ? -23.401 6.123   -0.201  1.00 0.00 ? 37 GLU A HB2  9  
ATOM 11457 H HB3  . GLU A 1 37 ? -23.586 7.252   1.129   1.00 0.00 ? 37 GLU A HB3  9  
ATOM 11458 H HG2  . GLU A 1 37 ? -25.494 7.889   -0.866  1.00 0.00 ? 37 GLU A HG2  9  
ATOM 11459 H HG3  . GLU A 1 37 ? -25.575 6.161   -0.538  1.00 0.00 ? 37 GLU A HG3  9  
ATOM 11460 N N    . GLY A 1 38 ? -21.089 8.718   0.627   1.00 0.00 ? 38 GLY A N    9  
ATOM 11461 C CA   . GLY A 1 38 ? -20.303 9.534   1.526   1.00 0.00 ? 38 GLY A CA   9  
ATOM 11462 C C    . GLY A 1 38 ? -19.613 8.719   2.597   1.00 0.00 ? 38 GLY A C    9  
ATOM 11463 O O    . GLY A 1 38 ? -19.751 8.993   3.789   1.00 0.00 ? 38 GLY A O    9  
ATOM 11464 H H    . GLY A 1 38 ? -20.737 7.871   0.311   1.00 0.00 ? 38 GLY A H    9  
ATOM 11465 H HA2  . GLY A 1 38 ? -19.557 10.068  0.956   1.00 0.00 ? 38 GLY A HA2  9  
ATOM 11466 H HA3  . GLY A 1 38 ? -20.951 10.237  1.994   1.00 0.00 ? 38 GLY A HA3  9  
ATOM 11467 N N    . LYS A 1 39 ? -18.860 7.726   2.163   1.00 0.00 ? 39 LYS A N    9  
ATOM 11468 C CA   . LYS A 1 39 ? -18.124 6.866   3.064   1.00 0.00 ? 39 LYS A CA   9  
ATOM 11469 C C    . LYS A 1 39 ? -16.813 6.438   2.424   1.00 0.00 ? 39 LYS A C    9  
ATOM 11470 O O    . LYS A 1 39 ? -16.745 5.425   1.730   1.00 0.00 ? 39 LYS A O    9  
ATOM 11471 C CB   . LYS A 1 39 ? -18.957 5.637   3.433   1.00 0.00 ? 39 LYS A CB   9  
ATOM 11472 C CG   . LYS A 1 39 ? -18.694 5.123   4.839   1.00 0.00 ? 39 LYS A CG   9  
ATOM 11473 C CD   . LYS A 1 39 ? -19.870 4.316   5.366   1.00 0.00 ? 39 LYS A CD   9  
ATOM 11474 C CE   . LYS A 1 39 ? -19.404 3.131   6.196   1.00 0.00 ? 39 LYS A CE   9  
ATOM 11475 N NZ   . LYS A 1 39 ? -19.445 3.423   7.655   1.00 0.00 ? 39 LYS A NZ   9  
ATOM 11476 H H    . LYS A 1 39 ? -18.780 7.582   1.211   1.00 0.00 ? 39 LYS A H    9  
ATOM 11477 H HA   . LYS A 1 39 ? -17.912 7.430   3.954   1.00 0.00 ? 39 LYS A HA   9  
ATOM 11478 H HB2  . LYS A 1 39 ? -20.004 5.889   3.355   1.00 0.00 ? 39 LYS A HB2  9  
ATOM 11479 H HB3  . LYS A 1 39 ? -18.735 4.843   2.736   1.00 0.00 ? 39 LYS A HB3  9  
ATOM 11480 H HG2  . LYS A 1 39 ? -17.817 4.495   4.825   1.00 0.00 ? 39 LYS A HG2  9  
ATOM 11481 H HG3  . LYS A 1 39 ? -18.525 5.966   5.494   1.00 0.00 ? 39 LYS A HG3  9  
ATOM 11482 H HD2  . LYS A 1 39 ? -20.485 4.954   5.982   1.00 0.00 ? 39 LYS A HD2  9  
ATOM 11483 H HD3  . LYS A 1 39 ? -20.449 3.954   4.529   1.00 0.00 ? 39 LYS A HD3  9  
ATOM 11484 H HE2  . LYS A 1 39 ? -20.047 2.288   5.989   1.00 0.00 ? 39 LYS A HE2  9  
ATOM 11485 H HE3  . LYS A 1 39 ? -18.390 2.887   5.914   1.00 0.00 ? 39 LYS A HE3  9  
ATOM 11486 H HZ1  . LYS A 1 39 ? -18.508 3.733   7.984   1.00 0.00 ? 39 LYS A HZ1  9  
ATOM 11487 H HZ2  . LYS A 1 39 ? -19.721 2.571   8.183   1.00 0.00 ? 39 LYS A HZ2  9  
ATOM 11488 H HZ3  . LYS A 1 39 ? -20.136 4.177   7.849   1.00 0.00 ? 39 LYS A HZ3  9  
ATOM 11489 N N    . MET A 1 40 ? -15.775 7.218   2.671   1.00 0.00 ? 40 MET A N    9  
ATOM 11490 C CA   . MET A 1 40 ? -14.457 6.934   2.135   1.00 0.00 ? 40 MET A CA   9  
ATOM 11491 C C    . MET A 1 40 ? -13.371 7.421   3.085   1.00 0.00 ? 40 MET A C    9  
ATOM 11492 O O    . MET A 1 40 ? -12.865 8.535   2.951   1.00 0.00 ? 40 MET A O    9  
ATOM 11493 C CB   . MET A 1 40 ? -14.284 7.589   0.764   1.00 0.00 ? 40 MET A CB   9  
ATOM 11494 C CG   . MET A 1 40 ? -13.473 6.753   -0.213  1.00 0.00 ? 40 MET A CG   9  
ATOM 11495 S SD   . MET A 1 40 ? -11.855 6.296   0.439   1.00 0.00 ? 40 MET A SD   9  
ATOM 11496 C CE   . MET A 1 40 ? -12.015 4.514   0.519   1.00 0.00 ? 40 MET A CE   9  
ATOM 11497 H H    . MET A 1 40 ? -15.900 8.000   3.229   1.00 0.00 ? 40 MET A H    9  
ATOM 11498 H HA   . MET A 1 40 ? -14.374 5.868   2.029   1.00 0.00 ? 40 MET A HA   9  
ATOM 11499 H HB2  . MET A 1 40 ? -15.260 7.761   0.335   1.00 0.00 ? 40 MET A HB2  9  
ATOM 11500 H HB3  . MET A 1 40 ? -13.786 8.539   0.892   1.00 0.00 ? 40 MET A HB3  9  
ATOM 11501 H HG2  . MET A 1 40 ? -14.023 5.851   -0.436  1.00 0.00 ? 40 MET A HG2  9  
ATOM 11502 H HG3  . MET A 1 40 ? -13.333 7.320   -1.121  1.00 0.00 ? 40 MET A HG3  9  
ATOM 11503 H HE1  . MET A 1 40 ? -11.624 4.159   1.461   1.00 0.00 ? 40 MET A HE1  9  
ATOM 11504 H HE2  . MET A 1 40 ? -11.461 4.066   -0.293  1.00 0.00 ? 40 MET A HE2  9  
