data_2I3B
# 
_entry.id   2I3B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2I3B         
RCSB  RCSB039083   
WWPDB D_1000039083 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          7119 
_pdbx_database_related.details        'assignments and constraint data for HCR-NTPase' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2I3B 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-17 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Placzek, W.J.' 1 
'Almeida, M.S.' 2 
'Wuthrich, K.'  3 
# 
_citation.id                        primary 
_citation.title                     
'NMR Structure and Functional Characterization of a Human Cancer-related Nucleoside Triphosphatase.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            367 
_citation.page_first                788 
_citation.page_last                 801 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17291528 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.01.001 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Placzek, W.J.' 1 
primary 'Almeida, M.S.' 2 
primary 'Wuthrich, K.'  3 
# 
_cell.entry_id           2I3B 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2I3B 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Human Cancer-Related NTPase' 
_entity.formula_weight             20610.869 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.6.1.15 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HCR-NTPase 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQY
VVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNR
KDVKVFNVTKENRNHLLPDIVTCVQSSRK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQY
VVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNR
KDVKVFNVTKENRNHLLPDIVTCVQSSRK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   HIS n 
1 4   VAL n 
1 5   PHE n 
1 6   LEU n 
1 7   THR n 
1 8   GLY n 
1 9   PRO n 
1 10  PRO n 
1 11  GLY n 
1 12  VAL n 
1 13  GLY n 
1 14  LYS n 
1 15  THR n 
1 16  THR n 
1 17  LEU n 
1 18  ILE n 
1 19  HIS n 
1 20  LYS n 
1 21  ALA n 
1 22  SER n 
1 23  GLU n 
1 24  VAL n 
1 25  LEU n 
1 26  LYS n 
1 27  SER n 
1 28  SER n 
1 29  GLY n 
1 30  VAL n 
1 31  PRO n 
1 32  VAL n 
1 33  ASP n 
1 34  GLY n 
1 35  PHE n 
1 36  TYR n 
1 37  THR n 
1 38  GLU n 
1 39  GLU n 
1 40  VAL n 
1 41  ARG n 
1 42  GLN n 
1 43  GLY n 
1 44  GLY n 
1 45  ARG n 
1 46  ARG n 
1 47  ILE n 
1 48  GLY n 
1 49  PHE n 
1 50  ASP n 
1 51  VAL n 
1 52  VAL n 
1 53  THR n 
1 54  LEU n 
1 55  SER n 
1 56  GLY n 
1 57  THR n 
1 58  ARG n 
1 59  GLY n 
1 60  PRO n 
1 61  LEU n 
1 62  SER n 
1 63  ARG n 
1 64  VAL n 
1 65  GLY n 
1 66  LEU n 
1 67  GLU n 
1 68  PRO n 
1 69  PRO n 
1 70  PRO n 
1 71  GLY n 
1 72  LYS n 
1 73  ARG n 
1 74  GLU n 
1 75  CYS n 
1 76  ARG n 
1 77  VAL n 
1 78  GLY n 
1 79  GLN n 
1 80  TYR n 
1 81  VAL n 
1 82  VAL n 
1 83  ASP n 
1 84  LEU n 
1 85  THR n 
1 86  SER n 
1 87  PHE n 
1 88  GLU n 
1 89  GLN n 
1 90  LEU n 
1 91  ALA n 
1 92  LEU n 
1 93  PRO n 
1 94  VAL n 
1 95  LEU n 
1 96  ARG n 
1 97  ASN n 
1 98  ALA n 
1 99  ASP n 
1 100 CYS n 
1 101 SER n 
1 102 SER n 
1 103 GLY n 
1 104 PRO n 
1 105 GLY n 
1 106 GLN n 
1 107 ARG n 
1 108 VAL n 
1 109 CYS n 
1 110 VAL n 
1 111 ILE n 
1 112 ASP n 
1 113 GLU n 
1 114 ILE n 
1 115 GLY n 
1 116 LYS n 
1 117 MET n 
1 118 GLU n 
1 119 LEU n 
1 120 PHE n 
1 121 SER n 
1 122 GLN n 
1 123 LEU n 
1 124 PHE n 
1 125 ILE n 
1 126 GLN n 
1 127 ALA n 
1 128 VAL n 
1 129 ARG n 
1 130 GLN n 
1 131 THR n 
1 132 LEU n 
1 133 SER n 
1 134 THR n 
1 135 PRO n 
1 136 GLY n 
1 137 THR n 
1 138 ILE n 
1 139 ILE n 
1 140 LEU n 
1 141 GLY n 
1 142 THR n 
1 143 ILE n 
1 144 PRO n 
1 145 VAL n 
1 146 PRO n 
1 147 LYS n 
1 148 GLY n 
1 149 LYS n 
1 150 PRO n 
1 151 LEU n 
1 152 ALA n 
1 153 LEU n 
1 154 VAL n 
1 155 GLU n 
1 156 GLU n 
1 157 ILE n 
1 158 ARG n 
1 159 ASN n 
1 160 ARG n 
1 161 LYS n 
1 162 ASP n 
1 163 VAL n 
1 164 LYS n 
1 165 VAL n 
1 166 PHE n 
1 167 ASN n 
1 168 VAL n 
1 169 THR n 
1 170 LYS n 
1 171 GLU n 
1 172 ASN n 
1 173 ARG n 
1 174 ASN n 
1 175 HIS n 
1 176 LEU n 
1 177 LEU n 
1 178 PRO n 
1 179 ASP n 
1 180 ILE n 
1 181 VAL n 
1 182 THR n 
1 183 CYS n 
1 184 VAL n 
1 185 GLN n 
1 186 SER n 
1 187 SER n 
1 188 ARG n 
1 189 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CDRT1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21d 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q5TDE9_HUMAN 
_struct_ref.pdbx_db_accession          Q5TDE9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQY
VVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNR
KDVKVFNVTKENRNHLLPDIVTCVQSSRK
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2I3B 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 189 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q5TDE9 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  190 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       189 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY          
2 1 1 3D_13C-resolved_aliphatic_NOESY 
3 1 1 3D_13C-resolved_aromatic_NOESY  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.4 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '25mM MES, 10mM MgCl2' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'2 mM HCR-NTPase U-15N,13C; 25 mM MES buffer pH 6.4; 10 mM MgCl2; 5 mM DTT; 2 mM ATPgS; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker Avance 600 
2 ? Bruker Avance 800 
# 
_pdbx_nmr_refine.entry_id           2I3B 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2I3B 
_pdbx_nmr_ensemble.conformers_calculated_total_number            80 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2I3B 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
ATNOS/CANDID 'version 1.0'   'data analysis'      'Herrmann, T.' 1 
CYANA        'version 1.0.3' 'structure solution' 'Guntert, P.'  2 
CYANA        ?               refinement           'Guntert, P.'  3 
# 
_exptl.entry_id          2I3B 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2I3B 
_struct.title                     'Solution Structure of a Human Cancer-Related Nucleoside Triphosphatase' 
_struct.pdbx_descriptor           'Human Cancer-Related NTPase (HCR-NTPase)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2I3B 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'NTPase, AAA, Rossmann, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 13  ? SER A 28  ? GLY A 13  SER A 28  1 ? 16 
HELX_P HELX_P2 2 ASP A 83  ? GLN A 89  ? ASP A 83  GLN A 89  1 ? 7  
HELX_P HELX_P3 3 GLN A 122 ? THR A 134 ? GLN A 122 THR A 134 1 ? 13 
HELX_P HELX_P4 4 LEU A 153 ? ASN A 159 ? LEU A 153 ASN A 159 1 ? 7  
HELX_P HELX_P5 5 ASN A 172 ? ASN A 174 ? ASN A 172 ASN A 174 5 ? 3  
HELX_P HELX_P6 6 HIS A 175 ? GLN A 185 ? HIS A 175 GLN A 185 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 39  ? ARG A 41  ? GLU A 39  ARG A 41  
A 2 ARG A 46  ? THR A 53  ? ARG A 46  THR A 53  
A 3 ARG A 58  ? ARG A 63  ? ARG A 58  ARG A 63  
A 4 VAL A 81  ? VAL A 82  ? VAL A 81  VAL A 82  
A 5 CYS A 75  ? ARG A 76  ? CYS A 75  ARG A 76  
B 1 GLU A 39  ? ARG A 41  ? GLU A 39  ARG A 41  
B 2 ARG A 46  ? THR A 53  ? ARG A 46  THR A 53  
B 3 ASP A 33  ? TYR A 36  ? ASP A 33  TYR A 36  
B 4 CYS A 109 ? ILE A 111 ? CYS A 109 ILE A 111 
B 5 ILE A 139 ? THR A 142 ? ILE A 139 THR A 142 
B 6 VAL A 4   ? THR A 7   ? VAL A 4   THR A 7   
B 7 LYS A 164 ? ASN A 167 ? LYS A 164 ASN A 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 40  ? N VAL A 40  O ILE A 47  ? O ILE A 47  
A 2 3 N VAL A 51  ? N VAL A 51  O GLY A 59  ? O GLY A 59  
A 3 4 N ARG A 63  ? N ARG A 63  O VAL A 81  ? O VAL A 81  
A 4 5 O VAL A 82  ? O VAL A 82  N CYS A 75  ? N CYS A 75  
B 1 2 N VAL A 40  ? N VAL A 40  O ILE A 47  ? O ILE A 47  
B 2 3 O VAL A 52  ? O VAL A 52  N TYR A 36  ? N TYR A 36  
B 3 4 N ASP A 33  ? N ASP A 33  O VAL A 110 ? O VAL A 110 
B 4 5 N ILE A 111 ? N ILE A 111 O LEU A 140 ? O LEU A 140 
B 5 6 O GLY A 141 ? O GLY A 141 N LEU A 6   ? N LEU A 6   
B 6 7 N PHE A 5   ? N PHE A 5   O LYS A 164 ? O LYS A 164 
# 
_atom_sites.entry_id                    2I3B 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1   ? -19.906 -3.375  -4.244  1.00 0.00 ? 1   ALA A N    1  
ATOM 2     C CA   . ALA A 1 1   ? -19.065 -2.281  -4.763  1.00 0.00 ? 1   ALA A CA   1  
ATOM 3     C C    . ALA A 1 1   ? -17.733 -2.860  -5.253  1.00 0.00 ? 1   ALA A C    1  
ATOM 4     O O    . ALA A 1 1   ? -17.686 -4.036  -5.620  1.00 0.00 ? 1   ALA A O    1  
ATOM 5     C CB   . ALA A 1 1   ? -18.935 -1.142  -3.745  1.00 0.00 ? 1   ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1   ? -20.050 -4.135  -4.877  1.00 0.00 ? 1   ALA A H1   1  
ATOM 7     H HA   . ALA A 1 1   ? -19.575 -1.881  -5.640  1.00 0.00 ? 1   ALA A HA   1  
ATOM 8     H HB1  . ALA A 1 1   ? -18.305 -0.344  -4.137  1.00 0.00 ? 1   ALA A HB1  1  
ATOM 9     H HB2  . ALA A 1 1   ? -19.921 -0.727  -3.551  1.00 0.00 ? 1   ALA A HB2  1  
ATOM 10    H HB3  . ALA A 1 1   ? -18.513 -1.518  -2.817  1.00 0.00 ? 1   ALA A HB3  1  
ATOM 11    N N    . ARG A 1 2   ? -16.659 -2.063  -5.336  1.00 0.00 ? 2   ARG A N    1  
ATOM 12    C CA   . ARG A 1 2   ? -15.392 -2.502  -5.918  1.00 0.00 ? 2   ARG A CA   1  
ATOM 13    C C    . ARG A 1 2   ? -14.219 -1.855  -5.194  1.00 0.00 ? 2   ARG A C    1  
ATOM 14    O O    . ARG A 1 2   ? -14.397 -0.964  -4.371  1.00 0.00 ? 2   ARG A O    1  
ATOM 15    C CB   . ARG A 1 2   ? -15.351 -2.160  -7.423  1.00 0.00 ? 2   ARG A CB   1  
ATOM 16    C CG   . ARG A 1 2   ? -14.704 -3.264  -8.268  1.00 0.00 ? 2   ARG A CG   1  
ATOM 17    C CD   . ARG A 1 2   ? -15.697 -4.363  -8.664  1.00 0.00 ? 2   ARG A CD   1  
ATOM 18    N NE   . ARG A 1 2   ? -16.635 -3.946  -9.726  1.00 0.00 ? 2   ARG A NE   1  
ATOM 19    C CZ   . ARG A 1 2   ? -17.766 -4.586  -10.050 1.00 0.00 ? 2   ARG A CZ   1  
ATOM 20    N NH1  . ARG A 1 2   ? -18.299 -5.461  -9.199  1.00 0.00 ? 2   ARG A NH1  1  
ATOM 21    N NH2  . ARG A 1 2   ? -18.345 -4.359  -11.226 1.00 0.00 ? 2   ARG A NH2  1  
ATOM 22    H H    . ARG A 1 2   ? -16.651 -1.146  -4.901  1.00 0.00 ? 2   ARG A H    1  
ATOM 23    H HA   . ARG A 1 2   ? -15.319 -3.583  -5.780  1.00 0.00 ? 2   ARG A HA   1  
ATOM 24    H HB2  . ARG A 1 2   ? -16.358 -1.977  -7.799  1.00 0.00 ? 2   ARG A HB2  1  
ATOM 25    H HB3  . ARG A 1 2   ? -14.771 -1.246  -7.564  1.00 0.00 ? 2   ARG A HB3  1  
ATOM 26    H HG2  . ARG A 1 2   ? -14.282 -2.813  -9.160  1.00 0.00 ? 2   ARG A HG2  1  
ATOM 27    H HG3  . ARG A 1 2   ? -13.877 -3.714  -7.722  1.00 0.00 ? 2   ARG A HG3  1  
ATOM 28    H HD2  . ARG A 1 2   ? -15.128 -5.213  -9.041  1.00 0.00 ? 2   ARG A HD2  1  
ATOM 29    H HD3  . ARG A 1 2   ? -16.244 -4.678  -7.775  1.00 0.00 ? 2   ARG A HD3  1  
ATOM 30    H HE   . ARG A 1 2   ? -16.372 -3.119  -10.261 1.00 0.00 ? 2   ARG A HE   1  
ATOM 31    H HH11 . ARG A 1 2   ? -17.883 -5.580  -8.286  1.00 0.00 ? 2   ARG A HH11 1  
ATOM 32    H HH12 . ARG A 1 2   ? -19.228 -5.864  -9.307  1.00 0.00 ? 2   ARG A HH12 1  
ATOM 33    H HH21 . ARG A 1 2   ? -17.913 -3.778  -11.945 1.00 0.00 ? 2   ARG A HH21 1  
ATOM 34    H HH22 . ARG A 1 2   ? -19.102 -4.942  -11.583 1.00 0.00 ? 2   ARG A HH22 1  
ATOM 35    N N    . HIS A 1 3   ? -13.023 -2.307  -5.554  1.00 0.00 ? 3   HIS A N    1  
ATOM 36    C CA   . HIS A 1 3   ? -11.735 -1.805  -5.104  1.00 0.00 ? 3   HIS A CA   1  
ATOM 37    C C    . HIS A 1 3   ? -11.560 -0.323  -5.431  1.00 0.00 ? 3   HIS A C    1  
ATOM 38    O O    . HIS A 1 3   ? -12.118 0.170   -6.414  1.00 0.00 ? 3   HIS A O    1  
ATOM 39    C CB   . HIS A 1 3   ? -10.644 -2.642  -5.764  1.00 0.00 ? 3   HIS A CB   1  
ATOM 40    C CG   . HIS A 1 3   ? -10.914 -4.128  -5.714  1.00 0.00 ? 3   HIS A CG   1  
ATOM 41    N ND1  . HIS A 1 3   ? -11.334 -4.835  -4.607  1.00 0.00 ? 3   HIS A ND1  1  
ATOM 42    C CD2  . HIS A 1 3   ? -11.006 -4.961  -6.797  1.00 0.00 ? 3   HIS A CD2  1  
ATOM 43    C CE1  . HIS A 1 3   ? -11.623 -6.085  -5.005  1.00 0.00 ? 3   HIS A CE1  1  
ATOM 44    N NE2  . HIS A 1 3   ? -11.463 -6.198  -6.337  1.00 0.00 ? 3   HIS A NE2  1  
ATOM 45    H H    . HIS A 1 3   ? -13.004 -3.056  -6.224  1.00 0.00 ? 3   HIS A H    1  
ATOM 46    H HA   . HIS A 1 3   ? -11.641 -1.946  -4.042  1.00 0.00 ? 3   HIS A HA   1  
ATOM 47    H HB2  . HIS A 1 3   ? -10.591 -2.335  -6.796  1.00 0.00 ? 3   HIS A HB2  1  
ATOM 48    H HB3  . HIS A 1 3   ? -9.685  -2.410  -5.304  1.00 0.00 ? 3   HIS A HB3  1  
ATOM 49    H HD1  . HIS A 1 3   ? -11.560 -4.449  -3.703  1.00 0.00 ? 3   HIS A HD1  1  
ATOM 50    H HD2  . HIS A 1 3   ? -10.851 -4.683  -7.831  1.00 0.00 ? 3   HIS A HD2  1  
ATOM 51    H HE1  . HIS A 1 3   ? -12.032 -6.858  -4.362  1.00 0.00 ? 3   HIS A HE1  1  
ATOM 52    N N    . VAL A 1 4   ? -10.695 0.353   -4.679  1.00 0.00 ? 4   VAL A N    1  
ATOM 53    C CA   . VAL A 1 4   ? -10.433 1.777   -4.805  1.00 0.00 ? 4   VAL A CA   1  
ATOM 54    C C    . VAL A 1 4   ? -8.926  1.980   -4.703  1.00 0.00 ? 4   VAL A C    1  
ATOM 55    O O    . VAL A 1 4   ? -8.292  1.497   -3.760  1.00 0.00 ? 4   VAL A O    1  
ATOM 56    C CB   . VAL A 1 4   ? -11.171 2.555   -3.693  1.00 0.00 ? 4   VAL A CB   1  
ATOM 57    C CG1  . VAL A 1 4   ? -10.975 4.062   -3.867  1.00 0.00 ? 4   VAL A CG1  1  
ATOM 58    C CG2  . VAL A 1 4   ? -12.683 2.271   -3.640  1.00 0.00 ? 4   VAL A CG2  1  
ATOM 59    H H    . VAL A 1 4   ? -10.231 -0.111  -3.905  1.00 0.00 ? 4   VAL A H    1  
ATOM 60    H HA   . VAL A 1 4   ? -10.777 2.127   -5.778  1.00 0.00 ? 4   VAL A HA   1  
ATOM 61    H HB   . VAL A 1 4   ? -10.734 2.285   -2.731  1.00 0.00 ? 4   VAL A HB   1  
ATOM 62    H HG11 . VAL A 1 4   ? -11.476 4.585   -3.056  1.00 0.00 ? 4   VAL A HG11 1  
ATOM 63    H HG12 . VAL A 1 4   ? -9.918  4.323   -3.822  1.00 0.00 ? 4   VAL A HG12 1  
ATOM 64    H HG13 . VAL A 1 4   ? -11.375 4.402   -4.820  1.00 0.00 ? 4   VAL A HG13 1  
ATOM 65    H HG21 . VAL A 1 4   ? -13.161 2.526   -4.584  1.00 0.00 ? 4   VAL A HG21 1  
ATOM 66    H HG22 . VAL A 1 4   ? -12.871 1.220   -3.426  1.00 0.00 ? 4   VAL A HG22 1  
ATOM 67    H HG23 . VAL A 1 4   ? -13.133 2.847   -2.832  1.00 0.00 ? 4   VAL A HG23 1  
ATOM 68    N N    . PHE A 1 5   ? -8.354  2.727   -5.641  1.00 0.00 ? 5   PHE A N    1  
ATOM 69    C CA   . PHE A 1 5   ? -6.957  3.124   -5.606  1.00 0.00 ? 5   PHE A CA   1  
ATOM 70    C C    . PHE A 1 5   ? -6.806  4.637   -5.712  1.00 0.00 ? 5   PHE A C    1  
ATOM 71    O O    . PHE A 1 5   ? -7.488  5.294   -6.497  1.00 0.00 ? 5   PHE A O    1  
ATOM 72    C CB   . PHE A 1 5   ? -6.197  2.407   -6.718  1.00 0.00 ? 5   PHE A CB   1  
ATOM 73    C CG   . PHE A 1 5   ? -5.816  0.993   -6.339  1.00 0.00 ? 5   PHE A CG   1  
ATOM 74    C CD1  . PHE A 1 5   ? -6.728  -0.065  -6.513  1.00 0.00 ? 5   PHE A CD1  1  
ATOM 75    C CD2  . PHE A 1 5   ? -4.560  0.745   -5.757  1.00 0.00 ? 5   PHE A CD2  1  
ATOM 76    C CE1  . PHE A 1 5   ? -6.357  -1.376  -6.170  1.00 0.00 ? 5   PHE A CE1  1  
ATOM 77    C CE2  . PHE A 1 5   ? -4.182  -0.568  -5.439  1.00 0.00 ? 5   PHE A CE2  1  
ATOM 78    C CZ   . PHE A 1 5   ? -5.063  -1.632  -5.687  1.00 0.00 ? 5   PHE A CZ   1  
ATOM 79    H H    . PHE A 1 5   ? -8.912  3.049   -6.429  1.00 0.00 ? 5   PHE A H    1  
ATOM 80    H HA   . PHE A 1 5   ? -6.521  2.813   -4.659  1.00 0.00 ? 5   PHE A HA   1  
ATOM 81    H HB2  . PHE A 1 5   ? -6.788  2.403   -7.637  1.00 0.00 ? 5   PHE A HB2  1  
ATOM 82    H HB3  . PHE A 1 5   ? -5.289  2.970   -6.921  1.00 0.00 ? 5   PHE A HB3  1  
ATOM 83    H HD1  . PHE A 1 5   ? -7.713  0.133   -6.901  1.00 0.00 ? 5   PHE A HD1  1  
ATOM 84    H HD2  . PHE A 1 5   ? -3.881  1.560   -5.558  1.00 0.00 ? 5   PHE A HD2  1  
ATOM 85    H HE1  . PHE A 1 5   ? -7.047  -2.201  -6.287  1.00 0.00 ? 5   PHE A HE1  1  
ATOM 86    H HE2  . PHE A 1 5   ? -3.219  -0.761  -4.994  1.00 0.00 ? 5   PHE A HE2  1  
ATOM 87    H HZ   . PHE A 1 5   ? -4.754  -2.653  -5.502  1.00 0.00 ? 5   PHE A HZ   1  
ATOM 88    N N    . LEU A 1 6   ? -5.874  5.179   -4.936  1.00 0.00 ? 6   LEU A N    1  
ATOM 89    C CA   . LEU A 1 6   ? -5.373  6.539   -5.048  1.00 0.00 ? 6   LEU A CA   1  
ATOM 90    C C    . LEU A 1 6   ? -4.424  6.593   -6.231  1.00 0.00 ? 6   LEU A C    1  
ATOM 91    O O    . LEU A 1 6   ? -3.744  5.609   -6.523  1.00 0.00 ? 6   LEU A O    1  
ATOM 92    C CB   . LEU A 1 6   ? -4.564  6.897   -3.792  1.00 0.00 ? 6   LEU A CB   1  
ATOM 93    C CG   . LEU A 1 6   ? -5.360  7.366   -2.578  1.00 0.00 ? 6   LEU A CG   1  
ATOM 94    C CD1  . LEU A 1 6   ? -6.599  6.524   -2.298  1.00 0.00 ? 6   LEU A CD1  1  
ATOM 95    C CD2  . LEU A 1 6   ? -4.428  7.333   -1.365  1.00 0.00 ? 6   LEU A CD2  1  
ATOM 96    H H    . LEU A 1 6   ? -5.363  4.553   -4.323  1.00 0.00 ? 6   LEU A H    1  
ATOM 97    H HA   . LEU A 1 6   ? -6.197  7.238   -5.189  1.00 0.00 ? 6   LEU A HA   1  
ATOM 98    H HB2  . LEU A 1 6   ? -3.988  6.029   -3.502  1.00 0.00 ? 6   LEU A HB2  1  
ATOM 99    H HB3  . LEU A 1 6   ? -3.861  7.694   -4.035  1.00 0.00 ? 6   LEU A HB3  1  
ATOM 100   H HG   . LEU A 1 6   ? -5.662  8.389   -2.764  1.00 0.00 ? 6   LEU A HG   1  
ATOM 101   H HD11 . LEU A 1 6   ? -7.015  6.780   -1.331  1.00 0.00 ? 6   LEU A HD11 1  
ATOM 102   H HD12 . LEU A 1 6   ? -7.356  6.688   -3.066  1.00 0.00 ? 6   LEU A HD12 1  
ATOM 103   H HD13 . LEU A 1 6   ? -6.324  5.472   -2.286  1.00 0.00 ? 6   LEU A HD13 1  
ATOM 104   H HD21 . LEU A 1 6   ? -4.180  6.301   -1.119  1.00 0.00 ? 6   LEU A HD21 1  
ATOM 105   H HD22 . LEU A 1 6   ? -3.503  7.853   -1.591  1.00 0.00 ? 6   LEU A HD22 1  
ATOM 106   H HD23 . LEU A 1 6   ? -4.908  7.789   -0.502  1.00 0.00 ? 6   LEU A HD23 1  
ATOM 107   N N    . THR A 1 7   ? -4.264  7.778   -6.807  1.00 0.00 ? 7   THR A N    1  
ATOM 108   C CA   . THR A 1 7   ? -3.246  8.070   -7.796  1.00 0.00 ? 7   THR A CA   1  
ATOM 109   C C    . THR A 1 7   ? -2.925  9.568   -7.684  1.00 0.00 ? 7   THR A C    1  
ATOM 110   O O    . THR A 1 7   ? -3.563  10.296  -6.916  1.00 0.00 ? 7   THR A O    1  
ATOM 111   C CB   . THR A 1 7   ? -3.731  7.572   -9.173  1.00 0.00 ? 7   THR A CB   1  
ATOM 112   O OG1  . THR A 1 7   ? -2.661  7.411   -10.073 1.00 0.00 ? 7   THR A OG1  1  
ATOM 113   C CG2  . THR A 1 7   ? -4.751  8.491   -9.849  1.00 0.00 ? 7   THR A CG2  1  
ATOM 114   H H    . THR A 1 7   ? -4.779  8.592   -6.462  1.00 0.00 ? 7   THR A H    1  
ATOM 115   H HA   . THR A 1 7   ? -2.352  7.508   -7.543  1.00 0.00 ? 7   THR A HA   1  
ATOM 116   H HB   . THR A 1 7   ? -4.189  6.590   -9.044  1.00 0.00 ? 7   THR A HB   1  
ATOM 117   H HG1  . THR A 1 7   ? -2.113  6.656   -9.793  1.00 0.00 ? 7   THR A HG1  1  
ATOM 118   H HG21 . THR A 1 7   ? -4.335  9.487   -10.001 1.00 0.00 ? 7   THR A HG21 1  
ATOM 119   H HG22 . THR A 1 7   ? -5.010  8.082   -10.824 1.00 0.00 ? 7   THR A HG22 1  
ATOM 120   H HG23 . THR A 1 7   ? -5.646  8.554   -9.233  1.00 0.00 ? 7   THR A HG23 1  
ATOM 121   N N    . GLY A 1 8   ? -1.947  10.044  -8.448  1.00 0.00 ? 8   GLY A N    1  
ATOM 122   C CA   . GLY A 1 8   ? -1.536  11.439  -8.491  1.00 0.00 ? 8   GLY A CA   1  
ATOM 123   C C    . GLY A 1 8   ? -0.015  11.537  -8.471  1.00 0.00 ? 8   GLY A C    1  
ATOM 124   O O    . GLY A 1 8   ? 0.655   10.549  -8.779  1.00 0.00 ? 8   GLY A O    1  
ATOM 125   H H    . GLY A 1 8   ? -1.413  9.404   -9.021  1.00 0.00 ? 8   GLY A H    1  
ATOM 126   H HA2  . GLY A 1 8   ? -1.923  11.899  -9.399  1.00 0.00 ? 8   GLY A HA2  1  
ATOM 127   H HA3  . GLY A 1 8   ? -1.929  11.973  -7.635  1.00 0.00 ? 8   GLY A HA3  1  
ATOM 128   N N    . PRO A 1 9   ? 0.541   12.719  -8.168  1.00 0.00 ? 9   PRO A N    1  
ATOM 129   C CA   . PRO A 1 9   ? 1.957   12.868  -7.884  1.00 0.00 ? 9   PRO A CA   1  
ATOM 130   C C    . PRO A 1 9   ? 2.253   12.480  -6.425  1.00 0.00 ? 9   PRO A C    1  
ATOM 131   O O    . PRO A 1 9   ? 1.430   12.748  -5.534  1.00 0.00 ? 9   PRO A O    1  
ATOM 132   C CB   . PRO A 1 9   ? 2.236   14.354  -8.125  1.00 0.00 ? 9   PRO A CB   1  
ATOM 133   C CG   . PRO A 1 9   ? 0.929   15.019  -7.693  1.00 0.00 ? 9   PRO A CG   1  
ATOM 134   C CD   . PRO A 1 9   ? -0.146  13.999  -8.065  1.00 0.00 ? 9   PRO A CD   1  
ATOM 135   H HA   . PRO A 1 9   ? 2.535   12.256  -8.571  1.00 0.00 ? 9   PRO A HA   1  
ATOM 136   H HB2  . PRO A 1 9   ? 3.088   14.713  -7.547  1.00 0.00 ? 9   PRO A HB2  1  
ATOM 137   H HB3  . PRO A 1 9   ? 2.402   14.532  -9.188  1.00 0.00 ? 9   PRO A HB3  1  
ATOM 138   H HG2  . PRO A 1 9   ? 0.943   15.167  -6.613  1.00 0.00 ? 9   PRO A HG2  1  
ATOM 139   H HG3  . PRO A 1 9   ? 0.762   15.966  -8.203  1.00 0.00 ? 9   PRO A HG3  1  
ATOM 140   H HD2  . PRO A 1 9   ? -0.918  13.977  -7.295  1.00 0.00 ? 9   PRO A HD2  1  
ATOM 141   H HD3  . PRO A 1 9   ? -0.582  14.260  -9.029  1.00 0.00 ? 9   PRO A HD3  1  
ATOM 142   N N    . PRO A 1 10  ? 3.428   11.904  -6.117  1.00 0.00 ? 10  PRO A N    1  
ATOM 143   C CA   . PRO A 1 10  ? 3.887   11.792  -4.743  1.00 0.00 ? 10  PRO A CA   1  
ATOM 144   C C    . PRO A 1 10  ? 4.154   13.188  -4.181  1.00 0.00 ? 10  PRO A C    1  
ATOM 145   O O    . PRO A 1 10  ? 4.414   14.150  -4.910  1.00 0.00 ? 10  PRO A O    1  
ATOM 146   C CB   . PRO A 1 10  ? 5.130   10.903  -4.786  1.00 0.00 ? 10  PRO A CB   1  
ATOM 147   C CG   . PRO A 1 10  ? 5.687   11.131  -6.188  1.00 0.00 ? 10  PRO A CG   1  
ATOM 148   C CD   . PRO A 1 10  ? 4.451   11.432  -7.036  1.00 0.00 ? 10  PRO A CD   1  
ATOM 149   H HA   . PRO A 1 10  ? 3.136   11.318  -4.117  1.00 0.00 ? 10  PRO A HA   1  
ATOM 150   H HB2  . PRO A 1 10  ? 5.852   11.168  -4.013  1.00 0.00 ? 10  PRO A HB2  1  
ATOM 151   H HB3  . PRO A 1 10  ? 4.828   9.860   -4.681  1.00 0.00 ? 10  PRO A HB3  1  
ATOM 152   H HG2  . PRO A 1 10  ? 6.344   12.001  -6.189  1.00 0.00 ? 10  PRO A HG2  1  
ATOM 153   H HG3  . PRO A 1 10  ? 6.217   10.248  -6.546  1.00 0.00 ? 10  PRO A HG3  1  
ATOM 154   H HD2  . PRO A 1 10  ? 4.696   12.194  -7.772  1.00 0.00 ? 10  PRO A HD2  1  
ATOM 155   H HD3  . PRO A 1 10  ? 4.105   10.521  -7.526  1.00 0.00 ? 10  PRO A HD3  1  
ATOM 156   N N    . GLY A 1 11  ? 4.045   13.303  -2.863  1.00 0.00 ? 11  GLY A N    1  
ATOM 157   C CA   . GLY A 1 11  ? 4.253   14.544  -2.145  1.00 0.00 ? 11  GLY A CA   1  
ATOM 158   C C    . GLY A 1 11  ? 3.732   14.484  -0.714  1.00 0.00 ? 11  GLY A C    1  
ATOM 159   O O    . GLY A 1 11  ? 3.787   15.494  -0.016  1.00 0.00 ? 11  GLY A O    1  
ATOM 160   H H    . GLY A 1 11  ? 3.850   12.468  -2.316  1.00 0.00 ? 11  GLY A H    1  
ATOM 161   H HA2  . GLY A 1 11  ? 5.326   14.716  -2.113  1.00 0.00 ? 11  GLY A HA2  1  
ATOM 162   H HA3  . GLY A 1 11  ? 3.772   15.367  -2.676  1.00 0.00 ? 11  GLY A HA3  1  
ATOM 163   N N    . VAL A 1 12  ? 3.276   13.312  -0.262  1.00 0.00 ? 12  VAL A N    1  
ATOM 164   C CA   . VAL A 1 12  ? 2.908   12.985  1.104   1.00 0.00 ? 12  VAL A CA   1  
ATOM 165   C C    . VAL A 1 12  ? 1.690   13.776  1.588   1.00 0.00 ? 12  VAL A C    1  
ATOM 166   O O    . VAL A 1 12  ? 1.677   15.003  1.700   1.00 0.00 ? 12  VAL A O    1  
ATOM 167   C CB   . VAL A 1 12  ? 4.157   13.005  2.010   1.00 0.00 ? 12  VAL A CB   1  
ATOM 168   C CG1  . VAL A 1 12  ? 3.826   12.760  3.483   1.00 0.00 ? 12  VAL A CG1  1  
ATOM 169   C CG2  . VAL A 1 12  ? 5.111   11.907  1.513   1.00 0.00 ? 12  VAL A CG2  1  
ATOM 170   H H    . VAL A 1 12  ? 3.383   12.496  -0.851  1.00 0.00 ? 12  VAL A H    1  
ATOM 171   H HA   . VAL A 1 12  ? 2.598   11.939  1.072   1.00 0.00 ? 12  VAL A HA   1  
ATOM 172   H HB   . VAL A 1 12  ? 4.660   13.967  1.937   1.00 0.00 ? 12  VAL A HB   1  
ATOM 173   H HG11 . VAL A 1 12  ? 3.242   13.592  3.874   1.00 0.00 ? 12  VAL A HG11 1  
ATOM 174   H HG12 . VAL A 1 12  ? 3.255   11.839  3.586   1.00 0.00 ? 12  VAL A HG12 1  
ATOM 175   H HG13 . VAL A 1 12  ? 4.745   12.686  4.064   1.00 0.00 ? 12  VAL A HG13 1  
ATOM 176   H HG21 . VAL A 1 12  ? 4.575   10.959  1.429   1.00 0.00 ? 12  VAL A HG21 1  
ATOM 177   H HG22 . VAL A 1 12  ? 5.505   12.163  0.530   1.00 0.00 ? 12  VAL A HG22 1  
ATOM 178   H HG23 . VAL A 1 12  ? 5.944   11.788  2.204   1.00 0.00 ? 12  VAL A HG23 1  
ATOM 179   N N    . GLY A 1 13  ? 0.634   13.018  1.859   1.00 0.00 ? 13  GLY A N    1  
ATOM 180   C CA   . GLY A 1 13  ? -0.522  13.464  2.628   1.00 0.00 ? 13  GLY A CA   1  
ATOM 181   C C    . GLY A 1 13  ? -1.655  12.458  2.538   1.00 0.00 ? 13  GLY A C    1  
ATOM 182   O O    . GLY A 1 13  ? -2.272  12.107  3.540   1.00 0.00 ? 13  GLY A O    1  
ATOM 183   H H    . GLY A 1 13  ? 0.789   12.025  1.731   1.00 0.00 ? 13  GLY A H    1  
ATOM 184   H HA2  . GLY A 1 13  ? -0.235  13.566  3.670   1.00 0.00 ? 13  GLY A HA2  1  
ATOM 185   H HA3  . GLY A 1 13  ? -0.868  14.434  2.272   1.00 0.00 ? 13  GLY A HA3  1  
ATOM 186   N N    . LYS A 1 14  ? -1.870  11.931  1.329   1.00 0.00 ? 14  LYS A N    1  
ATOM 187   C CA   . LYS A 1 14  ? -2.843  10.884  1.014   1.00 0.00 ? 14  LYS A CA   1  
ATOM 188   C C    . LYS A 1 14  ? -2.734  9.678   1.955   1.00 0.00 ? 14  LYS A C    1  
ATOM 189   O O    . LYS A 1 14  ? -3.745  9.080   2.304   1.00 0.00 ? 14  LYS A O    1  
ATOM 190   C CB   . LYS A 1 14  ? -2.677  10.502  -0.460  1.00 0.00 ? 14  LYS A CB   1  
ATOM 191   C CG   . LYS A 1 14  ? -1.407  9.669   -0.714  1.00 0.00 ? 14  LYS A CG   1  
ATOM 192   C CD   . LYS A 1 14  ? -0.993  9.694   -2.183  1.00 0.00 ? 14  LYS A CD   1  
ATOM 193   C CE   . LYS A 1 14  ? -0.158  10.937  -2.504  1.00 0.00 ? 14  LYS A CE   1  
ATOM 194   N NZ   . LYS A 1 14  ? 0.306   10.876  -3.897  1.00 0.00 ? 14  LYS A NZ   1  
ATOM 195   H H    . LYS A 1 14  ? -1.299  12.281  0.579   1.00 0.00 ? 14  LYS A H    1  
ATOM 196   H HA   . LYS A 1 14  ? -3.845  11.295  1.129   1.00 0.00 ? 14  LYS A HA   1  
ATOM 197   H HB2  . LYS A 1 14  ? -3.555  9.938   -0.774  1.00 0.00 ? 14  LYS A HB2  1  
ATOM 198   H HB3  . LYS A 1 14  ? -2.648  11.417  -1.055  1.00 0.00 ? 14  LYS A HB3  1  
ATOM 199   H HG2  . LYS A 1 14  ? -0.575  10.043  -0.116  1.00 0.00 ? 14  LYS A HG2  1  
ATOM 200   H HG3  . LYS A 1 14  ? -1.598  8.637   -0.418  1.00 0.00 ? 14  LYS A HG3  1  
ATOM 201   H HD2  . LYS A 1 14  ? -0.379  8.819   -2.378  1.00 0.00 ? 14  LYS A HD2  1  
ATOM 202   H HD3  . LYS A 1 14  ? -1.882  9.644   -2.814  1.00 0.00 ? 14  LYS A HD3  1  
ATOM 203   H HE2  . LYS A 1 14  ? -0.756  11.833  -2.348  1.00 0.00 ? 14  LYS A HE2  1  
ATOM 204   H HE3  . LYS A 1 14  ? 0.715   10.969  -1.837  1.00 0.00 ? 14  LYS A HE3  1  
ATOM 205   H HZ1  . LYS A 1 14  ? -0.436  10.693  -4.559  1.00 0.00 ? 14  LYS A HZ1  1  
ATOM 206   H HZ2  . LYS A 1 14  ? 0.782   11.713  -4.219  1.00 0.00 ? 14  LYS A HZ2  1  
ATOM 207   H HZ3  . LYS A 1 14  ? 0.949   10.096  -4.038  1.00 0.00 ? 14  LYS A HZ3  1  
ATOM 208   N N    . THR A 1 15  ? -1.521  9.393   2.425   1.00 0.00 ? 15  THR A N    1  
ATOM 209   C CA   . THR A 1 15  ? -1.133  8.400   3.410   1.00 0.00 ? 15  THR A CA   1  
ATOM 210   C C    . THR A 1 15  ? -2.087  8.447   4.606   1.00 0.00 ? 15  THR A C    1  
ATOM 211   O O    . THR A 1 15  ? -2.623  7.430   5.045   1.00 0.00 ? 15  THR A O    1  
ATOM 212   C CB   . THR A 1 15  ? 0.312   8.757   3.830   1.00 0.00 ? 15  THR A CB   1  
ATOM 213   O OG1  . THR A 1 15  ? 1.067   9.259   2.724   1.00 0.00 ? 15  THR A OG1  1  
ATOM 214   C CG2  . THR A 1 15  ? 1.035   7.580   4.466   1.00 0.00 ? 15  THR A CG2  1  
ATOM 215   H H    . THR A 1 15  ? -0.726  9.943   2.149   1.00 0.00 ? 15  THR A H    1  
ATOM 216   H HA   . THR A 1 15  ? -1.160  7.408   2.955   1.00 0.00 ? 15  THR A HA   1  
ATOM 217   H HB   . THR A 1 15  ? 0.269   9.554   4.572   1.00 0.00 ? 15  THR A HB   1  
ATOM 218   H HG1  . THR A 1 15  ? 2.016   9.213   2.971   1.00 0.00 ? 15  THR A HG1  1  
ATOM 219   H HG21 . THR A 1 15  ? 0.452   7.178   5.302   1.00 0.00 ? 15  THR A HG21 1  
ATOM 220   H HG22 . THR A 1 15  ? 1.223   6.802   3.730   1.00 0.00 ? 15  THR A HG22 1  
ATOM 221   H HG23 . THR A 1 15  ? 1.988   7.914   4.863   1.00 0.00 ? 15  THR A HG23 1  
ATOM 222   N N    . THR A 1 16  ? -2.343  9.659   5.094   1.00 0.00 ? 16  THR A N    1  
ATOM 223   C CA   . THR A 1 16  ? -3.090  9.919   6.298   1.00 0.00 ? 16  THR A CA   1  
ATOM 224   C C    . THR A 1 16  ? -4.589  9.971   6.004   1.00 0.00 ? 16  THR A C    1  
ATOM 225   O O    . THR A 1 16  ? -5.389  9.706   6.898   1.00 0.00 ? 16  THR A O    1  
ATOM 226   C CB   . THR A 1 16  ? -2.553  11.229  6.888   1.00 0.00 ? 16  THR A CB   1  
ATOM 227   O OG1  . THR A 1 16  ? -1.132  11.185  6.924   1.00 0.00 ? 16  THR A OG1  1  
ATOM 228   C CG2  . THR A 1 16  ? -3.096  11.472  8.301   1.00 0.00 ? 16  THR A CG2  1  
ATOM 229   H H    . THR A 1 16  ? -1.938  10.486  4.675   1.00 0.00 ? 16  THR A H    1  
ATOM 230   H HA   . THR A 1 16  ? -2.901  9.112   6.999   1.00 0.00 ? 16  THR A HA   1  
ATOM 231   H HB   . THR A 1 16  ? -2.840  12.040  6.215   1.00 0.00 ? 16  THR A HB   1  
ATOM 232   H HG1  . THR A 1 16  ? -0.820  11.762  7.641   1.00 0.00 ? 16  THR A HG1  1  
ATOM 233   H HG21 . THR A 1 16  ? -2.646  12.360  8.737   1.00 0.00 ? 16  THR A HG21 1  
ATOM 234   H HG22 . THR A 1 16  ? -4.177  11.621  8.266   1.00 0.00 ? 16  THR A HG22 1  
ATOM 235   H HG23 . THR A 1 16  ? -2.880  10.611  8.938   1.00 0.00 ? 16  THR A HG23 1  
ATOM 236   N N    . LEU A 1 17  ? -5.001  10.268  4.766   1.00 0.00 ? 17  LEU A N    1  
ATOM 237   C CA   . LEU A 1 17  ? -6.402  10.129  4.394   1.00 0.00 ? 17  LEU A CA   1  
ATOM 238   C C    . LEU A 1 17  ? -6.779  8.656   4.358   1.00 0.00 ? 17  LEU A C    1  
ATOM 239   O O    . LEU A 1 17  ? -7.862  8.322   4.832   1.00 0.00 ? 17  LEU A O    1  
ATOM 240   C CB   . LEU A 1 17  ? -6.727  10.854  3.075   1.00 0.00 ? 17  LEU A CB   1  
ATOM 241   C CG   . LEU A 1 17  ? -6.763  12.401  3.154   1.00 0.00 ? 17  LEU A CG   1  
ATOM 242   C CD1  . LEU A 1 17  ? -6.923  12.978  4.574   1.00 0.00 ? 17  LEU A CD1  1  
ATOM 243   C CD2  . LEU A 1 17  ? -5.505  12.997  2.517   1.00 0.00 ? 17  LEU A CD2  1  
ATOM 244   H H    . LEU A 1 17  ? -4.329  10.443  4.032   1.00 0.00 ? 17  LEU A H    1  
ATOM 245   H HA   . LEU A 1 17  ? -7.012  10.554  5.190   1.00 0.00 ? 17  LEU A HA   1  
ATOM 246   H HB2  . LEU A 1 17  ? -6.042  10.528  2.293   1.00 0.00 ? 17  LEU A HB2  1  
ATOM 247   H HB3  . LEU A 1 17  ? -7.711  10.517  2.750   1.00 0.00 ? 17  LEU A HB3  1  
ATOM 248   H HG   . LEU A 1 17  ? -7.611  12.739  2.562   1.00 0.00 ? 17  LEU A HG   1  
ATOM 249   H HD11 . LEU A 1 17  ? -7.052  14.054  4.538   1.00 0.00 ? 17  LEU A HD11 1  
ATOM 250   H HD12 . LEU A 1 17  ? -7.813  12.571  5.051   1.00 0.00 ? 17  LEU A HD12 1  
ATOM 251   H HD13 . LEU A 1 17  ? -6.040  12.760  5.178   1.00 0.00 ? 17  LEU A HD13 1  
ATOM 252   H HD21 . LEU A 1 17  ? -4.624  12.601  3.009   1.00 0.00 ? 17  LEU A HD21 1  
ATOM 253   H HD22 . LEU A 1 17  ? -5.495  12.754  1.454   1.00 0.00 ? 17  LEU A HD22 1  
ATOM 254   H HD23 . LEU A 1 17  ? -5.502  14.080  2.617   1.00 0.00 ? 17  LEU A HD23 1  
ATOM 255   N N    . ILE A 1 18  ? -5.879  7.775   3.907   1.00 0.00 ? 18  ILE A N    1  
ATOM 256   C CA   . ILE A 1 18  ? -6.097  6.346   4.074   1.00 0.00 ? 18  ILE A CA   1  
ATOM 257   C C    . ILE A 1 18  ? -6.098  6.019   5.576   1.00 0.00 ? 18  ILE A C    1  
ATOM 258   O O    . ILE A 1 18  ? -7.000  5.313   6.008   1.00 0.00 ? 18  ILE A O    1  
ATOM 259   C CB   . ILE A 1 18  ? -5.013  5.499   3.350   1.00 0.00 ? 18  ILE A CB   1  
ATOM 260   C CG1  . ILE A 1 18  ? -4.888  5.709   1.829   1.00 0.00 ? 18  ILE A CG1  1  
ATOM 261   C CG2  . ILE A 1 18  ? -5.139  3.990   3.640   1.00 0.00 ? 18  ILE A CG2  1  
ATOM 262   C CD1  . ILE A 1 18  ? -6.119  5.329   1.005   1.00 0.00 ? 18  ILE A CD1  1  
ATOM 263   H H    . ILE A 1 18  ? -5.001  8.096   3.514   1.00 0.00 ? 18  ILE A H    1  
ATOM 264   H HA   . ILE A 1 18  ? -7.111  6.165   3.676   1.00 0.00 ? 18  ILE A HA   1  
ATOM 265   H HB   . ILE A 1 18  ? -4.054  5.803   3.759   1.00 0.00 ? 18  ILE A HB   1  
ATOM 266   H HG12 . ILE A 1 18  ? -4.648  6.750   1.629   1.00 0.00 ? 18  ILE A HG12 1  
ATOM 267   H HG13 . ILE A 1 18  ? -4.046  5.115   1.469   1.00 0.00 ? 18  ILE A HG13 1  
ATOM 268   H HG21 . ILE A 1 18  ? -4.972  3.795   4.696   1.00 0.00 ? 18  ILE A HG21 1  
ATOM 269   H HG22 . ILE A 1 18  ? -6.132  3.630   3.386   1.00 0.00 ? 18  ILE A HG22 1  
ATOM 270   H HG23 . ILE A 1 18  ? -4.381  3.432   3.085   1.00 0.00 ? 18  ILE A HG23 1  
ATOM 271   H HD11 . ILE A 1 18  ? -5.820  5.179   -0.028  1.00 0.00 ? 18  ILE A HD11 1  
ATOM 272   H HD12 . ILE A 1 18  ? -6.566  4.400   1.354   1.00 0.00 ? 18  ILE A HD12 1  
ATOM 273   H HD13 . ILE A 1 18  ? -6.847  6.136   1.057   1.00 0.00 ? 18  ILE A HD13 1  
ATOM 274   N N    . HIS A 1 19  ? -5.144  6.516   6.387   1.00 0.00 ? 19  HIS A N    1  
ATOM 275   C CA   . HIS A 1 19  ? -5.136  6.218   7.829   1.00 0.00 ? 19  HIS A CA   1  
ATOM 276   C C    . HIS A 1 19  ? -6.473  6.561   8.476   1.00 0.00 ? 19  HIS A C    1  
ATOM 277   O O    . HIS A 1 19  ? -7.001  5.777   9.254   1.00 0.00 ? 19  HIS A O    1  
ATOM 278   C CB   . HIS A 1 19  ? -4.046  6.939   8.618   1.00 0.00 ? 19  HIS A CB   1  
ATOM 279   C CG   . HIS A 1 19  ? -2.659  6.450   8.347   1.00 0.00 ? 19  HIS A CG   1  
ATOM 280   N ND1  . HIS A 1 19  ? -2.272  5.163   8.059   1.00 0.00 ? 19  HIS A ND1  1  
ATOM 281   C CD2  . HIS A 1 19  ? -1.544  7.228   8.360   1.00 0.00 ? 19  HIS A CD2  1  
ATOM 282   C CE1  . HIS A 1 19  ? -0.949  5.192   7.837   1.00 0.00 ? 19  HIS A CE1  1  
ATOM 283   N NE2  . HIS A 1 19  ? -0.459  6.426   8.023   1.00 0.00 ? 19  HIS A NE2  1  
ATOM 284   H H    . HIS A 1 19  ? -4.351  6.999   5.982   1.00 0.00 ? 19  HIS A H    1  
ATOM 285   H HA   . HIS A 1 19  ? -4.942  5.158   7.954   1.00 0.00 ? 19  HIS A HA   1  
ATOM 286   H HB2  . HIS A 1 19  ? -4.109  8.013   8.454   1.00 0.00 ? 19  HIS A HB2  1  
ATOM 287   H HB3  . HIS A 1 19  ? -4.234  6.765   9.677   1.00 0.00 ? 19  HIS A HB3  1  
ATOM 288   H HD1  . HIS A 1 19  ? -2.865  4.349   7.897   1.00 0.00 ? 19  HIS A HD1  1  
ATOM 289   H HD2  . HIS A 1 19  ? -1.540  8.281   8.559   1.00 0.00 ? 19  HIS A HD2  1  
ATOM 290   H HE1  . HIS A 1 19  ? -0.375  4.355   7.476   1.00 0.00 ? 19  HIS A HE1  1  
ATOM 291   N N    . LYS A 1 20  ? -7.036  7.725   8.156   1.00 0.00 ? 20  LYS A N    1  
ATOM 292   C CA   . LYS A 1 20  ? -8.348  8.142   8.636   1.00 0.00 ? 20  LYS A CA   1  
ATOM 293   C C    . LYS A 1 20  ? -9.432  7.186   8.147   1.00 0.00 ? 20  LYS A C    1  
ATOM 294   O O    . LYS A 1 20  ? -10.295 6.800   8.930   1.00 0.00 ? 20  LYS A O    1  
ATOM 295   C CB   . LYS A 1 20  ? -8.603  9.582   8.223   1.00 0.00 ? 20  LYS A CB   1  
ATOM 296   C CG   . LYS A 1 20  ? -7.888  10.494  9.222   1.00 0.00 ? 20  LYS A CG   1  
ATOM 297   C CD   . LYS A 1 20  ? -7.622  11.840  8.582   1.00 0.00 ? 20  LYS A CD   1  
ATOM 298   C CE   . LYS A 1 20  ? -7.041  12.798  9.625   1.00 0.00 ? 20  LYS A CE   1  
ATOM 299   N NZ   . LYS A 1 20  ? -7.429  14.187  9.327   1.00 0.00 ? 20  LYS A NZ   1  
ATOM 300   H H    . LYS A 1 20  ? -6.536  8.336   7.521   1.00 0.00 ? 20  LYS A H    1  
ATOM 301   H HA   . LYS A 1 20  ? -8.334  8.133   9.720   1.00 0.00 ? 20  LYS A HA   1  
ATOM 302   H HB2  . LYS A 1 20  ? -8.222  9.740   7.216   1.00 0.00 ? 20  LYS A HB2  1  
ATOM 303   H HB3  . LYS A 1 20  ? -9.672  9.798   8.248   1.00 0.00 ? 20  LYS A HB3  1  
ATOM 304   H HG2  . LYS A 1 20  ? -8.518  10.614  10.104  1.00 0.00 ? 20  LYS A HG2  1  
ATOM 305   H HG3  . LYS A 1 20  ? -6.930  10.066  9.518   1.00 0.00 ? 20  LYS A HG3  1  
ATOM 306   H HD2  . LYS A 1 20  ? -6.914  11.670  7.779   1.00 0.00 ? 20  LYS A HD2  1  
ATOM 307   H HD3  . LYS A 1 20  ? -8.557  12.227  8.175   1.00 0.00 ? 20  LYS A HD3  1  
ATOM 308   H HE2  . LYS A 1 20  ? -7.448  12.530  10.603  1.00 0.00 ? 20  LYS A HE2  1  
ATOM 309   H HE3  . LYS A 1 20  ? -5.954  12.697  9.664   1.00 0.00 ? 20  LYS A HE3  1  
ATOM 310   H HZ1  . LYS A 1 20  ? -7.273  14.792  10.123  1.00 0.00 ? 20  LYS A HZ1  1  
ATOM 311   H HZ2  . LYS A 1 20  ? -6.932  14.552  8.519   1.00 0.00 ? 20  LYS A HZ2  1  
ATOM 312   H HZ3  . LYS A 1 20  ? -8.433  14.222  9.161   1.00 0.00 ? 20  LYS A HZ3  1  
ATOM 313   N N    . ALA A 1 21  ? -9.356  6.726   6.899   1.00 0.00 ? 21  ALA A N    1  
ATOM 314   C CA   . ALA A 1 21  ? -10.243 5.688   6.400   1.00 0.00 ? 21  ALA A CA   1  
ATOM 315   C C    . ALA A 1 21  ? -10.099 4.376   7.192   1.00 0.00 ? 21  ALA A C    1  
ATOM 316   O O    . ALA A 1 21  ? -11.036 3.581   7.246   1.00 0.00 ? 21  ALA A O    1  
ATOM 317   C CB   . ALA A 1 21  ? -9.993  5.460   4.921   1.00 0.00 ? 21  ALA A CB   1  
ATOM 318   H H    . ALA A 1 21  ? -8.629  7.054   6.276   1.00 0.00 ? 21  ALA A H    1  
ATOM 319   H HA   . ALA A 1 21  ? -11.257 6.067   6.467   1.00 0.00 ? 21  ALA A HA   1  
ATOM 320   H HB1  . ALA A 1 21  ? -9.746  6.401   4.438   1.00 0.00 ? 21  ALA A HB1  1  
ATOM 321   H HB2  . ALA A 1 21  ? -9.177  4.749   4.785   1.00 0.00 ? 21  ALA A HB2  1  
ATOM 322   H HB3  . ALA A 1 21  ? -10.909 5.066   4.483   1.00 0.00 ? 21  ALA A HB3  1  
ATOM 323   N N    . SER A 1 22  ? -8.954  4.154   7.841   1.00 0.00 ? 22  SER A N    1  
ATOM 324   C CA   . SER A 1 22  ? -8.655  3.004   8.685   1.00 0.00 ? 22  SER A CA   1  
ATOM 325   C C    . SER A 1 22  ? -9.051  3.242   10.153  1.00 0.00 ? 22  SER A C    1  
ATOM 326   O O    . SER A 1 22  ? -8.639  2.486   11.027  1.00 0.00 ? 22  SER A O    1  
ATOM 327   C CB   . SER A 1 22  ? -7.162  2.625   8.545   1.00 0.00 ? 22  SER A CB   1  
ATOM 328   O OG   . SER A 1 22  ? -6.772  2.501   7.182   1.00 0.00 ? 22  SER A OG   1  
ATOM 329   H H    . SER A 1 22  ? -8.214  4.842   7.767   1.00 0.00 ? 22  SER A H    1  
ATOM 330   H HA   . SER A 1 22  ? -9.280  2.184   8.339   1.00 0.00 ? 22  SER A HA   1  
ATOM 331   H HB2  . SER A 1 22  ? -6.538  3.386   9.017   1.00 0.00 ? 22  SER A HB2  1  
ATOM 332   H HB3  . SER A 1 22  ? -6.984  1.675   9.054   1.00 0.00 ? 22  SER A HB3  1  
ATOM 333   H HG   . SER A 1 22  ? -5.820  2.695   7.125   1.00 0.00 ? 22  SER A HG   1  
ATOM 334   N N    . GLU A 1 23  ? -9.811  4.297   10.445  1.00 0.00 ? 23  GLU A N    1  
ATOM 335   C CA   . GLU A 1 23  ? -10.479 4.548   11.727  1.00 0.00 ? 23  GLU A CA   1  
ATOM 336   C C    . GLU A 1 23  ? -11.999 4.477   11.599  1.00 0.00 ? 23  GLU A C    1  
ATOM 337   O O    . GLU A 1 23  ? -12.747 4.266   12.548  1.00 0.00 ? 23  GLU A O    1  
ATOM 338   C CB   . GLU A 1 23  ? -10.126 5.967   12.168  1.00 0.00 ? 23  GLU A CB   1  
ATOM 339   C CG   . GLU A 1 23  ? -8.610  6.158   12.157  1.00 0.00 ? 23  GLU A CG   1  
ATOM 340   C CD   . GLU A 1 23  ? -8.095  7.163   13.174  1.00 0.00 ? 23  GLU A CD   1  
ATOM 341   O OE1  . GLU A 1 23  ? -8.058  8.371   12.863  1.00 0.00 ? 23  GLU A OE1  1  
ATOM 342   O OE2  . GLU A 1 23  ? -7.676  6.776   14.293  1.00 0.00 ? 23  GLU A OE2  1  
ATOM 343   H H    . GLU A 1 23  ? -9.969  4.977   9.717   1.00 0.00 ? 23  GLU A H    1  
ATOM 344   H HA   . GLU A 1 23  ? -10.153 3.830   12.477  1.00 0.00 ? 23  GLU A HA   1  
ATOM 345   H HB2  . GLU A 1 23  ? -10.575 6.666   11.461  1.00 0.00 ? 23  GLU A HB2  1  
ATOM 346   H HB3  . GLU A 1 23  ? -10.526 6.154   13.163  1.00 0.00 ? 23  GLU A HB3  1  
ATOM 347   H HG2  . GLU A 1 23  ? -8.139  5.198   12.320  1.00 0.00 ? 23  GLU A HG2  1  
ATOM 348   H HG3  . GLU A 1 23  ? -8.322  6.521   11.178  1.00 0.00 ? 23  GLU A HG3  1  
ATOM 349   N N    . VAL A 1 24  ? -12.474 4.691   10.387  1.00 0.00 ? 24  VAL A N    1  
ATOM 350   C CA   . VAL A 1 24  ? -13.865 5.052   10.137  1.00 0.00 ? 24  VAL A CA   1  
ATOM 351   C C    . VAL A 1 24  ? -14.740 3.868   9.847   1.00 0.00 ? 24  VAL A C    1  
ATOM 352   O O    . VAL A 1 24  ? -15.791 3.698   10.460  1.00 0.00 ? 24  VAL A O    1  
ATOM 353   C CB   . VAL A 1 24  ? -13.888 6.134   9.092   1.00 0.00 ? 24  VAL A CB   1  
ATOM 354   C CG1  . VAL A 1 24  ? -13.844 5.634   7.679   1.00 0.00 ? 24  VAL A CG1  1  
ATOM 355   C CG2  . VAL A 1 24  ? -15.107 7.047   9.273   1.00 0.00 ? 24  VAL A CG2  1  
ATOM 356   H H    . VAL A 1 24  ? -11.756 4.921   9.715   1.00 0.00 ? 24  VAL A H    1  
ATOM 357   H HA   . VAL A 1 24  ? -14.261 5.530   11.002  1.00 0.00 ? 24  VAL A HA   1  
ATOM 358   H HB   . VAL A 1 24  ? -12.941 6.608   9.253   1.00 0.00 ? 24  VAL A HB   1  
ATOM 359   H HG11 . VAL A 1 24  ? -14.779 5.131   7.462   1.00 0.00 ? 24  VAL A HG11 1  
ATOM 360   H HG12 . VAL A 1 24  ? -13.660 6.470   7.014   1.00 0.00 ? 24  VAL A HG12 1  
ATOM 361   H HG13 . VAL A 1 24  ? -13.013 4.952   7.637   1.00 0.00 ? 24  VAL A HG13 1  
ATOM 362   H HG21 . VAL A 1 24  ? -16.013 6.438   9.189   1.00 0.00 ? 24  VAL A HG21 1  
ATOM 363   H HG22 . VAL A 1 24  ? -15.081 7.531   10.245  1.00 0.00 ? 24  VAL A HG22 1  
ATOM 364   H HG23 . VAL A 1 24  ? -15.134 7.818   8.507   1.00 0.00 ? 24  VAL A HG23 1  
ATOM 365   N N    . LEU A 1 25  ? -14.220 2.978   9.012   1.00 0.00 ? 25  LEU A N    1  
ATOM 366   C CA   . LEU A 1 25  ? -14.789 1.664   8.863   1.00 0.00 ? 25  LEU A CA   1  
ATOM 367   C C    . LEU A 1 25  ? -14.752 1.019   10.244  1.00 0.00 ? 25  LEU A C    1  
ATOM 368   O O    . LEU A 1 25  ? -15.684 0.322   10.619  1.00 0.00 ? 25  LEU A O    1  
ATOM 369   C CB   . LEU A 1 25  ? -13.989 0.794   7.886   1.00 0.00 ? 25  LEU A CB   1  
ATOM 370   C CG   . LEU A 1 25  ? -13.820 1.347   6.464   1.00 0.00 ? 25  LEU A CG   1  
ATOM 371   C CD1  . LEU A 1 25  ? -12.605 0.696   5.797   1.00 0.00 ? 25  LEU A CD1  1  
ATOM 372   C CD2  . LEU A 1 25  ? -15.075 1.074   5.633   1.00 0.00 ? 25  LEU A CD2  1  
ATOM 373   H H    . LEU A 1 25  ? -13.286 3.166   8.675   1.00 0.00 ? 25  LEU A H    1  
ATOM 374   H HA   . LEU A 1 25  ? -15.816 1.790   8.535   1.00 0.00 ? 25  LEU A HA   1  
ATOM 375   H HB2  . LEU A 1 25  ? -13.044 0.598   8.375   1.00 0.00 ? 25  LEU A HB2  1  
ATOM 376   H HB3  . LEU A 1 25  ? -14.459 -0.172  7.815   1.00 0.00 ? 25  LEU A HB3  1  
ATOM 377   H HG   . LEU A 1 25  ? -13.650 2.420   6.512   1.00 0.00 ? 25  LEU A HG   1  
ATOM 378   H HD11 . LEU A 1 25  ? -11.689 1.121   6.206   1.00 0.00 ? 25  LEU A HD11 1  
ATOM 379   H HD12 . LEU A 1 25  ? -12.613 -0.377  5.981   1.00 0.00 ? 25  LEU A HD12 1  
ATOM 380   H HD13 . LEU A 1 25  ? -12.642 0.886   4.729   1.00 0.00 ? 25  LEU A HD13 1  
ATOM 381   H HD21 . LEU A 1 25  ? -15.020 1.632   4.701   1.00 0.00 ? 25  LEU A HD21 1  
ATOM 382   H HD22 . LEU A 1 25  ? -15.175 0.006   5.435   1.00 0.00 ? 25  LEU A HD22 1  
ATOM 383   H HD23 . LEU A 1 25  ? -15.955 1.406   6.181   1.00 0.00 ? 25  LEU A HD23 1  
ATOM 384   N N    . LYS A 1 26  ? -13.706 1.301   11.036  1.00 0.00 ? 26  LYS A N    1  
ATOM 385   C CA   . LYS A 1 26  ? -13.601 0.679   12.359  1.00 0.00 ? 26  LYS A CA   1  
ATOM 386   C C    . LYS A 1 26  ? -14.690 1.211   13.269  1.00 0.00 ? 26  LYS A C    1  
ATOM 387   O O    . LYS A 1 26  ? -15.300 0.440   14.016  1.00 0.00 ? 26  LYS A O    1  
ATOM 388   C CB   . LYS A 1 26  ? -12.232 0.917   13.000  1.00 0.00 ? 26  LYS A CB   1  
ATOM 389   C CG   . LYS A 1 26  ? -11.124 0.156   12.282  1.00 0.00 ? 26  LYS A CG   1  
ATOM 390   C CD   . LYS A 1 26  ? -9.831  0.206   13.093  1.00 0.00 ? 26  LYS A CD   1  
ATOM 391   C CE   . LYS A 1 26  ? -8.714  -0.405  12.253  1.00 0.00 ? 26  LYS A CE   1  
ATOM 392   N NZ   . LYS A 1 26  ? -7.447  -0.438  12.997  1.00 0.00 ? 26  LYS A NZ   1  
ATOM 393   H H    . LYS A 1 26  ? -13.089 2.073   10.718  1.00 0.00 ? 26  LYS A H    1  
ATOM 394   H HA   . LYS A 1 26  ? -13.761 -0.397  12.249  1.00 0.00 ? 26  LYS A HA   1  
ATOM 395   H HB2  . LYS A 1 26  ? -12.002 1.977   12.979  1.00 0.00 ? 26  LYS A HB2  1  
ATOM 396   H HB3  . LYS A 1 26  ? -12.277 0.581   14.035  1.00 0.00 ? 26  LYS A HB3  1  
ATOM 397   H HG2  . LYS A 1 26  ? -11.426 -0.878  12.132  1.00 0.00 ? 26  LYS A HG2  1  
ATOM 398   H HG3  . LYS A 1 26  ? -10.964 0.612   11.311  1.00 0.00 ? 26  LYS A HG3  1  
ATOM 399   H HD2  . LYS A 1 26  ? -9.595  1.245   13.333  1.00 0.00 ? 26  LYS A HD2  1  
ATOM 400   H HD3  . LYS A 1 26  ? -9.967  -0.375  14.009  1.00 0.00 ? 26  LYS A HD3  1  
ATOM 401   H HE2  . LYS A 1 26  ? -9.004  -1.419  11.970  1.00 0.00 ? 26  LYS A HE2  1  
ATOM 402   H HE3  . LYS A 1 26  ? -8.590  0.197   11.349  1.00 0.00 ? 26  LYS A HE3  1  
ATOM 403   H HZ1  . LYS A 1 26  ? -7.623  -0.286  13.984  1.00 0.00 ? 26  LYS A HZ1  1  
ATOM 404   H HZ2  . LYS A 1 26  ? -7.005  -1.346  12.897  1.00 0.00 ? 26  LYS A HZ2  1  
ATOM 405   H HZ3  . LYS A 1 26  ? -6.828  0.312   12.695  1.00 0.00 ? 26  LYS A HZ3  1  
ATOM 406   N N    . SER A 1 27  ? -14.964 2.506   13.171  1.00 0.00 ? 27  SER A N    1  
ATOM 407   C CA   . SER A 1 27  ? -16.028 3.156   13.910  1.00 0.00 ? 27  SER A CA   1  
ATOM 408   C C    . SER A 1 27  ? -17.416 2.727   13.385  1.00 0.00 ? 27  SER A C    1  
ATOM 409   O O    . SER A 1 27  ? -18.413 2.842   14.098  1.00 0.00 ? 27  SER A O    1  
ATOM 410   C CB   . SER A 1 27  ? -15.785 4.667   13.861  1.00 0.00 ? 27  SER A CB   1  
ATOM 411   O OG   . SER A 1 27  ? -16.387 5.327   14.956  1.00 0.00 ? 27  SER A OG   1  
ATOM 412   H H    . SER A 1 27  ? -14.392 3.044   12.523  1.00 0.00 ? 27  SER A H    1  
ATOM 413   H HA   . SER A 1 27  ? -15.919 2.831   14.940  1.00 0.00 ? 27  SER A HA   1  
ATOM 414   H HB2  . SER A 1 27  ? -14.716 4.868   13.921  1.00 0.00 ? 27  SER A HB2  1  
ATOM 415   H HB3  . SER A 1 27  ? -16.169 5.064   12.921  1.00 0.00 ? 27  SER A HB3  1  
ATOM 416   H HG   . SER A 1 27  ? -15.901 5.091   15.769  1.00 0.00 ? 27  SER A HG   1  
ATOM 417   N N    . SER A 1 28  ? -17.482 2.172   12.174  1.00 0.00 ? 28  SER A N    1  
ATOM 418   C CA   . SER A 1 28  ? -18.643 1.554   11.553  1.00 0.00 ? 28  SER A CA   1  
ATOM 419   C C    . SER A 1 28  ? -18.648 0.023   11.741  1.00 0.00 ? 28  SER A C    1  
ATOM 420   O O    . SER A 1 28  ? -19.501 -0.664  11.178  1.00 0.00 ? 28  SER A O    1  
ATOM 421   C CB   . SER A 1 28  ? -18.652 1.968   10.075  1.00 0.00 ? 28  SER A CB   1  
ATOM 422   O OG   . SER A 1 28  ? -19.940 1.844   9.512   1.00 0.00 ? 28  SER A OG   1  
ATOM 423   H H    . SER A 1 28  ? -16.654 2.203   11.592  1.00 0.00 ? 28  SER A H    1  
ATOM 424   H HA   . SER A 1 28  ? -19.534 1.953   12.033  1.00 0.00 ? 28  SER A HA   1  
ATOM 425   H HB2  . SER A 1 28  ? -18.353 3.014   9.997   1.00 0.00 ? 28  SER A HB2  1  
ATOM 426   H HB3  . SER A 1 28  ? -17.942 1.366   9.510   1.00 0.00 ? 28  SER A HB3  1  
ATOM 427   H HG   . SER A 1 28  ? -19.970 1.007   9.004   1.00 0.00 ? 28  SER A HG   1  
ATOM 428   N N    . GLY A 1 29  ? -17.711 -0.532  12.518  1.00 0.00 ? 29  GLY A N    1  
ATOM 429   C CA   . GLY A 1 29  ? -17.704 -1.938  12.918  1.00 0.00 ? 29  GLY A CA   1  
ATOM 430   C C    . GLY A 1 29  ? -17.201 -2.879  11.827  1.00 0.00 ? 29  GLY A C    1  
ATOM 431   O O    . GLY A 1 29  ? -17.491 -4.076  11.872  1.00 0.00 ? 29  GLY A O    1  
ATOM 432   H H    . GLY A 1 29  ? -17.015 0.071   12.926  1.00 0.00 ? 29  GLY A H    1  
ATOM 433   H HA2  . GLY A 1 29  ? -17.063 -2.054  13.790  1.00 0.00 ? 29  GLY A HA2  1  
ATOM 434   H HA3  . GLY A 1 29  ? -18.711 -2.237  13.204  1.00 0.00 ? 29  GLY A HA3  1  
ATOM 435   N N    . VAL A 1 30  ? -16.493 -2.347  10.836  1.00 0.00 ? 30  VAL A N    1  
ATOM 436   C CA   . VAL A 1 30  ? -15.879 -3.057  9.730   1.00 0.00 ? 30  VAL A CA   1  
ATOM 437   C C    . VAL A 1 30  ? -14.374 -3.166  10.052  1.00 0.00 ? 30  VAL A C    1  
ATOM 438   O O    . VAL A 1 30  ? -13.642 -2.180  9.888   1.00 0.00 ? 30  VAL A O    1  
ATOM 439   C CB   . VAL A 1 30  ? -16.213 -2.290  8.429   1.00 0.00 ? 30  VAL A CB   1  
ATOM 440   C CG1  . VAL A 1 30  ? -15.372 -2.758  7.231   1.00 0.00 ? 30  VAL A CG1  1  
ATOM 441   C CG2  . VAL A 1 30  ? -17.701 -2.467  8.071   1.00 0.00 ? 30  VAL A CG2  1  
ATOM 442   H H    . VAL A 1 30  ? -16.307 -1.349  10.855  1.00 0.00 ? 30  VAL A H    1  
ATOM 443   H HA   . VAL A 1 30  ? -16.326 -4.047  9.644   1.00 0.00 ? 30  VAL A HA   1  
ATOM 444   H HB   . VAL A 1 30  ? -16.041 -1.223  8.585   1.00 0.00 ? 30  VAL A HB   1  
ATOM 445   H HG11 . VAL A 1 30  ? -15.485 -3.830  7.116   1.00 0.00 ? 30  VAL A HG11 1  
ATOM 446   H HG12 . VAL A 1 30  ? -15.703 -2.256  6.321   1.00 0.00 ? 30  VAL A HG12 1  
ATOM 447   H HG13 . VAL A 1 30  ? -14.317 -2.530  7.389   1.00 0.00 ? 30  VAL A HG13 1  
ATOM 448   H HG21 . VAL A 1 30  ? -18.331 -2.114  8.889   1.00 0.00 ? 30  VAL A HG21 1  
ATOM 449   H HG22 . VAL A 1 30  ? -17.934 -1.901  7.168   1.00 0.00 ? 30  VAL A HG22 1  
ATOM 450   H HG23 . VAL A 1 30  ? -17.930 -3.516  7.891   1.00 0.00 ? 30  VAL A HG23 1  
ATOM 451   N N    . PRO A 1 31  ? -13.893 -4.325  10.550  1.00 0.00 ? 31  PRO A N    1  
ATOM 452   C CA   . PRO A 1 31  ? -12.508 -4.494  10.964  1.00 0.00 ? 31  PRO A CA   1  
ATOM 453   C C    . PRO A 1 31  ? -11.592 -4.630  9.747   1.00 0.00 ? 31  PRO A C    1  
ATOM 454   O O    . PRO A 1 31  ? -11.363 -5.733  9.232   1.00 0.00 ? 31  PRO A O    1  
ATOM 455   C CB   . PRO A 1 31  ? -12.473 -5.732  11.857  1.00 0.00 ? 31  PRO A CB   1  
ATOM 456   C CG   . PRO A 1 31  ? -13.626 -6.567  11.319  1.00 0.00 ? 31  PRO A CG   1  
ATOM 457   C CD   . PRO A 1 31  ? -14.656 -5.517  10.907  1.00 0.00 ? 31  PRO A CD   1  
ATOM 458   H HA   . PRO A 1 31  ? -12.214 -3.626  11.552  1.00 0.00 ? 31  PRO A HA   1  
ATOM 459   H HB2  . PRO A 1 31  ? -11.521 -6.248  11.782  1.00 0.00 ? 31  PRO A HB2  1  
ATOM 460   H HB3  . PRO A 1 31  ? -12.665 -5.455  12.892  1.00 0.00 ? 31  PRO A HB3  1  
ATOM 461   H HG2  . PRO A 1 31  ? -13.305 -7.132  10.445  1.00 0.00 ? 31  PRO A HG2  1  
ATOM 462   H HG3  . PRO A 1 31  ? -14.007 -7.238  12.081  1.00 0.00 ? 31  PRO A HG3  1  
ATOM 463   H HD2  . PRO A 1 31  ? -15.249 -5.888  10.070  1.00 0.00 ? 31  PRO A HD2  1  
ATOM 464   H HD3  . PRO A 1 31  ? -15.301 -5.296  11.758  1.00 0.00 ? 31  PRO A HD3  1  
ATOM 465   N N    . VAL A 1 32  ? -11.088 -3.498  9.271   1.00 0.00 ? 32  VAL A N    1  
ATOM 466   C CA   . VAL A 1 32  ? -10.101 -3.369  8.217   1.00 0.00 ? 32  VAL A CA   1  
ATOM 467   C C    . VAL A 1 32  ? -8.808  -4.083  8.635   1.00 0.00 ? 32  VAL A C    1  
ATOM 468   O O    . VAL A 1 32  ? -8.512  -4.248  9.820   1.00 0.00 ? 32  VAL A O    1  
ATOM 469   C CB   . VAL A 1 32  ? -9.928  -1.863  7.904   1.00 0.00 ? 32  VAL A CB   1  
ATOM 470   C CG1  . VAL A 1 32  ? -9.526  -1.028  9.128   1.00 0.00 ? 32  VAL A CG1  1  
ATOM 471   C CG2  . VAL A 1 32  ? -8.913  -1.589  6.793   1.00 0.00 ? 32  VAL A CG2  1  
ATOM 472   H H    . VAL A 1 32  ? -11.332 -2.656  9.762   1.00 0.00 ? 32  VAL A H    1  
ATOM 473   H HA   . VAL A 1 32  ? -10.494 -3.864  7.329   1.00 0.00 ? 32  VAL A HA   1  
ATOM 474   H HB   . VAL A 1 32  ? -10.890 -1.489  7.556   1.00 0.00 ? 32  VAL A HB   1  
ATOM 475   H HG11 . VAL A 1 32  ? -8.589  -1.406  9.541   1.00 0.00 ? 32  VAL A HG11 1  
ATOM 476   H HG12 . VAL A 1 32  ? -9.392  0.014   8.844   1.00 0.00 ? 32  VAL A HG12 1  
ATOM 477   H HG13 . VAL A 1 32  ? -10.304 -1.084  9.886   1.00 0.00 ? 32  VAL A HG13 1  
ATOM 478   H HG21 . VAL A 1 32  ? -7.905  -1.785  7.157   1.00 0.00 ? 32  VAL A HG21 1  
ATOM 479   H HG22 . VAL A 1 32  ? -9.109  -2.219  5.929   1.00 0.00 ? 32  VAL A HG22 1  
ATOM 480   H HG23 . VAL A 1 32  ? -8.979  -0.547  6.480   1.00 0.00 ? 32  VAL A HG23 1  
ATOM 481   N N    . ASP A 1 33  ? -8.028  -4.516  7.654   1.00 0.00 ? 33  ASP A N    1  
ATOM 482   C CA   . ASP A 1 33  ? -6.742  -5.169  7.861   1.00 0.00 ? 33  ASP A CA   1  
ATOM 483   C C    . ASP A 1 33  ? -5.751  -4.753  6.776   1.00 0.00 ? 33  ASP A C    1  
ATOM 484   O O    . ASP A 1 33  ? -6.109  -4.018  5.852   1.00 0.00 ? 33  ASP A O    1  
ATOM 485   C CB   . ASP A 1 33  ? -6.920  -6.694  7.890   1.00 0.00 ? 33  ASP A CB   1  
ATOM 486   C CG   . ASP A 1 33  ? -6.123  -7.288  9.035   1.00 0.00 ? 33  ASP A CG   1  
ATOM 487   O OD1  . ASP A 1 33  ? -4.881  -7.353  8.929   1.00 0.00 ? 33  ASP A OD1  1  
ATOM 488   O OD2  . ASP A 1 33  ? -6.745  -7.779  10.005  1.00 0.00 ? 33  ASP A OD2  1  
ATOM 489   H H    . ASP A 1 33  ? -8.294  -4.317  6.700   1.00 0.00 ? 33  ASP A H    1  
ATOM 490   H HA   . ASP A 1 33  ? -6.343  -4.847  8.825   1.00 0.00 ? 33  ASP A HA   1  
ATOM 491   H HB2  . ASP A 1 33  ? -7.973  -6.960  8.006   1.00 0.00 ? 33  ASP A HB2  1  
ATOM 492   H HB3  . ASP A 1 33  ? -6.546  -7.138  6.964   1.00 0.00 ? 33  ASP A HB3  1  
ATOM 493   N N    . GLY A 1 34  ? -4.510  -5.223  6.883   1.00 0.00 ? 34  GLY A N    1  
ATOM 494   C CA   . GLY A 1 34  ? -3.441  -4.984  5.925   1.00 0.00 ? 34  GLY A CA   1  
ATOM 495   C C    . GLY A 1 34  ? -2.244  -4.312  6.592   1.00 0.00 ? 34  GLY A C    1  
ATOM 496   O O    . GLY A 1 34  ? -1.984  -4.536  7.781   1.00 0.00 ? 34  GLY A O    1  
ATOM 497   H H    . GLY A 1 34  ? -4.281  -5.790  7.694   1.00 0.00 ? 34  GLY A H    1  
ATOM 498   H HA2  . GLY A 1 34  ? -3.126  -5.936  5.532   1.00 0.00 ? 34  GLY A HA2  1  
ATOM 499   H HA3  . GLY A 1 34  ? -3.770  -4.451  5.040   1.00 0.00 ? 34  GLY A HA3  1  
ATOM 500   N N    . PHE A 1 35  ? -1.493  -3.503  5.844   1.00 0.00 ? 35  PHE A N    1  
ATOM 501   C CA   . PHE A 1 35  ? -0.279  -2.858  6.319   1.00 0.00 ? 35  PHE A CA   1  
ATOM 502   C C    . PHE A 1 35  ? -0.102  -1.472  5.710   1.00 0.00 ? 35  PHE A C    1  
ATOM 503   O O    . PHE A 1 35  ? -0.694  -1.149  4.679   1.00 0.00 ? 35  PHE A O    1  
ATOM 504   C CB   . PHE A 1 35  ? 0.923   -3.760  6.015   1.00 0.00 ? 35  PHE A CB   1  
ATOM 505   C CG   . PHE A 1 35  ? 1.256   -3.965  4.555   1.00 0.00 ? 35  PHE A CG   1  
ATOM 506   C CD1  . PHE A 1 35  ? 2.151   -3.093  3.912   1.00 0.00 ? 35  PHE A CD1  1  
ATOM 507   C CD2  . PHE A 1 35  ? 0.722   -5.059  3.853   1.00 0.00 ? 35  PHE A CD2  1  
ATOM 508   C CE1  . PHE A 1 35  ? 2.552   -3.352  2.595   1.00 0.00 ? 35  PHE A CE1  1  
ATOM 509   C CE2  . PHE A 1 35  ? 1.089   -5.298  2.521   1.00 0.00 ? 35  PHE A CE2  1  
ATOM 510   C CZ   . PHE A 1 35  ? 2.029   -4.456  1.907   1.00 0.00 ? 35  PHE A CZ   1  
ATOM 511   H H    . PHE A 1 35  ? -1.754  -3.291  4.892   1.00 0.00 ? 35  PHE A H    1  
ATOM 512   H HA   . PHE A 1 35  ? -0.341  -2.726  7.396   1.00 0.00 ? 35  PHE A HA   1  
ATOM 513   H HB2  . PHE A 1 35  ? 1.810   -3.333  6.474   1.00 0.00 ? 35  PHE A HB2  1  
ATOM 514   H HB3  . PHE A 1 35  ? 0.751   -4.732  6.479   1.00 0.00 ? 35  PHE A HB3  1  
ATOM 515   H HD1  . PHE A 1 35  ? 2.539   -2.223  4.419   1.00 0.00 ? 35  PHE A HD1  1  
ATOM 516   H HD2  . PHE A 1 35  ? 0.013   -5.712  4.331   1.00 0.00 ? 35  PHE A HD2  1  
ATOM 517   H HE1  . PHE A 1 35  ? 3.254   -2.696  2.106   1.00 0.00 ? 35  PHE A HE1  1  
ATOM 518   H HE2  . PHE A 1 35  ? 0.659   -6.132  1.984   1.00 0.00 ? 35  PHE A HE2  1  
ATOM 519   H HZ   . PHE A 1 35  ? 2.325   -4.625  0.891   1.00 0.00 ? 35  PHE A HZ   1  
ATOM 520   N N    . TYR A 1 36  ? 0.730   -0.658  6.357   1.00 0.00 ? 36  TYR A N    1  
ATOM 521   C CA   . TYR A 1 36  ? 1.123   0.665   5.920   1.00 0.00 ? 36  TYR A CA   1  
ATOM 522   C C    . TYR A 1 36  ? 2.588   0.852   6.324   1.00 0.00 ? 36  TYR A C    1  
ATOM 523   O O    . TYR A 1 36  ? 2.952   0.542   7.456   1.00 0.00 ? 36  TYR A O    1  
ATOM 524   C CB   . TYR A 1 36  ? 0.157   1.674   6.556   1.00 0.00 ? 36  TYR A CB   1  
ATOM 525   C CG   . TYR A 1 36  ? 0.277   1.931   8.047   1.00 0.00 ? 36  TYR A CG   1  
ATOM 526   C CD1  . TYR A 1 36  ? 1.240   2.838   8.539   1.00 0.00 ? 36  TYR A CD1  1  
ATOM 527   C CD2  . TYR A 1 36  ? -0.652  1.351   8.931   1.00 0.00 ? 36  TYR A CD2  1  
ATOM 528   C CE1  . TYR A 1 36  ? 1.224   3.225   9.888   1.00 0.00 ? 36  TYR A CE1  1  
ATOM 529   C CE2  . TYR A 1 36  ? -0.659  1.719   10.285  1.00 0.00 ? 36  TYR A CE2  1  
ATOM 530   C CZ   . TYR A 1 36  ? 0.256   2.686   10.762  1.00 0.00 ? 36  TYR A CZ   1  
ATOM 531   O OH   . TYR A 1 36  ? 0.173   3.126   12.048  1.00 0.00 ? 36  TYR A OH   1  
ATOM 532   H H    . TYR A 1 36  ? 1.149   -0.950  7.240   1.00 0.00 ? 36  TYR A H    1  
ATOM 533   H HA   . TYR A 1 36  ? 1.031   0.755   4.836   1.00 0.00 ? 36  TYR A HA   1  