ATOM 11505 H HE3  . MET A 1 40 ? -13.057 4.242   0.436   1.00 0.00 ? 40 MET A HE3  9  
ATOM 11506 N N    . TYR A 1 41 ? -13.015 6.574   4.040   1.00 0.00 ? 41 TYR A N    9  
ATOM 11507 C CA   . TYR A 1 41 ? -11.987 6.905   5.014   1.00 0.00 ? 41 TYR A CA   9  
ATOM 11508 C C    . TYR A 1 41 ? -10.596 6.761   4.405   1.00 0.00 ? 41 TYR A C    9  
ATOM 11509 O O    . TYR A 1 41 ? -10.456 6.460   3.219   1.00 0.00 ? 41 TYR A O    9  
ATOM 11510 C CB   . TYR A 1 41 ? -12.117 6.012   6.247   1.00 0.00 ? 41 TYR A CB   9  
ATOM 11511 C CG   . TYR A 1 41 ? -12.417 6.774   7.518   1.00 0.00 ? 41 TYR A CG   9  
ATOM 11512 C CD1  . TYR A 1 41 ? -13.685 7.287   7.760   1.00 0.00 ? 41 TYR A CD1  9  
ATOM 11513 C CD2  . TYR A 1 41 ? -11.432 6.980   8.476   1.00 0.00 ? 41 TYR A CD2  9  
ATOM 11514 C CE1  . TYR A 1 41 ? -13.963 7.984   8.921   1.00 0.00 ? 41 TYR A CE1  9  
ATOM 11515 C CE2  . TYR A 1 41 ? -11.702 7.676   9.639   1.00 0.00 ? 41 TYR A CE2  9  
ATOM 11516 C CZ   . TYR A 1 41 ? -12.969 8.176   9.856   1.00 0.00 ? 41 TYR A CZ   9  
ATOM 11517 O OH   . TYR A 1 41 ? -13.242 8.869   11.013  1.00 0.00 ? 41 TYR A OH   9  
ATOM 11518 H H    . TYR A 1 41 ? -13.458 5.706   4.092   1.00 0.00 ? 41 TYR A H    9  
ATOM 11519 H HA   . TYR A 1 41 ? -12.135 7.925   5.310   1.00 0.00 ? 41 TYR A HA   9  
ATOM 11520 H HB2  . TYR A 1 41 ? -12.917 5.309   6.087   1.00 0.00 ? 41 TYR A HB2  9  
ATOM 11521 H HB3  . TYR A 1 41 ? -11.194 5.475   6.392   1.00 0.00 ? 41 TYR A HB3  9  
ATOM 11522 H HD1  . TYR A 1 41 ? -14.462 7.135   7.025   1.00 0.00 ? 41 TYR A HD1  9  
ATOM 11523 H HD2  . TYR A 1 41 ? -10.441 6.588   8.302   1.00 0.00 ? 41 TYR A HD2  9  
ATOM 11524 H HE1  . TYR A 1 41 ? -14.956 8.375   9.091   1.00 0.00 ? 41 TYR A HE1  9  
ATOM 11525 H HE2  . TYR A 1 41 ? -10.923 7.826   10.372  1.00 0.00 ? 41 TYR A HE2  9  
ATOM 11526 H HH   . TYR A 1 41 ? -13.687 8.290   11.636  1.00 0.00 ? 41 TYR A HH   9  
ATOM 11527 N N    . GLY A 1 42 ? -9.570  6.974   5.221   1.00 0.00 ? 42 GLY A N    9  
ATOM 11528 C CA   . GLY A 1 42 ? -8.206  6.860   4.741   1.00 0.00 ? 42 GLY A CA   9  
ATOM 11529 C C    . GLY A 1 42 ? -7.890  5.470   4.223   1.00 0.00 ? 42 GLY A C    9  
ATOM 11530 O O    . GLY A 1 42 ? -7.656  4.549   5.005   1.00 0.00 ? 42 GLY A O    9  
ATOM 11531 H H    . GLY A 1 42 ? -9.740  7.209   6.157   1.00 0.00 ? 42 GLY A H    9  
ATOM 11532 H HA2  . GLY A 1 42 ? -8.056  7.573   3.943   1.00 0.00 ? 42 GLY A HA2  9  
ATOM 11533 H HA3  . GLY A 1 42 ? -7.530  7.094   5.550   1.00 0.00 ? 42 GLY A HA3  9  
ATOM 11534 N N    . ARG A 1 43 ? -7.886  5.318   2.903   1.00 0.00 ? 43 ARG A N    9  
ATOM 11535 C CA   . ARG A 1 43 ? -7.599  4.029   2.284   1.00 0.00 ? 43 ARG A CA   9  
ATOM 11536 C C    . ARG A 1 43 ? -6.213  3.532   2.671   1.00 0.00 ? 43 ARG A C    9  
ATOM 11537 O O    . ARG A 1 43 ? -5.972  2.327   2.748   1.00 0.00 ? 43 ARG A O    9  
ATOM 11538 C CB   . ARG A 1 43 ? -7.718  4.129   0.765   1.00 0.00 ? 43 ARG A CB   9  
ATOM 11539 C CG   . ARG A 1 43 ? -8.774  3.208   0.176   1.00 0.00 ? 43 ARG A CG   9  
ATOM 11540 C CD   . ARG A 1 43 ? -8.800  3.283   -1.343  1.00 0.00 ? 43 ARG A CD   9  
ATOM 11541 N NE   . ARG A 1 43 ? -7.457  3.236   -1.919  1.00 0.00 ? 43 ARG A NE   9  
ATOM 11542 C CZ   . ARG A 1 43 ? -6.698  4.310   -2.130  1.00 0.00 ? 43 ARG A CZ   9  
ATOM 11543 N NH1  . ARG A 1 43 ? -7.140  5.521   -1.812  1.00 0.00 ? 43 ARG A NH1  9  
ATOM 11544 N NH2  . ARG A 1 43 ? -5.491  4.172   -2.660  1.00 0.00 ? 43 ARG A NH2  9  
ATOM 11545 H H    . ARG A 1 43 ? -8.082  6.090   2.331   1.00 0.00 ? 43 ARG A H    9  
ATOM 11546 H HA   . ARG A 1 43 ? -8.324  3.326   2.642   1.00 0.00 ? 43 ARG A HA   9  
ATOM 11547 H HB2  . ARG A 1 43 ? -7.970  5.144   0.504   1.00 0.00 ? 43 ARG A HB2  9  
ATOM 11548 H HB3  . ARG A 1 43 ? -6.767  3.877   0.324   1.00 0.00 ? 43 ARG A HB3  9  
ATOM 11549 H HG2  . ARG A 1 43 ? -8.558  2.193   0.472   1.00 0.00 ? 43 ARG A HG2  9  
ATOM 11550 H HG3  . ARG A 1 43 ? -9.742  3.497   0.558   1.00 0.00 ? 43 ARG A HG3  9  
ATOM 11551 H HD2  . ARG A 1 43 ? -9.371  2.448   -1.721  1.00 0.00 ? 43 ARG A HD2  9  
ATOM 11552 H HD3  . ARG A 1 43 ? -9.278  4.205   -1.638  1.00 0.00 ? 43 ARG A HD3  9  
ATOM 11553 H HE   . ARG A 1 43 ? -7.102  2.356   -2.163  1.00 0.00 ? 43 ARG A HE   9  