ATOM 534   H HB2  . TYR A 1 36  ? 0.271   2.618   6.046   1.00 0.00 ? 36  TYR A HB2  1  
ATOM 535   H HB3  . TYR A 1 36  ? -0.867  1.352   6.350   1.00 0.00 ? 36  TYR A HB3  1  
ATOM 536   H HD1  . TYR A 1 36  ? 1.985   3.271   7.883   1.00 0.00 ? 36  TYR A HD1  1  
ATOM 537   H HD2  . TYR A 1 36  ? -1.373  0.630   8.573   1.00 0.00 ? 36  TYR A HD2  1  
ATOM 538   H HE1  . TYR A 1 36  ? 1.958   3.936   10.235  1.00 0.00 ? 36  TYR A HE1  1  
ATOM 539   H HE2  . TYR A 1 36  ? -1.363  1.248   10.955  1.00 0.00 ? 36  TYR A HE2  1  
ATOM 540   H HH   . TYR A 1 36  ? 1.029   3.401   12.397  1.00 0.00 ? 36  TYR A HH   1  
ATOM 541   N N    . THR A 1 37  ? 3.454   1.304   5.422   1.00 0.00 ? 37  THR A N    1  
ATOM 542   C CA   . THR A 1 37  ? 4.810   1.704   5.792   1.00 0.00 ? 37  THR A CA   1  
ATOM 543   C C    . THR A 1 37  ? 4.722   3.054   6.516   1.00 0.00 ? 37  THR A C    1  
ATOM 544   O O    . THR A 1 37  ? 3.926   3.893   6.072   1.00 0.00 ? 37  THR A O    1  
ATOM 545   C CB   . THR A 1 37  ? 5.627   1.900   4.504   1.00 0.00 ? 37  THR A CB   1  
ATOM 546   O OG1  . THR A 1 37  ? 4.933   2.786   3.633   1.00 0.00 ? 37  THR A OG1  1  
ATOM 547   C CG2  . THR A 1 37  ? 5.875   0.587   3.765   1.00 0.00 ? 37  THR A CG2  1  
ATOM 548   H H    . THR A 1 37  ? 3.166   1.534   4.483   1.00 0.00 ? 37  THR A H    1  
ATOM 549   H HA   . THR A 1 37  ? 5.269   0.939   6.433   1.00 0.00 ? 37  THR A HA   1  
ATOM 550   H HB   . THR A 1 37  ? 6.589   2.340   4.769   1.00 0.00 ? 37  THR A HB   1  
ATOM 551   H HG1  . THR A 1 37  ? 4.552   3.459   4.220   1.00 0.00 ? 37  THR A HG1  1  
ATOM 552   H HG21 . THR A 1 37  ? 6.583   0.756   2.956   1.00 0.00 ? 37  THR A HG21 1  
ATOM 553   H HG22 . THR A 1 37  ? 6.306   -0.123  4.467   1.00 0.00 ? 37  THR A HG22 1  
ATOM 554   H HG23 . THR A 1 37  ? 4.947   0.180   3.361   1.00 0.00 ? 37  THR A HG23 1  
ATOM 555   N N    . GLU A 1 38  ? 5.573   3.355   7.495   1.00 0.00 ? 38  GLU A N    1  
ATOM 556   C CA   . GLU A 1 38  ? 5.716   4.704   8.040   1.00 0.00 ? 38  GLU A CA   1  
ATOM 557   C C    . GLU A 1 38  ? 7.200   5.104   8.010   1.00 0.00 ? 38  GLU A C    1  
ATOM 558   O O    . GLU A 1 38  ? 8.104   4.278   7.848   1.00 0.00 ? 38  GLU A O    1  
ATOM 559   C CB   . GLU A 1 38  ? 5.001   4.777   9.407   1.00 0.00 ? 38  GLU A CB   1  
ATOM 560   C CG   . GLU A 1 38  ? 4.351   6.113   9.821   1.00 0.00 ? 38  GLU A CG   1  
ATOM 561   C CD   . GLU A 1 38  ? 5.282   7.313   10.034  1.00 0.00 ? 38  GLU A CD   1  
ATOM 562   O OE1  . GLU A 1 38  ? 5.781   7.516   11.172  1.00 0.00 ? 38  GLU A OE1  1  
ATOM 563   O OE2  . GLU A 1 38  ? 5.412   8.151   9.109   1.00 0.00 ? 38  GLU A OE2  1  
ATOM 564   H H    . GLU A 1 38  ? 6.184   2.644   7.907   1.00 0.00 ? 38  GLU A H    1  
ATOM 565   H HA   . GLU A 1 38  ? 5.207   5.395   7.375   1.00 0.00 ? 38  GLU A HA   1  
ATOM 566   H HB2  . GLU A 1 38  ? 4.154   4.092   9.336   1.00 0.00 ? 38  GLU A HB2  1  
ATOM 567   H HB3  . GLU A 1 38  ? 5.655   4.415   10.196  1.00 0.00 ? 38  GLU A HB3  1  
ATOM 568   H HG2  . GLU A 1 38  ? 3.608   6.378   9.072   1.00 0.00 ? 38  GLU A HG2  1  
ATOM 569   H HG3  . GLU A 1 38  ? 3.805   5.940   10.751  1.00 0.00 ? 38  GLU A HG3  1  
ATOM 570   N N    . GLU A 1 39  ? 7.448   6.412   8.057   1.00 0.00 ? 39  GLU A N    1  
ATOM 571   C CA   . GLU A 1 39  ? 8.750   7.010   7.842   1.00 0.00 ? 39  GLU A CA   1  
ATOM 572   C C    . GLU A 1 39  ? 9.529   6.926   9.152   1.00 0.00 ? 39  GLU A C    1  
ATOM 573   O O    . GLU A 1 39  ? 9.357   7.750   10.056  1.00 0.00 ? 39  GLU A O    1  
ATOM 574   C CB   . GLU A 1 39  ? 8.563   8.462   7.368   1.00 0.00 ? 39  GLU A CB   1  
ATOM 575   C CG   . GLU A 1 39  ? 9.818   9.169   6.830   1.00 0.00 ? 39  GLU A CG   1  
ATOM 576   C CD   . GLU A 1 39  ? 9.910   9.234   5.298   1.00 0.00 ? 39  GLU A CD   1  
ATOM 577   O OE1  . GLU A 1 39  ? 9.201   8.498   4.572   1.00 0.00 ? 39  GLU A OE1  1  
ATOM 578   O OE2  . GLU A 1 39  ? 10.719  10.042  4.783   1.00 0.00 ? 39  GLU A OE2  1  
ATOM 579   H H    . GLU A 1 39  ? 6.693   7.058   8.247   1.00 0.00 ? 39  GLU A H    1  
ATOM 580   H HA   . GLU A 1 39  ? 9.251   6.408   7.084   1.00 0.00 ? 39  GLU A HA   1  
ATOM 581   H HB2  . GLU A 1 39  ? 7.775   8.510   6.618   1.00 0.00 ? 39  GLU A HB2  1  
ATOM 582   H HB3  . GLU A 1 39  ? 8.215   9.027   8.223   1.00 0.00 ? 39  GLU A HB3  1  
ATOM 583   H HG2  . GLU A 1 39  ? 9.799   10.192  7.199   1.00 0.00 ? 39  GLU A HG2  1  
ATOM 584   H HG3  . GLU A 1 39  ? 10.713  8.704   7.240   1.00 0.00 ? 39  GLU A HG3  1  
ATOM 585   N N    . VAL A 1 40  ? 10.354  5.891   9.267   1.00 0.00 ? 40  VAL A N    1  
ATOM 586   C CA   . VAL A 1 40  ? 11.108  5.599   10.475  1.00 0.00 ? 40  VAL A CA   1  
ATOM 587   C C    . VAL A 1 40  ? 12.149  6.695   10.682  1.00 0.00 ? 40  VAL A C    1  
ATOM 588   O O    . VAL A 1 40  ? 13.214  6.730   10.052  1.00 0.00 ? 40  VAL A O    1  
ATOM 589   C CB   . VAL A 1 40  ? 11.690  4.180   10.448  1.00 0.00 ? 40  VAL A CB   1  
ATOM 590   C CG1  . VAL A 1 40  ? 12.557  3.888   11.674  1.00 0.00 ? 40  VAL A CG1  1  
ATOM 591   C CG2  . VAL A 1 40  ? 10.558  3.151   10.433  1.00 0.00 ? 40  VAL A CG2  1  
ATOM 592   H H    . VAL A 1 40  ? 10.391  5.258   8.484   1.00 0.00 ? 40  VAL A H    1  
ATOM 593   H HA   . VAL A 1 40  ? 10.402  5.636   11.305  1.00 0.00 ? 40  VAL A HA   1  
ATOM 594   H HB   . VAL A 1 40  ? 12.303  4.047   9.564   1.00 0.00 ? 40  VAL A HB   1  
ATOM 595   H HG11 . VAL A 1 40  ? 13.396  4.574   11.708  1.00 0.00 ? 40  VAL A HG11 1  
ATOM 596   H HG12 . VAL A 1 40  ? 11.972  3.990   12.587  1.00 0.00 ? 40  VAL A HG12 1  
ATOM 597   H HG13 . VAL A 1 40  ? 12.951  2.879   11.599  1.00 0.00 ? 40  VAL A HG13 1  
ATOM 598   H HG21 . VAL A 1 40  ? 10.985  2.153   10.373  1.00 0.00 ? 40  VAL A HG21 1  
ATOM 599   H HG22 . VAL A 1 40  ? 9.955   3.231   11.338  1.00 0.00 ? 40  VAL A HG22 1  
ATOM 600   H HG23 . VAL A 1 40  ? 9.903   3.312   9.578   1.00 0.00 ? 40  VAL A HG23 1  
ATOM 601   N N    . ARG A 1 41  ? 11.821  7.602   11.598  1.00 0.00 ? 41  ARG A N    1  
ATOM 602   C CA   . ARG A 1 41  ? 12.617  8.740   11.978  1.00 0.00 ? 41  ARG A CA   1  
ATOM 603   C C    . ARG A 1 41  ? 12.900  8.659   13.473  1.00 0.00 ? 41  ARG A C    1  
ATOM 604   O O    . ARG A 1 41  ? 12.188  9.289   14.257  1.00 0.00 ? 41  ARG A O    1  
ATOM 605   C CB   . ARG A 1 41  ? 11.854  10.013  11.609  1.00 0.00 ? 41  ARG A CB   1  
ATOM 606   C CG   . ARG A 1 41  ? 11.669  10.245  10.104  1.00 0.00 ? 41  ARG A CG   1  
ATOM 607   C CD   . ARG A 1 41  ? 10.563  11.292  9.901   1.00 0.00 ? 41  ARG A CD   1  
ATOM 608   N NE   . ARG A 1 41  ? 10.832  12.237  8.803   1.00 0.00 ? 41  ARG A NE   1  
ATOM 609   C CZ   . ARG A 1 41  ? 9.956   13.140  8.338   1.00 0.00 ? 41  ARG A CZ   1  
ATOM 610   N NH1  . ARG A 1 41  ? 8.722   13.182  8.835   1.00 0.00 ? 41  ARG A NH1  1  
ATOM 611   N NH2  . ARG A 1 41  ? 10.327  14.031  7.420   1.00 0.00 ? 41  ARG A NH2  1  
ATOM 612   H H    . ARG A 1 41  ? 10.868  7.591   11.942  1.00 0.00 ? 41  ARG A H    1  
ATOM 613   H HA   . ARG A 1 41  ? 13.543  8.702   11.423  1.00 0.00 ? 41  ARG A HA   1  
ATOM 614   H HB2  . ARG A 1 41  ? 10.873  9.982   12.084  1.00 0.00 ? 41  ARG A HB2  1  
ATOM 615   H HB3  . ARG A 1 41  ? 12.410  10.852  12.017  1.00 0.00 ? 41  ARG A HB3  1  
ATOM 616   H HG2  . ARG A 1 41  ? 12.619  10.571  9.698   1.00 0.00 ? 41  ARG A HG2  1  
ATOM 617   H HG3  . ARG A 1 41  ? 11.380  9.328   9.594   1.00 0.00 ? 41  ARG A HG3  1  
ATOM 618   H HD2  . ARG A 1 41  ? 9.624   10.767  9.720   1.00 0.00 ? 41  ARG A HD2  1  
ATOM 619   H HD3  . ARG A 1 41  ? 10.456  11.875  10.816  1.00 0.00 ? 41  ARG A HD3  1  
ATOM 620   H HE   . ARG A 1 41  ? 11.797  12.269  8.486   1.00 0.00 ? 41  ARG A HE   1  
ATOM 621   H HH11 . ARG A 1 41  ? 8.450   12.566  9.605   1.00 0.00 ? 41  ARG A HH11 1  
ATOM 622   H HH12 . ARG A 1 41  ? 8.016   13.861  8.580   1.00 0.00 ? 41  ARG A HH12 1  
ATOM 623   H HH21 . ARG A 1 41  ? 11.299  14.107  7.117   1.00 0.00 ? 41  ARG A HH21 1  
ATOM 624   H HH22 . ARG A 1 41  ? 9.692   14.730  7.059   1.00 0.00 ? 41  ARG A HH22 1  
ATOM 625   N N    . GLN A 1 42  ? 13.943  7.924   13.873  1.00 0.00 ? 42  GLN A N    1  
ATOM 626   C CA   . GLN A 1 42  ? 14.395  7.907   15.268  1.00 0.00 ? 42  GLN A CA   1  
ATOM 627   C C    . GLN A 1 42  ? 14.746  9.349   15.616  1.00 0.00 ? 42  GLN A C    1  
ATOM 628   O O    . GLN A 1 42  ? 15.706  9.870   15.052  1.00 0.00 ? 42  GLN A O    1  
ATOM 629   C CB   . GLN A 1 42  ? 15.619  6.989   15.490  1.00 0.00 ? 42  GLN A CB   1  
ATOM 630   C CG   . GLN A 1 42  ? 16.017  6.891   16.979  1.00 0.00 ? 42  GLN A CG   1  
ATOM 631   C CD   . GLN A 1 42  ? 17.522  6.703   17.201  1.00 0.00 ? 42  GLN A CD   1  
ATOM 632   O OE1  . GLN A 1 42  ? 18.057  5.592   17.160  1.00 0.00 ? 42  GLN A OE1  1  
ATOM 633   N NE2  . GLN A 1 42  ? 18.244  7.781   17.465  1.00 0.00 ? 42  GLN A NE2  1  
ATOM 634   H H    . GLN A 1 42  ? 14.531  7.544   13.150  1.00 0.00 ? 42  GLN A H    1  
ATOM 635   H HA   . GLN A 1 42  ? 13.572  7.559   15.893  1.00 0.00 ? 42  GLN A HA   1  
ATOM 636   H HB2  . GLN A 1 42  ? 15.389  5.987   15.137  1.00 0.00 ? 42  GLN A HB2  1  
ATOM 637   H HB3  . GLN A 1 42  ? 16.464  7.373   14.916  1.00 0.00 ? 42  GLN A HB3  1  
ATOM 638   H HG2  . GLN A 1 42  ? 15.710  7.793   17.511  1.00 0.00 ? 42  GLN A HG2  1  
ATOM 639   H HG3  . GLN A 1 42  ? 15.479  6.058   17.434  1.00 0.00 ? 42  GLN A HG3  1  
ATOM 640   H HE21 . GLN A 1 42  ? 17.808  8.706   17.504  1.00 0.00 ? 42  GLN A HE21 1  
ATOM 641   H HE22 . GLN A 1 42  ? 19.187  7.695   17.819  1.00 0.00 ? 42  GLN A HE22 1  
ATOM 642   N N    . GLY A 1 43  ? 13.954  10.006  16.464  1.00 0.00 ? 43  GLY A N    1  
ATOM 643   C CA   . GLY A 1 43  ? 14.159  11.403  16.822  1.00 0.00 ? 43  GLY A CA   1  
ATOM 644   C C    . GLY A 1 43  ? 14.346  12.315  15.605  1.00 0.00 ? 43  GLY A C    1  
ATOM 645   O O    . GLY A 1 43  ? 15.144  13.247  15.661  1.00 0.00 ? 43  GLY A O    1  
ATOM 646   H H    . GLY A 1 43  ? 13.159  9.513   16.862  1.00 0.00 ? 43  GLY A H    1  
ATOM 647   H HA2  . GLY A 1 43  ? 13.303  11.751  17.402  1.00 0.00 ? 43  GLY A HA2  1  
ATOM 648   H HA3  . GLY A 1 43  ? 15.049  11.473  17.446  1.00 0.00 ? 43  GLY A HA3  1  
ATOM 649   N N    . GLY A 1 44  ? 13.678  12.055  14.478  1.00 0.00 ? 44  GLY A N    1  
ATOM 650   C CA   . GLY A 1 44  ? 13.693  12.993  13.364  1.00 0.00 ? 44  GLY A CA   1  
ATOM 651   C C    . GLY A 1 44  ? 14.926  12.916  12.462  1.00 0.00 ? 44  GLY A C    1  
ATOM 652   O O    . GLY A 1 44  ? 15.394  13.962  12.010  1.00 0.00 ? 44  GLY A O    1  
ATOM 653   H H    . GLY A 1 44  ? 12.998  11.303  14.486  1.00 0.00 ? 44  GLY A H    1  
ATOM 654   H HA2  . GLY A 1 44  ? 12.798  12.855  12.760  1.00 0.00 ? 44  GLY A HA2  1  
ATOM 655   H HA3  . GLY A 1 44  ? 13.654  14.001  13.778  1.00 0.00 ? 44  GLY A HA3  1  
ATOM 656   N N    . ARG A 1 45  ? 15.474  11.729  12.163  1.00 0.00 ? 45  ARG A N    1  
ATOM 657   C CA   . ARG A 1 45  ? 16.342  11.550  10.990  1.00 0.00 ? 45  ARG A CA   1  
ATOM 658   C C    . ARG A 1 45  ? 15.887  10.297  10.268  1.00 0.00 ? 45  ARG A C    1  
ATOM 659   O O    . ARG A 1 45  ? 15.642  9.294   10.931  1.00 0.00 ? 45  ARG A O    1  
ATOM 660   C CB   . ARG A 1 45  ? 17.846  11.417  11.312  1.00 0.00 ? 45  ARG A CB   1  
ATOM 661   C CG   . ARG A 1 45  ? 18.382  12.127  12.558  1.00 0.00 ? 45  ARG A CG   1  
ATOM 662   C CD   . ARG A 1 45  ? 18.094  11.316  13.827  1.00 0.00 ? 45  ARG A CD   1  
ATOM 663   N NE   . ARG A 1 45  ? 19.040  11.625  14.902  1.00 0.00 ? 45  ARG A NE   1  
ATOM 664   C CZ   . ARG A 1 45  ? 18.905  12.590  15.810  1.00 0.00 ? 45  ARG A CZ   1  
ATOM 665   N NH1  . ARG A 1 45  ? 17.831  13.357  15.833  1.00 0.00 ? 45  ARG A NH1  1  
ATOM 666   N NH2  . ARG A 1 45  ? 19.866  12.840  16.685  1.00 0.00 ? 45  ARG A NH2  1  
ATOM 667   H H    . ARG A 1 45  ? 15.138  10.877  12.597  1.00 0.00 ? 45  ARG A H    1  
ATOM 668   H HA   . ARG A 1 45  ? 16.207  12.405  10.324  1.00 0.00 ? 45  ARG A HA   1  
ATOM 669   H HB2  . ARG A 1 45  ? 18.105  10.359  11.395  1.00 0.00 ? 45  ARG A HB2  1  
ATOM 670   H HB3  . ARG A 1 45  ? 18.392  11.799  10.447  1.00 0.00 ? 45  ARG A HB3  1  
ATOM 671   H HG2  . ARG A 1 45  ? 19.459  12.218  12.440  1.00 0.00 ? 45  ARG A HG2  1  
ATOM 672   H HG3  . ARG A 1 45  ? 17.959  13.128  12.644  1.00 0.00 ? 45  ARG A HG3  1  
ATOM 673   H HD2  . ARG A 1 45  ? 17.083  11.533  14.157  1.00 0.00 ? 45  ARG A HD2  1  
ATOM 674   H HD3  . ARG A 1 45  ? 18.171  10.250  13.612  1.00 0.00 ? 45  ARG A HD3  1  
ATOM 675   H HE   . ARG A 1 45  ? 19.874  11.040  14.889  1.00 0.00 ? 45  ARG A HE   1  
ATOM 676   H HH11 . ARG A 1 45  ? 16.957  13.053  15.409  1.00 0.00 ? 45  ARG A HH11 1  
ATOM 677   H HH12 . ARG A 1 45  ? 17.721  14.142  16.474  1.00 0.00 ? 45  ARG A HH12 1  
ATOM 678   H HH21 . ARG A 1 45  ? 20.639  12.182  16.788  1.00 0.00 ? 45  ARG A HH21 1  
ATOM 679   H HH22 . ARG A 1 45  ? 19.686  13.446  17.481  1.00 0.00 ? 45  ARG A HH22 1  
ATOM 680   N N    . ARG A 1 46  ? 15.790  10.339  8.941   1.00 0.00 ? 46  ARG A N    1  
ATOM 681   C CA   . ARG A 1 46  ? 15.386  9.202   8.117   1.00 0.00 ? 46  ARG A CA   1  
ATOM 682   C C    . ARG A 1 46  ? 16.468  8.129   8.192   1.00 0.00 ? 46  ARG A C    1  
ATOM 683   O O    . ARG A 1 46  ? 17.576  8.342   7.691   1.00 0.00 ? 46  ARG A O    1  
ATOM 684   C CB   . ARG A 1 46  ? 15.181  9.663   6.660   1.00 0.00 ? 46  ARG A CB   1  
ATOM 685   C CG   . ARG A 1 46  ? 14.150  10.790  6.490   1.00 0.00 ? 46  ARG A CG   1  
ATOM 686   C CD   . ARG A 1 46  ? 14.111  11.268  5.032   1.00 0.00 ? 46  ARG A CD   1  
ATOM 687   N NE   . ARG A 1 46  ? 13.656  12.660  4.943   1.00 0.00 ? 46  ARG A NE   1  
ATOM 688   C CZ   . ARG A 1 46  ? 12.835  13.192  4.034   1.00 0.00 ? 46  ARG A CZ   1  
ATOM 689   N NH1  . ARG A 1 46  ? 12.289  12.471  3.061   1.00 0.00 ? 46  ARG A NH1  1  
ATOM 690   N NH2  . ARG A 1 46  ? 12.572  14.489  4.114   1.00 0.00 ? 46  ARG A NH2  1  
ATOM 691   H H    . ARG A 1 46  ? 16.061  11.184  8.463   1.00 0.00 ? 46  ARG A H    1  
ATOM 692   H HA   . ARG A 1 46  ? 14.460  8.773   8.516   1.00 0.00 ? 46  ARG A HA   1  
ATOM 693   H HB2  . ARG A 1 46  ? 16.138  10.019  6.274   1.00 0.00 ? 46  ARG A HB2  1  
ATOM 694   H HB3  . ARG A 1 46  ? 14.874  8.810   6.054   1.00 0.00 ? 46  ARG A HB3  1  
ATOM 695   H HG2  . ARG A 1 46  ? 13.161  10.440  6.792   1.00 0.00 ? 46  ARG A HG2  1  
ATOM 696   H HG3  . ARG A 1 46  ? 14.435  11.631  7.121   1.00 0.00 ? 46  ARG A HG3  1  
ATOM 697   H HD2  . ARG A 1 46  ? 15.109  11.213  4.596   1.00 0.00 ? 46  ARG A HD2  1  
ATOM 698   H HD3  . ARG A 1 46  ? 13.450  10.624  4.463   1.00 0.00 ? 46  ARG A HD3  1  
ATOM 699   H HE   . ARG A 1 46  ? 14.114  13.291  5.593   1.00 0.00 ? 46  ARG A HE   1  
ATOM 700   H HH11 . ARG A 1 46  ? 12.420  11.465  2.999   1.00 0.00 ? 46  ARG A HH11 1  
ATOM 701   H HH12 . ARG A 1 46  ? 11.667  12.889  2.377   1.00 0.00 ? 46  ARG A HH12 1  
ATOM 702   H HH21 . ARG A 1 46  ? 12.896  15.025  4.909   1.00 0.00 ? 46  ARG A HH21 1  
ATOM 703   H HH22 . ARG A 1 46  ? 11.950  14.955  3.462   1.00 0.00 ? 46  ARG A HH22 1  
ATOM 704   N N    . ILE A 1 47  ? 16.171  6.993   8.816   1.00 0.00 ? 47  ILE A N    1  
ATOM 705   C CA   . ILE A 1 47  ? 17.130  5.903   9.035   1.00 0.00 ? 47  ILE A CA   1  
ATOM 706   C C    . ILE A 1 47  ? 16.738  4.618   8.292   1.00 0.00 ? 47  ILE A C    1  
ATOM 707   O O    . ILE A 1 47  ? 17.559  3.705   8.172   1.00 0.00 ? 47  ILE A O    1  
ATOM 708   C CB   . ILE A 1 47  ? 17.316  5.662   10.547  1.00 0.00 ? 47  ILE A CB   1  
ATOM 709   C CG1  . ILE A 1 47  ? 15.964  5.493   11.260  1.00 0.00 ? 47  ILE A CG1  1  
ATOM 710   C CG2  . ILE A 1 47  ? 18.144  6.799   11.175  1.00 0.00 ? 47  ILE A CG2  1  
ATOM 711   C CD1  . ILE A 1 47  ? 16.104  4.923   12.667  1.00 0.00 ? 47  ILE A CD1  1  
ATOM 712   H H    . ILE A 1 47  ? 15.250  6.899   9.236   1.00 0.00 ? 47  ILE A H    1  
ATOM 713   H HA   . ILE A 1 47  ? 18.101  6.194   8.631   1.00 0.00 ? 47  ILE A HA   1  
ATOM 714   H HB   . ILE A 1 47  ? 17.868  4.731   10.669  1.00 0.00 ? 47  ILE A HB   1  
ATOM 715   H HG12 . ILE A 1 47  ? 15.456  6.455   11.330  1.00 0.00 ? 47  ILE A HG12 1  
ATOM 716   H HG13 . ILE A 1 47  ? 15.346  4.808   10.680  1.00 0.00 ? 47  ILE A HG13 1  
ATOM 717   H HG21 . ILE A 1 47  ? 18.403  6.556   12.204  1.00 0.00 ? 47  ILE A HG21 1  
ATOM 718   H HG22 . ILE A 1 47  ? 19.065  6.937   10.611  1.00 0.00 ? 47  ILE A HG22 1  
ATOM 719   H HG23 . ILE A 1 47  ? 17.585  7.732   11.163  1.00 0.00 ? 47  ILE A HG23 1  
ATOM 720   H HD11 . ILE A 1 47  ? 16.559  3.935   12.624  1.00 0.00 ? 47  ILE A HD11 1  
ATOM 721   H HD12 . ILE A 1 47  ? 16.717  5.585   13.272  1.00 0.00 ? 47  ILE A HD12 1  
ATOM 722   H HD13 . ILE A 1 47  ? 15.115  4.846   13.113  1.00 0.00 ? 47  ILE A HD13 1  
ATOM 723   N N    . GLY A 1 48  ? 15.523  4.559   7.749   1.00 0.00 ? 48  GLY A N    1  
ATOM 724   C CA   . GLY A 1 48  ? 14.968  3.400   7.078   1.00 0.00 ? 48  GLY A CA   1  
ATOM 725   C C    . GLY A 1 48  ? 13.452  3.575   7.010   1.00 0.00 ? 48  GLY A C    1  
ATOM 726   O O    . GLY A 1 48  ? 12.960  4.686   7.222   1.00 0.00 ? 48  GLY A O    1  
ATOM 727   H H    . GLY A 1 48  ? 14.853  5.311   7.866   1.00 0.00 ? 48  GLY A H    1  
ATOM 728   H HA2  . GLY A 1 48  ? 15.392  3.341   6.074   1.00 0.00 ? 48  GLY A HA2  1  
ATOM 729   H HA3  . GLY A 1 48  ? 15.211  2.498   7.643   1.00 0.00 ? 48  GLY A HA3  1  
ATOM 730   N N    . PHE A 1 49  ? 12.729  2.502   6.705   1.00 0.00 ? 49  PHE A N    1  
ATOM 731   C CA   . PHE A 1 49  ? 11.269  2.417   6.744   1.00 0.00 ? 49  PHE A CA   1  
ATOM 732   C C    . PHE A 1 49  ? 10.896  1.241   7.655   1.00 0.00 ? 49  PHE A C    1  
ATOM 733   O O    . PHE A 1 49  ? 11.773  0.426   7.969   1.00 0.00 ? 49  PHE A O    1  
ATOM 734   C CB   . PHE A 1 49  ? 10.721  2.171   5.328   1.00 0.00 ? 49  PHE A CB   1  
ATOM 735   C CG   . PHE A 1 49  ? 10.765  3.321   4.337   1.00 0.00 ? 49  PHE A CG   1  
ATOM 736   C CD1  . PHE A 1 49  ? 11.995  3.792   3.838   1.00 0.00 ? 49  PHE A CD1  1  
ATOM 737   C CD2  . PHE A 1 49  ? 9.565   3.882   3.855   1.00 0.00 ? 49  PHE A CD2  1  
ATOM 738   C CE1  . PHE A 1 49  ? 12.030  4.824   2.887   1.00 0.00 ? 49  PHE A CE1  1  
ATOM 739   C CE2  . PHE A 1 49  ? 9.599   4.908   2.893   1.00 0.00 ? 49  PHE A CE2  1  
ATOM 740   C CZ   . PHE A 1 49  ? 10.830  5.380   2.407   1.00 0.00 ? 49  PHE A CZ   1  
ATOM 741   H H    . PHE A 1 49  ? 13.204  1.616   6.590   1.00 0.00 ? 49  PHE A H    1  
ATOM 742   H HA   . PHE A 1 49  ? 10.835  3.335   7.147   1.00 0.00 ? 49  PHE A HA   1  
ATOM 743   H HB2  . PHE A 1 49  ? 11.264  1.338   4.888   1.00 0.00 ? 49  PHE A HB2  1  
ATOM 744   H HB3  . PHE A 1 49  ? 9.682   1.857   5.424   1.00 0.00 ? 49  PHE A HB3  1  
ATOM 745   H HD1  . PHE A 1 49  ? 12.926  3.371   4.183   1.00 0.00 ? 49  PHE A HD1  1  
ATOM 746   H HD2  . PHE A 1 49  ? 8.610   3.532   4.226   1.00 0.00 ? 49  PHE A HD2  1  
ATOM 747   H HE1  . PHE A 1 49  ? 12.989  5.189   2.548   1.00 0.00 ? 49  PHE A HE1  1  
ATOM 748   H HE2  . PHE A 1 49  ? 8.674   5.344   2.539   1.00 0.00 ? 49  PHE A HE2  1  
ATOM 749   H HZ   . PHE A 1 49  ? 10.849  6.186   1.686   1.00 0.00 ? 49  PHE A HZ   1  
ATOM 750   N N    . ASP A 1 50  ? 9.625   1.131   8.040   1.00 0.00 ? 50  ASP A N    1  
ATOM 751   C CA   . ASP A 1 50  ? 9.026   -0.047  8.684   1.00 0.00 ? 50  ASP A CA   1  
ATOM 752   C C    . ASP A 1 50  ? 7.871   -0.569  7.826   1.00 0.00 ? 50  ASP A C    1  
ATOM 753   O O    . ASP A 1 50  ? 7.609   -0.025  6.750   1.00 0.00 ? 50  ASP A O    1  
ATOM 754   C CB   . ASP A 1 50  ? 8.588   0.231   10.145  1.00 0.00 ? 50  ASP A CB   1  
ATOM 755   C CG   . ASP A 1 50  ? 7.373   1.143   10.360  1.00 0.00 ? 50  ASP A CG   1  
ATOM 756   O OD1  . ASP A 1 50  ? 6.759   1.590   9.375   1.00 0.00 ? 50  ASP A OD1  1  
ATOM 757   O OD2  . ASP A 1 50  ? 7.046   1.360   11.555  1.00 0.00 ? 50  ASP A OD2  1  
ATOM 758   H H    . ASP A 1 50  ? 8.956   1.849   7.761   1.00 0.00 ? 50  ASP A H    1  
ATOM 759   H HA   . ASP A 1 50  ? 9.776   -0.834  8.718   1.00 0.00 ? 50  ASP A HA   1  
ATOM 760   H HB2  . ASP A 1 50  ? 8.328   -0.718  10.605  1.00 0.00 ? 50  ASP A HB2  1  
ATOM 761   H HB3  . ASP A 1 50  ? 9.430   0.624   10.706  1.00 0.00 ? 50  ASP A HB3  1  
ATOM 762   N N    . VAL A 1 51  ? 7.192   -1.631  8.277   1.00 0.00 ? 51  VAL A N    1  
ATOM 763   C CA   . VAL A 1 51  ? 5.877   -1.977  7.748   1.00 0.00 ? 51  VAL A CA   1  
ATOM 764   C C    . VAL A 1 51  ? 4.927   -2.183  8.919   1.00 0.00 ? 51  VAL A C    1  
ATOM 765   O O    . VAL A 1 51  ? 4.924   -3.266  9.506   1.00 0.00 ? 51  VAL A O    1  
ATOM 766   C CB   . VAL A 1 51  ? 5.888   -3.217  6.822   1.00 0.00 ? 51  VAL A CB   1  
ATOM 767   C CG1  . VAL A 1 51  ? 5.182   -2.896  5.520   1.00 0.00 ? 51  VAL A CG1  1  
ATOM 768   C CG2  . VAL A 1 51  ? 7.218   -3.927  6.562   1.00 0.00 ? 51  VAL A CG2  1  
ATOM 769   H H    . VAL A 1 51  ? 7.492   -2.101  9.123   1.00 0.00 ? 51  VAL A H    1  
ATOM 770   H HA   . VAL A 1 51  ? 5.504   -1.122  7.183   1.00 0.00 ? 51  VAL A HA   1  
ATOM 771   H HB   . VAL A 1 51  ? 5.257   -3.960  7.274   1.00 0.00 ? 51  VAL A HB   1  
ATOM 772   H HG11 . VAL A 1 51  ? 5.823   -2.278  4.897   1.00 0.00 ? 51  VAL A HG11 1  
ATOM 773   H HG12 . VAL A 1 51  ? 4.936   -3.827  5.016   1.00 0.00 ? 51  VAL A HG12 1  
ATOM 774   H HG13 . VAL A 1 51  ? 4.262   -2.371  5.765   1.00 0.00 ? 51  VAL A HG13 1  
ATOM 775   H HG21 . VAL A 1 51  ? 7.039   -4.834  5.985   1.00 0.00 ? 51  VAL A HG21 1  
ATOM 776   H HG22 . VAL A 1 51  ? 7.897   -3.271  6.023   1.00 0.00 ? 51  VAL A HG22 1  
ATOM 777   H HG23 . VAL A 1 51  ? 7.662   -4.233  7.507   1.00 0.00 ? 51  VAL A HG23 1  
ATOM 778   N N    . VAL A 1 52  ? 4.151   -1.176  9.297   1.00 0.00 ? 52  VAL A N    1  
ATOM 779   C CA   . VAL A 1 52  ? 3.132   -1.310  10.323  1.00 0.00 ? 52  VAL A CA   1  
ATOM 780   C C    . VAL A 1 52  ? 2.012   -2.193  9.771   1.00 0.00 ? 52  VAL A C    1  
ATOM 781   O O    . VAL A 1 52  ? 1.760   -2.214  8.571   1.00 0.00 ? 52  VAL A O    1  
ATOM 782   C CB   . VAL A 1 52  ? 2.617   0.077   10.762  1.00 0.00 ? 52  VAL A CB   1  
ATOM 783   C CG1  . VAL A 1 52  ? 1.866   -0.040  12.096  1.00 0.00 ? 52  VAL A CG1  1  
ATOM 784   C CG2  . VAL A 1 52  ? 3.748   1.099   10.939  1.00 0.00 ? 52  VAL A CG2  1  
ATOM 785   H H    . VAL A 1 52  ? 4.074   -0.342  8.720   1.00 0.00 ? 52  VAL A H    1  
ATOM 786   H HA   . VAL A 1 52  ? 3.581   -1.800  11.179  1.00 0.00 ? 52  VAL A HA   1  
ATOM 787   H HB   . VAL A 1 52  ? 1.934   0.455   10.006  1.00 0.00 ? 52  VAL A HB   1  
ATOM 788   H HG11 . VAL A 1 52  ? 1.670   0.948   12.506  1.00 0.00 ? 52  VAL A HG11 1  
ATOM 789   H HG12 . VAL A 1 52  ? 0.905   -0.526  11.943  1.00 0.00 ? 52  VAL A HG12 1  
ATOM 790   H HG13 . VAL A 1 52  ? 2.451   -0.608  12.818  1.00 0.00 ? 52  VAL A HG13 1  
ATOM 791   H HG21 . VAL A 1 52  ? 4.530   0.679   11.567  1.00 0.00 ? 52  VAL A HG21 1  
ATOM 792   H HG22 . VAL A 1 52  ? 4.175   1.364   9.970   1.00 0.00 ? 52  VAL A HG22 1  
ATOM 793   H HG23 . VAL A 1 52  ? 3.376   2.016   11.389  1.00 0.00 ? 52  VAL A HG23 1  
ATOM 794   N N    . THR A 1 53  ? 1.316   -2.914  10.639  1.00 0.00 ? 53  THR A N    1  
ATOM 795   C CA   . THR A 1 53  ? 0.092   -3.647  10.338  1.00 0.00 ? 53  THR A CA   1  
ATOM 796   C C    . THR A 1 53  ? -1.008  -3.000  11.162  1.00 0.00 ? 53  THR A C    1  
ATOM 797   O O    . THR A 1 53  ? -0.716  -2.479  12.237  1.00 0.00 ? 53  THR A O    1  
ATOM 798   C CB   . THR A 1 53  ? 0.270   -5.128  10.711  1.00 0.00 ? 53  THR A CB   1  
ATOM 799   O OG1  . THR A 1 53  ? 0.780   -5.266  12.031  1.00 0.00 ? 53  THR A OG1  1  
ATOM 800   C CG2  . THR A 1 53  ? 1.251   -5.815  9.768   1.00 0.00 ? 53  THR A CG2  1  
ATOM 801   H H    . THR A 1 53  ? 1.553   -2.815  11.624  1.00 0.00 ? 53  THR A H    1  
ATOM 802   H HA   . THR A 1 53  ? -0.165  -3.566  9.279   1.00 0.00 ? 53  THR A HA   1  
ATOM 803   H HB   . THR A 1 53  ? -0.693  -5.633  10.638  1.00 0.00 ? 53  THR A HB   1  
ATOM 804   H HG1  . THR A 1 53  ? 1.491   -4.606  12.107  1.00 0.00 ? 53  THR A HG1  1  
ATOM 805   H HG21 . THR A 1 53  ? 1.288   -6.879  9.999   1.00 0.00 ? 53  THR A HG21 1  
ATOM 806   H HG22 . THR A 1 53  ? 0.915   -5.691  8.738   1.00 0.00 ? 53  THR A HG22 1  
ATOM 807   H HG23 . THR A 1 53  ? 2.246   -5.380  9.868   1.00 0.00 ? 53  THR A HG23 1  
ATOM 808   N N    . LEU A 1 54  ? -2.272  -3.091  10.745  1.00 0.00 ? 54  LEU A N    1  
ATOM 809   C CA   . LEU A 1 54  ? -3.376  -2.523  11.522  1.00 0.00 ? 54  LEU A CA   1  
ATOM 810   C C    . LEU A 1 54  ? -3.569  -3.254  12.868  1.00 0.00 ? 54  LEU A C    1  
ATOM 811   O O    . LEU A 1 54  ? -4.364  -2.815  13.695  1.00 0.00 ? 54  LEU A O    1  
ATOM 812   C CB   . LEU A 1 54  ? -4.672  -2.524  10.686  1.00 0.00 ? 54  LEU A CB   1  
ATOM 813   C CG   . LEU A 1 54  ? -4.738  -1.568  9.471   1.00 0.00 ? 54  LEU A CG   1  
ATOM 814   C CD1  . LEU A 1 54  ? -4.487  -0.095  9.818   1.00 0.00 ? 54  LEU A CD1  1  
ATOM 815   C CD2  . LEU A 1 54  ? -3.807  -1.923  8.317   1.00 0.00 ? 54  LEU A CD2  1  
ATOM 816   H H    . LEU A 1 54  ? -2.495  -3.555  9.871   1.00 0.00 ? 54  LEU A H    1  
ATOM 817   H HA   . LEU A 1 54  ? -3.124  -1.490  11.769  1.00 0.00 ? 54  LEU A HA   1  
ATOM 818   H HB2  . LEU A 1 54  ? -4.873  -3.543  10.350  1.00 0.00 ? 54  LEU A HB2  1  
ATOM 819   H HB3  . LEU A 1 54  ? -5.492  -2.246  11.348  1.00 0.00 ? 54  LEU A HB3  1  
ATOM 820   H HG   . LEU A 1 54  ? -5.744  -1.673  9.074   1.00 0.00 ? 54  LEU A HG   1  
ATOM 821   H HD11 . LEU A 1 54  ? -5.159  0.215   10.615  1.00 0.00 ? 54  LEU A HD11 1  
ATOM 822   H HD12 . LEU A 1 54  ? -3.456  0.056   10.141  1.00 0.00 ? 54  LEU A HD12 1  
ATOM 823   H HD13 . LEU A 1 54  ? -4.663  0.531   8.941   1.00 0.00 ? 54  LEU A HD13 1  
ATOM 824   H HD21 . LEU A 1 54  ? -2.763  -1.749  8.572   1.00 0.00 ? 54  LEU A HD21 1  
ATOM 825   H HD22 . LEU A 1 54  ? -3.964  -2.965  8.075   1.00 0.00 ? 54  LEU A HD22 1  
ATOM 826   H HD23 . LEU A 1 54  ? -4.061  -1.326  7.442   1.00 0.00 ? 54  LEU A HD23 1  
ATOM 827   N N    . SER A 1 55  ? -2.849  -4.353  13.106  1.00 0.00 ? 55  SER A N    1  
ATOM 828   C CA   . SER A 1 55  ? -2.735  -5.103  14.351  1.00 0.00 ? 55  SER A CA   1  
ATOM 829   C C    . SER A 1 55  ? -1.632  -4.526  15.270  1.00 0.00 ? 55  SER A C    1  
ATOM 830   O O    . SER A 1 55  ? -1.332  -5.092  16.326  1.00 0.00 ? 55  SER A O    1  
ATOM 831   C CB   . SER A 1 55  ? -2.477  -6.557  13.920  1.00 0.00 ? 55  SER A CB   1  
ATOM 832   O OG   . SER A 1 55  ? -2.365  -7.468  14.986  1.00 0.00 ? 55  SER A OG   1  
ATOM 833   H H    . SER A 1 55  ? -2.253  -4.674  12.362  1.00 0.00 ? 55  SER A H    1  
ATOM 834   H HA   . SER A 1 55  ? -3.685  -5.057  14.887  1.00 0.00 ? 55  SER A HA   1  
ATOM 835   H HB2  . SER A 1 55  ? -3.318  -6.877  13.307  1.00 0.00 ? 55  SER A HB2  1  
ATOM 836   H HB3  . SER A 1 55  ? -1.568  -6.607  13.319  1.00 0.00 ? 55  SER A HB3  1  
ATOM 837   H HG   . SER A 1 55  ? -2.470  -8.367  14.614  1.00 0.00 ? 55  SER A HG   1  
ATOM 838   N N    . GLY A 1 56  ? -0.978  -3.424  14.886  1.00 0.00 ? 56  GLY A N    1  
ATOM 839   C CA   . GLY A 1 56  ? 0.004   -2.731  15.707  1.00 0.00 ? 56  GLY A CA   1  
ATOM 840   C C    . GLY A 1 56  ? 1.387   -3.389  15.729  1.00 0.00 ? 56  GLY A C    1  
ATOM 841   O O    . GLY A 1 56  ? 2.263   -2.968  16.491  1.00 0.00 ? 56  GLY A O    1  
ATOM 842   H H    . GLY A 1 56  ? -1.212  -2.971  14.007  1.00 0.00 ? 56  GLY A H    1  
ATOM 843   H HA2  . GLY A 1 56  ? 0.110   -1.718  15.327  1.00 0.00 ? 56  GLY A HA2  1  
ATOM 844   H HA3  . GLY A 1 56  ? -0.386  -2.676  16.720  1.00 0.00 ? 56  GLY A HA3  1  
ATOM 845   N N    . THR A 1 57  ? 1.610   -4.433  14.931  1.00 0.00 ? 57  THR A N    1  
ATOM 846   C CA   . THR A 1 57  ? 2.922   -5.014  14.680  1.00 0.00 ? 57  THR A CA   1  
ATOM 847   C C    . THR A 1 57  ? 3.590   -4.105  13.648  1.00 0.00 ? 57  THR A C    1  
ATOM 848   O O    . THR A 1 57  ? 2.878   -3.544  12.814  1.00 0.00 ? 57  THR A O    1  
ATOM 849   C CB   . THR A 1 57  ? 2.770   -6.446  14.107  1.00 0.00 ? 57  THR A CB   1  
ATOM 850   O OG1  . THR A 1 57  ? 1.457   -6.975  14.251  1.00 0.00 ? 57  THR A OG1  1  
ATOM 851   C CG2  . THR A 1 57  ? 3.727   -7.413  14.806  1.00 0.00 ? 57  THR A CG2  1  
ATOM 852   H H    . THR A 1 57  ? 0.908   -4.693  14.264  1.00 0.00 ? 57  THR A H    1  
ATOM 853   H HA   . THR A 1 57  ? 3.510   -5.005  15.591  1.00 0.00 ? 57  THR A HA   1  
ATOM 854   H HB   . THR A 1 57  ? 3.006   -6.435  13.043  1.00 0.00 ? 57  THR A HB   1  
ATOM 855   H HG1  . THR A 1 57  ? 0.970   -6.666  13.466  1.00 0.00 ? 57  THR A HG1  1  
ATOM 856   H HG21 . THR A 1 57  ? 3.613   -8.410  14.381  1.00 0.00 ? 57  THR A HG21 1  
ATOM 857   H HG22 . THR A 1 57  ? 4.757   -7.087  14.662  1.00 0.00 ? 57  THR A HG22 1  
ATOM 858   H HG23 . THR A 1 57  ? 3.505   -7.457  15.873  1.00 0.00 ? 57  THR A HG23 1  
ATOM 859   N N    . ARG A 1 58  ? 4.920   -3.994  13.624  1.00 0.00 ? 58  ARG A N    1  
ATOM 860   C CA   . ARG A 1 58  ? 5.629   -3.294  12.564  1.00 0.00 ? 58  ARG A CA   1  
ATOM 861   C C    . ARG A 1 58  ? 6.950   -3.971  12.236  1.00 0.00 ? 58  ARG A C    1  
ATOM 862   O O    . ARG A 1 58  ? 7.666   -4.404  13.144  1.00 0.00 ? 58  ARG A O    1  
ATOM 863   C CB   . ARG A 1 58  ? 5.786   -1.786  12.815  1.00 0.00 ? 58  ARG A CB   1  
ATOM 864   C CG   . ARG A 1 58  ? 6.766   -1.346  13.907  1.00 0.00 ? 58  ARG A CG   1  
ATOM 865   C CD   . ARG A 1 58  ? 6.169   -1.489  15.304  1.00 0.00 ? 58  ARG A CD   1  
ATOM 866   N NE   . ARG A 1 58  ? 7.062   -0.933  16.334  1.00 0.00 ? 58  ARG A NE   1  
ATOM 867   C CZ   . ARG A 1 58  ? 6.691   -0.669  17.589  1.00 0.00 ? 58  ARG A CZ   1  
ATOM 868   N NH1  . ARG A 1 58  ? 5.424   -0.850  17.960  1.00 0.00 ? 58  ARG A NH1  1  
ATOM 869   N NH2  . ARG A 1 58  ? 7.574   -0.238  18.484  1.00 0.00 ? 58  ARG A NH2  1  
ATOM 870   H H    . ARG A 1 58  ? 5.487   -4.579  14.215  1.00 0.00 ? 58  ARG A H    1  
ATOM 871   H HA   . ARG A 1 58  ? 4.993   -3.394  11.700  1.00 0.00 ? 58  ARG A HA   1  
ATOM 872   H HB2  . ARG A 1 58  ? 6.145   -1.366  11.881  1.00 0.00 ? 58  ARG A HB2  1  
ATOM 873   H HB3  . ARG A 1 58  ? 4.811   -1.343  13.017  1.00 0.00 ? 58  ARG A HB3  1  
ATOM 874   H HG2  . ARG A 1 58  ? 7.686   -1.916  13.838  1.00 0.00 ? 58  ARG A HG2  1  
ATOM 875   H HG3  . ARG A 1 58  ? 7.007   -0.298  13.740  1.00 0.00 ? 58  ARG A HG3  1  
ATOM 876   H HD2  . ARG A 1 58  ? 5.216   -0.962  15.322  1.00 0.00 ? 58  ARG A HD2  1  
ATOM 877   H HD3  . ARG A 1 58  ? 5.995   -2.541  15.520  1.00 0.00 ? 58  ARG A HD3  1  
ATOM 878   H HE   . ARG A 1 58  ? 8.017   -0.756  16.021  1.00 0.00 ? 58  ARG A HE   1  
ATOM 879   H HH11 . ARG A 1 58  ? 4.749   -1.228  17.303  1.00 0.00 ? 58  ARG A HH11 1  
ATOM 880   H HH12 . ARG A 1 58  ? 5.113   -0.736  18.922  1.00 0.00 ? 58  ARG A HH12 1  
ATOM 881   H HH21 . ARG A 1 58  ? 8.491   0.106   18.206  1.00 0.00 ? 58  ARG A HH21 1  
ATOM 882   H HH22 . ARG A 1 58  ? 7.281   -0.019  19.440  1.00 0.00 ? 58  ARG A HH22 1  
ATOM 883   N N    . GLY A 1 59  ? 7.250   -4.098  10.945  1.00 0.00 ? 59  GLY A N    1  
ATOM 884   C CA   . GLY A 1 59  ? 8.410   -4.840  10.486  1.00 0.00 ? 59  GLY A CA   1  
ATOM 885   C C    . GLY A 1 59  ? 9.666   -3.996  10.429  1.00 0.00 ? 59  GLY A C    1  
ATOM 886   O O    . GLY A 1 59  ? 9.635   -2.783  10.646  1.00 0.00 ? 59  GLY A O    1  
ATOM 887   H H    . GLY A 1 59  ? 6.601   -3.756  10.231  1.00 0.00 ? 59  GLY A H    1  
ATOM 888   H HA2  . GLY A 1 59  ? 8.611   -5.705  11.123  1.00 0.00 ? 59  GLY A HA2  1  
ATOM 889   H HA3  . GLY A 1 59  ? 8.221   -5.186  9.474   1.00 0.00 ? 59  GLY A HA3  1  
ATOM 890   N N    . PRO A 1 60  ? 10.783  -4.638  10.086  1.00 0.00 ? 60  PRO A N    1  
ATOM 891   C CA   . PRO A 1 60  ? 11.804  -3.966  9.317   1.00 0.00 ? 60  PRO A CA   1  
ATOM 892   C C    . PRO A 1 60  ? 11.261  -3.703  7.908   1.00 0.00 ? 60  PRO A C    1  
ATOM 893   O O    . PRO A 1 60  ? 10.265  -4.293  7.495   1.00 0.00 ? 60  PRO A O    1  
ATOM 894   C CB   . PRO A 1 60  ? 12.982  -4.946  9.317   1.00 0.00 ? 60  PRO A CB   1  
ATOM 895   C CG   . PRO A 1 60  ? 12.375  -6.325  9.613   1.00 0.00 ? 60  PRO A CG   1  
ATOM 896   C CD   . PRO A 1 60  ? 10.910  -6.077  9.924   1.00 0.00 ? 60  PRO A CD   1  
ATOM 897   H HA   . PRO A 1 60  ? 12.069  -3.012  9.768   1.00 0.00 ? 60  PRO A HA   1  
ATOM 898   H HB2  . PRO A 1 60  ? 13.513  -4.943  8.364   1.00 0.00 ? 60  PRO A HB2  1  
ATOM 899   H HB3  . PRO A 1 60  ? 13.661  -4.682  10.127  1.00 0.00 ? 60  PRO A HB3  1  
ATOM 900   H HG2  . PRO A 1 60  ? 12.483  -6.999  8.762   1.00 0.00 ? 60  PRO A HG2  1  
ATOM 901   H HG3  . PRO A 1 60  ? 12.815  -6.748  10.512  1.00 0.00 ? 60  PRO A HG3  1  
ATOM 902   H HD2  . PRO A 1 60  ? 10.294  -6.417  9.089   1.00 0.00 ? 60  PRO A HD2  1  
ATOM 903   H HD3  . PRO A 1 60  ? 10.628  -6.602  10.838  1.00 0.00 ? 60  PRO A HD3  1  
ATOM 904   N N    . LEU A 1 61  ? 11.946  -2.875  7.130   1.00 0.00 ? 61  LEU A N    1  
ATOM 905   C CA   . LEU A 1 61  ? 11.738  -2.808  5.688   1.00 0.00 ? 61  LEU A CA   1  
ATOM 906   C C    . LEU A 1 61  ? 13.100  -2.582  5.068   1.00 0.00 ? 61  LEU A C    1  
ATOM 907   O O    . LEU A 1 61  ? 13.688  -3.525  4.532   1.00 0.00 ? 61  LEU A O    1  
ATOM 908   C CB   . LEU A 1 61  ? 10.674  -1.756  5.324   1.00 0.00 ? 61  LEU A CB   1  
ATOM 909   C CG   . LEU A 1 61  ? 10.325  -1.744  3.825   1.00 0.00 ? 61  LEU A CG   1  
ATOM 910   C CD1  . LEU A 1 61  ? 9.822   -3.097  3.308   1.00 0.00 ? 61  LEU A CD1  1  
ATOM 911   C CD2  . LEU A 1 61  ? 9.262   -0.689  3.513   1.00 0.00 ? 61  LEU A CD2  1  
ATOM 912   H H    . LEU A 1 61  ? 12.748  -2.396  7.528   1.00 0.00 ? 61  LEU A H    1  
ATOM 913   H HA   . LEU A 1 61  ? 11.391  -3.775  5.325   1.00 0.00 ? 61  LEU A HA   1  
ATOM 914   H HB2  . LEU A 1 61  ? 9.767   -1.963  5.892   1.00 0.00 ? 61  LEU A HB2  1  
ATOM 915   H HB3  . LEU A 1 61  ? 11.025  -0.770  5.619   1.00 0.00 ? 61  LEU A HB3  1  
ATOM 916   H HG   . LEU A 1 61  ? 11.215  -1.469  3.272   1.00 0.00 ? 61  LEU A HG   1  
ATOM 917   H HD11 . LEU A 1 61  ? 8.935   -3.408  3.865   1.00 0.00 ? 61  LEU A HD11 1  
ATOM 918   H HD12 . LEU A 1 61  ? 9.562   -3.007  2.257   1.00 0.00 ? 61  LEU A HD12 1  
ATOM 919   H HD13 . LEU A 1 61  ? 10.587  -3.867  3.383   1.00 0.00 ? 61  LEU A HD13 1  
ATOM 920   H HD21 . LEU A 1 61  ? 8.418   -0.815  4.191   1.00 0.00 ? 61  LEU A HD21 1  
ATOM 921   H HD22 . LEU A 1 61  ? 9.668   0.310   3.637   1.00 0.00 ? 61  LEU A HD22 1  
ATOM 922   H HD23 . LEU A 1 61  ? 8.910   -0.782  2.485   1.00 0.00 ? 61  LEU A HD23 1  
ATOM 923   N N    . SER A 1 62  ? 13.659  -1.393  5.264   1.00 0.00 ? 62  SER A N    1  
ATOM 924   C CA   . SER A 1 62  ? 15.000  -1.045  4.824   1.00 0.00 ? 62  SER A CA   1  
ATOM 925   C C    . SER A 1 62  ? 15.789  -0.462  5.981   1.00 0.00 ? 62  SER A C    1  
ATOM 926   O O    . SER A 1 62  ? 15.215  0.016   6.967   1.00 0.00 ? 62  SER A O    1  
ATOM 927   C CB   . SER A 1 62  ? 14.917  -0.039  3.667   1.00 0.00 ? 62  SER A CB   1  
ATOM 928   O OG   . SER A 1 62  ? 13.939  0.963   3.897   1.00 0.00 ? 62  SER A OG   1  
ATOM 929   H H    . SER A 1 62  ? 13.171  -0.698  5.813   1.00 0.00 ? 62  SER A H    1  
ATOM 930   H HA   . SER A 1 62  ? 15.504  -1.963  4.492   1.00 0.00 ? 62  SER A HA   1  
ATOM 931   H HB2  . SER A 1 62  ? 15.887  0.441   3.456   1.00 0.00 ? 62  SER A HB2  1  
ATOM 932   H HB3  . SER A 1 62  ? 14.623  -0.602  2.788   1.00 0.00 ? 62  SER A HB3  1  
ATOM 933   H HG   . SER A 1 62  ? 13.687  1.294   3.017   1.00 0.00 ? 62  SER A HG   1  
ATOM 934   N N    . ARG A 1 63  ? 17.109  -0.457  5.835   1.00 0.00 ? 63  ARG A N    1  
ATOM 935   C CA   . ARG A 1 63  ? 18.045  0.151   6.767   1.00 0.00 ? 63  ARG A CA   1  
ATOM 936   C C    . ARG A 1 63  ? 19.263  0.622   5.977   1.00 0.00 ? 63  ARG A C    1  
ATOM 937   O O    . ARG A 1 63  ? 19.386  0.317   4.788   1.00 0.00 ? 63  ARG A O    1  
ATOM 938   C CB   . ARG A 1 63  ? 18.379  -0.870  7.872   1.00 0.00 ? 63  ARG A CB   1  
ATOM 939   C CG   . ARG A 1 63  ? 19.152  -2.096  7.357   1.00 0.00 ? 63  ARG A CG   1  
ATOM 940   C CD   . ARG A 1 63  ? 19.066  -3.273  8.338   1.00 0.00 ? 63  ARG A CD   1  
ATOM 941   N NE   . ARG A 1 63  ? 20.278  -4.099  8.296   1.00 0.00 ? 63  ARG A NE   1  
ATOM 942   C CZ   . ARG A 1 63  ? 20.699  -4.858  7.283   1.00 0.00 ? 63  ARG A CZ   1  
ATOM 943   N NH1  . ARG A 1 63  ? 19.903  -5.199  6.280   1.00 0.00 ? 63  ARG A NH1  1  
ATOM 944   N NH2  . ARG A 1 63  ? 21.951  -5.284  7.288   1.00 0.00 ? 63  ARG A NH2  1  
ATOM 945   H H    . ARG A 1 63  ? 17.519  -0.857  4.994   1.00 0.00 ? 63  ARG A H    1  
ATOM 946   H HA   . ARG A 1 63  ? 17.567  1.020   7.227   1.00 0.00 ? 63  ARG A HA   1  
ATOM 947   H HB2  . ARG A 1 63  ? 18.971  -0.382  8.648   1.00 0.00 ? 63  ARG A HB2  1  
ATOM 948   H HB3  . ARG A 1 63  ? 17.444  -1.202  8.327   1.00 0.00 ? 63  ARG A HB3  1  
ATOM 949   H HG2  . ARG A 1 63  ? 18.761  -2.428  6.394   1.00 0.00 ? 63  ARG A HG2  1  
ATOM 950   H HG3  . ARG A 1 63  ? 20.191  -1.805  7.217   1.00 0.00 ? 63  ARG A HG3  1  
ATOM 951   H HD2  . ARG A 1 63  ? 18.944  -2.899  9.354   1.00 0.00 ? 63  ARG A HD2  1  
ATOM 952   H HD3  . ARG A 1 63  ? 18.200  -3.882  8.085   1.00 0.00 ? 63  ARG A HD3  1  
ATOM 953   H HE   . ARG A 1 63  ? 20.863  -4.073  9.125   1.00 0.00 ? 63  ARG A HE   1  
ATOM 954   H HH11 . ARG A 1 63  ? 18.923  -4.932  6.250   1.00 0.00 ? 63  ARG A HH11 1  
ATOM 955   H HH12 . ARG A 1 63  ? 20.256  -5.652  5.443   1.00 0.00 ? 63  ARG A HH12 1  
ATOM 956   H HH21 . ARG A 1 63  ? 22.630  -4.845  7.900   1.00 0.00 ? 63  ARG A HH21 1  
ATOM 957   H HH22 . ARG A 1 63  ? 22.309  -5.878  6.551   1.00 0.00 ? 63  ARG A HH22 1  
ATOM 958   N N    . VAL A 1 64  ? 20.139  1.395   6.612   1.00 0.00 ? 64  VAL A N    1  
ATOM 959   C CA   . VAL A 1 64  ? 21.373  1.883   6.003   1.00 0.00 ? 64  VAL A CA   1  
ATOM 960   C C    . VAL A 1 64  ? 22.247  0.685   5.589   1.00 0.00 ? 64  VAL A C    1  
ATOM 961   O O    . VAL A 1 64  ? 22.202  -0.378  6.218   1.00 0.00 ? 64  VAL A O    1  
ATOM 962   C CB   . VAL A 1 64  ? 22.035  2.857   7.008   1.00 0.00 ? 64  VAL A CB   1  
ATOM 963   C CG1  . VAL A 1 64  ? 23.517  3.176   6.753   1.00 0.00 ? 64  VAL A CG1  1  
ATOM 964   C CG2  . VAL A 1 64  ? 21.234  4.172   7.064   1.00 0.00 ? 64  VAL A CG2  1  
ATOM 965   H H    . VAL A 1 64  ? 20.004  1.581   7.593   1.00 0.00 ? 64  VAL A H    1  
ATOM 966   H HA   . VAL A 1 64  ? 21.114  2.429   5.096   1.00 0.00 ? 64  VAL A HA   1  
ATOM 967   H HB   . VAL A 1 64  ? 21.975  2.409   7.999   1.00 0.00 ? 64  VAL A HB   1  
ATOM 968   H HG11 . VAL A 1 64  ? 24.117  2.268   6.827   1.00 0.00 ? 64  VAL A HG11 1  
ATOM 969   H HG12 . VAL A 1 64  ? 23.660  3.601   5.762   1.00 0.00 ? 64  VAL A HG12 1  
ATOM 970   H HG13 . VAL A 1 64  ? 23.881  3.887   7.493   1.00 0.00 ? 64  VAL A HG13 1  
ATOM 971   H HG21 . VAL A 1 64  ? 21.699  4.863   7.767   1.00 0.00 ? 64  VAL A HG21 1  
ATOM 972   H HG22 . VAL A 1 64  ? 21.212  4.641   6.080   1.00 0.00 ? 64  VAL A HG22 1  
ATOM 973   H HG23 . VAL A 1 64  ? 20.211  3.983   7.388   1.00 0.00 ? 64  VAL A HG23 1  
ATOM 974   N N    . GLY A 1 65  ? 23.045  0.846   4.534   1.00 0.00 ? 65  GLY A N    1  
ATOM 975   C CA   . GLY A 1 65  ? 23.958  -0.144  4.013   1.00 0.00 ? 65  GLY A CA   1  
ATOM 976   C C    . GLY A 1 65  ? 24.645  0.421   2.775   1.00 0.00 ? 65  GLY A C    1  
ATOM 977   O O    . GLY A 1 65  ? 24.209  1.423   2.195   1.00 0.00 ? 65  GLY A O    1  
ATOM 978   H H    . GLY A 1 65  ? 23.105  1.711   4.015   1.00 0.00 ? 65  GLY A H    1  
ATOM 979   H HA2  . GLY A 1 65  ? 24.702  -0.385  4.773   1.00 0.00 ? 65  GLY A HA2  1  
ATOM 980   H HA3  . GLY A 1 65  ? 23.408  -1.044  3.737   1.00 0.00 ? 65  GLY A HA3  1  
ATOM 981   N N    . LEU A 1 66  ? 25.722  -0.248  2.374   1.00 0.00 ? 66  LEU A N    1  
ATOM 982   C CA   . LEU A 1 66  ? 26.451  0.023   1.139   1.00 0.00 ? 66  LEU A CA   1  
ATOM 983   C C    . LEU A 1 66  ? 25.545  -0.252  -0.062  1.00 0.00 ? 66  LEU A C    1  
ATOM 984   O O    . LEU A 1 66  ? 24.583  -1.017  0.048   1.00 0.00 ? 66  LEU A O    1  
ATOM 985   C CB   . LEU A 1 66  ? 27.703  -0.877  1.067   1.00 0.00 ? 66  LEU A CB   1  
ATOM 986   C CG   . LEU A 1 66  ? 28.962  -0.091  0.665   1.00 0.00 ? 66  LEU A CG   1  
ATOM 987   C CD1  . LEU A 1 66  ? 29.513  0.687   1.866   1.00 0.00 ? 66  LEU A CD1  1  
ATOM 988   C CD2  . LEU A 1 66  ? 30.046  -1.042  0.153   1.00 0.00 ? 66  LEU A CD2  1  
ATOM 989   H H    . LEU A 1 66  ? 25.971  -1.043  2.934   1.00 0.00 ? 66  LEU A H    1  
ATOM 990   H HA   . LEU A 1 66  ? 26.740  1.076   1.126   1.00 0.00 ? 66  LEU A HA   1  
ATOM 991   H HB2  . LEU A 1 66  ? 27.884  -1.366  2.026   1.00 0.00 ? 66  LEU A HB2  1  
ATOM 992   H HB3  . LEU A 1 66  ? 27.521  -1.661  0.331   1.00 0.00 ? 66  LEU A HB3  1  
ATOM 993   H HG   . LEU A 1 66  ? 28.706  0.599   -0.139  1.00 0.00 ? 66  LEU A HG   1  
ATOM 994   H HD11 . LEU A 1 66  ? 30.334  1.329   1.542   1.00 0.00 ? 66  LEU A HD11 1  
ATOM 995   H HD12 . LEU A 1 66  ? 28.735  1.318   2.295   1.00 0.00 ? 66  LEU A HD12 1  
ATOM 996   H HD13 . LEU A 1 66  ? 29.877  -0.000  2.630   1.00 0.00 ? 66  LEU A HD13 1  
ATOM 997   H HD21 . LEU A 1 66  ? 30.929  -0.465  -0.129  1.00 0.00 ? 66  LEU A HD21 1  
ATOM 998   H HD22 . LEU A 1 66  ? 30.321  -1.760  0.926   1.00 0.00 ? 66  LEU A HD22 1  
ATOM 999   H HD23 . LEU A 1 66  ? 29.686  -1.569  -0.727  1.00 0.00 ? 66  LEU A HD23 1  
ATOM 1000  N N    . GLU A 1 67  ? 25.876  0.296   -1.231  1.00 0.00 ? 67  GLU A N    1  
ATOM 1001  C CA   . GLU A 1 67  ? 25.233  -0.092  -2.470  1.00 0.00 ? 67  GLU A CA   1  
ATOM 1002  C C    . GLU A 1 67  ? 25.652  -1.531  -2.825  1.00 0.00 ? 67  GLU A C    1  
ATOM 1003  O O    . GLU A 1 67  ? 26.734  -1.982  -2.420  1.00 0.00 ? 67  GLU A O    1  
ATOM 1004  C CB   . GLU A 1 67  ? 25.547  0.920   -3.592  1.00 0.00 ? 67  GLU A CB   1  
ATOM 1005  C CG   . GLU A 1 67  ? 26.942  0.800   -4.228  1.00 0.00 ? 67  GLU A CG   1  
ATOM 1006  C CD   . GLU A 1 67  ? 27.009  1.550   -5.561  1.00 0.00 ? 67  GLU A CD   1  
ATOM 1007  O OE1  . GLU A 1 67  ? 26.828  2.783   -5.577  1.00 0.00 ? 67  GLU A OE1  1  
ATOM 1008  O OE2  . GLU A 1 67  ? 27.180  0.900   -6.623  1.00 0.00 ? 67  GLU A OE2  1  
ATOM 1009  H H    . GLU A 1 67  ? 26.689  0.867   -1.336  1.00 0.00 ? 67  GLU A H    1  
ATOM 1010  H HA   . GLU A 1 67  ? 24.160  -0.063  -2.284  1.00 0.00 ? 67  GLU A HA   1  
ATOM 1011  H HB2  . GLU A 1 67  ? 24.810  0.795   -4.383  1.00 0.00 ? 67  GLU A HB2  1  
ATOM 1012  H HB3  . GLU A 1 67  ? 25.419  1.930   -3.200  1.00 0.00 ? 67  GLU A HB3  1  
ATOM 1013  H HG2  . GLU A 1 67  ? 27.682  1.196   -3.534  1.00 0.00 ? 67  GLU A HG2  1  
ATOM 1014  H HG3  . GLU A 1 67  ? 27.177  -0.245  -4.426  1.00 0.00 ? 67  GLU A HG3  1  
ATOM 1015  N N    . PRO A 1 68  ? 24.833  -2.246  -3.607  1.00 0.00 ? 68  PRO A N    1  
ATOM 1016  C CA   . PRO A 1 68  ? 25.140  -3.592  -4.050  1.00 0.00 ? 68  PRO A CA   1  
ATOM 1017  C C    . PRO A 1 68  ? 26.277  -3.507  -5.066  1.00 0.00 ? 68  PRO A C    1  
ATOM 1018  O O    . PRO A 1 68  ? 26.150  -2.761  -6.040  1.00 0.00 ? 68  PRO A O    1  
ATOM 1019  C CB   . PRO A 1 68  ? 23.848  -4.139  -4.658  1.00 0.00 ? 68  PRO A CB   1  
ATOM 1020  C CG   . PRO A 1 68  ? 23.021  -2.902  -5.009  1.00 0.00 ? 68  PRO A CG   1  
ATOM 1021  C CD   . PRO A 1 68  ? 23.533  -1.812  -4.070  1.00 0.00 ? 68  PRO A CD   1  
ATOM 1022  H HA   . PRO A 1 68  ? 25.429  -4.202  -3.195  1.00 0.00 ? 68  PRO A HA   1  
ATOM 1023  H HB2  . PRO A 1 68  ? 24.040  -4.763  -5.532  1.00 0.00 ? 68  PRO A HB2  1  
ATOM 1024  H HB3  . PRO A 1 68  ? 23.323  -4.709  -3.901  1.00 0.00 ? 68  PRO A HB3  1  
ATOM 1025  H HG2  . PRO A 1 68  ? 23.236  -2.608  -6.038  1.00 0.00 ? 68  PRO A HG2  1  
ATOM 1026  H HG3  . PRO A 1 68  ? 21.953  -3.075  -4.878  1.00 0.00 ? 68  PRO A HG3  1  
ATOM 1027  H HD2  . PRO A 1 68  ? 23.593  -0.880  -4.625  1.00 0.00 ? 68  PRO A HD2  1  
ATOM 1028  H HD3  . PRO A 1 68  ? 22.917  -1.675  -3.184  1.00 0.00 ? 68  PRO A HD3  1  
ATOM 1029  N N    . PRO A 1 69  ? 27.396  -4.220  -4.868  1.00 0.00 ? 69  PRO A N    1  
ATOM 1030  C CA   . PRO A 1 69  ? 28.428  -4.297  -5.888  1.00 0.00 ? 69  PRO A CA   1  
ATOM 1031  C C    . PRO A 1 69  ? 27.871  -5.077  -7.089  1.00 0.00 ? 69  PRO A C    1  
ATOM 1032  O O    . PRO A 1 69  ? 26.937  -5.866  -6.927  1.00 0.00 ? 69  PRO A O    1  
ATOM 1033  C CB   . PRO A 1 69  ? 29.608  -5.033  -5.245  1.00 0.00 ? 69  PRO A CB   1  
ATOM 1034  C CG   . PRO A 1 69  ? 29.104  -5.501  -3.876  1.00 0.00 ? 69  PRO A CG   1  
ATOM 1035  C CD   . PRO A 1 69  ? 27.604  -5.263  -3.887  1.00 0.00 ? 69  PRO A CD   1  
ATOM 1036  H HA   . PRO A 1 69  ? 28.725  -3.291  -6.190  1.00 0.00 ? 69  PRO A HA   1  
ATOM 1037  H HB2  . PRO A 1 69  ? 29.912  -5.877  -5.865  1.00 0.00 ? 69  PRO A HB2  1  
ATOM 1038  H HB3  . PRO A 1 69  ? 30.449  -4.351  -5.117  1.00 0.00 ? 69  PRO A HB3  1  
ATOM 1039  H HG2  . PRO A 1 69  ? 29.328  -6.550  -3.693  1.00 0.00 ? 69  PRO A HG2  1  
ATOM 1040  H HG3  . PRO A 1 69  ? 29.533  -4.870  -3.098  1.00 0.00 ? 69  PRO A HG3  1  
ATOM 1041  H HD2  . PRO A 1 69  ? 27.087  -6.149  -4.242  1.00 0.00 ? 69  PRO A HD2  1  
ATOM 1042  H HD3  . PRO A 1 69  ? 27.257  -5.008  -2.886  1.00 0.00 ? 69  PRO A HD3  1  
ATOM 1043  N N    . PRO A 1 70  ? 28.490  -4.992  -8.276  1.00 0.00 ? 70  PRO A N    1  
ATOM 1044  C CA   . PRO A 1 70  ? 27.917  -5.574  -9.484  1.00 0.00 ? 70  PRO A CA   1  
ATOM 1045  C C    . PRO A 1 70  ? 27.835  -7.111  -9.454  1.00 0.00 ? 70  PRO A C    1  
ATOM 1046  O O    . PRO A 1 70  ? 27.161  -7.686  -10.311 1.00 0.00 ? 70  PRO A O    1  
ATOM 1047  C CB   . PRO A 1 70  ? 28.770  -5.043  -10.642 1.00 0.00 ? 70  PRO A CB   1  
ATOM 1048  C CG   . PRO A 1 70  ? 30.107  -4.695  -9.986  1.00 0.00 ? 70  PRO A CG   1  
ATOM 1049  C CD   . PRO A 1 70  ? 29.717  -4.274  -8.569  1.00 0.00 ? 70  PRO A CD   1  
ATOM 1050  H HA   . PRO A 1 70  ? 26.905  -5.185  -9.594  1.00 0.00 ? 70  PRO A HA   1  
ATOM 1051  H HB2  . PRO A 1 70  ? 28.890  -5.778  -11.440 1.00 0.00 ? 70  PRO A HB2  1  
ATOM 1052  H HB3  . PRO A 1 70  ? 28.314  -4.133  -11.035 1.00 0.00 ? 70  PRO A HB3  1  
ATOM 1053  H HG2  . PRO A 1 70  ? 30.731  -5.588  -9.941  1.00 0.00 ? 70  PRO A HG2  1  
ATOM 1054  H HG3  . PRO A 1 70  ? 30.622  -3.895  -10.518 1.00 0.00 ? 70  PRO A HG3  1  
ATOM 1055  H HD2  . PRO A 1 70  ? 30.513  -4.536  -7.872  1.00 0.00 ? 70  PRO A HD2  1  
ATOM 1056  H HD3  . PRO A 1 70  ? 29.525  -3.204  -8.523  1.00 0.00 ? 70  PRO A HD3  1  
ATOM 1057  N N    . GLY A 1 71  ? 28.481  -7.767  -8.480  1.00 0.00 ? 71  GLY A N    1  
ATOM 1058  C CA   . GLY A 1 71  ? 28.431  -9.206  -8.261  1.00 0.00 ? 71  GLY A CA   1  
ATOM 1059  C C    . GLY A 1 71  ? 27.353  -9.640  -7.263  1.00 0.00 ? 71  GLY A C    1  
ATOM 1060  O O    . GLY A 1 71  ? 26.708  -10.668 -7.486  1.00 0.00 ? 71  GLY A O    1  
ATOM 1061  H H    . GLY A 1 71  ? 28.963  -7.200  -7.803  1.00 0.00 ? 71  GLY A H    1  
ATOM 1062  H HA2  . GLY A 1 71  ? 28.268  -9.713  -9.209  1.00 0.00 ? 71  GLY A HA2  1  
ATOM 1063  H HA3  . GLY A 1 71  ? 29.397  -9.534  -7.879  1.00 0.00 ? 71  GLY A HA3  1  
ATOM 1064  N N    . LYS A 1 72  ? 27.157  -8.906  -6.159  1.00 0.00 ? 72  LYS A N    1  
ATOM 1065  C CA   . LYS A 1 72  ? 26.309  -9.310  -5.039  1.00 0.00 ? 72  LYS A CA   1  
ATOM 1066  C C    . LYS A 1 72  ? 25.007  -8.535  -5.143  1.00 0.00 ? 72  LYS A C    1  
ATOM 1067  O O    . LYS A 1 72  ? 24.982  -7.319  -4.968  1.00 0.00 ? 72  LYS A O    1  
ATOM 1068  C CB   . LYS A 1 72  ? 27.011  -9.014  -3.704  1.00 0.00 ? 72  LYS A CB   1  
ATOM 1069  C CG   . LYS A 1 72  ? 26.675  -9.983  -2.567  1.00 0.00 ? 72  LYS A CG   1  
ATOM 1070  C CD   . LYS A 1 72  ? 25.237  -9.974  -2.045  1.00 0.00 ? 72  LYS A CD   1  
ATOM 1071  C CE   . LYS A 1 72  ? 24.897  -8.614  -1.459  1.00 0.00 ? 72  LYS A CE   1  
ATOM 1072  N NZ   . LYS A 1 72  ? 24.430  -8.679  -0.061  1.00 0.00 ? 72  LYS A NZ   1  
ATOM 1073  H H    . LYS A 1 72  ? 27.561  -7.985  -6.087  1.00 0.00 ? 72  LYS A H    1  
ATOM 1074  H HA   . LYS A 1 72  ? 26.120  -10.383 -5.110  1.00 0.00 ? 72  LYS A HA   1  
ATOM 1075  H HB2  . LYS A 1 72  ? 28.093  -9.040  -3.848  1.00 0.00 ? 72  LYS A HB2  1  
ATOM 1076  H HB3  . LYS A 1 72  ? 26.722  -8.023  -3.388  1.00 0.00 ? 72  LYS A HB3  1  
ATOM 1077  H HG2  . LYS A 1 72  ? 26.873  -10.970 -2.933  1.00 0.00 ? 72  LYS A HG2  1  
ATOM 1078  H HG3  . LYS A 1 72  ? 27.349  -9.785  -1.733  1.00 0.00 ? 72  LYS A HG3  1  
ATOM 1079  H HD2  . LYS A 1 72  ? 24.555  -10.170 -2.861  1.00 0.00 ? 72  LYS A HD2  1  
ATOM 1080  H HD3  . LYS A 1 72  ? 25.128  -10.758 -1.295  1.00 0.00 ? 72  LYS A HD3  1  
ATOM 1081  H HE2  . LYS A 1 72  ? 25.809  -8.021  -1.504  1.00 0.00 ? 72  LYS A HE2  1  
ATOM 1082  H HE3  . LYS A 1 72  ? 24.139  -8.141  -2.082  1.00 0.00 ? 72  LYS A HE3  1  
ATOM 1083  H HZ1  . LYS A 1 72  ? 25.171  -9.001  0.551   1.00 0.00 ? 72  LYS A HZ1  1  
ATOM 1084  H HZ2  . LYS A 1 72  ? 24.189  -7.742  0.246   1.00 0.00 ? 72  LYS A HZ2  1  
ATOM 1085  H HZ3  . LYS A 1 72  ? 23.590  -9.248  0.052   1.00 0.00 ? 72  LYS A HZ3  1  
ATOM 1086  N N    . ARG A 1 73  ? 23.917  -9.233  -5.422  1.00 0.00 ? 73  ARG A N    1  
ATOM 1087  C CA   . ARG A 1 73  ? 22.622  -8.584  -5.543  1.00 0.00 ? 73  ARG A CA   1  
ATOM 1088  C C    . ARG A 1 73  ? 22.155  -8.141  -4.166  1.00 0.00 ? 73  ARG A C    1  
ATOM 1089  O O    . ARG A 1 73  ? 22.227  -8.923  -3.217  1.00 0.00 ? 73  ARG A O    1  
ATOM 1090  C CB   . ARG A 1 73  ? 21.596  -9.513  -6.215  1.00 0.00 ? 73  ARG A CB   1  
ATOM 1091  C CG   . ARG A 1 73  ? 20.373  -8.742  -6.751  1.00 0.00 ? 73  ARG A CG   1  
ATOM 1092  C CD   . ARG A 1 73  ? 20.739  -7.646  -7.765  1.00 0.00 ? 73  ARG A CD   1  
ATOM 1093  N NE   . ARG A 1 73  ? 21.560  -8.186  -8.861  1.00 0.00 ? 73  ARG A NE   1  
ATOM 1094  C CZ   . ARG A 1 73  ? 22.504  -7.538  -9.548  1.00 0.00 ? 73  ARG A CZ   1  
ATOM 1095  N NH1  . ARG A 1 73  ? 22.752  -6.250  -9.370  1.00 0.00 ? 73  ARG A NH1  1  
ATOM 1096  N NH2  . ARG A 1 73  ? 23.235  -8.203  -10.427 1.00 0.00 ? 73  ARG A NH2  1  
ATOM 1097  H H    . ARG A 1 73  ? 24.006  -10.236 -5.359  1.00 0.00 ? 73  ARG A H    1  
ATOM 1098  H HA   . ARG A 1 73  ? 22.791  -7.703  -6.160  1.00 0.00 ? 73  ARG A HA   1  
ATOM 1099  H HB2  . ARG A 1 73  ? 22.073  -10.042 -7.041  1.00 0.00 ? 73  ARG A HB2  1  
ATOM 1100  H HB3  . ARG A 1 73  ? 21.258  -10.261 -5.498  1.00 0.00 ? 73  ARG A HB3  1  
ATOM 1101  H HG2  . ARG A 1 73  ? 19.702  -9.453  -7.233  1.00 0.00 ? 73  ARG A HG2  1  
ATOM 1102  H HG3  . ARG A 1 73  ? 19.833  -8.286  -5.921  1.00 0.00 ? 73  ARG A HG3  1  
ATOM 1103  H HD2  . ARG A 1 73  ? 19.831  -7.216  -8.175  1.00 0.00 ? 73  ARG A HD2  1  
ATOM 1104  H HD3  . ARG A 1 73  ? 21.268  -6.842  -7.255  1.00 0.00 ? 73  ARG A HD3  1  
ATOM 1105  H HE   . ARG A 1 73  ? 21.422  -9.168  -9.082  1.00 0.00 ? 73  ARG A HE   1  
ATOM 1106  H HH11 . ARG A 1 73  ? 22.222  -5.646  -8.737  1.00 0.00 ? 73  ARG A HH11 1  
ATOM 1107  H HH12 . ARG A 1 73  ? 23.514  -5.818  -9.893  1.00 0.00 ? 73  ARG A HH12 1  
ATOM 1108  H HH21 . ARG A 1 73  ? 23.124  -9.205  -10.554 1.00 0.00 ? 73  ARG A HH21 1  
ATOM 1109  H HH22 . ARG A 1 73  ? 23.963  -7.710  -10.939 1.00 0.00 ? 73  ARG A HH22 1  
ATOM 1110  N N    . GLU A 1 74  ? 21.644  -6.921  -4.076  1.00 0.00 ? 74  GLU A N    1  
ATOM 1111  C CA   . GLU A 1 74  ? 20.886  -6.380  -2.959  1.00 0.00 ? 74  GLU A CA   1  
ATOM 1112  C C    . GLU A 1 74  ? 19.950  -5.313  -3.548  1.00 0.00 ? 74  GLU A C    1  
ATOM 1113  O O    . GLU A 1 74  ? 20.005  -5.046  -4.751  1.00 0.00 ? 74  GLU A O    1  
ATOM 1114  C CB   . GLU A 1 74  ? 21.838  -5.808  -1.893  1.00 0.00 ? 74  GLU A CB   1  
ATOM 1115  C CG   . GLU A 1 74  ? 21.584  -6.419  -0.512  1.00 0.00 ? 74  GLU A CG   1  
ATOM 1116  C CD   . GLU A 1 74  ? 22.615  -5.974  0.535   1.00 0.00 ? 74  GLU A CD   1  
ATOM 1117  O OE1  . GLU A 1 74  ? 23.837  -5.950  0.248   1.00 0.00 ? 74  GLU A OE1  1  
ATOM 1118  O OE2  . GLU A 1 74  ? 22.276  -5.791  1.725   1.00 0.00 ? 74  GLU A OE2  1  
ATOM 1119  H H    . GLU A 1 74  ? 21.586  -6.322  -4.893  1.00 0.00 ? 74  GLU A H    1  
ATOM 1120  H HA   . GLU A 1 74  ? 20.284  -7.184  -2.531  1.00 0.00 ? 74  GLU A HA   1  
ATOM 1121  H HB2  . GLU A 1 74  ? 22.872  -6.020  -2.169  1.00 0.00 ? 74  GLU A HB2  1  
ATOM 1122  H HB3  . GLU A 1 74  ? 21.707  -4.730  -1.836  1.00 0.00 ? 74  GLU A HB3  1  
ATOM 1123  H HG2  . GLU A 1 74  ? 20.575  -6.168  -0.181  1.00 0.00 ? 74  GLU A HG2  1  
ATOM 1124  H HG3  . GLU A 1 74  ? 21.647  -7.500  -0.612  1.00 0.00 ? 74  GLU A HG3  1  
ATOM 1125  N N    . CYS A 1 75  ? 19.081  -4.712  -2.731  1.00 0.00 ? 75  CYS A N    1  
ATOM 1126  C CA   . CYS A 1 75  ? 17.945  -3.926  -3.207  1.00 0.00 ? 75  CYS A CA   1  
ATOM 1127  C C    . CYS A 1 75  ? 17.973  -2.511  -2.622  1.00 0.00 ? 75  CYS A C    1  
ATOM 1128  O O    . CYS A 1 75  ? 17.232  -2.182  -1.694  1.00 0.00 ? 75  CYS A O    1  
ATOM 1129  C CB   . CYS A 1 75  ? 16.664  -4.674  -2.854  1.00 0.00 ? 75  CYS A CB   1  
ATOM 1130  S SG   . CYS A 1 75  ? 16.612  -6.255  -3.756  1.00 0.00 ? 75  CYS A SG   1  
ATOM 1131  H H    . CYS A 1 75  ? 19.118  -4.909  -1.742  1.00 0.00 ? 75  CYS A H    1  
ATOM 1132  H HA   . CYS A 1 75  ? 17.989  -3.838  -4.294  1.00 0.00 ? 75  CYS A HA   1  
ATOM 1133  H HB2  . CYS A 1 75  ? 16.638  -4.852  -1.778  1.00 0.00 ? 75  CYS A HB2  1  
ATOM 1134  H HB3  . CYS A 1 75  ? 15.804  -4.055  -3.119  1.00 0.00 ? 75  CYS A HB3  1  
ATOM 1135  H HG   . CYS A 1 75  ? 17.631  -6.844  -3.110  1.00 0.00 ? 75  CYS A HG   1  
ATOM 1136  N N    . ARG A 1 76  ? 18.870  -1.676  -3.138  1.00 0.00 ? 76  ARG A N    1  
ATOM 1137  C CA   . ARG A 1 76  ? 19.067  -0.297  -2.696  1.00 0.00 ? 76  ARG A CA   1  
ATOM 1138  C C    . ARG A 1 76  ? 18.036  0.586   -3.382  1.00 0.00 ? 76  ARG A C    1  
ATOM 1139  O O    . ARG A 1 76  ? 17.825  0.434   -4.582  1.00 0.00 ? 76  ARG A O    1  
ATOM 1140  C CB   . ARG A 1 76  ? 20.514  0.115   -3.009  1.00 0.00 ? 76  ARG A CB   1  
ATOM 1141  C CG   . ARG A 1 76  ? 20.836  1.616   -2.936  1.00 0.00 ? 76  ARG A CG   1  
ATOM 1142  C CD   . ARG A 1 76  ? 20.572  2.331   -4.280  1.00 0.00 ? 76  ARG A CD   1  
ATOM 1143  N NE   . ARG A 1 76  ? 21.808  2.828   -4.901  1.00 0.00 ? 76  ARG A NE   1  
ATOM 1144  C CZ   . ARG A 1 76  ? 22.518  2.245   -5.877  1.00 0.00 ? 76  ARG A CZ   1  
ATOM 1145  N NH1  . ARG A 1 76  ? 22.161  1.073   -6.401  1.00 0.00 ? 76  ARG A NH1  1  
ATOM 1146  N NH2  . ARG A 1 76  ? 23.610  2.857   -6.314  1.00 0.00 ? 76  ARG A NH2  1  
ATOM 1147  H H    . ARG A 1 76  ? 19.315  -1.966  -3.993  1.00 0.00 ? 76  ARG A H    1  
ATOM 1148  H HA   . ARG A 1 76  ? 18.914  -0.257  -1.623  1.00 0.00 ? 76  ARG A HA   1  
ATOM 1149  H HB2  . ARG A 1 76  ? 21.165  -0.410  -2.308  1.00 0.00 ? 76  ARG A HB2  1  
ATOM 1150  H HB3  . ARG A 1 76  ? 20.746  -0.227  -4.010  1.00 0.00 ? 76  ARG A HB3  1  
ATOM 1151  H HG2  . ARG A 1 76  ? 20.252  2.081   -2.141  1.00 0.00 ? 76  ARG A HG2  1  
ATOM 1152  H HG3  . ARG A 1 76  ? 21.889  1.729   -2.671  1.00 0.00 ? 76  ARG A HG3  1  
ATOM 1153  H HD2  . ARG A 1 76  ? 20.046  1.676   -4.974  1.00 0.00 ? 76  ARG A HD2  1  
ATOM 1154  H HD3  . ARG A 1 76  ? 19.929  3.187   -4.104  1.00 0.00 ? 76  ARG A HD3  1  
ATOM 1155  H HE   . ARG A 1 76  ? 22.118  3.731   -4.559  1.00 0.00 ? 76  ARG A HE   1  
ATOM 1156  H HH11 . ARG A 1 76  ? 21.286  0.595   -6.195  1.00 0.00 ? 76  ARG A HH11 1  
ATOM 1157  H HH12 . ARG A 1 76  ? 22.659  0.682   -7.199  1.00 0.00 ? 76  ARG A HH12 1  