ATOM 11554 H HH11 . ARG A 1 43 ? -8.048  5.634   -1.410  1.00 0.00 ? 43 ARG A HH11 9  
ATOM 11555 H HH12 . ARG A 1 43 ? -6.562  6.321   -1.974  1.00 0.00 ? 43 ARG A HH12 9  
ATOM 11556 H HH21 . ARG A 1 43 ? -5.151  3.262   -2.901  1.00 0.00 ? 43 ARG A HH21 9  
ATOM 11557 H HH22 . ARG A 1 43 ? -4.919  4.977   -2.819  1.00 0.00 ? 43 ARG A HH22 9  
ATOM 11558 N N    . ASN A 1 44 ? -5.308  4.467   2.918   1.00 0.00 ? 44 ASN A N    9  
ATOM 11559 C CA   . ASN A 1 44 ? -3.946  4.125   3.303   1.00 0.00 ? 44 ASN A CA   9  
ATOM 11560 C C    . ASN A 1 44 ? -3.926  3.446   4.665   1.00 0.00 ? 44 ASN A C    9  
ATOM 11561 O O    . ASN A 1 44 ? -3.048  2.634   4.955   1.00 0.00 ? 44 ASN A O    9  
ATOM 11562 C CB   . ASN A 1 44 ? -3.067  5.374   3.320   1.00 0.00 ? 44 ASN A CB   9  
ATOM 11563 C CG   . ASN A 1 44 ? -1.931  5.296   2.319   1.00 0.00 ? 44 ASN A CG   9  
ATOM 11564 O OD1  . ASN A 1 44 ? -1.456  4.210   1.985   1.00 0.00 ? 44 ASN A OD1  9  
ATOM 11565 N ND2  . ASN A 1 44 ? -1.487  6.450   1.836   1.00 0.00 ? 44 ASN A ND2  9  
ATOM 11566 H H    . ASN A 1 44 ? -5.564  5.406   2.843   1.00 0.00 ? 44 ASN A H    9  
ATOM 11567 H HA   . ASN A 1 44 ? -3.563  3.441   2.574   1.00 0.00 ? 44 ASN A HA   9  
ATOM 11568 H HB2  . ASN A 1 44 ? -3.673  6.232   3.081   1.00 0.00 ? 44 ASN A HB2  9  
ATOM 11569 H HB3  . ASN A 1 44 ? -2.647  5.497   4.305   1.00 0.00 ? 44 ASN A HB3  9  
ATOM 11570 H HD21 . ASN A 1 44 ? -1.913  7.276   2.148   1.00 0.00 ? 44 ASN A HD21 9  
ATOM 11571 H HD22 . ASN A 1 44 ? -0.753  6.429   1.187   1.00 0.00 ? 44 ASN A HD22 9  
ATOM 11572 N N    . GLU A 1 45 ? -4.907  3.779   5.493   1.00 0.00 ? 45 GLU A N    9  
ATOM 11573 C CA   . GLU A 1 45 ? -5.014  3.198   6.823   1.00 0.00 ? 45 GLU A CA   9  
ATOM 11574 C C    . GLU A 1 45 ? -5.318  1.708   6.733   1.00 0.00 ? 45 GLU A C    9  
ATOM 11575 O O    . GLU A 1 45 ? -4.958  0.934   7.619   1.00 0.00 ? 45 GLU A O    9  
ATOM 11576 C CB   . GLU A 1 45 ? -6.102  3.908   7.631   1.00 0.00 ? 45 GLU A CB   9  
ATOM 11577 C CG   . GLU A 1 45 ? -5.783  4.020   9.113   1.00 0.00 ? 45 GLU A CG   9  
ATOM 11578 C CD   . GLU A 1 45 ? -6.898  4.679   9.901   1.00 0.00 ? 45 GLU A CD   9  
ATOM 11579 O OE1  . GLU A 1 45 ? -7.122  5.893   9.712   1.00 0.00 ? 45 GLU A OE1  9  
ATOM 11580 O OE2  . GLU A 1 45 ? -7.548  3.980   10.707  1.00 0.00 ? 45 GLU A OE2  9  
ATOM 11581 H H    . GLU A 1 45 ? -5.577  4.426   5.199   1.00 0.00 ? 45 GLU A H    9  
ATOM 11582 H HA   . GLU A 1 45 ? -4.067  3.329   7.314   1.00 0.00 ? 45 GLU A HA   9  
ATOM 11583 H HB2  . GLU A 1 45 ? -6.234  4.904   7.236   1.00 0.00 ? 45 GLU A HB2  9  
ATOM 11584 H HB3  . GLU A 1 45 ? -7.027  3.362   7.524   1.00 0.00 ? 45 GLU A HB3  9  
ATOM 11585 H HG2  . GLU A 1 45 ? -5.620  3.029   9.509   1.00 0.00 ? 45 GLU A HG2  9  
ATOM 11586 H HG3  . GLU A 1 45 ? -4.883  4.607   9.231   1.00 0.00 ? 45 GLU A HG3  9  
ATOM 11587 N N    . LEU A 1 46 ? -5.979  1.317   5.651   1.00 0.00 ? 46 LEU A N    9  
ATOM 11588 C CA   . LEU A 1 46 ? -6.332  -0.078  5.433   1.00 0.00 ? 46 LEU A CA   9  
ATOM 11589 C C    . LEU A 1 46 ? -5.095  -0.912  5.153   1.00 0.00 ? 46 LEU A C    9  
ATOM 11590 O O    . LEU A 1 46 ? -4.870  -1.947  5.780   1.00 0.00 ? 46 LEU A O    9  
ATOM 11591 C CB   . LEU A 1 46 ? -7.322  -0.203  4.276   1.00 0.00 ? 46 LEU A CB   9  
ATOM 11592 C CG   . LEU A 1 46 ? -8.583  -1.012  4.580   1.00 0.00 ? 46 LEU A CG   9  
ATOM 11593 C CD1  . LEU A 1 46 ? -9.444  -1.141  3.333   1.00 0.00 ? 46 LEU A CD1  9  
ATOM 11594 C CD2  . LEU A 1 46 ? -8.216  -2.386  5.118   1.00 0.00 ? 46 LEU A CD2  9  
ATOM 11595 H H    . LEU A 1 46 ? -6.234  1.983   4.983   1.00 0.00 ? 46 LEU A H    9  
ATOM 11596 H HA   . LEU A 1 46 ? -6.790  -0.443  6.323   1.00 0.00 ? 46 LEU A HA   9  
ATOM 11597 H HB2  . LEU A 1 46 ? -7.619  0.791   3.975   1.00 0.00 ? 46 LEU A HB2  9  
ATOM 11598 H HB3  . LEU A 1 46 ? -6.814  -0.672  3.452   1.00 0.00 ? 46 LEU A HB3  9  
ATOM 11599 H HG   . LEU A 1 46 ? -9.161  -0.498  5.334   1.00 0.00 ? 46 LEU A HG   9  
ATOM 11600 H HD11 . LEU A 1 46 ? -8.829  -1.451  2.501   1.00 0.00 ? 46 LEU A HD11 9  
ATOM 11601 H HD12 . LEU A 1 46 ? -9.898  -0.187  3.109   1.00 0.00 ? 46 LEU A HD12 9  