ATOM 1158  H HH21 . ARG A 1 76  ? 23.881  3.789   -5.999  1.00 0.00 ? 76  ARG A HH21 1  
ATOM 1159  H HH22 . ARG A 1 76  ? 24.210  2.461   -7.038  1.00 0.00 ? 76  ARG A HH22 1  
ATOM 1160  N N    . VAL A 1 77  ? 17.454  1.541   -2.656  1.00 0.00 ? 77  VAL A N    1  
ATOM 1161  C CA   . VAL A 1 77  ? 16.413  2.426   -3.206  1.00 0.00 ? 77  VAL A CA   1  
ATOM 1162  C C    . VAL A 1 77  ? 16.965  3.825   -3.491  1.00 0.00 ? 77  VAL A C    1  
ATOM 1163  O O    . VAL A 1 77  ? 16.506  4.523   -4.399  1.00 0.00 ? 77  VAL A O    1  
ATOM 1164  C CB   . VAL A 1 77  ? 15.193  2.461   -2.264  1.00 0.00 ? 77  VAL A CB   1  
ATOM 1165  C CG1  . VAL A 1 77  ? 14.616  1.044   -2.096  1.00 0.00 ? 77  VAL A CG1  1  
ATOM 1166  C CG2  . VAL A 1 77  ? 15.516  3.109   -0.905  1.00 0.00 ? 77  VAL A CG2  1  
ATOM 1167  H H    . VAL A 1 77  ? 17.682  1.588   -1.664  1.00 0.00 ? 77  VAL A H    1  
ATOM 1168  H HA   . VAL A 1 77  ? 16.064  2.019   -4.158  1.00 0.00 ? 77  VAL A HA   1  
ATOM 1169  H HB   . VAL A 1 77  ? 14.423  3.073   -2.728  1.00 0.00 ? 77  VAL A HB   1  
ATOM 1170  H HG11 . VAL A 1 77  ? 14.281  0.679   -3.067  1.00 0.00 ? 77  VAL A HG11 1  
ATOM 1171  H HG12 . VAL A 1 77  ? 15.363  0.352   -1.710  1.00 0.00 ? 77  VAL A HG12 1  
ATOM 1172  H HG13 . VAL A 1 77  ? 13.761  1.073   -1.421  1.00 0.00 ? 77  VAL A HG13 1  
ATOM 1173  H HG21 . VAL A 1 77  ? 16.343  2.601   -0.416  1.00 0.00 ? 77  VAL A HG21 1  
ATOM 1174  H HG22 . VAL A 1 77  ? 15.777  4.156   -1.035  1.00 0.00 ? 77  VAL A HG22 1  
ATOM 1175  H HG23 . VAL A 1 77  ? 14.638  3.062   -0.261  1.00 0.00 ? 77  VAL A HG23 1  
ATOM 1176  N N    . GLY A 1 78  ? 17.991  4.221   -2.744  1.00 0.00 ? 78  GLY A N    1  
ATOM 1177  C CA   . GLY A 1 78  ? 18.735  5.455   -2.895  1.00 0.00 ? 78  GLY A CA   1  
ATOM 1178  C C    . GLY A 1 78  ? 19.949  5.296   -2.005  1.00 0.00 ? 78  GLY A C    1  
ATOM 1179  O O    . GLY A 1 78  ? 21.039  5.012   -2.499  1.00 0.00 ? 78  GLY A O    1  
ATOM 1180  H H    . GLY A 1 78  ? 18.344  3.575   -2.052  1.00 0.00 ? 78  GLY A H    1  
ATOM 1181  H HA2  . GLY A 1 78  ? 19.050  5.574   -3.929  1.00 0.00 ? 78  GLY A HA2  1  
ATOM 1182  H HA3  . GLY A 1 78  ? 18.136  6.311   -2.588  1.00 0.00 ? 78  GLY A HA3  1  
ATOM 1183  N N    . GLN A 1 79  ? 19.724  5.334   -0.690  1.00 0.00 ? 79  GLN A N    1  
ATOM 1184  C CA   . GLN A 1 79  ? 20.734  4.988   0.299   1.00 0.00 ? 79  GLN A CA   1  
ATOM 1185  C C    . GLN A 1 79  ? 20.423  3.653   0.979   1.00 0.00 ? 79  GLN A C    1  
ATOM 1186  O O    . GLN A 1 79  ? 21.293  2.787   0.978   1.00 0.00 ? 79  GLN A O    1  
ATOM 1187  C CB   . GLN A 1 79  ? 20.988  6.154   1.261   1.00 0.00 ? 79  GLN A CB   1  
ATOM 1188  C CG   . GLN A 1 79  ? 19.790  6.579   2.114   1.00 0.00 ? 79  GLN A CG   1  
ATOM 1189  C CD   . GLN A 1 79  ? 20.175  7.641   3.130   1.00 0.00 ? 79  GLN A CD   1  
ATOM 1190  O OE1  . GLN A 1 79  ? 19.896  8.827   2.956   1.00 0.00 ? 79  GLN A OE1  1  
ATOM 1191  N NE2  . GLN A 1 79  ? 20.832  7.238   4.203   1.00 0.00 ? 79  GLN A NE2  1  
ATOM 1192  H H    . GLN A 1 79  ? 18.813  5.623   -0.366  1.00 0.00 ? 79  GLN A H    1  
ATOM 1193  H HA   . GLN A 1 79  ? 21.682  4.838   -0.212  1.00 0.00 ? 79  GLN A HA   1  
ATOM 1194  H HB2  . GLN A 1 79  ? 21.806  5.874   1.919   1.00 0.00 ? 79  GLN A HB2  1  
ATOM 1195  H HB3  . GLN A 1 79  ? 21.327  7.010   0.680   1.00 0.00 ? 79  GLN A HB3  1  
ATOM 1196  H HG2  . GLN A 1 79  ? 18.994  6.961   1.476   1.00 0.00 ? 79  GLN A HG2  1  
ATOM 1197  H HG3  . GLN A 1 79  ? 19.416  5.723   2.667   1.00 0.00 ? 79  GLN A HG3  1  
ATOM 1198  H HE21 . GLN A 1 79  ? 21.123  6.269   4.287   1.00 0.00 ? 79  GLN A HE21 1  
ATOM 1199  H HE22 . GLN A 1 79  ? 20.899  7.841   5.019   1.00 0.00 ? 79  GLN A HE22 1  
ATOM 1200  N N    . TYR A 1 80  ? 19.217  3.445   1.519   1.00 0.00 ? 80  TYR A N    1  
ATOM 1201  C CA   . TYR A 1 80  ? 18.893  2.257   2.275   1.00 0.00 ? 80  TYR A CA   1  
ATOM 1202  C C    . TYR A 1 80  ? 18.784  1.074   1.327   1.00 0.00 ? 80  TYR A C    1  
ATOM 1203  O O    . TYR A 1 80  ? 18.587  1.255   0.114   1.00 0.00 ? 80  TYR A O    1  
ATOM 1204  C CB   . TYR A 1 80  ? 17.560  2.467   3.009   1.00 0.00 ? 80  TYR A CB   1  
ATOM 1205  C CG   . TYR A 1 80  ? 17.337  3.868   3.523   1.00 0.00 ? 80  TYR A CG   1  
ATOM 1206  C CD1  . TYR A 1 80  ? 17.847  4.246   4.776   1.00 0.00 ? 80  TYR A CD1  1  
ATOM 1207  C CD2  . TYR A 1 80  ? 16.700  4.807   2.691   1.00 0.00 ? 80  TYR A CD2  1  
ATOM 1208  C CE1  . TYR A 1 80  ? 17.733  5.575   5.206   1.00 0.00 ? 80  TYR A CE1  1  
ATOM 1209  C CE2  . TYR A 1 80  ? 16.582  6.142   3.123   1.00 0.00 ? 80  TYR A CE2  1  
ATOM 1210  C CZ   . TYR A 1 80  ? 17.108  6.533   4.378   1.00 0.00 ? 80  TYR A CZ   1  
ATOM 1211  O OH   . TYR A 1 80  ? 17.056  7.836   4.766   1.00 0.00 ? 80  TYR A OH   1  
ATOM 1212  H H    . TYR A 1 80  ? 18.438  4.079   1.523   1.00 0.00 ? 80  TYR A H    1  
ATOM 1213  H HA   . TYR A 1 80  ? 19.690  2.079   2.998   1.00 0.00 ? 80  TYR A HA   1  
ATOM 1214  H HB2  . TYR A 1 80  ? 16.744  2.236   2.328   1.00 0.00 ? 80  TYR A HB2  1  
ATOM 1215  H HB3  . TYR A 1 80  ? 17.504  1.773   3.845   1.00 0.00 ? 80  TYR A HB3  1  
ATOM 1216  H HD1  . TYR A 1 80  ? 18.347  3.522   5.406   1.00 0.00 ? 80  TYR A HD1  1  
ATOM 1217  H HD2  . TYR A 1 80  ? 16.344  4.490   1.711   1.00 0.00 ? 80  TYR A HD2  1  
ATOM 1218  H HE1  . TYR A 1 80  ? 18.142  5.843   6.166   1.00 0.00 ? 80  TYR A HE1  1  
ATOM 1219  H HE2  . TYR A 1 80  ? 16.115  6.876   2.486   1.00 0.00 ? 80  TYR A HE2  1  
ATOM 1220  H HH   . TYR A 1 80  ? 17.528  7.991   5.594   1.00 0.00 ? 80  TYR A HH   1  
ATOM 1221  N N    . VAL A 1 81  ? 18.840  -0.113  1.913   1.00 0.00 ? 81  VAL A N    1  
ATOM 1222  C CA   . VAL A 1 81  ? 18.698  -1.382  1.239   1.00 0.00 ? 81  VAL A CA   1  
ATOM 1223  C C    . VAL A 1 81  ? 17.455  -2.026  1.844   1.00 0.00 ? 81  VAL A C    1  
ATOM 1224  O O    . VAL A 1 81  ? 17.375  -2.175  3.065   1.00 0.00 ? 81  VAL A O    1  
ATOM 1225  C CB   . VAL A 1 81  ? 19.986  -2.215  1.398   1.00 0.00 ? 81  VAL A CB   1  
ATOM 1226  C CG1  . VAL A 1 81  ? 19.986  -3.332  0.354   1.00 0.00 ? 81  VAL A CG1  1  
ATOM 1227  C CG2  . VAL A 1 81  ? 21.274  -1.390  1.204   1.00 0.00 ? 81  VAL A CG2  1  
ATOM 1228  H H    . VAL A 1 81  ? 18.990  -0.160  2.918   1.00 0.00 ? 81  VAL A H    1  
ATOM 1229  H HA   . VAL A 1 81  ? 18.527  -1.203  0.183   1.00 0.00 ? 81  VAL A HA   1  
ATOM 1230  H HB   . VAL A 1 81  ? 20.014  -2.658  2.393   1.00 0.00 ? 81  VAL A HB   1  
ATOM 1231  H HG11 . VAL A 1 81  ? 20.877  -3.931  0.498   1.00 0.00 ? 81  VAL A HG11 1  
ATOM 1232  H HG12 . VAL A 1 81  ? 19.108  -3.965  0.478   1.00 0.00 ? 81  VAL A HG12 1  
ATOM 1233  H HG13 . VAL A 1 81  ? 20.005  -2.908  -0.648  1.00 0.00 ? 81  VAL A HG13 1  
ATOM 1234  H HG21 . VAL A 1 81  ? 22.144  -2.046  1.245   1.00 0.00 ? 81  VAL A HG21 1  
ATOM 1235  H HG22 . VAL A 1 81  ? 21.261  -0.878  0.241   1.00 0.00 ? 81  VAL A HG22 1  
ATOM 1236  H HG23 . VAL A 1 81  ? 21.382  -0.655  2.002   1.00 0.00 ? 81  VAL A HG23 1  
ATOM 1237  N N    . VAL A 1 82  ? 16.447  -2.308  1.016   1.00 0.00 ? 82  VAL A N    1  
ATOM 1238  C CA   . VAL A 1 82  ? 15.240  -3.004  1.425   1.00 0.00 ? 82  VAL A CA   1  
ATOM 1239  C C    . VAL A 1 82  ? 15.516  -4.505  1.443   1.00 0.00 ? 82  VAL A C    1  
ATOM 1240  O O    . VAL A 1 82  ? 16.584  -4.956  1.008   1.00 0.00 ? 82  VAL A O    1  
ATOM 1241  C CB   . VAL A 1 82  ? 14.068  -2.579  0.504   1.00 0.00 ? 82  VAL A CB   1  
ATOM 1242  C CG1  . VAL A 1 82  ? 13.779  -3.475  -0.697  1.00 0.00 ? 82  VAL A CG1  1  
ATOM 1243  C CG2  . VAL A 1 82  ? 12.804  -2.427  1.342   1.00 0.00 ? 82  VAL A CG2  1  
ATOM 1244  H H    . VAL A 1 82  ? 16.574  -2.205  0.015   1.00 0.00 ? 82  VAL A H    1  
ATOM 1245  H HA   . VAL A 1 82  ? 15.013  -2.707  2.446   1.00 0.00 ? 82  VAL A HA   1  
ATOM 1246  H HB   . VAL A 1 82  ? 14.297  -1.600  0.084   1.00 0.00 ? 82  VAL A HB   1  
ATOM 1247  H HG11 . VAL A 1 82  ? 13.066  -2.990  -1.365  1.00 0.00 ? 82  VAL A HG11 1  
ATOM 1248  H HG12 . VAL A 1 82  ? 14.702  -3.650  -1.240  1.00 0.00 ? 82  VAL A HG12 1  
ATOM 1249  H HG13 . VAL A 1 82  ? 13.363  -4.426  -0.364  1.00 0.00 ? 82  VAL A HG13 1  
ATOM 1250  H HG21 . VAL A 1 82  ? 11.941  -2.277  0.698   1.00 0.00 ? 82  VAL A HG21 1  
ATOM 1251  H HG22 . VAL A 1 82  ? 12.633  -3.306  1.968   1.00 0.00 ? 82  VAL A HG22 1  
ATOM 1252  H HG23 . VAL A 1 82  ? 12.930  -1.558  1.977   1.00 0.00 ? 82  VAL A HG23 1  
ATOM 1253  N N    . ASP A 1 83  ? 14.562  -5.292  1.935   1.00 0.00 ? 83  ASP A N    1  
ATOM 1254  C CA   . ASP A 1 83  ? 14.546  -6.720  1.676   1.00 0.00 ? 83  ASP A CA   1  
ATOM 1255  C C    . ASP A 1 83  ? 13.107  -7.200  1.562   1.00 0.00 ? 83  ASP A C    1  
ATOM 1256  O O    . ASP A 1 83  ? 12.222  -6.673  2.238   1.00 0.00 ? 83  ASP A O    1  
ATOM 1257  C CB   . ASP A 1 83  ? 15.328  -7.473  2.751   1.00 0.00 ? 83  ASP A CB   1  
ATOM 1258  C CG   . ASP A 1 83  ? 16.288  -8.453  2.071   1.00 0.00 ? 83  ASP A CG   1  
ATOM 1259  O OD1  . ASP A 1 83  ? 15.832  -9.277  1.242   1.00 0.00 ? 83  ASP A OD1  1  
ATOM 1260  O OD2  . ASP A 1 83  ? 17.517  -8.369  2.294   1.00 0.00 ? 83  ASP A OD2  1  
ATOM 1261  H H    . ASP A 1 83  ? 13.700  -4.912  2.306   1.00 0.00 ? 83  ASP A H    1  
ATOM 1262  H HA   . ASP A 1 83  ? 15.039  -6.899  0.724   1.00 0.00 ? 83  ASP A HA   1  
ATOM 1263  H HB2  . ASP A 1 83  ? 15.863  -6.735  3.364   1.00 0.00 ? 83  ASP A HB2  1  
ATOM 1264  H HB3  . ASP A 1 83  ? 14.651  -8.033  3.396   1.00 0.00 ? 83  ASP A HB3  1  
ATOM 1265  N N    . LEU A 1 84  ? 12.865  -8.194  0.707   1.00 0.00 ? 84  LEU A N    1  
ATOM 1266  C CA   . LEU A 1 84  ? 11.528  -8.749  0.478   1.00 0.00 ? 84  LEU A CA   1  
ATOM 1267  C C    . LEU A 1 84  ? 11.044  -9.516  1.705   1.00 0.00 ? 84  LEU A C    1  
ATOM 1268  O O    . LEU A 1 84  ? 9.858   -9.507  2.021   1.00 0.00 ? 84  LEU A O    1  
ATOM 1269  C CB   . LEU A 1 84  ? 11.542  -9.684  -0.746  1.00 0.00 ? 84  LEU A CB   1  
ATOM 1270  C CG   . LEU A 1 84  ? 11.224  -9.029  -2.104  1.00 0.00 ? 84  LEU A CG   1  
ATOM 1271  C CD1  . LEU A 1 84  ? 9.796   -8.492  -2.178  1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1272  C CD2  . LEU A 1 84  ? 12.168  -7.882  -2.460  1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1273  H H    . LEU A 1 84  ? 13.655  -8.605  0.226   1.00 0.00 ? 84  LEU A H    1  
ATOM 1274  H HA   . LEU A 1 84  ? 10.829  -7.931  0.313   1.00 0.00 ? 84  LEU A HA   1  
ATOM 1275  H HB2  . LEU A 1 84  ? 12.515  -10.170 -0.800  1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1276  H HB3  . LEU A 1 84  ? 10.811  -10.479 -0.583  1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1277  H HG   . LEU A 1 84  ? 11.331  -9.798  -2.870  1.00 0.00 ? 84  LEU A HG   1  
ATOM 1278  H HD11 . LEU A 1 84  ? 9.630   -8.145  -3.199  1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1279  H HD12 . LEU A 1 84  ? 9.100   -9.295  -1.931  1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1280  H HD13 . LEU A 1 84  ? 9.655   -7.659  -1.490  1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1281  H HD21 . LEU A 1 84  ? 11.893  -7.447  -3.420  1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1282  H HD22 . LEU A 1 84  ? 12.094  -7.091  -1.714  1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1283  H HD23 . LEU A 1 84  ? 13.174  -8.285  -2.547  1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1284  N N    . THR A 1 85  ? 11.963  -10.136 2.432   1.00 0.00 ? 85  THR A N    1  
ATOM 1285  C CA   . THR A 1 85  ? 11.661  -10.787 3.691   1.00 0.00 ? 85  THR A CA   1  
ATOM 1286  C C    . THR A 1 85  ? 11.203  -9.773  4.741   1.00 0.00 ? 85  THR A C    1  
ATOM 1287  O O    . THR A 1 85  ? 10.351  -10.110 5.561   1.00 0.00 ? 85  THR A O    1  
ATOM 1288  C CB   . THR A 1 85  ? 12.889  -11.593 4.124   1.00 0.00 ? 85  THR A CB   1  
ATOM 1289  O OG1  . THR A 1 85  ? 12.963  -12.760 3.336   1.00 0.00 ? 85  THR A OG1  1  
ATOM 1290  C CG2  . THR A 1 85  ? 12.863  -12.007 5.595   1.00 0.00 ? 85  THR A CG2  1  
ATOM 1291  H H    . THR A 1 85  ? 12.912  -10.119 2.097   1.00 0.00 ? 85  THR A H    1  
ATOM 1292  H HA   . THR A 1 85  ? 10.832  -11.470 3.523   1.00 0.00 ? 85  THR A HA   1  
ATOM 1293  H HB   . THR A 1 85  ? 13.784  -10.996 3.937   1.00 0.00 ? 85  THR A HB   1  
ATOM 1294  H HG1  . THR A 1 85  ? 12.068  -13.176 3.338   1.00 0.00 ? 85  THR A HG1  1  
ATOM 1295  H HG21 . THR A 1 85  ? 11.912  -12.487 5.831   1.00 0.00 ? 85  THR A HG21 1  
ATOM 1296  H HG22 . THR A 1 85  ? 13.672  -12.707 5.791   1.00 0.00 ? 85  THR A HG22 1  
ATOM 1297  H HG23 . THR A 1 85  ? 12.981  -11.120 6.224   1.00 0.00 ? 85  THR A HG23 1  
ATOM 1298  N N    . SER A 1 86  ? 11.705  -8.534  4.728   1.00 0.00 ? 86  SER A N    1  
ATOM 1299  C CA   . SER A 1 86  ? 11.301  -7.538  5.700   1.00 0.00 ? 86  SER A CA   1  
ATOM 1300  C C    . SER A 1 86  ? 9.795   -7.262  5.582   1.00 0.00 ? 86  SER A C    1  
ATOM 1301  O O    . SER A 1 86  ? 9.117   -7.096  6.595   1.00 0.00 ? 86  SER A O    1  
ATOM 1302  C CB   . SER A 1 86  ? 12.141  -6.286  5.481   1.00 0.00 ? 86  SER A CB   1  
ATOM 1303  O OG   . SER A 1 86  ? 13.512  -6.586  5.310   1.00 0.00 ? 86  SER A OG   1  
ATOM 1304  H H    . SER A 1 86  ? 12.377  -8.206  4.047   1.00 0.00 ? 86  SER A H    1  
ATOM 1305  H HA   . SER A 1 86  ? 11.509  -7.923  6.697   1.00 0.00 ? 86  SER A HA   1  
ATOM 1306  H HB2  . SER A 1 86  ? 11.778  -5.756  4.601   1.00 0.00 ? 86  SER A HB2  1  
ATOM 1307  H HB3  . SER A 1 86  ? 12.050  -5.660  6.357   1.00 0.00 ? 86  SER A HB3  1  
ATOM 1308  H HG   . SER A 1 86  ? 13.926  -5.828  4.878   1.00 0.00 ? 86  SER A HG   1  
ATOM 1309  N N    . PHE A 1 87  ? 9.267   -7.311  4.352   1.00 0.00 ? 87  PHE A N    1  
ATOM 1310  C CA   . PHE A 1 87  ? 7.837   -7.336  4.094   1.00 0.00 ? 87  PHE A CA   1  
ATOM 1311  C C    . PHE A 1 87  ? 7.231   -8.643  4.611   1.00 0.00 ? 87  PHE A C    1  
ATOM 1312  O O    . PHE A 1 87  ? 6.314   -8.597  5.430   1.00 0.00 ? 87  PHE A O    1  
ATOM 1313  C CB   . PHE A 1 87  ? 7.545   -7.178  2.595   1.00 0.00 ? 87  PHE A CB   1  
ATOM 1314  C CG   . PHE A 1 87  ? 7.487   -5.769  2.043   1.00 0.00 ? 87  PHE A CG   1  
ATOM 1315  C CD1  . PHE A 1 87  ? 6.538   -4.856  2.539   1.00 0.00 ? 87  PHE A CD1  1  
ATOM 1316  C CD2  . PHE A 1 87  ? 8.286   -5.411  0.940   1.00 0.00 ? 87  PHE A CD2  1  
ATOM 1317  C CE1  . PHE A 1 87  ? 6.389   -3.594  1.940   1.00 0.00 ? 87  PHE A CE1  1  
ATOM 1318  C CE2  . PHE A 1 87  ? 8.116   -4.160  0.323   1.00 0.00 ? 87  PHE A CE2  1  
ATOM 1319  C CZ   . PHE A 1 87  ? 7.166   -3.249  0.821   1.00 0.00 ? 87  PHE A CZ   1  
ATOM 1320  H H    . PHE A 1 87  ? 9.888   -7.526  3.585   1.00 0.00 ? 87  PHE A H    1  
ATOM 1321  H HA   . PHE A 1 87  ? 7.367   -6.517  4.635   1.00 0.00 ? 87  PHE A HA   1  
ATOM 1322  H HB2  . PHE A 1 87  ? 8.271   -7.756  2.025   1.00 0.00 ? 87  PHE A HB2  1  
ATOM 1323  H HB3  . PHE A 1 87  ? 6.562   -7.608  2.407   1.00 0.00 ? 87  PHE A HB3  1  
ATOM 1324  H HD1  . PHE A 1 87  ? 5.905   -5.125  3.370   1.00 0.00 ? 87  PHE A HD1  1  
ATOM 1325  H HD2  . PHE A 1 87  ? 9.013   -6.105  0.543   1.00 0.00 ? 87  PHE A HD2  1  
ATOM 1326  H HE1  . PHE A 1 87  ? 5.668   -2.890  2.334   1.00 0.00 ? 87  PHE A HE1  1  
ATOM 1327  H HE2  . PHE A 1 87  ? 8.725   -3.898  -0.529  1.00 0.00 ? 87  PHE A HE2  1  
ATOM 1328  H HZ   . PHE A 1 87  ? 7.029   -2.282  0.355   1.00 0.00 ? 87  PHE A HZ   1  
ATOM 1329  N N    . GLU A 1 88  ? 7.701   -9.801  4.125   1.00 0.00 ? 88  GLU A N    1  
ATOM 1330  C CA   . GLU A 1 88  ? 7.085   -11.114 4.364   1.00 0.00 ? 88  GLU A CA   1  
ATOM 1331  C C    . GLU A 1 88  ? 6.860   -11.423 5.853   1.00 0.00 ? 88  GLU A C    1  
ATOM 1332  O O    . GLU A 1 88  ? 5.948   -12.185 6.170   1.00 0.00 ? 88  GLU A O    1  
ATOM 1333  C CB   . GLU A 1 88  ? 7.859   -12.228 3.624   1.00 0.00 ? 88  GLU A CB   1  
ATOM 1334  C CG   . GLU A 1 88  ? 8.757   -13.117 4.502   1.00 0.00 ? 88  GLU A CG   1  
ATOM 1335  C CD   . GLU A 1 88  ? 9.474   -14.177 3.670   1.00 0.00 ? 88  GLU A CD   1  
ATOM 1336  O OE1  . GLU A 1 88  ? 8.845   -15.209 3.346   1.00 0.00 ? 88  GLU A OE1  1  
ATOM 1337  O OE2  . GLU A 1 88  ? 10.678  -14.011 3.366   1.00 0.00 ? 88  GLU A OE2  1  
ATOM 1338  H H    . GLU A 1 88  ? 8.484   -9.756  3.479   1.00 0.00 ? 88  GLU A H    1  
ATOM 1339  H HA   . GLU A 1 88  ? 6.092   -11.086 3.912   1.00 0.00 ? 88  GLU A HA   1  
ATOM 1340  H HB2  . GLU A 1 88  ? 7.125   -12.879 3.150   1.00 0.00 ? 88  GLU A HB2  1  
ATOM 1341  H HB3  . GLU A 1 88  ? 8.458   -11.788 2.825   1.00 0.00 ? 88  GLU A HB3  1  
ATOM 1342  H HG2  . GLU A 1 88  ? 9.489   -12.504 5.023   1.00 0.00 ? 88  GLU A HG2  1  
ATOM 1343  H HG3  . GLU A 1 88  ? 8.149   -13.630 5.249   1.00 0.00 ? 88  GLU A HG3  1  
ATOM 1344  N N    . GLN A 1 89  ? 7.628   -10.794 6.750   1.00 0.00 ? 89  GLN A N    1  
ATOM 1345  C CA   . GLN A 1 89  ? 7.469   -10.884 8.196   1.00 0.00 ? 89  GLN A CA   1  
ATOM 1346  C C    . GLN A 1 89  ? 6.035   -10.630 8.660   1.00 0.00 ? 89  GLN A C    1  
ATOM 1347  O O    . GLN A 1 89  ? 5.613   -11.192 9.674   1.00 0.00 ? 89  GLN A O    1  
ATOM 1348  C CB   . GLN A 1 89  ? 8.408   -9.875  8.883   1.00 0.00 ? 89  GLN A CB   1  
ATOM 1349  C CG   . GLN A 1 89  ? 9.898   -10.160 8.627   1.00 0.00 ? 89  GLN A CG   1  
ATOM 1350  C CD   . GLN A 1 89  ? 10.720  -10.370 9.896   1.00 0.00 ? 89  GLN A CD   1  
ATOM 1351  O OE1  . GLN A 1 89  ? 10.312  -11.067 10.820  1.00 0.00 ? 89  GLN A OE1  1  
ATOM 1352  N NE2  . GLN A 1 89  ? 11.907  -9.789  9.968   1.00 0.00 ? 89  GLN A NE2  1  
ATOM 1353  H H    . GLN A 1 89  ? 8.384   -10.225 6.383   1.00 0.00 ? 89  GLN A H    1  
ATOM 1354  H HA   . GLN A 1 89  ? 7.727   -11.892 8.499   1.00 0.00 ? 89  GLN A HA   1  
ATOM 1355  H HB2  . GLN A 1 89  ? 8.181   -8.876  8.511   1.00 0.00 ? 89  GLN A HB2  1  
ATOM 1356  H HB3  . GLN A 1 89  ? 8.205   -9.877  9.955   1.00 0.00 ? 89  GLN A HB3  1  
ATOM 1357  H HG2  . GLN A 1 89  ? 9.997   -11.054 8.016   1.00 0.00 ? 89  GLN A HG2  1  
ATOM 1358  H HG3  . GLN A 1 89  ? 10.311  -9.320  8.070   1.00 0.00 ? 89  GLN A HG3  1  
ATOM 1359  H HE21 . GLN A 1 89  ? 12.272  -9.277  9.184   1.00 0.00 ? 89  GLN A HE21 1  
ATOM 1360  H HE22 . GLN A 1 89  ? 12.511  -10.009 10.753  1.00 0.00 ? 89  GLN A HE22 1  
ATOM 1361  N N    . LEU A 1 90  ? 5.310   -9.723  7.998   1.00 0.00 ? 90  LEU A N    1  
ATOM 1362  C CA   . LEU A 1 90  ? 3.967   -9.340  8.416   1.00 0.00 ? 90  LEU A CA   1  
ATOM 1363  C C    . LEU A 1 90  ? 3.062   -9.034  7.224   1.00 0.00 ? 90  LEU A C    1  
ATOM 1364  O O    . LEU A 1 90  ? 1.883   -9.382  7.265   1.00 0.00 ? 90  LEU A O    1  
ATOM 1365  C CB   . LEU A 1 90  ? 3.985   -8.184  9.446   1.00 0.00 ? 90  LEU A CB   1  
ATOM 1366  C CG   . LEU A 1 90  ? 5.346   -7.586  9.862   1.00 0.00 ? 90  LEU A CG   1  
ATOM 1367  C CD1  . LEU A 1 90  ? 5.968   -6.696  8.785   1.00 0.00 ? 90  LEU A CD1  1  
ATOM 1368  C CD2  . LEU A 1 90  ? 5.227   -6.752  11.139  1.00 0.00 ? 90  LEU A CD2  1  
ATOM 1369  H H    . LEU A 1 90  ? 5.748   -9.221  7.231   1.00 0.00 ? 90  LEU A H    1  
ATOM 1370  H HA   . LEU A 1 90  ? 3.518   -10.201 8.913   1.00 0.00 ? 90  LEU A HA   1  
ATOM 1371  H HB2  . LEU A 1 90  ? 3.354   -7.380  9.081   1.00 0.00 ? 90  LEU A HB2  1  
ATOM 1372  H HB3  . LEU A 1 90  ? 3.512   -8.580  10.342  1.00 0.00 ? 90  LEU A HB3  1  
ATOM 1373  H HG   . LEU A 1 90  ? 6.043   -8.394  10.088  1.00 0.00 ? 90  LEU A HG   1  
ATOM 1374  H HD11 . LEU A 1 90  ? 7.049   -6.767  8.846   1.00 0.00 ? 90  LEU A HD11 1  
ATOM 1375  H HD12 . LEU A 1 90  ? 5.665   -7.008  7.788   1.00 0.00 ? 90  LEU A HD12 1  
ATOM 1376  H HD13 . LEU A 1 90  ? 5.663   -5.660  8.932   1.00 0.00 ? 90  LEU A HD13 1  
ATOM 1377  H HD21 . LEU A 1 90  ? 6.224   -6.466  11.464  1.00 0.00 ? 90  LEU A HD21 1  
ATOM 1378  H HD22 . LEU A 1 90  ? 4.646   -5.847  10.946  1.00 0.00 ? 90  LEU A HD22 1  
ATOM 1379  H HD23 . LEU A 1 90  ? 4.755   -7.342  11.922  1.00 0.00 ? 90  LEU A HD23 1  
ATOM 1380  N N    . ALA A 1 91  ? 3.600   -8.478  6.138   1.00 0.00 ? 91  ALA A N    1  
ATOM 1381  C CA   . ALA A 1 91  ? 2.886   -8.052  4.929   1.00 0.00 ? 91  ALA A CA   1  
ATOM 1382  C C    . ALA A 1 91  ? 2.590   -9.243  3.999   1.00 0.00 ? 91  ALA A C    1  
ATOM 1383  O O    . ALA A 1 91  ? 2.739   -9.146  2.779   1.00 0.00 ? 91  ALA A O    1  
ATOM 1384  C CB   . ALA A 1 91  ? 3.738   -6.993  4.212   1.00 0.00 ? 91  ALA A CB   1  
ATOM 1385  H H    . ALA A 1 91  ? 4.608   -8.349  6.141   1.00 0.00 ? 91  ALA A H    1  
ATOM 1386  H HA   . ALA A 1 91  ? 1.928   -7.598  5.216   1.00 0.00 ? 91  ALA A HA   1  
ATOM 1387  H HB1  . ALA A 1 91  ? 3.205   -6.614  3.344   1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1388  H HB2  . ALA A 1 91  ? 3.956   -6.161  4.879   1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1389  H HB3  . ALA A 1 91  ? 4.669   -7.433  3.866   1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1390  N N    . LEU A 1 92  ? 2.226   -10.395 4.566   1.00 0.00 ? 92  LEU A N    1  
ATOM 1391  C CA   . LEU A 1 92  ? 2.045   -11.666 3.864   1.00 0.00 ? 92  LEU A CA   1  
ATOM 1392  C C    . LEU A 1 92  ? 0.760   -12.353 4.338   1.00 0.00 ? 92  LEU A C    1  
ATOM 1393  O O    . LEU A 1 92  ? -0.088  -12.641 3.486   1.00 0.00 ? 92  LEU A O    1  
ATOM 1394  C CB   . LEU A 1 92  ? 3.311   -12.541 4.014   1.00 0.00 ? 92  LEU A CB   1  
ATOM 1395  C CG   . LEU A 1 92  ? 3.957   -13.043 2.711   1.00 0.00 ? 92  LEU A CG   1  
ATOM 1396  C CD1  . LEU A 1 92  ? 3.128   -14.127 2.031   1.00 0.00 ? 92  LEU A CD1  1  
ATOM 1397  C CD2  . LEU A 1 92  ? 4.246   -11.922 1.709   1.00 0.00 ? 92  LEU A CD2  1  
ATOM 1398  H H    . LEU A 1 92  ? 2.089   -10.373 5.570   1.00 0.00 ? 92  LEU A H    1  
ATOM 1399  H HA   . LEU A 1 92  ? 1.899   -11.448 2.808   1.00 0.00 ? 92  LEU A HA   1  
ATOM 1400  H HB2  . LEU A 1 92  ? 4.067   -11.969 4.546   1.00 0.00 ? 92  LEU A HB2  1  
ATOM 1401  H HB3  . LEU A 1 92  ? 3.097   -13.411 4.631   1.00 0.00 ? 92  LEU A HB3  1  
ATOM 1402  H HG   . LEU A 1 92  ? 4.909   -13.496 2.986   1.00 0.00 ? 92  LEU A HG   1  
ATOM 1403  H HD11 . LEU A 1 92  ? 2.162   -13.729 1.721   1.00 0.00 ? 92  LEU A HD11 1  
ATOM 1404  H HD12 . LEU A 1 92  ? 3.668   -14.488 1.157   1.00 0.00 ? 92  LEU A HD12 1  
ATOM 1405  H HD13 . LEU A 1 92  ? 2.980   -14.959 2.717   1.00 0.00 ? 92  LEU A HD13 1  
ATOM 1406  H HD21 . LEU A 1 92  ? 3.327   -11.610 1.209   1.00 0.00 ? 92  LEU A HD21 1  
ATOM 1407  H HD22 . LEU A 1 92  ? 4.669   -11.066 2.228   1.00 0.00 ? 92  LEU A HD22 1  
ATOM 1408  H HD23 . LEU A 1 92  ? 4.948   -12.279 0.958   1.00 0.00 ? 92  LEU A HD23 1  
ATOM 1409  N N    . PRO A 1 93  ? 0.556   -12.605 5.649   1.00 0.00 ? 93  PRO A N    1  
ATOM 1410  C CA   . PRO A 1 93  ? -0.733  -13.068 6.150   1.00 0.00 ? 93  PRO A CA   1  
ATOM 1411  C C    . PRO A 1 93  ? -1.809  -11.979 6.082   1.00 0.00 ? 93  PRO A C    1  
ATOM 1412  O O    . PRO A 1 93  ? -2.950  -12.297 5.757   1.00 0.00 ? 93  PRO A O    1  
ATOM 1413  C CB   . PRO A 1 93  ? -0.486  -13.518 7.591   1.00 0.00 ? 93  PRO A CB   1  
ATOM 1414  C CG   . PRO A 1 93  ? 0.742   -12.718 8.022   1.00 0.00 ? 93  PRO A CG   1  
ATOM 1415  C CD   . PRO A 1 93  ? 1.542   -12.633 6.727   1.00 0.00 ? 93  PRO A CD   1  
ATOM 1416  H HA   . PRO A 1 93  ? -1.074  -13.925 5.568   1.00 0.00 ? 93  PRO A HA   1  
ATOM 1417  H HB2  . PRO A 1 93  ? -1.346  -13.316 8.229   1.00 0.00 ? 93  PRO A HB2  1  
ATOM 1418  H HB3  . PRO A 1 93  ? -0.252  -14.583 7.599   1.00 0.00 ? 93  PRO A HB3  1  
ATOM 1419  H HG2  . PRO A 1 93  ? 0.443   -11.718 8.341   1.00 0.00 ? 93  PRO A HG2  1  
ATOM 1420  H HG3  . PRO A 1 93  ? 1.303   -13.226 8.807   1.00 0.00 ? 93  PRO A HG3  1  
ATOM 1421  H HD2  . PRO A 1 93  ? 2.190   -11.763 6.737   1.00 0.00 ? 93  PRO A HD2  1  
ATOM 1422  H HD3  . PRO A 1 93  ? 2.151   -13.532 6.635   1.00 0.00 ? 93  PRO A HD3  1  
ATOM 1423  N N    . VAL A 1 94  ? -1.467  -10.710 6.349   1.00 0.00 ? 94  VAL A N    1  
ATOM 1424  C CA   . VAL A 1 94  ? -2.430  -9.604  6.432   1.00 0.00 ? 94  VAL A CA   1  
ATOM 1425  C C    . VAL A 1 94  ? -3.264  -9.410  5.168   1.00 0.00 ? 94  VAL A C    1  
ATOM 1426  O O    . VAL A 1 94  ? -4.378  -8.892  5.251   1.00 0.00 ? 94  VAL A O    1  
ATOM 1427  C CB   . VAL A 1 94  ? -1.725  -8.279  6.767   1.00 0.00 ? 94  VAL A CB   1  
ATOM 1428  C CG1  . VAL A 1 94  ? -1.348  -8.191  8.239   1.00 0.00 ? 94  VAL A CG1  1  
ATOM 1429  C CG2  . VAL A 1 94  ? -0.564  -7.948  5.828   1.00 0.00 ? 94  VAL A CG2  1  
ATOM 1430  H H    . VAL A 1 94  ? -0.516  -10.502 6.623   1.00 0.00 ? 94  VAL A H    1  
ATOM 1431  H HA   . VAL A 1 94  ? -3.129  -9.839  7.234   1.00 0.00 ? 94  VAL A HA   1  
ATOM 1432  H HB   . VAL A 1 94  ? -2.426  -7.477  6.622   1.00 0.00 ? 94  VAL A HB   1  
ATOM 1433  H HG11 . VAL A 1 94  ? -2.247  -8.374  8.829   1.00 0.00 ? 94  VAL A HG11 1  
ATOM 1434  H HG12 . VAL A 1 94  ? -0.566  -8.906  8.490   1.00 0.00 ? 94  VAL A HG12 1  
ATOM 1435  H HG13 . VAL A 1 94  ? -1.028  -7.170  8.447   1.00 0.00 ? 94  VAL A HG13 1  
ATOM 1436  H HG21 . VAL A 1 94  ? -0.022  -7.087  6.217   1.00 0.00 ? 94  VAL A HG21 1  
ATOM 1437  H HG22 . VAL A 1 94  ? 0.110   -8.790  5.725   1.00 0.00 ? 94  VAL A HG22 1  
ATOM 1438  H HG23 . VAL A 1 94  ? -0.957  -7.699  4.842   1.00 0.00 ? 94  VAL A HG23 1  
ATOM 1439  N N    . LEU A 1 95  ? -2.758  -9.844  4.015   1.00 0.00 ? 95  LEU A N    1  
ATOM 1440  C CA   . LEU A 1 95  ? -3.503  -9.830  2.770   1.00 0.00 ? 95  LEU A CA   1  
ATOM 1441  C C    . LEU A 1 95  ? -4.765  -10.686 2.887   1.00 0.00 ? 95  LEU A C    1  
ATOM 1442  O O    . LEU A 1 95  ? -5.840  -10.293 2.430   1.00 0.00 ? 95  LEU A O    1  
ATOM 1443  C CB   . LEU A 1 95  ? -2.602  -10.358 1.638   1.00 0.00 ? 95  LEU A CB   1  
ATOM 1444  C CG   . LEU A 1 95  ? -1.613  -9.372  0.986   1.00 0.00 ? 95  LEU A CG   1  
ATOM 1445  C CD1  . LEU A 1 95  ? -2.140  -7.945  0.864   1.00 0.00 ? 95  LEU A CD1  1  
ATOM 1446  C CD2  . LEU A 1 95  ? -0.274  -9.314  1.722   1.00 0.00 ? 95  LEU A CD2  1  
ATOM 1447  H H    . LEU A 1 95  ? -1.843  -10.267 4.024   1.00 0.00 ? 95  LEU A H    1  
ATOM 1448  H HA   . LEU A 1 95  ? -3.834  -8.815  2.558   1.00 0.00 ? 95  LEU A HA   1  
ATOM 1449  H HB2  . LEU A 1 95  ? -2.040  -11.219 2.001   1.00 0.00 ? 95  LEU A HB2  1  
ATOM 1450  H HB3  . LEU A 1 95  ? -3.253  -10.735 0.854   1.00 0.00 ? 95  LEU A HB3  1  
ATOM 1451  H HG   . LEU A 1 95  ? -1.409  -9.735  -0.022  1.00 0.00 ? 95  LEU A HG   1  
ATOM 1452  H HD11 . LEU A 1 95  ? -3.102  -7.958  0.355   1.00 0.00 ? 95  LEU A HD11 1  
ATOM 1453  H HD12 . LEU A 1 95  ? -2.258  -7.497  1.854   1.00 0.00 ? 95  LEU A HD12 1  
ATOM 1454  H HD13 . LEU A 1 95  ? -1.432  -7.348  0.294   1.00 0.00 ? 95  LEU A HD13 1  
ATOM 1455  H HD21 . LEU A 1 95  ? 0.423   -8.705  1.145   1.00 0.00 ? 95  LEU A HD21 1  
ATOM 1456  H HD22 . LEU A 1 95  ? -0.395  -8.881  2.713   1.00 0.00 ? 95  LEU A HD22 1  
ATOM 1457  H HD23 . LEU A 1 95  ? 0.142   -10.316 1.805   1.00 0.00 ? 95  LEU A HD23 1  
ATOM 1458  N N    . ARG A 1 96  ? -4.655  -11.888 3.458   1.00 0.00 ? 96  ARG A N    1  
ATOM 1459  C CA   . ARG A 1 96  ? -5.742  -12.855 3.417   1.00 0.00 ? 96  ARG A CA   1  
ATOM 1460  C C    . ARG A 1 96  ? -5.655  -13.772 4.624   1.00 0.00 ? 96  ARG A C    1  
ATOM 1461  O O    . ARG A 1 96  ? -5.306  -14.950 4.514   1.00 0.00 ? 96  ARG A O    1  
ATOM 1462  C CB   . ARG A 1 96  ? -5.723  -13.559 2.039   1.00 0.00 ? 96  ARG A CB   1  
ATOM 1463  C CG   . ARG A 1 96  ? -7.098  -14.087 1.612   1.00 0.00 ? 96  ARG A CG   1  
ATOM 1464  C CD   . ARG A 1 96  ? -7.347  -15.545 1.958   1.00 0.00 ? 96  ARG A CD   1  
ATOM 1465  N NE   . ARG A 1 96  ? -7.040  -16.428 0.823   1.00 0.00 ? 96  ARG A NE   1  
ATOM 1466  C CZ   . ARG A 1 96  ? -6.259  -17.511 0.844   1.00 0.00 ? 96  ARG A CZ   1  
ATOM 1467  N NH1  . ARG A 1 96  ? -5.658  -17.894 1.964   1.00 0.00 ? 96  ARG A NH1  1  
ATOM 1468  N NH2  . ARG A 1 96  ? -6.091  -18.213 -0.269  1.00 0.00 ? 96  ARG A NH2  1  
ATOM 1469  H H    . ARG A 1 96  ? -3.807  -12.134 3.958   1.00 0.00 ? 96  ARG A H    1  
ATOM 1470  H HA   . ARG A 1 96  ? -6.676  -12.300 3.530   1.00 0.00 ? 96  ARG A HA   1  
ATOM 1471  H HB2  . ARG A 1 96  ? -5.434  -12.827 1.283   1.00 0.00 ? 96  ARG A HB2  1  
ATOM 1472  H HB3  . ARG A 1 96  ? -4.975  -14.352 2.011   1.00 0.00 ? 96  ARG A HB3  1  
ATOM 1473  H HG2  . ARG A 1 96  ? -7.880  -13.498 2.085   1.00 0.00 ? 96  ARG A HG2  1  
ATOM 1474  H HG3  . ARG A 1 96  ? -7.184  -13.968 0.533   1.00 0.00 ? 96  ARG A HG3  1  
ATOM 1475  H HD2  . ARG A 1 96  ? -6.759  -15.801 2.831   1.00 0.00 ? 96  ARG A HD2  1  
ATOM 1476  H HD3  . ARG A 1 96  ? -8.399  -15.662 2.210   1.00 0.00 ? 96  ARG A HD3  1  
ATOM 1477  H HE   . ARG A 1 96  ? -7.587  -16.224 -0.010  1.00 0.00 ? 96  ARG A HE   1  
ATOM 1478  H HH11 . ARG A 1 96  ? -5.981  -17.505 2.850   1.00 0.00 ? 96  ARG A HH11 1  
ATOM 1479  H HH12 . ARG A 1 96  ? -5.022  -18.678 2.016   1.00 0.00 ? 96  ARG A HH12 1  
ATOM 1480  H HH21 . ARG A 1 96  ? -6.486  -17.900 -1.155  1.00 0.00 ? 96  ARG A HH21 1  
ATOM 1481  H HH22 . ARG A 1 96  ? -5.518  -19.053 -0.299  1.00 0.00 ? 96  ARG A HH22 1  
ATOM 1482  N N    . ASN A 1 97  ? -5.957  -13.221 5.793   1.00 0.00 ? 97  ASN A N    1  
ATOM 1483  C CA   . ASN A 1 97  ? -6.221  -13.995 6.993   1.00 0.00 ? 97  ASN A CA   1  
ATOM 1484  C C    . ASN A 1 97  ? -7.605  -14.630 6.866   1.00 0.00 ? 97  ASN A C    1  
ATOM 1485  O O    . ASN A 1 97  ? -8.594  -13.904 6.750   1.00 0.00 ? 97  ASN A O    1  
ATOM 1486  C CB   . ASN A 1 97  ? -6.202  -13.077 8.211   1.00 0.00 ? 97  ASN A CB   1  
ATOM 1487  C CG   . ASN A 1 97  ? -6.588  -13.856 9.459   1.00 0.00 ? 97  ASN A CG   1  
ATOM 1488  O OD1  . ASN A 1 97  ? -7.742  -13.879 9.870   1.00 0.00 ? 97  ASN A OD1  1  
ATOM 1489  N ND2  . ASN A 1 97  ? -5.640  -14.537 10.073  1.00 0.00 ? 97  ASN A ND2  1  
ATOM 1490  H H    . ASN A 1 97  ? -6.166  -12.229 5.824   1.00 0.00 ? 97  ASN A H    1  
ATOM 1491  H HA   . ASN A 1 97  ? -5.458  -14.764 7.115   1.00 0.00 ? 97  ASN A HA   1  
ATOM 1492  H HB2  . ASN A 1 97  ? -5.212  -12.637 8.335   1.00 0.00 ? 97  ASN A HB2  1  
ATOM 1493  H HB3  . ASN A 1 97  ? -6.930  -12.285 8.038   1.00 0.00 ? 97  ASN A HB3  1  
ATOM 1494  H HD21 . ASN A 1 97  ? -4.657  -14.457 9.813   1.00 0.00 ? 97  ASN A HD21 1  
ATOM 1495  H HD22 . ASN A 1 97  ? -5.891  -15.070 10.890  1.00 0.00 ? 97  ASN A HD22 1  
ATOM 1496  N N    . ALA A 1 98  ? -7.664  -15.962 6.912   1.00 0.00 ? 98  ALA A N    1  
ATOM 1497  C CA   . ALA A 1 98  ? -8.870  -16.786 6.878   1.00 0.00 ? 98  ALA A CA   1  
ATOM 1498  C C    . ALA A 1 98  ? -9.757  -16.563 5.641   1.00 0.00 ? 98  ALA A C    1  
ATOM 1499  O O    . ALA A 1 98  ? -9.486  -15.737 4.766   1.00 0.00 ? 98  ALA A O    1  
ATOM 1500  C CB   . ALA A 1 98  ? -9.661  -16.605 8.185   1.00 0.00 ? 98  ALA A CB   1  
ATOM 1501  H H    . ALA A 1 98  ? -6.796  -16.468 6.981   1.00 0.00 ? 98  ALA A H    1  
ATOM 1502  H HA   . ALA A 1 98  ? -8.530  -17.823 6.847   1.00 0.00 ? 98  ALA A HA   1  
ATOM 1503  H HB1  . ALA A 1 98  ? -8.996  -16.694 9.045   1.00 0.00 ? 98  ALA A HB1  1  
ATOM 1504  H HB2  . ALA A 1 98  ? -10.126 -15.618 8.203   1.00 0.00 ? 98  ALA A HB2  1  
ATOM 1505  H HB3  . ALA A 1 98  ? -10.435 -17.366 8.262   1.00 0.00 ? 98  ALA A HB3  1  
ATOM 1506  N N    . ASP A 1 99  ? -10.791 -17.389 5.533   1.00 0.00 ? 99  ASP A N    1  
ATOM 1507  C CA   . ASP A 1 99  ? -12.004 -17.225 4.737   1.00 0.00 ? 99  ASP A CA   1  
ATOM 1508  C C    . ASP A 1 99  ? -12.987 -18.213 5.353   1.00 0.00 ? 99  ASP A C    1  
ATOM 1509  O O    . ASP A 1 99  ? -12.572 -19.277 5.824   1.00 0.00 ? 99  ASP A O    1  
ATOM 1510  C CB   . ASP A 1 99  ? -11.831 -17.611 3.254   1.00 0.00 ? 99  ASP A CB   1  
ATOM 1511  C CG   . ASP A 1 99  ? -11.585 -16.426 2.318   1.00 0.00 ? 99  ASP A CG   1  
ATOM 1512  O OD1  . ASP A 1 99  ? -12.415 -15.481 2.349   1.00 0.00 ? 99  ASP A OD1  1  
ATOM 1513  O OD2  . ASP A 1 99  ? -10.591 -16.500 1.547   1.00 0.00 ? 99  ASP A OD2  1  
ATOM 1514  H H    . ASP A 1 99  ? -10.868 -18.168 6.178   1.00 0.00 ? 99  ASP A H    1  
ATOM 1515  H HA   . ASP A 1 99  ? -12.382 -16.205 4.822   1.00 0.00 ? 99  ASP A HA   1  
ATOM 1516  H HB2  . ASP A 1 99  ? -11.040 -18.356 3.174   1.00 0.00 ? 99  ASP A HB2  1  
ATOM 1517  H HB3  . ASP A 1 99  ? -12.750 -18.087 2.906   1.00 0.00 ? 99  ASP A HB3  1  
ATOM 1518  N N    . CYS A 1 100 ? -14.275 -17.884 5.325   1.00 0.00 ? 100 CYS A N    1  
ATOM 1519  C CA   . CYS A 1 100 ? -15.417 -18.786 5.417   1.00 0.00 ? 100 CYS A CA   1  
ATOM 1520  C C    . CYS A 1 100 ? -16.673 -17.928 5.203   1.00 0.00 ? 100 CYS A C    1  
ATOM 1521  O O    . CYS A 1 100 ? -16.549 -16.741 4.881   1.00 0.00 ? 100 CYS A O    1  
ATOM 1522  C CB   . CYS A 1 100 ? -15.444 -19.529 6.769   1.00 0.00 ? 100 CYS A CB   1  
ATOM 1523  S SG   . CYS A 1 100 ? -15.709 -21.301 6.479   1.00 0.00 ? 100 CYS A SG   1  
ATOM 1524  H H    . CYS A 1 100 ? -14.549 -16.956 5.024   1.00 0.00 ? 100 CYS A H    1  
ATOM 1525  H HA   . CYS A 1 100 ? -15.341 -19.507 4.601   1.00 0.00 ? 100 CYS A HA   1  
ATOM 1526  H HB2  . CYS A 1 100 ? -14.499 -19.411 7.292   1.00 0.00 ? 100 CYS A HB2  1  
ATOM 1527  H HB3  . CYS A 1 100 ? -16.229 -19.138 7.415   1.00 0.00 ? 100 CYS A HB3  1  
ATOM 1528  H HG   . CYS A 1 100 ? -15.475 -21.679 7.745   1.00 0.00 ? 100 CYS A HG   1  
ATOM 1529  N N    . SER A 1 101 ? -17.852 -18.504 5.442   1.00 0.00 ? 101 SER A N    1  
ATOM 1530  C CA   . SER A 1 101 ? -19.112 -17.820 5.728   1.00 0.00 ? 101 SER A CA   1  
ATOM 1531  C C    . SER A 1 101 ? -19.719 -17.102 4.514   1.00 0.00 ? 101 SER A C    1  
ATOM 1532  O O    . SER A 1 101 ? -20.772 -17.521 4.018   1.00 0.00 ? 101 SER A O    1  
ATOM 1533  C CB   . SER A 1 101 ? -18.955 -16.904 6.960   1.00 0.00 ? 101 SER A CB   1  
ATOM 1534  O OG   . SER A 1 101 ? -18.174 -17.518 7.974   1.00 0.00 ? 101 SER A OG   1  
ATOM 1535  H H    . SER A 1 101 ? -17.823 -19.477 5.720   1.00 0.00 ? 101 SER A H    1  
ATOM 1536  H HA   . SER A 1 101 ? -19.819 -18.598 6.014   1.00 0.00 ? 101 SER A HA   1  
ATOM 1537  H HB2  . SER A 1 101 ? -18.469 -15.972 6.671   1.00 0.00 ? 101 SER A HB2  1  
ATOM 1538  H HB3  . SER A 1 101 ? -19.942 -16.668 7.357   1.00 0.00 ? 101 SER A HB3  1  
ATOM 1539  H HG   . SER A 1 101 ? -18.408 -18.471 7.982   1.00 0.00 ? 101 SER A HG   1  
ATOM 1540  N N    . SER A 1 102 ? -19.067 -16.041 4.032   1.00 0.00 ? 102 SER A N    1  
ATOM 1541  C CA   . SER A 1 102 ? -19.554 -15.092 3.042   1.00 0.00 ? 102 SER A CA   1  
ATOM 1542  C C    . SER A 1 102 ? -20.865 -14.424 3.493   1.00 0.00 ? 102 SER A C    1  
ATOM 1543  O O    . SER A 1 102 ? -21.321 -14.608 4.628   1.00 0.00 ? 102 SER A O    1  
ATOM 1544  C CB   . SER A 1 102 ? -19.626 -15.780 1.665   1.00 0.00 ? 102 SER A CB   1  
ATOM 1545  O OG   . SER A 1 102 ? -18.913 -15.030 0.700   1.00 0.00 ? 102 SER A OG   1  
ATOM 1546  H H    . SER A 1 102 ? -18.151 -15.863 4.426   1.00 0.00 ? 102 SER A H    1  
ATOM 1547  H HA   . SER A 1 102 ? -18.803 -14.304 2.988   1.00 0.00 ? 102 SER A HA   1  
ATOM 1548  H HB2  . SER A 1 102 ? -19.172 -16.772 1.720   1.00 0.00 ? 102 SER A HB2  1  
ATOM 1549  H HB3  . SER A 1 102 ? -20.665 -15.901 1.355   1.00 0.00 ? 102 SER A HB3  1  
ATOM 1550  H HG   . SER A 1 102 ? -19.361 -14.177 0.555   1.00 0.00 ? 102 SER A HG   1  
ATOM 1551  N N    . GLY A 1 103 ? -21.469 -13.609 2.628   1.00 0.00 ? 103 GLY A N    1  
ATOM 1552  C CA   . GLY A 1 103 ? -22.634 -12.806 2.968   1.00 0.00 ? 103 GLY A CA   1  
ATOM 1553  C C    . GLY A 1 103 ? -22.182 -11.585 3.761   1.00 0.00 ? 103 GLY A C    1  
ATOM 1554  O O    . GLY A 1 103 ? -21.297 -10.874 3.269   1.00 0.00 ? 103 GLY A O    1  
ATOM 1555  H H    . GLY A 1 103 ? -21.021 -13.406 1.744   1.00 0.00 ? 103 GLY A H    1  
ATOM 1556  H HA2  . GLY A 1 103 ? -23.120 -12.467 2.054   1.00 0.00 ? 103 GLY A HA2  1  
ATOM 1557  H HA3  . GLY A 1 103 ? -23.347 -13.407 3.530   1.00 0.00 ? 103 GLY A HA3  1  
ATOM 1558  N N    . PRO A 1 104 ? -22.751 -11.309 4.944   1.00 0.00 ? 104 PRO A N    1  
ATOM 1559  C CA   . PRO A 1 104 ? -22.404 -10.122 5.704   1.00 0.00 ? 104 PRO A CA   1  
ATOM 1560  C C    . PRO A 1 104 ? -20.972 -10.256 6.220   1.00 0.00 ? 104 PRO A C    1  
ATOM 1561  O O    . PRO A 1 104 ? -20.570 -11.317 6.703   1.00 0.00 ? 104 PRO A O    1  
ATOM 1562  C CB   . PRO A 1 104 ? -23.431 -10.044 6.835   1.00 0.00 ? 104 PRO A CB   1  
ATOM 1563  C CG   . PRO A 1 104 ? -23.799 -11.505 7.072   1.00 0.00 ? 104 PRO A CG   1  
ATOM 1564  C CD   . PRO A 1 104 ? -23.716 -12.117 5.675   1.00 0.00 ? 104 PRO A CD   1  
ATOM 1565  H HA   . PRO A 1 104 ? -22.493 -9.237  5.074   1.00 0.00 ? 104 PRO A HA   1  
ATOM 1566  H HB2  . PRO A 1 104 ? -23.026 -9.577  7.734   1.00 0.00 ? 104 PRO A HB2  1  
ATOM 1567  H HB3  . PRO A 1 104 ? -24.315 -9.505  6.487   1.00 0.00 ? 104 PRO A HB3  1  
ATOM 1568  H HG2  . PRO A 1 104 ? -23.061 -11.974 7.722   1.00 0.00 ? 104 PRO A HG2  1  
ATOM 1569  H HG3  . PRO A 1 104 ? -24.796 -11.599 7.499   1.00 0.00 ? 104 PRO A HG3  1  
ATOM 1570  H HD2  . PRO A 1 104 ? -23.401 -13.159 5.742   1.00 0.00 ? 104 PRO A HD2  1  
ATOM 1571  H HD3  . PRO A 1 104 ? -24.683 -12.046 5.182   1.00 0.00 ? 104 PRO A HD3  1  
ATOM 1572  N N    . GLY A 1 105 ? -20.204 -9.177  6.132   1.00 0.00 ? 105 GLY A N    1  
ATOM 1573  C CA   . GLY A 1 105 ? -18.873 -9.059  6.692   1.00 0.00 ? 105 GLY A CA   1  
ATOM 1574  C C    . GLY A 1 105 ? -17.980 -8.402  5.663   1.00 0.00 ? 105 GLY A C    1  
ATOM 1575  O O    . GLY A 1 105 ? -17.489 -7.296  5.896   1.00 0.00 ? 105 GLY A O    1  
ATOM 1576  H H    . GLY A 1 105 ? -20.555 -8.373  5.618   1.00 0.00 ? 105 GLY A H    1  
ATOM 1577  H HA2  . GLY A 1 105 ? -18.913 -8.444  7.591   1.00 0.00 ? 105 GLY A HA2  1  
ATOM 1578  H HA3  . GLY A 1 105 ? -18.470 -10.039 6.948   1.00 0.00 ? 105 GLY A HA3  1  
ATOM 1579  N N    . GLN A 1 106 ? -17.821 -9.051  4.504   1.00 0.00 ? 106 GLN A N    1  
ATOM 1580  C CA   . GLN A 1 106 ? -16.813 -8.711  3.503   1.00 0.00 ? 106 GLN A CA   1  
ATOM 1581  C C    . GLN A 1 106 ? -15.446 -8.638  4.215   1.00 0.00 ? 106 GLN A C    1  
ATOM 1582  O O    . GLN A 1 106 ? -15.255 -9.326  5.221   1.00 0.00 ? 106 GLN A O    1  
ATOM 1583  C CB   . GLN A 1 106 ? -17.264 -7.466  2.693   1.00 0.00 ? 106 GLN A CB   1  
ATOM 1584  C CG   . GLN A 1 106 ? -18.670 -7.651  2.074   1.00 0.00 ? 106 GLN A CG   1  
ATOM 1585  C CD   . GLN A 1 106 ? -19.172 -6.501  1.186   1.00 0.00 ? 106 GLN A CD   1  
ATOM 1586  O OE1  . GLN A 1 106 ? -20.355 -6.159  1.209   1.00 0.00 ? 106 GLN A OE1  1  
ATOM 1587  N NE2  . GLN A 1 106 ? -18.352 -5.909  0.336   1.00 0.00 ? 106 GLN A NE2  1  
ATOM 1588  H H    . GLN A 1 106 ? -18.281 -9.940  4.405   1.00 0.00 ? 106 GLN A H    1  
ATOM 1589  H HA   . GLN A 1 106 ? -16.741 -9.553  2.815   1.00 0.00 ? 106 GLN A HA   1  
ATOM 1590  H HB2  . GLN A 1 106 ? -17.278 -6.594  3.344   1.00 0.00 ? 106 GLN A HB2  1  
ATOM 1591  H HB3  . GLN A 1 106 ? -16.548 -7.281  1.895   1.00 0.00 ? 106 GLN A HB3  1  
ATOM 1592  H HG2  . GLN A 1 106 ? -18.688 -8.578  1.503   1.00 0.00 ? 106 GLN A HG2  1  
ATOM 1593  H HG3  . GLN A 1 106 ? -19.391 -7.765  2.882   1.00 0.00 ? 106 GLN A HG3  1  
ATOM 1594  H HE21 . GLN A 1 106 ? -17.389 -6.219  0.204   1.00 0.00 ? 106 GLN A HE21 1  
ATOM 1595  H HE22 . GLN A 1 106 ? -18.681 -5.138  -0.227  1.00 0.00 ? 106 GLN A HE22 1  
ATOM 1596  N N    . ARG A 1 107 ? -14.460 -7.923  3.678   1.00 0.00 ? 107 ARG A N    1  
ATOM 1597  C CA   . ARG A 1 107 ? -13.197 -7.587  4.338   1.00 0.00 ? 107 ARG A CA   1  
ATOM 1598  C C    . ARG A 1 107 ? -12.670 -6.311  3.682   1.00 0.00 ? 107 ARG A C    1  
ATOM 1599  O O    . ARG A 1 107 ? -13.089 -6.005  2.573   1.00 0.00 ? 107 ARG A O    1  
ATOM 1600  C CB   . ARG A 1 107 ? -12.212 -8.765  4.195   1.00 0.00 ? 107 ARG A CB   1  
ATOM 1601  C CG   . ARG A 1 107 ? -12.117 -9.602  5.474   1.00 0.00 ? 107 ARG A CG   1  
ATOM 1602  C CD   . ARG A 1 107 ? -11.983 -11.101 5.174   1.00 0.00 ? 107 ARG A CD   1  
ATOM 1603  N NE   . ARG A 1 107 ? -11.735 -11.853 6.415   1.00 0.00 ? 107 ARG A NE   1  
ATOM 1604  C CZ   . ARG A 1 107 ? -12.264 -13.029 6.768   1.00 0.00 ? 107 ARG A CZ   1  
ATOM 1605  N NH1  . ARG A 1 107 ? -12.947 -13.773 5.903   1.00 0.00 ? 107 ARG A NH1  1  
ATOM 1606  N NH2  . ARG A 1 107 ? -12.117 -13.443 8.018   1.00 0.00 ? 107 ARG A NH2  1  
ATOM 1607  H H    . ARG A 1 107 ? -14.617 -7.401  2.824   1.00 0.00 ? 107 ARG A H    1  
ATOM 1608  H HA   . ARG A 1 107 ? -13.392 -7.390  5.391   1.00 0.00 ? 107 ARG A HA   1  
ATOM 1609  H HB2  . ARG A 1 107 ? -12.524 -9.407  3.370   1.00 0.00 ? 107 ARG A HB2  1  
ATOM 1610  H HB3  . ARG A 1 107 ? -11.212 -8.391  3.969   1.00 0.00 ? 107 ARG A HB3  1  
ATOM 1611  H HG2  . ARG A 1 107 ? -11.256 -9.248  6.029   1.00 0.00 ? 107 ARG A HG2  1  
ATOM 1612  H HG3  . ARG A 1 107 ? -12.993 -9.447  6.100   1.00 0.00 ? 107 ARG A HG3  1  
ATOM 1613  H HD2  . ARG A 1 107 ? -12.915 -11.429 4.706   1.00 0.00 ? 107 ARG A HD2  1  
ATOM 1614  H HD3  . ARG A 1 107 ? -11.153 -11.264 4.487   1.00 0.00 ? 107 ARG A HD3  1  
ATOM 1615  H HE   . ARG A 1 107 ? -11.136 -11.381 7.092   1.00 0.00 ? 107 ARG A HE   1  
ATOM 1616  H HH11 . ARG A 1 107 ? -13.071 -13.517 4.935   1.00 0.00 ? 107 ARG A HH11 1  
ATOM 1617  H HH12 . ARG A 1 107 ? -13.543 -14.524 6.246   1.00 0.00 ? 107 ARG A HH12 1  
ATOM 1618  H HH21 . ARG A 1 107 ? -11.688 -12.834 8.718   1.00 0.00 ? 107 ARG A HH21 1  
ATOM 1619  H HH22 . ARG A 1 107 ? -12.496 -14.303 8.401   1.00 0.00 ? 107 ARG A HH22 1  
ATOM 1620  N N    . VAL A 1 108 ? -11.696 -5.621  4.266   1.00 0.00 ? 108 VAL A N    1  
ATOM 1621  C CA   . VAL A 1 108 ? -10.994 -4.503  3.641   1.00 0.00 ? 108 VAL A CA   1  
ATOM 1622  C C    . VAL A 1 108 ? -9.500  -4.783  3.792   1.00 0.00 ? 108 VAL A C    1  
ATOM 1623  O O    . VAL A 1 108 ? -9.077  -5.221  4.863   1.00 0.00 ? 108 VAL A O    1  
ATOM 1624  C CB   . VAL A 1 108 ? -11.454 -3.156  4.252   1.00 0.00 ? 108 VAL A CB   1  
ATOM 1625  C CG1  . VAL A 1 108 ? -10.848 -1.971  3.489   1.00 0.00 ? 108 VAL A CG1  1  
ATOM 1626  C CG2  . VAL A 1 108 ? -12.984 -2.999  4.249   1.00 0.00 ? 108 VAL A CG2  1  
ATOM 1627  H H    . VAL A 1 108 ? -11.369 -5.899  5.184   1.00 0.00 ? 108 VAL A H    1  
ATOM 1628  H HA   . VAL A 1 108 ? -11.221 -4.485  2.584   1.00 0.00 ? 108 VAL A HA   1  
ATOM 1629  H HB   . VAL A 1 108 ? -11.123 -3.113  5.287   1.00 0.00 ? 108 VAL A HB   1  
ATOM 1630  H HG11 . VAL A 1 108 ? -9.759  -2.009  3.520   1.00 0.00 ? 108 VAL A HG11 1  
ATOM 1631  H HG12 . VAL A 1 108 ? -11.177 -1.980  2.450   1.00 0.00 ? 108 VAL A HG12 1  
ATOM 1632  H HG13 . VAL A 1 108 ? -11.164 -1.033  3.947   1.00 0.00 ? 108 VAL A HG13 1  
ATOM 1633  H HG21 . VAL A 1 108 ? -13.269 -2.018  4.624   1.00 0.00 ? 108 VAL A HG21 1  
ATOM 1634  H HG22 . VAL A 1 108 ? -13.374 -3.103  3.239   1.00 0.00 ? 108 VAL A HG22 1  
ATOM 1635  H HG23 . VAL A 1 108 ? -13.449 -3.743  4.894   1.00 0.00 ? 108 VAL A HG23 1  
ATOM 1636  N N    . CYS A 1 109 ? -8.716  -4.562  2.729   1.00 0.00 ? 109 CYS A N    1  
ATOM 1637  C CA   . CYS A 1 109 ? -7.277  -4.772  2.707   1.00 0.00 ? 109 CYS A CA   1  
ATOM 1638  C C    . CYS A 1 109 ? -6.579  -3.477  2.303   1.00 0.00 ? 109 CYS A C    1  
ATOM 1639  O O    . CYS A 1 109 ? -6.616  -3.087  1.136   1.00 0.00 ? 109 CYS A O    1  
ATOM 1640  C CB   . CYS A 1 109 ? -6.855  -5.927  1.792   1.00 0.00 ? 109 CYS A CB   1  
ATOM 1641  S SG   . CYS A 1 109 ? -5.051  -6.004  1.606   1.00 0.00 ? 109 CYS A SG   1  
ATOM 1642  H H    . CYS A 1 109 ? -9.103  -4.107  1.905   1.00 0.00 ? 109 CYS A H    1  
ATOM 1643  H HA   . CYS A 1 109 ? -7.003  -5.062  3.709   1.00 0.00 ? 109 CYS A HA   1  
ATOM 1644  H HB2  . CYS A 1 109 ? -7.172  -6.861  2.245   1.00 0.00 ? 109 CYS A HB2  1  
ATOM 1645  H HB3  . CYS A 1 109 ? -7.304  -5.793  0.809   1.00 0.00 ? 109 CYS A HB3  1  
ATOM 1646  H HG   . CYS A 1 109 ? -4.924  -4.810  1.003   1.00 0.00 ? 109 CYS A HG   1  
ATOM 1647  N N    . VAL A 1 110 ? -5.914  -2.847  3.261   1.00 0.00 ? 110 VAL A N    1  
ATOM 1648  C CA   . VAL A 1 110 ? -5.059  -1.683  3.076   1.00 0.00 ? 110 VAL A CA   1  
ATOM 1649  C C    . VAL A 1 110 ? -3.721  -2.120  2.479   1.00 0.00 ? 110 VAL A C    1  
ATOM 1650  O O    . VAL A 1 110 ? -3.075  -3.016  3.027   1.00 0.00 ? 110 VAL A O    1  
ATOM 1651  C CB   . VAL A 1 110 ? -4.809  -1.028  4.449   1.00 0.00 ? 110 VAL A CB   1  
ATOM 1652  C CG1  . VAL A 1 110 ? -3.884  0.192   4.338   1.00 0.00 ? 110 VAL A CG1  1  
ATOM 1653  C CG2  . VAL A 1 110 ? -6.122  -0.557  5.089   1.00 0.00 ? 110 VAL A CG2  1  
ATOM 1654  H H    . VAL A 1 110 ? -5.914  -3.268  4.186   1.00 0.00 ? 110 VAL A H    1  
ATOM 1655  H HA   . VAL A 1 110 ? -5.555  -0.982  2.405   1.00 0.00 ? 110 VAL A HA   1  
ATOM 1656  H HB   . VAL A 1 110 ? -4.344  -1.774  5.104   1.00 0.00 ? 110 VAL A HB   1  
ATOM 1657  H HG11 . VAL A 1 110 ? -4.323  0.939   3.677   1.00 0.00 ? 110 VAL A HG11 1  
ATOM 1658  H HG12 . VAL A 1 110 ? -3.721  0.622   5.324   1.00 0.00 ? 110 VAL A HG12 1  
ATOM 1659  H HG13 . VAL A 1 110 ? -2.916  -0.108  3.935   1.00 0.00 ? 110 VAL A HG13 1  
ATOM 1660  H HG21 . VAL A 1 110 ? -6.794  -1.402  5.199   1.00 0.00 ? 110 VAL A HG21 1  
ATOM 1661  H HG22 . VAL A 1 110 ? -5.930  -0.140  6.078   1.00 0.00 ? 110 VAL A HG22 1  
ATOM 1662  H HG23 . VAL A 1 110 ? -6.599  0.194   4.462   1.00 0.00 ? 110 VAL A HG23 1  
ATOM 1663  N N    . ILE A 1 111 ? -3.280  -1.456  1.408   1.00 0.00 ? 111 ILE A N    1  
ATOM 1664  C CA   . ILE A 1 111 ? -1.906  -1.487  0.921   1.00 0.00 ? 111 ILE A CA   1  
ATOM 1665  C C    . ILE A 1 111 ? -1.586  -0.081  0.402   1.00 0.00 ? 111 ILE A C    1  
ATOM 1666  O O    . ILE A 1 111 ? -1.794  0.220   -0.776  1.00 0.00 ? 111 ILE A O    1  
ATOM 1667  C CB   . ILE A 1 111 ? -1.689  -2.559  -0.170  1.00 0.00 ? 111 ILE A CB   1  
ATOM 1668  C CG1  . ILE A 1 111 ? -2.475  -3.863  0.074   1.00 0.00 ? 111 ILE A CG1  1  
ATOM 1669  C CG2  . ILE A 1 111 ? -0.181  -2.809  -0.282  1.00 0.00 ? 111 ILE A CG2  1  
ATOM 1670  C CD1  . ILE A 1 111 ? -2.279  -4.903  -1.014  1.00 0.00 ? 111 ILE A CD1  1  
ATOM 1671  H H    . ILE A 1 111 ? -3.907  -0.791  0.970   1.00 0.00 ? 111 ILE A H    1  
ATOM 1672  H HA   . ILE A 1 111 ? -1.237  -1.723  1.755   1.00 0.00 ? 111 ILE A HA   1  
ATOM 1673  H HB   . ILE A 1 111 ? -2.020  -2.164  -1.120  1.00 0.00 ? 111 ILE A HB   1  
ATOM 1674  H HG12 . ILE A 1 111 ? -2.168  -4.291  1.023   1.00 0.00 ? 111 ILE A HG12 1  
ATOM 1675  H HG13 . ILE A 1 111 ? -3.552  -3.663  0.102   1.00 0.00 ? 111 ILE A HG13 1  
ATOM 1676  H HG21 . ILE A 1 111 ? 0.034   -3.398  -1.168  1.00 0.00 ? 111 ILE A HG21 1  
ATOM 1677  H HG22 . ILE A 1 111 ? 0.363   -1.866  -0.369  1.00 0.00 ? 111 ILE A HG22 1  
ATOM 1678  H HG23 . ILE A 1 111 ? 0.158   -3.330  0.607   1.00 0.00 ? 111 ILE A HG23 1  
ATOM 1679  H HD11 . ILE A 1 111 ? -1.240  -5.227  -1.063  1.00 0.00 ? 111 ILE A HD11 1  
ATOM 1680  H HD12 . ILE A 1 111 ? -2.896  -5.750  -0.740  1.00 0.00 ? 111 ILE A HD12 1  
ATOM 1681  H HD13 . ILE A 1 111 ? -2.603  -4.499  -1.974  1.00 0.00 ? 111 ILE A HD13 1  
ATOM 1682  N N    . ASP A 1 112 ? -1.136  0.812   1.279   1.00 0.00 ? 112 ASP A N    1  
ATOM 1683  C CA   . ASP A 1 112 ? -0.480  2.035   0.818   1.00 0.00 ? 112 ASP A CA   1  
ATOM 1684  C C    . ASP A 1 112 ? 0.880   1.669   0.208   1.00 0.00 ? 112 ASP A C    1  
ATOM 1685  O O    . ASP A 1 112 ? 1.441   0.628   0.539   1.00 0.00 ? 112 ASP A O    1  
ATOM 1686  C CB   . ASP A 1 112 ? -0.316  3.018   1.976   1.00 0.00 ? 112 ASP A CB   1  
ATOM 1687  C CG   . ASP A 1 112 ? 0.450   4.280   1.562   1.00 0.00 ? 112 ASP A CG   1  
ATOM 1688  O OD1  . ASP A 1 112 ? 0.088   4.889   0.521   1.00 0.00 ? 112 ASP A OD1  1  
ATOM 1689  O OD2  . ASP A 1 112 ? 1.410   4.676   2.252   1.00 0.00 ? 112 ASP A OD2  1  
ATOM 1690  H H    . ASP A 1 112 ? -0.933  0.492   2.216   1.00 0.00 ? 112 ASP A H    1  
ATOM 1691  H HA   . ASP A 1 112 ? -1.098  2.507   0.055   1.00 0.00 ? 112 ASP A HA   1  
ATOM 1692  H HB2  . ASP A 1 112 ? -1.299  3.297   2.357   1.00 0.00 ? 112 ASP A HB2  1  
ATOM 1693  H HB3  . ASP A 1 112 ? 0.224   2.504   2.764   1.00 0.00 ? 112 ASP A HB3  1  
ATOM 1694  N N    . GLU A 1 113 ? 1.416   2.546   -0.641  1.00 0.00 ? 113 GLU A N    1  
ATOM 1695  C CA   . GLU A 1 113 ? 2.632   2.399   -1.435  1.00 0.00 ? 113 GLU A CA   1  
ATOM 1696  C C    . GLU A 1 113 ? 2.657   1.089   -2.240  1.00 0.00 ? 113 GLU A C    1  
ATOM 1697  O O    . GLU A 1 113 ? 3.175   0.056   -1.803  1.00 0.00 ? 113 GLU A O    1  
ATOM 1698  C CB   . GLU A 1 113 ? 3.899   2.618   -0.580  1.00 0.00 ? 113 GLU A CB   1  
ATOM 1699  C CG   . GLU A 1 113 ? 5.052   3.311   -1.328  1.00 0.00 ? 113 GLU A CG   1  
ATOM 1700  C CD   . GLU A 1 113 ? 5.196   2.922   -2.802  1.00 0.00 ? 113 GLU A CD   1  
ATOM 1701  O OE1  . GLU A 1 113 ? 5.519   1.757   -3.122  1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1702  O OE2  . GLU A 1 113 ? 4.986   3.802   -3.671  1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1703  H H    . GLU A 1 113 ? 0.932   3.432   -0.716  1.00 0.00 ? 113 GLU A H    1  
ATOM 1704  H HA   . GLU A 1 113 ? 2.600   3.221   -2.152  1.00 0.00 ? 113 GLU A HA   1  
ATOM 1705  H HB2  . GLU A 1 113 ? 3.647   3.236   0.280   1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1706  H HB3  . GLU A 1 113 ? 4.259   1.669   -0.191  1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1707  H HG2  . GLU A 1 113 ? 4.886   4.384   -1.271  1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1708  H HG3  . GLU A 1 113 ? 5.989   3.108   -0.811  1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1709  N N    . ILE A 1 114 ? 2.149   1.158   -3.468  1.00 0.00 ? 114 ILE A N    1  
ATOM 1710  C CA   . ILE A 1 114 ? 2.355   0.167   -4.513  1.00 0.00 ? 114 ILE A CA   1  
ATOM 1711  C C    . ILE A 1 114 ? 2.920   0.967   -5.696  1.00 0.00 ? 114 ILE A C    1  
ATOM 1712  O O    . ILE A 1 114 ? 2.201   1.291   -6.638  1.00 0.00 ? 114 ILE A O    1  
ATOM 1713  C CB   . ILE A 1 114 ? 1.028   -0.581  -4.811  1.00 0.00 ? 114 ILE A CB   1  
ATOM 1714  C CG1  . ILE A 1 114 ? 0.513   -1.371  -3.584  1.00 0.00 ? 114 ILE A CG1  1  
ATOM 1715  C CG2  . ILE A 1 114 ? 1.190   -1.575  -5.980  1.00 0.00 ? 114 ILE A CG2  1  
ATOM 1716  C CD1  . ILE A 1 114 ? -0.940  -1.843  -3.734  1.00 0.00 ? 114 ILE A CD1  1  
ATOM 1717  H H    . ILE A 1 114 ? 1.663   2.001   -3.758  1.00 0.00 ? 114 ILE A H    1  
ATOM 1718  H HA   . ILE A 1 114 ? 3.101   -0.565  -4.191  1.00 0.00 ? 114 ILE A HA   1  
ATOM 1719  H HB   . ILE A 1 114 ? 0.279   0.165   -5.079  1.00 0.00 ? 114 ILE A HB   1  
ATOM 1720  H HG12 . ILE A 1 114 ? 1.156   -2.236  -3.416  1.00 0.00 ? 114 ILE A HG12 1  
ATOM 1721  H HG13 . ILE A 1 114 ? 0.556   -0.755  -2.687  1.00 0.00 ? 114 ILE A HG13 1  
ATOM 1722  H HG21 . ILE A 1 114 ? 1.730   -1.137  -6.814  1.00 0.00 ? 114 ILE A HG21 1  
ATOM 1723  H HG22 . ILE A 1 114 ? 1.737   -2.446  -5.634  1.00 0.00 ? 114 ILE A HG22 1  
ATOM 1724  H HG23 . ILE A 1 114 ? 0.220   -1.890  -6.358  1.00 0.00 ? 114 ILE A HG23 1  
ATOM 1725  H HD11 . ILE A 1 114 ? -1.607  -1.016  -3.495  1.00 0.00 ? 114 ILE A HD11 1  
ATOM 1726  H HD12 . ILE A 1 114 ? -1.153  -2.208  -4.735  1.00 0.00 ? 114 ILE A HD12 1  
ATOM 1727  H HD13 . ILE A 1 114 ? -1.125  -2.664  -3.049  1.00 0.00 ? 114 ILE A HD13 1  
ATOM 1728  N N    . GLY A 1 115 ? 4.195   1.355   -5.641  1.00 0.00 ? 115 GLY A N    1  
ATOM 1729  C CA   . GLY A 1 115 ? 4.790   2.174   -6.692  1.00 0.00 ? 115 GLY A CA   1  
ATOM 1730  C C    . GLY A 1 115 ? 6.308   2.207   -6.644  1.00 0.00 ? 115 GLY A C    1  
ATOM 1731  O O    . GLY A 1 115 ? 6.964   2.057   -7.675  1.00 0.00 ? 115 GLY A O    1  
ATOM 1732  H H    . GLY A 1 115 ? 4.707   1.224   -4.770  1.00 0.00 ? 115 GLY A H    1  
ATOM 1733  H HA2  . GLY A 1 115 ? 4.476   1.800   -7.667  1.00 0.00 ? 115 GLY A HA2  1  
ATOM 1734  H HA3  . GLY A 1 115 ? 4.431   3.195   -6.573  1.00 0.00 ? 115 GLY A HA3  1  
ATOM 1735  N N    . LYS A 1 116 ? 6.886   2.403   -5.462  1.00 0.00 ? 116 LYS A N    1  
ATOM 1736  C CA   . LYS A 1 116 ? 8.328   2.407   -5.267  1.00 0.00 ? 116 LYS A CA   1  
ATOM 1737  C C    . LYS A 1 116 ? 8.903   1.018   -5.525  1.00 0.00 ? 116 LYS A C    1  
ATOM 1738  O O    . LYS A 1 116 ? 9.992   0.898   -6.082  1.00 0.00 ? 116 LYS A O    1  
ATOM 1739  C CB   . LYS A 1 116 ? 8.662   2.894   -3.842  1.00 0.00 ? 116 LYS A CB   1  
ATOM 1740  C CG   . LYS A 1 116 ? 9.818   3.900   -3.857  1.00 0.00 ? 116 LYS A CG   1  
ATOM 1741  C CD   . LYS A 1 116 ? 9.317   5.303   -4.214  1.00 0.00 ? 116 LYS A CD   1  
ATOM 1742  C CE   . LYS A 1 116 ? 10.507  6.183   -4.590  1.00 0.00 ? 116 LYS A CE   1  
ATOM 1743  N NZ   . LYS A 1 116 ? 10.166  7.612   -4.523  1.00 0.00 ? 116 LYS A NZ   1  
ATOM 1744  H H    . LYS A 1 116 ? 6.279   2.531   -4.651  1.00 0.00 ? 116 LYS A H    1  
ATOM 1745  H HA   . LYS A 1 116 ? 8.761   3.084   -6.003  1.00 0.00 ? 116 LYS A HA   1  
ATOM 1746  H HB2  . LYS A 1 116 ? 7.801   3.375   -3.382  1.00 0.00 ? 116 LYS A HB2  1  
ATOM 1747  H HB3  . LYS A 1 116 ? 8.925   2.039   -3.217  1.00 0.00 ? 116 LYS A HB3  1  
ATOM 1748  H HG2  . LYS A 1 116 ? 10.272  3.940   -2.867  1.00 0.00 ? 116 LYS A HG2  1  
ATOM 1749  H HG3  . LYS A 1 116 ? 10.572  3.574   -4.573  1.00 0.00 ? 116 LYS A HG3  1  
ATOM 1750  H HD2  . LYS A 1 116 ? 8.627   5.265   -5.059  1.00 0.00 ? 116 LYS A HD2  1  
ATOM 1751  H HD3  . LYS A 1 116 ? 8.796   5.716   -3.348  1.00 0.00 ? 116 LYS A HD3  1  
ATOM 1752  H HE2  . LYS A 1 116 ? 11.334  5.986   -3.905  1.00 0.00 ? 116 LYS A HE2  1  
ATOM 1753  H HE3  . LYS A 1 116 ? 10.830  5.931   -5.602  1.00 0.00 ? 116 LYS A HE3  1  
ATOM 1754  H HZ1  . LYS A 1 116 ? 10.835  8.163   -5.058  1.00 0.00 ? 116 LYS A HZ1  1  
ATOM 1755  H HZ2  . LYS A 1 116 ? 9.263   7.802   -4.936  1.00 0.00 ? 116 LYS A HZ2  1  
ATOM 1756  H HZ3  . LYS A 1 116 ? 10.149  7.922   -3.559  1.00 0.00 ? 116 LYS A HZ3  1  
ATOM 1757  N N    . MET A 1 117 ? 8.185   -0.038  -5.134  1.00 0.00 ? 117 MET A N    1  
ATOM 1758  C CA   . MET A 1 117 ? 8.706   -1.402  -5.194  1.00 0.00 ? 117 MET A CA   1  
ATOM 1759  C C    . MET A 1 117 ? 8.654   -2.032  -6.582  1.00 0.00 ? 117 MET A C    1  
ATOM 1760  O O    . MET A 1 117 ? 9.126   -3.152  -6.669  1.00 0.00 ? 117 MET A O    1  
ATOM 1761  C CB   . MET A 1 117 ? 8.037   -2.318  -4.147  1.00 0.00 ? 117 MET A CB   1  
ATOM 1762  C CG   . MET A 1 117 ? 8.385   -1.821  -2.736  1.00 0.00 ? 117 MET A CG   1  
ATOM 1763  S SD   . MET A 1 117 ? 10.141  -1.771  -2.274  1.00 0.00 ? 117 MET A SD   1  
ATOM 1764  C CE   . MET A 1 117 ? 9.968   -0.833  -0.730  1.00 0.00 ? 117 MET A CE   1  
ATOM 1765  H H    . MET A 1 117 ? 7.310   0.129   -4.654  1.00 0.00 ? 117 MET A H    1  
ATOM 1766  H HA   . MET A 1 117 ? 9.763   -1.351  -4.942  1.00 0.00 ? 117 MET A HA   1  
ATOM 1767  H HB2  . MET A 1 117 ? 6.954   -2.301  -4.283  1.00 0.00 ? 117 MET A HB2  1  
ATOM 1768  H HB3  . MET A 1 117 ? 8.361   -3.366  -4.263  1.00 0.00 ? 117 MET A HB3  1  
ATOM 1769  H HG2  . MET A 1 117 ? 8.013   -0.803  -2.645  1.00 0.00 ? 117 MET A HG2  1  
ATOM 1770  H HG3  . MET A 1 117 ? 7.851   -2.430  -2.011  1.00 0.00 ? 117 MET A HG3  1  
ATOM 1771  H HE1  . MET A 1 117 ? 10.952  -0.579  -0.341  1.00 0.00 ? 117 MET A HE1  1  
ATOM 1772  H HE2  . MET A 1 117 ? 9.420   0.090   -0.916  1.00 0.00 ? 117 MET A HE2  1  
ATOM 1773  H HE3  . MET A 1 117 ? 9.424   -1.427  0.005   1.00 0.00 ? 117 MET A HE3  1  
ATOM 1774  N N    . GLU A 1 118 ? 8.176   -1.364  -7.641  1.00 0.00 ? 118 GLU A N    1  
ATOM 1775  C CA   . GLU A 1 118 ? 7.876   -1.894  -8.992  1.00 0.00 ? 118 GLU A CA   1  
ATOM 1776  C C    . GLU A 1 118 ? 8.960   -2.729  -9.711  1.00 0.00 ? 118 GLU A C    1  
ATOM 1777  O O    . GLU A 1 118 ? 8.735   -3.195  -10.827 1.00 0.00 ? 118 GLU A O    1  
ATOM 1778  C CB   . GLU A 1 118 ? 7.509   -0.708  -9.902  1.00 0.00 ? 118 GLU A CB   1  
ATOM 1779  C CG   . GLU A 1 118 ? 8.707   0.252   -10.096 1.00 0.00 ? 118 GLU A CG   1  
ATOM 1780  C CD   . GLU A 1 118 ? 9.047   0.689   -11.528 1.00 0.00 ? 118 GLU A CD   1  
ATOM 1781  O OE1  . GLU A 1 118 ? 8.629   0.097   -12.540 1.00 0.00 ? 118 GLU A OE1  1  
ATOM 1782  O OE2  . GLU A 1 118 ? 9.852   1.652   -11.627 1.00 0.00 ? 118 GLU A OE2  1  
ATOM 1783  H H    . GLU A 1 118 ? 7.896   -0.406  -7.495  1.00 0.00 ? 118 GLU A H    1  
ATOM 1784  H HA   . GLU A 1 118 ? 7.002   -2.542  -8.904  1.00 0.00 ? 118 GLU A HA   1  
ATOM 1785  H HB2  . GLU A 1 118 ? 7.163   -1.092  -10.860 1.00 0.00 ? 118 GLU A HB2  1  
ATOM 1786  H HB3  . GLU A 1 118 ? 6.682   -0.160  -9.446  1.00 0.00 ? 118 GLU A HB3  1  
ATOM 1787  H HG2  . GLU A 1 118 ? 8.528   1.144   -9.499  1.00 0.00 ? 118 GLU A HG2  1  
ATOM 1788  H HG3  . GLU A 1 118 ? 9.611   -0.195  -9.690  1.00 0.00 ? 118 GLU A HG3  1  
ATOM 1789  N N    . LEU A 1 119 ? 10.143  -2.872  -9.123  1.00 0.00 ? 119 LEU A N    1  
ATOM 1790  C CA   . LEU A 1 119 ? 11.252  -3.660  -9.624  1.00 0.00 ? 119 LEU A CA   1  
ATOM 1791  C C    . LEU A 1 119 ? 11.585  -4.784  -8.642  1.00 0.00 ? 119 LEU A C    1  
ATOM 1792  O O    . LEU A 1 119 ? 11.823  -5.921  -9.046  1.00 0.00 ? 119 LEU A O    1  
ATOM 1793  C CB   . LEU A 1 119 ? 12.443  -2.718  -9.808  1.00 0.00 ? 119 LEU A CB   1  
ATOM 1794  C CG   . LEU A 1 119 ? 13.549  -3.360  -10.657 1.00 0.00 ? 119 LEU A CG   1  
ATOM 1795  C CD1  . LEU A 1 119 ? 13.388  -3.031  -12.145 1.00 0.00 ? 119 LEU A CD1  1  
ATOM 1796  C CD2  . LEU A 1 119 ? 14.891  -2.863  -10.135 1.00 0.00 ? 119 LEU A CD2  1  
ATOM 1797  H H    . LEU A 1 119 ? 10.198  -2.502  -8.187  1.00 0.00 ? 119 LEU A H    1  
ATOM 1798  H HA   . LEU A 1 119 ? 10.985  -4.100  -10.586 1.00 0.00 ? 119 LEU A HA   1  
ATOM 1799  H HB2  . LEU A 1 119 ? 12.106  -1.809  -10.299 1.00 0.00 ? 119 LEU A HB2  1  
ATOM 1800  H HB3  . LEU A 1 119 ? 12.824  -2.435  -8.821  1.00 0.00 ? 119 LEU A HB3  1  
ATOM 1801  H HG   . LEU A 1 119 ? 13.526  -4.440  -10.545 1.00 0.00 ? 119 LEU A HG   1  
ATOM 1802  H HD11 . LEU A 1 119 ? 14.141  -3.563  -12.726 1.00 0.00 ? 119 LEU A HD11 1  
ATOM 1803  H HD12 . LEU A 1 119 ? 12.399  -3.342  -12.485 1.00 0.00 ? 119 LEU A HD12 1  
ATOM 1804  H HD13 . LEU A 1 119 ? 13.502  -1.959  -12.307 1.00 0.00 ? 119 LEU A HD13 1  
ATOM 1805  H HD21 . LEU A 1 119 ? 14.925  -1.775  -10.170 1.00 0.00 ? 119 LEU A HD21 1  
ATOM 1806  H HD22 . LEU A 1 119 ? 15.001  -3.205  -9.104  1.00 0.00 ? 119 LEU A HD22 1  
ATOM 1807  H HD23 . LEU A 1 119 ? 15.690  -3.273  -10.746 1.00 0.00 ? 119 LEU A HD23 1  
ATOM 1808  N N    . PHE A 1 120 ? 11.638  -4.479  -7.344  1.00 0.00 ? 120 PHE A N    1  
ATOM 1809  C CA   . PHE A 1 120 ? 11.884  -5.450  -6.280  1.00 0.00 ? 120 PHE A CA   1  
ATOM 1810  C C    . PHE A 1 120 ? 10.658  -6.333  -6.035  1.00 0.00 ? 120 PHE A C    1  
ATOM 1811  O O    . PHE A 1 120 ? 10.757  -7.396  -5.439  1.00 0.00 ? 120 PHE A O    1  
ATOM 1812  C CB   . PHE A 1 120 ? 12.244  -4.708  -4.983  1.00 0.00 ? 120 PHE A CB   1  
ATOM 1813  C CG   . PHE A 1 120 ? 13.256  -3.592  -5.167  1.00 0.00 ? 120 PHE A CG   1  
ATOM 1814  C CD1  . PHE A 1 120 ? 14.581  -3.905  -5.506  1.00 0.00 ? 120 PHE A CD1  1  
ATOM 1815  C CD2  . PHE A 1 120 ? 12.872  -2.244  -5.048  1.00 0.00 ? 120 PHE A CD2  1  
ATOM 1816  C CE1  . PHE A 1 120 ? 15.527  -2.886  -5.696  1.00 0.00 ? 120 PHE A CE1  1  
ATOM 1817  C CE2  . PHE A 1 120 ? 13.814  -1.220  -5.248  1.00 0.00 ? 120 PHE A CE2  1  
ATOM 1818  C CZ   . PHE A 1 120 ? 15.149  -1.542  -5.546  1.00 0.00 ? 120 PHE A CZ   1  
ATOM 1819  H H    . PHE A 1 120 ? 11.415  -3.542  -7.053  1.00 0.00 ? 120 PHE A H    1  
ATOM 1820  H HA   . PHE A 1 120 ? 12.719  -6.085  -6.572  1.00 0.00 ? 120 PHE A HA   1  
ATOM 1821  H HB2  . PHE A 1 120 ? 11.332  -4.306  -4.536  1.00 0.00 ? 120 PHE A HB2  1  
ATOM 1822  H HB3  . PHE A 1 120 ? 12.657  -5.427  -4.275  1.00 0.00 ? 120 PHE A HB3  1  
ATOM 1823  H HD1  . PHE A 1 120 ? 14.876  -4.938  -5.610  1.00 0.00 ? 120 PHE A HD1  1  
ATOM 1824  H HD2  . PHE A 1 120 ? 11.855  -1.989  -4.803  1.00 0.00 ? 120 PHE A HD2  1  
ATOM 1825  H HE1  . PHE A 1 120 ? 16.543  -3.144  -5.955  1.00 0.00 ? 120 PHE A HE1  1  
ATOM 1826  H HE2  . PHE A 1 120 ? 13.510  -0.187  -5.175  1.00 0.00 ? 120 PHE A HE2  1  
ATOM 1827  H HZ   . PHE A 1 120 ? 15.887  -0.762  -5.664  1.00 0.00 ? 120 PHE A HZ   1  
ATOM 1828  N N    . SER A 1 121 ? 9.490   -5.868  -6.454  1.00 0.00 ? 121 SER A N    1  
ATOM 1829  C CA   . SER A 1 121 ? 8.184   -6.458  -6.248  1.00 0.00 ? 121 SER A CA   1  
ATOM 1830  C C    . SER A 1 121 ? 8.187   -7.910  -6.720  1.00 0.00 ? 121 SER A C    1  
ATOM 1831  O O    . SER A 1 121 ? 8.366   -8.169  -7.908  1.00 0.00 ? 121 SER A O    1  
ATOM 1832  C CB   . SER A 1 121 ? 7.120   -5.620  -6.963  1.00 0.00 ? 121 SER A CB   1  
ATOM 1833  O OG   . SER A 1 121 ? 7.503   -5.246  -8.272  1.00 0.00 ? 121 SER A OG   1  
ATOM 1834  H H    . SER A 1 121 ? 9.538   -4.960  -6.889  1.00 0.00 ? 121 SER A H    1  
ATOM 1835  H HA   . SER A 1 121 ? 7.978   -6.413  -5.179  1.00 0.00 ? 121 SER A HA   1  
ATOM 1836  H HB2  . SER A 1 121 ? 6.193   -6.189  -7.000  1.00 0.00 ? 121 SER A HB2  1  
ATOM 1837  H HB3  . SER A 1 121 ? 6.944   -4.711  -6.388  1.00 0.00 ? 121 SER A HB3  1  
ATOM 1838  H HG   . SER A 1 121 ? 7.763   -6.046  -8.753  1.00 0.00 ? 121 SER A HG   1  
ATOM 1839  N N    . GLN A 1 122 ? 7.999   -8.843  -5.788  1.00 0.00 ? 122 GLN A N    1  
ATOM 1840  C CA   . GLN A 1 122 ? 8.151   -10.270 -6.008  1.00 0.00 ? 122 GLN A CA   1  
ATOM 1841  C C    . GLN A 1 122 ? 6.935   -10.991 -5.432  1.00 0.00 ? 122 GLN A C    1  
ATOM 1842  O O    . GLN A 1 122 ? 6.079   -11.497 -6.160  1.00 0.00 ? 122 GLN A O    1  
ATOM 1843  C CB   . GLN A 1 122 ? 9.454   -10.764 -5.341  1.00 0.00 ? 122 GLN A CB   1  
ATOM 1844  C CG   . GLN A 1 122 ? 10.727  -10.475 -6.146  1.00 0.00 ? 122 GLN A CG   1  
ATOM 1845  C CD   . GLN A 1 122 ? 10.931  -11.533 -7.211  1.00 0.00 ? 122 GLN A CD   1  
ATOM 1846  O OE1  . GLN A 1 122 ? 11.351  -12.652 -6.914  1.00 0.00 ? 122 GLN A OE1  1  
ATOM 1847  N NE2  . GLN A 1 122 ? 10.593  -11.215 -8.440  1.00 0.00 ? 122 GLN A NE2  1  
ATOM 1848  H H    . GLN A 1 122 ? 7.807   -8.535  -4.844  1.00 0.00 ? 122 GLN A H    1  
ATOM 1849  H HA   . GLN A 1 122 ? 8.189   -10.445 -7.079  1.00 0.00 ? 122 GLN A HA   1  
ATOM 1850  H HB2  . GLN A 1 122 ? 9.549   -10.298 -4.362  1.00 0.00 ? 122 GLN A HB2  1  
ATOM 1851  H HB3  . GLN A 1 122 ? 9.387   -11.841 -5.177  1.00 0.00 ? 122 GLN A HB3  1  
ATOM 1852  H HG2  . GLN A 1 122 ? 10.657  -9.499  -6.622  1.00 0.00 ? 122 GLN A HG2  1  
ATOM 1853  H HG3  . GLN A 1 122 ? 11.588  -10.481 -5.477  1.00 0.00 ? 122 GLN A HG3  1  
ATOM 1854  H HE21 . GLN A 1 122 ? 10.393  -10.237 -8.656  1.00 0.00 ? 122 GLN A HE21 1  
ATOM 1855  H HE22 . GLN A 1 122 ? 10.564  -11.896 -9.188  1.00 0.00 ? 122 GLN A HE22 1  
ATOM 1856  N N    . LEU A 1 123 ? 6.860   -11.028 -4.101  1.00 0.00 ? 123 LEU A N    1  
ATOM 1857  C CA   . LEU A 1 123 ? 5.785   -11.668 -3.354  1.00 0.00 ? 123 LEU A CA   1  
ATOM 1858  C C    . LEU A 1 123 ? 4.518   -10.825 -3.421  1.00 0.00 ? 123 LEU A C    1  
ATOM 1859  O O    . LEU A 1 123 ? 3.437   -11.376 -3.259  1.00 0.00 ? 123 LEU A O    1  
ATOM 1860  C CB   . LEU A 1 123 ? 6.211   -11.888 -1.892  1.00 0.00 ? 123 LEU A CB   1  
ATOM 1861  C CG   . LEU A 1 123 ? 7.594   -12.547 -1.702  1.00 0.00 ? 123 LEU A CG   1  
ATOM 1862  C CD1  . LEU A 1 123 ? 7.932   -12.665 -0.211  1.00 0.00 ? 123 LEU A CD1  1  
ATOM 1863  C CD2  . LEU A 1 123 ? 7.685   -13.925 -2.364  1.00 0.00 ? 123 LEU A CD2  1  
ATOM 1864  H H    . LEU A 1 123 ? 7.579   -10.548 -3.580  1.00 0.00 ? 123 LEU A H    1  
ATOM 1865  H HA   . LEU A 1 123 ? 5.541   -12.632 -3.804  1.00 0.00 ? 123 LEU A HA   1  
ATOM 1866  H HB2  . LEU A 1 123 ? 6.231   -10.915 -1.407  1.00 0.00 ? 123 LEU A HB2  1  
ATOM 1867  H HB3  . LEU A 1 123 ? 5.449   -12.496 -1.401  1.00 0.00 ? 123 LEU A HB3  1  
ATOM 1868  H HG   . LEU A 1 123 ? 8.353   -11.906 -2.153  1.00 0.00 ? 123 LEU A HG   1  
ATOM 1869  H HD11 . LEU A 1 123 ? 7.921   -11.677 0.247   1.00 0.00 ? 123 LEU A HD11 1  
ATOM 1870  H HD12 . LEU A 1 123 ? 7.215   -13.312 0.297   1.00 0.00 ? 123 LEU A HD12 1  
ATOM 1871  H HD13 . LEU A 1 123 ? 8.936   -13.072 -0.089  1.00 0.00 ? 123 LEU A HD13 1  
ATOM 1872  H HD21 . LEU A 1 123 ? 7.372   -13.871 -3.407  1.00 0.00 ? 123 LEU A HD21 1  
ATOM 1873  H HD22 . LEU A 1 123 ? 8.720   -14.259 -2.370  1.00 0.00 ? 123 LEU A HD22 1  
ATOM 1874  H HD23 . LEU A 1 123 ? 7.047   -14.648 -1.850  1.00 0.00 ? 123 LEU A HD23 1  
ATOM 1875  N N    . PHE A 1 124 ? 4.638   -9.525  -3.712  1.00 0.00 ? 124 PHE A N    1  
ATOM 1876  C CA   . PHE A 1 124 ? 3.535   -8.617  -3.965  1.00 0.00 ? 124 PHE A CA   1  
ATOM 1877  C C    . PHE A 1 124 ? 2.597   -9.207  -5.016  1.00 0.00 ? 124 PHE A C    1  
ATOM 1878  O O    . PHE A 1 124 ? 1.500   -9.609  -4.647  1.00 0.00 ? 124 PHE A O    1  
ATOM 1879  C CB   . PHE A 1 124 ? 4.067   -7.228  -4.346  1.00 0.00 ? 124 PHE A CB   1  
ATOM 1880  C CG   . PHE A 1 124 ? 4.071   -6.162  -3.267  1.00 0.00 ? 124 PHE A CG   1  
ATOM 1881  C CD1  . PHE A 1 124 ? 2.879   -5.879  -2.576  1.00 0.00 ? 124 PHE A CD1  1  
ATOM 1882  C CD2  . PHE A 1 124 ? 5.193   -5.328  -3.079  1.00 0.00 ? 124 PHE A CD2  1  
ATOM 1883  C CE1  . PHE A 1 124 ? 2.807   -4.774  -1.716  1.00 0.00 ? 124 PHE A CE1  1  
ATOM 1884  C CE2  . PHE A 1 124 ? 5.121   -4.233  -2.199  1.00 0.00 ? 124 PHE A CE2  1  
ATOM 1885  C CZ   . PHE A 1 124 ? 3.927   -3.952  -1.517  1.00 0.00 ? 124 PHE A CZ   1  
ATOM 1886  H H    . PHE A 1 124 ? 5.573   -9.136  -3.752  1.00 0.00 ? 124 PHE A H    1  
ATOM 1887  H HA   . PHE A 1 124 ? 2.943   -8.536  -3.060  1.00 0.00 ? 124 PHE A HA   1  
ATOM 1888  H HB2  . PHE A 1 124 ? 5.047   -7.304  -4.820  1.00 0.00 ? 124 PHE A HB2  1  
ATOM 1889  H HB3  . PHE A 1 124 ? 3.393   -6.841  -5.090  1.00 0.00 ? 124 PHE A HB3  1  
ATOM 1890  H HD1  . PHE A 1 124 ? 1.999   -6.483  -2.730  1.00 0.00 ? 124 PHE A HD1  1  
ATOM 1891  H HD2  . PHE A 1 124 ? 6.107   -5.506  -3.624  1.00 0.00 ? 124 PHE A HD2  1  
ATOM 1892  H HE1  . PHE A 1 124 ? 1.877   -4.545  -1.226  1.00 0.00 ? 124 PHE A HE1  1  
ATOM 1893  H HE2  . PHE A 1 124 ? 5.970   -3.582  -2.057  1.00 0.00 ? 124 PHE A HE2  1  
ATOM 1894  H HZ   . PHE A 1 124 ? 3.870   -3.097  -0.855  1.00 0.00 ? 124 PHE A HZ   1  
ATOM 1895  N N    . ILE A 1 125 ? 3.011   -9.315  -6.284  1.00 0.00 ? 125 ILE A N    1  
ATOM 1896  C CA   . ILE A 1 125 ? 2.273   -9.910  -7.383  1.00 0.00 ? 125 ILE A CA   1  
ATOM 1897  C C    . ILE A 1 125 ? 1.472   -11.153 -6.956  1.00 0.00 ? 125 ILE A C    1  
ATOM 1898  O O    . ILE A 1 125 ? 0.276   -11.250 -7.247  1.00 0.00 ? 125 ILE A O    1  
ATOM 1899  C CB   . ILE A 1 125 ? 3.284   -10.198 -8.525  1.00 0.00 ? 125 ILE A CB   1  
ATOM 1900  C CG1  . ILE A 1 125 ? 3.881   -8.904  -9.140  1.00 0.00 ? 125 ILE A CG1  1  
ATOM 1901  C CG2  . ILE A 1 125 ? 2.682   -11.041 -9.648  1.00 0.00 ? 125 ILE A CG2  1  
ATOM 1902  C CD1  . ILE A 1 125 ? 5.217   -8.503  -8.513  1.00 0.00 ? 125 ILE A CD1  1  
ATOM 1903  H H    . ILE A 1 125 ? 3.819   -8.827  -6.627  1.00 0.00 ? 125 ILE A H    1  
ATOM 1904  H HA   . ILE A 1 125 ? 1.572   -9.145  -7.704  1.00 0.00 ? 125 ILE A HA   1  
ATOM 1905  H HB   . ILE A 1 125 ? 4.101   -10.796 -8.115  1.00 0.00 ? 125 ILE A HB   1  
ATOM 1906  H HG12 . ILE A 1 125 ? 4.072   -9.046  -10.204 1.00 0.00 ? 125 ILE A HG12 1  
ATOM 1907  H HG13 . ILE A 1 125 ? 3.177   -8.079  -9.056  1.00 0.00 ? 125 ILE A HG13 1  
ATOM 1908  H HG21 . ILE A 1 125 ? 3.431   -11.137 -10.431 1.00 0.00 ? 125 ILE A HG21 1  
ATOM 1909  H HG22 . ILE A 1 125 ? 2.439   -12.042 -9.293  1.00 0.00 ? 125 ILE A HG22 1  
ATOM 1910  H HG23 . ILE A 1 125 ? 1.796   -10.568 -10.058 1.00 0.00 ? 125 ILE A HG23 1  
ATOM 1911  H HD11 . ILE A 1 125 ? 5.090   -8.190  -7.481  1.00 0.00 ? 125 ILE A HD11 1  
ATOM 1912  H HD12 . ILE A 1 125 ? 5.897   -9.354  -8.547  1.00 0.00 ? 125 ILE A HD12 1  
ATOM 1913  H HD13 . ILE A 1 125 ? 5.646   -7.681  -9.084  1.00 0.00 ? 125 ILE A HD13 1  
ATOM 1914  N N    . GLN A 1 126 ? 2.102   -12.090 -6.248  1.00 0.00 ? 126 GLN A N    1  
ATOM 1915  C CA   . GLN A 1 126 ? 1.446   -13.274 -5.710  1.00 0.00 ? 126 GLN A CA   1  
ATOM 1916  C C    . GLN A 1 126 ? 0.384   -12.931 -4.673  1.00 0.00 ? 126 GLN A C    1  
ATOM 1917  O O    . GLN A 1 126 ? -0.795  -13.234 -4.876  1.00 0.00 ? 126 GLN A O    1  
ATOM 1918  C CB   . GLN A 1 126 ? 2.485   -14.192 -5.092  1.00 0.00 ? 126 GLN A CB   1  
ATOM 1919  C CG   . GLN A 1 126 ? 3.169   -14.962 -6.225  1.00 0.00 ? 126 GLN A CG   1  
ATOM 1920  C CD   . GLN A 1 126 ? 3.913   -16.141 -5.657  1.00 0.00 ? 126 GLN A CD   1  
ATOM 1921  O OE1  . GLN A 1 126 ? 5.131   -16.143 -5.598  1.00 0.00 ? 126 GLN A OE1  1  
ATOM 1922  N NE2  . GLN A 1 126 ? 3.198   -17.131 -5.158  1.00 0.00 ? 126 GLN A NE2  1  
ATOM 1923  H H    . GLN A 1 126 ? 3.067   -11.926 -5.994  1.00 0.00 ? 126 GLN A H    1  
ATOM 1924  H HA   . GLN A 1 126 ? 0.968   -13.840 -6.509  1.00 0.00 ? 126 GLN A HA   1  
ATOM 1925  H HB2  . GLN A 1 126 ? 3.216   -13.633 -4.509  1.00 0.00 ? 126 GLN A HB2  1  
ATOM 1926  H HB3  . GLN A 1 126 ? 1.963   -14.861 -4.407  1.00 0.00 ? 126 GLN A HB3  1  
ATOM 1927  H HG2  . GLN A 1 126 ? 2.435   -15.342 -6.936  1.00 0.00 ? 126 GLN A HG2  1  
ATOM 1928  H HG3  . GLN A 1 126 ? 3.860   -14.307 -6.759  1.00 0.00 ? 126 GLN A HG3  1  
ATOM 1929  H HE21 . GLN A 1 126 ? 2.188   -17.141 -5.222  1.00 0.00 ? 126 GLN A HE21 1  
ATOM 1930  H HE22 . GLN A 1 126 ? 3.726   -17.969 -4.944  1.00 0.00 ? 126 GLN A HE22 1  
ATOM 1931  N N    . ALA A 1 127 ? 0.813   -12.362 -3.547  1.00 0.00 ? 127 ALA A N    1  
ATOM 1932  C CA   . ALA A 1 127 ? -0.020  -12.142 -2.378  1.00 0.00 ? 127 ALA A CA   1  
ATOM 1933  C C    . ALA A 1 127 ? -1.224  -11.265 -2.736  1.00 0.00 ? 127 ALA A C    1  
ATOM 1934  O O    . ALA A 1 127 ? -2.371  -11.559 -2.392  1.00 0.00 ? 127 ALA A O    1  
ATOM 1935  C CB   . ALA A 1 127 ? 0.828   -11.503 -1.272  1.00 0.00 ? 127 ALA A CB   1  
ATOM 1936  H H    . ALA A 1 127 ? 1.798   -12.110 -3.474  1.00 0.00 ? 127 ALA A H    1  
ATOM 1937  H HA   . ALA A 1 127 ? -0.356  -13.120 -2.042  1.00 0.00 ? 127 ALA A HA   1  
ATOM 1938  H HB1  . ALA A 1 127 ? 1.186   -10.519 -1.584  1.00 0.00 ? 127 ALA A HB1  1  
ATOM 1939  H HB2  . ALA A 1 127 ? 0.223   -11.395 -0.374  1.00 0.00 ? 127 ALA A HB2  1  
ATOM 1940  H HB3  . ALA A 1 127 ? 1.682   -12.142 -1.044  1.00 0.00 ? 127 ALA A HB3  1  
ATOM 1941  N N    . VAL A 1 128 ? -0.971  -10.200 -3.492  1.00 0.00 ? 128 VAL A N    1  
ATOM 1942  C CA   . VAL A 1 128 ? -1.977  -9.275  -3.971  1.00 0.00 ? 128 VAL A CA   1  
ATOM 1943  C C    . VAL A 1 128 ? -2.984  -10.028 -4.846  1.00 0.00 ? 128 VAL A C    1  
ATOM 1944  O O    . VAL A 1 128 ? -4.187  -9.878  -4.645  1.00 0.00 ? 128 VAL A O    1  
ATOM 1945  C CB   . VAL A 1 128 ? -1.296  -8.074  -4.669  1.00 0.00 ? 128 VAL A CB   1  
ATOM 1946  C CG1  . VAL A 1 128 ? -2.253  -7.140  -5.425  1.00 0.00 ? 128 VAL A CG1  1  
ATOM 1947  C CG2  . VAL A 1 128 ? -0.513  -7.234  -3.649  1.00 0.00 ? 128 VAL A CG2  1  
ATOM 1948  H H    . VAL A 1 128 ? -0.010  -10.025 -3.774  1.00 0.00 ? 128 VAL A H    1  
ATOM 1949  H HA   . VAL A 1 128 ? -2.495  -8.913  -3.088  1.00 0.00 ? 128 VAL A HA   1  
ATOM 1950  H HB   . VAL A 1 128 ? -0.584  -8.461  -5.389  1.00 0.00 ? 128 VAL A HB   1  
ATOM 1951  H HG11 . VAL A 1 128 ? -2.936  -6.641  -4.742  1.00 0.00 ? 128 VAL A HG11 1  
ATOM 1952  H HG12 . VAL A 1 128 ? -1.667  -6.391  -5.954  1.00 0.00 ? 128 VAL A HG12 1  
ATOM 1953  H HG13 . VAL A 1 128 ? -2.830  -7.695  -6.160  1.00 0.00 ? 128 VAL A HG13 1  
ATOM 1954  H HG21 . VAL A 1 128 ? -1.197  -6.789  -2.929  1.00 0.00 ? 128 VAL A HG21 1  
ATOM 1955  H HG22 . VAL A 1 128 ? 0.207   -7.854  -3.118  1.00 0.00 ? 128 VAL A HG22 1  
ATOM 1956  H HG23 . VAL A 1 128 ? 0.023   -6.439  -4.168  1.00 0.00 ? 128 VAL A HG23 1  
ATOM 1957  N N    . ARG A 1 129 ? -2.562  -10.908 -5.767  1.00 0.00 ? 129 ARG A N    1  
ATOM 1958  C CA   . ARG A 1 129 ? -3.540  -11.679 -6.545  1.00 0.00 ? 129 ARG A CA   1  
ATOM 1959  C C    . ARG A 1 129 ? -4.307  -12.679 -5.685  1.00 0.00 ? 129 ARG A C    1  
ATOM 1960  O O    . ARG A 1 129 ? -5.490  -12.863 -5.959  1.00 0.00 ? 129 ARG A O    1  
ATOM 1961  C CB   . ARG A 1 129 ? -2.917  -12.323 -7.792  1.00 0.00 ? 129 ARG A CB   1  
ATOM 1962  C CG   . ARG A 1 129 ? -3.020  -11.363 -8.994  1.00 0.00 ? 129 ARG A CG   1  
ATOM 1963  C CD   . ARG A 1 129 ? -1.903  -11.533 -10.029 1.00 0.00 ? 129 ARG A CD   1  
ATOM 1964  N NE   . ARG A 1 129 ? -2.168  -12.622 -10.977 1.00 0.00 ? 129 ARG A NE   1  
ATOM 1965  C CZ   . ARG A 1 129 ? -1.837  -13.909 -10.881 1.00 0.00 ? 129 ARG A CZ   1  
ATOM 1966  N NH1  . ARG A 1 129 ? -1.324  -14.405 -9.759  1.00 0.00 ? 129 ARG A NH1  1  
ATOM 1967  N NH2  . ARG A 1 129 ? -2.007  -14.694 -11.935 1.00 0.00 ? 129 ARG A NH2  1  
ATOM 1968  H H    . ARG A 1 129 ? -1.572  -11.112 -5.858  1.00 0.00 ? 129 ARG A H    1  
ATOM 1969  H HA   . ARG A 1 129 ? -4.301  -10.982 -6.891  1.00 0.00 ? 129 ARG A HA   1  
ATOM 1970  H HB2  . ARG A 1 129 ? -1.882  -12.589 -7.584  1.00 0.00 ? 129 ARG A HB2  1  
ATOM 1971  H HB3  . ARG A 1 129 ? -3.458  -13.234 -8.044  1.00 0.00 ? 129 ARG A HB3  1  
ATOM 1972  H HG2  . ARG A 1 129 ? -3.993  -11.487 -9.475  1.00 0.00 ? 129 ARG A HG2  1  
ATOM 1973  H HG3  . ARG A 1 129 ? -2.976  -10.336 -8.640  1.00 0.00 ? 129 ARG A HG3  1  
ATOM 1974  H HD2  . ARG A 1 129 ? -1.844  -10.610 -10.609 1.00 0.00 ? 129 ARG A HD2  1  
ATOM 1975  H HD3  . ARG A 1 129 ? -0.940  -11.674 -9.539  1.00 0.00 ? 129 ARG A HD3  1  
ATOM 1976  H HE   . ARG A 1 129 ? -2.581  -12.311 -11.857 1.00 0.00 ? 129 ARG A HE   1  
ATOM 1977  H HH11 . ARG A 1 129 ? -1.196  -13.813 -8.956  1.00 0.00 ? 129 ARG A HH11 1  
ATOM 1978  H HH12 . ARG A 1 129 ? -1.083  -15.382 -9.669  1.00 0.00 ? 129 ARG A HH12 1  
ATOM 1979  H HH21 . ARG A 1 129 ? -2.408  -14.335 -12.800 1.00 0.00 ? 129 ARG A HH21 1  
ATOM 1980  H HH22 . ARG A 1 129 ? -1.855  -15.700 -11.907 1.00 0.00 ? 129 ARG A HH22 1  
ATOM 1981  N N    . GLN A 1 130 ? -3.732  -13.261 -4.629  1.00 0.00 ? 130 GLN A N    1  
ATOM 1982  C CA   . GLN A 1 130 ? -4.532  -14.047 -3.686  1.00 0.00 ? 130 GLN A CA   1  
ATOM 1983  C C    . GLN A 1 130 ? -5.604  -13.172 -3.033  1.00 0.00 ? 130 GLN A C    1  
ATOM 1984  O O    . GLN A 1 130 ? -6.740  -13.610 -2.863  1.00 0.00 ? 130 GLN A O    1  
ATOM 1985  C CB   . GLN A 1 130 ? -3.659  -14.732 -2.624  1.00 0.00 ? 130 GLN A CB   1  
ATOM 1986  C CG   . GLN A 1 130 ? -2.735  -15.783 -3.250  1.00 0.00 ? 130 GLN A CG   1  
ATOM 1987  C CD   . GLN A 1 130 ? -2.633  -17.072 -2.437  1.00 0.00 ? 130 GLN A CD   1  
ATOM 1988  O OE1  . GLN A 1 130 ? -1.544  -17.554 -2.138  1.00 0.00 ? 130 GLN A OE1  1  
ATOM 1989  N NE2  . GLN A 1 130 ? -3.737  -17.715 -2.110  1.00 0.00 ? 130 GLN A NE2  1  
ATOM 1990  H H    . GLN A 1 130 ? -2.747  -13.100 -4.444  1.00 0.00 ? 130 GLN A H    1  
ATOM 1991  H HA   . GLN A 1 130 ? -5.052  -14.825 -4.244  1.00 0.00 ? 130 GLN A HA   1  
ATOM 1992  H HB2  . GLN A 1 130 ? -3.047  -14.005 -2.101  1.00 0.00 ? 130 GLN A HB2  1  
ATOM 1993  H HB3  . GLN A 1 130 ? -4.322  -15.198 -1.895  1.00 0.00 ? 130 GLN A HB3  1  
ATOM 1994  H HG2  . GLN A 1 130 ? -3.102  -16.026 -4.241  1.00 0.00 ? 130 GLN A HG2  1  
ATOM 1995  H HG3  . GLN A 1 130 ? -1.741  -15.350 -3.365  1.00 0.00 ? 130 GLN A HG3  1  
ATOM 1996  H HE21 . GLN A 1 130 ? -4.649  -17.367 -2.393  1.00 0.00 ? 130 GLN A HE21 1  
ATOM 1997  H HE22 . GLN A 1 130 ? -3.664  -18.509 -1.480  1.00 0.00 ? 130 GLN A HE22 1  
ATOM 1998  N N    . THR A 1 131 ? -5.274  -11.919 -2.733  1.00 0.00 ? 131 THR A N    1  
ATOM 1999  C CA   . THR A 1 131 ? -6.222  -10.963 -2.180  1.00 0.00 ? 131 THR A CA   1  
ATOM 2000  C C    . THR A 1 131 ? -7.327  -10.635 -3.199  1.00 0.00 ? 131 THR A C    1  
ATOM 2001  O O    . THR A 1 131 ? -8.512  -10.674 -2.872  1.00 0.00 ? 131 THR A O    1  
ATOM 2002  C CB   . THR A 1 131 ? -5.503  -9.675  -1.760  1.00 0.00 ? 131 THR A CB   1  
ATOM 2003  O OG1  . THR A 1 131 ? -4.201  -9.848  -1.233  1.00 0.00 ? 131 THR A OG1  1  
ATOM 2004  C CG2  . THR A 1 131 ? -6.295  -8.954  -0.674  1.00 0.00 ? 131 THR A CG2  1  
ATOM 2005  H H    . THR A 1 131 ? -4.321  -11.634 -2.917  1.00 0.00 ? 131 THR A H    1  
ATOM 2006  H HA   . THR A 1 131 ? -6.680  -11.421 -1.305  1.00 0.00 ? 131 THR A HA   1  
ATOM 2007  H HB   . THR A 1 131 ? -5.432  -9.039  -2.637  1.00 0.00 ? 131 THR A HB   1  
ATOM 2008  H HG1  . THR A 1 131 ? -3.705  -10.524 -1.723  1.00 0.00 ? 131 THR A HG1  1  
ATOM 2009  H HG21 . THR A 1 131 ? -6.322  -9.567  0.214   1.00 0.00 ? 131 THR A HG21 1  
ATOM 2010  H HG22 . THR A 1 131 ? -5.812  -8.012  -0.420  1.00 0.00 ? 131 THR A HG22 1  
ATOM 2011  H HG23 . THR A 1 131 ? -7.316  -8.771  -1.008  1.00 0.00 ? 131 THR A HG23 1  
ATOM 2012  N N    . LEU A 1 132 ? -6.954  -10.333 -4.450  1.00 0.00 ? 132 LEU A N    1  
ATOM 2013  C CA   . LEU A 1 132 ? -7.877  -10.027 -5.546  1.00 0.00 ? 132 LEU A CA   1  
ATOM 2014  C C    . LEU A 1 132 ? -8.732  -11.247 -5.910  1.00 0.00 ? 132 LEU A C    1  
ATOM 2015  O O    . LEU A 1 132 ? -9.794  -11.080 -6.508  1.00 0.00 ? 132 LEU A O    1  
ATOM 2016  C CB   . LEU A 1 132 ? -7.111  -9.556  -6.799  1.00 0.00 ? 132 LEU A CB   1  
ATOM 2017  C CG   . LEU A 1 132 ? -6.399  -8.191  -6.670  1.00 0.00 ? 132 LEU A CG   1  
ATOM 2018  C CD1  . LEU A 1 132 ? -5.326  -8.056  -7.757  1.00 0.00 ? 132 LEU A CD1  1  
ATOM 2019  C CD2  . LEU A 1 132 ? -7.362  -7.002  -6.804  1.00 0.00 ? 132 LEU A CD2  1  
ATOM 2020  H H    . LEU A 1 132 ? -5.958  -10.285 -4.641  1.00 0.00 ? 132 LEU A H    1  
ATOM 2021  H HA   . LEU A 1 132 ? -8.545  -9.228  -5.225  1.00 0.00 ? 132 LEU A HA   1  
ATOM 2022  H HB2  . LEU A 1 132 ? -6.384  -10.325 -7.053  1.00 0.00 ? 132 LEU A HB2  1  
ATOM 2023  H HB3  . LEU A 1 132 ? -7.809  -9.498  -7.636  1.00 0.00 ? 132 LEU A HB3  1  
ATOM 2024  H HG   . LEU A 1 132 ? -5.908  -8.127  -5.700  1.00 0.00 ? 132 LEU A HG   1  
ATOM 2025  H HD11 . LEU A 1 132 ? -5.769  -8.149  -8.750  1.00 0.00 ? 132 LEU A HD11 1  
ATOM 2026  H HD12 . LEU A 1 132 ? -4.833  -7.089  -7.674  1.00 0.00 ? 132 LEU A HD12 1  
ATOM 2027  H HD13 . LEU A 1 132 ? -4.575  -8.831  -7.630  1.00 0.00 ? 132 LEU A HD13 1  
ATOM 2028  H HD21 . LEU A 1 132 ? -6.817  -6.064  -6.646  1.00 0.00 ? 132 LEU A HD21 1  
ATOM 2029  H HD22 . LEU A 1 132 ? -7.815  -6.991  -7.795  1.00 0.00 ? 132 LEU A HD22 1  
ATOM 2030  H HD23 . LEU A 1 132 ? -8.155  -7.078  -6.059  1.00 0.00 ? 132 LEU A HD23 1  
ATOM 2031  N N    . SER A 1 133 ? -8.311  -12.458 -5.542  1.00 0.00 ? 133 SER A N    1  
ATOM 2032  C CA   . SER A 1 133 ? -9.101  -13.670 -5.678  1.00 0.00 ? 133 SER A CA   1  
ATOM 2033  C C    . SER A 1 133 ? -10.272 -13.627 -4.699  1.00 0.00 ? 133 SER A C    1  
ATOM 2034  O O    . SER A 1 133 ? -11.363 -14.093 -5.025  1.00 0.00 ? 133 SER A O    1  
ATOM 2035  C CB   . SER A 1 133 ? -8.217  -14.895 -5.393  1.00 0.00 ? 133 SER A CB   1  
ATOM 2036  O OG   . SER A 1 133 ? -7.968  -15.660 -6.556  1.00 0.00 ? 133 SER A OG   1  
ATOM 2037  H H    . SER A 1 133 ? -7.453  -12.516 -5.011  1.00 0.00 ? 133 SER A H    1  
ATOM 2038  H HA   . SER A 1 133 ? -9.503  -13.728 -6.689  1.00 0.00 ? 133 SER A HA   1  
ATOM 2039  H HB2  . SER A 1 133 ? -7.260  -14.582 -4.985  1.00 0.00 ? 133 SER A HB2  1  
ATOM 2040  H HB3  . SER A 1 133 ? -8.701  -15.529 -4.652  1.00 0.00 ? 133 SER A HB3  1  
ATOM 2041  H HG   . SER A 1 133 ? -8.531  -16.460 -6.480  1.00 0.00 ? 133 SER A HG   1  
ATOM 2042  N N    . THR A 1 134 ? -10.061 -13.135 -3.482  1.00 0.00 ? 134 THR A N    1  
ATOM 2043  C CA   . THR A 1 134 ? -11.061 -13.130 -2.437  1.00 0.00 ? 134 THR A CA   1  
ATOM 2044  C C    . THR A 1 134 ? -12.232 -12.223 -2.854  1.00 0.00 ? 134 THR A C    1  
ATOM 2045  O O    . THR A 1 134 ? -12.005 -11.098 -3.299  1.00 0.00 ? 134 THR A O    1  
ATOM 2046  C CB   . THR A 1 134 ? -10.401 -12.632 -1.146  1.00 0.00 ? 134 THR A CB   1  
ATOM 2047  O OG1  . THR A 1 134 ? -9.202  -13.331 -0.903  1.00 0.00 ? 134 THR A OG1  1  
ATOM 2048  C CG2  . THR A 1 134 ? -11.310 -12.860 0.057   1.00 0.00 ? 134 THR A CG2  1  
ATOM 2049  H H    . THR A 1 134 ? -9.159  -12.781 -3.205  1.00 0.00 ? 134 THR A H    1  
ATOM 2050  H HA   . THR A 1 134 ? -11.383 -14.159 -2.290  1.00 0.00 ? 134 THR A HA   1  
ATOM 2051  H HB   . THR A 1 134 ? -10.168 -11.573 -1.251  1.00 0.00 ? 134 THR A HB   1  
ATOM 2052  H HG1  . THR A 1 134 ? -8.649  -12.732 -0.360  1.00 0.00 ? 134 THR A HG1  1  
ATOM 2053  H HG21 . THR A 1 134 ? -11.579 -13.915 0.123   1.00 0.00 ? 134 THR A HG21 1  
ATOM 2054  H HG22 . THR A 1 134 ? -10.802 -12.577 0.978   1.00 0.00 ? 134 THR A HG22 1  
ATOM 2055  H HG23 . THR A 1 134 ? -12.215 -12.267 -0.050  1.00 0.00 ? 134 THR A HG23 1  
ATOM 2056  N N    . PRO A 1 135 ? -13.486 -12.670 -2.688  1.00 0.00 ? 135 PRO A N    1  
ATOM 2057  C CA   . PRO A 1 135 ? -14.671 -11.871 -2.966  1.00 0.00 ? 135 PRO A CA   1  
ATOM 2058  C C    . PRO A 1 135 ? -14.987 -10.901 -1.830  1.00 0.00 ? 135 PRO A C    1  
ATOM 2059  O O    . PRO A 1 135 ? -15.600 -9.864  -2.069  1.00 0.00 ? 135 PRO A O    1  
ATOM 2060  C CB   . PRO A 1 135 ? -15.813 -12.878 -3.112  1.00 0.00 ? 135 PRO A CB   1  
ATOM 2061  C CG   . PRO A 1 135 ? -15.359 -14.079 -2.287  1.00 0.00 ? 135 PRO A CG   1  
ATOM 2062  C CD   . PRO A 1 135 ? -13.839 -14.036 -2.363  1.00 0.00 ? 135 PRO A CD   1  
ATOM 2063  H HA   . PRO A 1 135 ? -14.552 -11.306 -3.891  1.00 0.00 ? 135 PRO A HA   1  
ATOM 2064  H HB2  . PRO A 1 135 ? -16.739 -12.472 -2.708  1.00 0.00 ? 135 PRO A HB2  1  
ATOM 2065  H HB3  . PRO A 1 135 ? -15.924 -13.161 -4.160  1.00 0.00 ? 135 PRO A HB3  1  
ATOM 2066  H HG2  . PRO A 1 135 ? -15.677 -13.955 -1.251  1.00 0.00 ? 135 PRO A HG2  1  
ATOM 2067  H HG3  . PRO A 1 135 ? -15.742 -15.011 -2.691  1.00 0.00 ? 135 PRO A HG3  1  
ATOM 2068  H HD2  . PRO A 1 135 ? -13.413 -14.347 -1.409  1.00 0.00 ? 135 PRO A HD2  1  
ATOM 2069  H HD3  . PRO A 1 135 ? -13.462 -14.668 -3.166  1.00 0.00 ? 135 PRO A HD3  1  
ATOM 2070  N N    . GLY A 1 136 ? -14.631 -11.244 -0.589  1.00 0.00 ? 136 GLY A N    1  
ATOM 2071  C CA   . GLY A 1 136 ? -14.903 -10.412 0.564   1.00 0.00 ? 136 GLY A CA   1  
ATOM 2072  C C    . GLY A 1 136 ? -13.980 -9.203  0.588   1.00 0.00 ? 136 GLY A C    1  
ATOM 2073  O O    . GLY A 1 136 ? -14.469 -8.085  0.706   1.00 0.00 ? 136 GLY A O    1  
ATOM 2074  H H    . GLY A 1 136 ? -14.198 -12.145 -0.413  1.00 0.00 ? 136 GLY A H    1  
ATOM 2075  H HA2  . GLY A 1 136 ? -15.939 -10.073 0.530   1.00 0.00 ? 136 GLY A HA2  1  
ATOM 2076  H HA3  . GLY A 1 136 ? -14.758 -11.003 1.465   1.00 0.00 ? 136 GLY A HA3  1  
ATOM 2077  N N    . THR A 1 137 ? -12.665 -9.412  0.515   1.00 0.00 ? 137 THR A N    1  
ATOM 2078  C CA   . THR A 1 137 ? -11.681 -8.363  0.752   1.00 0.00 ? 137 THR A CA   1  
ATOM 2079  C C    . THR A 1 137 ? -11.796 -7.218  -0.262  1.00 0.00 ? 137 THR A C    1  
ATOM 2080  O O    . THR A 1 137 ? -12.058 -7.446  -1.447  1.00 0.00 ? 137 THR A O    1  
ATOM 2081  C CB   . THR A 1 137 ? -10.290 -9.004  0.792   1.00 0.00 ? 137 THR A CB   1  
ATOM 2082  O OG1  . THR A 1 137 ? -10.290 -10.109 1.681   1.00 0.00 ? 137 THR A OG1  1  
ATOM 2083  C CG2  . THR A 1 137 ? -9.215  -8.038  1.271   1.00 0.00 ? 137 THR A CG2  1  
ATOM 2084  H H    . THR A 1 137 ? -12.306 -10.351 0.443   1.00 0.00 ? 137 THR A H    1  
ATOM 2085  H HA   . THR A 1 137 ? -11.892 -7.944  1.727   1.00 0.00 ? 137 THR A HA   1  
ATOM 2086  H HB   . THR A 1 137 ? -10.029 -9.361  -0.207  1.00 0.00 ? 137 THR A HB   1  
ATOM 2087  H HG1  . THR A 1 137 ? -10.236 -9.791  2.592   1.00 0.00 ? 137 THR A HG1  1  
ATOM 2088  H HG21 . THR A 1 137 ? -9.071  -7.250  0.532   1.00 0.00 ? 137 THR A HG21 1  
ATOM 2089  H HG22 . THR A 1 137 ? -9.486  -7.595  2.231   1.00 0.00 ? 137 THR A HG22 1  
ATOM 2090  H HG23 . THR A 1 137 ? -8.272  -8.573  1.385   1.00 0.00 ? 137 THR A HG23 1  
ATOM 2091  N N    . ILE A 1 138 ? -11.538 -5.988  0.194   1.00 0.00 ? 138 ILE A N    1  
ATOM 2092  C CA   . ILE A 1 138 ? -11.794 -4.762  -0.545  1.00 0.00 ? 138 ILE A CA   1  
ATOM 2093  C C    . ILE A 1 138 ? -10.428 -4.113  -0.609  1.00 0.00 ? 138 ILE A C    1  
ATOM 2094  O O    . ILE A 1 138 ? -9.962  -3.557  0.384   1.00 0.00 ? 138 ILE A O    1  
ATOM 2095  C CB   . ILE A 1 138 ? -12.877 -3.880  0.139   1.00 0.00 ? 138 ILE A CB   1  
ATOM 2096  C CG1  . ILE A 1 138 ? -14.281 -4.509  0.056   1.00 0.00 ? 138 ILE A CG1  1  
ATOM 2097  C CG2  . ILE A 1 138 ? -12.920 -2.478  -0.485  1.00 0.00 ? 138 ILE A CG2  1  
ATOM 2098  C CD1  . ILE A 1 138 ? -15.265 -3.977  1.112   1.00 0.00 ? 138 ILE A CD1  1  
ATOM 2099  H H    . ILE A 1 138 ? -11.144 -5.858  1.126   1.00 0.00 ? 138 ILE A H    1  
ATOM 2100  H HA   . ILE A 1 138 ? -12.135 -4.997  -1.554  1.00 0.00 ? 138 ILE A HA   1  
ATOM 2101  H HB   . ILE A 1 138 ? -12.616 -3.761  1.186   1.00 0.00 ? 138 ILE A HB   1  
ATOM 2102  H HG12 . ILE A 1 138 ? -14.696 -4.344  -0.940  1.00 0.00 ? 138 ILE A HG12 1  
ATOM 2103  H HG13 . ILE A 1 138 ? -14.196 -5.580  0.212   1.00 0.00 ? 138 ILE A HG13 1  
ATOM 2104  H HG21 . ILE A 1 138 ? -13.071 -2.533  -1.563  1.00 0.00 ? 138 ILE A HG21 1  
ATOM 2105  H HG22 . ILE A 1 138 ? -13.717 -1.879  -0.050  1.00 0.00 ? 138 ILE A HG22 1  
ATOM 2106  H HG23 . ILE A 1 138 ? -11.985 -1.964  -0.273  1.00 0.00 ? 138 ILE A HG23 1  
ATOM 2107  H HD11 . ILE A 1 138 ? -16.259 -4.369  0.908   1.00 0.00 ? 138 ILE A HD11 1  
ATOM 2108  H HD12 . ILE A 1 138 ? -14.968 -4.308  2.105   1.00 0.00 ? 138 ILE A HD12 1  
ATOM 2109  H HD13 . ILE A 1 138 ? -15.307 -2.891  1.104   1.00 0.00 ? 138 ILE A HD13 1  
ATOM 2110  N N    . ILE A 1 139 ? -9.746  -4.284  -1.737  1.00 0.00 ? 139 ILE A N    1  
ATOM 2111  C CA   . ILE A 1 139 ? -8.460  -3.656  -1.956  1.00 0.00 ? 139 ILE A CA   1  
ATOM 2112  C C    . ILE A 1 139 ? -8.631  -2.145  -1.900  1.00 0.00 ? 139 ILE A C    1  
ATOM 2113  O O    . ILE A 1 139 ? -9.534  -1.588  -2.535  1.00 0.00 ? 139 ILE A O    1  
ATOM 2114  C CB   . ILE A 1 139 ? -7.864  -4.107  -3.295  1.00 0.00 ? 139 ILE A CB   1  
ATOM 2115  C CG1  . ILE A 1 139 ? -7.696  -5.625  -3.389  1.00 0.00 ? 139 ILE A CG1  1  
ATOM 2116  C CG2  . ILE A 1 139 ? -6.504  -3.454  -3.511  1.00 0.00 ? 139 ILE A CG2  1  
ATOM 2117  C CD1  . ILE A 1 139 ? -6.881  -6.208  -2.243  1.00 0.00 ? 139 ILE A CD1  1  
ATOM 2118  H H    . ILE A 1 139 ? -10.115 -4.845  -2.486  1.00 0.00 ? 139 ILE A H    1  
ATOM 2119  H HA   . ILE A 1 139 ? -7.791  -3.954  -1.147  1.00 0.00 ? 139 ILE A HA   1  
ATOM 2120  H HB   . ILE A 1 139 ? -8.517  -3.799  -4.105  1.00 0.00 ? 139 ILE A HB   1  
ATOM 2121  H HG12 . ILE A 1 139 ? -8.672  -6.107  -3.412  1.00 0.00 ? 139 ILE A HG12 1  
ATOM 2122  H HG13 . ILE A 1 139 ? -7.183  -5.858  -4.318  1.00 0.00 ? 139 ILE A HG13 1  
ATOM 2123  H HG21 . ILE A 1 139 ? -6.620  -2.381  -3.659  1.00 0.00 ? 139 ILE A HG21 1  
ATOM 2124  H HG22 . ILE A 1 139 ? -5.870  -3.594  -2.639  1.00 0.00 ? 139 ILE A HG22 1  
ATOM 2125  H HG23 . ILE A 1 139 ? -6.019  -3.901  -4.374  1.00 0.00 ? 139 ILE A HG23 1  
ATOM 2126  H HD11 . ILE A 1 139 ? -5.996  -5.606  -2.012  1.00 0.00 ? 139 ILE A HD11 1  
ATOM 2127  H HD12 . ILE A 1 139 ? -7.497  -6.289  -1.351  1.00 0.00 ? 139 ILE A HD12 1  
ATOM 2128  H HD13 . ILE A 1 139 ? -6.565  -7.189  -2.570  1.00 0.00 ? 139 ILE A HD13 1  
ATOM 2129  N N    . LEU A 1 140 ? -7.757  -1.510  -1.135  1.00 0.00 ? 140 LEU A N    1  
ATOM 2130  C CA   . LEU A 1 140 ? -7.723  -0.093  -0.862  1.00 0.00 ? 140 LEU A CA   1  
ATOM 2131  C C    . LEU A 1 140 ? -6.249  0.300   -0.791  1.00 0.00 ? 140 LEU A C    1  
ATOM 2132  O O    . LEU A 1 140 ? -5.530  -0.233  0.058   1.00 0.00 ? 140 LEU A O    1  
ATOM 2133  C CB   . LEU A 1 140 ? -8.447  0.134   0.465   1.00 0.00 ? 140 LEU A CB   1  
ATOM 2134  C CG   . LEU A 1 140 ? -8.455  1.617   0.862   1.00 0.00 ? 140 LEU A CG   1  
ATOM 2135  C CD1  . LEU A 1 140 ? -9.822  2.210   0.541   1.00 0.00 ? 140 LEU A CD1  1  
ATOM 2136  C CD2  . LEU A 1 140 ? -8.112  1.746   2.343   1.00 0.00 ? 140 LEU A CD2  1  
ATOM 2137  H H    . LEU A 1 140 ? -7.076  -2.068  -0.624  1.00 0.00 ? 140 LEU A H    1  
ATOM 2138  H HA   . LEU A 1 140 ? -8.232  0.455   -1.648  1.00 0.00 ? 140 LEU A HA   1  
ATOM 2139  H HB2  . LEU A 1 140 ? -9.466  -0.250  0.397   1.00 0.00 ? 140 LEU A HB2  1  
ATOM 2140  H HB3  . LEU A 1 140 ? -7.965  -0.455  1.241   1.00 0.00 ? 140 LEU A HB3  1  
ATOM 2141  H HG   . LEU A 1 140 ? -7.713  2.178   0.294   1.00 0.00 ? 140 LEU A HG   1  
ATOM 2142  H HD11 . LEU A 1 140 ? -9.931  2.286   -0.540  1.00 0.00 ? 140 LEU A HD11 1  
ATOM 2143  H HD12 . LEU A 1 140 ? -10.620 1.610   0.979   1.00 0.00 ? 140 LEU A HD12 1  
ATOM 2144  H HD13 . LEU A 1 140 ? -9.875  3.202   0.970   1.00 0.00 ? 140 LEU A HD13 1  
ATOM 2145  H HD21 . LEU A 1 140 ? -8.784  1.115   2.925   1.00 0.00 ? 140 LEU A HD21 1  
ATOM 2146  H HD22 . LEU A 1 140 ? -7.080  1.431   2.500   1.00 0.00 ? 140 LEU A HD22 1  
ATOM 2147  H HD23 . LEU A 1 140 ? -8.216  2.785   2.658   1.00 0.00 ? 140 LEU A HD23 1  
ATOM 2148  N N    . GLY A 1 141 ? -5.760  1.154   -1.693  1.00 0.00 ? 141 GLY A N    1  
ATOM 2149  C CA   . GLY A 1 141 ? -4.317  1.374   -1.776  1.00 0.00 ? 141 GLY A CA   1  
ATOM 2150  C C    . GLY A 1 141 ? -3.870  2.575   -2.579  1.00 0.00 ? 141 GLY A C    1  
ATOM 2151  O O    . GLY A 1 141 ? -4.702  3.293   -3.139  1.00 0.00 ? 141 GLY A O    1  
ATOM 2152  H H    . GLY A 1 141 ? -6.365  1.518   -2.416  1.00 0.00 ? 141 GLY A H    1  
ATOM 2153  H HA2  . GLY A 1 141 ? -3.918  1.477   -0.769  1.00 0.00 ? 141 GLY A HA2  1  
ATOM 2154  H HA3  . GLY A 1 141 ? -3.864  0.501   -2.239  1.00 0.00 ? 141 GLY A HA3  1  
ATOM 2155  N N    . THR A 1 142 ? -2.549  2.762   -2.655  1.00 0.00 ? 142 THR A N    1  
ATOM 2156  C CA   . THR A 1 142 ? -1.928  3.913   -3.300  1.00 0.00 ? 142 THR A CA   1  
ATOM 2157  C C    . THR A 1 142 ? -0.948  3.496   -4.404  1.00 0.00 ? 142 THR A C    1  
ATOM 2158  O O    . THR A 1 142 ? 0.216   3.197   -4.118  1.00 0.00 ? 142 THR A O    1  
ATOM 2159  C CB   . THR A 1 142 ? -1.209  4.758   -2.241  1.00 0.00 ? 142 THR A CB   1  
ATOM 2160  O OG1  . THR A 1 142 ? -1.983  4.947   -1.081  1.00 0.00 ? 142 THR A OG1  1  
ATOM 2161  C CG2  . THR A 1 142 ? -0.846  6.124   -2.813  1.00 0.00 ? 142 THR A CG2  1  
ATOM 2162  H H    . THR A 1 142 ? -1.952  2.167   -2.082  1.00 0.00 ? 142 THR A H    1  
ATOM 2163  H HA   . THR A 1 142 ? -2.706  4.529   -3.749  1.00 0.00 ? 142 THR A HA   1  
ATOM 2164  H HB   . THR A 1 142 ? -0.291  4.244   -1.951  1.00 0.00 ? 142 THR A HB   1  
ATOM 2165  H HG1  . THR A 1 142 ? -1.329  4.996   -0.349  1.00 0.00 ? 142 THR A HG1  1  
ATOM 2166  H HG21 . THR A 1 142 ? -0.165  6.624   -2.122  1.00 0.00 ? 142 THR A HG21 1  
ATOM 2167  H HG22 . THR A 1 142 ? -0.369  6.000   -3.787  1.00 0.00 ? 142 THR A HG22 1  
ATOM 2168  H HG23 . THR A 1 142 ? -1.749  6.718   -2.946  1.00 0.00 ? 142 THR A HG23 1  
ATOM 2169  N N    . ILE A 1 143 ? -1.375  3.561   -5.666  1.00 0.00 ? 143 ILE A N    1  
ATOM 2170  C CA   . ILE A 1 143 ? -0.478  3.401   -6.813  1.00 0.00 ? 143 ILE A CA   1  
ATOM 2171  C C    . ILE A 1 143 ? -0.054  4.786   -7.347  1.00 0.00 ? 143 ILE A C    1  
ATOM 2172  O O    . ILE A 1 143 ? -0.715  5.784   -7.038  1.00 0.00 ? 143 ILE A O    1  
ATOM 2173  C CB   . ILE A 1 143 ? -1.151  2.511   -7.884  1.00 0.00 ? 143 ILE A CB   1  
ATOM 2174  C CG1  . ILE A 1 143 ? -2.506  3.071   -8.352  1.00 0.00 ? 143 ILE A CG1  1  
ATOM 2175  C CG2  . ILE A 1 143 ? -1.321  1.076   -7.352  1.00 0.00 ? 143 ILE A CG2  1  
ATOM 2176  C CD1  . ILE A 1 143 ? -2.828  2.679   -9.803  1.00 0.00 ? 143 ILE A CD1  1  
ATOM 2177  H H    . ILE A 1 143 ? -2.300  3.915   -5.878  1.00 0.00 ? 143 ILE A H    1  
ATOM 2178  H HA   . ILE A 1 143 ? 0.422   2.888   -6.483  1.00 0.00 ? 143 ILE A HA   1  
ATOM 2179  H HB   . ILE A 1 143 ? -0.488  2.466   -8.746  1.00 0.00 ? 143 ILE A HB   1  
ATOM 2180  H HG12 . ILE A 1 143 ? -3.292  2.696   -7.703  1.00 0.00 ? 143 ILE A HG12 1  
ATOM 2181  H HG13 . ILE A 1 143 ? -2.506  4.161   -8.263  1.00 0.00 ? 143 ILE A HG13 1  
ATOM 2182  H HG21 . ILE A 1 143 ? -0.344  0.609   -7.254  1.00 0.00 ? 143 ILE A HG21 1  
ATOM 2183  H HG22 . ILE A 1 143 ? -1.796  1.069   -6.374  1.00 0.00 ? 143 ILE A HG22 1  
ATOM 2184  H HG23 . ILE A 1 143 ? -1.927  0.476   -8.030  1.00 0.00 ? 143 ILE A HG23 1  
ATOM 2185  H HD11 . ILE A 1 143 ? -2.020  2.989   -10.466 1.00 0.00 ? 143 ILE A HD11 1  
ATOM 2186  H HD12 . ILE A 1 143 ? -2.981  1.600   -9.913  1.00 0.00 ? 143 ILE A HD12 1  
ATOM 2187  H HD13 . ILE A 1 143 ? -3.736  3.192   -10.104 1.00 0.00 ? 143 ILE A HD13 1  
ATOM 2188  N N    . PRO A 1 144 ? 1.028   4.900   -8.137  1.00 0.00 ? 144 PRO A N    1  
ATOM 2189  C CA   . PRO A 1 144 ? 1.384   6.130   -8.841  1.00 0.00 ? 144 PRO A CA   1  
ATOM 2190  C C    . PRO A 1 144 ? 0.418   6.379   -10.010 1.00 0.00 ? 144 PRO A C    1  
ATOM 2191  O O    . PRO A 1 144 ? -0.516  5.603   -10.238 1.00 0.00 ? 144 PRO A O    1  
ATOM 2192  C CB   . PRO A 1 144 ? 2.831   5.915   -9.302  1.00 0.00 ? 144 PRO A CB   1  
ATOM 2193  C CG   . PRO A 1 144 ? 2.924   4.404   -9.493  1.00 0.00 ? 144 PRO A CG   1  
ATOM 2194  C CD   . PRO A 1 144 ? 2.033   3.877   -8.372  1.00 0.00 ? 144 PRO A CD   1  
ATOM 2195  H HA   . PRO A 1 144 ? 1.342   6.979   -8.157  1.00 0.00 ? 144 PRO A HA   1  
ATOM 2196  H HB2  . PRO A 1 144 ? 3.076   6.456   -10.217 1.00 0.00 ? 144 PRO A HB2  1  
ATOM 2197  H HB3  . PRO A 1 144 ? 3.504   6.212   -8.498  1.00 0.00 ? 144 PRO A HB3  1  
ATOM 2198  H HG2  . PRO A 1 144 ? 2.504   4.127   -10.461 1.00 0.00 ? 144 PRO A HG2  1  
ATOM 2199  H HG3  . PRO A 1 144 ? 3.949   4.044   -9.398  1.00 0.00 ? 144 PRO A HG3  1  
ATOM 2200  H HD2  . PRO A 1 144 ? 1.597   2.924   -8.658  1.00 0.00 ? 144 PRO A HD2  1  
ATOM 2201  H HD3  . PRO A 1 144 ? 2.617   3.758   -7.462  1.00 0.00 ? 144 PRO A HD3  1  
ATOM 2202  N N    . VAL A 1 145 ? 0.609   7.471   -10.758 1.00 0.00 ? 145 VAL A N    1  
ATOM 2203  C CA   . VAL A 1 145 ? -0.037  7.615   -12.059 1.00 0.00 ? 145 VAL A CA   1  
ATOM 2204  C C    . VAL A 1 145 ? 0.684   6.782   -13.117 1.00 0.00 ? 145 VAL A C    1  
ATOM 2205  O O    . VAL A 1 145 ? 1.908   6.621   -13.066 1.00 0.00 ? 145 VAL A O    1  
ATOM 2206  C CB   . VAL A 1 145 ? -0.116  9.079   -12.536 1.00 0.00 ? 145 VAL A CB   1  
ATOM 2207  C CG1  . VAL A 1 145 ? -1.401  9.725   -12.014 1.00 0.00 ? 145 VAL A CG1  1  
ATOM 2208  C CG2  . VAL A 1 145 ? 1.109   9.932   -12.175 1.00 0.00 ? 145 VAL A CG2  1  
ATOM 2209  H H    . VAL A 1 145 ? 1.378   8.095   -10.563 1.00 0.00 ? 145 VAL A H    1  
ATOM 2210  H HA   . VAL A 1 145 ? -1.051  7.218   -11.989 1.00 0.00 ? 145 VAL A HA   1  
ATOM 2211  H HB   . VAL A 1 145 ? -0.193  9.075   -13.623 1.00 0.00 ? 145 VAL A HB   1  
ATOM 2212  H HG11 . VAL A 1 145 ? -1.572  10.667  -12.523 1.00 0.00 ? 145 VAL A HG11 1  
ATOM 2213  H HG12 . VAL A 1 145 ? -2.256  9.084   -12.227 1.00 0.00 ? 145 VAL A HG12 1  
ATOM 2214  H HG13 . VAL A 1 145 ? -1.333  9.874   -10.943 1.00 0.00 ? 145 VAL A HG13 1  
ATOM 2215  H HG21 . VAL A 1 145 ? 1.081   10.867  -12.735 1.00 0.00 ? 145 VAL A HG21 1  
ATOM 2216  H HG22 . VAL A 1 145 ? 1.129   10.151  -11.109 1.00 0.00 ? 145 VAL A HG22 1  
ATOM 2217  H HG23 . VAL A 1 145 ? 2.024   9.404   -12.447 1.00 0.00 ? 145 VAL A HG23 1  
ATOM 2218  N N    . PRO A 1 146 ? -0.068  6.321   -14.127 1.00 0.00 ? 146 PRO A N    1  
ATOM 2219  C CA   . PRO A 1 146 ? 0.488   5.804   -15.353 1.00 0.00 ? 146 PRO A CA   1  
ATOM 2220  C C    . PRO A 1 146 ? 1.054   6.966   -16.168 1.00 0.00 ? 146 PRO A C    1  
ATOM 2221  O O    . PRO A 1 146 ? 0.303   7.771   -16.728 1.00 0.00 ? 146 PRO A O    1  
ATOM 2222  C CB   . PRO A 1 146 ? -0.667  5.094   -16.049 1.00 0.00 ? 146 PRO A CB   1  
ATOM 2223  C CG   . PRO A 1 146 ? -1.910  5.851   -15.566 1.00 0.00 ? 146 PRO A CG   1  
ATOM 2224  C CD   . PRO A 1 146 ? -1.519  6.380   -14.202 1.00 0.00 ? 146 PRO A CD   1  
ATOM 2225  H HA   . PRO A 1 146 ? 1.268   5.082   -15.124 1.00 0.00 ? 146 PRO A HA   1  
ATOM 2226  H HB2  . PRO A 1 146 ? -0.573  5.114   -17.134 1.00 0.00 ? 146 PRO A HB2  1  
ATOM 2227  H HB3  . PRO A 1 146 ? -0.679  4.069   -15.686 1.00 0.00 ? 146 PRO A HB3  1  
ATOM 2228  H HG2  . PRO A 1 146 ? -2.132  6.681   -16.238 1.00 0.00 ? 146 PRO A HG2  1  
ATOM 2229  H HG3  . PRO A 1 146 ? -2.775  5.212   -15.436 1.00 0.00 ? 146 PRO A HG3  1  
ATOM 2230  H HD2  . PRO A 1 146 ? -1.884  7.402   -14.090 1.00 0.00 ? 146 PRO A HD2  1  
ATOM 2231  H HD3  . PRO A 1 146 ? -1.942  5.741   -13.427 1.00 0.00 ? 146 PRO A HD3  1  
ATOM 2232  N N    . LYS A 1 147 ? 2.377   7.038   -16.266 1.00 0.00 ? 147 LYS A N    1  
ATOM 2233  C CA   . LYS A 1 147 ? 3.069   7.853   -17.250 1.00 0.00 ? 147 LYS A CA   1  
ATOM 2234  C C    . LYS A 1 147 ? 4.214   6.998   -17.755 1.00 0.00 ? 147 LYS A C    1  
ATOM 2235  O O    . LYS A 1 147 ? 5.078   6.614   -16.969 1.00 0.00 ? 147 LYS A O    1  
ATOM 2236  C CB   . LYS A 1 147 ? 3.529   9.204   -16.667 1.00 0.00 ? 147 LYS A CB   1  
ATOM 2237  C CG   . LYS A 1 147 ? 4.024   10.182  -17.732 1.00 0.00 ? 147 LYS A CG   1  
ATOM 2238  C CD   . LYS A 1 147 ? 5.544   10.076  -17.873 1.00 0.00 ? 147 LYS A CD   1  
ATOM 2239  C CE   . LYS A 1 147 ? 6.027   10.740  -19.135 1.00 0.00 ? 147 LYS A CE   1  
ATOM 2240  N NZ   . LYS A 1 147 ? 6.036   12.213  -19.038 1.00 0.00 ? 147 LYS A NZ   1  
ATOM 2241  H H    . LYS A 1 147 ? 2.920   6.296   -15.834 1.00 0.00 ? 147 LYS A H    1  
ATOM 2242  H HA   . LYS A 1 147 ? 2.374   8.052   -18.059 1.00 0.00 ? 147 LYS A HA   1  
ATOM 2243  H HB2  . LYS A 1 147 ? 2.693   9.677   -16.161 1.00 0.00 ? 147 LYS A HB2  1  
ATOM 2244  H HB3  . LYS A 1 147 ? 4.347   9.050   -15.969 1.00 0.00 ? 147 LYS A HB3  1  
ATOM 2245  H HG2  . LYS A 1 147 ? 3.537   9.970   -18.684 1.00 0.00 ? 147 LYS A HG2  1  
ATOM 2246  H HG3  . LYS A 1 147 ? 3.773   11.199  -17.425 1.00 0.00 ? 147 LYS A HG3  1  
ATOM 2247  H HD2  . LYS A 1 147 ? 6.036   10.530  -17.018 1.00 0.00 ? 147 LYS A HD2  1  
ATOM 2248  H HD3  . LYS A 1 147 ? 5.840   9.031   -17.935 1.00 0.00 ? 147 LYS A HD3  1  
ATOM 2249  H HE2  . LYS A 1 147 ? 7.034   10.374  -19.311 1.00 0.00 ? 147 LYS A HE2  1  
ATOM 2250  H HE3  . LYS A 1 147 ? 5.348   10.410  -19.916 1.00 0.00 ? 147 LYS A HE3  1  
ATOM 2251  H HZ1  . LYS A 1 147 ? 5.087   12.570  -19.103 1.00 0.00 ? 147 LYS A HZ1  1  
ATOM 2252  H HZ2  . LYS A 1 147 ? 6.466   12.507  -18.164 1.00 0.00 ? 147 LYS A HZ2  1  
ATOM 2253  H HZ3  . LYS A 1 147 ? 6.603   12.606  -19.783 1.00 0.00 ? 147 LYS A HZ3  1  
ATOM 2254  N N    . GLY A 1 148 ? 4.237   6.710   -19.053 1.00 0.00 ? 148 GLY A N    1  
ATOM 2255  C CA   . GLY A 1 148 ? 5.285   5.872   -19.605 1.00 0.00 ? 148 GLY A CA   1  
ATOM 2256  C C    . GLY A 1 148 ? 5.197   4.462   -19.047 1.00 0.00 ? 148 GLY A C    1  
ATOM 2257  O O    . GLY A 1 148 ? 4.144   3.832   -19.144 1.00 0.00 ? 148 GLY A O    1  
ATOM 2258  H H    . GLY A 1 148 ? 3.484   7.023   -19.650 1.00 0.00 ? 148 GLY A H    1  
ATOM 2259  H HA2  . GLY A 1 148 ? 5.197   5.793   -20.688 1.00 0.00 ? 148 GLY A HA2  1  
ATOM 2260  H HA3  . GLY A 1 148 ? 6.250   6.308   -19.348 1.00 0.00 ? 148 GLY A HA3  1  
ATOM 2261  N N    . LYS A 1 149 ? 6.330   3.933   -18.577 1.00 0.00 ? 149 LYS A N    1  
ATOM 2262  C CA   . LYS A 1 149 ? 6.503   2.493   -18.442 1.00 0.00 ? 149 LYS A CA   1  
ATOM 2263  C C    . LYS A 1 149 ? 5.557   1.902   -17.397 1.00 0.00 ? 149 LYS A C    1  
ATOM 2264  O O    . LYS A 1 149 ? 5.383   2.512   -16.337 1.00 0.00 ? 149 LYS A O    1  
ATOM 2265  C CB   . LYS A 1 149 ? 7.976   2.157   -18.132 1.00 0.00 ? 149 LYS A CB   1  
ATOM 2266  C CG   . LYS A 1 149 ? 8.526   0.971   -18.945 1.00 0.00 ? 149 LYS A CG   1  
ATOM 2267  C CD   . LYS A 1 149 ? 8.327   1.072   -20.469 1.00 0.00 ? 149 LYS A CD   1  
ATOM 2268  C CE   . LYS A 1 149 ? 8.802   2.418   -21.004 1.00 0.00 ? 149 LYS A CE   1  
ATOM 2269  N NZ   . LYS A 1 149 ? 8.794   2.470   -22.477 1.00 0.00 ? 149 LYS A NZ   1  
ATOM 2270  H H    . LYS A 1 149 ? 7.144   4.530   -18.467 1.00 0.00 ? 149 LYS A H    1  
ATOM 2271  H HA   . LYS A 1 149 ? 6.216   2.100   -19.410 1.00 0.00 ? 149 LYS A HA   1  
ATOM 2272  H HB2  . LYS A 1 149 ? 8.608   3.021   -18.338 1.00 0.00 ? 149 LYS A HB2  1  
ATOM 2273  H HB3  . LYS A 1 149 ? 8.085   1.937   -17.068 1.00 0.00 ? 149 LYS A HB3  1  
ATOM 2274  H HG2  . LYS A 1 149 ? 9.592   0.901   -18.752 1.00 0.00 ? 149 LYS A HG2  1  
ATOM 2275  H HG3  . LYS A 1 149 ? 8.088   0.044   -18.580 1.00 0.00 ? 149 LYS A HG3  1  
ATOM 2276  H HD2  . LYS A 1 149 ? 8.896   0.274   -20.938 1.00 0.00 ? 149 LYS A HD2  1  
ATOM 2277  H HD3  . LYS A 1 149 ? 7.278   0.950   -20.733 1.00 0.00 ? 149 LYS A HD3  1  
ATOM 2278  H HE2  . LYS A 1 149 ? 8.138   3.188   -20.610 1.00 0.00 ? 149 LYS A HE2  1  
ATOM 2279  H HE3  . LYS A 1 149 ? 9.818   2.590   -20.643 1.00 0.00 ? 149 LYS A HE3  1  
ATOM 2280  H HZ1  . LYS A 1 149 ? 9.220   3.334   -22.800 1.00 0.00 ? 149 LYS A HZ1  1  
ATOM 2281  H HZ2  . LYS A 1 149 ? 9.337   1.696   -22.853 1.00 0.00 ? 149 LYS A HZ2  1  
ATOM 2282  H HZ3  . LYS A 1 149 ? 7.856   2.424   -22.851 1.00 0.00 ? 149 LYS A HZ3  1  
ATOM 2283  N N    . PRO A 1 150 ? 4.937   0.742   -17.673 1.00 0.00 ? 150 PRO A N    1  
ATOM 2284  C CA   . PRO A 1 150 ? 4.072   0.072   -16.721 1.00 0.00 ? 150 PRO A CA   1  
ATOM 2285  C C    . PRO A 1 150 ? 4.918   -0.450  -15.562 1.00 0.00 ? 150 PRO A C    1  
ATOM 2286  O O    . PRO A 1 150 ? 5.940   -1.105  -15.757 1.00 0.00 ? 150 PRO A O    1  
ATOM 2287  C CB   . PRO A 1 150 ? 3.386   -1.053  -17.498 1.00 0.00 ? 150 PRO A CB   1  
ATOM 2288  C CG   . PRO A 1 150 ? 4.386   -1.379  -18.600 1.00 0.00 ? 150 PRO A CG   1  
ATOM 2289  C CD   . PRO A 1 150 ? 5.062   -0.046  -18.889 1.00 0.00 ? 150 PRO A CD   1  
ATOM 2290  H HA   . PRO A 1 150 ? 3.319   0.768   -16.348 1.00 0.00 ? 150 PRO A HA   1  
ATOM 2291  H HB2  . PRO A 1 150 ? 3.197   -1.924  -16.871 1.00 0.00 ? 150 PRO A HB2  1  
ATOM 2292  H HB3  . PRO A 1 150 ? 2.458   -0.684  -17.935 1.00 0.00 ? 150 PRO A HB3  1  
ATOM 2293  H HG2  . PRO A 1 150 ? 5.128   -2.080  -18.214 1.00 0.00 ? 150 PRO A HG2  1  
ATOM 2294  H HG3  . PRO A 1 150 ? 3.910   -1.779  -19.491 1.00 0.00 ? 150 PRO A HG3  1  
ATOM 2295  H HD2  . PRO A 1 150 ? 6.099   -0.236  -19.144 1.00 0.00 ? 150 PRO A HD2  1  
ATOM 2296  H HD3  . PRO A 1 150 ? 4.578   0.479   -19.712 1.00 0.00 ? 150 PRO A HD3  1  
ATOM 2297  N N    . LEU A 1 151 ? 4.470   -0.164  -14.346 1.00 0.00 ? 151 LEU A N    1  
ATOM 2298  C CA   . LEU A 1 151 ? 5.061   -0.634  -13.112 1.00 0.00 ? 151 LEU A CA   1  
ATOM 2299  C C    . LEU A 1 151 ? 4.681   -2.113  -13.009 1.00 0.00 ? 151 LEU A C    1  
ATOM 2300  O O    . LEU A 1 151 ? 3.481   -2.402  -12.996 1.00 0.00 ? 151 LEU A O    1  
ATOM 2301  C CB   . LEU A 1 151 ? 4.453   0.128   -11.922 1.00 0.00 ? 151 LEU A CB   1  
ATOM 2302  C CG   . LEU A 1 151 ? 4.583   1.659   -11.808 1.00 0.00 ? 151 LEU A CG   1  
ATOM 2303  C CD1  . LEU A 1 151 ? 6.032   2.129   -11.807 1.00 0.00 ? 151 LEU A CD1  1  
ATOM 2304  C CD2  . LEU A 1 151 ? 3.790   2.421   -12.875 1.00 0.00 ? 151 LEU A CD2  1  
ATOM 2305  H H    . LEU A 1 151 ? 3.564   0.261   -14.258 1.00 0.00 ? 151 LEU A H    1  
ATOM 2306  H HA   . LEU A 1 151 ? 6.143   -0.496  -13.138 1.00 0.00 ? 151 LEU A HA   1  
ATOM 2307  H HB2  . LEU A 1 151 ? 3.397   -0.090  -11.915 1.00 0.00 ? 151 LEU A HB2  1  
ATOM 2308  H HB3  . LEU A 1 151 ? 4.861   -0.310  -11.020 1.00 0.00 ? 151 LEU A HB3  1  
ATOM 2309  H HG   . LEU A 1 151 ? 4.154   1.937   -10.845 1.00 0.00 ? 151 LEU A HG   1  
ATOM 2310  H HD11 . LEU A 1 151 ? 6.543   1.809   -12.716 1.00 0.00 ? 151 LEU A HD11 1  
ATOM 2311  H HD12 . LEU A 1 151 ? 6.067   3.210   -11.735 1.00 0.00 ? 151 LEU A HD12 1  
ATOM 2312  H HD13 . LEU A 1 151 ? 6.536   1.721   -10.936 1.00 0.00 ? 151 LEU A HD13 1  
ATOM 2313  H HD21 . LEU A 1 151 ? 3.746   3.477   -12.609 1.00 0.00 ? 151 LEU A HD21 1  
ATOM 2314  H HD22 . LEU A 1 151 ? 4.283   2.324   -13.841 1.00 0.00 ? 151 LEU A HD22 1  
ATOM 2315  H HD23 . LEU A 1 151 ? 2.774   2.033   -12.933 1.00 0.00 ? 151 LEU A HD23 1  
ATOM 2316  N N    . ALA A 1 152 ? 5.653   -3.019  -12.921 1.00 0.00 ? 152 ALA A N    1  
ATOM 2317  C CA   . ALA A 1 152 ? 5.536   -4.481  -12.971 1.00 0.00 ? 152 ALA A CA   1  
ATOM 2318  C C    . ALA A 1 152 ? 4.796   -5.132  -11.785 1.00 0.00 ? 152 ALA A C    1  
ATOM 2319  O O    . ALA A 1 152 ? 4.911   -6.341  -11.586 1.00 0.00 ? 152 ALA A O    1  
ATOM 2320  C CB   . ALA A 1 152 ? 6.960   -5.049  -13.048 1.00 0.00 ? 152 ALA A CB   1  
ATOM 2321  H H    . ALA A 1 152 ? 6.598   -2.681  -12.950 1.00 0.00 ? 152 ALA A H    1  
ATOM 2322  H HA   . ALA A 1 152 ? 4.997   -4.742  -13.887 1.00 0.00 ? 152 ALA A HA   1  
ATOM 2323  H HB1  . ALA A 1 152 ? 7.433   -4.996  -12.067 1.00 0.00 ? 152 ALA A HB1  1  
ATOM 2324  H HB2  . ALA A 1 152 ? 6.924   -6.095  -13.346 1.00 0.00 ? 152 ALA A HB2  1  
ATOM 2325  H HB3  . ALA A 1 152 ? 7.561   -4.490  -13.764 1.00 0.00 ? 152 ALA A HB3  1  
ATOM 2326  N N    . LEU A 1 153 ? 4.101   -4.332  -10.977 1.00 0.00 ? 153 LEU A N    1  
ATOM 2327  C CA   . LEU A 1 153 ? 3.231   -4.751  -9.882  1.00 0.00 ? 153 LEU A CA   1  
ATOM 2328  C C    . LEU A 1 153 ? 1.895   -4.020  -9.988  1.00 0.00 ? 153 LEU A C    1  
ATOM 2329  O O    . LEU A 1 153 ? 0.842   -4.603  -9.758  1.00 0.00 ? 153 LEU A O    1  
ATOM 2330  C CB   . LEU A 1 153 ? 3.912   -4.474  -8.539  1.00 0.00 ? 153 LEU A CB   1  
ATOM 2331  C CG   . LEU A 1 153 ? 2.955   -4.559  -7.334  1.00 0.00 ? 153 LEU A CG   1  
ATOM 2332  C CD1  . LEU A 1 153 ? 2.300   -5.939  -7.204  1.00 0.00 ? 153 LEU A CD1  1  
ATOM 2333  C CD2  . LEU A 1 153 ? 3.749   -4.214  -6.071  1.00 0.00 ? 153 LEU A CD2  1  
ATOM 2334  H H    . LEU A 1 153 ? 4.025   -3.385  -11.303 1.00 0.00 ? 153 LEU A H    1  
ATOM 2335  H HA   . LEU A 1 153 ? 3.046   -5.826  -9.946  1.00 0.00 ? 153 LEU A HA   1  
ATOM 2336  H HB2  . LEU A 1 153 ? 4.710   -5.205  -8.419  1.00 0.00 ? 153 LEU A HB2  1  
ATOM 2337  H HB3  . LEU A 1 153 ? 4.352   -3.476  -8.564  1.00 0.00 ? 153 LEU A HB3  1  
ATOM 2338  H HG   . LEU A 1 153 ? 2.169   -3.814  -7.437  1.00 0.00 ? 153 LEU A HG   1  
ATOM 2339  H HD11 . LEU A 1 153 ? 1.699   -5.983  -6.297  1.00 0.00 ? 153 LEU A HD11 1  
ATOM 2340  H HD12 . LEU A 1 153 ? 1.631   -6.140  -8.039  1.00 0.00 ? 153 LEU A HD12 1  
ATOM 2341  H HD13 . LEU A 1 153 ? 3.067   -6.706  -7.204  1.00 0.00 ? 153 LEU A HD13 1  
ATOM 2342  H HD21 . LEU A 1 153 ? 4.143   -3.201  -6.144  1.00 0.00 ? 153 LEU A HD21 1  
ATOM 2343  H HD22 . LEU A 1 153 ? 3.100   -4.266  -5.196  1.00 0.00 ? 153 LEU A HD22 1  
ATOM 2344  H HD23 . LEU A 1 153 ? 4.578   -4.905  -5.944  1.00 0.00 ? 153 LEU A HD23 1  
ATOM 2345  N N    . VAL A 1 154 ? 1.901   -2.731  -10.344 1.00 0.00 ? 154 VAL A N    1  
ATOM 2346  C CA   . VAL A 1 154 ? 0.646   -2.031  -10.591 1.00 0.00 ? 154 VAL A CA   1  
ATOM 2347  C C    . VAL A 1 154 ? -0.078  -2.703  -11.762 1.00 0.00 ? 154 VAL A C    1  
ATOM 2348  O O    . VAL A 1 154 ? -1.295  -2.588  -11.844 1.00 0.00 ? 154 VAL A O    1  
ATOM 2349  C CB   . VAL A 1 154 ? 0.871   -0.528  -10.848 1.00 0.00 ? 154 VAL A CB   1  
ATOM 2350  C CG1  . VAL A 1 154 ? -0.439  0.265   -10.936 1.00 0.00 ? 154 VAL A CG1  1  
ATOM 2351  C CG2  . VAL A 1 154 ? 1.734   0.123   -9.754  1.00 0.00 ? 154 VAL A CG2  1  
ATOM 2352  H H    . VAL A 1 154 ? 2.771   -2.263  -10.528 1.00 0.00 ? 154 VAL A H    1  
ATOM 2353  H HA   . VAL A 1 154 ? 0.025   -2.139  -9.702  1.00 0.00 ? 154 VAL A HA   1  
ATOM 2354  H HB   . VAL A 1 154 ? 1.365   -0.419  -11.809 1.00 0.00 ? 154 VAL A HB   1  
ATOM 2355  H HG11 . VAL A 1 154 ? -1.013  -0.048  -11.807 1.00 0.00 ? 154 VAL A HG11 1  
ATOM 2356  H HG12 . VAL A 1 154 ? -1.034  0.084   -10.045 1.00 0.00 ? 154 VAL A HG12 1  
ATOM 2357  H HG13 . VAL A 1 154 ? -0.230  1.332   -11.024 1.00 0.00 ? 154 VAL A HG13 1  
ATOM 2358  H HG21 . VAL A 1 154 ? 1.913   1.169   -9.995  1.00 0.00 ? 154 VAL A HG21 1  
ATOM 2359  H HG22 . VAL A 1 154 ? 1.220   0.064   -8.797  1.00 0.00 ? 154 VAL A HG22 1  
ATOM 2360  H HG23 . VAL A 1 154 ? 2.699   -0.369  -9.652  1.00 0.00 ? 154 VAL A HG23 1  
ATOM 2361  N N    . GLU A 1 155 ? 0.632   -3.406  -12.652 1.00 0.00 ? 155 GLU A N    1  
ATOM 2362  C CA   . GLU A 1 155 ? 0.068   -4.079  -13.811 1.00 0.00 ? 155 GLU A CA   1  
ATOM 2363  C C    . GLU A 1 155 ? -1.008  -5.086  -13.384 1.00 0.00 ? 155 GLU A C    1  
ATOM 2364  O O    . GLU A 1 155 ? -2.084  -5.163  -13.978 1.00 0.00 ? 155 GLU A O    1  
ATOM 2365  C CB   . GLU A 1 155 ? 1.204   -4.734  -14.630 1.00 0.00 ? 155 GLU A CB   1  
ATOM 2366  C CG   . GLU A 1 155 ? 1.124   -4.225  -16.076 1.00 0.00 ? 155 GLU A CG   1  
ATOM 2367  C CD   . GLU A 1 155 ? 1.926   -5.017  -17.109 1.00 0.00 ? 155 GLU A CD   1  
ATOM 2368  O OE1  . GLU A 1 155 ? 2.465   -6.107  -16.793 1.00 0.00 ? 155 GLU A OE1  1  
ATOM 2369  O OE2  . GLU A 1 155 ? 1.936   -4.569  -18.273 1.00 0.00 ? 155 GLU A OE2  1  
ATOM 2370  H H    . GLU A 1 155 ? 1.615   -3.569  -12.476 1.00 0.00 ? 155 GLU A H    1  
ATOM 2371  H HA   . GLU A 1 155 ? -0.422  -3.319  -14.416 1.00 0.00 ? 155 GLU A HA   1  
ATOM 2372  H HB2  . GLU A 1 155 ? 2.194   -4.475  -14.223 1.00 0.00 ? 155 GLU A HB2  1  
ATOM 2373  H HB3  . GLU A 1 155 ? 1.083   -5.817  -14.611 1.00 0.00 ? 155 GLU A HB3  1  
ATOM 2374  H HG2  . GLU A 1 155 ? 0.082   -4.238  -16.399 1.00 0.00 ? 155 GLU A HG2  1  
ATOM 2375  H HG3  . GLU A 1 155 ? 1.467   -3.190  -16.086 1.00 0.00 ? 155 GLU A HG3  1  
ATOM 2376  N N    . GLU A 1 156 ? -0.750  -5.800  -12.296 1.00 0.00 ? 156 GLU A N    1  
ATOM 2377  C CA   . GLU A 1 156 ? -1.558  -6.879  -11.754 1.00 0.00 ? 156 GLU A CA   1  
ATOM 2378  C C    . GLU A 1 156 ? -2.931  -6.352  -11.312 1.00 0.00 ? 156 GLU A C    1  
ATOM 2379  O O    . GLU A 1 156 ? -3.929  -7.076  -11.394 1.00 0.00 ? 156 GLU A O    1  
ATOM 2380  C CB   . GLU A 1 156 ? -0.822  -7.494  -10.549 1.00 0.00 ? 156 GLU A CB   1  
ATOM 2381  C CG   . GLU A 1 156 ? 0.481   -8.288  -10.802 1.00 0.00 ? 156 GLU A CG   1  
ATOM 2382  C CD   . GLU A 1 156 ? 1.360   -7.779  -11.959 1.00 0.00 ? 156 GLU A CD   1  
ATOM 2383  O OE1  . GLU A 1 156 ? 1.821   -6.620  -11.917 1.00 0.00 ? 156 GLU A OE1  1  
ATOM 2384  O OE2  . GLU A 1 156 ? 1.546   -8.543  -12.933 1.00 0.00 ? 156 GLU A OE2  1  
ATOM 2385  H H    . GLU A 1 156 ? 0.195   -5.721  -11.912 1.00 0.00 ? 156 GLU A H    1  
ATOM 2386  H HA   . GLU A 1 156 ? -1.700  -7.643  -12.520 1.00 0.00 ? 156 GLU A HA   1  
ATOM 2387  H HB2  . GLU A 1 156 ? -0.609  -6.707  -9.830  1.00 0.00 ? 156 GLU A HB2  1  
ATOM 2388  H HB3  . GLU A 1 156 ? -1.526  -8.177  -10.077 1.00 0.00 ? 156 GLU A HB3  1  
ATOM 2389  H HG2  . GLU A 1 156 ? 1.073   -8.318  -9.871  1.00 0.00 ? 156 GLU A HG2  1  
ATOM 2390  H HG3  . GLU A 1 156 ? 0.183   -9.311  -11.033 1.00 0.00 ? 156 GLU A HG3  1  
ATOM 2391  N N    . ILE A 1 157 ? -2.985  -5.088  -10.873 1.00 0.00 ? 157 ILE A N    1  
ATOM 2392  C CA   . ILE A 1 157 ? -4.199  -4.371  -10.502 1.00 0.00 ? 157 ILE A CA   1  
ATOM 2393  C C    . ILE A 1 157 ? -4.755  -3.642  -11.733 1.00 0.00 ? 157 ILE A C    1  
ATOM 2394  O O    . ILE A 1 157 ? -5.969  -3.645  -11.948 1.00 0.00 ? 157 ILE A O    1  
ATOM 2395  C CB   . ILE A 1 157 ? -3.930  -3.385  -9.335  1.00 0.00 ? 157 ILE A CB   1  
ATOM 2396  C CG1  . ILE A 1 157 ? -3.349  -4.049  -8.063  1.00 0.00 ? 157 ILE A CG1  1  
ATOM 2397  C CG2  . ILE A 1 157 ? -5.228  -2.666  -8.934  1.00 0.00 ? 157 ILE A CG2  1  
ATOM 2398  C CD1  . ILE A 1 157 ? -1.822  -4.132  -8.042  1.00 0.00 ? 157 ILE A CD1  1  
ATOM 2399  H H    . ILE A 1 157 ? -2.101  -4.590  -10.857 1.00 0.00 ? 157 ILE A H    1  
ATOM 2400  H HA   . ILE A 1 157 ? -4.939  -5.099  -10.168 1.00 0.00 ? 157 ILE A HA   1  