ATOM 11602 H HD13 . LEU A 1 46 ? -10.217 -1.876  3.503   1.00 0.00 ? 46 LEU A HD13 9  
ATOM 11603 H HD21 . LEU A 1 46 ? -7.902  -2.298  6.148   1.00 0.00 ? 46 LEU A HD21 9  
ATOM 11604 H HD22 . LEU A 1 46 ? -7.411  -2.800  4.530   1.00 0.00 ? 46 LEU A HD22 9  
ATOM 11605 H HD23 . LEU A 1 46 ? -9.076  -3.037  5.059   1.00 0.00 ? 46 LEU A HD23 9  
ATOM 11606 N N    . ILE A 1 47 ? -4.294  -0.446  4.214   1.00 0.00 ? 47 ILE A N    9  
ATOM 11607 C CA   . ILE A 1 47 ? -3.067  -1.141  3.851   1.00 0.00 ? 47 ILE A CA   9  
ATOM 11608 C C    . ILE A 1 47 ? -2.033  -0.994  4.955   1.00 0.00 ? 47 ILE A C    9  
ATOM 11609 O O    . ILE A 1 47 ? -1.195  -1.872  5.159   1.00 0.00 ? 47 ILE A O    9  
ATOM 11610 C CB   . ILE A 1 47 ? -2.461  -0.648  2.509   1.00 0.00 ? 47 ILE A CB   9  
ATOM 11611 C CG1  . ILE A 1 47 ? -3.153  0.626   2.012   1.00 0.00 ? 47 ILE A CG1  9  
ATOM 11612 C CG2  . ILE A 1 47 ? -2.554  -1.742  1.456   1.00 0.00 ? 47 ILE A CG2  9  
ATOM 11613 C CD1  . ILE A 1 47 ? -2.564  1.175   0.731   1.00 0.00 ? 47 ILE A CD1  9  
ATOM 11614 H H    . ILE A 1 47 ? -4.532  0.384   3.766   1.00 0.00 ? 47 ILE A H    9  
ATOM 11615 H HA   . ILE A 1 47 ? -3.308  -2.184  3.753   1.00 0.00 ? 47 ILE A HA   9  
ATOM 11616 H HB   . ILE A 1 47 ? -1.414  -0.437  2.672   1.00 0.00 ? 47 ILE A HB   9  
ATOM 11617 H HG12 . ILE A 1 47 ? -4.196  0.414   1.831   1.00 0.00 ? 47 ILE A HG12 9  
ATOM 11618 H HG13 . ILE A 1 47 ? -3.071  1.391   2.770   1.00 0.00 ? 47 ILE A HG13 9  
ATOM 11619 H HG21 . ILE A 1 47 ? -3.520  -2.221  1.518   1.00 0.00 ? 47 ILE A HG21 9  
ATOM 11620 H HG22 . ILE A 1 47 ? -1.778  -2.473  1.626   1.00 0.00 ? 47 ILE A HG22 9  
ATOM 11621 H HG23 . ILE A 1 47 ? -2.430  -1.308  0.474   1.00 0.00 ? 47 ILE A HG23 9  
ATOM 11622 H HD11 . ILE A 1 47 ? -3.346  1.631   0.142   1.00 0.00 ? 47 ILE A HD11 9  
ATOM 11623 H HD12 . ILE A 1 47 ? -2.113  0.370   0.169   1.00 0.00 ? 47 ILE A HD12 9  
ATOM 11624 H HD13 . ILE A 1 47 ? -1.814  1.915   0.967   1.00 0.00 ? 47 ILE A HD13 9  
ATOM 11625 N N    . ALA A 1 48 ? -2.111  0.116   5.674   1.00 0.00 ? 48 ALA A N    9  
ATOM 11626 C CA   . ALA A 1 48 ? -1.198  0.376   6.770   1.00 0.00 ? 48 ALA A CA   9  
ATOM 11627 C C    . ALA A 1 48 ? -1.607  -0.414  8.003   1.00 0.00 ? 48 ALA A C    9  
ATOM 11628 O O    . ALA A 1 48 ? -0.772  -0.755  8.840   1.00 0.00 ? 48 ALA A O    9  
ATOM 11629 C CB   . ALA A 1 48 ? -1.140  1.865   7.077   1.00 0.00 ? 48 ALA A CB   9  
ATOM 11630 H H    . ALA A 1 48 ? -2.806  0.767   5.469   1.00 0.00 ? 48 ALA A H    9  
ATOM 11631 H HA   . ALA A 1 48 ? -0.222  0.052   6.462   1.00 0.00 ? 48 ALA A HA   9  
ATOM 11632 H HB1  . ALA A 1 48 ? -0.792  2.010   8.089   1.00 0.00 ? 48 ALA A HB1  9  
ATOM 11633 H HB2  . ALA A 1 48 ? -2.125  2.293   6.969   1.00 0.00 ? 48 ALA A HB2  9  
ATOM 11634 H HB3  . ALA A 1 48 ? -0.460  2.347   6.390   1.00 0.00 ? 48 ALA A HB3  9  
ATOM 11635 N N    . ARG A 1 49 ? -2.895  -0.718  8.102   1.00 0.00 ? 49 ARG A N    9  
ATOM 11636 C CA   . ARG A 1 49 ? -3.404  -1.486  9.224   1.00 0.00 ? 49 ARG A CA   9  
ATOM 11637 C C    . ARG A 1 49 ? -2.955  -2.934  9.108   1.00 0.00 ? 49 ARG A C    9  
ATOM 11638 O O    . ARG A 1 49 ? -2.791  -3.630  10.110  1.00 0.00 ? 49 ARG A O    9  
ATOM 11639 C CB   . ARG A 1 49 ? -4.931  -1.405  9.288   1.00 0.00 ? 49 ARG A CB   9  
ATOM 11640 C CG   . ARG A 1 49 ? -5.536  -2.208  10.428  1.00 0.00 ? 49 ARG A CG   9  
ATOM 11641 C CD   . ARG A 1 49 ? -6.774  -1.529  10.991  1.00 0.00 ? 49 ARG A CD   9  
ATOM 11642 N NE   . ARG A 1 49 ? -6.438  -0.529  12.002  1.00 0.00 ? 49 ARG A NE   9  
ATOM 11643 C CZ   . ARG A 1 49 ? -7.339  0.223   12.630  1.00 0.00 ? 49 ARG A CZ   9  
ATOM 11644 N NH1  . ARG A 1 49 ? -8.631  0.091   12.355  1.00 0.00 ? 49 ARG A NH1  9  
ATOM 11645 N NH2  . ARG A 1 49 ? -6.948  1.108   13.537  1.00 0.00 ? 49 ARG A NH2  9  
ATOM 11646 H H    . ARG A 1 49 ? -3.512  -0.430  7.399   1.00 0.00 ? 49 ARG A H    9  
ATOM 11647 H HA   . ARG A 1 49 ? -2.986  -1.067  10.120  1.00 0.00 ? 49 ARG A HA   9  
ATOM 11648 H HB2  . ARG A 1 49 ? -5.220  -0.372  9.411   1.00 0.00 ? 49 ARG A HB2  9  
ATOM 11649 H HB3  . ARG A 1 49 ? -5.339  -1.775  8.359   1.00 0.00 ? 49 ARG A HB3  9  
ATOM 11650 H HG2  . ARG A 1 49 ? -5.810  -3.185  10.061  1.00 0.00 ? 49 ARG A HG2  9  
ATOM 11651 H HG3  . ARG A 1 49 ? -4.802  -2.308  11.214  1.00 0.00 ? 49 ARG A HG3  9  
ATOM 11652 H HD2  . ARG A 1 49 ? -7.303  -1.045  10.184  1.00 0.00 ? 49 ARG A HD2  9  
ATOM 11653 H HD3  . ARG A 1 49 ? -7.409  -2.280  11.438  1.00 0.00 ? 49 ARG A HD3  9  
ATOM 11654 H HE   . ARG A 1 49 ? -5.490  -0.411  12.225  1.00 0.00 ? 49 ARG A HE   9  
ATOM 11655 H HH11 . ARG A 1 49 ? -8.932  -0.574  11.673  1.00 0.00 ? 49 ARG A HH11 9  
ATOM 11656 H HH12 . ARG A 1 49 ? -9.303  0.659   12.831  1.00 0.00 ? 49 ARG A HH12 9  
ATOM 11657 H HH21 . ARG A 1 49 ? -5.976  1.211   13.749  1.00 0.00 ? 49 ARG A HH21 9  
ATOM 11658 H HH22 . ARG A 1 49 ? -7.625  1.673   14.009  1.00 0.00 ? 49 ARG A HH22 9  
ATOM 11659 N N    . TYR A 1 50 ? -2.744  -3.375  7.874   1.00 0.00 ? 50 TYR A N    9  
ATOM 11660 C CA   . TYR A 1 50 ? -2.297  -4.733  7.617   1.00 0.00 ? 50 TYR A CA   9  
ATOM 11661 C C    . TYR A 1 50 ? -0.869  -4.919  8.083   1.00 0.00 ? 50 TYR A C    9  
ATOM 11662 O O    . TYR A 1 50 ? -0.562  -5.825  8.858   1.00 0.00 ? 50 TYR A O    9  
ATOM 11663 C CB   . TYR A 1 50 ? -2.396  -5.055  6.137   1.00 0.00 ? 50 TYR A CB   9  
ATOM 11664 C CG   . TYR A 1 50 ? -2.450  -6.536  5.846   1.00 0.00 ? 50 TYR A CG   9  
ATOM 11665 C CD1  . TYR A 1 50 ? -1.289  -7.297  5.831   1.00 0.00 ? 50 TYR A CD1  9  
ATOM 11666 C CD2  . TYR A 1 50 ? -3.657  -7.174  5.590   1.00 0.00 ? 50 TYR A CD2  9  
ATOM 11667 C CE1  . TYR A 1 50 ? -1.328  -8.652  5.570   1.00 0.00 ? 50 TYR A CE1  9  
ATOM 11668 C CE2  . TYR A 1 50 ? -3.705  -8.530  5.327   1.00 0.00 ? 50 TYR A CE2  9  
ATOM 11669 C CZ   . TYR A 1 50 ? -2.537  -9.264  5.318   1.00 0.00 ? 50 TYR A CZ   9  
ATOM 11670 O OH   . TYR A 1 50 ? -2.580  -10.615 5.057   1.00 0.00 ? 50 TYR A OH   9  
ATOM 11671 H H    . TYR A 1 50 ? -2.883  -2.768  7.119   1.00 0.00 ? 50 TYR A H    9  
ATOM 11672 H HA   . TYR A 1 50 ? -2.923  -5.396  8.158   1.00 0.00 ? 50 TYR A HA   9  
ATOM 11673 H HB2  . TYR A 1 50 ? -3.281  -4.596  5.731   1.00 0.00 ? 50 TYR A HB2  9  
ATOM 11674 H HB3  . TYR A 1 50 ? -1.533  -4.655  5.647   1.00 0.00 ? 50 TYR A HB3  9  
ATOM 11675 H HD1  . TYR A 1 50 ? -0.343  -6.815  6.029   1.00 0.00 ? 50 TYR A HD1  9  
ATOM 11676 H HD2  . TYR A 1 50 ? -4.569  -6.595  5.597   1.00 0.00 ? 50 TYR A HD2  9  
ATOM 11677 H HE1  . TYR A 1 50 ? -0.412  -9.225  5.563   1.00 0.00 ? 50 TYR A HE1  9  
ATOM 11678 H HE2  . TYR A 1 50 ? -4.652  -9.008  5.130   1.00 0.00 ? 50 TYR A HE2  9  
ATOM 11679 H HH   . TYR A 1 50 ? -2.750  -10.755 4.123   1.00 0.00 ? 50 TYR A HH   9  
ATOM 11680 N N    . ILE A 1 51 ? -0.002  -4.046  7.604   1.00 0.00 ? 51 ILE A N    9  
ATOM 11681 C CA   . ILE A 1 51 ? 1.404   -4.096  7.966   1.00 0.00 ? 51 ILE A CA   9  
ATOM 11682 C C    . ILE A 1 51 ? 1.581   -3.881  9.461   1.00 0.00 ? 51 ILE A C    9  
ATOM 11683 O O    . ILE A 1 51 ? 2.507   -4.414  10.074  1.00 0.00 ? 51 ILE A O    9  
ATOM 11684 C CB   . ILE A 1 51 ? 2.250   -3.058  7.195   1.00 0.00 ? 51 ILE A CB   9  
ATOM 11685 C CG1  . ILE A 1 51 ? 1.388   -1.902  6.677   1.00 0.00 ? 51 ILE A CG1  9  
ATOM 11686 C CG2  . ILE A 1 51 ? 2.985   -3.729  6.044   1.00 0.00 ? 51 ILE A CG2  9  
ATOM 11687 C CD1  . ILE A 1 51 ? 2.175   -0.639  6.400   1.00 0.00 ? 51 ILE A CD1  9  
ATOM 11688 H H    . ILE A 1 51 ? -0.321  -3.352  6.996   1.00 0.00 ? 51 ILE A H    9  
ATOM 11689 H HA   . ILE A 1 51 ? 1.768   -5.079  7.718   1.00 0.00 ? 51 ILE A HA   9  
ATOM 11690 H HB   . ILE A 1 51 ? 2.983   -2.664  7.875   1.00 0.00 ? 51 ILE A HB   9  
ATOM 11691 H HG12 . ILE A 1 51 ? 0.911   -2.202  5.757   1.00 0.00 ? 51 ILE A HG12 9  
ATOM 11692 H HG13 . ILE A 1 51 ? 0.631   -1.668  7.411   1.00 0.00 ? 51 ILE A HG13 9  
ATOM 11693 H HG21 . ILE A 1 51 ? 2.956   -3.089  5.175   1.00 0.00 ? 51 ILE A HG21 9  
ATOM 11694 H HG22 . ILE A 1 51 ? 2.509   -4.671  5.814   1.00 0.00 ? 51 ILE A HG22 9  
ATOM 11695 H HG23 . ILE A 1 51 ? 4.012   -3.904  6.328   1.00 0.00 ? 51 ILE A HG23 9  
ATOM 11696 H HD11 . ILE A 1 51 ? 3.195   -0.772  6.726   1.00 0.00 ? 51 ILE A HD11 9  
ATOM 11697 H HD12 . ILE A 1 51 ? 1.730   0.187   6.935   1.00 0.00 ? 51 ILE A HD12 9  
ATOM 11698 H HD13 . ILE A 1 51 ? 2.159   -0.431  5.340   1.00 0.00 ? 51 ILE A HD13 9  
ATOM 11699 N N    . LYS A 1 52 ? 0.679   -3.105  10.044  1.00 0.00 ? 52 LYS A N    9  