ATOM 2401  H HB   . ILE A 1 157 ? -3.235  -2.611  -9.659  1.00 0.00 ? 157 ILE A HB   1  
ATOM 2402  H HG12 . ILE A 1 157 ? -3.623  -3.457  -7.195  1.00 0.00 ? 157 ILE A HG12 1  
ATOM 2403  H HG13 . ILE A 1 157 ? -3.772  -5.044  -7.932  1.00 0.00 ? 157 ILE A HG13 1  
ATOM 2404  H HG21 . ILE A 1 157 ? -5.752  -2.253  -9.792  1.00 0.00 ? 157 ILE A HG21 1  
ATOM 2405  H HG22 . ILE A 1 157 ? -5.894  -3.345  -8.399  1.00 0.00 ? 157 ILE A HG22 1  
ATOM 2406  H HG23 . ILE A 1 157 ? -4.962  -1.822  -8.303  1.00 0.00 ? 157 ILE A HG23 1  
ATOM 2407  H HD11 . ILE A 1 157 ? -1.391  -3.160  -8.279  1.00 0.00 ? 157 ILE A HD11 1  
ATOM 2408  H HD12 . ILE A 1 157 ? -1.487  -4.420  -7.046  1.00 0.00 ? 157 ILE A HD12 1  
ATOM 2409  H HD13 . ILE A 1 157 ? -1.477  -4.877  -8.751  1.00 0.00 ? 157 ILE A HD13 1  
ATOM 2410  N N    . ARG A 1 158 ? -3.903  -3.019  -12.555 1.00 0.00 ? 158 ARG A N    1  
ATOM 2411  C CA   . ARG A 1 158 ? -4.267  -2.234  -13.740 1.00 0.00 ? 158 ARG A CA   1  
ATOM 2412  C C    . ARG A 1 158 ? -5.173  -3.060  -14.650 1.00 0.00 ? 158 ARG A C    1  
ATOM 2413  O O    . ARG A 1 158 ? -6.169  -2.545  -15.154 1.00 0.00 ? 158 ARG A O    1  
ATOM 2414  C CB   . ARG A 1 158 ? -2.988  -1.830  -14.484 1.00 0.00 ? 158 ARG A CB   1  
ATOM 2415  C CG   . ARG A 1 158 ? -3.224  -0.945  -15.715 1.00 0.00 ? 158 ARG A CG   1  
ATOM 2416  C CD   . ARG A 1 158 ? -2.106  -1.172  -16.740 1.00 0.00 ? 158 ARG A CD   1  
ATOM 2417  N NE   . ARG A 1 158 ? -2.205  -0.230  -17.864 1.00 0.00 ? 158 ARG A NE   1  
ATOM 2418  C CZ   . ARG A 1 158 ? -1.433  0.838   -18.077 1.00 0.00 ? 158 ARG A CZ   1  
ATOM 2419  N NH1  . ARG A 1 158 ? -0.496  1.177   -17.195 1.00 0.00 ? 158 ARG A NH1  1  
ATOM 2420  N NH2  . ARG A 1 158 ? -1.632  1.614   -19.136 1.00 0.00 ? 158 ARG A NH2  1  
ATOM 2421  H H    . ARG A 1 158 ? -2.915  -3.089  -12.334 1.00 0.00 ? 158 ARG A H    1  
ATOM 2422  H HA   . ARG A 1 158 ? -4.783  -1.331  -13.404 1.00 0.00 ? 158 ARG A HA   1  
ATOM 2423  H HB2  . ARG A 1 158 ? -2.330  -1.289  -13.800 1.00 0.00 ? 158 ARG A HB2  1  
ATOM 2424  H HB3  . ARG A 1 158 ? -2.497  -2.743  -14.812 1.00 0.00 ? 158 ARG A HB3  1  
ATOM 2425  H HG2  . ARG A 1 158 ? -4.173  -1.176  -16.195 1.00 0.00 ? 158 ARG A HG2  1  
ATOM 2426  H HG3  . ARG A 1 158 ? -3.241  0.094   -15.394 1.00 0.00 ? 158 ARG A HG3  1  
ATOM 2427  H HD2  . ARG A 1 158 ? -1.135  -1.095  -16.252 1.00 0.00 ? 158 ARG A HD2  1  
ATOM 2428  H HD3  . ARG A 1 158 ? -2.197  -2.180  -17.139 1.00 0.00 ? 158 ARG A HD3  1  
ATOM 2429  H HE   . ARG A 1 158 ? -2.967  -0.432  -18.509 1.00 0.00 ? 158 ARG A HE   1  
ATOM 2430  H HH11 . ARG A 1 158 ? -0.396  0.692   -16.305 1.00 0.00 ? 158 ARG A HH11 1  
ATOM 2431  H HH12 . ARG A 1 158 ? 0.246   1.846   -17.415 1.00 0.00 ? 158 ARG A HH12 1  
ATOM 2432  H HH21 . ARG A 1 158 ? -2.397  1.433   -19.778 1.00 0.00 ? 158 ARG A HH21 1  
ATOM 2433  H HH22 . ARG A 1 158 ? -0.985  2.373   -19.353 1.00 0.00 ? 158 ARG A HH22 1  
ATOM 2434  N N    . ASN A 1 159 ? -4.858  -4.353  -14.755 1.00 0.00 ? 159 ASN A N    1  
ATOM 2435  C CA   . ASN A 1 159 ? -5.654  -5.425  -15.338 1.00 0.00 ? 159 ASN A CA   1  
ATOM 2436  C C    . ASN A 1 159 ? -7.153  -5.232  -15.137 1.00 0.00 ? 159 ASN A C    1  
ATOM 2437  O O    . ASN A 1 159 ? -7.937  -5.447  -16.057 1.00 0.00 ? 159 ASN A O    1  
ATOM 2438  C CB   . ASN A 1 159 ? -5.243  -6.754  -14.673 1.00 0.00 ? 159 ASN A CB   1  
ATOM 2439  C CG   . ASN A 1 159 ? -4.339  -7.568  -15.568 1.00 0.00 ? 159 ASN A CG   1  
ATOM 2440  O OD1  . ASN A 1 159 ? -4.814  -8.437  -16.294 1.00 0.00 ? 159 ASN A OD1  1  
ATOM 2441  N ND2  . ASN A 1 159 ? -3.050  -7.307  -15.535 1.00 0.00 ? 159 ASN A ND2  1  
ATOM 2442  H H    . ASN A 1 159 ? -3.945  -4.612  -14.393 1.00 0.00 ? 159 ASN A H    1  
ATOM 2443  H HA   . ASN A 1 159 ? -5.452  -5.472  -16.412 1.00 0.00 ? 159 ASN A HA   1  
ATOM 2444  H HB2  . ASN A 1 159 ? -4.756  -6.577  -13.716 1.00 0.00 ? 159 ASN A HB2  1  
ATOM 2445  H HB3  . ASN A 1 159 ? -6.126  -7.358  -14.469 1.00 0.00 ? 159 ASN A HB3  1  
ATOM 2446  H HD21 . ASN A 1 159 ? -2.695  -6.548  -14.956 1.00 0.00 ? 159 ASN A HD21 1  
ATOM 2447  H HD22 . ASN A 1 159 ? -2.427  -7.646  -16.260 1.00 0.00 ? 159 ASN A HD22 1  
ATOM 2448  N N    . ARG A 1 160 ? -7.571  -4.913  -13.907 1.00 0.00 ? 160 ARG A N    1  
ATOM 2449  C CA   . ARG A 1 160 ? -8.974  -4.934  -13.523 1.00 0.00 ? 160 ARG A CA   1  
ATOM 2450  C C    . ARG A 1 160 ? -9.789  -3.875  -14.246 1.00 0.00 ? 160 ARG A C    1  
ATOM 2451  O O    . ARG A 1 160 ? -10.930 -4.176  -14.586 1.00 0.00 ? 160 ARG A O    1  
ATOM 2452  C CB   . ARG A 1 160 ? -9.150  -4.767  -12.003 1.00 0.00 ? 160 ARG A CB   1  
ATOM 2453  C CG   . ARG A 1 160 ? -8.439  -5.790  -11.095 1.00 0.00 ? 160 ARG A CG   1  
ATOM 2454  C CD   . ARG A 1 160 ? -8.354  -7.216  -11.648 1.00 0.00 ? 160 ARG A CD   1  
ATOM 2455  N NE   . ARG A 1 160 ? -9.674  -7.776  -11.980 1.00 0.00 ? 160 ARG A NE   1  
ATOM 2456  C CZ   . ARG A 1 160 ? -9.967  -8.722  -12.886 1.00 0.00 ? 160 ARG A CZ   1  
ATOM 2457  N NH1  . ARG A 1 160 ? -9.061  -9.181  -13.751 1.00 0.00 ? 160 ARG A NH1  1  
ATOM 2458  N NH2  . ARG A 1 160 ? -11.195 -9.213  -12.922 1.00 0.00 ? 160 ARG A NH2  1  
ATOM 2459  H H    . ARG A 1 160 ? -6.866  -4.693  -13.211 1.00 0.00 ? 160 ARG A H    1  
ATOM 2460  H HA   . ARG A 1 160 ? -9.391  -5.896  -13.826 1.00 0.00 ? 160 ARG A HA   1  
ATOM 2461  H HB2  . ARG A 1 160 ? -8.812  -3.771  -11.724 1.00 0.00 ? 160 ARG A HB2  1  
ATOM 2462  H HB3  . ARG A 1 160 ? -10.217 -4.815  -11.791 1.00 0.00 ? 160 ARG A HB3  1  
ATOM 2463  H HG2  . ARG A 1 160 ? -7.421  -5.452  -10.911 1.00 0.00 ? 160 ARG A HG2  1  
ATOM 2464  H HG3  . ARG A 1 160 ? -8.948  -5.811  -10.129 1.00 0.00 ? 160 ARG A HG3  1  
ATOM 2465  H HD2  . ARG A 1 160 ? -7.723  -7.190  -12.528 1.00 0.00 ? 160 ARG A HD2  1  
ATOM 2466  H HD3  . ARG A 1 160 ? -7.875  -7.843  -10.896 1.00 0.00 ? 160 ARG A HD3  1  
ATOM 2467  H HE   . ARG A 1 160 ? -10.447 -7.394  -11.437 1.00 0.00 ? 160 ARG A HE   1  
ATOM 2468  H HH11 . ARG A 1 160 ? -8.172  -8.726  -13.894 1.00 0.00 ? 160 ARG A HH11 1  
ATOM 2469  H HH12 . ARG A 1 160 ? -9.304  -9.895  -14.440 1.00 0.00 ? 160 ARG A HH12 1  
ATOM 2470  H HH21 . ARG A 1 160 ? -11.884 -8.950  -12.222 1.00 0.00 ? 160 ARG A HH21 1  
ATOM 2471  H HH22 . ARG A 1 160 ? -11.459 -9.934  -13.589 1.00 0.00 ? 160 ARG A HH22 1  
ATOM 2472  N N    . LYS A 1 161 ? -9.271  -2.652  -14.426 1.00 0.00 ? 161 LYS A N    1  
ATOM 2473  C CA   . LYS A 1 161 ? -9.999  -1.446  -14.859 1.00 0.00 ? 161 LYS A CA   1  
ATOM 2474  C C    . LYS A 1 161 ? -11.078 -0.992  -13.864 1.00 0.00 ? 161 LYS A C    1  
ATOM 2475  O O    . LYS A 1 161 ? -11.200 0.200   -13.602 1.00 0.00 ? 161 LYS A O    1  
ATOM 2476  C CB   . LYS A 1 161 ? -10.581 -1.634  -16.280 1.00 0.00 ? 161 LYS A CB   1  
ATOM 2477  C CG   . LYS A 1 161 ? -10.231 -0.505  -17.261 1.00 0.00 ? 161 LYS A CG   1  
ATOM 2478  C CD   . LYS A 1 161 ? -8.930  -0.749  -18.054 1.00 0.00 ? 161 LYS A CD   1  
ATOM 2479  C CE   . LYS A 1 161 ? -7.656  -0.745  -17.200 1.00 0.00 ? 161 LYS A CE   1  
ATOM 2480  N NZ   . LYS A 1 161 ? -7.232  0.627   -16.860 1.00 0.00 ? 161 LYS A NZ   1  
ATOM 2481  H H    . LYS A 1 161 ? -8.316  -2.506  -14.117 1.00 0.00 ? 161 LYS A H    1  
ATOM 2482  H HA   . LYS A 1 161 ? -9.267  -0.641  -14.888 1.00 0.00 ? 161 LYS A HA   1  
ATOM 2483  H HB2  . LYS A 1 161 ? -10.245 -2.577  -16.705 1.00 0.00 ? 161 LYS A HB2  1  
ATOM 2484  H HB3  . LYS A 1 161 ? -11.668 -1.696  -16.207 1.00 0.00 ? 161 LYS A HB3  1  
ATOM 2485  H HG2  . LYS A 1 161 ? -11.042 -0.431  -17.987 1.00 0.00 ? 161 LYS A HG2  1  
ATOM 2486  H HG3  . LYS A 1 161 ? -10.188 0.438   -16.719 1.00 0.00 ? 161 LYS A HG3  1  
ATOM 2487  H HD2  . LYS A 1 161 ? -9.002  -1.715  -18.554 1.00 0.00 ? 161 LYS A HD2  1  
ATOM 2488  H HD3  . LYS A 1 161 ? -8.841  0.007   -18.836 1.00 0.00 ? 161 LYS A HD3  1  
ATOM 2489  H HE2  . LYS A 1 161 ? -7.819  -1.326  -16.292 1.00 0.00 ? 161 LYS A HE2  1  
ATOM 2490  H HE3  . LYS A 1 161 ? -6.849  -1.231  -17.755 1.00 0.00 ? 161 LYS A HE3  1  
ATOM 2491  H HZ1  . LYS A 1 161 ? -7.994  1.189   -16.490 1.00 0.00 ? 161 LYS A HZ1  1  
ATOM 2492  H HZ2  . LYS A 1 161 ? -6.490  0.620   -16.167 1.00 0.00 ? 161 LYS A HZ2  1  
ATOM 2493  H HZ3  . LYS A 1 161 ? -6.901  1.099   -17.695 1.00 0.00 ? 161 LYS A HZ3  1  
ATOM 2494  N N    . ASP A 1 162 ? -11.824 -1.930  -13.282 1.00 0.00 ? 162 ASP A N    1  
ATOM 2495  C CA   . ASP A 1 162 ? -12.994 -1.738  -12.426 1.00 0.00 ? 162 ASP A CA   1  
ATOM 2496  C C    . ASP A 1 162 ? -12.706 -0.908  -11.174 1.00 0.00 ? 162 ASP A C    1  
ATOM 2497  O O    . ASP A 1 162 ? -13.650 -0.408  -10.549 1.00 0.00 ? 162 ASP A O    1  
ATOM 2498  C CB   . ASP A 1 162 ? -13.522 -3.087  -11.894 1.00 0.00 ? 162 ASP A CB   1  
ATOM 2499  C CG   . ASP A 1 162 ? -13.996 -4.119  -12.904 1.00 0.00 ? 162 ASP A CG   1  
ATOM 2500  O OD1  . ASP A 1 162 ? -14.549 -3.748  -13.956 1.00 0.00 ? 162 ASP A OD1  1  
ATOM 2501  O OD2  . ASP A 1 162 ? -13.880 -5.330  -12.590 1.00 0.00 ? 162 ASP A OD2  1  
ATOM 2502  H H    . ASP A 1 162 ? -11.721 -2.841  -13.709 1.00 0.00 ? 162 ASP A H    1  
ATOM 2503  H HA   . ASP A 1 162 ? -13.777 -1.251  -13.007 1.00 0.00 ? 162 ASP A HA   1  
ATOM 2504  H HB2  . ASP A 1 162 ? -12.759 -3.537  -11.257 1.00 0.00 ? 162 ASP A HB2  1  
ATOM 2505  H HB3  . ASP A 1 162 ? -14.391 -2.878  -11.279 1.00 0.00 ? 162 ASP A HB3  1  
ATOM 2506  N N    . VAL A 1 163 ? -11.450 -0.831  -10.727 1.00 0.00 ? 163 VAL A N    1  
ATOM 2507  C CA   . VAL A 1 163 ? -11.096 -0.144  -9.499  1.00 0.00 ? 163 VAL A CA   1  
ATOM 2508  C C    . VAL A 1 163 ? -11.369 1.351   -9.673  1.00 0.00 ? 163 VAL A C    1  
ATOM 2509  O O    . VAL A 1 163 ? -11.118 1.917   -10.738 1.00 0.00 ? 163 VAL A O    1  
ATOM 2510  C CB   . VAL A 1 163 ? -9.654  -0.490  -9.081  1.00 0.00 ? 163 VAL A CB   1  
ATOM 2511  C CG1  . VAL A 1 163 ? -9.399  -2.015  -9.087  1.00 0.00 ? 163 VAL A CG1  1  
ATOM 2512  C CG2  . VAL A 1 163 ? -8.563  0.222   -9.889  1.00 0.00 ? 163 VAL A CG2  1  
ATOM 2513  H H    . VAL A 1 163 ? -10.685 -1.171  -11.285 1.00 0.00 ? 163 VAL A H    1  
ATOM 2514  H HA   . VAL A 1 163 ? -11.744 -0.500  -8.703  1.00 0.00 ? 163 VAL A HA   1  
ATOM 2515  H HB   . VAL A 1 163 ? -9.565  -0.164  -8.053  1.00 0.00 ? 163 VAL A HB   1  
ATOM 2516  H HG11 . VAL A 1 163 ? -8.663  -2.263  -8.320  1.00 0.00 ? 163 VAL A HG11 1  
ATOM 2517  H HG12 . VAL A 1 163 ? -10.316 -2.557  -8.854  1.00 0.00 ? 163 VAL A HG12 1  
ATOM 2518  H HG13 . VAL A 1 163 ? -9.025  -2.350  -10.056 1.00 0.00 ? 163 VAL A HG13 1  
ATOM 2519  H HG21 . VAL A 1 163 ? -8.587  1.291   -9.677  1.00 0.00 ? 163 VAL A HG21 1  
ATOM 2520  H HG22 . VAL A 1 163 ? -7.580  -0.157  -9.612  1.00 0.00 ? 163 VAL A HG22 1  
ATOM 2521  H HG23 . VAL A 1 163 ? -8.727  0.073   -10.956 1.00 0.00 ? 163 VAL A HG23 1  
ATOM 2522  N N    . LYS A 1 164 ? -11.920 2.000   -8.649  1.00 0.00 ? 164 LYS A N    1  
ATOM 2523  C CA   . LYS A 1 164 ? -12.053 3.453   -8.645  1.00 0.00 ? 164 LYS A CA   1  
ATOM 2524  C C    . LYS A 1 164 ? -10.642 4.037   -8.627  1.00 0.00 ? 164 LYS A C    1  
ATOM 2525  O O    . LYS A 1 164 ? -9.775  3.472   -7.959  1.00 0.00 ? 164 LYS A O    1  
ATOM 2526  C CB   . LYS A 1 164 ? -12.882 3.862   -7.421  1.00 0.00 ? 164 LYS A CB   1  
ATOM 2527  C CG   . LYS A 1 164 ? -13.103 5.369   -7.254  1.00 0.00 ? 164 LYS A CG   1  
ATOM 2528  C CD   . LYS A 1 164 ? -13.704 6.025   -8.501  1.00 0.00 ? 164 LYS A CD   1  
ATOM 2529  C CE   . LYS A 1 164 ? -14.426 7.322   -8.153  1.00 0.00 ? 164 LYS A CE   1  
ATOM 2530  N NZ   . LYS A 1 164 ? -15.398 7.689   -9.193  1.00 0.00 ? 164 LYS A NZ   1  
ATOM 2531  H H    . LYS A 1 164 ? -12.113 1.490   -7.792  1.00 0.00 ? 164 LYS A H    1  
ATOM 2532  H HA   . LYS A 1 164 ? -12.574 3.763   -9.552  1.00 0.00 ? 164 LYS A HA   1  
ATOM 2533  H HB2  . LYS A 1 164 ? -13.861 3.387   -7.477  1.00 0.00 ? 164 LYS A HB2  1  
ATOM 2534  H HB3  . LYS A 1 164 ? -12.394 3.485   -6.528  1.00 0.00 ? 164 LYS A HB3  1  
ATOM 2535  H HG2  . LYS A 1 164 ? -13.795 5.492   -6.422  1.00 0.00 ? 164 LYS A HG2  1  
ATOM 2536  H HG3  . LYS A 1 164 ? -12.161 5.859   -7.007  1.00 0.00 ? 164 LYS A HG3  1  
ATOM 2537  H HD2  . LYS A 1 164 ? -12.901 6.274   -9.192  1.00 0.00 ? 164 LYS A HD2  1  
ATOM 2538  H HD3  . LYS A 1 164 ? -14.408 5.331   -8.963  1.00 0.00 ? 164 LYS A HD3  1  
ATOM 2539  H HE2  . LYS A 1 164 ? -14.955 7.190   -7.209  1.00 0.00 ? 164 LYS A HE2  1  
ATOM 2540  H HE3  . LYS A 1 164 ? -13.686 8.117   -8.045  1.00 0.00 ? 164 LYS A HE3  1  
ATOM 2541  H HZ1  . LYS A 1 164 ? -15.685 8.659   -9.103  1.00 0.00 ? 164 LYS A HZ1  1  
ATOM 2542  H HZ2  . LYS A 1 164 ? -15.022 7.548   -10.123 1.00 0.00 ? 164 LYS A HZ2  1  
ATOM 2543  H HZ3  . LYS A 1 164 ? -16.262 7.159   -9.076  1.00 0.00 ? 164 LYS A HZ3  1  
ATOM 2544  N N    . VAL A 1 165 ? -10.407 5.143   -9.330  1.00 0.00 ? 165 VAL A N    1  
ATOM 2545  C CA   . VAL A 1 165 ? -9.104  5.786   -9.409  1.00 0.00 ? 165 VAL A CA   1  
ATOM 2546  C C    . VAL A 1 165 ? -9.256  7.227   -8.931  1.00 0.00 ? 165 VAL A C    1  
ATOM 2547  O O    . VAL A 1 165 ? -9.776  8.087   -9.646  1.00 0.00 ? 165 VAL A O    1  
ATOM 2548  C CB   . VAL A 1 165 ? -8.513  5.633   -10.822 1.00 0.00 ? 165 VAL A CB   1  
ATOM 2549  C CG1  . VAL A 1 165 ? -7.124  6.273   -10.910 1.00 0.00 ? 165 VAL A CG1  1  
ATOM 2550  C CG2  . VAL A 1 165 ? -8.365  4.149   -11.185 1.00 0.00 ? 165 VAL A CG2  1  
ATOM 2551  H H    . VAL A 1 165 ? -11.138 5.524   -9.921  1.00 0.00 ? 165 VAL A H    1  
ATOM 2552  H HA   . VAL A 1 165 ? -8.421  5.283   -8.726  1.00 0.00 ? 165 VAL A HA   1  
ATOM 2553  H HB   . VAL A 1 165 ? -9.164  6.117   -11.548 1.00 0.00 ? 165 VAL A HB   1  
ATOM 2554  H HG11 . VAL A 1 165 ? -7.214  7.345   -10.740 1.00 0.00 ? 165 VAL A HG11 1  
ATOM 2555  H HG12 . VAL A 1 165 ? -6.457  5.842   -10.163 1.00 0.00 ? 165 VAL A HG12 1  
ATOM 2556  H HG13 . VAL A 1 165 ? -6.703  6.123   -11.904 1.00 0.00 ? 165 VAL A HG13 1  
ATOM 2557  H HG21 . VAL A 1 165 ? -9.350  3.708   -11.334 1.00 0.00 ? 165 VAL A HG21 1  
ATOM 2558  H HG22 . VAL A 1 165 ? -7.814  4.047   -12.120 1.00 0.00 ? 165 VAL A HG22 1  
ATOM 2559  H HG23 . VAL A 1 165 ? -7.858  3.628   -10.369 1.00 0.00 ? 165 VAL A HG23 1  
ATOM 2560  N N    . PHE A 1 166 ? -8.831  7.474   -7.694  1.00 0.00 ? 166 PHE A N    1  
ATOM 2561  C CA   . PHE A 1 166 ? -8.902  8.759   -7.032  1.00 0.00 ? 166 PHE A CA   1  
ATOM 2562  C C    . PHE A 1 166 ? -7.606  9.544   -7.218  1.00 0.00 ? 166 PHE A C    1  
ATOM 2563  O O    . PHE A 1 166 ? -6.628  9.331   -6.500  1.00 0.00 ? 166 PHE A O    1  
ATOM 2564  C CB   . PHE A 1 166 ? -9.291  8.549   -5.567  1.00 0.00 ? 166 PHE A CB   1  
ATOM 2565  C CG   . PHE A 1 166 ? -10.776 8.276   -5.379  1.00 0.00 ? 166 PHE A CG   1  
ATOM 2566  C CD1  . PHE A 1 166 ? -11.741 9.094   -5.998  1.00 0.00 ? 166 PHE A CD1  1  
ATOM 2567  C CD2  . PHE A 1 166 ? -11.212 7.232   -4.550  1.00 0.00 ? 166 PHE A CD2  1  
ATOM 2568  C CE1  . PHE A 1 166 ? -13.108 8.871   -5.796  1.00 0.00 ? 166 PHE A CE1  1  
ATOM 2569  C CE2  . PHE A 1 166 ? -12.584 6.971   -4.398  1.00 0.00 ? 166 PHE A CE2  1  
ATOM 2570  C CZ   . PHE A 1 166 ? -13.537 7.802   -4.999  1.00 0.00 ? 166 PHE A CZ   1  
ATOM 2571  H H    . PHE A 1 166 ? -8.444  6.708   -7.151  1.00 0.00 ? 166 PHE A H    1  
ATOM 2572  H HA   . PHE A 1 166 ? -9.694  9.329   -7.496  1.00 0.00 ? 166 PHE A HA   1  
ATOM 2573  H HB2  . PHE A 1 166 ? -8.703  7.733   -5.144  1.00 0.00 ? 166 PHE A HB2  1  
ATOM 2574  H HB3  . PHE A 1 166 ? -9.032  9.448   -5.017  1.00 0.00 ? 166 PHE A HB3  1  
ATOM 2575  H HD1  . PHE A 1 166 ? -11.454 9.925   -6.616  1.00 0.00 ? 166 PHE A HD1  1  
ATOM 2576  H HD2  . PHE A 1 166 ? -10.497 6.641   -4.005  1.00 0.00 ? 166 PHE A HD2  1  
ATOM 2577  H HE1  . PHE A 1 166 ? -13.816 9.518   -6.287  1.00 0.00 ? 166 PHE A HE1  1  
ATOM 2578  H HE2  . PHE A 1 166 ? -12.919 6.124   -3.823  1.00 0.00 ? 166 PHE A HE2  1  
ATOM 2579  H HZ   . PHE A 1 166 ? -14.588 7.603   -4.854  1.00 0.00 ? 166 PHE A HZ   1  
ATOM 2580  N N    . ASN A 1 167 ? -7.592  10.441  -8.207  1.00 0.00 ? 167 ASN A N    1  
ATOM 2581  C CA   . ASN A 1 167 ? -6.501  11.385  -8.441  1.00 0.00 ? 167 ASN A CA   1  
ATOM 2582  C C    . ASN A 1 167 ? -6.498  12.402  -7.310  1.00 0.00 ? 167 ASN A C    1  
ATOM 2583  O O    . ASN A 1 167 ? -7.369  13.267  -7.295  1.00 0.00 ? 167 ASN A O    1  
ATOM 2584  C CB   . ASN A 1 167 ? -6.673  12.093  -9.796  1.00 0.00 ? 167 ASN A CB   1  
ATOM 2585  C CG   . ASN A 1 167 ? -5.336  12.519  -10.377 1.00 0.00 ? 167 ASN A CG   1  
ATOM 2586  O OD1  . ASN A 1 167 ? -5.014  12.117  -11.490 1.00 0.00 ? 167 ASN A OD1  1  
ATOM 2587  N ND2  . ASN A 1 167 ? -4.520  13.290  -9.679  1.00 0.00 ? 167 ASN A ND2  1  
ATOM 2588  H H    . ASN A 1 167 ? -8.454  10.568  -8.726  1.00 0.00 ? 167 ASN A H    1  
ATOM 2589  H HA   . ASN A 1 167 ? -5.546  10.860  -8.452  1.00 0.00 ? 167 ASN A HA   1  
ATOM 2590  H HB2  . ASN A 1 167 ? -7.138  11.403  -10.498 1.00 0.00 ? 167 ASN A HB2  1  
ATOM 2591  H HB3  . ASN A 1 167 ? -7.310  12.978  -9.709  1.00 0.00 ? 167 ASN A HB3  1  
ATOM 2592  H HD21 . ASN A 1 167 ? -4.757  13.711  -8.779  1.00 0.00 ? 167 ASN A HD21 1  
ATOM 2593  H HD22 . ASN A 1 167 ? -3.663  13.553  -10.126 1.00 0.00 ? 167 ASN A HD22 1  
ATOM 2594  N N    . VAL A 1 168 ? -5.565  12.313  -6.365  1.00 0.00 ? 168 VAL A N    1  
ATOM 2595  C CA   . VAL A 1 168 ? -5.429  13.361  -5.361  1.00 0.00 ? 168 VAL A CA   1  
ATOM 2596  C C    . VAL A 1 168 ? -4.888  14.628  -6.038  1.00 0.00 ? 168 VAL A C    1  
ATOM 2597  O O    . VAL A 1 168 ? -4.262  14.569  -7.102  1.00 0.00 ? 168 VAL A O    1  
ATOM 2598  C CB   . VAL A 1 168 ? -4.568  12.856  -4.172  1.00 0.00 ? 168 VAL A CB   1  
ATOM 2599  C CG1  . VAL A 1 168 ? -3.109  13.337  -4.209  1.00 0.00 ? 168 VAL A CG1  1  
ATOM 2600  C CG2  . VAL A 1 168 ? -5.166  13.267  -2.820  1.00 0.00 ? 168 VAL A CG2  1  
ATOM 2601  H H    . VAL A 1 168 ? -4.876  11.569  -6.408  1.00 0.00 ? 168 VAL A H    1  
ATOM 2602  H HA   . VAL A 1 168 ? -6.431  13.590  -4.994  1.00 0.00 ? 168 VAL A HA   1  
ATOM 2603  H HB   . VAL A 1 168 ? -4.552  11.764  -4.189  1.00 0.00 ? 168 VAL A HB   1  
ATOM 2604  H HG11 . VAL A 1 168 ? -2.670  13.037  -5.162  1.00 0.00 ? 168 VAL A HG11 1  
ATOM 2605  H HG12 . VAL A 1 168 ? -3.065  14.430  -4.090  1.00 0.00 ? 168 VAL A HG12 1  
ATOM 2606  H HG13 . VAL A 1 168 ? -2.555  12.870  -3.399  1.00 0.00 ? 168 VAL A HG13 1  
ATOM 2607  H HG21 . VAL A 1 168 ? -6.144  12.807  -2.691  1.00 0.00 ? 168 VAL A HG21 1  
ATOM 2608  H HG22 . VAL A 1 168 ? -4.534  12.919  -2.003  1.00 0.00 ? 168 VAL A HG22 1  
ATOM 2609  H HG23 . VAL A 1 168 ? -5.274  14.348  -2.764  1.00 0.00 ? 168 VAL A HG23 1  
ATOM 2610  N N    . THR A 1 169 ? -5.036  15.753  -5.353  1.00 0.00 ? 169 THR A N    1  
ATOM 2611  C CA   . THR A 1 169 ? -4.287  16.983  -5.550  1.00 0.00 ? 169 THR A CA   1  
ATOM 2612  C C    . THR A 1 169 ? -3.648  17.316  -4.204  1.00 0.00 ? 169 THR A C    1  
ATOM 2613  O O    . THR A 1 169 ? -3.924  16.682  -3.186  1.00 0.00 ? 169 THR A O    1  
ATOM 2614  C CB   . THR A 1 169 ? -5.241  18.068  -6.074  1.00 0.00 ? 169 THR A CB   1  
ATOM 2615  O OG1  . THR A 1 169 ? -6.219  18.333  -5.097  1.00 0.00 ? 169 THR A OG1  1  
ATOM 2616  C CG2  . THR A 1 169 ? -5.922  17.676  -7.390  1.00 0.00 ? 169 THR A CG2  1  
ATOM 2617  H H    . THR A 1 169 ? -5.599  15.757  -4.514  1.00 0.00 ? 169 THR A H    1  
ATOM 2618  H HA   . THR A 1 169 ? -3.466  16.886  -6.260  1.00 0.00 ? 169 THR A HA   1  
ATOM 2619  H HB   . THR A 1 169 ? -4.671  18.981  -6.237  1.00 0.00 ? 169 THR A HB   1  
ATOM 2620  H HG1  . THR A 1 169 ? -7.101  18.291  -5.517  1.00 0.00 ? 169 THR A HG1  1  
ATOM 2621  H HG21 . THR A 1 169 ? -6.552  18.499  -7.725  1.00 0.00 ? 169 THR A HG21 1  
ATOM 2622  H HG22 . THR A 1 169 ? -5.169  17.468  -8.151  1.00 0.00 ? 169 THR A HG22 1  
ATOM 2623  H HG23 . THR A 1 169 ? -6.551  16.789  -7.272  1.00 0.00 ? 169 THR A HG23 1  
ATOM 2624  N N    . LYS A 1 170 ? -2.735  18.274  -4.189  1.00 0.00 ? 170 LYS A N    1  
ATOM 2625  C CA   . LYS A 1 170 ? -2.333  19.044  -3.008  1.00 0.00 ? 170 LYS A CA   1  
ATOM 2626  C C    . LYS A 1 170 ? -3.351  20.127  -2.648  1.00 0.00 ? 170 LYS A C    1  
ATOM 2627  O O    . LYS A 1 170 ? -3.228  20.749  -1.596  1.00 0.00 ? 170 LYS A O    1  
ATOM 2628  C CB   . LYS A 1 170 ? -0.970  19.693  -3.238  1.00 0.00 ? 170 LYS A CB   1  
ATOM 2629  C CG   . LYS A 1 170 ? -0.922  20.550  -4.510  1.00 0.00 ? 170 LYS A CG   1  
ATOM 2630  C CD   . LYS A 1 170 ? 0.377   21.366  -4.512  1.00 0.00 ? 170 LYS A CD   1  
ATOM 2631  C CE   . LYS A 1 170 ? 0.273   22.578  -3.571  1.00 0.00 ? 170 LYS A CE   1  
ATOM 2632  N NZ   . LYS A 1 170 ? 1.597   23.164  -3.279  1.00 0.00 ? 170 LYS A NZ   1  
ATOM 2633  H H    . LYS A 1 170 ? -2.386  18.534  -5.099  1.00 0.00 ? 170 LYS A H    1  
ATOM 2634  H HA   . LYS A 1 170 ? -2.236  18.397  -2.145  1.00 0.00 ? 170 LYS A HA   1  
ATOM 2635  H HB2  . LYS A 1 170 ? -0.738  20.303  -2.367  1.00 0.00 ? 170 LYS A HB2  1  
ATOM 2636  H HB3  . LYS A 1 170 ? -0.208  18.920  -3.304  1.00 0.00 ? 170 LYS A HB3  1  
ATOM 2637  H HG2  . LYS A 1 170 ? -0.976  19.874  -5.373  1.00 0.00 ? 170 LYS A HG2  1  
ATOM 2638  H HG3  . LYS A 1 170 ? -1.768  21.237  -4.553  1.00 0.00 ? 170 LYS A HG3  1  
ATOM 2639  H HD2  . LYS A 1 170 ? 1.199   20.717  -4.204  1.00 0.00 ? 170 LYS A HD2  1  
ATOM 2640  H HD3  . LYS A 1 170 ? 0.569   21.734  -5.519  1.00 0.00 ? 170 LYS A HD3  1  
ATOM 2641  H HE2  . LYS A 1 170 ? -0.365  23.331  -4.042  1.00 0.00 ? 170 LYS A HE2  1  
ATOM 2642  H HE3  . LYS A 1 170 ? -0.194  22.282  -2.630  1.00 0.00 ? 170 LYS A HE3  1  
ATOM 2643  H HZ1  . LYS A 1 170 ? 1.487   24.088  -2.864  1.00 0.00 ? 170 LYS A HZ1  1  
ATOM 2644  H HZ2  . LYS A 1 170 ? 2.114   22.598  -2.612  1.00 0.00 ? 170 LYS A HZ2  1  
ATOM 2645  H HZ3  . LYS A 1 170 ? 2.140   23.279  -4.132  1.00 0.00 ? 170 LYS A HZ3  1  
ATOM 2646  N N    . GLU A 1 171 ? -4.315  20.381  -3.529  1.00 0.00 ? 171 GLU A N    1  
ATOM 2647  C CA   . GLU A 1 171 ? -5.301  21.420  -3.316  1.00 0.00 ? 171 GLU A CA   1  
ATOM 2648  C C    . GLU A 1 171 ? -6.349  20.861  -2.372  1.00 0.00 ? 171 GLU A C    1  
ATOM 2649  O O    . GLU A 1 171 ? -6.320  21.142  -1.177  1.00 0.00 ? 171 GLU A O    1  
ATOM 2650  C CB   . GLU A 1 171 ? -5.858  21.903  -4.669  1.00 0.00 ? 171 GLU A CB   1  
ATOM 2651  C CG   . GLU A 1 171 ? -4.803  22.693  -5.463  1.00 0.00 ? 171 GLU A CG   1  
ATOM 2652  C CD   . GLU A 1 171 ? -4.179  23.809  -4.620  1.00 0.00 ? 171 GLU A CD   1  
ATOM 2653  O OE1  . GLU A 1 171 ? -4.930  24.530  -3.929  1.00 0.00 ? 171 GLU A OE1  1  
ATOM 2654  O OE2  . GLU A 1 171 ? -2.927  23.888  -4.571  1.00 0.00 ? 171 GLU A OE2  1  
ATOM 2655  H H    . GLU A 1 171 ? -4.406  19.812  -4.359  1.00 0.00 ? 171 GLU A H    1  
ATOM 2656  H HA   . GLU A 1 171 ? -4.838  22.258  -2.794  1.00 0.00 ? 171 GLU A HA   1  
ATOM 2657  H HB2  . GLU A 1 171 ? -6.180  21.050  -5.265  1.00 0.00 ? 171 GLU A HB2  1  
ATOM 2658  H HB3  . GLU A 1 171 ? -6.724  22.540  -4.496  1.00 0.00 ? 171 GLU A HB3  1  
ATOM 2659  H HG2  . GLU A 1 171 ? -4.022  22.007  -5.793  1.00 0.00 ? 171 GLU A HG2  1  
ATOM 2660  H HG3  . GLU A 1 171 ? -5.270  23.123  -6.349  1.00 0.00 ? 171 GLU A HG3  1  
ATOM 2661  N N    . ASN A 1 172 ? -7.203  19.972  -2.866  1.00 0.00 ? 172 ASN A N    1  
ATOM 2662  C CA   . ASN A 1 172 ? -8.264  19.320  -2.114  1.00 0.00 ? 172 ASN A CA   1  
ATOM 2663  C C    . ASN A 1 172 ? -7.725  18.048  -1.445  1.00 0.00 ? 172 ASN A C    1  
ATOM 2664  O O    . ASN A 1 172 ? -8.444  17.058  -1.326  1.00 0.00 ? 172 ASN A O    1  
ATOM 2665  C CB   . ASN A 1 172 ? -9.473  19.078  -3.039  1.00 0.00 ? 172 ASN A CB   1  
ATOM 2666  C CG   . ASN A 1 172 ? -9.191  18.137  -4.200  1.00 0.00 ? 172 ASN A CG   1  
ATOM 2667  O OD1  . ASN A 1 172 ? -8.915  18.588  -5.305  1.00 0.00 ? 172 ASN A OD1  1  
ATOM 2668  N ND2  . ASN A 1 172 ? -9.186  16.841  -3.972  1.00 0.00 ? 172 ASN A ND2  1  
ATOM 2669  H H    . ASN A 1 172 ? -7.024  19.612  -3.797  1.00 0.00 ? 172 ASN A H    1  
ATOM 2670  H HA   . ASN A 1 172 ? -8.600  19.995  -1.328  1.00 0.00 ? 172 ASN A HA   1  
ATOM 2671  H HB2  . ASN A 1 172 ? -10.309 18.693  -2.456  1.00 0.00 ? 172 ASN A HB2  1  
ATOM 2672  H HB3  . ASN A 1 172 ? -9.793  20.037  -3.451  1.00 0.00 ? 172 ASN A HB3  1  
ATOM 2673  H HD21 . ASN A 1 172 ? -9.306  16.514  -3.021  1.00 0.00 ? 172 ASN A HD21 1  
ATOM 2674  H HD22 . ASN A 1 172 ? -9.163  16.162  -4.732  1.00 0.00 ? 172 ASN A HD22 1  
ATOM 2675  N N    . ARG A 1 173 ? -6.446  18.019  -1.041  1.00 0.00 ? 173 ARG A N    1  
ATOM 2676  C CA   . ARG A 1 173 ? -5.798  16.779  -0.609  1.00 0.00 ? 173 ARG A CA   1  
ATOM 2677  C C    . ARG A 1 173 ? -6.604  16.118  0.510   1.00 0.00 ? 173 ARG A C    1  
ATOM 2678  O O    . ARG A 1 173 ? -6.952  14.944  0.404   1.00 0.00 ? 173 ARG A O    1  
ATOM 2679  C CB   . ARG A 1 173 ? -4.344  17.022  -0.176  1.00 0.00 ? 173 ARG A CB   1  
ATOM 2680  C CG   . ARG A 1 173 ? -3.584  15.685  -0.073  1.00 0.00 ? 173 ARG A CG   1  
ATOM 2681  C CD   . ARG A 1 173 ? -2.067  15.851  -0.237  1.00 0.00 ? 173 ARG A CD   1  
ATOM 2682  N NE   . ARG A 1 173 ? -1.678  15.907  -1.659  1.00 0.00 ? 173 ARG A NE   1  
ATOM 2683  C CZ   . ARG A 1 173 ? -0.479  16.238  -2.159  1.00 0.00 ? 173 ARG A CZ   1  
ATOM 2684  N NH1  . ARG A 1 173 ? 0.496   16.658  -1.367  1.00 0.00 ? 173 ARG A NH1  1  
ATOM 2685  N NH2  . ARG A 1 173 ? -0.248  16.155  -3.462  1.00 0.00 ? 173 ARG A NH2  1  
ATOM 2686  H H    . ARG A 1 173 ? -5.912  18.878  -1.089  1.00 0.00 ? 173 ARG A H    1  
ATOM 2687  H HA   . ARG A 1 173 ? -5.782  16.129  -1.492  1.00 0.00 ? 173 ARG A HA   1  
ATOM 2688  H HB2  . ARG A 1 173 ? -3.861  17.666  -0.904  1.00 0.00 ? 173 ARG A HB2  1  
ATOM 2689  H HB3  . ARG A 1 173 ? -4.313  17.536  0.785   1.00 0.00 ? 173 ARG A HB3  1  
ATOM 2690  H HG2  . ARG A 1 173 ? -3.793  15.237  0.896   1.00 0.00 ? 173 ARG A HG2  1  
ATOM 2691  H HG3  . ARG A 1 173 ? -3.938  14.989  -0.833  1.00 0.00 ? 173 ARG A HG3  1  
ATOM 2692  H HD2  . ARG A 1 173 ? -1.756  16.758  0.275   1.00 0.00 ? 173 ARG A HD2  1  
ATOM 2693  H HD3  . ARG A 1 173 ? -1.567  14.999  0.221   1.00 0.00 ? 173 ARG A HD3  1  
ATOM 2694  H HE   . ARG A 1 173 ? -2.465  15.826  -2.302  1.00 0.00 ? 173 ARG A HE   1  
ATOM 2695  H HH11 . ARG A 1 173 ? 0.264   16.938  -0.411  1.00 0.00 ? 173 ARG A HH11 1  
ATOM 2696  H HH12 . ARG A 1 173 ? 1.350   17.072  -1.743  1.00 0.00 ? 173 ARG A HH12 1  
ATOM 2697  H HH21 . ARG A 1 173 ? -0.970  16.003  -4.161  1.00 0.00 ? 173 ARG A HH21 1  
ATOM 2698  H HH22 . ARG A 1 173 ? 0.606   16.532  -3.876  1.00 0.00 ? 173 ARG A HH22 1  
ATOM 2699  N N    . ASN A 1 174 ? -6.932  16.872  1.566   1.00 0.00 ? 174 ASN A N    1  
ATOM 2700  C CA   . ASN A 1 174 ? -7.646  16.357  2.732   1.00 0.00 ? 174 ASN A CA   1  
ATOM 2701  C C    . ASN A 1 174 ? -9.140  16.121  2.504   1.00 0.00 ? 174 ASN A C    1  
ATOM 2702  O O    . ASN A 1 174 ? -9.834  15.698  3.427   1.00 0.00 ? 174 ASN A O    1  
ATOM 2703  C CB   . ASN A 1 174 ? -7.443  17.266  3.964   1.00 0.00 ? 174 ASN A CB   1  
ATOM 2704  C CG   . ASN A 1 174 ? -6.059  17.166  4.593   1.00 0.00 ? 174 ASN A CG   1  
ATOM 2705  O OD1  . ASN A 1 174 ? -5.462  16.094  4.686   1.00 0.00 ? 174 ASN A OD1  1  
ATOM 2706  N ND2  . ASN A 1 174 ? -5.505  18.260  5.075   1.00 0.00 ? 174 ASN A ND2  1  
ATOM 2707  H H    . ASN A 1 174 ? -6.588  17.823  1.615   1.00 0.00 ? 174 ASN A H    1  
ATOM 2708  H HA   . ASN A 1 174 ? -7.231  15.386  2.925   1.00 0.00 ? 174 ASN A HA   1  
ATOM 2709  H HB2  . ASN A 1 174 ? -7.678  18.298  3.699   1.00 0.00 ? 174 ASN A HB2  1  
ATOM 2710  H HB3  . ASN A 1 174 ? -8.152  16.976  4.742   1.00 0.00 ? 174 ASN A HB3  1  
ATOM 2711  H HD21 . ASN A 1 174 ? -5.959  19.167  4.965   1.00 0.00 ? 174 ASN A HD21 1  
ATOM 2712  H HD22 . ASN A 1 174 ? -4.614  18.236  5.545   1.00 0.00 ? 174 ASN A HD22 1  
ATOM 2713  N N    . HIS A 1 175 ? -9.637  16.315  1.286   1.00 0.00 ? 175 HIS A N    1  
ATOM 2714  C CA   . HIS A 1 175 ? -11.026 16.018  0.946   1.00 0.00 ? 175 HIS A CA   1  
ATOM 2715  C C    . HIS A 1 175 ? -11.234 14.571  0.547   1.00 0.00 ? 175 HIS A C    1  
ATOM 2716  O O    . HIS A 1 175 ? -12.371 14.113  0.564   1.00 0.00 ? 175 HIS A O    1  
ATOM 2717  C CB   . HIS A 1 175 ? -11.524 16.931  -0.180  1.00 0.00 ? 175 HIS A CB   1  
ATOM 2718  C CG   . HIS A 1 175 ? -12.246 18.100  0.385   1.00 0.00 ? 175 HIS A CG   1  
ATOM 2719  N ND1  . HIS A 1 175 ? -13.521 18.050  0.878   1.00 0.00 ? 175 HIS A ND1  1  
ATOM 2720  C CD2  . HIS A 1 175 ? -11.728 19.335  0.640   1.00 0.00 ? 175 HIS A CD2  1  
ATOM 2721  C CE1  . HIS A 1 175 ? -13.775 19.235  1.435   1.00 0.00 ? 175 HIS A CE1  1  
ATOM 2722  N NE2  . HIS A 1 175 ? -12.707 20.049  1.336   1.00 0.00 ? 175 HIS A NE2  1  
ATOM 2723  H H    . HIS A 1 175 ? -8.992  16.558  0.548   1.00 0.00 ? 175 HIS A H    1  
ATOM 2724  H HA   . HIS A 1 175 ? -11.660 16.179  1.818   1.00 0.00 ? 175 HIS A HA   1  
ATOM 2725  H HB2  . HIS A 1 175 ? -10.718 17.272  -0.810  1.00 0.00 ? 175 HIS A HB2  1  
ATOM 2726  H HB3  . HIS A 1 175 ? -12.221 16.396  -0.818  1.00 0.00 ? 175 HIS A HB3  1  
ATOM 2727  H HD1  . HIS A 1 175 ? -14.149 17.245  0.872   1.00 0.00 ? 175 HIS A HD1  1  
ATOM 2728  H HD2  . HIS A 1 175 ? -10.731 19.658  0.386   1.00 0.00 ? 175 HIS A HD2  1  
ATOM 2729  H HE1  . HIS A 1 175 ? -14.713 19.468  1.920   1.00 0.00 ? 175 HIS A HE1  1  
ATOM 2730  N N    . LEU A 1 176 ? -10.178 13.846  0.171   1.00 0.00 ? 176 LEU A N    1  
ATOM 2731  C CA   . LEU A 1 176 ? -10.421 12.599  -0.535  1.00 0.00 ? 176 LEU A CA   1  
ATOM 2732  C C    . LEU A 1 176 ? -10.812 11.456  0.396   1.00 0.00 ? 176 LEU A C    1  
ATOM 2733  O O    . LEU A 1 176 ? -11.439 10.504  -0.043  1.00 0.00 ? 176 LEU A O    1  
ATOM 2734  C CB   . LEU A 1 176 ? -9.226  12.236  -1.424  1.00 0.00 ? 176 LEU A CB   1  
ATOM 2735  C CG   . LEU A 1 176 ? -9.728  11.941  -2.847  1.00 0.00 ? 176 LEU A CG   1  
ATOM 2736  C CD1  . LEU A 1 176 ? -8.551  11.965  -3.819  1.00 0.00 ? 176 LEU A CD1  1  
ATOM 2737  C CD2  . LEU A 1 176 ? -10.411 10.588  -2.931  1.00 0.00 ? 176 LEU A CD2  1  
ATOM 2738  H H    . LEU A 1 176 ? -9.249  14.243  0.181   1.00 0.00 ? 176 LEU A H    1  
ATOM 2739  H HA   . LEU A 1 176 ? -11.285 12.786  -1.173  1.00 0.00 ? 176 LEU A HA   1  
ATOM 2740  H HB2  . LEU A 1 176 ? -8.521  13.065  -1.458  1.00 0.00 ? 176 LEU A HB2  1  
ATOM 2741  H HB3  . LEU A 1 176 ? -8.697  11.373  -1.019  1.00 0.00 ? 176 LEU A HB3  1  
ATOM 2742  H HG   . LEU A 1 176 ? -10.458 12.695  -3.144  1.00 0.00 ? 176 LEU A HG   1  
ATOM 2743  H HD11 . LEU A 1 176 ? -8.903  11.768  -4.832  1.00 0.00 ? 176 LEU A HD11 1  
ATOM 2744  H HD12 . LEU A 1 176 ? -8.126  12.965  -3.811  1.00 0.00 ? 176 LEU A HD12 1  
ATOM 2745  H HD13 . LEU A 1 176 ? -7.801  11.227  -3.530  1.00 0.00 ? 176 LEU A HD13 1  
ATOM 2746  H HD21 . LEU A 1 176 ? -11.301 10.565  -2.318  1.00 0.00 ? 176 LEU A HD21 1  
ATOM 2747  H HD22 . LEU A 1 176 ? -10.746 10.429  -3.947  1.00 0.00 ? 176 LEU A HD22 1  
ATOM 2748  H HD23 . LEU A 1 176 ? -9.736  9.808   -2.593  1.00 0.00 ? 176 LEU A HD23 1  
ATOM 2749  N N    . LEU A 1 177 ? -10.480 11.544  1.682   1.00 0.00 ? 177 LEU A N    1  
ATOM 2750  C CA   . LEU A 1 177 ? -10.828 10.521  2.660   1.00 0.00 ? 177 LEU A CA   1  
ATOM 2751  C C    . LEU A 1 177 ? -12.318 10.122  2.537   1.00 0.00 ? 177 LEU A C    1  
ATOM 2752  O O    . LEU A 1 177 ? -12.563 8.977   2.159   1.00 0.00 ? 177 LEU A O    1  
ATOM 2753  C CB   . LEU A 1 177 ? -10.425 11.047  4.054   1.00 0.00 ? 177 LEU A CB   1  
ATOM 2754  C CG   . LEU A 1 177 ? -10.785 10.238  5.317   1.00 0.00 ? 177 LEU A CG   1  
ATOM 2755  C CD1  . LEU A 1 177 ? -11.714 11.009  6.253   1.00 0.00 ? 177 LEU A CD1  1  
ATOM 2756  C CD2  . LEU A 1 177 ? -11.361 8.842   5.121   1.00 0.00 ? 177 LEU A CD2  1  
ATOM 2757  H H    . LEU A 1 177 ? -10.038 12.389  2.004   1.00 0.00 ? 177 LEU A H    1  
ATOM 2758  H HA   . LEU A 1 177 ? -10.216 9.638   2.389   1.00 0.00 ? 177 LEU A HA   1  
ATOM 2759  H HB2  . LEU A 1 177 ? -9.345  11.144  4.054   1.00 0.00 ? 177 LEU A HB2  1  
ATOM 2760  H HB3  . LEU A 1 177 ? -10.796 12.064  4.175   1.00 0.00 ? 177 LEU A HB3  1  
ATOM 2761  H HG   . LEU A 1 177 ? -9.848  10.116  5.846   1.00 0.00 ? 177 LEU A HG   1  
ATOM 2762  H HD11 . LEU A 1 177 ? -11.303 11.987  6.494   1.00 0.00 ? 177 LEU A HD11 1  
ATOM 2763  H HD12 . LEU A 1 177 ? -12.696 11.123  5.798   1.00 0.00 ? 177 LEU A HD12 1  
ATOM 2764  H HD13 . LEU A 1 177 ? -11.844 10.445  7.177   1.00 0.00 ? 177 LEU A HD13 1  
ATOM 2765  H HD21 . LEU A 1 177 ? -12.403 8.900   4.810   1.00 0.00 ? 177 LEU A HD21 1  
ATOM 2766  H HD22 . LEU A 1 177 ? -10.778 8.298   4.383   1.00 0.00 ? 177 LEU A HD22 1  
ATOM 2767  H HD23 . LEU A 1 177 ? -11.351 8.315   6.072   1.00 0.00 ? 177 LEU A HD23 1  
ATOM 2768  N N    . PRO A 1 178 ? -13.313 11.005  2.765   1.00 0.00 ? 178 PRO A N    1  
ATOM 2769  C CA   . PRO A 1 178 ? -14.720 10.616  2.676   1.00 0.00 ? 178 PRO A CA   1  
ATOM 2770  C C    . PRO A 1 178 ? -15.125 10.160  1.272   1.00 0.00 ? 178 PRO A C    1  
ATOM 2771  O O    . PRO A 1 178 ? -16.037 9.348   1.124   1.00 0.00 ? 178 PRO A O    1  
ATOM 2772  C CB   . PRO A 1 178 ? -15.520 11.857  3.079   1.00 0.00 ? 178 PRO A CB   1  
ATOM 2773  C CG   . PRO A 1 178 ? -14.575 13.013  2.777   1.00 0.00 ? 178 PRO A CG   1  
ATOM 2774  C CD   . PRO A 1 178 ? -13.223 12.409  3.138   1.00 0.00 ? 178 PRO A CD   1  
ATOM 2775  H HA   . PRO A 1 178 ? -14.923 9.811   3.383   1.00 0.00 ? 178 PRO A HA   1  
ATOM 2776  H HB2  . PRO A 1 178 ? -16.437 11.942  2.499   1.00 0.00 ? 178 PRO A HB2  1  
ATOM 2777  H HB3  . PRO A 1 178 ? -15.730 11.834  4.148   1.00 0.00 ? 178 PRO A HB3  1  
ATOM 2778  H HG2  . PRO A 1 178 ? -14.609 13.247  1.713   1.00 0.00 ? 178 PRO A HG2  1  
ATOM 2779  H HG3  . PRO A 1 178 ? -14.804 13.891  3.379   1.00 0.00 ? 178 PRO A HG3  1  
ATOM 2780  H HD2  . PRO A 1 178 ? -12.421 12.925  2.623   1.00 0.00 ? 178 PRO A HD2  1  
ATOM 2781  H HD3  . PRO A 1 178 ? -13.077 12.497  4.211   1.00 0.00 ? 178 PRO A HD3  1  
ATOM 2782  N N    . ASP A 1 179 ? -14.469 10.673  0.230   1.00 0.00 ? 179 ASP A N    1  
ATOM 2783  C CA   . ASP A 1 179 ? -14.796 10.370  -1.158  1.00 0.00 ? 179 ASP A CA   1  
ATOM 2784  C C    . ASP A 1 179 ? -14.450 8.912   -1.462  1.00 0.00 ? 179 ASP A C    1  
ATOM 2785  O O    . ASP A 1 179 ? -15.173 8.244   -2.209  1.00 0.00 ? 179 ASP A O    1  
ATOM 2786  C CB   . ASP A 1 179 ? -14.056 11.340  -2.091  1.00 0.00 ? 179 ASP A CB   1  
ATOM 2787  C CG   . ASP A 1 179 ? -14.970 12.470  -2.546  1.00 0.00 ? 179 ASP A CG   1  
ATOM 2788  O OD1  . ASP A 1 179 ? -15.097 13.490  -1.831  1.00 0.00 ? 179 ASP A OD1  1  
ATOM 2789  O OD2  . ASP A 1 179 ? -15.594 12.283  -3.621  1.00 0.00 ? 179 ASP A OD2  1  
ATOM 2790  H H    . ASP A 1 179 ? -13.663 11.262  0.389   1.00 0.00 ? 179 ASP A H    1  
ATOM 2791  H HA   . ASP A 1 179 ? -15.869 10.500  -1.309  1.00 0.00 ? 179 ASP A HA   1  
ATOM 2792  H HB2  . ASP A 1 179 ? -13.188 11.763  -1.591  1.00 0.00 ? 179 ASP A HB2  1  
ATOM 2793  H HB3  . ASP A 1 179 ? -13.706 10.803  -2.974  1.00 0.00 ? 179 ASP A HB3  1  
ATOM 2794  N N    . ILE A 1 180 ? -13.386 8.394   -0.841  1.00 0.00 ? 180 ILE A N    1  
ATOM 2795  C CA   . ILE A 1 180 ? -13.037 6.982   -0.863  1.00 0.00 ? 180 ILE A CA   1  
ATOM 2796  C C    . ILE A 1 180 ? -14.075 6.180   -0.082  1.00 0.00 ? 180 ILE A C    1  
ATOM 2797  O O    . ILE A 1 180 ? -14.621 5.217   -0.625  1.00 0.00 ? 180 ILE A O    1  
ATOM 2798  C CB   . ILE A 1 180 ? -11.598 6.771   -0.352  1.00 0.00 ? 180 ILE A CB   1  
ATOM 2799  C CG1  . ILE A 1 180 ? -10.544 7.303   -1.333  1.00 0.00 ? 180 ILE A CG1  1  
ATOM 2800  C CG2  . ILE A 1 180 ? -11.308 5.301   -0.016  1.00 0.00 ? 180 ILE A CG2  1  
ATOM 2801  C CD1  . ILE A 1 180 ? -9.349  7.930   -0.611  1.00 0.00 ? 180 ILE A CD1  1  
ATOM 2802  H H    . ILE A 1 180 ? -12.840 9.010   -0.243  1.00 0.00 ? 180 ILE A H    1  
ATOM 2803  H HA   . ILE A 1 180 ? -13.087 6.651   -1.888  1.00 0.00 ? 180 ILE A HA   1  
ATOM 2804  H HB   . ILE A 1 180 ? -11.477 7.347   0.547   1.00 0.00 ? 180 ILE A HB   1  
ATOM 2805  H HG12 . ILE A 1 180 ? -10.178 6.486   -1.951  1.00 0.00 ? 180 ILE A HG12 1  
ATOM 2806  H HG13 . ILE A 1 180 ? -10.993 8.061   -1.971  1.00 0.00 ? 180 ILE A HG13 1  
ATOM 2807  H HG21 . ILE A 1 180 ? -11.774 4.637   -0.744  1.00 0.00 ? 180 ILE A HG21 1  
ATOM 2808  H HG22 . ILE A 1 180 ? -10.235 5.130   -0.048  1.00 0.00 ? 180 ILE A HG22 1  
ATOM 2809  H HG23 . ILE A 1 180 ? -11.680 5.074   0.990   1.00 0.00 ? 180 ILE A HG23 1  
ATOM 2810  H HD11 . ILE A 1 180 ? -9.671  8.751   0.024   1.00 0.00 ? 180 ILE A HD11 1  
ATOM 2811  H HD12 . ILE A 1 180 ? -8.857  7.178   0.004   1.00 0.00 ? 180 ILE A HD12 1  
ATOM 2812  H HD13 . ILE A 1 180 ? -8.653  8.321   -1.351  1.00 0.00 ? 180 ILE A HD13 1  
ATOM 2813  N N    . VAL A 1 181 ? -14.370 6.564   1.163   1.00 0.00 ? 181 VAL A N    1  
ATOM 2814  C CA   . VAL A 1 181 ? -15.298 5.829   2.025   1.00 0.00 ? 181 VAL A CA   1  
ATOM 2815  C C    . VAL A 1 181 ? -16.672 5.721   1.354   1.00 0.00 ? 181 VAL A C    1  
ATOM 2816  O O    . VAL A 1 181 ? -17.304 4.671   1.438   1.00 0.00 ? 181 VAL A O    1  
ATOM 2817  C CB   . VAL A 1 181 ? -15.372 6.488   3.418   1.00 0.00 ? 181 VAL A CB   1  
ATOM 2818  C CG1  . VAL A 1 181 ? -16.276 5.710   4.385   1.00 0.00 ? 181 VAL A CG1  1  
ATOM 2819  C CG2  . VAL A 1 181 ? -13.981 6.566   4.062   1.00 0.00 ? 181 VAL A CG2  1  
ATOM 2820  H H    . VAL A 1 181 ? -13.908 7.383   1.547   1.00 0.00 ? 181 VAL A H    1  
ATOM 2821  H HA   . VAL A 1 181 ? -14.908 4.818   2.152   1.00 0.00 ? 181 VAL A HA   1  
ATOM 2822  H HB   . VAL A 1 181 ? -15.760 7.500   3.310   1.00 0.00 ? 181 VAL A HB   1  
ATOM 2823  H HG11 . VAL A 1 181 ? -17.305 5.705   4.025   1.00 0.00 ? 181 VAL A HG11 1  
ATOM 2824  H HG12 . VAL A 1 181 ? -15.931 4.680   4.489   1.00 0.00 ? 181 VAL A HG12 1  
ATOM 2825  H HG13 . VAL A 1 181 ? -16.263 6.184   5.368   1.00 0.00 ? 181 VAL A HG13 1  
ATOM 2826  H HG21 . VAL A 1 181 ? -13.266 7.043   3.402   1.00 0.00 ? 181 VAL A HG21 1  
ATOM 2827  H HG22 . VAL A 1 181 ? -14.049 7.179   4.959   1.00 0.00 ? 181 VAL A HG22 1  
ATOM 2828  H HG23 . VAL A 1 181 ? -13.622 5.569   4.316   1.00 0.00 ? 181 VAL A HG23 1  
ATOM 2829  N N    . THR A 1 182 ? -17.088 6.746   0.606   1.00 0.00 ? 182 THR A N    1  
ATOM 2830  C CA   . THR A 1 182 ? -18.321 6.753   -0.165  1.00 0.00 ? 182 THR A CA   1  
ATOM 2831  C C    . THR A 1 182 ? -18.351 5.563   -1.128  1.00 0.00 ? 182 THR A C    1  
ATOM 2832  O O    . THR A 1 182 ? -19.362 4.872   -1.249  1.00 0.00 ? 182 THR A O    1  
ATOM 2833  C CB   . THR A 1 182 ? -18.413 8.106   -0.895  1.00 0.00 ? 182 THR A CB   1  
ATOM 2834  O OG1  . THR A 1 182 ? -18.493 9.158   0.047   1.00 0.00 ? 182 THR A OG1  1  
ATOM 2835  C CG2  . THR A 1 182 ? -19.581 8.243   -1.879  1.00 0.00 ? 182 THR A CG2  1  
ATOM 2836  H H    . THR A 1 182 ? -16.501 7.570   0.557   1.00 0.00 ? 182 THR A H    1  
ATOM 2837  H HA   . THR A 1 182 ? -19.149 6.644   0.530   1.00 0.00 ? 182 THR A HA   1  
ATOM 2838  H HB   . THR A 1 182 ? -17.498 8.248   -1.464  1.00 0.00 ? 182 THR A HB   1  
ATOM 2839  H HG1  . THR A 1 182 ? -17.659 9.180   0.559   1.00 0.00 ? 182 THR A HG1  1  
ATOM 2840  H HG21 . THR A 1 182 ? -19.506 7.479   -2.655  1.00 0.00 ? 182 THR A HG21 1  
ATOM 2841  H HG22 . THR A 1 182 ? -20.532 8.143   -1.361  1.00 0.00 ? 182 THR A HG22 1  
ATOM 2842  H HG23 . THR A 1 182 ? -19.538 9.222   -2.354  1.00 0.00 ? 182 THR A HG23 1  
ATOM 2843  N N    . CYS A 1 183 ? -17.239 5.304   -1.817  1.00 0.00 ? 183 CYS A N    1  
ATOM 2844  C CA   . CYS A 1 183 ? -17.125 4.209   -2.759  1.00 0.00 ? 183 CYS A CA   1  
ATOM 2845  C C    . CYS A 1 183 ? -17.097 2.867   -2.014  1.00 0.00 ? 183 CYS A C    1  
ATOM 2846  O O    . CYS A 1 183 ? -17.757 1.921   -2.444  1.00 0.00 ? 183 CYS A O    1  
ATOM 2847  C CB   . CYS A 1 183 ? -15.871 4.439   -3.611  1.00 0.00 ? 183 CYS A CB   1  
ATOM 2848  S SG   . CYS A 1 183 ? -16.068 3.671   -5.245  1.00 0.00 ? 183 CYS A SG   1  
ATOM 2849  H H    . CYS A 1 183 ? -16.401 5.829   -1.598  1.00 0.00 ? 183 CYS A H    1  
ATOM 2850  H HA   . CYS A 1 183 ? -18.006 4.229   -3.401  1.00 0.00 ? 183 CYS A HA   1  
ATOM 2851  H HB2  . CYS A 1 183 ? -15.719 5.513   -3.740  1.00 0.00 ? 183 CYS A HB2  1  
ATOM 2852  H HB3  . CYS A 1 183 ? -15.002 4.023   -3.102  1.00 0.00 ? 183 CYS A HB3  1  
ATOM 2853  H HG   . CYS A 1 183 ? -17.157 4.363   -5.602  1.00 0.00 ? 183 CYS A HG   1  
ATOM 2854  N N    . VAL A 1 184 ? -16.380 2.781   -0.887  1.00 0.00 ? 184 VAL A N    1  
ATOM 2855  C CA   . VAL A 1 184 ? -16.279 1.560   -0.088  1.00 0.00 ? 184 VAL A CA   1  
ATOM 2856  C C    . VAL A 1 184 ? -17.667 1.179   0.461   1.00 0.00 ? 184 VAL A C    1  
ATOM 2857  O O    . VAL A 1 184 ? -18.167 0.096   0.137   1.00 0.00 ? 184 VAL A O    1  
ATOM 2858  C CB   . VAL A 1 184 ? -15.189 1.709   1.003   1.00 0.00 ? 184 VAL A CB   1  
ATOM 2859  C CG1  . VAL A 1 184 ? -15.131 0.484   1.929   1.00 0.00 ? 184 VAL A CG1  1  
ATOM 2860  C CG2  . VAL A 1 184 ? -13.786 1.879   0.385   1.00 0.00 ? 184 VAL A CG2  1  
ATOM 2861  H H    . VAL A 1 184 ? -15.893 3.612   -0.564  1.00 0.00 ? 184 VAL A H    1  
ATOM 2862  H HA   . VAL A 1 184 ? -15.967 0.759   -0.761  1.00 0.00 ? 184 VAL A HA   1  
ATOM 2863  H HB   . VAL A 1 184 ? -15.406 2.587   1.611   1.00 0.00 ? 184 VAL A HB   1  
ATOM 2864  H HG11 . VAL A 1 184 ? -14.998 -0.425  1.345   1.00 0.00 ? 184 VAL A HG11 1  
ATOM 2865  H HG12 . VAL A 1 184 ? -14.302 0.583   2.629   1.00 0.00 ? 184 VAL A HG12 1  
ATOM 2866  H HG13 . VAL A 1 184 ? -16.052 0.405   2.510   1.00 0.00 ? 184 VAL A HG13 1  
ATOM 2867  H HG21 . VAL A 1 184 ? -13.743 2.769   -0.240  1.00 0.00 ? 184 VAL A HG21 1  
ATOM 2868  H HG22 . VAL A 1 184 ? -13.034 1.979   1.171   1.00 0.00 ? 184 VAL A HG22 1  
ATOM 2869  H HG23 . VAL A 1 184 ? -13.531 1.008   -0.221  1.00 0.00 ? 184 VAL A HG23 1  
ATOM 2870  N N    . GLN A 1 185 ? -18.314 2.050   1.247   1.00 0.00 ? 185 GLN A N    1  
ATOM 2871  C CA   . GLN A 1 185 ? -19.600 1.777   1.900   1.00 0.00 ? 185 GLN A CA   1  
ATOM 2872  C C    . GLN A 1 185 ? -20.772 1.748   0.910   1.00 0.00 ? 185 GLN A C    1  
ATOM 2873  O O    . GLN A 1 185 ? -21.899 1.431   1.280   1.00 0.00 ? 185 GLN A O    1  
ATOM 2874  C CB   . GLN A 1 185 ? -19.823 2.740   3.085   1.00 0.00 ? 185 GLN A CB   1  
ATOM 2875  C CG   . GLN A 1 185 ? -20.432 4.119   2.767   1.00 0.00 ? 185 GLN A CG   1  
ATOM 2876  C CD   . GLN A 1 185 ? -21.960 4.131   2.890   1.00 0.00 ? 185 GLN A CD   1  
ATOM 2877  O OE1  . GLN A 1 185 ? -22.694 4.168   1.903   1.00 0.00 ? 185 GLN A OE1  1  
ATOM 2878  N NE2  . GLN A 1 185 ? -22.504 4.090   4.093   1.00 0.00 ? 185 GLN A NE2  1  
ATOM 2879  H H    . GLN A 1 185 ? -17.897 2.958   1.431   1.00 0.00 ? 185 GLN A H    1  
ATOM 2880  H HA   . GLN A 1 185 ? -19.530 0.775   2.328   1.00 0.00 ? 185 GLN A HA   1  
ATOM 2881  H HB2  . GLN A 1 185 ? -20.471 2.237   3.804   1.00 0.00 ? 185 GLN A HB2  1  
ATOM 2882  H HB3  . GLN A 1 185 ? -18.865 2.895   3.584   1.00 0.00 ? 185 GLN A HB3  1  
ATOM 2883  H HG2  . GLN A 1 185 ? -20.031 4.842   3.479   1.00 0.00 ? 185 GLN A HG2  1  
ATOM 2884  H HG3  . GLN A 1 185 ? -20.133 4.442   1.769   1.00 0.00 ? 185 GLN A HG3  1  
ATOM 2885  H HE21 . GLN A 1 185 ? -21.905 4.033   4.921   1.00 0.00 ? 185 GLN A HE21 1  
ATOM 2886  H HE22 . GLN A 1 185 ? -23.501 4.076   4.219   1.00 0.00 ? 185 GLN A HE22 1  
ATOM 2887  N N    . SER A 1 186 ? -20.525 2.027   -0.371  1.00 0.00 ? 186 SER A N    1  
ATOM 2888  C CA   . SER A 1 186 ? -21.461 1.737   -1.445  1.00 0.00 ? 186 SER A CA   1  
ATOM 2889  C C    . SER A 1 186 ? -21.748 0.226   -1.520  1.00 0.00 ? 186 SER A C    1  
ATOM 2890  O O    . SER A 1 186 ? -22.776 -0.166  -2.074  1.00 0.00 ? 186 SER A O    1  
ATOM 2891  C CB   . SER A 1 186 ? -20.916 2.285   -2.772  1.00 0.00 ? 186 SER A CB   1  
ATOM 2892  O OG   . SER A 1 186 ? -21.909 2.353   -3.783  1.00 0.00 ? 186 SER A OG   1  
ATOM 2893  H H    . SER A 1 186 ? -19.607 2.368   -0.595  1.00 0.00 ? 186 SER A H    1  
ATOM 2894  H HA   . SER A 1 186 ? -22.384 2.264   -1.210  1.00 0.00 ? 186 SER A HA   1  
ATOM 2895  H HB2  . SER A 1 186 ? -20.541 3.292   -2.616  1.00 0.00 ? 186 SER A HB2  1  
ATOM 2896  H HB3  . SER A 1 186 ? -20.099 1.654   -3.116  1.00 0.00 ? 186 SER A HB3  1  
ATOM 2897  H HG   . SER A 1 186 ? -22.688 2.807   -3.381  1.00 0.00 ? 186 SER A HG   1  
ATOM 2898  N N    . SER A 1 187 ? -20.881 -0.649  -0.987  1.00 0.00 ? 187 SER A N    1  
ATOM 2899  C CA   . SER A 1 187 ? -21.261 -2.034  -0.739  1.00 0.00 ? 187 SER A CA   1  
ATOM 2900  C C    . SER A 1 187 ? -22.302 -2.035  0.375   1.00 0.00 ? 187 SER A C    1  
ATOM 2901  O O    . SER A 1 187 ? -22.055 -1.461  1.433   1.00 0.00 ? 187 SER A O    1  
ATOM 2902  C CB   . SER A 1 187 ? -20.052 -2.909  -0.390  1.00 0.00 ? 187 SER A CB   1  
ATOM 2903  O OG   . SER A 1 187 ? -19.927 -3.957  -1.346  1.00 0.00 ? 187 SER A OG   1  
ATOM 2904  H H    . SER A 1 187 ? -20.046 -0.300  -0.526  1.00 0.00 ? 187 SER A H    1  
ATOM 2905  H HA   . SER A 1 187 ? -21.719 -2.419  -1.641  1.00 0.00 ? 187 SER A HA   1  
ATOM 2906  H HB2  . SER A 1 187 ? -19.146 -2.306  -0.392  1.00 0.00 ? 187 SER A HB2  1  
ATOM 2907  H HB3  . SER A 1 187 ? -20.178 -3.340  0.606   1.00 0.00 ? 187 SER A HB3  1  
ATOM 2908  H HG   . SER A 1 187 ? -20.632 -4.596  -1.163  1.00 0.00 ? 187 SER A HG   1  
ATOM 2909  N N    . ARG A 1 188 ? -23.456 -2.668  0.131   1.00 0.00 ? 188 ARG A N    1  
ATOM 2910  C CA   . ARG A 1 188 ? -24.616 -2.673  1.023   1.00 0.00 ? 188 ARG A CA   1  
ATOM 2911  C C    . ARG A 1 188 ? -24.210 -2.810  2.488   1.00 0.00 ? 188 ARG A C    1  
ATOM 2912  O O    . ARG A 1 188 ? -23.680 -3.844  2.912   1.00 0.00 ? 188 ARG A O    1  
ATOM 2913  C CB   . ARG A 1 188 ? -25.657 -3.713  0.580   1.00 0.00 ? 188 ARG A CB   1  
ATOM 2914  C CG   . ARG A 1 188 ? -25.141 -5.168  0.625   1.00 0.00 ? 188 ARG A CG   1  
ATOM 2915  C CD   . ARG A 1 188 ? -25.978 -6.226  -0.103  1.00 0.00 ? 188 ARG A CD   1  
ATOM 2916  N NE   . ARG A 1 188 ? -25.521 -7.566  0.317   1.00 0.00 ? 188 ARG A NE   1  
ATOM 2917  C CZ   . ARG A 1 188 ? -25.183 -8.622  -0.437  1.00 0.00 ? 188 ARG A CZ   1  
ATOM 2918  N NH1  . ARG A 1 188 ? -25.345 -8.632  -1.753  1.00 0.00 ? 188 ARG A NH1  1  
ATOM 2919  N NH2  . ARG A 1 188 ? -24.654 -9.688  0.151   1.00 0.00 ? 188 ARG A NH2  1  
ATOM 2920  H H    . ARG A 1 188 ? -23.566 -3.120  -0.773  1.00 0.00 ? 188 ARG A H    1  
ATOM 2921  H HA   . ARG A 1 188 ? -25.100 -1.704  0.898   1.00 0.00 ? 188 ARG A HA   1  
ATOM 2922  H HB2  . ARG A 1 188 ? -26.530 -3.633  1.230   1.00 0.00 ? 188 ARG A HB2  1  
ATOM 2923  H HB3  . ARG A 1 188 ? -25.968 -3.420  -0.416  1.00 0.00 ? 188 ARG A HB3  1  
ATOM 2924  H HG2  . ARG A 1 188 ? -24.130 -5.212  0.217   1.00 0.00 ? 188 ARG A HG2  1  
ATOM 2925  H HG3  . ARG A 1 188 ? -25.101 -5.464  1.673   1.00 0.00 ? 188 ARG A HG3  1  
ATOM 2926  H HD2  . ARG A 1 188 ? -27.029 -6.110  0.165   1.00 0.00 ? 188 ARG A HD2  1  
ATOM 2927  H HD3  . ARG A 1 188 ? -25.870 -6.094  -1.180  1.00 0.00 ? 188 ARG A HD3  1  
ATOM 2928  H HE   . ARG A 1 188 ? -25.445 -7.675  1.325   1.00 0.00 ? 188 ARG A HE   1  
ATOM 2929  H HH11 . ARG A 1 188 ? -25.794 -7.870  -2.251  1.00 0.00 ? 188 ARG A HH11 1  
ATOM 2930  H HH12 . ARG A 1 188 ? -25.270 -9.510  -2.262  1.00 0.00 ? 188 ARG A HH12 1  
ATOM 2931  H HH21 . ARG A 1 188 ? -24.462 -9.654  1.152   1.00 0.00 ? 188 ARG A HH21 1  
ATOM 2932  H HH22 . ARG A 1 188 ? -24.399 -10.540 -0.347  1.00 0.00 ? 188 ARG A HH22 1  
ATOM 2933  N N    . LYS A 1 189 ? -24.383 -1.714  3.214   1.00 0.00 ? 189 LYS A N    1  
ATOM 2934  C CA   . LYS A 1 189 ? -24.536 -1.680  4.644   1.00 0.00 ? 189 LYS A CA   1  
ATOM 2935  C C    . LYS A 1 189 ? -25.992 -2.060  4.806   1.00 0.00 ? 189 LYS A C    1  
ATOM 2936  O O    . LYS A 1 189 ? -26.862 -1.237  4.450   1.00 0.00 ? 189 LYS A O    1  
ATOM 2937  C CB   . LYS A 1 189 ? -24.166 -0.284  5.210   1.00 0.00 ? 189 LYS A CB   1  
ATOM 2938  C CG   . LYS A 1 189 ? -23.778 0.847   4.220   1.00 0.00 ? 189 LYS A CG   1  
ATOM 2939  C CD   . LYS A 1 189 ? -24.949 1.431   3.399   1.00 0.00 ? 189 LYS A CD   1  
ATOM 2940  C CE   . LYS A 1 189 ? -24.869 1.123   1.888   1.00 0.00 ? 189 LYS A CE   1  
ATOM 2941  N NZ   . LYS A 1 189 ? -24.670 2.344   1.073   1.00 0.00 ? 189 LYS A NZ   1  
ATOM 2942  H H    . LYS A 1 189 ? -24.807 -0.915  2.776   1.00 0.00 ? 189 LYS A H    1  
ATOM 2943  H HA   . LYS A 1 189 ? -23.918 -2.443  5.121   1.00 0.00 ? 189 LYS A HA   1  
ATOM 2944  H HB2  . LYS A 1 189 ? -24.973 0.071   5.854   1.00 0.00 ? 189 LYS A HB2  1  
ATOM 2945  H HB3  . LYS A 1 189 ? -23.307 -0.434  5.865   1.00 0.00 ? 189 LYS A HB3  1  
ATOM 2946  H HG2  . LYS A 1 189 ? -23.366 1.657   4.821   1.00 0.00 ? 189 LYS A HG2  1  
ATOM 2947  H HG3  . LYS A 1 189 ? -22.967 0.528   3.557   1.00 0.00 ? 189 LYS A HG3  1  
ATOM 2948  H HD2  . LYS A 1 189 ? -25.893 1.054   3.792   1.00 0.00 ? 189 LYS A HD2  1  
ATOM 2949  H HD3  . LYS A 1 189 ? -24.967 2.511   3.551   1.00 0.00 ? 189 LYS A HD3  1  
ATOM 2950  H HE2  . LYS A 1 189 ? -24.039 0.438   1.695   1.00 0.00 ? 189 LYS A HE2  1  
ATOM 2951  H HE3  . LYS A 1 189 ? -25.778 0.609   1.559   1.00 0.00 ? 189 LYS A HE3  1  
ATOM 2952  H HZ1  . LYS A 1 189 ? -24.721 2.106   0.088   1.00 0.00 ? 189 LYS A HZ1  1  
ATOM 2953  H HZ2  . LYS A 1 189 ? -25.380 3.045   1.242   1.00 0.00 ? 189 LYS A HZ2  1  
ATOM 2954  H HZ3  . LYS A 1 189 ? -23.754 2.749   1.267   1.00 0.00 ? 189 LYS A HZ3  1  
ATOM 2955  N N    . ALA A 1 1   ? -18.348 -0.472  -3.987  1.00 0.00 ? 1   ALA A N    2  
ATOM 2956  C CA   . ALA A 1 1   ? -18.299 -0.510  -5.451  1.00 0.00 ? 1   ALA A CA   2  
ATOM 2957  C C    . ALA A 1 1   ? -17.323 -1.581  -5.888  1.00 0.00 ? 1   ALA A C    2  
ATOM 2958  O O    . ALA A 1 1   ? -17.749 -2.665  -6.282  1.00 0.00 ? 1   ALA A O    2  
ATOM 2959  C CB   . ALA A 1 1   ? -18.044 0.875   -6.049  1.00 0.00 ? 1   ALA A CB   2  
ATOM 2960  H H1   . ALA A 1 1   ? -17.676 0.132   -3.558  1.00 0.00 ? 1   ALA A H1   2  
ATOM 2961  H HA   . ALA A 1 1   ? -19.278 -0.832  -5.798  1.00 0.00 ? 1   ALA A HA   2  
ATOM 2962  H HB1  . ALA A 1 1   ? -17.911 0.798   -7.129  1.00 0.00 ? 1   ALA A HB1  2  
ATOM 2963  H HB2  . ALA A 1 1   ? -18.910 1.500   -5.837  1.00 0.00 ? 1   ALA A HB2  2  
ATOM 2964  H HB3  . ALA A 1 1   ? -17.162 1.333   -5.604  1.00 0.00 ? 1   ALA A HB3  2  
ATOM 2965  N N    . ARG A 1 2   ? -16.020 -1.311  -5.822  1.00 0.00 ? 2   ARG A N    2  
ATOM 2966  C CA   . ARG A 1 2   ? -14.978 -2.327  -5.879  1.00 0.00 ? 2   ARG A CA   2  
ATOM 2967  C C    . ARG A 1 2   ? -13.695 -1.741  -5.301  1.00 0.00 ? 2   ARG A C    2  
ATOM 2968  O O    . ARG A 1 2   ? -13.667 -0.561  -4.948  1.00 0.00 ? 2   ARG A O    2  
ATOM 2969  C CB   . ARG A 1 2   ? -14.783 -2.886  -7.305  1.00 0.00 ? 2   ARG A CB   2  
ATOM 2970  C CG   . ARG A 1 2   ? -14.445 -1.859  -8.389  1.00 0.00 ? 2   ARG A CG   2  
ATOM 2971  C CD   . ARG A 1 2   ? -15.688 -1.147  -8.945  1.00 0.00 ? 2   ARG A CD   2  
ATOM 2972  N NE   . ARG A 1 2   ? -16.031 -1.550  -10.312 1.00 0.00 ? 2   ARG A NE   2  
ATOM 2973  C CZ   . ARG A 1 2   ? -16.781 -2.581  -10.708 1.00 0.00 ? 2   ARG A CZ   2  
ATOM 2974  N NH1  . ARG A 1 2   ? -17.296 -3.450  -9.838  1.00 0.00 ? 2   ARG A NH1  2  
ATOM 2975  N NH2  . ARG A 1 2   ? -17.016 -2.741  -12.003 1.00 0.00 ? 2   ARG A NH2  2  
ATOM 2976  H H    . ARG A 1 2   ? -15.684 -0.382  -5.579  1.00 0.00 ? 2   ARG A H    2  
ATOM 2977  H HA   . ARG A 1 2   ? -15.287 -3.163  -5.253  1.00 0.00 ? 2   ARG A HA   2  
ATOM 2978  H HB2  . ARG A 1 2   ? -13.977 -3.614  -7.277  1.00 0.00 ? 2   ARG A HB2  2  
ATOM 2979  H HB3  . ARG A 1 2   ? -15.666 -3.448  -7.601  1.00 0.00 ? 2   ARG A HB3  2  
ATOM 2980  H HG2  . ARG A 1 2   ? -13.746 -1.119  -7.999  1.00 0.00 ? 2   ARG A HG2  2  
ATOM 2981  H HG3  . ARG A 1 2   ? -13.939 -2.392  -9.188  1.00 0.00 ? 2   ARG A HG3  2  
ATOM 2982  H HD2  . ARG A 1 2   ? -16.547 -1.325  -8.309  1.00 0.00 ? 2   ARG A HD2  2  
ATOM 2983  H HD3  . ARG A 1 2   ? -15.489 -0.079  -8.951  1.00 0.00 ? 2   ARG A HD3  2  
ATOM 2984  H HE   . ARG A 1 2   ? -15.635 -0.956  -11.041 1.00 0.00 ? 2   ARG A HE   2  
ATOM 2985  H HH11 . ARG A 1 2   ? -17.069 -3.399  -8.852  1.00 0.00 ? 2   ARG A HH11 2  
ATOM 2986  H HH12 . ARG A 1 2   ? -17.742 -4.292  -10.206 1.00 0.00 ? 2   ARG A HH12 2  
ATOM 2987  H HH21 . ARG A 1 2   ? -16.639 -2.070  -12.676 1.00 0.00 ? 2   ARG A HH21 2  
ATOM 2988  H HH22 . ARG A 1 2   ? -17.570 -3.510  -12.358 1.00 0.00 ? 2   ARG A HH22 2  
ATOM 2989  N N    . HIS A 1 3   ? -12.657 -2.572  -5.266  1.00 0.00 ? 3   HIS A N    2  
ATOM 2990  C CA   . HIS A 1 3   ? -11.245 -2.286  -5.032  1.00 0.00 ? 3   HIS A CA   2  
ATOM 2991  C C    . HIS A 1 3   ? -10.892 -0.833  -5.399  1.00 0.00 ? 3   HIS A C    2  
ATOM 2992  O O    . HIS A 1 3   ? -11.094 -0.409  -6.543  1.00 0.00 ? 3   HIS A O    2  
ATOM 2993  C CB   . HIS A 1 3   ? -10.453 -3.307  -5.865  1.00 0.00 ? 3   HIS A CB   2  
ATOM 2994  C CG   . HIS A 1 3   ? -10.966 -4.733  -5.792  1.00 0.00 ? 3   HIS A CG   2  
ATOM 2995  N ND1  . HIS A 1 3   ? -10.762 -5.682  -4.807  1.00 0.00 ? 3   HIS A ND1  2  
ATOM 2996  C CD2  . HIS A 1 3   ? -11.801 -5.287  -6.726  1.00 0.00 ? 3   HIS A CD2  2  
ATOM 2997  C CE1  . HIS A 1 3   ? -11.464 -6.777  -5.148  1.00 0.00 ? 3   HIS A CE1  2  
ATOM 2998  N NE2  . HIS A 1 3   ? -12.103 -6.587  -6.312  1.00 0.00 ? 3   HIS A NE2  2  
ATOM 2999  H H    . HIS A 1 3   ? -12.858 -3.522  -5.548  1.00 0.00 ? 3   HIS A H    2  
ATOM 3000  H HA   . HIS A 1 3   ? -10.999 -2.460  -3.994  1.00 0.00 ? 3   HIS A HA   2  
ATOM 3001  H HB2  . HIS A 1 3   ? -10.580 -3.011  -6.901  1.00 0.00 ? 3   HIS A HB2  2  
ATOM 3002  H HB3  . HIS A 1 3   ? -9.389  -3.260  -5.631  1.00 0.00 ? 3   HIS A HB3  2  
ATOM 3003  H HD1  . HIS A 1 3   ? -10.188 -5.659  -3.977  1.00 0.00 ? 3   HIS A HD1  2  
ATOM 3004  H HD2  . HIS A 1 3   ? -12.162 -4.791  -7.624  1.00 0.00 ? 3   HIS A HD2  2  
ATOM 3005  H HE1  . HIS A 1 3   ? -11.503 -7.695  -4.574  1.00 0.00 ? 3   HIS A HE1  2  
ATOM 3006  N N    . VAL A 1 4   ? -10.407 -0.052  -4.430  1.00 0.00 ? 4   VAL A N    2  
ATOM 3007  C CA   . VAL A 1 4   ? -10.054 1.349   -4.626  1.00 0.00 ? 4   VAL A CA   2  
ATOM 3008  C C    . VAL A 1 4   ? -8.540  1.461   -4.677  1.00 0.00 ? 4   VAL A C    2  
ATOM 3009  O O    . VAL A 1 4   ? -7.831  0.875   -3.852  1.00 0.00 ? 4   VAL A O    2  
ATOM 3010  C CB   . VAL A 1 4   ? -10.622 2.238   -3.496  1.00 0.00 ? 4   VAL A CB   2  
ATOM 3011  C CG1  . VAL A 1 4   ? -10.371 3.726   -3.776  1.00 0.00 ? 4   VAL A CG1  2  
ATOM 3012  C CG2  . VAL A 1 4   ? -12.148 2.068   -3.357  1.00 0.00 ? 4   VAL A CG2  2  
ATOM 3013  H H    . VAL A 1 4   ? -10.233 -0.415  -3.498  1.00 0.00 ? 4   VAL A H    2  
ATOM 3014  H HA   . VAL A 1 4   ? -10.461 1.683   -5.579  1.00 0.00 ? 4   VAL A HA   2  
ATOM 3015  H HB   . VAL A 1 4   ? -10.114 1.994   -2.552  1.00 0.00 ? 4   VAL A HB   2  
ATOM 3016  H HG11 . VAL A 1 4   ? -10.787 4.317   -2.963  1.00 0.00 ? 4   VAL A HG11 2  
ATOM 3017  H HG12 . VAL A 1 4   ? -9.305  3.942   -3.827  1.00 0.00 ? 4   VAL A HG12 2  
ATOM 3018  H HG13 . VAL A 1 4   ? -10.845 4.041   -4.707  1.00 0.00 ? 4   VAL A HG13 2  
ATOM 3019  H HG21 . VAL A 1 4   ? -12.519 2.706   -2.554  1.00 0.00 ? 4   VAL A HG21 2  
ATOM 3020  H HG22 . VAL A 1 4   ? -12.650 2.323   -4.290  1.00 0.00 ? 4   VAL A HG22 2  
ATOM 3021  H HG23 . VAL A 1 4   ? -12.392 1.039   -3.093  1.00 0.00 ? 4   VAL A HG23 2  
ATOM 3022  N N    . PHE A 1 5   ? -8.055  2.275   -5.609  1.00 0.00 ? 5   PHE A N    2  
ATOM 3023  C CA   . PHE A 1 5   ? -6.705  2.782   -5.601  1.00 0.00 ? 5   PHE A CA   2  
ATOM 3024  C C    . PHE A 1 5   ? -6.740  4.299   -5.738  1.00 0.00 ? 5   PHE A C    2  