ATOM 11700 C CA   . LYS A 1 52 ? 0.722   -2.824  11.470  1.00 0.00 ? 52 LYS A CA   9  
ATOM 11701 C C    . LYS A 1 52 ? 0.311   -4.052  12.273  1.00 0.00 ? 52 LYS A C    9  
ATOM 11702 O O    . LYS A 1 52 ? 0.715   -4.221  13.423  1.00 0.00 ? 52 LYS A O    9  
ATOM 11703 C CB   . LYS A 1 52 ? -0.192  -1.645  11.811  1.00 0.00 ? 52 LYS A CB   9  
ATOM 11704 C CG   . LYS A 1 52 ? 0.228   -0.891  13.062  1.00 0.00 ? 52 LYS A CG   9  
ATOM 11705 C CD   . LYS A 1 52 ? 0.005   -1.723  14.314  1.00 0.00 ? 52 LYS A CD   9  
ATOM 11706 C CE   . LYS A 1 52 ? -0.337  -0.849  15.510  1.00 0.00 ? 52 LYS A CE   9  
ATOM 11707 N NZ   . LYS A 1 52 ? 0.863   -0.548  16.339  1.00 0.00 ? 52 LYS A NZ   9  
ATOM 11708 H H    . LYS A 1 52 ? -0.035  -2.717  9.502   1.00 0.00 ? 52 LYS A H    9  
ATOM 11709 H HA   . LYS A 1 52 ? 1.734   -2.568  11.721  1.00 0.00 ? 52 LYS A HA   9  
ATOM 11710 H HB2  . LYS A 1 52 ? -0.190  -0.952  10.983  1.00 0.00 ? 52 LYS A HB2  9  
ATOM 11711 H HB3  . LYS A 1 52 ? -1.196  -2.013  11.959  1.00 0.00 ? 52 LYS A HB3  9  
ATOM 11712 H HG2  . LYS A 1 52 ? 1.277   -0.646  12.988  1.00 0.00 ? 52 LYS A HG2  9  
ATOM 11713 H HG3  . LYS A 1 52 ? -0.352  0.017   13.136  1.00 0.00 ? 52 LYS A HG3  9  
ATOM 11714 H HD2  . LYS A 1 52 ? -0.810  -2.409  14.139  1.00 0.00 ? 52 LYS A HD2  9  
ATOM 11715 H HD3  . LYS A 1 52 ? 0.906   -2.279  14.531  1.00 0.00 ? 52 LYS A HD3  9  
ATOM 11716 H HE2  . LYS A 1 52 ? -0.758  0.078   15.154  1.00 0.00 ? 52 LYS A HE2  9  
ATOM 11717 H HE3  . LYS A 1 52 ? -1.065  -1.364  16.120  1.00 0.00 ? 52 LYS A HE3  9  
ATOM 11718 H HZ1  . LYS A 1 52 ? 1.406   -1.418  16.511  1.00 0.00 ? 52 LYS A HZ1  9  
ATOM 11719 H HZ2  . LYS A 1 52 ? 0.575   -0.146  17.253  1.00 0.00 ? 52 LYS A HZ2  9  
ATOM 11720 H HZ3  . LYS A 1 52 ? 1.473   0.137   15.849  1.00 0.00 ? 52 LYS A HZ3  9  
ATOM 11721 N N    . LEU A 1 53 ? -0.495  -4.908  11.657  1.00 0.00 ? 53 LEU A N    9  
ATOM 11722 C CA   . LEU A 1 53 ? -0.966  -6.121  12.305  1.00 0.00 ? 53 LEU A CA   9  
ATOM 11723 C C    . LEU A 1 53 ? 0.012   -7.277  12.098  1.00 0.00 ? 53 LEU A C    9  
ATOM 11724 O O    . LEU A 1 53 ? -0.037  -8.278  12.813  1.00 0.00 ? 53 LEU A O    9  
ATOM 11725 C CB   . LEU A 1 53 ? -2.348  -6.503  11.767  1.00 0.00 ? 53 LEU A CB   9  
ATOM 11726 C CG   . LEU A 1 53 ? -3.479  -6.461  12.798  1.00 0.00 ? 53 LEU A CG   9  
ATOM 11727 C CD1  . LEU A 1 53 ? -4.629  -5.602  12.296  1.00 0.00 ? 53 LEU A CD1  9  
ATOM 11728 C CD2  . LEU A 1 53 ? -3.964  -7.868  13.116  1.00 0.00 ? 53 LEU A CD2  9  
ATOM 11729 H H    . LEU A 1 53 ? -0.782  -4.717  10.746  1.00 0.00 ? 53 LEU A H    9  
ATOM 11730 H HA   . LEU A 1 53 ? -1.045  -5.916  13.355  1.00 0.00 ? 53 LEU A HA   9  
ATOM 11731 H HB2  . LEU A 1 53 ? -2.595  -5.826  10.962  1.00 0.00 ? 53 LEU A HB2  9  
ATOM 11732 H HB3  . LEU A 1 53 ? -2.293  -7.505  11.365  1.00 0.00 ? 53 LEU A HB3  9  
ATOM 11733 H HG   . LEU A 1 53 ? -3.108  -6.020  13.711  1.00 0.00 ? 53 LEU A HG   9  
ATOM 11734 H HD11 . LEU A 1 53 ? -5.560  -5.978  12.692  1.00 0.00 ? 53 LEU A HD11 9  
ATOM 11735 H HD12 . LEU A 1 53 ? -4.658  -5.634  11.217  1.00 0.00 ? 53 LEU A HD12 9  
ATOM 11736 H HD13 . LEU A 1 53 ? -4.485  -4.582  12.622  1.00 0.00 ? 53 LEU A HD13 9  
ATOM 11737 H HD21 . LEU A 1 53 ? -4.019  -8.445  12.205  1.00 0.00 ? 53 LEU A HD21 9  
ATOM 11738 H HD22 . LEU A 1 53 ? -4.943  -7.818  13.569  1.00 0.00 ? 53 LEU A HD22 9  
ATOM 11739 H HD23 . LEU A 1 53 ? -3.275  -8.340  13.801  1.00 0.00 ? 53 LEU A HD23 9  
ATOM 11740 N N    . ARG A 1 54 ? 0.892   -7.138  11.111  1.00 0.00 ? 54 ARG A N    9  
ATOM 11741 C CA   . ARG A 1 54 ? 1.871   -8.177  10.806  1.00 0.00 ? 54 ARG A CA   9  
ATOM 11742 C C    . ARG A 1 54 ? 2.774   -8.460  11.998  1.00 0.00 ? 54 ARG A C    9  
ATOM 11743 O O    . ARG A 1 54 ? 3.100   -9.613  12.285  1.00 0.00 ? 54 ARG A O    9  
ATOM 11744 C CB   . ARG A 1 54 ? 2.712   -7.775  9.593   1.00 0.00 ? 54 ARG A CB   9  
ATOM 11745 C CG   . ARG A 1 54 ? 2.871   -8.887  8.569   1.00 0.00 ? 54 ARG A CG   9  
ATOM 11746 C CD   . ARG A 1 54 ? 3.884   -9.925  9.026   1.00 0.00 ? 54 ARG A CD   9  
ATOM 11747 N NE   . ARG A 1 54 ? 3.239   -11.099 9.609   1.00 0.00 ? 54 ARG A NE   9  