ATOM 3025  O O    . PHE A 1 5   ? -7.689  4.875   -6.275  1.00 0.00 ? 5   PHE A O    2  
ATOM 3026  C CB   . PHE A 1 5   ? -5.885  2.094   -6.693  1.00 0.00 ? 5   PHE A CB   2  
ATOM 3027  C CG   . PHE A 1 5   ? -5.470  0.702   -6.271  1.00 0.00 ? 5   PHE A CG   2  
ATOM 3028  C CD1  . PHE A 1 5   ? -6.333  -0.391  -6.476  1.00 0.00 ? 5   PHE A CD1  2  
ATOM 3029  C CD2  . PHE A 1 5   ? -4.245  0.509   -5.609  1.00 0.00 ? 5   PHE A CD2  2  
ATOM 3030  C CE1  . PHE A 1 5   ? -5.946  -1.678  -6.071  1.00 0.00 ? 5   PHE A CE1  2  
ATOM 3031  C CE2  . PHE A 1 5   ? -3.836  -0.783  -5.250  1.00 0.00 ? 5   PHE A CE2  2  
ATOM 3032  C CZ   . PHE A 1 5   ? -4.671  -1.879  -5.517  1.00 0.00 ? 5   PHE A CZ   2  
ATOM 3033  H H    . PHE A 1 5   ? -8.650  2.712   -6.305  1.00 0.00 ? 5   PHE A H    2  
ATOM 3034  H HA   . PHE A 1 5   ? -6.258  2.536   -4.645  1.00 0.00 ? 5   PHE A HA   2  
ATOM 3035  H HB2  . PHE A 1 5   ? -6.458  2.049   -7.621  1.00 0.00 ? 5   PHE A HB2  2  
ATOM 3036  H HB3  . PHE A 1 5   ? -4.989  2.678   -6.900  1.00 0.00 ? 5   PHE A HB3  2  
ATOM 3037  H HD1  . PHE A 1 5   ? -7.292  -0.244  -6.945  1.00 0.00 ? 5   PHE A HD1  2  
ATOM 3038  H HD2  . PHE A 1 5   ? -3.605  1.350   -5.389  1.00 0.00 ? 5   PHE A HD2  2  
ATOM 3039  H HE1  . PHE A 1 5   ? -6.593  -2.523  -6.259  1.00 0.00 ? 5   PHE A HE1  2  
ATOM 3040  H HE2  . PHE A 1 5   ? -2.878  -0.935  -4.780  1.00 0.00 ? 5   PHE A HE2  2  
ATOM 3041  H HZ   . PHE A 1 5   ? -4.321  -2.883  -5.328  1.00 0.00 ? 5   PHE A HZ   2  
ATOM 3042  N N    . LEU A 1 6   ? -5.699  4.943   -5.225  1.00 0.00 ? 6   LEU A N    2  
ATOM 3043  C CA   . LEU A 1 6   ? -5.442  6.369   -5.287  1.00 0.00 ? 6   LEU A CA   2  
ATOM 3044  C C    . LEU A 1 6   ? -4.307  6.606   -6.261  1.00 0.00 ? 6   LEU A C    2  
ATOM 3045  O O    . LEU A 1 6   ? -3.550  5.682   -6.559  1.00 0.00 ? 6   LEU A O    2  
ATOM 3046  C CB   . LEU A 1 6   ? -5.029  6.894   -3.903  1.00 0.00 ? 6   LEU A CB   2  
ATOM 3047  C CG   . LEU A 1 6   ? -6.207  7.300   -3.036  1.00 0.00 ? 6   LEU A CG   2  
ATOM 3048  C CD1  . LEU A 1 6   ? -7.152  6.131   -2.770  1.00 0.00 ? 6   LEU A CD1  2  
ATOM 3049  C CD2  . LEU A 1 6   ? -5.703  7.948   -1.743  1.00 0.00 ? 6   LEU A CD2  2  
ATOM 3050  H H    . LEU A 1 6   ? -5.040  4.395   -4.688  1.00 0.00 ? 6   LEU A H    2  
ATOM 3051  H HA   . LEU A 1 6   ? -6.335  6.883   -5.633  1.00 0.00 ? 6   LEU A HA   2  
ATOM 3052  H HB2  . LEU A 1 6   ? -4.455  6.141   -3.376  1.00 0.00 ? 6   LEU A HB2  2  
ATOM 3053  H HB3  . LEU A 1 6   ? -4.405  7.779   -4.028  1.00 0.00 ? 6   LEU A HB3  2  
ATOM 3054  H HG   . LEU A 1 6   ? -6.734  8.034   -3.617  1.00 0.00 ? 6   LEU A HG   2  
ATOM 3055  H HD11 . LEU A 1 6   ? -7.688  5.909   -3.690  1.00 0.00 ? 6   LEU A HD11 2  
ATOM 3056  H HD12 . LEU A 1 6   ? -6.582  5.257   -2.455  1.00 0.00 ? 6   LEU A HD12 2  
ATOM 3057  H HD13 . LEU A 1 6   ? -7.878  6.385   -2.006  1.00 0.00 ? 6   LEU A HD13 2  
ATOM 3058  H HD21 . LEU A 1 6   ? -6.543  8.224   -1.106  1.00 0.00 ? 6   LEU A HD21 2  
ATOM 3059  H HD22 . LEU A 1 6   ? -5.061  7.245   -1.211  1.00 0.00 ? 6   LEU A HD22 2  
ATOM 3060  H HD23 . LEU A 1 6   ? -5.125  8.840   -1.976  1.00 0.00 ? 6   LEU A HD23 2  
ATOM 3061  N N    . THR A 1 7   ? -4.136  7.851   -6.699  1.00 0.00 ? 7   THR A N    2  
ATOM 3062  C CA   . THR A 1 7   ? -3.022  8.213   -7.554  1.00 0.00 ? 7   THR A CA   2  
ATOM 3063  C C    . THR A 1 7   ? -2.722  9.715   -7.534  1.00 0.00 ? 7   THR A C    2  
ATOM 3064  O O    . THR A 1 7   ? -3.258  10.454  -6.715  1.00 0.00 ? 7   THR A O    2  
ATOM 3065  C CB   . THR A 1 7   ? -3.231  7.606   -8.957  1.00 0.00 ? 7   THR A CB   2  
ATOM 3066  O OG1  . THR A 1 7   ? -1.957  7.416   -9.520  1.00 0.00 ? 7   THR A OG1  2  
ATOM 3067  C CG2  . THR A 1 7   ? -4.118  8.431   -9.898  1.00 0.00 ? 7   THR A CG2  2  
ATOM 3068  H H    . THR A 1 7   ? -4.771  8.567   -6.349  1.00 0.00 ? 7   THR A H    2  
ATOM 3069  H HA   . THR A 1 7   ? -2.153  7.732   -7.106  1.00 0.00 ? 7   THR A HA   2  
ATOM 3070  H HB   . THR A 1 7   ? -3.683  6.620   -8.864  1.00 0.00 ? 7   THR A HB   2  
ATOM 3071  H HG1  . THR A 1 7   ? -1.502  6.783   -8.931  1.00 0.00 ? 7   THR A HG1  2  
ATOM 3072  H HG21 . THR A 1 7   ? -3.690  9.411   -10.104 1.00 0.00 ? 7   THR A HG21 2  
ATOM 3073  H HG22 . THR A 1 7   ? -4.225  7.897   -10.842 1.00 0.00 ? 7   THR A HG22 2  
ATOM 3074  H HG23 . THR A 1 7   ? -5.103  8.557   -9.449  1.00 0.00 ? 7   THR A HG23 2  
ATOM 3075  N N    . GLY A 1 8   ? -1.797  10.137  -8.402  1.00 0.00 ? 8   GLY A N    2  
ATOM 3076  C CA   . GLY A 1 8   ? -1.036  11.379  -8.345  1.00 0.00 ? 8   GLY A CA   2  
ATOM 3077  C C    . GLY A 1 8   ? -0.515  11.672  -6.936  1.00 0.00 ? 8   GLY A C    2  
ATOM 3078  O O    . GLY A 1 8   ? -0.730  12.782  -6.447  1.00 0.00 ? 8   GLY A O    2  
ATOM 3079  H H    . GLY A 1 8   ? -1.483  9.433   -9.058  1.00 0.00 ? 8   GLY A H    2  
ATOM 3080  H HA2  . GLY A 1 8   ? -0.194  11.329  -9.034  1.00 0.00 ? 8   GLY A HA2  2  
ATOM 3081  H HA3  . GLY A 1 8   ? -1.686  12.200  -8.651  1.00 0.00 ? 8   GLY A HA3  2  
ATOM 3082  N N    . PRO A 1 9   ? 0.208   10.743  -6.284  1.00 0.00 ? 9   PRO A N    2  
ATOM 3083  C CA   . PRO A 1 9   ? 0.570   10.909  -4.889  1.00 0.00 ? 9   PRO A CA   2  
ATOM 3084  C C    . PRO A 1 9   ? 1.664   11.976  -4.747  1.00 0.00 ? 9   PRO A C    2  
ATOM 3085  O O    . PRO A 1 9   ? 2.751   11.791  -5.296  1.00 0.00 ? 9   PRO A O    2  
ATOM 3086  C CB   . PRO A 1 9   ? 1.046   9.529   -4.431  1.00 0.00 ? 9   PRO A CB   2  
ATOM 3087  C CG   . PRO A 1 9   ? 1.573   8.868   -5.699  1.00 0.00 ? 9   PRO A CG   2  
ATOM 3088  C CD   . PRO A 1 9   ? 0.673   9.454   -6.785  1.00 0.00 ? 9   PRO A CD   2  
ATOM 3089  H HA   . PRO A 1 9   ? -0.322  11.175  -4.324  1.00 0.00 ? 9   PRO A HA   2  
ATOM 3090  H HB2  . PRO A 1 9   ? 1.812   9.586   -3.657  1.00 0.00 ? 9   PRO A HB2  2  
ATOM 3091  H HB3  . PRO A 1 9   ? 0.184   8.967   -4.074  1.00 0.00 ? 9   PRO A HB3  2  
ATOM 3092  H HG2  . PRO A 1 9   ? 2.606   9.162   -5.876  1.00 0.00 ? 9   PRO A HG2  2  
ATOM 3093  H HG3  . PRO A 1 9   ? 1.488   7.782   -5.644  1.00 0.00 ? 9   PRO A HG3  2  
ATOM 3094  H HD2  . PRO A 1 9   ? 1.227   9.574   -7.716  1.00 0.00 ? 9   PRO A HD2  2  
ATOM 3095  H HD3  . PRO A 1 9   ? -0.170  8.782   -6.929  1.00 0.00 ? 9   PRO A HD3  2  
ATOM 3096  N N    . PRO A 1 10  ? 1.463   13.044  -3.951  1.00 0.00 ? 10  PRO A N    2  
ATOM 3097  C CA   . PRO A 1 10  ? 2.540   13.952  -3.570  1.00 0.00 ? 10  PRO A CA   2  
ATOM 3098  C C    . PRO A 1 10  ? 3.537   13.298  -2.618  1.00 0.00 ? 10  PRO A C    2  
ATOM 3099  O O    . PRO A 1 10  ? 4.502   13.943  -2.213  1.00 0.00 ? 10  PRO A O    2  
ATOM 3100  C CB   . PRO A 1 10  ? 1.841   15.160  -2.939  1.00 0.00 ? 10  PRO A CB   2  
ATOM 3101  C CG   . PRO A 1 10  ? 0.605   14.536  -2.298  1.00 0.00 ? 10  PRO A CG   2  
ATOM 3102  C CD   . PRO A 1 10  ? 0.230   13.439  -3.290  1.00 0.00 ? 10  PRO A CD   2  
ATOM 3103  H HA   . PRO A 1 10  ? 3.108   14.263  -4.436  1.00 0.00 ? 10  PRO A HA   2  
ATOM 3104  H HB2  . PRO A 1 10  ? 2.460   15.674  -2.202  1.00 0.00 ? 10  PRO A HB2  2  
ATOM 3105  H HB3  . PRO A 1 10  ? 1.539   15.846  -3.731  1.00 0.00 ? 10  PRO A HB3  2  
ATOM 3106  H HG2  . PRO A 1 10  ? 0.876   14.087  -1.343  1.00 0.00 ? 10  PRO A HG2  2  
ATOM 3107  H HG3  . PRO A 1 10  ? -0.202  15.257  -2.169  1.00 0.00 ? 10  PRO A HG3  2  
ATOM 3108  H HD2  . PRO A 1 10  ? -0.223  12.607  -2.756  1.00 0.00 ? 10  PRO A HD2  2  
ATOM 3109  H HD3  . PRO A 1 10  ? -0.456  13.843  -4.033  1.00 0.00 ? 10  PRO A HD3  2  
ATOM 3110  N N    . GLY A 1 11  ? 3.312   12.042  -2.228  1.00 0.00 ? 11  GLY A N    2  
ATOM 3111  C CA   . GLY A 1 11  ? 4.071   11.395  -1.188  1.00 0.00 ? 11  GLY A CA   2  
ATOM 3112  C C    . GLY A 1 11  ? 3.376   11.692  0.126   1.00 0.00 ? 11  GLY A C    2  
ATOM 3113  O O    . GLY A 1 11  ? 2.870   10.792  0.788   1.00 0.00 ? 11  GLY A O    2  
ATOM 3114  H H    . GLY A 1 11  ? 2.498   11.551  -2.552  1.00 0.00 ? 11  GLY A H    2  
ATOM 3115  H HA2  . GLY A 1 11  ? 4.110   10.318  -1.359  1.00 0.00 ? 11  GLY A HA2  2  
ATOM 3116  H HA3  . GLY A 1 11  ? 5.078   11.811  -1.188  1.00 0.00 ? 11  GLY A HA3  2  
ATOM 3117  N N    . VAL A 1 12  ? 3.218   12.968  0.456   1.00 0.00 ? 12  VAL A N    2  
ATOM 3118  C CA   . VAL A 1 12  ? 2.813   13.443  1.738   1.00 0.00 ? 12  VAL A CA   2  
ATOM 3119  C C    . VAL A 1 12  ? 1.465   14.122  1.568   1.00 0.00 ? 12  VAL A C    2  
ATOM 3120  O O    . VAL A 1 12  ? 1.284   15.234  1.070   1.00 0.00 ? 12  VAL A O    2  
ATOM 3121  C CB   . VAL A 1 12  ? 3.942   14.289  2.324   1.00 0.00 ? 12  VAL A CB   2  
ATOM 3122  C CG1  . VAL A 1 12  ? 5.173   13.383  2.499   1.00 0.00 ? 12  VAL A CG1  2  
ATOM 3123  C CG2  . VAL A 1 12  ? 4.274   15.546  1.512   1.00 0.00 ? 12  VAL A CG2  2  
ATOM 3124  H H    . VAL A 1 12  ? 3.545   13.739  -0.086  1.00 0.00 ? 12  VAL A H    2  
ATOM 3125  H HA   . VAL A 1 12  ? 2.686   12.578  2.399   1.00 0.00 ? 12  VAL A HA   2  
ATOM 3126  H HB   . VAL A 1 12  ? 3.611   14.617  3.292   1.00 0.00 ? 12  VAL A HB   2  
ATOM 3127  H HG11 . VAL A 1 12  ? 5.920   13.889  3.108   1.00 0.00 ? 12  VAL A HG11 2  
ATOM 3128  H HG12 . VAL A 1 12  ? 4.878   12.448  2.987   1.00 0.00 ? 12  VAL A HG12 2  
ATOM 3129  H HG13 . VAL A 1 12  ? 5.612   13.137  1.531   1.00 0.00 ? 12  VAL A HG13 2  
ATOM 3130  H HG21 . VAL A 1 12  ? 3.392   16.188  1.475   1.00 0.00 ? 12  VAL A HG21 2  
ATOM 3131  H HG22 . VAL A 1 12  ? 5.070   16.093  2.010   1.00 0.00 ? 12  VAL A HG22 2  
ATOM 3132  H HG23 . VAL A 1 12  ? 4.574   15.293  0.497   1.00 0.00 ? 12  VAL A HG23 2  
ATOM 3133  N N    . GLY A 1 13  ? 0.483   13.320  1.894   1.00 0.00 ? 13  GLY A N    2  
ATOM 3134  C CA   . GLY A 1 13  ? -0.872  13.744  2.165   1.00 0.00 ? 13  GLY A CA   2  
ATOM 3135  C C    . GLY A 1 13  ? -1.802  12.580  1.889   1.00 0.00 ? 13  GLY A C    2  
ATOM 3136  O O    . GLY A 1 13  ? -2.634  12.217  2.713   1.00 0.00 ? 13  GLY A O    2  
ATOM 3137  H H    . GLY A 1 13  ? 0.840   12.418  2.173   1.00 0.00 ? 13  GLY A H    2  
ATOM 3138  H HA2  . GLY A 1 13  ? -0.963  14.042  3.208   1.00 0.00 ? 13  GLY A HA2  2  
ATOM 3139  H HA3  . GLY A 1 13  ? -1.079  14.597  1.519   1.00 0.00 ? 13  GLY A HA3  2  
ATOM 3140  N N    . LYS A 1 14  ? -1.567  11.929  0.752   1.00 0.00 ? 14  LYS A N    2  
ATOM 3141  C CA   . LYS A 1 14  ? -2.176  10.675  0.335   1.00 0.00 ? 14  LYS A CA   2  
ATOM 3142  C C    . LYS A 1 14  ? -2.163  9.606   1.439   1.00 0.00 ? 14  LYS A C    2  
ATOM 3143  O O    . LYS A 1 14  ? -3.218  9.050   1.720   1.00 0.00 ? 14  LYS A O    2  
ATOM 3144  C CB   . LYS A 1 14  ? -1.538  10.252  -1.000  1.00 0.00 ? 14  LYS A CB   2  
ATOM 3145  C CG   . LYS A 1 14  ? -0.009  10.053  -0.956  1.00 0.00 ? 14  LYS A CG   2  
ATOM 3146  C CD   . LYS A 1 14  ? 0.339   8.569   -0.916  1.00 0.00 ? 14  LYS A CD   2  
ATOM 3147  C CE   . LYS A 1 14  ? 1.769   8.342   -0.411  1.00 0.00 ? 14  LYS A CE   2  
ATOM 3148  N NZ   . LYS A 1 14  ? 2.134   6.910   -0.423  1.00 0.00 ? 14  LYS A NZ   2  
ATOM 3149  H H    . LYS A 1 14  ? -0.826  12.308  0.184   1.00 0.00 ? 14  LYS A H    2  
ATOM 3150  H HA   . LYS A 1 14  ? -3.229  10.865  0.136   1.00 0.00 ? 14  LYS A HA   2  
ATOM 3151  H HB2  . LYS A 1 14  ? -2.043  9.359   -1.366  1.00 0.00 ? 14  LYS A HB2  2  
ATOM 3152  H HB3  . LYS A 1 14  ? -1.740  11.039  -1.722  1.00 0.00 ? 14  LYS A HB3  2  
ATOM 3153  H HG2  . LYS A 1 14  ? 0.443   10.499  -1.840  1.00 0.00 ? 14  LYS A HG2  2  
ATOM 3154  H HG3  . LYS A 1 14  ? 0.416   10.548  -0.085  1.00 0.00 ? 14  LYS A HG3  2  
ATOM 3155  H HD2  . LYS A 1 14  ? -0.416  8.074   -0.302  1.00 0.00 ? 14  LYS A HD2  2  
ATOM 3156  H HD3  . LYS A 1 14  ? 0.282   8.164   -1.921  1.00 0.00 ? 14  LYS A HD3  2  
ATOM 3157  H HE2  . LYS A 1 14  ? 2.474   8.887   -1.043  1.00 0.00 ? 14  LYS A HE2  2  
ATOM 3158  H HE3  . LYS A 1 14  ? 1.890   8.759   0.593   1.00 0.00 ? 14  LYS A HE3  2  
ATOM 3159  H HZ1  . LYS A 1 14  ? 1.502   6.332   0.135   1.00 0.00 ? 14  LYS A HZ1  2  
ATOM 3160  H HZ2  . LYS A 1 14  ? 2.068   6.526   -1.363  1.00 0.00 ? 14  LYS A HZ2  2  
ATOM 3161  H HZ3  . LYS A 1 14  ? 3.091   6.792   -0.106  1.00 0.00 ? 14  LYS A HZ3  2  
ATOM 3162  N N    . THR A 1 15  ? -1.026  9.366   2.102   1.00 0.00 ? 15  THR A N    2  
ATOM 3163  C CA   . THR A 1 15  ? -0.937  8.405   3.199   1.00 0.00 ? 15  THR A CA   2  
ATOM 3164  C C    . THR A 1 15  ? -1.893  8.839   4.319   1.00 0.00 ? 15  THR A C    2  
ATOM 3165  O O    . THR A 1 15  ? -2.750  8.061   4.728   1.00 0.00 ? 15  THR A O    2  
ATOM 3166  C CB   . THR A 1 15  ? 0.536   8.287   3.649   1.00 0.00 ? 15  THR A CB   2  
ATOM 3167  O OG1  . THR A 1 15  ? 1.317   7.873   2.548   1.00 0.00 ? 15  THR A OG1  2  
ATOM 3168  C CG2  . THR A 1 15  ? 0.829   7.314   4.791   1.00 0.00 ? 15  THR A CG2  2  
ATOM 3169  H H    . THR A 1 15  ? -0.172  9.840   1.867   1.00 0.00 ? 15  THR A H    2  
ATOM 3170  H HA   . THR A 1 15  ? -1.270  7.435   2.820   1.00 0.00 ? 15  THR A HA   2  
ATOM 3171  H HB   . THR A 1 15  ? 0.882   9.276   3.953   1.00 0.00 ? 15  THR A HB   2  
ATOM 3172  H HG1  . THR A 1 15  ? 1.147   6.910   2.407   1.00 0.00 ? 15  THR A HG1  2  
ATOM 3173  H HG21 . THR A 1 15  ? 0.402   6.331   4.584   1.00 0.00 ? 15  THR A HG21 2  
ATOM 3174  H HG22 . THR A 1 15  ? 1.909   7.214   4.939   1.00 0.00 ? 15  THR A HG22 2  
ATOM 3175  H HG23 . THR A 1 15  ? 0.403   7.699   5.714   1.00 0.00 ? 15  THR A HG23 2  
ATOM 3176  N N    . THR A 1 16  ? -1.806  10.086  4.792   1.00 0.00 ? 16  THR A N    2  
ATOM 3177  C CA   . THR A 1 16  ? -2.635  10.571  5.890   1.00 0.00 ? 16  THR A CA   2  
ATOM 3178  C C    . THR A 1 16  ? -4.130  10.481  5.556   1.00 0.00 ? 16  THR A C    2  
ATOM 3179  O O    . THR A 1 16  ? -4.891  10.057  6.418   1.00 0.00 ? 16  THR A O    2  
ATOM 3180  C CB   . THR A 1 16  ? -2.186  11.983  6.273   1.00 0.00 ? 16  THR A CB   2  
ATOM 3181  O OG1  . THR A 1 16  ? -0.795  11.950  6.553   1.00 0.00 ? 16  THR A OG1  2  
ATOM 3182  C CG2  . THR A 1 16  ? -2.932  12.533  7.493   1.00 0.00 ? 16  THR A CG2  2  
ATOM 3183  H H    . THR A 1 16  ? -1.117  10.730  4.434   1.00 0.00 ? 16  THR A H    2  
ATOM 3184  H HA   . THR A 1 16  ? -2.459  9.929   6.754   1.00 0.00 ? 16  THR A HA   2  
ATOM 3185  H HB   . THR A 1 16  ? -2.357  12.643  5.421   1.00 0.00 ? 16  THR A HB   2  
ATOM 3186  H HG1  . THR A 1 16  ? -0.657  11.410  7.357   1.00 0.00 ? 16  THR A HG1  2  
ATOM 3187  H HG21 . THR A 1 16  ? -2.872  11.836  8.331   1.00 0.00 ? 16  THR A HG21 2  
ATOM 3188  H HG22 . THR A 1 16  ? -2.507  13.491  7.790   1.00 0.00 ? 16  THR A HG22 2  
ATOM 3189  H HG23 . THR A 1 16  ? -3.982  12.685  7.243   1.00 0.00 ? 16  THR A HG23 2  
ATOM 3190  N N    . LEU A 1 17  ? -4.572  10.794  4.332   1.00 0.00 ? 17  LEU A N    2  
ATOM 3191  C CA   . LEU A 1 17  ? -5.974  10.608  3.936   1.00 0.00 ? 17  LEU A CA   2  
ATOM 3192  C C    . LEU A 1 17  ? -6.399  9.176   4.245   1.00 0.00 ? 17  LEU A C    2  
ATOM 3193  O O    . LEU A 1 17  ? -7.368  8.949   4.966   1.00 0.00 ? 17  LEU A O    2  
ATOM 3194  C CB   . LEU A 1 17  ? -6.171  10.885  2.433   1.00 0.00 ? 17  LEU A CB   2  
ATOM 3195  C CG   . LEU A 1 17  ? -6.380  12.345  1.978   1.00 0.00 ? 17  LEU A CG   2  
ATOM 3196  C CD1  . LEU A 1 17  ? -5.916  13.426  2.961   1.00 0.00 ? 17  LEU A CD1  2  
ATOM 3197  C CD2  . LEU A 1 17  ? -5.650  12.542  0.646   1.00 0.00 ? 17  LEU A CD2  2  
ATOM 3198  H H    . LEU A 1 17  ? -3.913  11.144  3.645   1.00 0.00 ? 17  LEU A H    2  
ATOM 3199  H HA   . LEU A 1 17  ? -6.608  11.269  4.525   1.00 0.00 ? 17  LEU A HA   2  
ATOM 3200  H HB2  . LEU A 1 17  ? -5.329  10.447  1.900   1.00 0.00 ? 17  LEU A HB2  2  
ATOM 3201  H HB3  . LEU A 1 17  ? -7.054  10.332  2.104   1.00 0.00 ? 17  LEU A HB3  2  
ATOM 3202  H HG   . LEU A 1 17  ? -7.448  12.494  1.811   1.00 0.00 ? 17  LEU A HG   2  
ATOM 3203  H HD11 . LEU A 1 17  ? -6.507  13.357  3.871   1.00 0.00 ? 17  LEU A HD11 2  
ATOM 3204  H HD12 . LEU A 1 17  ? -4.863  13.306  3.207   1.00 0.00 ? 17  LEU A HD12 2  
ATOM 3205  H HD13 . LEU A 1 17  ? -6.070  14.415  2.537   1.00 0.00 ? 17  LEU A HD13 2  
ATOM 3206  H HD21 . LEU A 1 17  ? -6.000  11.795  -0.067  1.00 0.00 ? 17  LEU A HD21 2  
ATOM 3207  H HD22 . LEU A 1 17  ? -5.852  13.527  0.242   1.00 0.00 ? 17  LEU A HD22 2  
ATOM 3208  H HD23 . LEU A 1 17  ? -4.578  12.443  0.794   1.00 0.00 ? 17  LEU A HD23 2  
ATOM 3209  N N    . ILE A 1 18  ? -5.626  8.215   3.748   1.00 0.00 ? 18  ILE A N    2  
ATOM 3210  C CA   . ILE A 1 18  ? -5.926  6.801   3.869   1.00 0.00 ? 18  ILE A CA   2  
ATOM 3211  C C    . ILE A 1 18  ? -5.853  6.341   5.346   1.00 0.00 ? 18  ILE A C    2  
ATOM 3212  O O    . ILE A 1 18  ? -6.500  5.358   5.722   1.00 0.00 ? 18  ILE A O    2  
ATOM 3213  C CB   . ILE A 1 18  ? -4.893  6.047   2.981   1.00 0.00 ? 18  ILE A CB   2  
ATOM 3214  C CG1  . ILE A 1 18  ? -5.168  6.254   1.478   1.00 0.00 ? 18  ILE A CG1  2  
ATOM 3215  C CG2  . ILE A 1 18  ? -4.696  4.558   3.325   1.00 0.00 ? 18  ILE A CG2  2  
ATOM 3216  C CD1  . ILE A 1 18  ? -6.256  5.337   0.924   1.00 0.00 ? 18  ILE A CD1  2  
ATOM 3217  H H    . ILE A 1 18  ? -4.808  8.470   3.208   1.00 0.00 ? 18  ILE A H    2  
ATOM 3218  H HA   . ILE A 1 18  ? -6.962  6.713   3.483   1.00 0.00 ? 18  ILE A HA   2  
ATOM 3219  H HB   . ILE A 1 18  ? -3.921  6.504   3.164   1.00 0.00 ? 18  ILE A HB   2  
ATOM 3220  H HG12 . ILE A 1 18  ? -5.457  7.289   1.292   1.00 0.00 ? 18  ILE A HG12 2  
ATOM 3221  H HG13 . ILE A 1 18  ? -4.247  6.066   0.923   1.00 0.00 ? 18  ILE A HG13 2  
ATOM 3222  H HG21 . ILE A 1 18  ? -4.219  4.471   4.300   1.00 0.00 ? 18  ILE A HG21 2  
ATOM 3223  H HG22 . ILE A 1 18  ? -5.650  4.032   3.330   1.00 0.00 ? 18  ILE A HG22 2  
ATOM 3224  H HG23 . ILE A 1 18  ? -4.030  4.099   2.597   1.00 0.00 ? 18  ILE A HG23 2  
ATOM 3225  H HD11 . ILE A 1 18  ? -7.114  5.335   1.599   1.00 0.00 ? 18  ILE A HD11 2  
ATOM 3226  H HD12 . ILE A 1 18  ? -6.564  5.688   -0.057  1.00 0.00 ? 18  ILE A HD12 2  
ATOM 3227  H HD13 . ILE A 1 18  ? -5.845  4.334   0.809   1.00 0.00 ? 18  ILE A HD13 2  
ATOM 3228  N N    . HIS A 1 19  ? -5.076  7.004   6.213   1.00 0.00 ? 19  HIS A N    2  
ATOM 3229  C CA   . HIS A 1 19  ? -5.123  6.757   7.655   1.00 0.00 ? 19  HIS A CA   2  
ATOM 3230  C C    . HIS A 1 19  ? -6.482  7.191   8.198   1.00 0.00 ? 19  HIS A C    2  
ATOM 3231  O O    . HIS A 1 19  ? -7.206  6.359   8.757   1.00 0.00 ? 19  HIS A O    2  
ATOM 3232  C CB   . HIS A 1 19  ? -4.002  7.471   8.415   1.00 0.00 ? 19  HIS A CB   2  
ATOM 3233  C CG   . HIS A 1 19  ? -2.671  6.778   8.349   1.00 0.00 ? 19  HIS A CG   2  
ATOM 3234  N ND1  . HIS A 1 19  ? -2.226  5.809   9.217   1.00 0.00 ? 19  HIS A ND1  2  
ATOM 3235  C CD2  . HIS A 1 19  ? -1.624  7.115   7.541   1.00 0.00 ? 19  HIS A CD2  2  
ATOM 3236  C CE1  . HIS A 1 19  ? -0.936  5.581   8.935   1.00 0.00 ? 19  HIS A CE1  2  
ATOM 3237  N NE2  . HIS A 1 19  ? -0.531  6.331   7.900   1.00 0.00 ? 19  HIS A NE2  2  
ATOM 3238  H H    . HIS A 1 19  ? -4.494  7.756   5.858   1.00 0.00 ? 19  HIS A H    2  
ATOM 3239  H HA   . HIS A 1 19  ? -5.010  5.688   7.833   1.00 0.00 ? 19  HIS A HA   2  
ATOM 3240  H HB2  . HIS A 1 19  ? -3.896  8.495   8.066   1.00 0.00 ? 19  HIS A HB2  2  
ATOM 3241  H HB3  . HIS A 1 19  ? -4.278  7.515   9.468   1.00 0.00 ? 19  HIS A HB3  2  
ATOM 3242  H HD1  . HIS A 1 19  ? -2.708  5.418   10.025  1.00 0.00 ? 19  HIS A HD1  2  
ATOM 3243  H HD2  . HIS A 1 19  ? -1.612  7.904   6.815   1.00 0.00 ? 19  HIS A HD2  2  
ATOM 3244  H HE1  . HIS A 1 19  ? -0.300  4.936   9.516   1.00 0.00 ? 19  HIS A HE1  2  
ATOM 3245  N N    . LYS A 1 20  ? -6.861  8.461   7.999   1.00 0.00 ? 20  LYS A N    2  
ATOM 3246  C CA   . LYS A 1 20  ? -8.127  8.998   8.506   1.00 0.00 ? 20  LYS A CA   2  
ATOM 3247  C C    . LYS A 1 20  ? -9.348  8.327   7.875   1.00 0.00 ? 20  LYS A C    2  
ATOM 3248  O O    . LYS A 1 20  ? -10.456 8.519   8.370   1.00 0.00 ? 20  LYS A O    2  
ATOM 3249  C CB   . LYS A 1 20  ? -8.215  10.522  8.336   1.00 0.00 ? 20  LYS A CB   2  
ATOM 3250  C CG   . LYS A 1 20  ? -7.376  11.302  9.370   1.00 0.00 ? 20  LYS A CG   2  
ATOM 3251  C CD   . LYS A 1 20  ? -5.942  11.605  8.952   1.00 0.00 ? 20  LYS A CD   2  
ATOM 3252  C CE   . LYS A 1 20  ? -5.089  12.034  10.148  1.00 0.00 ? 20  LYS A CE   2  
ATOM 3253  N NZ   . LYS A 1 20  ? -4.513  10.868  10.851  1.00 0.00 ? 20  LYS A NZ   2  
ATOM 3254  H H    . LYS A 1 20  ? -6.259  9.059   7.438   1.00 0.00 ? 20  LYS A H    2  
ATOM 3255  H HA   . LYS A 1 20  ? -8.167  8.783   9.570   1.00 0.00 ? 20  LYS A HA   2  
ATOM 3256  H HB2  . LYS A 1 20  ? -7.973  10.781  7.306   1.00 0.00 ? 20  LYS A HB2  2  
ATOM 3257  H HB3  . LYS A 1 20  ? -9.252  10.816  8.504   1.00 0.00 ? 20  LYS A HB3  2  
ATOM 3258  H HG2  . LYS A 1 20  ? -7.875  12.247  9.586   1.00 0.00 ? 20  LYS A HG2  2  
ATOM 3259  H HG3  . LYS A 1 20  ? -7.325  10.738  10.293  1.00 0.00 ? 20  LYS A HG3  2  
ATOM 3260  H HD2  . LYS A 1 20  ? -5.496  10.711  8.543   1.00 0.00 ? 20  LYS A HD2  2  
ATOM 3261  H HD3  . LYS A 1 20  ? -5.960  12.397  8.203   1.00 0.00 ? 20  LYS A HD3  2  
ATOM 3262  H HE2  . LYS A 1 20  ? -4.273  12.672  9.802   1.00 0.00 ? 20  LYS A HE2  2  
ATOM 3263  H HE3  . LYS A 1 20  ? -5.698  12.618  10.839  1.00 0.00 ? 20  LYS A HE3  2  
ATOM 3264  H HZ1  . LYS A 1 20  ? -5.208  10.168  11.085  1.00 0.00 ? 20  LYS A HZ1  2  
ATOM 3265  H HZ2  . LYS A 1 20  ? -3.776  10.418  10.313  1.00 0.00 ? 20  LYS A HZ2  2  
ATOM 3266  H HZ3  . LYS A 1 20  ? -4.069  11.169  11.714  1.00 0.00 ? 20  LYS A HZ3  2  
ATOM 3267  N N    . ALA A 1 21  ? -9.171  7.538   6.818   1.00 0.00 ? 21  ALA A N    2  
ATOM 3268  C CA   . ALA A 1 21  ? -10.192 6.696   6.233   1.00 0.00 ? 21  ALA A CA   2  
ATOM 3269  C C    . ALA A 1 21  ? -10.439 5.440   7.041   1.00 0.00 ? 21  ALA A C    2  
ATOM 3270  O O    . ALA A 1 21  ? -11.576 4.979   7.151   1.00 0.00 ? 21  ALA A O    2  
ATOM 3271  C CB   . ALA A 1 21  ? -9.684  6.259   4.869   1.00 0.00 ? 21  ALA A CB   2  
ATOM 3272  H H    . ALA A 1 21  ? -8.274  7.549   6.356   1.00 0.00 ? 21  ALA A H    2  
ATOM 3273  H HA   . ALA A 1 21  ? -11.123 7.253   6.145   1.00 0.00 ? 21  ALA A HA   2  
ATOM 3274  H HB1  . ALA A 1 21  ? -9.502  7.148   4.280   1.00 0.00 ? 21  ALA A HB1  2  
ATOM 3275  H HB2  . ALA A 1 21  ? -8.766  5.689   4.958   1.00 0.00 ? 21  ALA A HB2  2  
ATOM 3276  H HB3  . ALA A 1 21  ? -10.416 5.615   4.393   1.00 0.00 ? 21  ALA A HB3  2  
ATOM 3277  N N    . SER A 1 22  ? -9.357  4.840   7.529   1.00 0.00 ? 22  SER A N    2  
ATOM 3278  C CA   . SER A 1 22  ? -9.408  3.545   8.166   1.00 0.00 ? 22  SER A CA   2  
ATOM 3279  C C    . SER A 1 22  ? -10.181 3.674   9.470   1.00 0.00 ? 22  SER A C    2  
ATOM 3280  O O    . SER A 1 22  ? -11.096 2.892   9.716   1.00 0.00 ? 22  SER A O    2  
ATOM 3281  C CB   . SER A 1 22  ? -7.993  3.011   8.340   1.00 0.00 ? 22  SER A CB   2  
ATOM 3282  O OG   . SER A 1 22  ? -7.183  3.759   9.235   1.00 0.00 ? 22  SER A OG   2  
ATOM 3283  H H    . SER A 1 22  ? -8.469  5.318   7.453   1.00 0.00 ? 22  SER A H    2  
ATOM 3284  H HA   . SER A 1 22  ? -9.924  2.834   7.513   1.00 0.00 ? 22  SER A HA   2  
ATOM 3285  H HB2  . SER A 1 22  ? -8.078  1.992   8.708   1.00 0.00 ? 22  SER A HB2  2  
ATOM 3286  H HB3  . SER A 1 22  ? -7.517  2.982   7.361   1.00 0.00 ? 22  SER A HB3  2  
ATOM 3287  H HG   . SER A 1 22  ? -7.230  4.713   9.012   1.00 0.00 ? 22  SER A HG   2  
ATOM 3288  N N    . GLU A 1 23  ? -9.842  4.691   10.263  1.00 0.00 ? 23  GLU A N    2  
ATOM 3289  C CA   . GLU A 1 23  ? -10.380 4.965   11.584  1.00 0.00 ? 23  GLU A CA   2  
ATOM 3290  C C    . GLU A 1 23  ? -11.906 5.045   11.582  1.00 0.00 ? 23  GLU A C    2  
ATOM 3291  O O    . GLU A 1 23  ? -12.547 4.469   12.453  1.00 0.00 ? 23  GLU A O    2  
ATOM 3292  C CB   . GLU A 1 23  ? -9.683  6.188   12.171  1.00 0.00 ? 23  GLU A CB   2  
ATOM 3293  C CG   . GLU A 1 23  ? -9.982  7.464   11.403  1.00 0.00 ? 23  GLU A CG   2  
ATOM 3294  C CD   . GLU A 1 23  ? -9.485  8.715   12.120  1.00 0.00 ? 23  GLU A CD   2  
ATOM 3295  O OE1  . GLU A 1 23  ? -8.275  9.021   12.026  1.00 0.00 ? 23  GLU A OE1  2  
ATOM 3296  O OE2  . GLU A 1 23  ? -10.309 9.389   12.777  1.00 0.00 ? 23  GLU A OE2  2  
ATOM 3297  H H    . GLU A 1 23  ? -9.085  5.293   9.970   1.00 0.00 ? 23  GLU A H    2  
ATOM 3298  H HA   . GLU A 1 23  ? -10.111 4.160   12.241  1.00 0.00 ? 23  GLU A HA   2  
ATOM 3299  H HB2  . GLU A 1 23  ? -10.017 6.297   13.194  1.00 0.00 ? 23  GLU A HB2  2  
ATOM 3300  H HB3  . GLU A 1 23  ? -8.610  6.014   12.143  1.00 0.00 ? 23  GLU A HB3  2  
ATOM 3301  H HG2  . GLU A 1 23  ? -9.522  7.382   10.425  1.00 0.00 ? 23  GLU A HG2  2  
ATOM 3302  H HG3  . GLU A 1 23  ? -11.053 7.523   11.287  1.00 0.00 ? 23  GLU A HG3  2  
ATOM 3303  N N    . VAL A 1 24  ? -12.486 5.658   10.551  1.00 0.00 ? 24  VAL A N    2  
ATOM 3304  C CA   . VAL A 1 24  ? -13.937 5.803   10.380  1.00 0.00 ? 24  VAL A CA   2  
ATOM 3305  C C    . VAL A 1 24  ? -14.584 4.425   10.395  1.00 0.00 ? 24  VAL A C    2  
ATOM 3306  O O    . VAL A 1 24  ? -15.489 4.137   11.182  1.00 0.00 ? 24  VAL A O    2  
ATOM 3307  C CB   . VAL A 1 24  ? -14.209 6.540   9.049   1.00 0.00 ? 24  VAL A CB   2  
ATOM 3308  C CG1  . VAL A 1 24  ? -15.686 6.640   8.653   1.00 0.00 ? 24  VAL A CG1  2  
ATOM 3309  C CG2  . VAL A 1 24  ? -13.628 7.952   9.117   1.00 0.00 ? 24  VAL A CG2  2  
ATOM 3310  H H    . VAL A 1 24  ? -11.843 6.112   9.906   1.00 0.00 ? 24  VAL A H    2  
ATOM 3311  H HA   . VAL A 1 24  ? -14.354 6.368   11.219  1.00 0.00 ? 24  VAL A HA   2  
ATOM 3312  H HB   . VAL A 1 24  ? -13.700 6.000   8.252   1.00 0.00 ? 24  VAL A HB   2  
ATOM 3313  H HG11 . VAL A 1 24  ? -15.776 7.142   7.689   1.00 0.00 ? 24  VAL A HG11 2  
ATOM 3314  H HG12 . VAL A 1 24  ? -16.135 5.651   8.566   1.00 0.00 ? 24  VAL A HG12 2  
ATOM 3315  H HG13 . VAL A 1 24  ? -16.227 7.218   9.398   1.00 0.00 ? 24  VAL A HG13 2  
ATOM 3316  H HG21 . VAL A 1 24  ? -14.139 8.523   9.890   1.00 0.00 ? 24  VAL A HG21 2  
ATOM 3317  H HG22 . VAL A 1 24  ? -12.577 7.902   9.374   1.00 0.00 ? 24  VAL A HG22 2  
ATOM 3318  H HG23 . VAL A 1 24  ? -13.730 8.449   8.153   1.00 0.00 ? 24  VAL A HG23 2  
ATOM 3319  N N    . LEU A 1 25  ? -14.099 3.545   9.525   1.00 0.00 ? 25  LEU A N    2  
ATOM 3320  C CA   . LEU A 1 25  ? -14.596 2.207   9.399   1.00 0.00 ? 25  LEU A CA   2  
ATOM 3321  C C    . LEU A 1 25  ? -14.209 1.400   10.649  1.00 0.00 ? 25  LEU A C    2  
ATOM 3322  O O    . LEU A 1 25  ? -14.989 0.572   11.093  1.00 0.00 ? 25  LEU A O    2  
ATOM 3323  C CB   . LEU A 1 25  ? -13.978 1.593   8.150   1.00 0.00 ? 25  LEU A CB   2  
ATOM 3324  C CG   . LEU A 1 25  ? -13.982 2.369   6.823   1.00 0.00 ? 25  LEU A CG   2  
ATOM 3325  C CD1  . LEU A 1 25  ? -13.158 1.597   5.787   1.00 0.00 ? 25  LEU A CD1  2  
ATOM 3326  C CD2  . LEU A 1 25  ? -15.401 2.598   6.299   1.00 0.00 ? 25  LEU A CD2  2  
ATOM 3327  H H    . LEU A 1 25  ? -13.303 3.765   8.947   1.00 0.00 ? 25  LEU A H    2  
ATOM 3328  H HA   . LEU A 1 25  ? -15.677 2.231   9.282   1.00 0.00 ? 25  LEU A HA   2  
ATOM 3329  H HB2  . LEU A 1 25  ? -12.953 1.404   8.448   1.00 0.00 ? 25  LEU A HB2  2  
ATOM 3330  H HB3  . LEU A 1 25  ? -14.489 0.657   7.961   1.00 0.00 ? 25  LEU A HB3  2  
ATOM 3331  H HG   . LEU A 1 25  ? -13.507 3.333   6.967   1.00 0.00 ? 25  LEU A HG   2  
ATOM 3332  H HD11 . LEU A 1 25  ? -12.132 1.492   6.147   1.00 0.00 ? 25  LEU A HD11 2  
ATOM 3333  H HD12 . LEU A 1 25  ? -13.593 0.610   5.621   1.00 0.00 ? 25  LEU A HD12 2  
ATOM 3334  H HD13 . LEU A 1 25  ? -13.136 2.135   4.841   1.00 0.00 ? 25  LEU A HD13 2  
ATOM 3335  H HD21 . LEU A 1 25  ? -15.382 3.126   5.347   1.00 0.00 ? 25  LEU A HD21 2  
ATOM 3336  H HD22 . LEU A 1 25  ? -15.904 1.641   6.154   1.00 0.00 ? 25  LEU A HD22 2  
ATOM 3337  H HD23 . LEU A 1 25  ? -15.963 3.200   7.013   1.00 0.00 ? 25  LEU A HD23 2  
ATOM 3338  N N    . LYS A 1 26  ? -13.029 1.598   11.251  1.00 0.00 ? 26  LYS A N    2  
ATOM 3339  C CA   . LYS A 1 26  ? -12.624 0.884   12.474  1.00 0.00 ? 26  LYS A CA   2  
ATOM 3340  C C    . LYS A 1 26  ? -13.604 1.195   13.607  1.00 0.00 ? 26  LYS A C    2  
ATOM 3341  O O    . LYS A 1 26  ? -14.006 0.283   14.333  1.00 0.00 ? 26  LYS A O    2  
ATOM 3342  C CB   . LYS A 1 26  ? -11.193 1.275   12.866  1.00 0.00 ? 26  LYS A CB   2  
ATOM 3343  C CG   . LYS A 1 26  ? -10.170 0.653   11.904  1.00 0.00 ? 26  LYS A CG   2  
ATOM 3344  C CD   . LYS A 1 26  ? -8.763  1.235   12.074  1.00 0.00 ? 26  LYS A CD   2  
ATOM 3345  C CE   . LYS A 1 26  ? -7.789  0.619   11.058  1.00 0.00 ? 26  LYS A CE   2  
ATOM 3346  N NZ   . LYS A 1 26  ? -6.545  1.407   10.913  1.00 0.00 ? 26  LYS A NZ   2  
ATOM 3347  H H    . LYS A 1 26  ? -12.400 2.301   10.868  1.00 0.00 ? 26  LYS A H    2  
ATOM 3348  H HA   . LYS A 1 26  ? -12.639 -0.199  12.297  1.00 0.00 ? 26  LYS A HA   2  
ATOM 3349  H HB2  . LYS A 1 26  ? -11.107 2.358   12.861  1.00 0.00 ? 26  LYS A HB2  2  
ATOM 3350  H HB3  . LYS A 1 26  ? -10.988 0.916   13.876  1.00 0.00 ? 26  LYS A HB3  2  
ATOM 3351  H HG2  . LYS A 1 26  ? -10.161 -0.418  12.064  1.00 0.00 ? 26  LYS A HG2  2  
ATOM 3352  H HG3  . LYS A 1 26  ? -10.483 0.813   10.880  1.00 0.00 ? 26  LYS A HG3  2  
ATOM 3353  H HD2  . LYS A 1 26  ? -8.817  2.309   11.906  1.00 0.00 ? 26  LYS A HD2  2  
ATOM 3354  H HD3  . LYS A 1 26  ? -8.410  1.045   13.089  1.00 0.00 ? 26  LYS A HD3  2  
ATOM 3355  H HE2  . LYS A 1 26  ? -7.540  -0.396  11.374  1.00 0.00 ? 26  LYS A HE2  2  
ATOM 3356  H HE3  . LYS A 1 26  ? -8.284  0.563   10.088  1.00 0.00 ? 26  LYS A HE3  2  
ATOM 3357  H HZ1  . LYS A 1 26  ? -5.976  1.351   11.759  1.00 0.00 ? 26  LYS A HZ1  2  
ATOM 3358  H HZ2  . LYS A 1 26  ? -5.998  1.081   10.121  1.00 0.00 ? 26  LYS A HZ2  2  
ATOM 3359  H HZ3  . LYS A 1 26  ? -6.744  2.390   10.766  1.00 0.00 ? 26  LYS A HZ3  2  
ATOM 3360  N N    . SER A 1 27  ? -14.063 2.446   13.699  1.00 0.00 ? 27  SER A N    2  
ATOM 3361  C CA   . SER A 1 27  ? -15.168 2.882   14.542  1.00 0.00 ? 27  SER A CA   2  
ATOM 3362  C C    . SER A 1 27  ? -16.448 2.105   14.190  1.00 0.00 ? 27  SER A C    2  
ATOM 3363  O O    . SER A 1 27  ? -17.232 1.754   15.070  1.00 0.00 ? 27  SER A O    2  
ATOM 3364  C CB   . SER A 1 27  ? -15.331 4.404   14.353  1.00 0.00 ? 27  SER A CB   2  
ATOM 3365  O OG   . SER A 1 27  ? -14.860 5.100   15.491  1.00 0.00 ? 27  SER A OG   2  
ATOM 3366  H H    . SER A 1 27  ? -13.694 3.147   13.062  1.00 0.00 ? 27  SER A H    2  
ATOM 3367  H HA   . SER A 1 27  ? -14.920 2.668   15.583  1.00 0.00 ? 27  SER A HA   2  
ATOM 3368  H HB2  . SER A 1 27  ? -14.762 4.746   13.491  1.00 0.00 ? 27  SER A HB2  2  
ATOM 3369  H HB3  . SER A 1 27  ? -16.366 4.658   14.149  1.00 0.00 ? 27  SER A HB3  2  
ATOM 3370  H HG   . SER A 1 27  ? -15.194 6.014   15.461  1.00 0.00 ? 27  SER A HG   2  
ATOM 3371  N N    . SER A 1 28  ? -16.627 1.775   12.912  1.00 0.00 ? 28  SER A N    2  
ATOM 3372  C CA   . SER A 1 28  ? -17.658 0.909   12.361  1.00 0.00 ? 28  SER A CA   2  
ATOM 3373  C C    . SER A 1 28  ? -17.473 -0.589  12.633  1.00 0.00 ? 28  SER A C    2  
ATOM 3374  O O    . SER A 1 28  ? -18.248 -1.388  12.100  1.00 0.00 ? 28  SER A O    2  
ATOM 3375  C CB   . SER A 1 28  ? -17.808 1.207   10.866  1.00 0.00 ? 28  SER A CB   2  
ATOM 3376  O OG   . SER A 1 28  ? -19.135 1.467   10.442  1.00 0.00 ? 28  SER A OG   2  
ATOM 3377  H H    . SER A 1 28  ? -15.941 2.101   12.245  1.00 0.00 ? 28  SER A H    2  
ATOM 3378  H HA   . SER A 1 28  ? -18.561 1.170   12.839  1.00 0.00 ? 28  SER A HA   2  
ATOM 3379  H HB2  . SER A 1 28  ? -17.233 2.096   10.621  1.00 0.00 ? 28  SER A HB2  2  
ATOM 3380  H HB3  . SER A 1 28  ? -17.404 0.366   10.300  1.00 0.00 ? 28  SER A HB3  2  
ATOM 3381  H HG   . SER A 1 28  ? -19.740 0.838   10.899  1.00 0.00 ? 28  SER A HG   2  
ATOM 3382  N N    . GLY A 1 29  ? -16.461 -0.993  13.409  1.00 0.00 ? 29  GLY A N    2  
ATOM 3383  C CA   . GLY A 1 29  ? -16.166 -2.397  13.662  1.00 0.00 ? 29  GLY A CA   2  
ATOM 3384  C C    . GLY A 1 29  ? -15.839 -3.159  12.378  1.00 0.00 ? 29  GLY A C    2  
ATOM 3385  O O    . GLY A 1 29  ? -15.971 -4.383  12.356  1.00 0.00 ? 29  GLY A O    2  
ATOM 3386  H H    . GLY A 1 29  ? -15.823 -0.307  13.793  1.00 0.00 ? 29  GLY A H    2  
ATOM 3387  H HA2  . GLY A 1 29  ? -15.315 -2.475  14.339  1.00 0.00 ? 29  GLY A HA2  2  
ATOM 3388  H HA3  . GLY A 1 29  ? -17.032 -2.863  14.135  1.00 0.00 ? 29  GLY A HA3  2  
ATOM 3389  N N    . VAL A 1 30  ? -15.454 -2.467  11.301  1.00 0.00 ? 30  VAL A N    2  
ATOM 3390  C CA   . VAL A 1 30  ? -15.162 -3.047  9.999   1.00 0.00 ? 30  VAL A CA   2  
ATOM 3391  C C    . VAL A 1 30  ? -14.058 -4.128  10.170  1.00 0.00 ? 30  VAL A C    2  
ATOM 3392  O O    . VAL A 1 30  ? -13.139 -3.931  10.978  1.00 0.00 ? 30  VAL A O    2  
ATOM 3393  C CB   . VAL A 1 30  ? -14.769 -1.839  9.109   1.00 0.00 ? 30  VAL A CB   2  
ATOM 3394  C CG1  . VAL A 1 30  ? -13.353 -1.416  9.510   1.00 0.00 ? 30  VAL A CG1  2  
ATOM 3395  C CG2  . VAL A 1 30  ? -14.979 -1.981  7.601   1.00 0.00 ? 30  VAL A CG2  2  
ATOM 3396  H H    . VAL A 1 30  ? -15.302 -1.461  11.348  1.00 0.00 ? 30  VAL A H    2  
ATOM 3397  H HA   . VAL A 1 30  ? -16.074 -3.498  9.619   1.00 0.00 ? 30  VAL A HA   2  
ATOM 3398  H HB   . VAL A 1 30  ? -15.402 -0.979  9.356   1.00 0.00 ? 30  VAL A HB   2  
ATOM 3399  H HG11 . VAL A 1 30  ? -12.630 -2.199  9.321   1.00 0.00 ? 30  VAL A HG11 2  
ATOM 3400  H HG12 . VAL A 1 30  ? -13.037 -0.558  8.967   1.00 0.00 ? 30  VAL A HG12 2  
ATOM 3401  H HG13 . VAL A 1 30  ? -13.392 -1.174  10.573  1.00 0.00 ? 30  VAL A HG13 2  
ATOM 3402  H HG21 . VAL A 1 30  ? -14.022 -1.952  7.078   1.00 0.00 ? 30  VAL A HG21 2  
ATOM 3403  H HG22 . VAL A 1 30  ? -15.522 -2.900  7.379   1.00 0.00 ? 30  VAL A HG22 2  
ATOM 3404  H HG23 . VAL A 1 30  ? -15.585 -1.157  7.226   1.00 0.00 ? 30  VAL A HG23 2  
ATOM 3405  N N    . PRO A 1 31  ? -14.090 -5.283  9.487   1.00 0.00 ? 31  PRO A N    2  
ATOM 3406  C CA   . PRO A 1 31  ? -12.945 -6.188  9.460   1.00 0.00 ? 31  PRO A CA   2  
ATOM 3407  C C    . PRO A 1 31  ? -11.881 -5.709  8.475   1.00 0.00 ? 31  PRO A C    2  
ATOM 3408  O O    . PRO A 1 31  ? -11.852 -6.101  7.303   1.00 0.00 ? 31  PRO A O    2  
ATOM 3409  C CB   . PRO A 1 31  ? -13.495 -7.561  9.111   1.00 0.00 ? 31  PRO A CB   2  
ATOM 3410  C CG   . PRO A 1 31  ? -14.844 -7.291  8.432   1.00 0.00 ? 31  PRO A CG   2  
ATOM 3411  C CD   . PRO A 1 31  ? -15.277 -5.914  8.940   1.00 0.00 ? 31  PRO A CD   2  
ATOM 3412  H HA   . PRO A 1 31  ? -12.474 -6.235  10.439  1.00 0.00 ? 31  PRO A HA   2  
ATOM 3413  H HB2  . PRO A 1 31  ? -12.779 -8.088  8.490   1.00 0.00 ? 31  PRO A HB2  2  
ATOM 3414  H HB3  . PRO A 1 31  ? -13.654 -8.130  10.017  1.00 0.00 ? 31  PRO A HB3  2  
ATOM 3415  H HG2  . PRO A 1 31  ? -14.726 -7.253  7.355   1.00 0.00 ? 31  PRO A HG2  2  
ATOM 3416  H HG3  . PRO A 1 31  ? -15.578 -8.056  8.690   1.00 0.00 ? 31  PRO A HG3  2  
ATOM 3417  H HD2  . PRO A 1 31  ? -15.697 -5.321  8.128   1.00 0.00 ? 31  PRO A HD2  2  
ATOM 3418  H HD3  . PRO A 1 31  ? -16.012 -6.035  9.737   1.00 0.00 ? 31  PRO A HD3  2  
ATOM 3419  N N    . VAL A 1 32  ? -11.025 -4.813  8.943   1.00 0.00 ? 32  VAL A N    2  
ATOM 3420  C CA   . VAL A 1 32  ? -9.874  -4.317  8.202   1.00 0.00 ? 32  VAL A CA   2  
ATOM 3421  C C    . VAL A 1 32  ? -8.665  -5.208  8.498   1.00 0.00 ? 32  VAL A C    2  
ATOM 3422  O O    . VAL A 1 32  ? -8.598  -5.860  9.545   1.00 0.00 ? 32  VAL A O    2  
ATOM 3423  C CB   . VAL A 1 32  ? -9.677  -2.826  8.547   1.00 0.00 ? 32  VAL A CB   2  
ATOM 3424  C CG1  . VAL A 1 32  ? -9.334  -2.570  10.020  1.00 0.00 ? 32  VAL A CG1  2  
ATOM 3425  C CG2  . VAL A 1 32  ? -8.646  -2.109  7.655   1.00 0.00 ? 32  VAL A CG2  2  
ATOM 3426  H H    . VAL A 1 32  ? -11.147 -4.550  9.910   1.00 0.00 ? 32  VAL A H    2  
ATOM 3427  H HA   . VAL A 1 32  ? -10.092 -4.388  7.137   1.00 0.00 ? 32  VAL A HA   2  
ATOM 3428  H HB   . VAL A 1 32  ? -10.642 -2.357  8.361   1.00 0.00 ? 32  VAL A HB   2  
ATOM 3429  H HG11 . VAL A 1 32  ? -8.375  -3.024  10.276  1.00 0.00 ? 32  VAL A HG11 2  
ATOM 3430  H HG12 . VAL A 1 32  ? -9.281  -1.501  10.193  1.00 0.00 ? 32  VAL A HG12 2  
ATOM 3431  H HG13 . VAL A 1 32  ? -10.102 -2.983  10.677  1.00 0.00 ? 32  VAL A HG13 2  
ATOM 3432  H HG21 . VAL A 1 32  ? -8.874  -2.296  6.609   1.00 0.00 ? 32  VAL A HG21 2  
ATOM 3433  H HG22 . VAL A 1 32  ? -8.678  -1.027  7.820   1.00 0.00 ? 32  VAL A HG22 2  
ATOM 3434  H HG23 . VAL A 1 32  ? -7.639  -2.466  7.869   1.00 0.00 ? 32  VAL A HG23 2  
ATOM 3435  N N    . ASP A 1 33  ? -7.700  -5.209  7.585   1.00 0.00 ? 33  ASP A N    2  
ATOM 3436  C CA   . ASP A 1 33  ? -6.343  -5.713  7.772   1.00 0.00 ? 33  ASP A CA   2  
ATOM 3437  C C    . ASP A 1 33  ? -5.442  -5.003  6.749   1.00 0.00 ? 33  ASP A C    2  
ATOM 3438  O O    . ASP A 1 33  ? -5.945  -4.260  5.897   1.00 0.00 ? 33  ASP A O    2  
ATOM 3439  C CB   . ASP A 1 33  ? -6.298  -7.238  7.574   1.00 0.00 ? 33  ASP A CB   2  
ATOM 3440  C CG   . ASP A 1 33  ? -5.278  -7.918  8.483   1.00 0.00 ? 33  ASP A CG   2  
ATOM 3441  O OD1  . ASP A 1 33  ? -4.204  -7.347  8.764   1.00 0.00 ? 33  ASP A OD1  2  
ATOM 3442  O OD2  . ASP A 1 33  ? -5.547  -9.066  8.908   1.00 0.00 ? 33  ASP A OD2  2  
ATOM 3443  H H    . ASP A 1 33  ? -7.814  -4.684  6.728   1.00 0.00 ? 33  ASP A H    2  
ATOM 3444  H HA   . ASP A 1 33  ? -6.011  -5.473  8.784   1.00 0.00 ? 33  ASP A HA   2  
ATOM 3445  H HB2  . ASP A 1 33  ? -7.280  -7.669  7.780   1.00 0.00 ? 33  ASP A HB2  2  
ATOM 3446  H HB3  . ASP A 1 33  ? -6.034  -7.467  6.544   1.00 0.00 ? 33  ASP A HB3  2  
ATOM 3447  N N    . GLY A 1 34  ? -4.131  -5.221  6.812   1.00 0.00 ? 34  GLY A N    2  
ATOM 3448  C CA   . GLY A 1 34  ? -3.144  -4.744  5.845   1.00 0.00 ? 34  GLY A CA   2  
ATOM 3449  C C    . GLY A 1 34  ? -1.958  -4.102  6.539   1.00 0.00 ? 34  GLY A C    2  
ATOM 3450  O O    . GLY A 1 34  ? -1.573  -4.520  7.636   1.00 0.00 ? 34  GLY A O    2  
ATOM 3451  H H    . GLY A 1 34  ? -3.791  -5.717  7.633   1.00 0.00 ? 34  GLY A H    2  
ATOM 3452  H HA2  . GLY A 1 34  ? -2.763  -5.585  5.277   1.00 0.00 ? 34  GLY A HA2  2  
ATOM 3453  H HA3  . GLY A 1 34  ? -3.584  -4.064  5.125   1.00 0.00 ? 34  GLY A HA3  2  
ATOM 3454  N N    . PHE A 1 35  ? -1.351  -3.105  5.901   1.00 0.00 ? 35  PHE A N    2  
ATOM 3455  C CA   . PHE A 1 35  ? -0.243  -2.351  6.451   1.00 0.00 ? 35  PHE A CA   2  
ATOM 3456  C C    . PHE A 1 35  ? -0.252  -0.909  5.948   1.00 0.00 ? 35  PHE A C    2  
ATOM 3457  O O    . PHE A 1 35  ? -1.007  -0.550  5.041   1.00 0.00 ? 35  PHE A O    2  
ATOM 3458  C CB   . PHE A 1 35  ? 1.073   -3.062  6.108   1.00 0.00 ? 35  PHE A CB   2  
ATOM 3459  C CG   . PHE A 1 35  ? 1.367   -3.218  4.623   1.00 0.00 ? 35  PHE A CG   2  
ATOM 3460  C CD1  . PHE A 1 35  ? 2.034   -2.196  3.919   1.00 0.00 ? 35  PHE A CD1  2  
ATOM 3461  C CD2  . PHE A 1 35  ? 0.992   -4.395  3.945   1.00 0.00 ? 35  PHE A CD2  2  
ATOM 3462  C CE1  . PHE A 1 35  ? 2.361   -2.371  2.563   1.00 0.00 ? 35  PHE A CE1  2  
ATOM 3463  C CE2  . PHE A 1 35  ? 1.309   -4.570  2.586   1.00 0.00 ? 35  PHE A CE2  2  
ATOM 3464  C CZ   . PHE A 1 35  ? 2.019   -3.564  1.904   1.00 0.00 ? 35  PHE A CZ   2  
ATOM 3465  H H    . PHE A 1 35  ? -1.690  -2.782  5.006   1.00 0.00 ? 35  PHE A H    2  
ATOM 3466  H HA   . PHE A 1 35  ? -0.359  -2.326  7.531   1.00 0.00 ? 35  PHE A HA   2  
ATOM 3467  H HB2  . PHE A 1 35  ? 1.893   -2.519  6.578   1.00 0.00 ? 35  PHE A HB2  2  
ATOM 3468  H HB3  . PHE A 1 35  ? 1.050   -4.051  6.566   1.00 0.00 ? 35  PHE A HB3  2  
ATOM 3469  H HD1  . PHE A 1 35  ? 2.319   -1.280  4.417   1.00 0.00 ? 35  PHE A HD1  2  
ATOM 3470  H HD2  . PHE A 1 35  ? 0.455   -5.172  4.464   1.00 0.00 ? 35  PHE A HD2  2  
ATOM 3471  H HE1  . PHE A 1 35  ? 2.885   -1.589  2.030   1.00 0.00 ? 35  PHE A HE1  2  
ATOM 3472  H HE2  . PHE A 1 35  ? 1.001   -5.476  2.072   1.00 0.00 ? 35  PHE A HE2  2  
ATOM 3473  H HZ   . PHE A 1 35  ? 2.284   -3.695  0.865   1.00 0.00 ? 35  PHE A HZ   2  
ATOM 3474  N N    . TYR A 1 36  ? 0.619   -0.086  6.527   1.00 0.00 ? 36  TYR A N    2  
ATOM 3475  C CA   . TYR A 1 36  ? 0.992   1.227   6.029   1.00 0.00 ? 36  TYR A CA   2  
ATOM 3476  C C    . TYR A 1 36  ? 2.467   1.473   6.373   1.00 0.00 ? 36  TYR A C    2  
ATOM 3477  O O    . TYR A 1 36  ? 3.088   0.698   7.105   1.00 0.00 ? 36  TYR A O    2  
ATOM 3478  C CB   . TYR A 1 36  ? 0.038   2.295   6.597   1.00 0.00 ? 36  TYR A CB   2  
ATOM 3479  C CG   . TYR A 1 36  ? -0.059  2.368   8.110   1.00 0.00 ? 36  TYR A CG   2  
ATOM 3480  C CD1  . TYR A 1 36  ? 1.016   2.838   8.889   1.00 0.00 ? 36  TYR A CD1  2  
ATOM 3481  C CD2  . TYR A 1 36  ? -1.258  1.994   8.742   1.00 0.00 ? 36  TYR A CD2  2  
ATOM 3482  C CE1  . TYR A 1 36  ? 0.909   2.889   10.293  1.00 0.00 ? 36  TYR A CE1  2  
ATOM 3483  C CE2  . TYR A 1 36  ? -1.377  2.080   10.136  1.00 0.00 ? 36  TYR A CE2  2  
ATOM 3484  C CZ   . TYR A 1 36  ? -0.288  2.511   10.919  1.00 0.00 ? 36  TYR A CZ   2  
ATOM 3485  O OH   . TYR A 1 36  ? -0.333  2.469   12.272  1.00 0.00 ? 36  TYR A OH   2  
ATOM 3486  H H    . TYR A 1 36  ? 1.191   -0.435  7.291   1.00 0.00 ? 36  TYR A H    2  
ATOM 3487  H HA   . TYR A 1 36  ? 0.893   1.231   4.942   1.00 0.00 ? 36  TYR A HA   2  
ATOM 3488  H HB2  . TYR A 1 36  ? 0.328   3.274   6.216   1.00 0.00 ? 36  TYR A HB2  2  
ATOM 3489  H HB3  . TYR A 1 36  ? -0.965  2.082   6.217   1.00 0.00 ? 36  TYR A HB3  2  
ATOM 3490  H HD1  . TYR A 1 36  ? 1.919   3.210   8.423   1.00 0.00 ? 36  TYR A HD1  2  
ATOM 3491  H HD2  . TYR A 1 36  ? -2.093  1.632   8.161   1.00 0.00 ? 36  TYR A HD2  2  
ATOM 3492  H HE1  . TYR A 1 36  ? 1.722   3.276   10.907  1.00 0.00 ? 36  TYR A HE1  2  
ATOM 3493  H HE2  . TYR A 1 36  ? -2.287  1.756   10.605  1.00 0.00 ? 36  TYR A HE2  2  
ATOM 3494  H HH   . TYR A 1 36  ? -1.146  2.075   12.638  1.00 0.00 ? 36  TYR A HH   2  
ATOM 3495  N N    . THR A 1 37  ? 3.022   2.563   5.855   1.00 0.00 ? 37  THR A N    2  
ATOM 3496  C CA   . THR A 1 37  ? 4.427   2.926   5.926   1.00 0.00 ? 37  THR A CA   2  
ATOM 3497  C C    . THR A 1 37  ? 4.471   4.399   6.358   1.00 0.00 ? 37  THR A C    2  
ATOM 3498  O O    . THR A 1 37  ? 4.367   5.305   5.526   1.00 0.00 ? 37  THR A O    2  
ATOM 3499  C CB   . THR A 1 37  ? 5.080   2.650   4.552   1.00 0.00 ? 37  THR A CB   2  
ATOM 3500  O OG1  . THR A 1 37  ? 4.166   2.757   3.470   1.00 0.00 ? 37  THR A OG1  2  
ATOM 3501  C CG2  . THR A 1 37  ? 5.615   1.221   4.515   1.00 0.00 ? 37  THR A CG2  2  
ATOM 3502  H H    . THR A 1 37  ? 2.493   3.108   5.193   1.00 0.00 ? 37  THR A H    2  
ATOM 3503  H HA   . THR A 1 37  ? 4.941   2.306   6.672   1.00 0.00 ? 37  THR A HA   2  
ATOM 3504  H HB   . THR A 1 37  ? 5.909   3.339   4.393   1.00 0.00 ? 37  THR A HB   2  
ATOM 3505  H HG1  . THR A 1 37  ? 4.147   3.677   3.153   1.00 0.00 ? 37  THR A HG1  2  
ATOM 3506  H HG21 . THR A 1 37  ? 6.071   1.033   3.543   1.00 0.00 ? 37  THR A HG21 2  
ATOM 3507  H HG22 . THR A 1 37  ? 6.370   1.086   5.290   1.00 0.00 ? 37  THR A HG22 2  
ATOM 3508  H HG23 . THR A 1 37  ? 4.795   0.523   4.683   1.00 0.00 ? 37  THR A HG23 2  
ATOM 3509  N N    . GLU A 1 38  ? 4.530   4.658   7.667   1.00 0.00 ? 38  GLU A N    2  
ATOM 3510  C CA   . GLU A 1 38  ? 4.356   6.012   8.218   1.00 0.00 ? 38  GLU A CA   2  
ATOM 3511  C C    . GLU A 1 38  ? 5.581   6.902   7.996   1.00 0.00 ? 38  GLU A C    2  
ATOM 3512  O O    . GLU A 1 38  ? 5.421   8.118   7.875   1.00 0.00 ? 38  GLU A O    2  
ATOM 3513  C CB   . GLU A 1 38  ? 3.998   5.938   9.710   1.00 0.00 ? 38  GLU A CB   2  
ATOM 3514  C CG   . GLU A 1 38  ? 2.662   5.321   9.908   1.00 0.00 ? 38  GLU A CG   2  
ATOM 3515  C CD   . GLU A 1 38  ? 1.992   5.774   11.226  1.00 0.00 ? 38  GLU A CD   2  
ATOM 3516  O OE1  . GLU A 1 38  ? 2.338   5.212   12.292  1.00 0.00 ? 38  GLU A OE1  2  
ATOM 3517  O OE2  . GLU A 1 38  ? 1.139   6.695   11.202  1.00 0.00 ? 38  GLU A OE2  2  
ATOM 3518  H H    . GLU A 1 38  ? 4.611   3.882   8.309   1.00 0.00 ? 38  GLU A H    2  
ATOM 3519  H HA   . GLU A 1 38  ? 3.517   6.486   7.705   1.00 0.00 ? 38  GLU A HA   2  
ATOM 3520  H HB2  . GLU A 1 38  ? 4.746   5.395   10.291  1.00 0.00 ? 38  GLU A HB2  2  
ATOM 3521  H HB3  . GLU A 1 38  ? 3.807   6.879   10.142  1.00 0.00 ? 38  GLU A HB3  2  
ATOM 3522  H HG2  . GLU A 1 38  ? 2.004   5.525   9.061   1.00 0.00 ? 38  GLU A HG2  2  
ATOM 3523  H HG3  . GLU A 1 38  ? 2.969   4.287   9.908   1.00 0.00 ? 38  GLU A HG3  2  
ATOM 3524  N N    . GLU A 1 39  ? 6.746   6.274   7.798   1.00 0.00 ? 39  GLU A N    2  
ATOM 3525  C CA   . GLU A 1 39  ? 8.147   6.715   7.929   1.00 0.00 ? 39  GLU A CA   2  
ATOM 3526  C C    . GLU A 1 39  ? 8.694   6.305   9.306   1.00 0.00 ? 39  GLU A C    2  
ATOM 3527  O O    . GLU A 1 39  ? 7.922   5.948   10.198  1.00 0.00 ? 39  GLU A O    2  
ATOM 3528  C CB   . GLU A 1 39  ? 8.355   8.222   7.656   1.00 0.00 ? 39  GLU A CB   2  
ATOM 3529  C CG   . GLU A 1 39  ? 8.088   9.148   8.866   1.00 0.00 ? 39  GLU A CG   2  
ATOM 3530  C CD   . GLU A 1 39  ? 7.794   10.607  8.493   1.00 0.00 ? 39  GLU A CD   2  
ATOM 3531  O OE1  . GLU A 1 39  ? 7.369   10.901  7.350   1.00 0.00 ? 39  GLU A OE1  2  
ATOM 3532  O OE2  . GLU A 1 39  ? 8.026   11.502  9.337   1.00 0.00 ? 39  GLU A OE2  2  
ATOM 3533  H H    . GLU A 1 39  ? 6.626   5.278   7.878   1.00 0.00 ? 39  GLU A H    2  
ATOM 3534  H HA   . GLU A 1 39  ? 8.714   6.172   7.174   1.00 0.00 ? 39  GLU A HA   2  
ATOM 3535  H HB2  . GLU A 1 39  ? 9.393   8.371   7.354   1.00 0.00 ? 39  GLU A HB2  2  
ATOM 3536  H HB3  . GLU A 1 39  ? 7.737   8.500   6.803   1.00 0.00 ? 39  GLU A HB3  2  
ATOM 3537  H HG2  . GLU A 1 39  ? 7.260   8.774   9.466   1.00 0.00 ? 39  GLU A HG2  2  
ATOM 3538  H HG3  . GLU A 1 39  ? 8.974   9.129   9.502   1.00 0.00 ? 39  GLU A HG3  2  
ATOM 3539  N N    . VAL A 1 40  ? 10.021  6.334   9.476   1.00 0.00 ? 40  VAL A N    2  
ATOM 3540  C CA   . VAL A 1 40  ? 10.701  5.967   10.716  1.00 0.00 ? 40  VAL A CA   2  
ATOM 3541  C C    . VAL A 1 40  ? 11.803  6.994   10.969  1.00 0.00 ? 40  VAL A C    2  
ATOM 3542  O O    . VAL A 1 40  ? 12.843  7.000   10.294  1.00 0.00 ? 40  VAL A O    2  
ATOM 3543  C CB   . VAL A 1 40  ? 11.232  4.519   10.636  1.00 0.00 ? 40  VAL A CB   2  
ATOM 3544  C CG1  . VAL A 1 40  ? 12.066  4.142   11.868  1.00 0.00 ? 40  VAL A CG1  2  
ATOM 3545  C CG2  . VAL A 1 40  ? 10.072  3.520   10.515  1.00 0.00 ? 40  VAL A CG2  2  
ATOM 3546  H H    . VAL A 1 40  ? 10.630  6.580   8.708   1.00 0.00 ? 40  VAL A H    2  
ATOM 3547  H HA   . VAL A 1 40  ? 9.989   6.019   11.543  1.00 0.00 ? 40  VAL A HA   2  
ATOM 3548  H HB   . VAL A 1 40  ? 11.868  4.424   9.758   1.00 0.00 ? 40  VAL A HB   2  
ATOM 3549  H HG11 . VAL A 1 40  ? 12.909  4.822   11.973  1.00 0.00 ? 40  VAL A HG11 2  
ATOM 3550  H HG12 . VAL A 1 40  ? 11.450  4.199   12.765  1.00 0.00 ? 40  VAL A HG12 2  
ATOM 3551  H HG13 . VAL A 1 40  ? 12.476  3.139   11.755  1.00 0.00 ? 40  VAL A HG13 2  
ATOM 3552  H HG21 . VAL A 1 40  ? 9.374   3.658   11.340  1.00 0.00 ? 40  VAL A HG21 2  
ATOM 3553  H HG22 . VAL A 1 40  ? 9.547   3.667   9.574   1.00 0.00 ? 40  VAL A HG22 2  
ATOM 3554  H HG23 . VAL A 1 40  ? 10.457  2.504   10.540  1.00 0.00 ? 40  VAL A HG23 2  
ATOM 3555  N N    . ARG A 1 41  ? 11.559  7.907   11.913  1.00 0.00 ? 41  ARG A N    2  
ATOM 3556  C CA   . ARG A 1 41  ? 12.498  8.933   12.339  1.00 0.00 ? 41  ARG A CA   2  
ATOM 3557  C C    . ARG A 1 41  ? 12.739  8.751   13.827  1.00 0.00 ? 41  ARG A C    2  
ATOM 3558  O O    . ARG A 1 41  ? 11.888  9.074   14.653  1.00 0.00 ? 41  ARG A O    2  
ATOM 3559  C CB   . ARG A 1 41  ? 11.943  10.319  11.987  1.00 0.00 ? 41  ARG A CB   2  
ATOM 3560  C CG   . ARG A 1 41  ? 11.873  10.448  10.462  1.00 0.00 ? 41  ARG A CG   2  
ATOM 3561  C CD   . ARG A 1 41  ? 10.911  11.517  9.975   1.00 0.00 ? 41  ARG A CD   2  
ATOM 3562  N NE   . ARG A 1 41  ? 11.560  12.779  9.613   1.00 0.00 ? 41  ARG A NE   2  
ATOM 3563  C CZ   . ARG A 1 41  ? 10.919  13.825  9.086   1.00 0.00 ? 41  ARG A CZ   2  
ATOM 3564  N NH1  . ARG A 1 41  ? 9.626   13.742  8.781   1.00 0.00 ? 41  ARG A NH1  2  
ATOM 3565  N NH2  . ARG A 1 41  ? 11.591  14.944  8.851   1.00 0.00 ? 41  ARG A NH2  2  
ATOM 3566  H H    . ARG A 1 41  ? 10.632  7.978   12.311  1.00 0.00 ? 41  ARG A H    2  
ATOM 3567  H HA   . ARG A 1 41  ? 13.438  8.787   11.808  1.00 0.00 ? 41  ARG A HA   2  
ATOM 3568  H HB2  . ARG A 1 41  ? 10.950  10.434  12.423  1.00 0.00 ? 41  ARG A HB2  2  
ATOM 3569  H HB3  . ARG A 1 41  ? 12.595  11.097  12.388  1.00 0.00 ? 41  ARG A HB3  2  
ATOM 3570  H HG2  . ARG A 1 41  ? 12.875  10.618  10.088  1.00 0.00 ? 41  ARG A HG2  2  
ATOM 3571  H HG3  . ARG A 1 41  ? 11.513  9.523   10.017  1.00 0.00 ? 41  ARG A HG3  2  
ATOM 3572  H HD2  . ARG A 1 41  ? 10.436  11.118  9.081   1.00 0.00 ? 41  ARG A HD2  2  
ATOM 3573  H HD3  . ARG A 1 41  ? 10.140  11.694  10.727  1.00 0.00 ? 41  ARG A HD3  2  
ATOM 3574  H HE   . ARG A 1 41  ? 12.558  12.873  9.795   1.00 0.00 ? 41  ARG A HE   2  
ATOM 3575  H HH11 . ARG A 1 41  ? 9.102   12.876  8.955   1.00 0.00 ? 41  ARG A HH11 2  
ATOM 3576  H HH12 . ARG A 1 41  ? 9.086   14.570  8.550   1.00 0.00 ? 41  ARG A HH12 2  
ATOM 3577  H HH21 . ARG A 1 41  ? 12.552  15.036  9.167   1.00 0.00 ? 41  ARG A HH21 2  
ATOM 3578  H HH22 . ARG A 1 41  ? 11.130  15.805  8.556   1.00 0.00 ? 41  ARG A HH22 2  
ATOM 3579  N N    . GLN A 1 42  ? 13.905  8.218   14.163  1.00 0.00 ? 42  GLN A N    2  
ATOM 3580  C CA   . GLN A 1 42  ? 14.367  8.050   15.532  1.00 0.00 ? 42  GLN A CA   2  
ATOM 3581  C C    . GLN A 1 42  ? 14.880  9.425   15.944  1.00 0.00 ? 42  GLN A C    2  
ATOM 3582  O O    . GLN A 1 42  ? 15.807  9.915   15.306  1.00 0.00 ? 42  GLN A O    2  
ATOM 3583  C CB   . GLN A 1 42  ? 15.462  6.968   15.500  1.00 0.00 ? 42  GLN A CB   2  
ATOM 3584  C CG   . GLN A 1 42  ? 16.255  6.739   16.798  1.00 0.00 ? 42  GLN A CG   2  
ATOM 3585  C CD   . GLN A 1 42  ? 17.465  5.814   16.605  1.00 0.00 ? 42  GLN A CD   2  
ATOM 3586  O OE1  . GLN A 1 42  ? 17.624  5.120   15.600  1.00 0.00 ? 42  GLN A OE1  2  
ATOM 3587  N NE2  . GLN A 1 42  ? 18.406  5.808   17.526  1.00 0.00 ? 42  GLN A NE2  2  
ATOM 3588  H H    . GLN A 1 42  ? 14.584  8.081   13.431  1.00 0.00 ? 42  GLN A H    2  
ATOM 3589  H HA   . GLN A 1 42  ? 13.549  7.733   16.183  1.00 0.00 ? 42  GLN A HA   2  
ATOM 3590  H HB2  . GLN A 1 42  ? 14.998  6.022   15.223  1.00 0.00 ? 42  GLN A HB2  2  
ATOM 3591  H HB3  . GLN A 1 42  ? 16.159  7.236   14.710  1.00 0.00 ? 42  GLN A HB3  2  
ATOM 3592  H HG2  . GLN A 1 42  ? 16.614  7.699   17.165  1.00 0.00 ? 42  GLN A HG2  2  
ATOM 3593  H HG3  . GLN A 1 42  ? 15.594  6.300   17.547  1.00 0.00 ? 42  GLN A HG3  2  
ATOM 3594  H HE21 . GLN A 1 42  ? 18.353  6.408   18.349  1.00 0.00 ? 42  GLN A HE21 2  
ATOM 3595  H HE22 . GLN A 1 42  ? 19.194  5.183   17.456  1.00 0.00 ? 42  GLN A HE22 2  
ATOM 3596  N N    . GLY A 1 43  ? 14.291  10.099  16.928  1.00 0.00 ? 43  GLY A N    2  
ATOM 3597  C CA   . GLY A 1 43  ? 14.842  11.332  17.487  1.00 0.00 ? 43  GLY A CA   2  
ATOM 3598  C C    . GLY A 1 43  ? 14.582  12.574  16.636  1.00 0.00 ? 43  GLY A C    2  
ATOM 3599  O O    . GLY A 1 43  ? 14.041  13.564  17.133  1.00 0.00 ? 43  GLY A O    2  
ATOM 3600  H H    . GLY A 1 43  ? 13.527  9.667   17.432  1.00 0.00 ? 43  GLY A H    2  
ATOM 3601  H HA2  . GLY A 1 43  ? 14.421  11.490  18.471  1.00 0.00 ? 43  GLY A HA2  2  
ATOM 3602  H HA3  . GLY A 1 43  ? 15.919  11.214  17.612  1.00 0.00 ? 43  GLY A HA3  2  
ATOM 3603  N N    . GLY A 1 44  ? 14.993  12.546  15.371  1.00 0.00 ? 44  GLY A N    2  
ATOM 3604  C CA   . GLY A 1 44  ? 14.950  13.680  14.463  1.00 0.00 ? 44  GLY A CA   2  
ATOM 3605  C C    . GLY A 1 44  ? 15.569  13.399  13.094  1.00 0.00 ? 44  GLY A C    2  
ATOM 3606  O O    . GLY A 1 44  ? 15.834  14.353  12.360  1.00 0.00 ? 44  GLY A O    2  
ATOM 3607  H H    . GLY A 1 44  ? 15.433  11.685  15.077  1.00 0.00 ? 44  GLY A H    2  
ATOM 3608  H HA2  . GLY A 1 44  ? 13.918  13.986  14.318  1.00 0.00 ? 44  GLY A HA2  2  
ATOM 3609  H HA3  . GLY A 1 44  ? 15.480  14.515  14.923  1.00 0.00 ? 44  GLY A HA3  2  
ATOM 3610  N N    . ARG A 1 45  ? 15.878  12.142  12.738  1.00 0.00 ? 45  ARG A N    2  
ATOM 3611  C CA   . ARG A 1 45  ? 16.525  11.808  11.471  1.00 0.00 ? 45  ARG A CA   2  
ATOM 3612  C C    . ARG A 1 45  ? 15.965  10.494  10.946  1.00 0.00 ? 45  ARG A C    2  
ATOM 3613  O O    . ARG A 1 45  ? 15.750  9.563   11.730  1.00 0.00 ? 45  ARG A O    2  
ATOM 3614  C CB   . ARG A 1 45  ? 18.061  11.845  11.621  1.00 0.00 ? 45  ARG A CB   2  
ATOM 3615  C CG   . ARG A 1 45  ? 18.760  10.717  12.401  1.00 0.00 ? 45  ARG A CG   2  
ATOM 3616  C CD   . ARG A 1 45  ? 18.162  10.453  13.783  1.00 0.00 ? 45  ARG A CD   2  
ATOM 3617  N NE   . ARG A 1 45  ? 19.101  9.869   14.747  1.00 0.00 ? 45  ARG A NE   2  
ATOM 3618  C CZ   . ARG A 1 45  ? 19.261  8.581   15.050  1.00 0.00 ? 45  ARG A CZ   2  
ATOM 3619  N NH1  . ARG A 1 45  ? 18.656  7.642   14.335  1.00 0.00 ? 45  ARG A NH1  2  
ATOM 3620  N NH2  . ARG A 1 45  ? 20.034  8.226   16.063  1.00 0.00 ? 45  ARG A NH2  2  
ATOM 3621  H H    . ARG A 1 45  ? 15.668  11.343  13.325  1.00 0.00 ? 45  ARG A H    2  
ATOM 3622  H HA   . ARG A 1 45  ? 16.268  12.584  10.752  1.00 0.00 ? 45  ARG A HA   2  
ATOM 3623  H HB2  . ARG A 1 45  ? 18.496  11.871  10.621  1.00 0.00 ? 45  ARG A HB2  2  
ATOM 3624  H HB3  . ARG A 1 45  ? 18.317  12.788  12.102  1.00 0.00 ? 45  ARG A HB3  2  
ATOM 3625  H HG2  . ARG A 1 45  ? 18.704  9.797   11.821  1.00 0.00 ? 45  ARG A HG2  2  
ATOM 3626  H HG3  . ARG A 1 45  ? 19.804  11.000  12.516  1.00 0.00 ? 45  ARG A HG3  2  
ATOM 3627  H HD2  . ARG A 1 45  ? 17.800  11.383  14.227  1.00 0.00 ? 45  ARG A HD2  2  
ATOM 3628  H HD3  . ARG A 1 45  ? 17.323  9.779   13.642  1.00 0.00 ? 45  ARG A HD3  2  
ATOM 3629  H HE   . ARG A 1 45  ? 19.601  10.565  15.298  1.00 0.00 ? 45  ARG A HE   2  
ATOM 3630  H HH11 . ARG A 1 45  ? 18.076  7.918   13.557  1.00 0.00 ? 45  ARG A HH11 2  
ATOM 3631  H HH12 . ARG A 1 45  ? 18.716  6.658   14.577  1.00 0.00 ? 45  ARG A HH12 2  
ATOM 3632  H HH21 . ARG A 1 45  ? 20.665  8.887   16.525  1.00 0.00 ? 45  ARG A HH21 2  
ATOM 3633  H HH22 . ARG A 1 45  ? 20.240  7.249   16.246  1.00 0.00 ? 45  ARG A HH22 2  
ATOM 3634  N N    . ARG A 1 46  ? 15.688  10.423  9.643   1.00 0.00 ? 46  ARG A N    2  
ATOM 3635  C CA   . ARG A 1 46  ? 15.196  9.209   9.000   1.00 0.00 ? 46  ARG A CA   2  
ATOM 3636  C C    . ARG A 1 46  ? 16.288  8.151   9.040   1.00 0.00 ? 46  ARG A C    2  
ATOM 3637  O O    . ARG A 1 46  ? 17.473  8.474   8.885   1.00 0.00 ? 46  ARG A O    2  
ATOM 3638  C CB   . ARG A 1 46  ? 14.791  9.472   7.540   1.00 0.00 ? 46  ARG A CB   2  
ATOM 3639  C CG   . ARG A 1 46  ? 13.451  10.198  7.380   1.00 0.00 ? 46  ARG A CG   2  
ATOM 3640  C CD   . ARG A 1 46  ? 13.109  10.406  5.898   1.00 0.00 ? 46  ARG A CD   2  
ATOM 3641  N NE   . ARG A 1 46  ? 13.588  11.698  5.373   1.00 0.00 ? 46  ARG A NE   2  
ATOM 3642  C CZ   . ARG A 1 46  ? 12.900  12.851  5.333   1.00 0.00 ? 46  ARG A CZ   2  
ATOM 3643  N NH1  . ARG A 1 46  ? 11.700  12.952  5.888   1.00 0.00 ? 46  ARG A NH1  2  
ATOM 3644  N NH2  . ARG A 1 46  ? 13.405  13.900  4.696   1.00 0.00 ? 46  ARG A NH2  2  
ATOM 3645  H H    . ARG A 1 46  ? 16.030  11.167  9.044   1.00 0.00 ? 46  ARG A H    2  
ATOM 3646  H HA   . ARG A 1 46  ? 14.334  8.839   9.556   1.00 0.00 ? 46  ARG A HA   2  
ATOM 3647  H HB2  . ARG A 1 46  ? 15.578  10.031  7.031   1.00 0.00 ? 46  ARG A HB2  2  
ATOM 3648  H HB3  . ARG A 1 46  ? 14.687  8.505   7.050   1.00 0.00 ? 46  ARG A HB3  2  