ATOM 11748 C CZ   . ARG A 1 54 ? 2.460   -11.934 8.925   1.00 0.00 ? 54 ARG A CZ   9  
ATOM 11749 N NH1  . ARG A 1 54 ? 2.227   -11.728 7.634   1.00 0.00 ? 54 ARG A NH1  9  
ATOM 11750 N NH2  . ARG A 1 54 ? 1.913   -12.978 9.532   1.00 0.00 ? 54 ARG A NH2  9  
ATOM 11751 H H    . ARG A 1 54 ? 0.878   -6.323  10.569  1.00 0.00 ? 54 ARG A H    9  
ATOM 11752 H HA   . ARG A 1 54 ? 1.330   -9.072  10.571  1.00 0.00 ? 54 ARG A HA   9  
ATOM 11753 H HB2  . ARG A 1 54 ? 2.242   -6.932  9.107   1.00 0.00 ? 54 ARG A HB2  9  
ATOM 11754 H HB3  . ARG A 1 54 ? 3.696   -7.482  9.930   1.00 0.00 ? 54 ARG A HB3  9  
ATOM 11755 H HG2  . ARG A 1 54 ? 1.916   -9.370  8.426   1.00 0.00 ? 54 ARG A HG2  9  
ATOM 11756 H HG3  . ARG A 1 54 ? 3.204   -8.459  7.635   1.00 0.00 ? 54 ARG A HG3  9  
ATOM 11757 H HD2  . ARG A 1 54 ? 4.472   -10.235 8.175   1.00 0.00 ? 54 ARG A HD2  9  
ATOM 11758 H HD3  . ARG A 1 54 ? 4.531   -9.476  9.766   1.00 0.00 ? 54 ARG A HD3  9  
ATOM 11759 H HE   . ARG A 1 54 ? 3.394   -11.275 10.561  1.00 0.00 ? 54 ARG A HE   9  
ATOM 11760 H HH11 . ARG A 1 54 ? 2.637   -10.943 7.170   1.00 0.00 ? 54 ARG A HH11 9  
ATOM 11761 H HH12 . ARG A 1 54 ? 1.641   -12.359 7.126   1.00 0.00 ? 54 ARG A HH12 9  
ATOM 11762 H HH21 . ARG A 1 54 ? 2.086   -13.138 10.504  1.00 0.00 ? 54 ARG A HH21 9  
ATOM 11763 H HH22 . ARG A 1 54 ? 1.328   -13.605 9.018   1.00 0.00 ? 54 ARG A HH22 9  
ATOM 11764 N N    . THR A 1 55 ? 3.178   -7.405  12.686  1.00 0.00 ? 55 THR A N    9  
ATOM 11765 C CA   . THR A 1 55 ? 4.048   -7.539  13.846  1.00 0.00 ? 55 THR A CA   9  
ATOM 11766 C C    . THR A 1 55 ? 4.042   -6.273  14.700  1.00 0.00 ? 55 THR A C    9  
ATOM 11767 O O    . THR A 1 55 ? 5.022   -5.972  15.381  1.00 0.00 ? 55 THR A O    9  
ATOM 11768 C CB   . THR A 1 55 ? 5.474   -7.862  13.400  1.00 0.00 ? 55 THR A CB   9  
ATOM 11769 O OG1  . THR A 1 55 ? 6.300   -8.136  14.518  1.00 0.00 ? 55 THR A OG1  9  
ATOM 11770 C CG2  . THR A 1 55 ? 6.125   -6.746  12.611  1.00 0.00 ? 55 THR A CG2  9  
ATOM 11771 H H    . THR A 1 55 ? 2.884   -6.521  12.405  1.00 0.00 ? 55 THR A H    9  
ATOM 11772 H HA   . THR A 1 55 ? 3.674   -8.356  14.439  1.00 0.00 ? 55 THR A HA   9  
ATOM 11773 H HB   . THR A 1 55 ? 5.451   -8.741  12.772  1.00 0.00 ? 55 THR A HB   9  
ATOM 11774 H HG1  . THR A 1 55 ? 7.156   -8.448  14.216  1.00 0.00 ? 55 THR A HG1  9  
ATOM 11775 H HG21 . THR A 1 55 ? 5.360   -6.106  12.195  1.00 0.00 ? 55 THR A HG21 9  
ATOM 11776 H HG22 . THR A 1 55 ? 6.716   -7.167  11.812  1.00 0.00 ? 55 THR A HG22 9  
ATOM 11777 H HG23 . THR A 1 55 ? 6.762   -6.167  13.264  1.00 0.00 ? 55 THR A HG23 9  
ATOM 11778 N N    . GLY A 1 56 ? 2.936   -5.537  14.663  1.00 0.00 ? 56 GLY A N    9  
ATOM 11779 C CA   . GLY A 1 56 ? 2.832   -4.317  15.444  1.00 0.00 ? 56 GLY A CA   9  
ATOM 11780 C C    . GLY A 1 56 ? 3.913   -3.307  15.107  1.00 0.00 ? 56 GLY A C    9  
ATOM 11781 O O    . GLY A 1 56 ? 4.165   -2.380  15.878  1.00 0.00 ? 56 GLY A O    9  
ATOM 11782 H H    . GLY A 1 56 ? 2.184   -5.826  14.105  1.00 0.00 ? 56 GLY A H    9  
ATOM 11783 H HA2  . GLY A 1 56 ? 1.868   -3.868  15.264  1.00 0.00 ? 56 GLY A HA2  9  
ATOM 11784 H HA3  . GLY A 1 56 ? 2.908   -4.569  16.490  1.00 0.00 ? 56 GLY A HA3  9  
ATOM 11785 N N    . LYS A 1 57 ? 4.554   -3.482  13.957  1.00 0.00 ? 57 LYS A N    9  
ATOM 11786 C CA   . LYS A 1 57 ? 5.610   -2.580  13.526  1.00 0.00 ? 57 LYS A CA   9  
ATOM 11787 C C    . LYS A 1 57 ? 5.027   -1.322  12.892  1.00 0.00 ? 57 LYS A C    9  
ATOM 11788 O O    . LYS A 1 57 ? 3.817   -1.101  12.927  1.00 0.00 ? 57 LYS A O    9  
ATOM 11789 C CB   . LYS A 1 57 ? 6.540   -3.284  12.540  1.00 0.00 ? 57 LYS A CB   9  
ATOM 11790 C CG   . LYS A 1 57 ? 7.967   -3.423  13.043  1.00 0.00 ? 57 LYS A CG   9  
ATOM 11791 C CD   . LYS A 1 57 ? 8.776   -4.371  12.172  1.00 0.00 ? 57 LYS A CD   9  
ATOM 11792 C CE   . LYS A 1 57 ? 9.704   -5.239  13.006  1.00 0.00 ? 57 LYS A CE   9  
ATOM 11793 N NZ   . LYS A 1 57 ? 10.981  -5.527  12.297  1.00 0.00 ? 57 LYS A NZ   9  
ATOM 11794 H H    . LYS A 1 57 ? 4.313   -4.234  13.386  1.00 0.00 ? 57 LYS A H    9  
ATOM 11795 H HA   . LYS A 1 57 ? 6.175   -2.304  14.394  1.00 0.00 ? 57 LYS A HA   9  
ATOM 11796 H HB2  . LYS A 1 57 ? 6.153   -4.270  12.344  1.00 0.00 ? 57 LYS A HB2  9  
ATOM 11797 H HB3  . LYS A 1 57 ? 6.560   -2.724  11.618  1.00 0.00 ? 57 LYS A HB3  9  
ATOM 11798 H HG2  . LYS A 1 57 ? 8.439   -2.452  13.034  1.00 0.00 ? 57 LYS A HG2  9  
ATOM 11799 H HG3  . LYS A 1 57 ? 7.946   -3.806  14.054  1.00 0.00 ? 57 LYS A HG3  9  
ATOM 11800 H HD2  . LYS A 1 57 ? 8.097   -5.010  11.626  1.00 0.00 ? 57 LYS A HD2  9  
ATOM 11801 H HD3  . LYS A 1 57 ? 9.366   -3.792  11.478  1.00 0.00 ? 57 LYS A HD3  9  
ATOM 11802 H HE2  . LYS A 1 57 ? 9.924   -4.725  13.930  1.00 0.00 ? 57 LYS A HE2  9  
ATOM 11803 H HE3  . LYS A 1 57 ? 9.205   -6.172  13.225  1.00 0.00 ? 57 LYS A HE3  9  
ATOM 11804 H HZ1  . LYS A 1 57 ? 11.719  -4.862  12.605  1.00 0.00 ? 57 LYS A HZ1  9  
ATOM 11805 H HZ2  . LYS A 1 57 ? 10.850  -5.431  11.270  1.00 0.00 ? 57 LYS A HZ2  9  
ATOM 11806 H HZ3  . LYS A 1 57 ? 11.295  -6.497  12.506  1.00 0.00 ? 57 LYS A HZ3  9  
ATOM 11807 N N    . THR A 1 58 ? 5.896   -0.500  12.311  1.00 0.00 ? 58 THR A N    9  
ATOM 11808 C CA   . THR A 1 58 ? 5.463   0.735   11.666  1.00 0.00 ? 58 THR A CA   9  
ATOM 11809 C C    . THR A 1 58 ? 4.432   0.445   10.579  1.00 0.00 ? 58 THR A C    9  
ATOM 11810 O O    . THR A 1 58 ? 4.209   -0.710  10.216  1.00 0.00 ? 58 THR A O    9  
ATOM 11811 C CB   . THR A 1 58 ? 6.664   1.474   11.069  1.00 0.00 ? 58 THR A CB   9  
ATOM 11812 O OG1  . THR A 1 58 ? 6.288   2.767   10.629  1.00 0.00 ? 58 THR A OG1  9  
ATOM 11813 C CG2  . THR A 1 58 ? 7.292   0.755   9.895   1.00 0.00 ? 58 THR A CG2  9  
ATOM 11814 H H    . THR A 1 58 ? 6.848   -0.730  12.313  1.00 0.00 ? 58 THR A H    9  
ATOM 11815 H HA   . THR A 1 58 ? 5.007   1.359   12.420  1.00 0.00 ? 58 THR A HA   9  
ATOM 11816 H HB   . THR A 1 58 ? 7.421   1.584   11.833  1.00 0.00 ? 58 THR A HB   9  
ATOM 11817 H HG1  . THR A 1 58 ? 6.524   3.414   11.297  1.00 0.00 ? 58 THR A HG1  9  
ATOM 11818 H HG21 . THR A 1 58 ? 6.549   0.605   9.126   1.00 0.00 ? 58 THR A HG21 9  
ATOM 11819 H HG22 . THR A 1 58 ? 7.673   -0.202  10.220  1.00 0.00 ? 58 THR A HG22 9  
ATOM 11820 H HG23 . THR A 1 58 ? 8.102   1.350   9.500   1.00 0.00 ? 58 THR A HG23 9  
ATOM 11821 N N    . ARG A 1 59 ? 3.815   1.498   10.056  1.00 0.00 ? 59 ARG A N    9  
ATOM 11822 C CA   . ARG A 1 59 ? 2.825   1.357   9.008   1.00 0.00 ? 59 ARG A CA   9  
ATOM 11823 C C    . ARG A 1 59 ? 2.730   2.641   8.198   1.00 0.00 ? 59 ARG A C    9  
ATOM 11824 O O    . ARG A 1 59 ? 1.715   3.337   8.223   1.00 0.00 ? 59 ARG A O    9  
ATOM 11825 C CB   . ARG A 1 59 ? 1.460   1.003   9.604   1.00 0.00 ? 59 ARG A CB   9  
ATOM 11826 C CG   . ARG A 1 59 ? 0.970   2.004   10.637  1.00 0.00 ? 59 ARG A CG   9  
ATOM 11827 C CD   . ARG A 1 59 ? -0.546  2.114   10.631  1.00 0.00 ? 59 ARG A CD   9  
ATOM 11828 N NE   . ARG A 1 59 ? -1.072  2.502   11.938  1.00 0.00 ? 59 ARG A NE   9  
ATOM 11829 C CZ   . ARG A 1 59 ? -2.292  2.998   12.128  1.00 0.00 ? 59 ARG A CZ   9  
ATOM 11830 N NH1  . ARG A 1 59 ? -3.115  3.169   11.100  1.00 0.00 ? 59 ARG A NH1  9  
ATOM 11831 N NH2  . ARG A 1 59 ? -2.692  3.324   13.349  1.00 0.00 ? 59 ARG A NH2  9  
ATOM 11832 H H    . ARG A 1 59 ? 4.044   2.392   10.368  1.00 0.00 ? 59 ARG A H    9  
ATOM 11833 H HA   . ARG A 1 59 ? 3.146   0.559   8.361   1.00 0.00 ? 59 ARG A HA   9  
ATOM 11834 H HB2  . ARG A 1 59 ? 0.734   0.956   8.806   1.00 0.00 ? 59 ARG A HB2  9  
ATOM 11835 H HB3  . ARG A 1 59 ? 1.527   0.034   10.076  1.00 0.00 ? 59 ARG A HB3  9  
ATOM 11836 H HG2  . ARG A 1 59 ? 1.294   1.684   11.616  1.00 0.00 ? 59 ARG A HG2  9  
ATOM 11837 H HG3  . ARG A 1 59 ? 1.394   2.973   10.415  1.00 0.00 ? 59 ARG A HG3  9  
ATOM 11838 H HD2  . ARG A 1 59 ? -0.837  2.856   9.902   1.00 0.00 ? 59 ARG A HD2  9  
ATOM 11839 H HD3  . ARG A 1 59 ? -0.962  1.156   10.355  1.00 0.00 ? 59 ARG A HD3  9  
ATOM 11840 H HE   . ARG A 1 59 ? -0.486  2.386   12.714  1.00 0.00 ? 59 ARG A HE   9  
ATOM 11841 H HH11 . ARG A 1 59 ? -2.820  2.925   10.176  1.00 0.00 ? 59 ARG A HH11 9  
ATOM 11842 H HH12 . ARG A 1 59 ? -4.030  3.543   11.250  1.00 0.00 ? 59 ARG A HH12 9  
ATOM 11843 H HH21 . ARG A 1 59 ? -2.077  3.197   14.127  1.00 0.00 ? 59 ARG A HH21 9  
ATOM 11844 H HH22 . ARG A 1 59 ? -3.609  3.697   13.493  1.00 0.00 ? 59 ARG A HH22 9  
ATOM 11845 N N    . THR A 1 60 ? 3.800   2.942   7.478   1.00 0.00 ? 60