ATOM 3649  H HG2  . ARG A 1 46  ? 12.673  9.573   7.819   1.00 0.00 ? 46  ARG A HG2  2  
ATOM 3650  H HG3  . ARG A 1 46  ? 13.475  11.155  7.901   1.00 0.00 ? 46  ARG A HG3  2  
ATOM 3651  H HD2  . ARG A 1 46  ? 13.549  9.600   5.310   1.00 0.00 ? 46  ARG A HD2  2  
ATOM 3652  H HD3  . ARG A 1 46  ? 12.031  10.337  5.771   1.00 0.00 ? 46  ARG A HD3  2  
ATOM 3653  H HE   . ARG A 1 46  ? 14.563  11.700  5.070   1.00 0.00 ? 46  ARG A HE   2  
ATOM 3654  H HH11 . ARG A 1 46  ? 11.221  12.138  6.283   1.00 0.00 ? 46  ARG A HH11 2  
ATOM 3655  H HH12 . ARG A 1 46  ? 11.120  13.788  5.832   1.00 0.00 ? 46  ARG A HH12 2  
ATOM 3656  H HH21 . ARG A 1 46  ? 14.300  13.864  4.216   1.00 0.00 ? 46  ARG A HH21 2  
ATOM 3657  H HH22 . ARG A 1 46  ? 12.839  14.724  4.519   1.00 0.00 ? 46  ARG A HH22 2  
ATOM 3658  N N    . ILE A 1 47  ? 15.874  6.897   9.195   1.00 0.00 ? 47  ILE A N    2  
ATOM 3659  C CA   . ILE A 1 47  ? 16.753  5.729   9.254   1.00 0.00 ? 47  ILE A CA   2  
ATOM 3660  C C    . ILE A 1 47  ? 16.249  4.561   8.410   1.00 0.00 ? 47  ILE A C    2  
ATOM 3661  O O    . ILE A 1 47  ? 17.023  3.636   8.149   1.00 0.00 ? 47  ILE A O    2  
ATOM 3662  C CB   . ILE A 1 47  ? 16.935  5.282   10.722  1.00 0.00 ? 47  ILE A CB   2  
ATOM 3663  C CG1  . ILE A 1 47  ? 15.589  5.123   11.461  1.00 0.00 ? 47  ILE A CG1  2  
ATOM 3664  C CG2  . ILE A 1 47  ? 17.883  6.250   11.452  1.00 0.00 ? 47  ILE A CG2  2  
ATOM 3665  C CD1  . ILE A 1 47  ? 15.741  4.411   12.805  1.00 0.00 ? 47  ILE A CD1  2  
ATOM 3666  H H    . ILE A 1 47  ? 14.886  6.739   9.361   1.00 0.00 ? 47  ILE A H    2  
ATOM 3667  H HA   . ILE A 1 47  ? 17.719  5.992   8.814   1.00 0.00 ? 47  ILE A HA   2  
ATOM 3668  H HB   . ILE A 1 47  ? 17.392  4.294   10.717  1.00 0.00 ? 47  ILE A HB   2  
ATOM 3669  H HG12 . ILE A 1 47  ? 15.133  6.099   11.635  1.00 0.00 ? 47  ILE A HG12 2  
ATOM 3670  H HG13 . ILE A 1 47  ? 14.917  4.527   10.845  1.00 0.00 ? 47  ILE A HG13 2  
ATOM 3671  H HG21 . ILE A 1 47  ? 18.189  5.808   12.398  1.00 0.00 ? 47  ILE A HG21 2  
ATOM 3672  H HG22 . ILE A 1 47  ? 18.779  6.415   10.852  1.00 0.00 ? 47  ILE A HG22 2  
ATOM 3673  H HG23 . ILE A 1 47  ? 17.386  7.204   11.623  1.00 0.00 ? 47  ILE A HG23 2  
ATOM 3674  H HD11 . ILE A 1 47  ? 16.349  5.020   13.466  1.00 0.00 ? 47  ILE A HD11 2  
ATOM 3675  H HD12 . ILE A 1 47  ? 14.763  4.270   13.262  1.00 0.00 ? 47  ILE A HD12 2  
ATOM 3676  H HD13 . ILE A 1 47  ? 16.209  3.437   12.659  1.00 0.00 ? 47  ILE A HD13 2  
ATOM 3677  N N    . GLY A 1 48  ? 15.008  4.611   7.940   1.00 0.00 ? 48  GLY A N    2  
ATOM 3678  C CA   . GLY A 1 48  ? 14.427  3.525   7.190   1.00 0.00 ? 48  GLY A CA   2  
ATOM 3679  C C    . GLY A 1 48  ? 12.950  3.789   6.994   1.00 0.00 ? 48  GLY A C    2  
ATOM 3680  O O    . GLY A 1 48  ? 12.465  4.900   7.241   1.00 0.00 ? 48  GLY A O    2  
ATOM 3681  H H    . GLY A 1 48  ? 14.349  5.345   8.167   1.00 0.00 ? 48  GLY A H    2  
ATOM 3682  H HA2  . GLY A 1 48  ? 14.906  3.436   6.217   1.00 0.00 ? 48  GLY A HA2  2  
ATOM 3683  H HA3  . GLY A 1 48  ? 14.565  2.601   7.750   1.00 0.00 ? 48  GLY A HA3  2  
ATOM 3684  N N    . PHE A 1 49  ? 12.265  2.754   6.529   1.00 0.00 ? 49  PHE A N    2  
ATOM 3685  C CA   . PHE A 1 49  ? 10.827  2.621   6.588   1.00 0.00 ? 49  PHE A CA   2  
ATOM 3686  C C    . PHE A 1 49  ? 10.594  1.243   7.187   1.00 0.00 ? 49  PHE A C    2  
ATOM 3687  O O    . PHE A 1 49  ? 11.276  0.284   6.815   1.00 0.00 ? 49  PHE A O    2  
ATOM 3688  C CB   . PHE A 1 49  ? 10.202  2.758   5.191   1.00 0.00 ? 49  PHE A CB   2  
ATOM 3689  C CG   . PHE A 1 49  ? 10.160  4.185   4.672   1.00 0.00 ? 49  PHE A CG   2  
ATOM 3690  C CD1  . PHE A 1 49  ? 11.332  4.810   4.201   1.00 0.00 ? 49  PHE A CD1  2  
ATOM 3691  C CD2  . PHE A 1 49  ? 8.949   4.905   4.681   1.00 0.00 ? 49  PHE A CD2  2  
ATOM 3692  C CE1  . PHE A 1 49  ? 11.297  6.148   3.775   1.00 0.00 ? 49  PHE A CE1  2  
ATOM 3693  C CE2  . PHE A 1 49  ? 8.914   6.238   4.237   1.00 0.00 ? 49  PHE A CE2  2  
ATOM 3694  C CZ   . PHE A 1 49  ? 10.088  6.865   3.791   1.00 0.00 ? 49  PHE A CZ   2  
ATOM 3695  H H    . PHE A 1 49  ? 12.747  1.860   6.489   1.00 0.00 ? 49  PHE A H    2  
ATOM 3696  H HA   . PHE A 1 49  ? 10.411  3.381   7.250   1.00 0.00 ? 49  PHE A HA   2  
ATOM 3697  H HB2  . PHE A 1 49  ? 10.751  2.134   4.484   1.00 0.00 ? 49  PHE A HB2  2  
ATOM 3698  H HB3  . PHE A 1 49  ? 9.182   2.374   5.236   1.00 0.00 ? 49  PHE A HB3  2  
ATOM 3699  H HD1  . PHE A 1 49  ? 12.271  4.274   4.188   1.00 0.00 ? 49  PHE A HD1  2  
ATOM 3700  H HD2  . PHE A 1 49  ? 8.037   4.442   5.028   1.00 0.00 ? 49  PHE A HD2  2  
ATOM 3701  H HE1  . PHE A 1 49  ? 12.207  6.623   3.443   1.00 0.00 ? 49  PHE A HE1  2  
ATOM 3702  H HE2  . PHE A 1 49  ? 7.979   6.779   4.241   1.00 0.00 ? 49  PHE A HE2  2  
ATOM 3703  H HZ   . PHE A 1 49  ? 10.056  7.893   3.460   1.00 0.00 ? 49  PHE A HZ   2  
ATOM 3704  N N    . ASP A 1 50  ? 9.631   1.145   8.096   1.00 0.00 ? 50  ASP A N    2  
ATOM 3705  C CA   . ASP A 1 50  ? 9.144   -0.118  8.626   1.00 0.00 ? 50  ASP A CA   2  
ATOM 3706  C C    . ASP A 1 50  ? 7.691   -0.238  8.167   1.00 0.00 ? 50  ASP A C    2  
ATOM 3707  O O    . ASP A 1 50  ? 7.060   0.780   7.862   1.00 0.00 ? 50  ASP A O    2  
ATOM 3708  C CB   . ASP A 1 50  ? 9.217   -0.176  10.159  1.00 0.00 ? 50  ASP A CB   2  
ATOM 3709  C CG   . ASP A 1 50  ? 10.607  -0.239  10.800  1.00 0.00 ? 50  ASP A CG   2  
ATOM 3710  O OD1  . ASP A 1 50  ? 11.638  -0.495  10.133  1.00 0.00 ? 50  ASP A OD1  2  
ATOM 3711  O OD2  . ASP A 1 50  ? 10.674  -0.069  12.039  1.00 0.00 ? 50  ASP A OD2  2  
ATOM 3712  H H    . ASP A 1 50  ? 9.027   1.934   8.271   1.00 0.00 ? 50  ASP A H    2  
ATOM 3713  H HA   . ASP A 1 50  ? 9.731   -0.934  8.212   1.00 0.00 ? 50  ASP A HA   2  
ATOM 3714  H HB2  . ASP A 1 50  ? 8.674   0.675   10.573  1.00 0.00 ? 50  ASP A HB2  2  
ATOM 3715  H HB3  . ASP A 1 50  ? 8.699   -1.081  10.467  1.00 0.00 ? 50  ASP A HB3  2  
ATOM 3716  N N    . VAL A 1 51  ? 7.143   -1.455  8.129   1.00 0.00 ? 51  VAL A N    2  
ATOM 3717  C CA   . VAL A 1 51  ? 5.882   -1.731  7.454   1.00 0.00 ? 51  VAL A CA   2  
ATOM 3718  C C    . VAL A 1 51  ? 4.872   -2.191  8.492   1.00 0.00 ? 51  VAL A C    2  
ATOM 3719  O O    . VAL A 1 51  ? 4.883   -3.342  8.927   1.00 0.00 ? 51  VAL A O    2  
ATOM 3720  C CB   . VAL A 1 51  ? 6.145   -2.653  6.255   1.00 0.00 ? 51  VAL A CB   2  
ATOM 3721  C CG1  . VAL A 1 51  ? 6.697   -4.051  6.535   1.00 0.00 ? 51  VAL A CG1  2  
ATOM 3722  C CG2  . VAL A 1 51  ? 4.905   -2.773  5.374   1.00 0.00 ? 51  VAL A CG2  2  
ATOM 3723  H H    . VAL A 1 51  ? 7.671   -2.266  8.438   1.00 0.00 ? 51  VAL A H    2  
ATOM 3724  H HA   . VAL A 1 51  ? 5.502   -0.798  7.031   1.00 0.00 ? 51  VAL A HA   2  
ATOM 3725  H HB   . VAL A 1 51  ? 6.911   -2.151  5.692   1.00 0.00 ? 51  VAL A HB   2  
ATOM 3726  H HG11 . VAL A 1 51  ? 7.092   -4.490  5.618   1.00 0.00 ? 51  VAL A HG11 2  
ATOM 3727  H HG12 . VAL A 1 51  ? 7.496   -4.025  7.269   1.00 0.00 ? 51  VAL A HG12 2  
ATOM 3728  H HG13 . VAL A 1 51  ? 5.887   -4.680  6.880   1.00 0.00 ? 51  VAL A HG13 2  
ATOM 3729  H HG21 . VAL A 1 51  ? 4.052   -3.050  5.985   1.00 0.00 ? 51  VAL A HG21 2  
ATOM 3730  H HG22 . VAL A 1 51  ? 4.705   -1.823  4.882   1.00 0.00 ? 51  VAL A HG22 2  
ATOM 3731  H HG23 . VAL A 1 51  ? 5.053   -3.548  4.627   1.00 0.00 ? 51  VAL A HG23 2  
ATOM 3732  N N    . VAL A 1 52  ? 4.090   -1.231  8.972   1.00 0.00 ? 52  VAL A N    2  
ATOM 3733  C CA   . VAL A 1 52  ? 3.307   -1.301  10.189  1.00 0.00 ? 52  VAL A CA   2  
ATOM 3734  C C    . VAL A 1 52  ? 1.983   -1.996  9.867   1.00 0.00 ? 52  VAL A C    2  
ATOM 3735  O O    . VAL A 1 52  ? 1.213   -1.460  9.066   1.00 0.00 ? 52  VAL A O    2  
ATOM 3736  C CB   . VAL A 1 52  ? 3.102   0.129   10.749  1.00 0.00 ? 52  VAL A CB   2  
ATOM 3737  C CG1  . VAL A 1 52  ? 2.712   0.075   12.230  1.00 0.00 ? 52  VAL A CG1  2  
ATOM 3738  C CG2  . VAL A 1 52  ? 4.333   1.055   10.628  1.00 0.00 ? 52  VAL A CG2  2  
ATOM 3739  H H    . VAL A 1 52  ? 4.051   -0.348  8.472   1.00 0.00 ? 52  VAL A H    2  
ATOM 3740  H HA   . VAL A 1 52  ? 3.863   -1.889  10.909  1.00 0.00 ? 52  VAL A HA   2  
ATOM 3741  H HB   . VAL A 1 52  ? 2.294   0.602   10.197  1.00 0.00 ? 52  VAL A HB   2  
ATOM 3742  H HG11 . VAL A 1 52  ? 3.557   -0.255  12.834  1.00 0.00 ? 52  VAL A HG11 2  
ATOM 3743  H HG12 . VAL A 1 52  ? 2.382   1.057   12.569  1.00 0.00 ? 52  VAL A HG12 2  
ATOM 3744  H HG13 . VAL A 1 52  ? 1.900   -0.636  12.379  1.00 0.00 ? 52  VAL A HG13 2  
ATOM 3745  H HG21 . VAL A 1 52  ? 4.574   1.234   9.580   1.00 0.00 ? 52  VAL A HG21 2  
ATOM 3746  H HG22 . VAL A 1 52  ? 4.113   2.022   11.080  1.00 0.00 ? 52  VAL A HG22 2  
ATOM 3747  H HG23 . VAL A 1 52  ? 5.196   0.611   11.123  1.00 0.00 ? 52  VAL A HG23 2  
ATOM 3748  N N    . THR A 1 53  ? 1.698   -3.162  10.447  1.00 0.00 ? 53  THR A N    2  
ATOM 3749  C CA   . THR A 1 53  ? 0.418   -3.844  10.279  1.00 0.00 ? 53  THR A CA   2  
ATOM 3750  C C    . THR A 1 53  ? -0.556  -3.358  11.349  1.00 0.00 ? 53  THR A C    2  
ATOM 3751  O O    . THR A 1 53  ? -0.161  -2.994  12.464  1.00 0.00 ? 53  THR A O    2  
ATOM 3752  C CB   . THR A 1 53  ? 0.587   -5.367  10.371  1.00 0.00 ? 53  THR A CB   2  
ATOM 3753  O OG1  . THR A 1 53  ? 1.013   -5.779  11.646  1.00 0.00 ? 53  THR A OG1  2  
ATOM 3754  C CG2  . THR A 1 53  ? 1.615   -5.876  9.369   1.00 0.00 ? 53  THR A CG2  2  
ATOM 3755  H H    . THR A 1 53  ? 2.283   -3.500  11.205  1.00 0.00 ? 53  THR A H    2  
ATOM 3756  H HA   . THR A 1 53  ? 0.011   -3.604  9.290   1.00 0.00 ? 53  THR A HA   2  
ATOM 3757  H HB   . THR A 1 53  ? -0.376  -5.832  10.165  1.00 0.00 ? 53  THR A HB   2  
ATOM 3758  H HG1  . THR A 1 53  ? 1.098   -6.751  11.628  1.00 0.00 ? 53  THR A HG1  2  
ATOM 3759  H HG21 . THR A 1 53  ? 1.601   -6.965  9.375   1.00 0.00 ? 53  THR A HG21 2  
ATOM 3760  H HG22 . THR A 1 53  ? 1.351   -5.529  8.373   1.00 0.00 ? 53  THR A HG22 2  
ATOM 3761  H HG23 . THR A 1 53  ? 2.613   -5.523  9.629   1.00 0.00 ? 53  THR A HG23 2  
ATOM 3762  N N    . LEU A 1 54  ? -1.851  -3.374  11.030  1.00 0.00 ? 54  LEU A N    2  
ATOM 3763  C CA   . LEU A 1 54  ? -2.860  -2.711  11.853  1.00 0.00 ? 54  LEU A CA   2  
ATOM 3764  C C    . LEU A 1 54  ? -2.986  -3.352  13.232  1.00 0.00 ? 54  LEU A C    2  
ATOM 3765  O O    . LEU A 1 54  ? -3.356  -2.659  14.181  1.00 0.00 ? 54  LEU A O    2  
ATOM 3766  C CB   . LEU A 1 54  ? -4.232  -2.692  11.154  1.00 0.00 ? 54  LEU A CB   2  
ATOM 3767  C CG   . LEU A 1 54  ? -4.329  -1.877  9.848   1.00 0.00 ? 54  LEU A CG   2  
ATOM 3768  C CD1  . LEU A 1 54  ? -3.781  -0.451  9.995   1.00 0.00 ? 54  LEU A CD1  2  
ATOM 3769  C CD2  . LEU A 1 54  ? -3.611  -2.519  8.676   1.00 0.00 ? 54  LEU A CD2  2  
ATOM 3770  H H    . LEU A 1 54  ? -2.127  -3.724  10.121  1.00 0.00 ? 54  LEU A H    2  
ATOM 3771  H HA   . LEU A 1 54  ? -2.538  -1.683  12.023  1.00 0.00 ? 54  LEU A HA   2  
ATOM 3772  H HB2  . LEU A 1 54  ? -4.552  -3.719  10.965  1.00 0.00 ? 54  LEU A HB2  2  
ATOM 3773  H HB3  . LEU A 1 54  ? -4.950  -2.263  11.854  1.00 0.00 ? 54  LEU A HB3  2  
ATOM 3774  H HG   . LEU A 1 54  ? -5.379  -1.860  9.561   1.00 0.00 ? 54  LEU A HG   2  
ATOM 3775  H HD11 . LEU A 1 54  ? -4.253  0.050   10.836  1.00 0.00 ? 54  LEU A HD11 2  
ATOM 3776  H HD12 . LEU A 1 54  ? -2.712  -0.489  10.182  1.00 0.00 ? 54  LEU A HD12 2  
ATOM 3777  H HD13 . LEU A 1 54  ? -3.896  0.116   9.072   1.00 0.00 ? 54  LEU A HD13 2  
ATOM 3778  H HD21 . LEU A 1 54  ? -2.542  -2.311  8.713   1.00 0.00 ? 54  LEU A HD21 2  
ATOM 3779  H HD22 . LEU A 1 54  ? -3.775  -3.591  8.727   1.00 0.00 ? 54  LEU A HD22 2  
ATOM 3780  H HD23 . LEU A 1 54  ? -4.014  -2.136  7.739   1.00 0.00 ? 54  LEU A HD23 2  
ATOM 3781  N N    . SER A 1 55  ? -2.625  -4.632  13.371  1.00 0.00 ? 55  SER A N    2  
ATOM 3782  C CA   . SER A 1 55  ? -2.666  -5.365  14.620  1.00 0.00 ? 55  SER A CA   2  
ATOM 3783  C C    . SER A 1 55  ? -1.734  -4.698  15.627  1.00 0.00 ? 55  SER A C    2  
ATOM 3784  O O    . SER A 1 55  ? -2.046  -4.676  16.817  1.00 0.00 ? 55  SER A O    2  
ATOM 3785  C CB   . SER A 1 55  ? -2.226  -6.817  14.391  1.00 0.00 ? 55  SER A CB   2  
ATOM 3786  O OG   . SER A 1 55  ? -2.589  -7.309  13.109  1.00 0.00 ? 55  SER A OG   2  
ATOM 3787  H H    . SER A 1 55  ? -2.190  -5.136  12.620  1.00 0.00 ? 55  SER A H    2  
ATOM 3788  H HA   . SER A 1 55  ? -3.689  -5.358  14.998  1.00 0.00 ? 55  SER A HA   2  
ATOM 3789  H HB2  . SER A 1 55  ? -1.138  -6.867  14.467  1.00 0.00 ? 55  SER A HB2  2  
ATOM 3790  H HB3  . SER A 1 55  ? -2.656  -7.449  15.168  1.00 0.00 ? 55  SER A HB3  2  
ATOM 3791  H HG   . SER A 1 55  ? -3.544  -7.539  13.112  1.00 0.00 ? 55  SER A HG   2  
ATOM 3792  N N    . GLY A 1 56  ? -0.628  -4.114  15.149  1.00 0.00 ? 56  GLY A N    2  
ATOM 3793  C CA   . GLY A 1 56  ? 0.316   -3.376  15.958  1.00 0.00 ? 56  GLY A CA   2  
ATOM 3794  C C    . GLY A 1 56  ? 1.773   -3.588  15.549  1.00 0.00 ? 56  GLY A C    2  
ATOM 3795  O O    . GLY A 1 56  ? 2.635   -2.836  16.005  1.00 0.00 ? 56  GLY A O    2  
ATOM 3796  H H    . GLY A 1 56  ? -0.471  -4.079  14.146  1.00 0.00 ? 56  GLY A H    2  
ATOM 3797  H HA2  . GLY A 1 56  ? 0.074   -2.314  15.925  1.00 0.00 ? 56  GLY A HA2  2  
ATOM 3798  H HA3  . GLY A 1 56  ? 0.196   -3.731  16.972  1.00 0.00 ? 56  GLY A HA3  2  
ATOM 3799  N N    . THR A 1 57  ? 2.067   -4.607  14.744  1.00 0.00 ? 57  THR A N    2  
ATOM 3800  C CA   . THR A 1 57  ? 3.390   -5.043  14.335  1.00 0.00 ? 57  THR A CA   2  
ATOM 3801  C C    . THR A 1 57  ? 4.026   -4.028  13.383  1.00 0.00 ? 57  THR A C    2  
ATOM 3802  O O    . THR A 1 57  ? 3.335   -3.211  12.779  1.00 0.00 ? 57  THR A O    2  
ATOM 3803  C CB   . THR A 1 57  ? 3.244   -6.440  13.694  1.00 0.00 ? 57  THR A CB   2  
ATOM 3804  O OG1  . THR A 1 57  ? 2.084   -7.130  14.137  1.00 0.00 ? 57  THR A OG1  2  
ATOM 3805  C CG2  . THR A 1 57  ? 4.409   -7.359  14.033  1.00 0.00 ? 57  THR A CG2  2  
ATOM 3806  H H    . THR A 1 57  ? 1.360   -5.222  14.375  1.00 0.00 ? 57  THR A H    2  
ATOM 3807  H HA   . THR A 1 57  ? 4.026   -5.121  15.203  1.00 0.00 ? 57  THR A HA   2  
ATOM 3808  H HB   . THR A 1 57  ? 3.193   -6.326  12.614  1.00 0.00 ? 57  THR A HB   2  
ATOM 3809  H HG1  . THR A 1 57  ? 1.810   -7.711  13.403  1.00 0.00 ? 57  THR A HG1  2  
ATOM 3810  H HG21 . THR A 1 57  ? 4.265   -8.314  13.528  1.00 0.00 ? 57  THR A HG21 2  
ATOM 3811  H HG22 . THR A 1 57  ? 5.342   -6.914  13.689  1.00 0.00 ? 57  THR A HG22 2  
ATOM 3812  H HG23 . THR A 1 57  ? 4.442   -7.523  15.111  1.00 0.00 ? 57  THR A HG23 2  
ATOM 3813  N N    . ARG A 1 58  ? 5.344   -4.106  13.184  1.00 0.00 ? 58  ARG A N    2  
ATOM 3814  C CA   . ARG A 1 58  ? 6.006   -3.590  11.995  1.00 0.00 ? 58  ARG A CA   2  
ATOM 3815  C C    . ARG A 1 58  ? 7.221   -4.446  11.678  1.00 0.00 ? 58  ARG A C    2  
ATOM 3816  O O    . ARG A 1 58  ? 7.766   -5.073  12.588  1.00 0.00 ? 58  ARG A O    2  
ATOM 3817  C CB   . ARG A 1 58  ? 6.379   -2.106  12.117  1.00 0.00 ? 58  ARG A CB   2  
ATOM 3818  C CG   . ARG A 1 58  ? 7.541   -1.730  13.058  1.00 0.00 ? 58  ARG A CG   2  
ATOM 3819  C CD   . ARG A 1 58  ? 7.078   -1.342  14.459  1.00 0.00 ? 58  ARG A CD   2  
ATOM 3820  N NE   . ARG A 1 58  ? 7.397   -2.354  15.474  1.00 0.00 ? 58  ARG A NE   2  
ATOM 3821  C CZ   . ARG A 1 58  ? 6.765   -2.443  16.649  1.00 0.00 ? 58  ARG A CZ   2  
ATOM 3822  N NH1  . ARG A 1 58  ? 5.740   -1.647  16.933  1.00 0.00 ? 58  ARG A NH1  2  
ATOM 3823  N NH2  . ARG A 1 58  ? 7.162   -3.337  17.545  1.00 0.00 ? 58  ARG A NH2  2  
ATOM 3824  H H    . ARG A 1 58  ? 5.866   -4.824  13.660  1.00 0.00 ? 58  ARG A H    2  
ATOM 3825  H HA   . ARG A 1 58  ? 5.297   -3.696  11.180  1.00 0.00 ? 58  ARG A HA   2  
ATOM 3826  H HB2  . ARG A 1 58  ? 6.662   -1.804  11.117  1.00 0.00 ? 58  ARG A HB2  2  
ATOM 3827  H HB3  . ARG A 1 58  ? 5.496   -1.525  12.374  1.00 0.00 ? 58  ARG A HB3  2  
ATOM 3828  H HG2  . ARG A 1 58  ? 8.280   -2.527  13.109  1.00 0.00 ? 58  ARG A HG2  2  
ATOM 3829  H HG3  . ARG A 1 58  ? 8.025   -0.848  12.646  1.00 0.00 ? 58  ARG A HG3  2  
ATOM 3830  H HD2  . ARG A 1 58  ? 7.557   -0.404  14.749  1.00 0.00 ? 58  ARG A HD2  2  
ATOM 3831  H HD3  . ARG A 1 58  ? 6.004   -1.185  14.429  1.00 0.00 ? 58  ARG A HD3  2  
ATOM 3832  H HE   . ARG A 1 58  ? 8.145   -2.995  15.249  1.00 0.00 ? 58  ARG A HE   2  
ATOM 3833  H HH11 . ARG A 1 58  ? 5.412   -0.926  16.283  1.00 0.00 ? 58  ARG A HH11 2  
ATOM 3834  H HH12 . ARG A 1 58  ? 5.165   -1.781  17.760  1.00 0.00 ? 58  ARG A HH12 2  
ATOM 3835  H HH21 . ARG A 1 58  ? 7.888   -4.009  17.355  1.00 0.00 ? 58  ARG A HH21 2  
ATOM 3836  H HH22 . ARG A 1 58  ? 6.608   -3.461  18.382  1.00 0.00 ? 58  ARG A HH22 2  
ATOM 3837  N N    . GLY A 1 59  ? 7.663   -4.445  10.420  1.00 0.00 ? 59  GLY A N    2  
ATOM 3838  C CA   . GLY A 1 59  ? 8.851   -5.175  9.990   1.00 0.00 ? 59  GLY A CA   2  
ATOM 3839  C C    . GLY A 1 59  ? 9.807   -4.247  9.251   1.00 0.00 ? 59  GLY A C    2  
ATOM 3840  O O    . GLY A 1 59  ? 9.378   -3.194  8.781   1.00 0.00 ? 59  GLY A O    2  
ATOM 3841  H H    . GLY A 1 59  ? 7.177   -3.912  9.708   1.00 0.00 ? 59  GLY A H    2  
ATOM 3842  H HA2  . GLY A 1 59  ? 9.368   -5.597  10.853  1.00 0.00 ? 59  GLY A HA2  2  
ATOM 3843  H HA3  . GLY A 1 59  ? 8.563   -5.989  9.330   1.00 0.00 ? 59  GLY A HA3  2  
ATOM 3844  N N    . PRO A 1 60  ? 11.094  -4.612  9.148   1.00 0.00 ? 60  PRO A N    2  
ATOM 3845  C CA   . PRO A 1 60  ? 12.177  -3.727  8.730   1.00 0.00 ? 60  PRO A CA   2  
ATOM 3846  C C    . PRO A 1 60  ? 12.282  -3.644  7.201   1.00 0.00 ? 60  PRO A C    2  
ATOM 3847  O O    . PRO A 1 60  ? 13.258  -4.106  6.609   1.00 0.00 ? 60  PRO A O    2  
ATOM 3848  C CB   . PRO A 1 60  ? 13.423  -4.321  9.395   1.00 0.00 ? 60  PRO A CB   2  
ATOM 3849  C CG   . PRO A 1 60  ? 13.123  -5.817  9.389   1.00 0.00 ? 60  PRO A CG   2  
ATOM 3850  C CD   . PRO A 1 60  ? 11.622  -5.885  9.605   1.00 0.00 ? 60  PRO A CD   2  
ATOM 3851  H HA   . PRO A 1 60  ? 12.010  -2.725  9.121   1.00 0.00 ? 60  PRO A HA   2  
ATOM 3852  H HB2  . PRO A 1 60  ? 14.348  -4.080  8.870   1.00 0.00 ? 60  PRO A HB2  2  
ATOM 3853  H HB3  . PRO A 1 60  ? 13.483  -3.977  10.427  1.00 0.00 ? 60  PRO A HB3  2  
ATOM 3854  H HG2  . PRO A 1 60  ? 13.383  -6.254  8.427   1.00 0.00 ? 60  PRO A HG2  2  
ATOM 3855  H HG3  . PRO A 1 60  ? 13.623  -6.318  10.205  1.00 0.00 ? 60  PRO A HG3  2  
ATOM 3856  H HD2  . PRO A 1 60  ? 11.193  -6.714  9.041   1.00 0.00 ? 60  PRO A HD2  2  
ATOM 3857  H HD3  . PRO A 1 60  ? 11.426  -6.009  10.670  1.00 0.00 ? 60  PRO A HD3  2  
ATOM 3858  N N    . LEU A 1 61  ? 11.244  -3.093  6.566   1.00 0.00 ? 61  LEU A N    2  
ATOM 3859  C CA   . LEU A 1 61  ? 11.102  -2.880  5.118   1.00 0.00 ? 61  LEU A CA   2  
ATOM 3860  C C    . LEU A 1 61  ? 12.403  -2.385  4.520   1.00 0.00 ? 61  LEU A C    2  
ATOM 3861  O O    . LEU A 1 61  ? 12.908  -3.041  3.617   1.00 0.00 ? 61  LEU A O    2  
ATOM 3862  C CB   . LEU A 1 61  ? 9.938   -1.914  4.824   1.00 0.00 ? 61  LEU A CB   2  
ATOM 3863  C CG   . LEU A 1 61  ? 9.002   -2.323  3.667   1.00 0.00 ? 61  LEU A CG   2  
ATOM 3864  C CD1  . LEU A 1 61  ? 8.273   -1.057  3.212   1.00 0.00 ? 61  LEU A CD1  2  
ATOM 3865  C CD2  . LEU A 1 61  ? 9.664   -2.900  2.419   1.00 0.00 ? 61  LEU A CD2  2  
ATOM 3866  H H    . LEU A 1 61  ? 10.497  -2.817  7.188   1.00 0.00 ? 61  LEU A H    2  
ATOM 3867  H HA   . LEU A 1 61  ? 10.918  -3.814  4.587   1.00 0.00 ? 61  LEU A HA   2  
ATOM 3868  H HB2  . LEU A 1 61  ? 9.322   -1.806  5.717   1.00 0.00 ? 61  LEU A HB2  2  
ATOM 3869  H HB3  . LEU A 1 61  ? 10.351  -0.926  4.613   1.00 0.00 ? 61  LEU A HB3  2  
ATOM 3870  H HG   . LEU A 1 61  ? 8.283   -3.053  4.035   1.00 0.00 ? 61  LEU A HG   2  
ATOM 3871  H HD11 . LEU A 1 61  ? 7.802   -0.579  4.068   1.00 0.00 ? 61  LEU A HD11 2  
ATOM 3872  H HD12 . LEU A 1 61  ? 8.995   -0.370  2.761   1.00 0.00 ? 61  LEU A HD12 2  
ATOM 3873  H HD13 . LEU A 1 61  ? 7.507   -1.313  2.481   1.00 0.00 ? 61  LEU A HD13 2  
ATOM 3874  H HD21 . LEU A 1 61  ? 10.364  -2.173  2.026   1.00 0.00 ? 61  LEU A HD21 2  
ATOM 3875  H HD22 . LEU A 1 61  ? 10.167  -3.844  2.631   1.00 0.00 ? 61  LEU A HD22 2  
ATOM 3876  H HD23 . LEU A 1 61  ? 8.903   -3.106  1.668   1.00 0.00 ? 61  LEU A HD23 2  
ATOM 3877  N N    . SER A 1 62  ? 12.958  -1.280  5.018   1.00 0.00 ? 62  SER A N    2  
ATOM 3878  C CA   . SER A 1 62  ? 14.245  -0.785  4.568   1.00 0.00 ? 62  SER A CA   2  
ATOM 3879  C C    . SER A 1 62  ? 14.998  -0.181  5.746   1.00 0.00 ? 62  SER A C    2  
ATOM 3880  O O    . SER A 1 62  ? 14.381  0.420   6.629   1.00 0.00 ? 62  SER A O    2  
ATOM 3881  C CB   . SER A 1 62  ? 14.013  0.253   3.454   1.00 0.00 ? 62  SER A CB   2  
ATOM 3882  O OG   . SER A 1 62  ? 14.710  -0.069  2.277   1.00 0.00 ? 62  SER A OG   2  
ATOM 3883  H H    . SER A 1 62  ? 12.509  -0.798  5.793   1.00 0.00 ? 62  SER A H    2  
ATOM 3884  H HA   . SER A 1 62  ? 14.808  -1.641  4.197   1.00 0.00 ? 62  SER A HA   2  
ATOM 3885  H HB2  . SER A 1 62  ? 12.952  0.288   3.206   1.00 0.00 ? 62  SER A HB2  2  
ATOM 3886  H HB3  . SER A 1 62  ? 14.345  1.246   3.772   1.00 0.00 ? 62  SER A HB3  2  
ATOM 3887  H HG   . SER A 1 62  ? 15.301  -0.815  2.471   1.00 0.00 ? 62  SER A HG   2  
ATOM 3888  N N    . ARG A 1 63  ? 16.330  -0.280  5.735   1.00 0.00 ? 63  ARG A N    2  
ATOM 3889  C CA   . ARG A 1 63  ? 17.227  0.368   6.689   1.00 0.00 ? 63  ARG A CA   2  
ATOM 3890  C C    . ARG A 1 63  ? 18.532  0.721   5.973   1.00 0.00 ? 63  ARG A C    2  
ATOM 3891  O O    . ARG A 1 63  ? 18.777  0.201   4.882   1.00 0.00 ? 63  ARG A O    2  
ATOM 3892  C CB   . ARG A 1 63  ? 17.468  -0.611  7.845   1.00 0.00 ? 63  ARG A CB   2  
ATOM 3893  C CG   . ARG A 1 63  ? 17.958  0.093   9.112   1.00 0.00 ? 63  ARG A CG   2  
ATOM 3894  C CD   . ARG A 1 63  ? 17.834  -0.881  10.281  1.00 0.00 ? 63  ARG A CD   2  
ATOM 3895  N NE   . ARG A 1 63  ? 18.311  -0.289  11.531  1.00 0.00 ? 63  ARG A NE   2  
ATOM 3896  C CZ   . ARG A 1 63  ? 18.181  -0.822  12.745  1.00 0.00 ? 63  ARG A CZ   2  
ATOM 3897  N NH1  . ARG A 1 63  ? 17.630  -2.015  12.949  1.00 0.00 ? 63  ARG A NH1  2  
ATOM 3898  N NH2  . ARG A 1 63  ? 18.642  -0.115  13.765  1.00 0.00 ? 63  ARG A NH2  2  
ATOM 3899  H H    . ARG A 1 63  ? 16.804  -0.819  5.013   1.00 0.00 ? 63  ARG A H    2  
ATOM 3900  H HA   . ARG A 1 63  ? 16.749  1.274   7.067   1.00 0.00 ? 63  ARG A HA   2  
ATOM 3901  H HB2  . ARG A 1 63  ? 16.528  -1.112  8.079   1.00 0.00 ? 63  ARG A HB2  2  
ATOM 3902  H HB3  . ARG A 1 63  ? 18.187  -1.376  7.543   1.00 0.00 ? 63  ARG A HB3  2  
ATOM 3903  H HG2  . ARG A 1 63  ? 18.994  0.404   8.993   1.00 0.00 ? 63  ARG A HG2  2  
ATOM 3904  H HG3  . ARG A 1 63  ? 17.341  0.971   9.306   1.00 0.00 ? 63  ARG A HG3  2  
ATOM 3905  H HD2  . ARG A 1 63  ? 16.784  -1.155  10.396  1.00 0.00 ? 63  ARG A HD2  2  
ATOM 3906  H HD3  . ARG A 1 63  ? 18.416  -1.776  10.065  1.00 0.00 ? 63  ARG A HD3  2  
ATOM 3907  H HE   . ARG A 1 63  ? 18.769  0.616   11.447  1.00 0.00 ? 63  ARG A HE   2  
ATOM 3908  H HH11 . ARG A 1 63  ? 17.280  -2.571  12.158  1.00 0.00 ? 63  ARG A HH11 2  
ATOM 3909  H HH12 . ARG A 1 63  ? 17.513  -2.434  13.864  1.00 0.00 ? 63  ARG A HH12 2  
ATOM 3910  H HH21 . ARG A 1 63  ? 19.025  0.801   13.532  1.00 0.00 ? 63  ARG A HH21 2  
ATOM 3911  H HH22 . ARG A 1 63  ? 18.467  -0.300  14.749  1.00 0.00 ? 63  ARG A HH22 2  
ATOM 3912  N N    . VAL A 1 64  ? 19.341  1.632   6.523   1.00 0.00 ? 64  VAL A N    2  
ATOM 3913  C CA   . VAL A 1 64  ? 20.643  1.973   5.998   1.00 0.00 ? 64  VAL A CA   2  
ATOM 3914  C C    . VAL A 1 64  ? 21.560  0.742   6.045   1.00 0.00 ? 64  VAL A C    2  
ATOM 3915  O O    . VAL A 1 64  ? 21.365  -0.135  6.893   1.00 0.00 ? 64  VAL A O    2  
ATOM 3916  C CB   . VAL A 1 64  ? 21.209  3.145   6.826   1.00 0.00 ? 64  VAL A CB   2  
ATOM 3917  C CG1  . VAL A 1 64  ? 20.209  4.285   7.088   1.00 0.00 ? 64  VAL A CG1  2  
ATOM 3918  C CG2  . VAL A 1 64  ? 21.801  2.728   8.185   1.00 0.00 ? 64  VAL A CG2  2  
ATOM 3919  H H    . VAL A 1 64  ? 19.161  2.128   7.376   1.00 0.00 ? 64  VAL A H    2  
ATOM 3920  H HA   . VAL A 1 64  ? 20.516  2.309   4.963   1.00 0.00 ? 64  VAL A HA   2  
ATOM 3921  H HB   . VAL A 1 64  ? 21.997  3.560   6.233   1.00 0.00 ? 64  VAL A HB   2  
ATOM 3922  H HG11 . VAL A 1 64  ? 19.695  4.537   6.163   1.00 0.00 ? 64  VAL A HG11 2  
ATOM 3923  H HG12 . VAL A 1 64  ? 19.486  3.993   7.847   1.00 0.00 ? 64  VAL A HG12 2  
ATOM 3924  H HG13 . VAL A 1 64  ? 20.745  5.167   7.440   1.00 0.00 ? 64  VAL A HG13 2  
ATOM 3925  H HG21 . VAL A 1 64  ? 21.047  2.221   8.788   1.00 0.00 ? 64  VAL A HG21 2  
ATOM 3926  H HG22 . VAL A 1 64  ? 22.645  2.050   8.033   1.00 0.00 ? 64  VAL A HG22 2  
ATOM 3927  H HG23 . VAL A 1 64  ? 22.168  3.602   8.722   1.00 0.00 ? 64  VAL A HG23 2  
ATOM 3928  N N    . GLY A 1 65  ? 22.631  0.736   5.254   1.00 0.00 ? 65  GLY A N    2  
ATOM 3929  C CA   . GLY A 1 65  ? 23.631  -0.313  5.270   1.00 0.00 ? 65  GLY A CA   2  
ATOM 3930  C C    . GLY A 1 65  ? 24.960  0.210   4.726   1.00 0.00 ? 65  GLY A C    2  
ATOM 3931  O O    . GLY A 1 65  ? 25.251  1.410   4.790   1.00 0.00 ? 65  GLY A O    2  
ATOM 3932  H H    . GLY A 1 65  ? 22.786  1.464   4.570   1.00 0.00 ? 65  GLY A H    2  
ATOM 3933  H HA2  . GLY A 1 65  ? 23.760  -0.673  6.288   1.00 0.00 ? 65  GLY A HA2  2  
ATOM 3934  H HA3  . GLY A 1 65  ? 23.273  -1.135  4.658   1.00 0.00 ? 65  GLY A HA3  2  
ATOM 3935  N N    . LEU A 1 66  ? 25.794  -0.694  4.222   1.00 0.00 ? 66  LEU A N    2  
ATOM 3936  C CA   . LEU A 1 66  ? 26.795  -0.368  3.206   1.00 0.00 ? 66  LEU A CA   2  
ATOM 3937  C C    . LEU A 1 66  ? 26.061  -0.297  1.859   1.00 0.00 ? 66  LEU A C    2  
ATOM 3938  O O    . LEU A 1 66  ? 24.917  -0.761  1.763   1.00 0.00 ? 66  LEU A O    2  
ATOM 3939  C CB   . LEU A 1 66  ? 27.908  -1.433  3.195   1.00 0.00 ? 66  LEU A CB   2  
ATOM 3940  C CG   . LEU A 1 66  ? 29.148  -1.040  4.019   1.00 0.00 ? 66  LEU A CG   2  
ATOM 3941  C CD1  . LEU A 1 66  ? 28.827  -0.898  5.513   1.00 0.00 ? 66  LEU A CD1  2  
ATOM 3942  C CD2  . LEU A 1 66  ? 30.236  -2.105  3.843   1.00 0.00 ? 66  LEU A CD2  2  
ATOM 3943  H H    . LEU A 1 66  ? 25.452  -1.643  4.192   1.00 0.00 ? 66  LEU A H    2  
ATOM 3944  H HA   . LEU A 1 66  ? 27.239  0.606   3.411   1.00 0.00 ? 66  LEU A HA   2  
ATOM 3945  H HB2  . LEU A 1 66  ? 27.529  -2.390  3.544   1.00 0.00 ? 66  LEU A HB2  2  
ATOM 3946  H HB3  . LEU A 1 66  ? 28.225  -1.585  2.168   1.00 0.00 ? 66  LEU A HB3  2  
ATOM 3947  H HG   . LEU A 1 66  ? 29.534  -0.088  3.653   1.00 0.00 ? 66  LEU A HG   2  
ATOM 3948  H HD11 . LEU A 1 66  ? 29.741  -0.679  6.066   1.00 0.00 ? 66  LEU A HD11 2  
ATOM 3949  H HD12 . LEU A 1 66  ? 28.131  -0.074  5.668   1.00 0.00 ? 66  LEU A HD12 2  
ATOM 3950  H HD13 . LEU A 1 66  ? 28.383  -1.820  5.886   1.00 0.00 ? 66  LEU A HD13 2  
ATOM 3951  H HD21 . LEU A 1 66  ? 31.134  -1.811  4.387   1.00 0.00 ? 66  LEU A HD21 2  
ATOM 3952  H HD22 . LEU A 1 66  ? 29.884  -3.069  4.208   1.00 0.00 ? 66  LEU A HD22 2  
ATOM 3953  H HD23 . LEU A 1 66  ? 30.493  -2.192  2.786   1.00 0.00 ? 66  LEU A HD23 2  
ATOM 3954  N N    . GLU A 1 67  ? 26.678  0.252   0.817   1.00 0.00 ? 67  GLU A N    2  
ATOM 3955  C CA   . GLU A 1 67  ? 26.068  0.318   -0.505  1.00 0.00 ? 67  GLU A CA   2  
ATOM 3956  C C    . GLU A 1 67  ? 26.452  -0.934  -1.309  1.00 0.00 ? 67  GLU A C    2  
ATOM 3957  O O    . GLU A 1 67  ? 27.529  -1.492  -1.081  1.00 0.00 ? 67  GLU A O    2  
ATOM 3958  C CB   . GLU A 1 67  ? 26.439  1.626   -1.219  1.00 0.00 ? 67  GLU A CB   2  
ATOM 3959  C CG   . GLU A 1 67  ? 27.909  1.797   -1.642  1.00 0.00 ? 67  GLU A CG   2  
ATOM 3960  C CD   . GLU A 1 67  ? 28.012  2.691   -2.883  1.00 0.00 ? 67  GLU A CD   2  
ATOM 3961  O OE1  . GLU A 1 67  ? 27.677  2.200   -3.989  1.00 0.00 ? 67  GLU A OE1  2  
ATOM 3962  O OE2  . GLU A 1 67  ? 28.401  3.876   -2.773  1.00 0.00 ? 67  GLU A OE2  2  
ATOM 3963  H H    . GLU A 1 67  ? 27.672  0.434   0.852   1.00 0.00 ? 67  GLU A H    2  
ATOM 3964  H HA   . GLU A 1 67  ? 24.987  0.336   -0.374  1.00 0.00 ? 67  GLU A HA   2  
ATOM 3965  H HB2  . GLU A 1 67  ? 25.811  1.679   -2.103  1.00 0.00 ? 67  GLU A HB2  2  
ATOM 3966  H HB3  . GLU A 1 67  ? 26.157  2.464   -0.583  1.00 0.00 ? 67  GLU A HB3  2  
ATOM 3967  H HG2  . GLU A 1 67  ? 28.480  2.218   -0.814  1.00 0.00 ? 67  GLU A HG2  2  
ATOM 3968  H HG3  . GLU A 1 67  ? 28.350  0.832   -1.886  1.00 0.00 ? 67  GLU A HG3  2  
ATOM 3969  N N    . PRO A 1 68  ? 25.602  -1.418  -2.227  1.00 0.00 ? 68  PRO A N    2  
ATOM 3970  C CA   . PRO A 1 68  ? 25.909  -2.600  -3.016  1.00 0.00 ? 68  PRO A CA   2  
ATOM 3971  C C    . PRO A 1 68  ? 26.959  -2.266  -4.084  1.00 0.00 ? 68  PRO A C    2  
ATOM 3972  O O    . PRO A 1 68  ? 26.741  -1.359  -4.887  1.00 0.00 ? 68  PRO A O    2  
ATOM 3973  C CB   . PRO A 1 68  ? 24.587  -3.053  -3.625  1.00 0.00 ? 68  PRO A CB   2  
ATOM 3974  C CG   . PRO A 1 68  ? 23.716  -1.794  -3.626  1.00 0.00 ? 68  PRO A CG   2  
ATOM 3975  C CD   . PRO A 1 68  ? 24.257  -0.944  -2.477  1.00 0.00 ? 68  PRO A CD   2  
ATOM 3976  H HA   . PRO A 1 68  ? 26.272  -3.389  -2.355  1.00 0.00 ? 68  PRO A HA   2  
ATOM 3977  H HB2  . PRO A 1 68  ? 24.713  -3.466  -4.627  1.00 0.00 ? 68  PRO A HB2  2  
ATOM 3978  H HB3  . PRO A 1 68  ? 24.172  -3.802  -2.958  1.00 0.00 ? 68  PRO A HB3  2  
ATOM 3979  H HG2  . PRO A 1 68  ? 23.861  -1.252  -4.562  1.00 0.00 ? 68  PRO A HG2  2  
ATOM 3980  H HG3  . PRO A 1 68  ? 22.663  -2.037  -3.483  1.00 0.00 ? 68  PRO A HG3  2  
ATOM 3981  H HD2  . PRO A 1 68  ? 24.256  0.106   -2.771  1.00 0.00 ? 68  PRO A HD2  2  
ATOM 3982  H HD3  . PRO A 1 68  ? 23.685  -1.084  -1.559  1.00 0.00 ? 68  PRO A HD3  2  
ATOM 3983  N N    . PRO A 1 69  ? 28.084  -2.995  -4.113  1.00 0.00 ? 69  PRO A N    2  
ATOM 3984  C CA   . PRO A 1 69  ? 29.152  -2.786  -5.078  1.00 0.00 ? 69  PRO A CA   2  
ATOM 3985  C C    . PRO A 1 69  ? 28.752  -3.321  -6.463  1.00 0.00 ? 69  PRO A C    2  
ATOM 3986  O O    . PRO A 1 69  ? 27.843  -4.145  -6.564  1.00 0.00 ? 69  PRO A O    2  
ATOM 3987  C CB   . PRO A 1 69  ? 30.359  -3.521  -4.487  1.00 0.00 ? 69  PRO A CB   2  
ATOM 3988  C CG   . PRO A 1 69  ? 29.760  -4.603  -3.583  1.00 0.00 ? 69  PRO A CG   2  
ATOM 3989  C CD   . PRO A 1 69  ? 28.381  -4.090  -3.210  1.00 0.00 ? 69  PRO A CD   2  
ATOM 3990  H HA   . PRO A 1 69  ? 29.373  -1.720  -5.149  1.00 0.00 ? 69  PRO A HA   2  
ATOM 3991  H HB2  . PRO A 1 69  ? 30.997  -3.960  -5.255  1.00 0.00 ? 69  PRO A HB2  2  
ATOM 3992  H HB3  . PRO A 1 69  ? 30.932  -2.813  -3.891  1.00 0.00 ? 69  PRO A HB3  2  
ATOM 3993  H HG2  . PRO A 1 69  ? 29.642  -5.531  -4.137  1.00 0.00 ? 69  PRO A HG2  2  
ATOM 3994  H HG3  . PRO A 1 69  ? 30.353  -4.757  -2.685  1.00 0.00 ? 69  PRO A HG3  2  
ATOM 3995  H HD2  . PRO A 1 69  ? 27.645  -4.880  -3.320  1.00 0.00 ? 69  PRO A HD2  2  
ATOM 3996  H HD3  . PRO A 1 69  ? 28.349  -3.745  -2.181  1.00 0.00 ? 69  PRO A HD3  2  
ATOM 3997  N N    . PRO A 1 70  ? 29.460  -2.952  -7.544  1.00 0.00 ? 70  PRO A N    2  
ATOM 3998  C CA   . PRO A 1 70  ? 29.082  -3.344  -8.902  1.00 0.00 ? 70  PRO A CA   2  
ATOM 3999  C C    . PRO A 1 70  ? 29.329  -4.831  -9.209  1.00 0.00 ? 70  PRO A C    2  
ATOM 4000  O O    . PRO A 1 70  ? 28.822  -5.337  -10.208 1.00 0.00 ? 70  PRO A O    2  
ATOM 4001  C CB   . PRO A 1 70  ? 29.880  -2.417  -9.823  1.00 0.00 ? 70  PRO A CB   2  
ATOM 4002  C CG   . PRO A 1 70  ? 31.111  -2.046  -8.996  1.00 0.00 ? 70  PRO A CG   2  
ATOM 4003  C CD   . PRO A 1 70  ? 30.587  -2.033  -7.559  1.00 0.00 ? 70  PRO A CD   2  
ATOM 4004  H HA   . PRO A 1 70  ? 28.019  -3.145  -9.048  1.00 0.00 ? 70  PRO A HA   2  
ATOM 4005  H HB2  . PRO A 1 70  ? 30.154  -2.898  -10.763 1.00 0.00 ? 70  PRO A HB2  2  
ATOM 4006  H HB3  . PRO A 1 70  ? 29.294  -1.519  -10.017 1.00 0.00 ? 70  PRO A HB3  2  
ATOM 4007  H HG2  . PRO A 1 70  ? 31.868  -2.824  -9.101  1.00 0.00 ? 70  PRO A HG2  2  
ATOM 4008  H HG3  . PRO A 1 70  ? 31.516  -1.076  -9.286  1.00 0.00 ? 70  PRO A HG3  2  
ATOM 4009  H HD2  . PRO A 1 70  ? 31.373  -2.353  -6.877  1.00 0.00 ? 70  PRO A HD2  2  
ATOM 4010  H HD3  . PRO A 1 70  ? 30.243  -1.036  -7.280  1.00 0.00 ? 70  PRO A HD3  2  
ATOM 4011  N N    . GLY A 1 71  ? 30.069  -5.557  -8.361  1.00 0.00 ? 71  GLY A N    2  
ATOM 4012  C CA   . GLY A 1 71  ? 30.240  -7.010  -8.451  1.00 0.00 ? 71  GLY A CA   2  
ATOM 4013  C C    . GLY A 1 71  ? 29.115  -7.787  -7.756  1.00 0.00 ? 71  GLY A C    2  
ATOM 4014  O O    . GLY A 1 71  ? 29.215  -8.999  -7.585  1.00 0.00 ? 71  GLY A O    2  
ATOM 4015  H H    . GLY A 1 71  ? 30.441  -5.092  -7.548  1.00 0.00 ? 71  GLY A H    2  
ATOM 4016  H HA2  . GLY A 1 71  ? 30.273  -7.315  -9.498  1.00 0.00 ? 71  GLY A HA2  2  
ATOM 4017  H HA3  . GLY A 1 71  ? 31.187  -7.286  -7.987  1.00 0.00 ? 71  GLY A HA3  2  
ATOM 4018  N N    . LYS A 1 72  ? 28.072  -7.091  -7.315  1.00 0.00 ? 72  LYS A N    2  
ATOM 4019  C CA   . LYS A 1 72  ? 26.914  -7.515  -6.539  1.00 0.00 ? 72  LYS A CA   2  
ATOM 4020  C C    . LYS A 1 72  ? 25.745  -6.742  -7.155  1.00 0.00 ? 72  LYS A C    2  
ATOM 4021  O O    . LYS A 1 72  ? 25.934  -5.814  -7.950  1.00 0.00 ? 72  LYS A O    2  
ATOM 4022  C CB   . LYS A 1 72  ? 27.233  -7.146  -5.075  1.00 0.00 ? 72  LYS A CB   2  
ATOM 4023  C CG   . LYS A 1 72  ? 26.135  -7.279  -4.016  1.00 0.00 ? 72  LYS A CG   2  
ATOM 4024  C CD   . LYS A 1 72  ? 25.792  -8.720  -3.632  1.00 0.00 ? 72  LYS A CD   2  
ATOM 4025  C CE   . LYS A 1 72  ? 24.419  -8.714  -2.957  1.00 0.00 ? 72  LYS A CE   2  
ATOM 4026  N NZ   . LYS A 1 72  ? 24.344  -9.515  -1.714  1.00 0.00 ? 72  LYS A NZ   2  
ATOM 4027  H H    . LYS A 1 72  ? 28.022  -6.104  -7.549  1.00 0.00 ? 72  LYS A H    2  
ATOM 4028  H HA   . LYS A 1 72  ? 26.714  -8.588  -6.594  1.00 0.00 ? 72  LYS A HA   2  
ATOM 4029  H HB2  . LYS A 1 72  ? 28.088  -7.740  -4.749  1.00 0.00 ? 72  LYS A HB2  2  
ATOM 4030  H HB3  . LYS A 1 72  ? 27.540  -6.106  -5.066  1.00 0.00 ? 72  LYS A HB3  2  
ATOM 4031  H HG2  . LYS A 1 72  ? 26.493  -6.789  -3.113  1.00 0.00 ? 72  LYS A HG2  2  
ATOM 4032  H HG3  . LYS A 1 72  ? 25.247  -6.739  -4.339  1.00 0.00 ? 72  LYS A HG3  2  
ATOM 4033  H HD2  . LYS A 1 72  ? 25.750  -9.351  -4.517  1.00 0.00 ? 72  LYS A HD2  2  
ATOM 4034  H HD3  . LYS A 1 72  ? 26.561  -9.091  -2.957  1.00 0.00 ? 72  LYS A HD3  2  
ATOM 4035  H HE2  . LYS A 1 72  ? 24.170  -7.681  -2.716  1.00 0.00 ? 72  LYS A HE2  2  
ATOM 4036  H HE3  . LYS A 1 72  ? 23.701  -9.074  -3.697  1.00 0.00 ? 72  LYS A HE3  2  
ATOM 4037  H HZ1  . LYS A 1 72  ? 23.465  -9.340  -1.227  1.00 0.00 ? 72  LYS A HZ1  2  
ATOM 4038  H HZ2  . LYS A 1 72  ? 24.447  -10.511 -1.889  1.00 0.00 ? 72  LYS A HZ2  2  
ATOM 4039  H HZ3  . LYS A 1 72  ? 25.097  -9.276  -1.075  1.00 0.00 ? 72  LYS A HZ3  2  
ATOM 4040  N N    . ARG A 1 73  ? 24.517  -7.069  -6.786  1.00 0.00 ? 73  ARG A N    2  
ATOM 4041  C CA   . ARG A 1 73  ? 23.415  -6.120  -6.818  1.00 0.00 ? 73  ARG A CA   2  
ATOM 4042  C C    . ARG A 1 73  ? 22.627  -6.390  -5.548  1.00 0.00 ? 73  ARG A C    2  
ATOM 4043  O O    . ARG A 1 73  ? 22.646  -7.514  -5.049  1.00 0.00 ? 73  ARG A O    2  
ATOM 4044  C CB   . ARG A 1 73  ? 22.605  -6.295  -8.115  1.00 0.00 ? 73  ARG A CB   2  
ATOM 4045  C CG   . ARG A 1 73  ? 21.385  -5.366  -8.240  1.00 0.00 ? 73  ARG A CG   2  
ATOM 4046  C CD   . ARG A 1 73  ? 21.658  -3.864  -8.076  1.00 0.00 ? 73  ARG A CD   2  
ATOM 4047  N NE   . ARG A 1 73  ? 22.567  -3.328  -9.103  1.00 0.00 ? 73  ARG A NE   2  
ATOM 4048  C CZ   . ARG A 1 73  ? 22.340  -2.308  -9.940  1.00 0.00 ? 73  ARG A CZ   2  
ATOM 4049  N NH1  . ARG A 1 73  ? 21.206  -1.622  -9.900  1.00 0.00 ? 73  ARG A NH1  2  
ATOM 4050  N NH2  . ARG A 1 73  ? 23.269  -1.971  -10.826 1.00 0.00 ? 73  ARG A NH2  2  
ATOM 4051  H H    . ARG A 1 73  ? 24.367  -7.849  -6.156  1.00 0.00 ? 73  ARG A H    2  
ATOM 4052  H HA   . ARG A 1 73  ? 23.823  -5.110  -6.783  1.00 0.00 ? 73  ARG A HA   2  
ATOM 4053  H HB2  . ARG A 1 73  ? 23.265  -6.118  -8.965  1.00 0.00 ? 73  ARG A HB2  2  
ATOM 4054  H HB3  . ARG A 1 73  ? 22.255  -7.327  -8.178  1.00 0.00 ? 73  ARG A HB3  2  
ATOM 4055  H HG2  . ARG A 1 73  ? 20.937  -5.531  -9.217  1.00 0.00 ? 73  ARG A HG2  2  
ATOM 4056  H HG3  . ARG A 1 73  ? 20.649  -5.650  -7.490  1.00 0.00 ? 73  ARG A HG3  2  
ATOM 4057  H HD2  . ARG A 1 73  ? 20.698  -3.350  -8.114  1.00 0.00 ? 73  ARG A HD2  2  
ATOM 4058  H HD3  . ARG A 1 73  ? 22.094  -3.677  -7.096  1.00 0.00 ? 73  ARG A HD3  2  
ATOM 4059  H HE   . ARG A 1 73  ? 23.485  -3.766  -9.163  1.00 0.00 ? 73  ARG A HE   2  
ATOM 4060  H HH11 . ARG A 1 73  ? 20.494  -1.796  -9.198  1.00 0.00 ? 73  ARG A HH11 2  
ATOM 4061  H HH12 . ARG A 1 73  ? 21.000  -0.900  -10.593 1.00 0.00 ? 73  ARG A HH12 2  
ATOM 4062  H HH21 . ARG A 1 73  ? 24.175  -2.429  -10.780 1.00 0.00 ? 73  ARG A HH21 2  
ATOM 4063  H HH22 . ARG A 1 73  ? 23.180  -1.157  -11.428 1.00 0.00 ? 73  ARG A HH22 2  
ATOM 4064  N N    . GLU A 1 74  ? 21.985  -5.370  -4.991  1.00 0.00 ? 74  GLU A N    2  
ATOM 4065  C CA   . GLU A 1 74  ? 21.079  -5.539  -3.873  1.00 0.00 ? 74  GLU A CA   2  
ATOM 4066  C C    . GLU A 1 74  ? 20.042  -4.424  -3.967  1.00 0.00 ? 74  GLU A C    2  
ATOM 4067  O O    . GLU A 1 74  ? 20.316  -3.350  -4.524  1.00 0.00 ? 74  GLU A O    2  
ATOM 4068  C CB   . GLU A 1 74  ? 21.875  -5.540  -2.555  1.00 0.00 ? 74  GLU A CB   2  
ATOM 4069  C CG   . GLU A 1 74  ? 21.204  -6.408  -1.482  1.00 0.00 ? 74  GLU A CG   2  
ATOM 4070  C CD   . GLU A 1 74  ? 22.207  -7.014  -0.502  1.00 0.00 ? 74  GLU A CD   2  
ATOM 4071  O OE1  . GLU A 1 74  ? 23.051  -6.280  0.055   1.00 0.00 ? 74  GLU A OE1  2  
ATOM 4072  O OE2  . GLU A 1 74  ? 22.176  -8.253  -0.313  1.00 0.00 ? 74  GLU A OE2  2  
ATOM 4073  H H    . GLU A 1 74  ? 21.977  -4.448  -5.396  1.00 0.00 ? 74  GLU A H    2  
ATOM 4074  H HA   . GLU A 1 74  ? 20.576  -6.500  -3.992  1.00 0.00 ? 74  GLU A HA   2  
ATOM 4075  H HB2  . GLU A 1 74  ? 22.863  -5.957  -2.749  1.00 0.00 ? 74  GLU A HB2  2  
ATOM 4076  H HB3  . GLU A 1 74  ? 21.998  -4.520  -2.192  1.00 0.00 ? 74  GLU A HB3  2  
ATOM 4077  H HG2  . GLU A 1 74  ? 20.449  -5.836  -0.947  1.00 0.00 ? 74  GLU A HG2  2  
ATOM 4078  H HG3  . GLU A 1 74  ? 20.708  -7.237  -1.974  1.00 0.00 ? 74  GLU A HG3  2  
ATOM 4079  N N    . CYS A 1 75  ? 18.836  -4.706  -3.485  1.00 0.00 ? 75  CYS A N    2  
ATOM 4080  C CA   . CYS A 1 75  ? 17.642  -3.908  -3.703  1.00 0.00 ? 75  CYS A CA   2  
ATOM 4081  C C    . CYS A 1 75  ? 17.666  -2.670  -2.806  1.00 0.00 ? 75  CYS A C    2  
ATOM 4082  O O    . CYS A 1 75  ? 17.292  -2.765  -1.643  1.00 0.00 ? 75  CYS A O    2  
ATOM 4083  C CB   . CYS A 1 75  ? 16.428  -4.782  -3.375  1.00 0.00 ? 75  CYS A CB   2  
ATOM 4084  S SG   . CYS A 1 75  ? 16.470  -6.302  -4.365  1.00 0.00 ? 75  CYS A SG   2  
ATOM 4085  H H    . CYS A 1 75  ? 18.684  -5.609  -3.053  1.00 0.00 ? 75  CYS A H    2  
ATOM 4086  H HA   . CYS A 1 75  ? 17.587  -3.613  -4.752  1.00 0.00 ? 75  CYS A HA   2  
ATOM 4087  H HB2  . CYS A 1 75  ? 16.459  -5.056  -2.318  1.00 0.00 ? 75  CYS A HB2  2  
ATOM 4088  H HB3  . CYS A 1 75  ? 15.507  -4.221  -3.551  1.00 0.00 ? 75  CYS A HB3  2  
ATOM 4089  H HG   . CYS A 1 75  ? 16.035  -5.819  -5.538  1.00 0.00 ? 75  CYS A HG   2  
ATOM 4090  N N    . ARG A 1 76  ? 18.078  -1.498  -3.295  1.00 0.00 ? 76  ARG A N    2  
ATOM 4091  C CA   . ARG A 1 76  ? 18.050  -0.255  -2.506  1.00 0.00 ? 76  ARG A CA   2  
ATOM 4092  C C    . ARG A 1 76  ? 17.141  0.775   -3.141  1.00 0.00 ? 76  ARG A C    2  
ATOM 4093  O O    . ARG A 1 76  ? 16.791  0.652   -4.316  1.00 0.00 ? 76  ARG A O    2  
ATOM 4094  C CB   . ARG A 1 76  ? 19.458  0.293   -2.239  1.00 0.00 ? 76  ARG A CB   2  
ATOM 4095  C CG   . ARG A 1 76  ? 20.317  0.569   -3.472  1.00 0.00 ? 76  ARG A CG   2  
ATOM 4096  C CD   . ARG A 1 76  ? 20.265  1.984   -4.067  1.00 0.00 ? 76  ARG A CD   2  
ATOM 4097  N NE   . ARG A 1 76  ? 21.533  2.269   -4.772  1.00 0.00 ? 76  ARG A NE   2  
ATOM 4098  C CZ   . ARG A 1 76  ? 21.816  2.094   -6.071  1.00 0.00 ? 76  ARG A CZ   2  
ATOM 4099  N NH1  . ARG A 1 76  ? 20.865  1.968   -6.988  1.00 0.00 ? 76  ARG A NH1  2  
ATOM 4100  N NH2  . ARG A 1 76  ? 23.077  2.014   -6.461  1.00 0.00 ? 76  ARG A NH2  2  
ATOM 4101  H H    . ARG A 1 76  ? 18.323  -1.444  -4.273  1.00 0.00 ? 76  ARG A H    2  
ATOM 4102  H HA   . ARG A 1 76  ? 17.620  -0.483  -1.528  1.00 0.00 ? 76  ARG A HA   2  
ATOM 4103  H HB2  . ARG A 1 76  ? 19.388  1.211   -1.660  1.00 0.00 ? 76  ARG A HB2  2  
ATOM 4104  H HB3  . ARG A 1 76  ? 19.981  -0.444  -1.628  1.00 0.00 ? 76  ARG A HB3  2  
ATOM 4105  H HG2  . ARG A 1 76  ? 21.339  0.370   -3.161  1.00 0.00 ? 76  ARG A HG2  2  
ATOM 4106  H HG3  . ARG A 1 76  ? 20.031  -0.131  -4.243  1.00 0.00 ? 76  ARG A HG3  2  
ATOM 4107  H HD2  . ARG A 1 76  ? 19.409  2.076   -4.736  1.00 0.00 ? 76  ARG A HD2  2  
ATOM 4108  H HD3  . ARG A 1 76  ? 20.152  2.704   -3.257  1.00 0.00 ? 76  ARG A HD3  2  
ATOM 4109  H HE   . ARG A 1 76  ? 22.292  2.567   -4.157  1.00 0.00 ? 76  ARG A HE   2  
ATOM 4110  H HH11 . ARG A 1 76  ? 19.909  2.238   -6.755  1.00 0.00 ? 76  ARG A HH11 2  
ATOM 4111  H HH12 . ARG A 1 76  ? 21.081  1.877   -7.969  1.00 0.00 ? 76  ARG A HH12 2  
ATOM 4112  H HH21 . ARG A 1 76  ? 23.832  2.036   -5.771  1.00 0.00 ? 76  ARG A HH21 2  
ATOM 4113  H HH22 . ARG A 1 76  ? 23.367  2.026   -7.438  1.00 0.00 ? 76  ARG A HH22 2  
ATOM 4114  N N    . VAL A 1 77  ? 16.745  1.769   -2.347  1.00 0.00 ? 77  VAL A N    2  
ATOM 4115  C CA   . VAL A 1 77  ? 15.582  2.606   -2.657  1.00 0.00 ? 77  VAL A CA   2  
ATOM 4116  C C    . VAL A 1 77  ? 15.787  4.091   -2.318  1.00 0.00 ? 77  VAL A C    2  
ATOM 4117  O O    . VAL A 1 77  ? 14.918  4.911   -2.629  1.00 0.00 ? 77  VAL A O    2  
ATOM 4118  C CB   . VAL A 1 77  ? 14.318  2.015   -1.988  1.00 0.00 ? 77  VAL A CB   2  
ATOM 4119  C CG1  . VAL A 1 77  ? 13.996  0.605   -2.491  1.00 0.00 ? 77  VAL A CG1  2  
ATOM 4120  C CG2  . VAL A 1 77  ? 14.400  2.004   -0.454  1.00 0.00 ? 77  VAL A CG2  2  
ATOM 4121  H H    . VAL A 1 77  ? 17.100  1.750   -1.393  1.00 0.00 ? 77  VAL A H    2  
ATOM 4122  H HA   . VAL A 1 77  ? 15.409  2.574   -3.733  1.00 0.00 ? 77  VAL A HA   2  
ATOM 4123  H HB   . VAL A 1 77  ? 13.469  2.620   -2.288  1.00 0.00 ? 77  VAL A HB   2  
ATOM 4124  H HG11 . VAL A 1 77  ? 13.945  0.629   -3.580  1.00 0.00 ? 77  VAL A HG11 2  
ATOM 4125  H HG12 . VAL A 1 77  ? 14.750  -0.113  -2.171  1.00 0.00 ? 77  VAL A HG12 2  
ATOM 4126  H HG13 . VAL A 1 77  ? 13.025  0.290   -2.106  1.00 0.00 ? 77  VAL A HG13 2  
ATOM 4127  H HG21 . VAL A 1 77  ? 13.466  1.622   -0.040  1.00 0.00 ? 77  VAL A HG21 2  
ATOM 4128  H HG22 . VAL A 1 77  ? 15.213  1.363   -0.113  1.00 0.00 ? 77  VAL A HG22 2  
ATOM 4129  H HG23 . VAL A 1 77  ? 14.547  3.015   -0.078  1.00 0.00 ? 77  VAL A HG23 2  
ATOM 4130  N N    . GLY A 1 78  ? 16.923  4.463   -1.716  1.00 0.00 ? 78  GLY A N    2  
ATOM 4131  C CA   . GLY A 1 78  ? 17.244  5.846   -1.377  1.00 0.00 ? 78  GLY A CA   2  
ATOM 4132  C C    . GLY A 1 78  ? 17.807  5.922   0.033   1.00 0.00 ? 78  GLY A C    2  
ATOM 4133  O O    . GLY A 1 78  ? 17.069  6.283   0.946   1.00 0.00 ? 78  GLY A O    2  
ATOM 4134  H H    . GLY A 1 78  ? 17.613  3.758   -1.503  1.00 0.00 ? 78  GLY A H    2  
ATOM 4135  H HA2  . GLY A 1 78  ? 17.964  6.243   -2.087  1.00 0.00 ? 78  GLY A HA2  2  
ATOM 4136  H HA3  . GLY A 1 78  ? 16.348  6.466   -1.425  1.00 0.00 ? 78  GLY A HA3  2  
ATOM 4137  N N    . GLN A 1 79  ? 19.080  5.547   0.212   1.00 0.00 ? 79  GLN A N    2  
ATOM 4138  C CA   . GLN A 1 79  ? 19.840  5.407   1.468   1.00 0.00 ? 79  GLN A CA   2  
ATOM 4139  C C    . GLN A 1 79  ? 19.648  4.027   2.086   1.00 0.00 ? 79  GLN A C    2  
ATOM 4140  O O    . GLN A 1 79  ? 20.547  3.540   2.764   1.00 0.00 ? 79  GLN A O    2  
ATOM 4141  C CB   . GLN A 1 79  ? 19.502  6.487   2.513   1.00 0.00 ? 79  GLN A CB   2  
ATOM 4142  C CG   . GLN A 1 79  ? 20.489  6.588   3.687   1.00 0.00 ? 79  GLN A CG   2  
ATOM 4143  C CD   . GLN A 1 79  ? 20.286  7.853   4.525   1.00 0.00 ? 79  GLN A CD   2  
ATOM 4144  O OE1  . GLN A 1 79  ? 21.224  8.422   5.080   1.00 0.00 ? 79  GLN A OE1  2  
ATOM 4145  N NE2  . GLN A 1 79  ? 19.067  8.338   4.685   1.00 0.00 ? 79  GLN A NE2  2  
ATOM 4146  H H    . GLN A 1 79  ? 19.598  5.279   -0.622  1.00 0.00 ? 79  GLN A H    2  
ATOM 4147  H HA   . GLN A 1 79  ? 20.893  5.504   1.223   1.00 0.00 ? 79  GLN A HA   2  
ATOM 4148  H HB2  . GLN A 1 79  ? 19.467  7.453   2.012   1.00 0.00 ? 79  GLN A HB2  2  
ATOM 4149  H HB3  . GLN A 1 79  ? 18.534  6.245   2.948   1.00 0.00 ? 79  GLN A HB3  2  
ATOM 4150  H HG2  . GLN A 1 79  ? 20.367  5.718   4.332   1.00 0.00 ? 79  GLN A HG2  2  
ATOM 4151  H HG3  . GLN A 1 79  ? 21.503  6.596   3.293   1.00 0.00 ? 79  GLN A HG3  2  
ATOM 4152  H HE21 . GLN A 1 79  ? 18.283  7.896   4.224   1.00 0.00 ? 79  GLN A HE21 2  
ATOM 4153  H HE22 . GLN A 1 79  ? 18.985  9.311   4.970   1.00 0.00 ? 79  GLN A HE22 2  
ATOM 4154  N N    . TYR A 1 80  ? 18.480  3.411   1.898   1.00 0.00 ? 80  TYR A N    2  
ATOM 4155  C CA   . TYR A 1 80  ? 18.150  2.156   2.530   1.00 0.00 ? 80  TYR A CA   2  
ATOM 4156  C C    . TYR A 1 80  ? 18.214  1.039   1.503   1.00 0.00 ? 80  TYR A C    2  
ATOM 4157  O O    . TYR A 1 80  ? 17.876  1.261   0.334   1.00 0.00 ? 80  TYR A O    2  
ATOM 4158  C CB   . TYR A 1 80  ? 16.747  2.266   3.115   1.00 0.00 ? 80  TYR A CB   2  
ATOM 4159  C CG   . TYR A 1 80  ? 16.431  3.613   3.721   1.00 0.00 ? 80  TYR A CG   2  
ATOM 4160  C CD1  . TYR A 1 80  ? 17.102  4.053   4.876   1.00 0.00 ? 80  TYR A CD1  2  
ATOM 4161  C CD2  . TYR A 1 80  ? 15.566  4.473   3.028   1.00 0.00 ? 80  TYR A CD2  2  
ATOM 4162  C CE1  . TYR A 1 80  ? 16.914  5.361   5.354   1.00 0.00 ? 80  TYR A CE1  2  
ATOM 4163  C CE2  . TYR A 1 80  ? 15.345  5.771   3.516   1.00 0.00 ? 80  TYR A CE2  2  
ATOM 4164  C CZ   . TYR A 1 80  ? 16.021  6.217   4.676   1.00 0.00 ? 80  TYR A CZ   2  
ATOM 4165  O OH   . TYR A 1 80  ? 15.925  7.517   5.054   1.00 0.00 ? 80  TYR A OH   2  
ATOM 4166  H H    . TYR A 1 80  ? 17.690  3.871   1.472   1.00 0.00 ? 80  TYR A H    2  
ATOM 4167  H HA   . TYR A 1 80  ? 18.856  1.967   3.334   1.00 0.00 ? 80  TYR A HA   2  
ATOM 4168  H HB2  . TYR A 1 80  ? 16.036  2.088   2.310   1.00 0.00 ? 80  TYR A HB2  2  
ATOM 4169  H HB3  . TYR A 1 80  ? 16.615  1.490   3.860   1.00 0.00 ? 80  TYR A HB3  2  
ATOM 4170  H HD1  . TYR A 1 80  ? 17.787  3.394   5.381   1.00 0.00 ? 80  TYR A HD1  2  
ATOM 4171  H HD2  . TYR A 1 80  ? 15.124  4.144   2.089   1.00 0.00 ? 80  TYR A HD2  2  
ATOM 4172  H HE1  . TYR A 1 80  ? 17.469  5.707   6.219   1.00 0.00 ? 80  TYR A HE1  2  
ATOM 4173  H HE2  . TYR A 1 80  ? 14.701  6.433   2.958   1.00 0.00 ? 80  TYR A HE2  2  
ATOM 4174  H HH   . TYR A 1 80  ? 16.022  8.051   4.249   1.00 0.00 ? 80  TYR A HH   2  
ATOM 4175  N N    . VAL A 1 81  ? 18.624  -0.147  1.936   1.00 0.00 ? 81  VAL A N    2  
ATOM 4176  C CA   . VAL A 1 81  ? 18.413  -1.390  1.213   1.00 0.00 ? 81  VAL A CA   2  
ATOM 4177  C C    . VAL A 1 81  ? 17.079  -1.947  1.729   1.00 0.00 ? 81  VAL A C    2  
ATOM 4178  O O    . VAL A 1 81  ? 16.791  -1.868  2.927   1.00 0.00 ? 81  VAL A O    2  
ATOM 4179  C CB   . VAL A 1 81  ? 19.656  -2.289  1.367   1.00 0.00 ? 81  VAL A CB   2  
ATOM 4180  C CG1  . VAL A 1 81  ? 19.772  -2.897  2.759   1.00 0.00 ? 81  VAL A CG1  2  
ATOM 4181  C CG2  . VAL A 1 81  ? 19.714  -3.399  0.315   1.00 0.00 ? 81  VAL A CG2  2  
ATOM 4182  H H    . VAL A 1 81  ? 18.830  -0.244  2.929   1.00 0.00 ? 81  VAL A H    2  
ATOM 4183  H HA   . VAL A 1 81  ? 18.318  -1.170  0.160   1.00 0.00 ? 81  VAL A HA   2  
ATOM 4184  H HB   . VAL A 1 81  ? 20.536  -1.663  1.205   1.00 0.00 ? 81  VAL A HB   2  
ATOM 4185  H HG11 . VAL A 1 81  ? 20.734  -3.394  2.856   1.00 0.00 ? 81  VAL A HG11 2  
ATOM 4186  H HG12 . VAL A 1 81  ? 19.690  -2.114  3.512   1.00 0.00 ? 81  VAL A HG12 2  
ATOM 4187  H HG13 . VAL A 1 81  ? 18.969  -3.621  2.889   1.00 0.00 ? 81  VAL A HG13 2  
ATOM 4188  H HG21 . VAL A 1 81  ? 19.762  -2.964  -0.682  1.00 0.00 ? 81  VAL A HG21 2  
ATOM 4189  H HG22 . VAL A 1 81  ? 20.611  -3.998  0.476   1.00 0.00 ? 81  VAL A HG22 2  
ATOM 4190  H HG23 . VAL A 1 81  ? 18.838  -4.046  0.393   1.00 0.00 ? 81  VAL A HG23 2  
ATOM 4191  N N    . VAL A 1 82  ? 16.186  -2.362  0.839   1.00 0.00 ? 82  VAL A N    2  
ATOM 4192  C CA   . VAL A 1 82  ? 14.903  -2.962  1.147   1.00 0.00 ? 82  VAL A CA   2  
ATOM 4193  C C    . VAL A 1 82  ? 15.085  -4.471  1.290   1.00 0.00 ? 82  VAL A C    2  
ATOM 4194  O O    . VAL A 1 82  ? 16.153  -5.009  0.975   1.00 0.00 ? 82  VAL A O    2  
ATOM 4195  C CB   . VAL A 1 82  ? 13.901  -2.572  0.039   1.00 0.00 ? 82  VAL A CB   2  
ATOM 4196  C CG1  . VAL A 1 82  ? 13.868  -3.525  -1.157  1.00 0.00 ? 82  VAL A CG1  2  
ATOM 4197  C CG2  . VAL A 1 82  ? 12.516  -2.391  0.657   1.00 0.00 ? 82  VAL A CG2  2  
ATOM 4198  H H    . VAL A 1 82  ? 16.426  -2.449  -0.137  1.00 0.00 ? 82  VAL A H    2  
ATOM 4199  H HA   . VAL A 1 82  ? 14.539  -2.560  2.088   1.00 0.00 ? 82  VAL A HA   2  
ATOM 4200  H HB   . VAL A 1 82  ? 14.196  -1.608  -0.374  1.00 0.00 ? 82  VAL A HB   2  
ATOM 4201  H HG11 . VAL A 1 82  ? 13.214  -3.129  -1.932  1.00 0.00 ? 82  VAL A HG11 2  
ATOM 4202  H HG12 . VAL A 1 82  ? 14.872  -3.616  -1.548  1.00 0.00 ? 82  VAL A HG12 2  
ATOM 4203  H HG13 . VAL A 1 82  ? 13.528  -4.519  -0.863  1.00 0.00 ? 82  VAL A HG13 2  
ATOM 4204  H HG21 . VAL A 1 82  ? 11.791  -2.130  -0.110  1.00 0.00 ? 82  VAL A HG21 2  
ATOM 4205  H HG22 . VAL A 1 82  ? 12.194  -3.287  1.202   1.00 0.00 ? 82  VAL A HG22 2  
ATOM 4206  H HG23 . VAL A 1 82  ? 12.572  -1.587  1.388   1.00 0.00 ? 82  VAL A HG23 2  
ATOM 4207  N N    . ASP A 1 83  ? 14.020  -5.167  1.671   1.00 0.00 ? 83  ASP A N    2  
ATOM 4208  C CA   . ASP A 1 83  ? 13.942  -6.610  1.540   1.00 0.00 ? 83  ASP A CA   2  
ATOM 4209  C C    . ASP A 1 83  ? 12.501  -7.021  1.251   1.00 0.00 ? 83  ASP A C    2  
ATOM 4210  O O    . ASP A 1 83  ? 11.583  -6.546  1.920   1.00 0.00 ? 83  ASP A O    2  
ATOM 4211  C CB   . ASP A 1 83  ? 14.463  -7.243  2.834   1.00 0.00 ? 83  ASP A CB   2  
ATOM 4212  C CG   . ASP A 1 83  ? 15.878  -7.800  2.713   1.00 0.00 ? 83  ASP A CG   2  
ATOM 4213  O OD1  . ASP A 1 83  ? 16.202  -8.484  1.713   1.00 0.00 ? 83  ASP A OD1  2  
ATOM 4214  O OD2  . ASP A 1 83  ? 16.674  -7.604  3.656   1.00 0.00 ? 83  ASP A OD2  2  
ATOM 4215  H H    . ASP A 1 83  ? 13.203  -4.690  2.043   1.00 0.00 ? 83  ASP A H    2  
ATOM 4216  H HA   . ASP A 1 83  ? 14.562  -6.931  0.709   1.00 0.00 ? 83  ASP A HA   2  
ATOM 4217  H HB2  . ASP A 1 83  ? 14.432  -6.486  3.617   1.00 0.00 ? 83  ASP A HB2  2  
ATOM 4218  H HB3  . ASP A 1 83  ? 13.814  -8.060  3.127   1.00 0.00 ? 83  ASP A HB3  2  
ATOM 4219  N N    . LEU A 1 84  ? 12.302  -7.934  0.293   1.00 0.00 ? 84  LEU A N    2  
ATOM 4220  C CA   . LEU A 1 84  ? 11.050  -8.682  0.110   1.00 0.00 ? 84  LEU A CA   2  
ATOM 4221  C C    . LEU A 1 84  ? 10.799  -9.503  1.366   1.00 0.00 ? 84  LEU A C    2  
ATOM 4222  O O    . LEU A 1 84  ? 9.673   -9.583  1.843   1.00 0.00 ? 84  LEU A O    2  
ATOM 4223  C CB   . LEU A 1 84  ? 11.149  -9.666  -1.073  1.00 0.00 ? 84  LEU A CB   2  
ATOM 4224  C CG   . LEU A 1 84  ? 10.856  -9.116  -2.484  1.00 0.00 ? 84  LEU A CG   2  
ATOM 4225  C CD1  . LEU A 1 84  ? 9.366   -8.881  -2.752  1.00 0.00 ? 84  LEU A CD1  2  
ATOM 4226  C CD2  . LEU A 1 84  ? 11.633  -7.837  -2.793  1.00 0.00 ? 84  LEU A CD2  2  
ATOM 4227  H H    . LEU A 1 84  ? 13.111  -8.289  -0.207  1.00 0.00 ? 84  LEU A H    2  
ATOM 4228  H HA   . LEU A 1 84  ? 10.218  -7.994  -0.035  1.00 0.00 ? 84  LEU A HA   2  
ATOM 4229  H HB2  . LEU A 1 84  ? 12.146  -10.107 -1.047  1.00 0.00 ? 84  LEU A HB2  2  
ATOM 4230  H HB3  . LEU A 1 84  ? 10.456  -10.490 -0.894  1.00 0.00 ? 84  LEU A HB3  2  
ATOM 4231  H HG   . LEU A 1 84  ? 11.155  -9.870  -3.208  1.00 0.00 ? 84  LEU A HG   2  
ATOM 4232  H HD11 . LEU A 1 84  ? 8.842   -9.838  -2.702  1.00 0.00 ? 84  LEU A HD11 2  
ATOM 4233  H HD12 . LEU A 1 84  ? 8.953   -8.182  -2.026  1.00 0.00 ? 84  LEU A HD12 2  
ATOM 4234  H HD13 . LEU A 1 84  ? 9.261   -8.462  -3.754  1.00 0.00 ? 84  LEU A HD13 2  
ATOM 4235  H HD21 . LEU A 1 84  ? 11.384  -7.053  -2.084  1.00 0.00 ? 84  LEU A HD21 2  
ATOM 4236  H HD22 . LEU A 1 84  ? 12.704  -8.037  -2.754  1.00 0.00 ? 84  LEU A HD22 2  
ATOM 4237  H HD23 . LEU A 1 84  ? 11.374  -7.491  -3.787  1.00 0.00 ? 84  LEU A HD23 2  
ATOM 4238  N N    . THR A 1 85  ? 11.868  -10.041 1.942   1.00 0.00 ? 85  THR A N    2  
ATOM 4239  C CA   . THR A 1 85  ? 11.869  -10.729 3.214   1.00 0.00 ? 85  THR A CA   2  
ATOM 4240  C C    . THR A 1 85  ? 11.191  -9.874  4.298   1.00 0.00 ? 85  THR A C    2  
ATOM 4241  O O    . THR A 1 85  ? 10.413  -10.379 5.104   1.00 0.00 ? 85  THR A O    2  
ATOM 4242  C CB   . THR A 1 85  ? 13.333  -11.046 3.538   1.00 0.00 ? 85  THR A CB   2  
ATOM 4243  O OG1  . THR A 1 85  ? 13.933  -11.875 2.562   1.00 0.00 ? 85  THR A OG1  2  
ATOM 4244  C CG2  . THR A 1 85  ? 13.490  -11.689 4.909   1.00 0.00 ? 85  THR A CG2  2  
ATOM 4245  H H    . THR A 1 85  ? 12.738  -9.988  1.432   1.00 0.00 ? 85  THR A H    2  
ATOM 4246  H HA   . THR A 1 85  ? 11.316  -11.658 3.107   1.00 0.00 ? 85  THR A HA   2  
ATOM 4247  H HB   . THR A 1 85  ? 13.889  -10.114 3.530   1.00 0.00 ? 85  THR A HB   2  
ATOM 4248  H HG1  . THR A 1 85  ? 13.279  -12.099 1.863   1.00 0.00 ? 85  THR A HG1  2  
ATOM 4249  H HG21 . THR A 1 85  ? 12.898  -12.602 4.960   1.00 0.00 ? 85  THR A HG21 2  
ATOM 4250  H HG22 . THR A 1 85  ? 14.543  -11.910 5.083   1.00 0.00 ? 85  THR A HG22 2  
ATOM 4251  H HG23 . THR A 1 85  ? 13.142  -11.005 5.680   1.00 0.00 ? 85  THR A HG23 2  
ATOM 4252  N N    . SER A 1 86  ? 11.462  -8.570  4.342   1.00 0.00 ? 86  SER A N    2  
ATOM 4253  C CA   . SER A 1 86  ? 10.877  -7.701  5.348   1.00 0.00 ? 86  SER A CA   2  
ATOM 4254  C C    . SER A 1 86  ? 9.416   -7.364  5.065   1.00 0.00 ? 86  SER A C    2  
ATOM 4255  O O    . SER A 1 86  ? 8.727   -6.905  5.976   1.00 0.00 ? 86  SER A O    2  
ATOM 4256  C CB   . SER A 1 86  ? 11.702  -6.433  5.440   1.00 0.00 ? 86  SER A CB   2  
ATOM 4257  O OG   . SER A 1 86  ? 13.033  -6.745  5.791   1.00 0.00 ? 86  SER A OG   2  
ATOM 4258  H H    . SER A 1 86  ? 12.051  -8.135  3.645   1.00 0.00 ? 86  SER A H    2  
ATOM 4259  H HA   . SER A 1 86  ? 10.909  -8.203  6.315   1.00 0.00 ? 86  SER A HA   2  
ATOM 4260  H HB2  . SER A 1 86  ? 11.686  -5.896  4.492   1.00 0.00 ? 86  SER A HB2  2  
ATOM 4261  H HB3  . SER A 1 86  ? 11.265  -5.823  6.222   1.00 0.00 ? 86  SER A HB3  2  
ATOM 4262  H HG   . SER A 1 86  ? 13.502  -5.887  5.857   1.00 0.00 ? 86  SER A HG   2  
ATOM 4263  N N    . PHE A 1 87  ? 8.931   -7.605  3.845   1.00 0.00 ? 87  PHE A N    2  
ATOM 4264  C CA   . PHE A 1 87  ? 7.509   -7.684  3.588   1.00 0.00 ? 87  PHE A CA   2  
ATOM 4265  C C    . PHE A 1 87  ? 7.001   -9.035  4.091   1.00 0.00 ? 87  PHE A C    2  
ATOM 4266  O O    . PHE A 1 87  ? 6.141   -9.033  4.958   1.00 0.00 ? 87  PHE A O    2  
ATOM 4267  C CB   . PHE A 1 87  ? 7.185   -7.457  2.104   1.00 0.00 ? 87  PHE A CB   2  
ATOM 4268  C CG   . PHE A 1 87  ? 6.911   -6.021  1.681   1.00 0.00 ? 87  PHE A CG   2  
ATOM 4269  C CD1  . PHE A 1 87  ? 6.021   -5.190  2.396   1.00 0.00 ? 87  PHE A CD1  2  
ATOM 4270  C CD2  . PHE A 1 87  ? 7.434   -5.560  0.461   1.00 0.00 ? 87  PHE A CD2  2  
ATOM 4271  C CE1  . PHE A 1 87  ? 5.663   -3.926  1.894   1.00 0.00 ? 87  PHE A CE1  2  
ATOM 4272  C CE2  . PHE A 1 87  ? 7.069   -4.299  -0.036  1.00 0.00 ? 87  PHE A CE2  2  
ATOM 4273  C CZ   . PHE A 1 87  ? 6.186   -3.476  0.676   1.00 0.00 ? 87  PHE A CZ   2  
ATOM 4274  H H    . PHE A 1 87  ? 9.545   -8.004  3.145   1.00 0.00 ? 87  PHE A H    2  
ATOM 4275  H HA   . PHE A 1 87  ? 7.008   -6.917  4.177   1.00 0.00 ? 87  PHE A HA   2  
ATOM 4276  H HB2  . PHE A 1 87  ? 7.994   -7.859  1.493   1.00 0.00 ? 87  PHE A HB2  2  
ATOM 4277  H HB3  . PHE A 1 87  ? 6.291   -8.028  1.856   1.00 0.00 ? 87  PHE A HB3  2  
ATOM 4278  H HD1  . PHE A 1 87  ? 5.578   -5.508  3.324   1.00 0.00 ? 87  PHE A HD1  2  
ATOM 4279  H HD2  . PHE A 1 87  ? 8.090   -6.194  -0.118  1.00 0.00 ? 87  PHE A HD2  2  
ATOM 4280  H HE1  . PHE A 1 87  ? 4.968   -3.301  2.433   1.00 0.00 ? 87  PHE A HE1  2  
ATOM 4281  H HE2  . PHE A 1 87  ? 7.458   -3.963  -0.980  1.00 0.00 ? 87  PHE A HE2  2  
ATOM 4282  H HZ   . PHE A 1 87  ? 5.905   -2.507  0.284   1.00 0.00 ? 87  PHE A HZ   2  
ATOM 4283  N N    . GLU A 1 88  ? 7.507   -10.175 3.604   1.00 0.00 ? 88  GLU A N    2  
ATOM 4284  C CA   . GLU A 1 88  ? 6.951   -11.515 3.870   1.00 0.00 ? 88  GLU A CA   2  
ATOM 4285  C C    . GLU A 1 88  ? 6.876   -11.876 5.362   1.00 0.00 ? 88  GLU A C    2  
ATOM 4286  O O    . GLU A 1 88  ? 6.095   -12.752 5.742   1.00 0.00 ? 88  GLU A O    2  
ATOM 4287  C CB   . GLU A 1 88  ? 7.679   -12.577 3.017   1.00 0.00 ? 88  GLU A CB   2  
ATOM 4288  C CG   . GLU A 1 88  ? 8.938   -13.180 3.665   1.00 0.00 ? 88  GLU A CG   2  
ATOM 4289  C CD   . GLU A 1 88  ? 9.910   -13.859 2.687   1.00 0.00 ? 88  GLU A CD   2  
ATOM 4290  O OE1  . GLU A 1 88  ? 10.063  -13.400 1.537   1.00 0.00 ? 88  GLU A OE1  2  
ATOM 4291  O OE2  . GLU A 1 88  ? 10.625  -14.802 3.099   1.00 0.00 ? 88  GLU A OE2  2  
ATOM 4292  H H    . GLU A 1 88  ? 8.265   -10.116 2.929   1.00 0.00 ? 88  GLU A H    2  
ATOM 4293  H HA   . GLU A 1 88  ? 5.917   -11.505 3.526   1.00 0.00 ? 88  GLU A HA   2  
ATOM 4294  H HB2  . GLU A 1 88  ? 6.988   -13.394 2.811   1.00 0.00 ? 88  GLU A HB2  2  
ATOM 4295  H HB3  . GLU A 1 88  ? 7.933   -12.113 2.065   1.00 0.00 ? 88  GLU A HB3  2  
ATOM 4296  H HG2  . GLU A 1 88  ? 9.480   -12.394 4.173   1.00 0.00 ? 88  GLU A HG2  2  
ATOM 4297  H HG3  . GLU A 1 88  ? 8.626   -13.897 4.423   1.00 0.00 ? 88  GLU A HG3  2  
ATOM 4298  N N    . GLN A 1 89  ? 7.611   -11.153 6.214   1.00 0.00 ? 89  GLN A N    2  
ATOM 4299  C CA   . GLN A 1 89  ? 7.437   -11.179 7.658   1.00 0.00 ? 89  GLN A CA   2  
ATOM 4300  C C    . GLN A 1 89  ? 5.999   -10.921 8.111   1.00 0.00 ? 89  GLN A C    2  
ATOM 4301  O O    . GLN A 1 89  ? 5.559   -11.539 9.079   1.00 0.00 ? 89  GLN A O    2  
ATOM 4302  C CB   . GLN A 1 89  ? 8.380   -10.165 8.335   1.00 0.00 ? 89  GLN A CB   2  
ATOM 4303  C CG   . GLN A 1 89  ? 9.823   -10.664 8.458   1.00 0.00 ? 89  GLN A CG   2  
ATOM 4304  C CD   . GLN A 1 89  ? 10.536  -10.141 9.708   1.00 0.00 ? 89  GLN A CD   2  
ATOM 4305  O OE1  . GLN A 1 89  ? 10.016  -10.200 10.818  1.00 0.00 ? 89  GLN A OE1  2  
ATOM 4306  N NE2  . GLN A 1 89  ? 11.729  -9.589  9.583   1.00 0.00 ? 89  GLN A NE2  2  
ATOM 4307  H H    . GLN A 1 89  ? 8.276   -10.504 5.812   1.00 0.00 ? 89  GLN A H    2  
ATOM 4308  H HA   . GLN A 1 89  ? 7.665   -12.181 7.988   1.00 0.00 ? 89  GLN A HA   2  
ATOM 4309  H HB2  . GLN A 1 89  ? 8.381   -9.228  7.782   1.00 0.00 ? 89  GLN A HB2  2  
ATOM 4310  H HB3  . GLN A 1 89  ? 7.991   -9.975  9.335   1.00 0.00 ? 89  GLN A HB3  2  
ATOM 4311  H HG2  . GLN A 1 89  ? 9.790   -11.743 8.506   1.00 0.00 ? 89  GLN A HG2  2  
ATOM 4312  H HG3  . GLN A 1 89  ? 10.384  -10.383 7.571   1.00 0.00 ? 89  GLN A HG3  2  
ATOM 4313  H HE21 . GLN A 1 89  ? 12.190  -9.512  8.678   1.00 0.00 ? 89  GLN A HE21 2  
ATOM 4314  H HE22 . GLN A 1 89  ? 12.257  -9.394  10.418  1.00 0.00 ? 89  GLN A HE22 2  
ATOM 4315  N N    . LEU A 1 90  ? 5.299   -9.971  7.494   1.00 0.00 ? 90  LEU A N    2  
ATOM 4316  C CA   . LEU A 1 90  ? 3.986   -9.502  7.945   1.00 0.00 ? 90  LEU A CA   2  
ATOM 4317  C C    . LEU A 1 90  ? 3.042   -9.195  6.788   1.00 0.00 ? 90  LEU A C    2  
ATOM 4318  O O    . LEU A 1 90  ? 1.851   -9.499  6.867   1.00 0.00 ? 90  LEU A O    2  
ATOM 4319  C CB   . LEU A 1 90  ? 4.081   -8.262  8.856   1.00 0.00 ? 90  LEU A CB   2  
ATOM 4320  C CG   . LEU A 1 90  ? 5.460   -7.769  9.331   1.00 0.00 ? 90  LEU A CG   2  
ATOM 4321  C CD1  . LEU A 1 90  ? 6.240   -7.003  8.248   1.00 0.00 ? 90  LEU A CD1  2  
ATOM 4322  C CD2  . LEU A 1 90  ? 5.289   -6.847  10.536  1.00 0.00 ? 90  LEU A CD2  2  
ATOM 4323  H H    . LEU A 1 90  ? 5.785   -9.492  6.748   1.00 0.00 ? 90  LEU A H    2  
ATOM 4324  H HA   . LEU A 1 90  ? 3.524   -10.302 8.527   1.00 0.00 ? 90  LEU A HA   2  
ATOM 4325  H HB2  . LEU A 1 90  ? 3.590   -7.426  8.366   1.00 0.00 ? 90  LEU A HB2  2  
ATOM 4326  H HB3  . LEU A 1 90  ? 3.487   -8.511  9.731   1.00 0.00 ? 90  LEU A HB3  2  
ATOM 4327  H HG   . LEU A 1 90  ? 6.042   -8.626  9.668   1.00 0.00 ? 90  LEU A HG   2  
ATOM 4328  H HD11 . LEU A 1 90  ? 5.770   -7.086  7.267   1.00 0.00 ? 90  LEU A HD11 2  
ATOM 4329  H HD12 . LEU A 1 90  ? 6.303   -5.942  8.493   1.00 0.00 ? 90  LEU A HD12 2  
ATOM 4330  H HD13 . LEU A 1 90  ? 7.255   -7.387  8.187   1.00 0.00 ? 90  LEU A HD13 2  
ATOM 4331  H HD21 . LEU A 1 90  ? 4.897   -5.874  10.232  1.00 0.00 ? 90  LEU A HD21 2  
ATOM 4332  H HD22 . LEU A 1 90  ? 4.626   -7.313  11.257  1.00 0.00 ? 90  LEU A HD22 2  
ATOM 4333  H HD23 . LEU A 1 90  ? 6.263   -6.723  11.000  1.00 0.00 ? 90  LEU A HD23 2  
ATOM 4334  N N    . ALA A 1 91  ? 3.563   -8.638  5.696   1.00 0.00 ? 91  ALA A N    2  
ATOM 4335  C CA   . ALA A 1 91  ? 2.848   -8.333  4.459   1.00 0.00 ? 91  ALA A CA   2  
ATOM 4336  C C    . ALA A 1 91  ? 2.666   -9.619  3.647   1.00 0.00 ? 91  ALA A C    2  
ATOM 4337  O O    . ALA A 1 91  ? 3.010   -9.693  2.466   1.00 0.00 ? 91  ALA A O    2  
ATOM 4338  C CB   . ALA A 1 91  ? 3.580   -7.252  3.662   1.00 0.00 ? 91  ALA A CB   2  
ATOM 4339  H H    . ALA A 1 91  ? 4.576   -8.569  5.683   1.00 0.00 ? 91  ALA A H    2  
ATOM 4340  H HA   . ALA A 1 91  ? 1.872   -7.926  4.715   1.00 0.00 ? 91  ALA A HA   2  
ATOM 4341  H HB1  . ALA A 1 91  ? 4.557   -7.618  3.364   1.00 0.00 ? 91  ALA A HB1  2  
ATOM 4342  H HB2  . ALA A 1 91  ? 3.008   -7.005  2.768   1.00 0.00 ? 91  ALA A HB2  2  
ATOM 4343  H HB3  . ALA A 1 91  ? 3.684   -6.354  4.267   1.00 0.00 ? 91  ALA A HB3  2  
ATOM 4344  N N    . LEU A 1 92  ? 2.146   -10.651 4.305   1.00 0.00 ? 92  LEU A N    2  
ATOM 4345  C CA   . LEU A 1 92  ? 1.833   -11.971 3.789   1.00 0.00 ? 92  LEU A CA   2  
ATOM 4346  C C    . LEU A 1 92  ? 0.512   -12.376 4.458   1.00 0.00 ? 92  LEU A C    2  
ATOM 4347  O O    . LEU A 1 92  ? -0.499  -12.412 3.751   1.00 0.00 ? 92  LEU A O    2  
ATOM 4348  C CB   . LEU A 1 92  ? 3.027   -12.932 4.011   1.00 0.00 ? 92  LEU A CB   2  
ATOM 4349  C CG   . LEU A 1 92  ? 3.669   -13.561 2.756   1.00 0.00 ? 92  LEU A CG   2  
ATOM 4350  C CD1  . LEU A 1 92  ? 2.780   -14.664 2.193   1.00 0.00 ? 92  LEU A CD1  2  
ATOM 4351  C CD2  . LEU A 1 92  ? 3.996   -12.590 1.614   1.00 0.00 ? 92  LEU A CD2  2  
ATOM 4352  H H    . LEU A 1 92  ? 1.920   -10.479 5.278   1.00 0.00 ? 92  LEU A H    2  
ATOM 4353  H HA   . LEU A 1 92  ? 1.641   -11.886 2.721   1.00 0.00 ? 92  LEU A HA   2  
ATOM 4354  H HB2  . LEU A 1 92  ? 3.809   -12.400 4.551   1.00 0.00 ? 92  LEU A HB2  2  
ATOM 4355  H HB3  . LEU A 1 92  ? 2.716   -13.754 4.654   1.00 0.00 ? 92  LEU A HB3  2  
ATOM 4356  H HG   . LEU A 1 92  ? 4.605   -14.026 3.070   1.00 0.00 ? 92  LEU A HG   2  
ATOM 4357  H HD11 . LEU A 1 92  ? 3.297   -15.142 1.361   1.00 0.00 ? 92  LEU A HD11 2  
ATOM 4358  H HD12 . LEU A 1 92  ? 2.606   -15.409 2.969   1.00 0.00 ? 92  LEU A HD12 2  
ATOM 4359  H HD13 . LEU A 1 92  ? 1.831   -14.256 1.851   1.00 0.00 ? 92  LEU A HD13 2  
ATOM 4360  H HD21 . LEU A 1 92  ? 4.615   -13.100 0.877   1.00 0.00 ? 92  LEU A HD21 2  
ATOM 4361  H HD22 . LEU A 1 92  ? 3.091   -12.228 1.130   1.00 0.00 ? 92  LEU A HD22 2  
ATOM 4362  H HD23 . LEU A 1 92  ? 4.547   -11.732 1.986   1.00 0.00 ? 92  LEU A HD23 2  
ATOM 4363  N N    . PRO A 1 93  ? 0.430   -12.562 5.793   1.00 0.00 ? 93  PRO A N    2  
ATOM 4364  C CA   . PRO A 1 93  ? -0.842  -12.829 6.459   1.00 0.00 ? 93  PRO A CA   2  
ATOM 4365  C C    . PRO A 1 93  ? -1.830  -11.663 6.394   1.00 0.00 ? 93  PRO A C    2  
ATOM 4366  O O    . PRO A 1 93  ? -3.032  -11.902 6.287   1.00 0.00 ? 93  PRO A O    2  
ATOM 4367  C CB   . PRO A 1 93  ? -0.497  -13.163 7.910   1.00 0.00 ? 93  PRO A CB   2  
ATOM 4368  C CG   . PRO A 1 93  ? 0.840   -12.473 8.124   1.00 0.00 ? 93  PRO A CG   2  
ATOM 4369  C CD   . PRO A 1 93  ? 1.511   -12.660 6.770   1.00 0.00 ? 93  PRO A CD   2  
ATOM 4370  H HA   . PRO A 1 93  ? -1.307  -13.700 6.000   1.00 0.00 ? 93  PRO A HA   2  
ATOM 4371  H HB2  . PRO A 1 93  ? -1.241  -12.794 8.614   1.00 0.00 ? 93  PRO A HB2  2  
ATOM 4372  H HB3  . PRO A 1 93  ? -0.372  -14.241 8.008   1.00 0.00 ? 93  PRO A HB3  2  
ATOM 4373  H HG2  . PRO A 1 93  ? 0.686   -11.413 8.328   1.00 0.00 ? 93  PRO A HG2  2  
ATOM 4374  H HG3  . PRO A 1 93  ? 1.398   -12.944 8.925   1.00 0.00 ? 93  PRO A HG3  2  
ATOM 4375  H HD2  . PRO A 1 93  ? 2.291   -11.918 6.623   1.00 0.00 ? 93  PRO A HD2  2  
ATOM 4376  H HD3  . PRO A 1 93  ? 1.945   -13.660 6.731   1.00 0.00 ? 93  PRO A HD3  2  
ATOM 4377  N N    . VAL A 1 94  ? -1.381  -10.405 6.457   1.00 0.00 ? 94  VAL A N    2  
ATOM 4378  C CA   . VAL A 1 94  ? -2.291  -9.254  6.438   1.00 0.00 ? 94  VAL A CA   2  
ATOM 4379  C C    . VAL A 1 94  ? -3.104  -9.148  5.150   1.00 0.00 ? 94  VAL A C    2  
ATOM 4380  O O    . VAL A 1 94  ? -4.137  -8.482  5.141   1.00 0.00 ? 94  VAL A O    2  
ATOM 4381  C CB   . VAL A 1 94  ? -1.523  -7.945  6.652   1.00 0.00 ? 94  VAL A CB   2  
ATOM 4382  C CG1  . VAL A 1 94  ? -0.935  -7.857  8.049   1.00 0.00 ? 94  VAL A CG1  2  
ATOM 4383  C CG2  . VAL A 1 94  ? -0.473  -7.672  5.576   1.00 0.00 ? 94  VAL A CG2  2  
ATOM 4384  H H    . VAL A 1 94  ? -0.396  -10.219 6.607   1.00 0.00 ? 94  VAL A H    2  
ATOM 4385  H HA   . VAL A 1 94  ? -3.004  -9.359  7.257   1.00 0.00 ? 94  VAL A HA   2  
ATOM 4386  H HB   . VAL A 1 94  ? -2.226  -7.136  6.584   1.00 0.00 ? 94  VAL A HB   2  
ATOM 4387  H HG11 . VAL A 1 94  ? -0.523  -6.863  8.164   1.00 0.00 ? 94  VAL A HG11 2  
ATOM 4388  H HG12 . VAL A 1 94  ? -1.743  -7.955  8.768   1.00 0.00 ? 94  VAL A HG12 2  
ATOM 4389  H HG13 . VAL A 1 94  ? -0.177  -8.618  8.222   1.00 0.00 ? 94  VAL A HG13 2  
ATOM 4390  H HG21 . VAL A 1 94  ? 0.055   -8.590  5.344   1.00 0.00 ? 94  VAL A HG21 2  
ATOM 4391  H HG22 . VAL A 1 94  ? -0.959  -7.305  4.671   1.00 0.00 ? 94  VAL A HG22 2  
ATOM 4392  H HG23 . VAL A 1 94  ? 0.230   -6.918  5.928   1.00 0.00 ? 94  VAL A HG23 2  
ATOM 4393  N N    . LEU A 1 95  ? -2.646  -9.771  4.062   1.00 0.00 ? 95  LEU A N    2  
ATOM 4394  C CA   . LEU A 1 95  ? -3.385  -9.778  2.812   1.00 0.00 ? 95  LEU A CA   2  
ATOM 4395  C C    . LEU A 1 95  ? -4.611  -10.686 2.940   1.00 0.00 ? 95  LEU A C    2  
ATOM 4396  O O    . LEU A 1 95  ? -5.660  -10.384 2.382   1.00 0.00 ? 95  LEU A O    2  
ATOM 4397  C CB   . LEU A 1 95  ? -2.466  -10.198 1.654   1.00 0.00 ? 95  LEU A CB   2  
ATOM 4398  C CG   . LEU A 1 95  ? -1.424  -9.162  1.170   1.00 0.00 ? 95  LEU A CG   2  
ATOM 4399  C CD1  . LEU A 1 95  ? -1.884  -7.699  1.146   1.00 0.00 ? 95  LEU A CD1  2  
ATOM 4400  C CD2  . LEU A 1 95  ? -0.144  -9.241  1.992   1.00 0.00 ? 95  LEU A CD2  2  
ATOM 4401  H H    . LEU A 1 95  ? -1.795  -10.310 4.125   1.00 0.00 ? 95  LEU A H    2  
ATOM 4402  H HA   . LEU A 1 95  ? -3.763  -8.777  2.610   1.00 0.00 ? 95  LEU A HA   2  
ATOM 4403  H HB2  . LEU A 1 95  ? -1.973  -11.138 1.899   1.00 0.00 ? 95  LEU A HB2  2  
ATOM 4404  H HB3  . LEU A 1 95  ? -3.098  -10.418 0.808   1.00 0.00 ? 95  LEU A HB3  2  
ATOM 4405  H HG   . LEU A 1 95  ? -1.160  -9.434  0.149   1.00 0.00 ? 95  LEU A HG   2  
ATOM 4406  H HD11 . LEU A 1 95  ? -2.793  -7.609  0.554   1.00 0.00 ? 95  LEU A HD11 2  
ATOM 4407  H HD12 . LEU A 1 95  ? -2.068  -7.326  2.156   1.00 0.00 ? 95  LEU A HD12 2  
ATOM 4408  H HD13 . LEU A 1 95  ? -1.102  -7.075  0.705   1.00 0.00 ? 95  LEU A HD13 2  
ATOM 4409  H HD21 . LEU A 1 95  ? 0.212   -10.267 2.020   1.00 0.00 ? 95  LEU A HD21 2  
ATOM 4410  H HD22 . LEU A 1 95  ? 0.616   -8.625  1.515   1.00 0.00 ? 95  LEU A HD22 2  
ATOM 4411  H HD23 . LEU A 1 95  ? -0.314  -8.880  3.000   1.00 0.00 ? 95  LEU A HD23 2  
ATOM 4412  N N    . ARG A 1 96  ? -4.533  -11.780 3.705   1.00 0.00 ? 96  ARG A N    2  
ATOM 4413  C CA   . ARG A 1 96  ? -5.663  -12.652 3.970   1.00 0.00 ? 96  ARG A CA   2  
ATOM 4414  C C    . ARG A 1 96  ? -5.568  -13.283 5.341   1.00 0.00 ? 96  ARG A C    2  
ATOM 4415  O O    . ARG A 1 96  ? -4.772  -14.197 5.572   1.00 0.00 ? 96  ARG A O    2  
ATOM 4416  C CB   . ARG A 1 96  ? -5.866  -13.703 2.911   1.00 0.00 ? 96  ARG A CB   2  
ATOM 4417  C CG   . ARG A 1 96  ? -4.567  -14.382 2.539   1.00 0.00 ? 96  ARG A CG   2  
ATOM 4418  C CD   . ARG A 1 96  ? -4.807  -15.886 2.499   1.00 0.00 ? 96  ARG A CD   2  
ATOM 4419  N NE   . ARG A 1 96  ? -3.582  -16.665 2.270   1.00 0.00 ? 96  ARG A NE   2  
ATOM 4420  C CZ   . ARG A 1 96  ? -3.470  -17.962 2.577   1.00 0.00 ? 96  ARG A CZ   2  
ATOM 4421  N NH1  . ARG A 1 96  ? -4.537  -18.657 2.967   1.00 0.00 ? 96  ARG A NH1  2  
ATOM 4422  N NH2  . ARG A 1 96  ? -2.295  -18.573 2.481   1.00 0.00 ? 96  ARG A NH2  2  
ATOM 4423  H H    . ARG A 1 96  ? -3.697  -12.019 4.214   1.00 0.00 ? 96  ARG A H    2  
ATOM 4424  H HA   . ARG A 1 96  ? -6.557  -12.078 3.891   1.00 0.00 ? 96  ARG A HA   2  
ATOM 4425  H HB2  . ARG A 1 96  ? -6.582  -14.411 3.310   1.00 0.00 ? 96  ARG A HB2  2  
ATOM 4426  H HB3  . ARG A 1 96  ? -6.291  -13.238 2.020   1.00 0.00 ? 96  ARG A HB3  2  
ATOM 4427  H HG2  . ARG A 1 96  ? -4.325  -13.912 1.602   1.00 0.00 ? 96  ARG A HG2  2  
ATOM 4428  H HG3  . ARG A 1 96  ? -3.776  -14.175 3.257   1.00 0.00 ? 96  ARG A HG3  2  
ATOM 4429  H HD2  . ARG A 1 96  ? -5.196  -16.150 3.491   1.00 0.00 ? 96  ARG A HD2  2  
ATOM 4430  H HD3  . ARG A 1 96  ? -5.552  -16.124 1.739   1.00 0.00 ? 96  ARG A HD3  2  
ATOM 4431  H HE   . ARG A 1 96  ? -2.782  -16.165 1.888   1.00 0.00 ? 96  ARG A HE   2  
ATOM 4432  H HH11 . ARG A 1 96  ? -5.446  -18.199 3.071   1.00 0.00 ? 96  ARG A HH11 2  
ATOM 4433  H HH12 . ARG A 1 96  ? -4.551  -19.669 3.086   1.00 0.00 ? 96  ARG A HH12 2  
ATOM 4434  H HH21 . ARG A 1 96  ? -1.463  -18.007 2.275   1.00 0.00 ? 96  ARG A HH21 2  
ATOM 4435  H HH22 . ARG A 1 96  ? -2.133  -19.487 2.879   1.00 0.00 ? 96  ARG A HH22 2  
ATOM 4436  N N    . ASN A 1 97  ? -6.408  -12.809 6.246   1.00 0.00 ? 97  ASN A N    2  
ATOM 4437  C CA   . ASN A 1 97  ? -6.745  -13.563 7.434   1.00 0.00 ? 97  ASN A CA   2  
ATOM 4438  C C    . ASN A 1 97  ? -7.770  -14.631 7.054   1.00 0.00 ? 97  ASN A C    2  
ATOM 4439  O O    . ASN A 1 97  ? -8.602  -14.376 6.178   1.00 0.00 ? 97  ASN A O    2  
ATOM 4440  C CB   . ASN A 1 97  ? -7.288  -12.572 8.467   1.00 0.00 ? 97  ASN A CB   2  
ATOM 4441  C CG   . ASN A 1 97  ? -7.452  -13.216 9.843   1.00 0.00 ? 97  ASN A CG   2  
ATOM 4442  O OD1  . ASN A 1 97  ? -8.279  -14.095 10.042  1.00 0.00 ? 97  ASN A OD1  2  
ATOM 4443  N ND2  . ASN A 1 97  ? -6.649  -12.812 10.812  1.00 0.00 ? 97  ASN A ND2  2  
ATOM 4444  H H    . ASN A 1 97  ? -7.033  -12.065 5.985   1.00 0.00 ? 97  ASN A H    2  
ATOM 4445  H HA   . ASN A 1 97  ? -5.854  -14.070 7.788   1.00 0.00 ? 97  ASN A HA   2  
ATOM 4446  H HB2  . ASN A 1 97  ? -6.606  -11.723 8.548   1.00 0.00 ? 97  ASN A HB2  2  
ATOM 4447  H HB3  . ASN A 1 97  ? -8.236  -12.186 8.093   1.00 0.00 ? 97  ASN A HB3  2  
ATOM 4448  H HD21 . ASN A 1 97  ? -6.061  -11.995 10.696  1.00 0.00 ? 97  ASN A HD21 2  
ATOM 4449  H HD22 . ASN A 1 97  ? -6.784  -13.192 11.738  1.00 0.00 ? 97  ASN A HD22 2  
ATOM 4450  N N    . ALA A 1 98  ? -7.707  -15.806 7.678   1.00 0.00 ? 98  ALA A N    2  
ATOM 4451  C CA   . ALA A 1 98  ? -8.650  -16.896 7.463   1.00 0.00 ? 98  ALA A CA   2  
ATOM 4452  C C    . ALA A 1 98  ? -10.081 -16.408 7.727   1.00 0.00 ? 98  ALA A C    2  
ATOM 4453  O O    . ALA A 1 98  ? -10.374 -15.885 8.800   1.00 0.00 ? 98  ALA A O    2  
ATOM 4454  C CB   . ALA A 1 98  ? -8.275  -18.075 8.366   1.00 0.00 ? 98  ALA A CB   2  
ATOM 4455  H H    . ALA A 1 98  ? -7.030  -15.909 8.425   1.00 0.00 ? 98  ALA A H    2  
ATOM 4456  H HA   . ALA A 1 98  ? -8.574  -17.217 6.424   1.00 0.00 ? 98  ALA A HA   2  
ATOM 4457  H HB1  . ALA A 1 98  ? -8.994  -18.884 8.230   1.00 0.00 ? 98  ALA A HB1  2  
ATOM 4458  H HB2  . ALA A 1 98  ? -7.279  -18.439 8.114   1.00 0.00 ? 98  ALA A HB2  2  
ATOM 4459  H HB3  . ALA A 1 98  ? -8.287  -17.759 9.410   1.00 0.00 ? 98  ALA A HB3  2  
ATOM 4460  N N    . ASP A 1 99  ? -10.958 -16.539 6.733   1.00 0.00 ? 99  ASP A N    2  
ATOM 4461  C CA   . ASP A 1 99  ? -12.321 -16.003 6.760   1.00 0.00 ? 99  ASP A CA   2  
ATOM 4462  C C    . ASP A 1 99  ? -13.288 -17.173 6.867   1.00 0.00 ? 99  ASP A C    2  
ATOM 4463  O O    . ASP A 1 99  ? -13.874 -17.377 7.930   1.00 0.00 ? 99  ASP A O    2  
ATOM 4464  C CB   . ASP A 1 99  ? -12.546 -15.140 5.513   1.00 0.00 ? 99  ASP A CB   2  
ATOM 4465  C CG   . ASP A 1 99  ? -13.878 -14.383 5.448   1.00 0.00 ? 99  ASP A CG   2  
ATOM 4466  O OD1  . ASP A 1 99  ? -14.375 -13.856 6.469   1.00 0.00 ? 99  ASP A OD1  2  
ATOM 4467  O OD2  . ASP A 1 99  ? -14.357 -14.189 4.305   1.00 0.00 ? 99  ASP A OD2  2  
ATOM 4468  H H    . ASP A 1 99  ? -10.667 -17.015 5.891   1.00 0.00 ? 99  ASP A H    2  
ATOM 4469  H HA   . ASP A 1 99  ? -12.459 -15.364 7.634   1.00 0.00 ? 99  ASP A HA   2  
ATOM 4470  H HB2  . ASP A 1 99  ? -11.750 -14.401 5.469   1.00 0.00 ? 99  ASP A HB2  2  
ATOM 4471  H HB3  . ASP A 1 99  ? -12.450 -15.770 4.628   1.00 0.00 ? 99  ASP A HB3  2  
ATOM 4472  N N    . CYS A 1 100 ? -13.356 -18.023 5.834   1.00 0.00 ? 100 CYS A N    2  
ATOM 4473  C CA   . CYS A 1 100 ? -14.346 -19.092 5.710   1.00 0.00 ? 100 CYS A CA   2  
ATOM 4474  C C    . CYS A 1 100 ? -15.765 -18.514 5.866   1.00 0.00 ? 100 CYS A C    2  
ATOM 4475  O O    . CYS A 1 100 ? -15.980 -17.350 5.516   1.00 0.00 ? 100 CYS A O    2  
ATOM 4476  C CB   . CYS A 1 100 ? -13.999 -20.266 6.639   1.00 0.00 ? 100 CYS A CB   2  
ATOM 4477  S SG   . CYS A 1 100 ? -12.307 -20.860 6.326   1.00 0.00 ? 100 CYS A SG   2  
ATOM 4478  H H    . CYS A 1 100 ? -12.794 -17.847 5.009   1.00 0.00 ? 100 CYS A H    2  
ATOM 4479  H HA   . CYS A 1 100 ? -14.286 -19.469 4.690   1.00 0.00 ? 100 CYS A HA   2  
ATOM 4480  H HB2  . CYS A 1 100 ? -14.097 -19.947 7.675   1.00 0.00 ? 100 CYS A HB2  2  
ATOM 4481  H HB3  . CYS A 1 100 ? -14.694 -21.088 6.468   1.00 0.00 ? 100 CYS A HB3  2  
ATOM 4482  H HG   . CYS A 1 100 ? -12.348 -21.827 7.256   1.00 0.00 ? 100 CYS A HG   2  
ATOM 4483  N N    . SER A 1 101 ? -16.756 -19.319 6.251   1.00 0.00 ? 101 SER A N    2  
ATOM 4484  C CA   . SER A 1 101 ? -18.156 -18.924 6.151   1.00 0.00 ? 101 SER A CA   2  
ATOM 4485  C C    . SER A 1 101 ? -18.574 -18.096 7.378   1.00 0.00 ? 101 SER A C    2  
ATOM 4486  O O    . SER A 1 101 ? -19.209 -18.596 8.313   1.00 0.00 ? 101 SER A O    2  
ATOM 4487  C CB   . SER A 1 101 ? -19.019 -20.160 5.889   1.00 0.00 ? 101 SER A CB   2  
ATOM 4488  O OG   . SER A 1 101 ? -18.529 -20.875 4.761   1.00 0.00 ? 101 SER A OG   2  
ATOM 4489  H H    . SER A 1 101 ? -16.573 -20.257 6.589   1.00 0.00 ? 101 SER A H    2  
ATOM 4490  H HA   . SER A 1 101 ? -18.264 -18.289 5.273   1.00 0.00 ? 101 SER A HA   2  
ATOM 4491  H HB2  . SER A 1 101 ? -19.022 -20.814 6.762   1.00 0.00 ? 101 SER A HB2  2  
ATOM 4492  H HB3  . SER A 1 101 ? -20.038 -19.834 5.685   1.00 0.00 ? 101 SER A HB3  2  
ATOM 4493  H HG   . SER A 1 101 ? -19.304 -21.329 4.377   1.00 0.00 ? 101 SER A HG   2  
ATOM 4494  N N    . SER A 1 102 ? -18.180 -16.826 7.385   1.00 0.00 ? 102 SER A N    2  
ATOM 4495  C CA   . SER A 1 102 ? -18.389 -15.827 8.427   1.00 0.00 ? 102 SER A CA   2  
ATOM 4496  C C    . SER A 1 102 ? -19.751 -15.121 8.267   1.00 0.00 ? 102 SER A C    2  
ATOM 4497  O O    . SER A 1 102 ? -20.618 -15.578 7.512   1.00 0.00 ? 102 SER A O    2  
ATOM 4498  C CB   . SER A 1 102 ? -17.178 -14.882 8.369   1.00 0.00 ? 102 SER A CB   2  
ATOM 4499  O OG   . SER A 1 102 ? -16.872 -14.538 7.029   1.00 0.00 ? 102 SER A OG   2  
ATOM 4500  H H    . SER A 1 102 ? -17.630 -16.494 6.599   1.00 0.00 ? 102 SER A H    2  
ATOM 4501  H HA   . SER A 1 102 ? -18.385 -16.320 9.400   1.00 0.00 ? 102 SER A HA   2  
ATOM 4502  H HB2  . SER A 1 102 ? -17.363 -13.981 8.953   1.00 0.00 ? 102 SER A HB2  2  
ATOM 4503  H HB3  . SER A 1 102 ? -16.320 -15.404 8.796   1.00 0.00 ? 102 SER A HB3  2  
ATOM 4504  H HG   . SER A 1 102 ? -15.899 -14.402 6.966   1.00 0.00 ? 102 SER A HG   2  
ATOM 4505  N N    . GLY A 1 103 ? -20.010 -14.049 9.023   1.00 0.00 ? 103 GLY A N    2  
ATOM 4506  C CA   . GLY A 1 103 ? -21.218 -13.230 8.882   1.00 0.00 ? 103 GLY A CA   2  
ATOM 4507  C C    . GLY A 1 103 ? -21.096 -12.219 7.734   1.00 0.00 ? 103 GLY A C    2  
ATOM 4508  O O    . GLY A 1 103 ? -20.050 -12.166 7.074   1.00 0.00 ? 103 GLY A O    2  
ATOM 4509  H H    . GLY A 1 103 ? -19.297 -13.699 9.649   1.00 0.00 ? 103 GLY A H    2  
ATOM 4510  H HA2  . GLY A 1 103 ? -22.087 -13.864 8.705   1.00 0.00 ? 103 GLY A HA2  2  
ATOM 4511  H HA3  . GLY A 1 103 ? -21.373 -12.686 9.811   1.00 0.00 ? 103 GLY A HA3  2  
ATOM 4512  N N    . PRO A 1 104 ? -22.130 -11.398 7.476   1.00 0.00 ? 104 PRO A N    2  
ATOM 4513  C CA   . PRO A 1 104 ? -22.014 -10.230 6.611   1.00 0.00 ? 104 PRO A CA   2  
ATOM 4514  C C    . PRO A 1 104 ? -21.055 -9.221  7.258   1.00 0.00 ? 104 PRO A C    2  
ATOM 4515  O O    . PRO A 1 104 ? -20.938 -9.160  8.487   1.00 0.00 ? 104 PRO A O    2  
ATOM 4516  C CB   . PRO A 1 104 ? -23.436 -9.684  6.468   1.00 0.00 ? 104 PRO A CB   2  
ATOM 4517  C CG   . PRO A 1 104 ? -24.089 -10.078 7.789   1.00 0.00 ? 104 PRO A CG   2  
ATOM 4518  C CD   . PRO A 1 104 ? -23.424 -11.409 8.138   1.00 0.00 ? 104 PRO A CD   2  
ATOM 4519  H HA   . PRO A 1 104 ? -21.646 -10.518 5.628   1.00 0.00 ? 104 PRO A HA   2  
ATOM 4520  H HB2  . PRO A 1 104 ? -23.454 -8.603  6.315   1.00 0.00 ? 104 PRO A HB2  2  
ATOM 4521  H HB3  . PRO A 1 104 ? -23.942 -10.195 5.647   1.00 0.00 ? 104 PRO A HB3  2  
ATOM 4522  H HG2  . PRO A 1 104 ? -23.832 -9.340  8.547   1.00 0.00 ? 104 PRO A HG2  2  
ATOM 4523  H HG3  . PRO A 1 104 ? -25.172 -10.175 7.695   1.00 0.00 ? 104 PRO A HG3  2  
ATOM 4524  H HD2  . PRO A 1 104 ? -23.304 -11.486 9.217   1.00 0.00 ? 104 PRO A HD2  2  
ATOM 4525  H HD3  . PRO A 1 104 ? -24.024 -12.237 7.758   1.00 0.00 ? 104 PRO A HD3  2  
ATOM 4526  N N    . GLY A 1 105 ? -20.367 -8.426  6.436   1.00 0.00 ? 105 GLY A N    2  
ATOM 4527  C CA   . GLY A 1 105 ? -19.297 -7.572  6.915   1.00 0.00 ? 105 GLY A CA   2  
ATOM 4528  C C    . GLY A 1 105 ? -18.176 -7.574  5.900   1.00 0.00 ? 105 GLY A C    2  
ATOM 4529  O O    . GLY A 1 105 ? -17.233 -8.356  6.014   1.00 0.00 ? 105 GLY A O    2  
ATOM 4530  H H    . GLY A 1 105 ? -20.488 -8.495  5.434   1.00 0.00 ? 105 GLY A H    2  
ATOM 4531  H HA2  . GLY A 1 105 ? -19.669 -6.560  7.076   1.00 0.00 ? 105 GLY A HA2  2  
ATOM 4532  H HA3  . GLY A 1 105 ? -18.899 -7.970  7.847   1.00 0.00 ? 105 GLY A HA3  2  
ATOM 4533  N N    . GLN A 1 106 ? -18.290 -6.726  4.880   1.00 0.00 ? 106 GLN A N    2  
ATOM 4534  C CA   . GLN A 1 106 ? -17.245 -6.581  3.875   1.00 0.00 ? 106 GLN A CA   2  
ATOM 4535  C C    . GLN A 1 106 ? -15.930 -6.255  4.556   1.00 0.00 ? 106 GLN A C    2  
ATOM 4536  O O    . GLN A 1 106 ? -15.837 -5.383  5.428   1.00 0.00 ? 106 GLN A O    2  
ATOM 4537  C CB   . GLN A 1 106 ? -17.604 -5.505  2.866   1.00 0.00 ? 106 GLN A CB   2  
ATOM 4538  C CG   . GLN A 1 106 ? -18.848 -5.935  2.096   1.00 0.00 ? 106 GLN A CG   2  
ATOM 4539  C CD   . GLN A 1 106 ? -19.211 -4.876  1.084   1.00 0.00 ? 106 GLN A CD   2  
ATOM 4540  O OE1  . GLN A 1 106 ? -19.801 -3.850  1.429   1.00 0.00 ? 106 GLN A OE1  2  
ATOM 4541  N NE2  . GLN A 1 106 ? -18.799 -5.064  -0.149  1.00 0.00 ? 106 GLN A NE2  2  
ATOM 4542  H H    . GLN A 1 106 ? -19.101 -6.125  4.821   1.00 0.00 ? 106 GLN A H    2  
ATOM 4543  H HA   . GLN A 1 106 ? -17.118 -7.525  3.334   1.00 0.00 ? 106 GLN A HA   2  
ATOM 4544  H HB2  . GLN A 1 106 ? -17.777 -4.556  3.375   1.00 0.00 ? 106 GLN A HB2  2  
ATOM 4545  H HB3  . GLN A 1 106 ? -16.774 -5.391  2.168   1.00 0.00 ? 106 GLN A HB3  2  
ATOM 4546  H HG2  . GLN A 1 106 ? -18.671 -6.895  1.616   1.00 0.00 ? 106 GLN A HG2  2  
ATOM 4547  H HG3  . GLN A 1 106 ? -19.684 -6.062  2.771   1.00 0.00 ? 106 GLN A HG3  2  
ATOM 4548  H HE21 . GLN A 1 106 ? -18.273 -5.905  -0.383  1.00 0.00 ? 106 GLN A HE21 2  
ATOM 4549  H HE22 . GLN A 1 106 ? -19.208 -4.505  -0.881  1.00 0.00 ? 106 GLN A HE22 2  
ATOM 4550  N N    . ARG A 1 107 ? -14.922 -7.013  4.163   1.00 0.00 ? 107 ARG A N    2  
ATOM 4551  C CA   . ARG A 1 107 ? -13.580 -6.908  4.688   1.00 0.00 ? 107 ARG A CA   2  
ATOM 4552  C C    . ARG A 1 107 ? -12.879 -5.799  3.909   1.00 0.00 ? 107 ARG A C    2  
ATOM 4553  O O    . ARG A 1 107 ? -13.313 -5.426  2.823   1.00 0.00 ? 107 ARG A O    2  
ATOM 4554  C CB   . ARG A 1 107 ? -12.920 -8.293  4.624   1.00 0.00 ? 107 ARG A CB   2  
ATOM 4555  C CG   . ARG A 1 107 ? -13.585 -9.295  5.592   1.00 0.00 ? 107 ARG A CG   2  
ATOM 4556  C CD   . ARG A 1 107 ? -13.467 -10.747 5.126   1.00 0.00 ? 107 ARG A CD   2  
ATOM 4557  N NE   . ARG A 1 107 ? -12.076 -11.209 5.092   1.00 0.00 ? 107 ARG A NE   2  
ATOM 4558  C CZ   . ARG A 1 107 ? -11.406 -11.772 6.102   1.00 0.00 ? 107 ARG A CZ   2  
ATOM 4559  N NH1  . ARG A 1 107 ? -11.989 -12.039 7.266   1.00 0.00 ? 107 ARG A NH1  2  
ATOM 4560  N NH2  . ARG A 1 107 ? -10.135 -12.087 5.899   1.00 0.00 ? 107 ARG A NH2  2  
ATOM 4561  H H    . ARG A 1 107 ? -15.063 -7.498  3.280   1.00 0.00 ? 107 ARG A H    2  
ATOM 4562  H HA   . ARG A 1 107 ? -13.627 -6.620  5.728   1.00 0.00 ? 107 ARG A HA   2  
ATOM 4563  H HB2  . ARG A 1 107 ? -12.994 -8.684  3.614   1.00 0.00 ? 107 ARG A HB2  2  
ATOM 4564  H HB3  . ARG A 1 107 ? -11.871 -8.196  4.893   1.00 0.00 ? 107 ARG A HB3  2  
ATOM 4565  H HG2  . ARG A 1 107 ? -13.134 -9.197  6.577   1.00 0.00 ? 107 ARG A HG2  2  
ATOM 4566  H HG3  . ARG A 1 107 ? -14.649 -9.084  5.690   1.00 0.00 ? 107 ARG A HG3  2  
ATOM 4567  H HD2  . ARG A 1 107 ? -14.034 -11.377 5.805   1.00 0.00 ? 107 ARG A HD2  2  
ATOM 4568  H HD3  . ARG A 1 107 ? -13.908 -10.845 4.134   1.00 0.00 ? 107 ARG A HD3  2  
ATOM 4569  H HE   . ARG A 1 107 ? -11.590 -11.057 4.218   1.00 0.00 ? 107 ARG A HE   2  
ATOM 4570  H HH11 . ARG A 1 107 ? -13.001 -12.081 7.346   1.00 0.00 ? 107 ARG A HH11 2  
ATOM 4571  H HH12 . ARG A 1 107 ? -11.462 -12.217 8.125   1.00 0.00 ? 107 ARG A HH12 2  
ATOM 4572  H HH21 . ARG A 1 107 ? -9.768  -12.004 4.951   1.00 0.00 ? 107 ARG A HH21 2  
ATOM 4573  H HH22 . ARG A 1 107 ? -9.656  -12.731 6.520   1.00 0.00 ? 107 ARG A HH22 2  
ATOM 4574  N N    . VAL A 1 108 ? -11.775 -5.278  4.421   1.00 0.00 ? 108 VAL A N    2  
ATOM 4575  C CA   . VAL A 1 108 ? -10.936 -4.317  3.731   1.00 0.00 ? 108 VAL A CA   2  
ATOM 4576  C C    . VAL A 1 108 ? -9.528  -4.905  3.748   1.00 0.00 ? 108 VAL A C    2  
ATOM 4577  O O    . VAL A 1 108 ? -9.206  -5.739  4.600   1.00 0.00 ? 108 VAL A O    2  
ATOM 4578  C CB   . VAL A 1 108 ? -11.099 -2.929  4.396   1.00 0.00 ? 108 VAL A CB   2  
ATOM 4579  C CG1  . VAL A 1 108 ? -10.031 -1.920  3.960   1.00 0.00 ? 108 VAL A CG1  2  
ATOM 4580  C CG2  . VAL A 1 108 ? -12.463 -2.299  4.061   1.00 0.00 ? 108 VAL A CG2  2  
ATOM 4581  H H    . VAL A 1 108 ? -11.470 -5.526  5.355   1.00 0.00 ? 108 VAL A H    2  
ATOM 4582  H HA   . VAL A 1 108 ? -11.246 -4.227  2.693   1.00 0.00 ? 108 VAL A HA   2  
ATOM 4583  H HB   . VAL A 1 108 ? -11.028 -3.046  5.477   1.00 0.00 ? 108 VAL A HB   2  
ATOM 4584  H HG11 . VAL A 1 108 ? -9.052  -2.273  4.274   1.00 0.00 ? 108 VAL A HG11 2  
ATOM 4585  H HG12 . VAL A 1 108 ? -10.036 -1.812  2.874   1.00 0.00 ? 108 VAL A HG12 2  
ATOM 4586  H HG13 . VAL A 1 108 ? -10.208 -0.958  4.440   1.00 0.00 ? 108 VAL A HG13 2  
ATOM 4587  H HG21 . VAL A 1 108 ? -12.533 -2.077  2.997   1.00 0.00 ? 108 VAL A HG21 2  
ATOM 4588  H HG22 . VAL A 1 108 ? -13.274 -2.975  4.321   1.00 0.00 ? 108 VAL A HG22 2  
ATOM 4589  H HG23 . VAL A 1 108 ? -12.597 -1.384  4.636   1.00 0.00 ? 108 VAL A HG23 2  
ATOM 4590  N N    . CYS A 1 109 ? -8.706  -4.506  2.780   1.00 0.00 ? 109 CYS A N    2  
ATOM 4591  C CA   . CYS A 1 109 ? -7.274  -4.671  2.812   1.00 0.00 ? 109 CYS A CA   2  
ATOM 4592  C C    . CYS A 1 109 ? -6.621  -3.348  2.429   1.00 0.00 ? 109 CYS A C    2  
ATOM 4593  O O    . CYS A 1 109 ? -7.185  -2.592  1.642   1.00 0.00 ? 109 CYS A O    2  
ATOM 4594  C CB   . CYS A 1 109 ? -6.823  -5.816  1.907   1.00 0.00 ? 109 CYS A CB   2  
ATOM 4595  S SG   . CYS A 1 109 ? -6.830  -7.329  2.904   1.00 0.00 ? 109 CYS A SG   2  
ATOM 4596  H H    . CYS A 1 109 ? -9.028  -3.808  2.110   1.00 0.00 ? 109 CYS A H    2  
ATOM 4597  H HA   . CYS A 1 109 ? -7.044  -4.912  3.835   1.00 0.00 ? 109 CYS A HA   2  
ATOM 4598  H HB2  . CYS A 1 109 ? -7.494  -5.907  1.056   1.00 0.00 ? 109 CYS A HB2  2  
ATOM 4599  H HB3  . CYS A 1 109 ? -5.812  -5.628  1.542   1.00 0.00 ? 109 CYS A HB3  2  
ATOM 4600  H HG   . CYS A 1 109 ? -8.110  -7.234  3.288   1.00 0.00 ? 109 CYS A HG   2  
ATOM 4601  N N    . VAL A 1 110 ? -5.432  -3.077  2.955   1.00 0.00 ? 110 VAL A N    2  
ATOM 4602  C CA   . VAL A 1 110 ? -4.806  -1.755  2.882   1.00 0.00 ? 110 VAL A CA   2  
ATOM 4603  C C    . VAL A 1 110 ? -3.347  -1.907  2.463   1.00 0.00 ? 110 VAL A C    2  
ATOM 4604  O O    . VAL A 1 110 ? -2.600  -2.631  3.124   1.00 0.00 ? 110 VAL A O    2  
ATOM 4605  C CB   . VAL A 1 110 ? -4.936  -1.021  4.231   1.00 0.00 ? 110 VAL A CB   2  
ATOM 4606  C CG1  . VAL A 1 110 ? -4.345  0.391   4.122   1.00 0.00 ? 110 VAL A CG1  2  
ATOM 4607  C CG2  . VAL A 1 110 ? -6.403  -0.896  4.681   1.00 0.00 ? 110 VAL A CG2  2  
ATOM 4608  H H    . VAL A 1 110 ? -5.003  -3.794  3.529   1.00 0.00 ? 110 VAL A H    2  
ATOM 4609  H HA   . VAL A 1 110 ? -5.320  -1.160  2.127   1.00 0.00 ? 110 VAL A HA   2  
ATOM 4610  H HB   . VAL A 1 110 ? -4.388  -1.572  4.999   1.00 0.00 ? 110 VAL A HB   2  
ATOM 4611  H HG11 . VAL A 1 110 ? -4.416  0.892   5.083   1.00 0.00 ? 110 VAL A HG11 2  
ATOM 4612  H HG12 . VAL A 1 110 ? -3.289  0.329   3.854   1.00 0.00 ? 110 VAL A HG12 2  
ATOM 4613  H HG13 . VAL A 1 110 ? -4.872  0.960   3.355   1.00 0.00 ? 110 VAL A HG13 2  
ATOM 4614  H HG21 . VAL A 1 110 ? -6.481  -0.247  5.550   1.00 0.00 ? 110 VAL A HG21 2  
ATOM 4615  H HG22 . VAL A 1 110 ? -7.009  -0.486  3.873   1.00 0.00 ? 110 VAL A HG22 2  
ATOM 4616  H HG23 . VAL A 1 110 ? -6.786  -1.877  4.957   1.00 0.00 ? 110 VAL A HG23 2  
ATOM 4617  N N    . ILE A 1 111 ? -2.962  -1.255  1.357   1.00 0.00 ? 111 ILE A N    2  
ATOM 4618  C CA   . ILE A 1 111 ? -1.669  -1.429  0.723   1.00 0.00 ? 111 ILE A CA   2  
ATOM 4619  C C    . ILE A 1 111 ? -1.271  -0.058  0.165   1.00 0.00 ? 111 ILE A C    2  
ATOM 4620  O O    . ILE A 1 111 ? -1.573  0.242   -0.986  1.00 0.00 ? 111 ILE A O    2  
ATOM 4621  C CB   . ILE A 1 111 ? -1.763  -2.518  -0.387  1.00 0.00 ? 111 ILE A CB   2  
ATOM 4622  C CG1  . ILE A 1 111 ? -2.712  -3.697  -0.039  1.00 0.00 ? 111 ILE A CG1  2  
ATOM 4623  C CG2  . ILE A 1 111 ? -0.342  -3.035  -0.647  1.00 0.00 ? 111 ILE A CG2  2  
ATOM 4624  C CD1  . ILE A 1 111 ? -2.807  -4.788  -1.111  1.00 0.00 ? 111 ILE A CD1  2  
ATOM 4625  H H    . ILE A 1 111 ? -3.617  -0.710  0.808   1.00 0.00 ? 111 ILE A H    2  
ATOM 4626  H HA   . ILE A 1 111 ? -0.942  -1.739  1.477   1.00 0.00 ? 111 ILE A HA   2  
ATOM 4627  H HB   . ILE A 1 111 ? -2.142  -2.053  -1.302  1.00 0.00 ? 111 ILE A HB   2  
ATOM 4628  H HG12 . ILE A 1 111 ? -2.392  -4.153  0.899   1.00 0.00 ? 111 ILE A HG12 2  
ATOM 4629  H HG13 . ILE A 1 111 ? -3.723  -3.311  0.099   1.00 0.00 ? 111 ILE A HG13 2  
ATOM 4630  H HG21 . ILE A 1 111 ? -0.325  -3.699  -1.507  1.00 0.00 ? 111 ILE A HG21 2  
ATOM 4631  H HG22 . ILE A 1 111 ? 0.333   -2.198  -0.835  1.00 0.00 ? 111 ILE A HG22 2  
ATOM 4632  H HG23 . ILE A 1 111 ? -0.005  -3.593  0.223   1.00 0.00 ? 111 ILE A HG23 2  
ATOM 4633  H HD11 . ILE A 1 111 ? -1.872  -5.342  -1.158  1.00 0.00 ? 111 ILE A HD11 2  
ATOM 4634  H HD12 . ILE A 1 111 ? -3.602  -5.483  -0.842  1.00 0.00 ? 111 ILE A HD12 2  
ATOM 4635  H HD13 . ILE A 1 111 ? -3.029  -4.343  -2.082  1.00 0.00 ? 111 ILE A HD13 2  
ATOM 4636  N N    . ASP A 1 112 ? -0.674  0.833   0.961   1.00 0.00 ? 112 ASP A N    2  
ATOM 4637  C CA   . ASP A 1 112 ? -0.073  2.075   0.436   1.00 0.00 ? 112 ASP A CA   2  
ATOM 4638  C C    . ASP A 1 112 ? 1.249   1.749   -0.291  1.00 0.00 ? 112 ASP A C    2  
ATOM 4639  O O    . ASP A 1 112 ? 1.694   0.603   -0.278  1.00 0.00 ? 112 ASP A O    2  
ATOM 4640  C CB   . ASP A 1 112 ? 0.099   3.089   1.583   1.00 0.00 ? 112 ASP A CB   2  
ATOM 4641  C CG   . ASP A 1 112 ? 0.533   4.508   1.170   1.00 0.00 ? 112 ASP A CG   2  
ATOM 4642  O OD1  . ASP A 1 112 ? 0.368   4.889   -0.005  1.00 0.00 ? 112 ASP A OD1  2  
ATOM 4643  O OD2  . ASP A 1 112 ? 1.058   5.281   2.008   1.00 0.00 ? 112 ASP A OD2  2  
ATOM 4644  H H    . ASP A 1 112 ? -0.376  0.515   1.874   1.00 0.00 ? 112 ASP A H    2  
ATOM 4645  H HA   . ASP A 1 112 ? -0.745  2.514   -0.300  1.00 0.00 ? 112 ASP A HA   2  
ATOM 4646  H HB2  . ASP A 1 112 ? -0.842  3.169   2.130   1.00 0.00 ? 112 ASP A HB2  2  
ATOM 4647  H HB3  . ASP A 1 112 ? 0.841   2.671   2.242   1.00 0.00 ? 112 ASP A HB3  2  
ATOM 4648  N N    . GLU A 1 113 ? 1.825   2.737   -0.979  1.00 0.00 ? 113 GLU A N    2  
ATOM 4649  C CA   . GLU A 1 113 ? 3.077   2.746   -1.741  1.00 0.00 ? 113 GLU A CA   2  
ATOM 4650  C C    . GLU A 1 113 ? 3.400   1.415   -2.445  1.00 0.00 ? 113 GLU A C    2  
ATOM 4651  O O    . GLU A 1 113 ? 4.349   0.698   -2.123  1.00 0.00 ? 113 GLU A O    2  
ATOM 4652  C CB   . GLU A 1 113 ? 4.215   3.346   -0.892  1.00 0.00 ? 113 GLU A CB   2  
ATOM 4653  C CG   . GLU A 1 113 ? 5.266   4.084   -1.741  1.00 0.00 ? 113 GLU A CG   2  
ATOM 4654  C CD   . GLU A 1 113 ? 6.495   3.244   -2.078  1.00 0.00 ? 113 GLU A CD   2  
ATOM 4655  O OE1  . GLU A 1 113 ? 7.445   3.271   -1.261  1.00 0.00 ? 113 GLU A OE1  2  
ATOM 4656  O OE2  . GLU A 1 113 ? 6.550   2.643   -3.175  1.00 0.00 ? 113 GLU A OE2  2  
ATOM 4657  H H    . GLU A 1 113 ? 1.339   3.629   -0.925  1.00 0.00 ? 113 GLU A H    2  
ATOM 4658  H HA   . GLU A 1 113 ? 2.905   3.463   -2.542  1.00 0.00 ? 113 GLU A HA   2  
ATOM 4659  H HB2  . GLU A 1 113 ? 3.777   4.095   -0.229  1.00 0.00 ? 113 GLU A HB2  2  
ATOM 4660  H HB3  . GLU A 1 113 ? 4.680   2.586   -0.262  1.00 0.00 ? 113 GLU A HB3  2  
ATOM 4661  H HG2  . GLU A 1 113 ? 4.816   4.468   -2.658  1.00 0.00 ? 113 GLU A HG2  2  
ATOM 4662  H HG3  . GLU A 1 113 ? 5.611   4.948   -1.171  1.00 0.00 ? 113 GLU A HG3  2  
ATOM 4663  N N    . ILE A 1 114 ? 2.597   1.107   -3.463  1.00 0.00 ? 114 ILE A N    2  
ATOM 4664  C CA   . ILE A 1 114 ? 2.878   0.104   -4.482  1.00 0.00 ? 114 ILE A CA   2  
ATOM 4665  C C    . ILE A 1 114 ? 3.628   0.878   -5.568  1.00 0.00 ? 114 ILE A C    2  
ATOM 4666  O O    . ILE A 1 114 ? 2.991   1.510   -6.408  1.00 0.00 ? 114 ILE A O    2  
ATOM 4667  C CB   . ILE A 1 114 ? 1.540   -0.545  -4.937  1.00 0.00 ? 114 ILE A CB   2  
ATOM 4668  C CG1  . ILE A 1 114 ? 1.088   -1.593  -3.891  1.00 0.00 ? 114 ILE A CG1  2  
ATOM 4669  C CG2  . ILE A 1 114 ? 1.611   -1.183  -6.338  1.00 0.00 ? 114 ILE A CG2  2  
ATOM 4670  C CD1  . ILE A 1 114 ? -0.421  -1.894  -3.924  1.00 0.00 ? 114 ILE A CD1  2  
ATOM 4671  H H    . ILE A 1 114 ? 1.853   1.758   -3.687  1.00 0.00 ? 114 ILE A H    2  
ATOM 4672  H HA   . ILE A 1 114 ? 3.531   -0.673  -4.082  1.00 0.00 ? 114 ILE A HA   2  
ATOM 4673  H HB   . ILE A 1 114 ? 0.782   0.236   -4.996  1.00 0.00 ? 114 ILE A HB   2  
ATOM 4674  H HG12 . ILE A 1 114 ? 1.642   -2.518  -4.055  1.00 0.00 ? 114 ILE A HG12 2  
ATOM 4675  H HG13 . ILE A 1 114 ? 1.332   -1.248  -2.886  1.00 0.00 ? 114 ILE A HG13 2  
ATOM 4676  H HG21 . ILE A 1 114 ? 2.591   -1.620  -6.510  1.00 0.00 ? 114 ILE A HG21 2  
ATOM 4677  H HG22 . ILE A 1 114 ? 0.843   -1.942  -6.467  1.00 0.00 ? 114 ILE A HG22 2  
ATOM 4678  H HG23 . ILE A 1 114 ? 1.457   -0.412  -7.087  1.00 0.00 ? 114 ILE A HG23 2  
ATOM 4679  H HD11 . ILE A 1 114 ? -0.798  -1.880  -4.945  1.00 0.00 ? 114 ILE A HD11 2  
ATOM 4680  H HD12 . ILE A 1 114 ? -0.607  -2.882  -3.512  1.00 0.00 ? 114 ILE A HD12 2  
ATOM 4681  H HD13 . ILE A 1 114 ? -0.971  -1.173  -3.313  1.00 0.00 ? 114 ILE A HD13 2  
ATOM 4682  N N    . GLY A 1 115 ? 4.961   0.920   -5.514  1.00 0.00 ? 115 GLY A N    2  
ATOM 4683  C CA   . GLY A 1 115 ? 5.744   1.797   -6.374  1.00 0.00 ? 115 GLY A CA   2  
ATOM 4684  C C    . GLY A 1 115 ? 7.209   1.389   -6.423  1.00 0.00 ? 115 GLY A C    2  
ATOM 4685  O O    . GLY A 1 115 ? 7.629   0.729   -7.371  1.00 0.00 ? 115 GLY A O    2  
ATOM 4686  H H    . GLY A 1 115 ? 5.447   0.436   -4.767  1.00 0.00 ? 115 GLY A H    2  
ATOM 4687  H HA2  . GLY A 1 115 ? 5.339   1.768   -7.387  1.00 0.00 ? 115 GLY A HA2  2  
ATOM 4688  H HA3  . GLY A 1 115 ? 5.666   2.817   -5.998  1.00 0.00 ? 115 GLY A HA3  2  
ATOM 4689  N N    . LYS A 1 116 ? 7.998   1.777   -5.416  1.00 0.00 ? 116 LYS A N    2  
ATOM 4690  C CA   . LYS A 1 116 ? 9.447   1.554   -5.359  1.00 0.00 ? 116 LYS A CA   2  
ATOM 4691  C C    . LYS A 1 116 ? 9.835   0.094   -5.564  1.00 0.00 ? 116 LYS A C    2  
ATOM 4692  O O    . LYS A 1 116 ? 10.879  -0.155  -6.161  1.00 0.00 ? 116 LYS A O    2  
ATOM 4693  C CB   . LYS A 1 116 ? 10.010  2.036   -4.014  1.00 0.00 ? 116 LYS A CB   2  
ATOM 4694  C CG   . LYS A 1 116 ? 10.326  3.536   -4.029  1.00 0.00 ? 116 LYS A CG   2  
ATOM 4695  C CD   . LYS A 1 116 ? 10.616  4.014   -2.606  1.00 0.00 ? 116 LYS A CD   2  
ATOM 4696  C CE   . LYS A 1 116 ? 11.142  5.448   -2.603  1.00 0.00 ? 116 LYS A CE   2  
ATOM 4697  N NZ   . LYS A 1 116 ? 11.069  6.028   -1.253  1.00 0.00 ? 116 LYS A NZ   2  
ATOM 4698  H H    . LYS A 1 116 ? 7.548   2.233   -4.622  1.00 0.00 ? 116 LYS A H    2  
ATOM 4699  H HA   . LYS A 1 116 ? 9.919   2.121   -6.163  1.00 0.00 ? 116 LYS A HA   2  
ATOM 4700  H HB2  . LYS A 1 116 ? 9.300   1.808   -3.216  1.00 0.00 ? 116 LYS A HB2  2  
ATOM 4701  H HB3  . LYS A 1 116 ? 10.936  1.497   -3.801  1.00 0.00 ? 116 LYS A HB3  2  
ATOM 4702  H HG2  . LYS A 1 116 ? 11.198  3.713   -4.660  1.00 0.00 ? 116 LYS A HG2  2  
ATOM 4703  H HG3  . LYS A 1 116 ? 9.478   4.094   -4.429  1.00 0.00 ? 116 LYS A HG3  2  
ATOM 4704  H HD2  . LYS A 1 116 ? 9.690   3.956   -2.041  1.00 0.00 ? 116 LYS A HD2  2  
ATOM 4705  H HD3  . LYS A 1 116 ? 11.349  3.366   -2.125  1.00 0.00 ? 116 LYS A HD3  2  
ATOM 4706  H HE2  . LYS A 1 116 ? 12.179  5.439   -2.945  1.00 0.00 ? 116 LYS A HE2  2  
ATOM 4707  H HE3  . LYS A 1 116 ? 10.548  6.063   -3.283  1.00 0.00 ? 116 LYS A HE3  2  
ATOM 4708  H HZ1  . LYS A 1 116 ? 10.098  6.125   -0.963  1.00 0.00 ? 116 LYS A HZ1  2  
ATOM 4709  H HZ2  . LYS A 1 116 ? 11.499  5.406   -0.571  1.00 0.00 ? 116 LYS A HZ2  2  
ATOM 4710  H HZ3  . LYS A 1 116 ? 11.566  6.910   -1.228  1.00 0.00 ? 116 LYS A HZ3  2  
ATOM 4711  N N    . MET A 1 117 ? 9.044   -0.867  -5.081  1.00 0.00 ? 117 MET A N    2  
ATOM 4712  C CA   . MET A 1 117 ? 9.378   -2.273  -5.270  1.00 0.00 ? 117 MET A CA   2  
ATOM 4713  C C    . MET A 1 117 ? 9.236   -2.755  -6.709  1.00 0.00 ? 117 MET A C    2  
ATOM 4714  O O    . MET A 1 117 ? 9.587   -3.905  -6.931  1.00 0.00 ? 117 MET A O    2  
ATOM 4715  C CB   . MET A 1 117 ? 8.574   -3.179  -4.321  1.00 0.00 ? 117 MET A CB   2  
ATOM 4716  C CG   . MET A 1 117 ? 9.291   -3.310  -2.974  1.00 0.00 ? 117 MET A CG   2  
ATOM 4717  S SD   . MET A 1 117 ? 9.441   -5.028  -2.428  1.00 0.00 ? 117 MET A SD   2  
ATOM 4718  C CE   . MET A 1 117 ? 10.389  -4.763  -0.909  1.00 0.00 ? 117 MET A CE   2  
ATOM 4719  H H    . MET A 1 117 ? 8.193   -0.629  -4.580  1.00 0.00 ? 117 MET A H    2  
ATOM 4720  H HA   . MET A 1 117 ? 10.438  -2.394  -5.046  1.00 0.00 ? 117 MET A HA   2  
ATOM 4721  H HB2  . MET A 1 117 ? 7.572   -2.780  -4.168  1.00 0.00 ? 117 MET A HB2  2  
ATOM 4722  H HB3  . MET A 1 117 ? 8.460   -4.180  -4.762  1.00 0.00 ? 117 MET A HB3  2  
ATOM 4723  H HG2  . MET A 1 117 ? 10.296  -2.897  -3.039  1.00 0.00 ? 117 MET A HG2  2  
ATOM 4724  H HG3  . MET A 1 117 ? 8.751   -2.729  -2.227  1.00 0.00 ? 117 MET A HG3  2  
ATOM 4725  H HE1  . MET A 1 117 ? 10.493  -5.703  -0.370  1.00 0.00 ? 117 MET A HE1  2  
ATOM 4726  H HE2  . MET A 1 117 ? 11.374  -4.395  -1.172  1.00 0.00 ? 117 MET A HE2  2  
ATOM 4727  H HE3  . MET A 1 117 ? 9.887   -4.035  -0.274  1.00 0.00 ? 117 MET A HE3  2  
ATOM 4728  N N    . GLU A 1 118 ? 8.772   -1.949  -7.676  1.00 0.00 ? 118 GLU A N    2  
ATOM 4729  C CA   . GLU A 1 118 ? 8.474   -2.372  -9.045  1.00 0.00 ? 118 GLU A CA   2  
ATOM 4730  C C    . GLU A 1 118 ? 9.502   -3.364  -9.584  1.00 0.00 ? 118 GLU A C    2  
ATOM 4731  O O    . GLU A 1 118 ? 9.116   -4.445  -10.027 1.00 0.00 ? 118 GLU A O    2  
ATOM 4732  C CB   . GLU A 1 118 ? 8.350   -1.144  -9.952  1.00 0.00 ? 118 GLU A CB   2  
ATOM 4733  C CG   . GLU A 1 118 ? 8.183   -1.505  -11.438 1.00 0.00 ? 118 GLU A CG   2  
ATOM 4734  C CD   . GLU A 1 118 ? 9.378   -1.067  -12.282 1.00 0.00 ? 118 GLU A CD   2  
ATOM 4735  O OE1  . GLU A 1 118 ? 9.502   0.154   -12.546 1.00 0.00 ? 118 GLU A OE1  2  
ATOM 4736  O OE2  . GLU A 1 118 ? 10.200  -1.923  -12.672 1.00 0.00 ? 118 GLU A OE2  2  
ATOM 4737  H H    . GLU A 1 118 ? 8.505   -1.002  -7.429  1.00 0.00 ? 118 GLU A H    2  
ATOM 4738  H HA   . GLU A 1 118 ? 7.505   -2.871  -9.041  1.00 0.00 ? 118 GLU A HA   2  
ATOM 4739  H HB2  . GLU A 1 118 ? 7.474   -0.582  -9.634  1.00 0.00 ? 118 GLU A HB2  2  
ATOM 4740  H HB3  . GLU A 1 118 ? 9.227   -0.506  -9.823  1.00 0.00 ? 118 GLU A HB3  2  
ATOM 4741  H HG2  . GLU A 1 118 ? 8.014   -2.572  -11.573 1.00 0.00 ? 118 GLU A HG2  2  
ATOM 4742  H HG3  . GLU A 1 118 ? 7.297   -1.000  -11.799 1.00 0.00 ? 118 GLU A HG3  2  
ATOM 4743  N N    . LEU A 1 119 ? 10.786  -3.016  -9.506  1.00 0.00 ? 119 LEU A N    2  
ATOM 4744  C CA   . LEU A 1 119 ? 11.874  -3.838  -10.015 1.00 0.00 ? 119 LEU A CA   2  
ATOM 4745  C C    . LEU A 1 119 ? 11.924  -5.199  -9.309  1.00 0.00 ? 119 LEU A C    2  
ATOM 4746  O O    . LEU A 1 119 ? 12.043  -6.232  -9.961  1.00 0.00 ? 119 LEU A O    2  
ATOM 4747  C CB   . LEU A 1 119 ? 13.184  -3.033  -9.888  1.00 0.00 ? 119 LEU A CB   2  
ATOM 4748  C CG   . LEU A 1 119 ? 14.324  -3.411  -10.853 1.00 0.00 ? 119 LEU A CG   2  
ATOM 4749  C CD1  . LEU A 1 119 ? 14.970  -4.768  -10.573 1.00 0.00 ? 119 LEU A CD1  2  
ATOM 4750  C CD2  . LEU A 1 119 ? 13.881  -3.323  -12.317 1.00 0.00 ? 119 LEU A CD2  2  
ATOM 4751  H H    . LEU A 1 119 ? 11.006  -2.128  -9.076  1.00 0.00 ? 119 LEU A H    2  
ATOM 4752  H HA   . LEU A 1 119 ? 11.669  -4.018  -11.063 1.00 0.00 ? 119 LEU A HA   2  
ATOM 4753  H HB2  . LEU A 1 119 ? 12.958  -1.983  -10.083 1.00 0.00 ? 119 LEU A HB2  2  
ATOM 4754  H HB3  . LEU A 1 119 ? 13.547  -3.093  -8.863  1.00 0.00 ? 119 LEU A HB3  2  
ATOM 4755  H HG   . LEU A 1 119 ? 15.103  -2.663  -10.711 1.00 0.00 ? 119 LEU A HG   2  
ATOM 4756  H HD11 . LEU A 1 119 ? 14.291  -5.578  -10.827 1.00 0.00 ? 119 LEU A HD11 2  
ATOM 4757  H HD12 . LEU A 1 119 ? 15.872  -4.882  -11.174 1.00 0.00 ? 119 LEU A HD12 2  
ATOM 4758  H HD13 . LEU A 1 119 ? 15.240  -4.851  -9.522  1.00 0.00 ? 119 LEU A HD13 2  
ATOM 4759  H HD21 . LEU A 1 119 ? 13.449  -2.342  -12.512 1.00 0.00 ? 119 LEU A HD21 2  
ATOM 4760  H HD22 . LEU A 1 119 ? 14.737  -3.485  -12.964 1.00 0.00 ? 119 LEU A HD22 2  
ATOM 4761  H HD23 . LEU A 1 119 ? 13.132  -4.077  -12.556 1.00 0.00 ? 119 LEU A HD23 2  
ATOM 4762  N N    . PHE A 1 120 ? 11.800  -5.186  -7.984  1.00 0.00 ? 120 PHE A N    2  
ATOM 4763  C CA   . PHE A 1 120 ? 12.012  -6.300  -7.067  1.00 0.00 ? 120 PHE A CA   2  
ATOM 4764  C C    . PHE A 1 120 ? 10.762  -7.184  -6.869  1.00 0.00 ? 120 PHE A C    2  
ATOM 4765  O O    . PHE A 1 120 ? 10.848  -8.213  -6.196  1.00 0.00 ? 120 PHE A O    2  
ATOM 4766  C CB   . PHE A 1 120 ? 12.432  -5.711  -5.702  1.00 0.00 ? 120 PHE A CB   2  
ATOM 4767  C CG   . PHE A 1 120 ? 13.379  -4.510  -5.709  1.00 0.00 ? 120 PHE A CG   2  
ATOM 4768  C CD1  . PHE A 1 120 ? 14.492  -4.462  -6.570  1.00 0.00 ? 120 PHE A CD1  2  
ATOM 4769  C CD2  . PHE A 1 120 ? 13.124  -3.409  -4.867  1.00 0.00 ? 120 PHE A CD2  2  
ATOM 4770  C CE1  . PHE A 1 120 ? 15.335  -3.336  -6.596  1.00 0.00 ? 120 PHE A CE1  2  
ATOM 4771  C CE2  . PHE A 1 120 ? 13.953  -2.273  -4.899  1.00 0.00 ? 120 PHE A CE2  2  
ATOM 4772  C CZ   . PHE A 1 120 ? 15.061  -2.234  -5.765  1.00 0.00 ? 120 PHE A CZ   2  
ATOM 4773  H H    . PHE A 1 120 ? 11.547  -4.306  -7.557  1.00 0.00 ? 120 PHE A H    2  
ATOM 4774  H HA   . PHE A 1 120 ? 12.822  -6.922  -7.453  1.00 0.00 ? 120 PHE A HA   2  
ATOM 4775  H HB2  . PHE A 1 120 ? 11.521  -5.404  -5.184  1.00 0.00 ? 120 PHE A HB2  2  
ATOM 4776  H HB3  . PHE A 1 120 ? 12.881  -6.511  -5.112  1.00 0.00 ? 120 PHE A HB3  2  
ATOM 4777  H HD1  . PHE A 1 120 ? 14.682  -5.287  -7.237  1.00 0.00 ? 120 PHE A HD1  2  
ATOM 4778  H HD2  . PHE A 1 120 ? 12.277  -3.434  -4.199  1.00 0.00 ? 120 PHE A HD2  2  
ATOM 4779  H HE1  . PHE A 1 120 ? 16.175  -3.315  -7.277  1.00 0.00 ? 120 PHE A HE1  2  
ATOM 4780  H HE2  . PHE A 1 120 ? 13.723  -1.424  -4.270  1.00 0.00 ? 120 PHE A HE2  2  
ATOM 4781  H HZ   . PHE A 1 120 ? 15.689  -1.355  -5.808  1.00 0.00 ? 120 PHE A HZ   2  
ATOM 4782  N N    . SER A 1 121 ? 9.595   -6.761  -7.366  1.00 0.00 ? 121 SER A N    2  
ATOM 4783  C CA   . SER A 1 121 ? 8.281   -7.295  -7.011  1.00 0.00 ? 121 SER A CA   2  
ATOM 4784  C C    . SER A 1 121 ? 8.196   -8.814  -7.236  1.00 0.00 ? 121 SER A C    2  
ATOM 4785  O O    . SER A 1 121 ? 8.114   -9.248  -8.384  1.00 0.00 ? 121 SER A O    2  
ATOM 4786  C CB   . SER A 1 121 ? 7.176   -6.605  -7.834  1.00 0.00 ? 121 SER A CB   2  
ATOM 4787  O OG   . SER A 1 121 ? 7.267   -5.197  -7.874  1.00 0.00 ? 121 SER A OG   2  
ATOM 4788  H H    . SER A 1 121 ? 9.628   -5.867  -7.835  1.00 0.00 ? 121 SER A H    2  
ATOM 4789  H HA   . SER A 1 121 ? 8.113   -7.074  -5.956  1.00 0.00 ? 121 SER A HA   2  
ATOM 4790  H HB2  . SER A 1 121 ? 7.236   -6.949  -8.859  1.00 0.00 ? 121 SER A HB2  2  
ATOM 4791  H HB3  . SER A 1 121 ? 6.203   -6.887  -7.430  1.00 0.00 ? 121 SER A HB3  2  
ATOM 4792  H HG   . SER A 1 121 ? 8.018   -4.993  -8.459  1.00 0.00 ? 121 SER A HG   2  
ATOM 4793  N N    . GLN A 1 122 ? 8.132   -9.616  -6.165  1.00 0.00 ? 122 GLN A N    2  
ATOM 4794  C CA   . GLN A 1 122 ? 7.847   -11.047 -6.266  1.00 0.00 ? 122 GLN A CA   2  
ATOM 4795  C C    . GLN A 1 122 ? 6.590   -11.414 -5.489  1.00 0.00 ? 122 GLN A C    2  
ATOM 4796  O O    . GLN A 1 122 ? 5.505   -11.497 -6.063  1.00 0.00 ? 122 GLN A O    2  
ATOM 4797  C CB   . GLN A 1 122 ? 9.049   -11.905 -5.836  1.00 0.00 ? 122 GLN A CB   2  
ATOM 4798  C CG   . GLN A 1 122 ? 10.106  -12.017 -6.946  1.00 0.00 ? 122 GLN A CG   2  
ATOM 4799  C CD   . GLN A 1 122 ? 10.877  -13.340 -6.930  1.00 0.00 ? 122 GLN A CD   2  
ATOM 4800  O OE1  . GLN A 1 122 ? 12.087  -13.392 -7.129  1.00 0.00 ? 122 GLN A OE1  2  
ATOM 4801  N NE2  . GLN A 1 122 ? 10.189  -14.456 -6.763  1.00 0.00 ? 122 GLN A NE2  2  
ATOM 4802  H H    . GLN A 1 122 ? 8.328   -9.221  -5.259  1.00 0.00 ? 122 GLN A H    2  
ATOM 4803  H HA   . GLN A 1 122 ? 7.618   -11.284 -7.305  1.00 0.00 ? 122 GLN A HA   2  
ATOM 4804  H HB2  . GLN A 1 122 ? 9.507   -11.504 -4.930  1.00 0.00 ? 122 GLN A HB2  2  
ATOM 4805  H HB3  . GLN A 1 122 ? 8.663   -12.895 -5.598  1.00 0.00 ? 122 GLN A HB3  2  
ATOM 4806  H HG2  . GLN A 1 122 ? 9.627   -11.931 -7.918  1.00 0.00 ? 122 GLN A HG2  2  
ATOM 4807  H HG3  . GLN A 1 122 ? 10.794  -11.182 -6.836  1.00 0.00 ? 122 GLN A HG3  2  
ATOM 4808  H HE21 . GLN A 1 122 ? 9.177   -14.384 -6.699  1.00 0.00 ? 122 GLN A HE21 2  
ATOM 4809  H HE22 . GLN A 1 122 ? 10.643  -15.360 -6.693  1.00 0.00 ? 122 GLN A HE22 2  
ATOM 4810  N N    . LEU A 1 123 ? 6.709   -11.638 -4.179  1.00 0.00 ? 123 LEU A N    2  
ATOM 4811  C CA   . LEU A 1 123 ? 5.591   -12.108 -3.360  1.00 0.00 ? 123 LEU A CA   2  
ATOM 4812  C C    . LEU A 1 123 ? 4.443   -11.104 -3.335  1.00 0.00 ? 123 LEU A C    2  
ATOM 4813  O O    . LEU A 1 123 ? 3.316   -11.505 -3.066  1.00 0.00 ? 123 LEU A O    2  
ATOM 4814  C CB   . LEU A 1 123 ? 6.071   -12.399 -1.935  1.00 0.00 ? 123 LEU A CB   2  
ATOM 4815  C CG   . LEU A 1 123 ? 7.107   -13.535 -1.858  1.00 0.00 ? 123 LEU A CG   2  
ATOM 4816  C CD1  . LEU A 1 123 ? 7.687   -13.553 -0.449  1.00 0.00 ? 123 LEU A CD1  2  
ATOM 4817  C CD2  . LEU A 1 123 ? 6.491   -14.908 -2.156  1.00 0.00 ? 123 LEU A CD2  2  
ATOM 4818  H H    . LEU A 1 123 ? 7.628   -11.595 -3.762  1.00 0.00 ? 123 LEU A H    2  
ATOM 4819  H HA   . LEU A 1 123 ? 5.188   -13.025 -3.793  1.00 0.00 ? 123 LEU A HA   2  
ATOM 4820  H HB2  . LEU A 1 123 ? 6.500   -11.484 -1.522  1.00 0.00 ? 123 LEU A HB2  2  
ATOM 4821  H HB3  . LEU A 1 123 ? 5.207   -12.665 -1.325  1.00 0.00 ? 123 LEU A HB3  2  
ATOM 4822  H HG   . LEU A 1 123 ? 7.918   -13.341 -2.570  1.00 0.00 ? 123 LEU A HG   2  
ATOM 4823  H HD11 . LEU A 1 123 ? 8.161   -12.596 -0.226  1.00 0.00 ? 123 LEU A HD11 2  
ATOM 4824  H HD12 . LEU A 1 123 ? 6.911   -13.753 0.290   1.00 0.00 ? 123 LEU A HD12 2  
ATOM 4825  H HD13 . LEU A 1 123 ? 8.452   -14.319 -0.369  1.00 0.00 ? 123 LEU A HD13 2  
ATOM 4826  H HD21 . LEU A 1 123 ? 6.105   -14.939 -3.174  1.00 0.00 ? 123 LEU A HD21 2  
ATOM 4827  H HD22 . LEU A 1 123 ? 7.255   -15.678 -2.054  1.00 0.00 ? 123 LEU A HD22 2  
ATOM 4828  H HD23 . LEU A 1 123 ? 5.682   -15.115 -1.456  1.00 0.00 ? 123 LEU A HD23 2  
ATOM 4829  N N    . PHE A 1 124 ? 4.734   -9.843  -3.673  1.00 0.00 ? 124 PHE A N    2  
ATOM 4830  C CA   . PHE A 1 124 ? 3.795   -8.751  -3.842  1.00 0.00 ? 124 PHE A CA   2  
ATOM 4831  C C    . PHE A 1 124 ? 2.640   -9.179  -4.745  1.00 0.00 ? 124 PHE A C    2  
ATOM 4832  O O    . PHE A 1 124 ? 1.579   -9.460  -4.194  1.00 0.00 ? 124 PHE A O    2  
ATOM 4833  C CB   . PHE A 1 124 ? 4.549   -7.480  -4.283  1.00 0.00 ? 124 PHE A CB   2  
ATOM 4834  C CG   . PHE A 1 124 ? 4.309   -6.234  -3.444  1.00 0.00 ? 124 PHE A CG   2  
ATOM 4835  C CD1  . PHE A 1 124 ? 3.066   -5.993  -2.823  1.00 0.00 ? 124 PHE A CD1  2  
ATOM 4836  C CD2  . PHE A 1 124 ? 5.320   -5.256  -3.355  1.00 0.00 ? 124 PHE A CD2  2  
ATOM 4837  C CE1  . PHE A 1 124 ? 2.842   -4.795  -2.121  1.00 0.00 ? 124 PHE A CE1  2  
ATOM 4838  C CE2  . PHE A 1 124 ? 5.087   -4.053  -2.664  1.00 0.00 ? 124 PHE A CE2  2  
ATOM 4839  C CZ   . PHE A 1 124 ? 3.851   -3.822  -2.040  1.00 0.00 ? 124 PHE A CZ   2  
ATOM 4840  H H    . PHE A 1 124 ? 5.699   -9.647  -3.870  1.00 0.00 ? 124 PHE A H    2  
ATOM 4841  H HA   . PHE A 1 124 ? 3.346   -8.581  -2.870  1.00 0.00 ? 124 PHE A HA   2  
ATOM 4842  H HB2  . PHE A 1 124 ? 5.623   -7.677  -4.270  1.00 0.00 ? 124 PHE A HB2  2  
ATOM 4843  H HB3  . PHE A 1 124 ? 4.300   -7.249  -5.317  1.00 0.00 ? 124 PHE A HB3  2  
ATOM 4844  H HD1  . PHE A 1 124 ? 2.265   -6.716  -2.888  1.00 0.00 ? 124 PHE A HD1  2  
ATOM 4845  H HD2  . PHE A 1 124 ? 6.266   -5.402  -3.859  1.00 0.00 ? 124 PHE A HD2  2  
ATOM 4846  H HE1  . PHE A 1 124 ? 1.880   -4.615  -1.664  1.00 0.00 ? 124 PHE A HE1  2  
ATOM 4847  H HE2  . PHE A 1 124 ? 5.852   -3.291  -2.635  1.00 0.00 ? 124 PHE A HE2  2  
ATOM 4848  H HZ   . PHE A 1 124 ? 3.672   -2.890  -1.520  1.00 0.00 ? 124 PHE A HZ   2  
ATOM 4849  N N    . ILE A 1 125 ? 2.829   -9.303  -6.073  1.00 0.00 ? 125 ILE A N    2  
ATOM 4850  C CA   . ILE A 1 125 ? 1.862   -9.880  -6.988  1.00 0.00 ? 125 ILE A CA   2  
ATOM 4851  C C    . ILE A 1 125 ? 1.053   -11.018 -6.355  1.00 0.00 ? 125 ILE A C    2  
ATOM 4852  O O    . ILE A 1 125 ? -0.167  -10.928 -6.331  1.00 0.00 ? 125 ILE A O    2  
ATOM 4853  C CB   . ILE A 1 125 ? 2.547   -10.396 -8.275  1.00 0.00 ? 125 ILE A CB   2  
ATOM 4854  C CG1  . ILE A 1 125 ? 3.515   -9.405  -8.955  1.00 0.00 ? 125 ILE A CG1  2  
ATOM 4855  C CG2  . ILE A 1 125 ? 1.500   -10.883 -9.281  1.00 0.00 ? 125 ILE A CG2  2  
ATOM 4856  C CD1  . ILE A 1 125 ? 4.950   -9.647  -8.490  1.00 0.00 ? 125 ILE A CD1  2  
ATOM 4857  H H    . ILE A 1 125 ? 3.567   -8.831  -6.586  1.00 0.00 ? 125 ILE A H    2  
ATOM 4858  H HA   . ILE A 1 125 ? 1.196   -9.053  -7.228  1.00 0.00 ? 125 ILE A HA   2  
ATOM 4859  H HB   . ILE A 1 125 ? 3.123   -11.277 -8.009  1.00 0.00 ? 125 ILE A HB   2  
ATOM 4860  H HG12 . ILE A 1 125 ? 3.504   -9.549  -10.037 1.00 0.00 ? 125 ILE A HG12 2  
ATOM 4861  H HG13 . ILE A 1 125 ? 3.225   -8.376  -8.750  1.00 0.00 ? 125 ILE A HG13 2  
ATOM 4862  H HG21 . ILE A 1 125 ? 0.932   -11.719 -8.876  1.00 0.00 ? 125 ILE A HG21 2  
ATOM 4863  H HG22 . ILE A 1 125 ? 0.808   -10.082 -9.530  1.00 0.00 ? 125 ILE A HG22 2  
ATOM 4864  H HG23 . ILE A 1 125 ? 2.006   -11.216 -10.184 1.00 0.00 ? 125 ILE A HG23 2  
ATOM 4865  H HD11 . ILE A 1 125 ? 5.627   -9.045  -9.083  1.00 0.00 ? 125 ILE A HD11 2  
ATOM 4866  H HD12 . ILE A 1 125 ? 5.066   -9.373  -7.444  1.00 0.00 ? 125 ILE A HD12 2  
ATOM 4867  H HD13 . ILE A 1 125 ? 5.208   -10.698 -8.635  1.00 0.00 ? 125 ILE A HD13 2  
ATOM 4868  N N    . GLN A 1 126 ? 1.694   -12.090 -5.874  1.00 0.00 ? 126 GLN A N    2  
ATOM 4869  C CA   . GLN A 1 126 ? 1.002   -13.272 -5.372  1.00 0.00 ? 126 GLN A CA   2  
ATOM 4870  C C    . GLN A 1 126 ? 0.052   -12.933 -4.236  1.00 0.00 ? 126 GLN A C    2  
ATOM 4871  O O    . GLN A 1 126 ? -1.136  -13.258 -4.329  1.00 0.00 ? 126 GLN A O    2  
ATOM 4872  C CB   . GLN A 1 126 ? 2.008   -14.320 -4.866  1.00 0.00 ? 126 GLN A CB   2  
ATOM 4873  C CG   . GLN A 1 126 ? 2.379   -15.354 -5.936  1.00 0.00 ? 126 GLN A CG   2  
ATOM 4874  C CD   . GLN A 1 126 ? 1.670   -16.681 -5.709  1.00 0.00 ? 126 GLN A CD   2  
ATOM 4875  O OE1  . GLN A 1 126 ? 0.441   -16.756 -5.682  1.00 0.00 ? 126 GLN A OE1  2  
ATOM 4876  N NE2  . GLN A 1 126 ? 2.422   -17.751 -5.545  1.00 0.00 ? 126 GLN A NE2  2  
ATOM 4877  H H    . GLN A 1 126 ? 2.704   -12.106 -5.886  1.00 0.00 ? 126 GLN A H    2  
ATOM 4878  H HA   . GLN A 1 126 ? 0.396   -13.676 -6.187  1.00 0.00 ? 126 GLN A HA   2  
ATOM 4879  H HB2  . GLN A 1 126 ? 2.910   -13.819 -4.515  1.00 0.00 ? 126 GLN A HB2  2  
ATOM 4880  H HB3  . GLN A 1 126 ? 1.578   -14.835 -4.000  1.00 0.00 ? 126 GLN A HB3  2  
ATOM 4881  H HG2  . GLN A 1 126 ? 2.122   -14.987 -6.928  1.00 0.00 ? 126 GLN A HG2  2  
ATOM 4882  H HG3  . GLN A 1 126 ? 3.457   -15.512 -5.910  1.00 0.00 ? 126 GLN A HG3  2  
ATOM 4883  H HE21 . GLN A 1 126 ? 3.437   -17.662 -5.523  1.00 0.00 ? 126 GLN A HE21 2  
ATOM 4884  H HE22 . GLN A 1 126 ? 2.010   -18.668 -5.423  1.00 0.00 ? 126 GLN A HE22 2  
ATOM 4885  N N    . ALA A 1 127 ? 0.582   -12.344 -3.164  1.00 0.00 ? 127 ALA A N    2  
ATOM 4886  C CA   . ALA A 1 127 ? -0.155  -12.089 -1.940  1.00 0.00 ? 127 ALA A CA   2  
ATOM 4887  C C    . ALA A 1 127 ? -1.342  -11.174 -2.240  1.00 0.00 ? 127 ALA A C    2  
ATOM 4888  O O    . ALA A 1 127 ? -2.481  -11.440 -1.849  1.00 0.00 ? 127 ALA A O    2  
ATOM 4889  C CB   . ALA A 1 127 ? 0.788   -11.470 -0.907  1.00 0.00 ? 127 ALA A CB   2  
ATOM 4890  H H    . ALA A 1 127 ? 1.569   -12.089 -3.185  1.00 0.00 ? 127 ALA A H    2  
ATOM 4891  H HA   . ALA A 1 127 ? -0.510  -13.045 -1.565  1.00 0.00 ? 127 ALA A HA   2  
ATOM 4892  H HB1  . ALA A 1 127 ? 1.114   -10.478 -1.233  1.00 0.00 ? 127 ALA A HB1  2  
ATOM 4893  H HB2  . ALA A 1 127 ? 0.272   -11.389 0.046   1.00 0.00 ? 127 ALA A HB2  2  
ATOM 4894  H HB3  . ALA A 1 127 ? 1.663   -12.106 -0.777  1.00 0.00 ? 127 ALA A HB3  2  
ATOM 4895  N N    . VAL A 1 128 ? -1.079  -10.117 -3.002  1.00 0.00 ? 128 VAL A N    2  
ATOM 4896  C CA   . VAL A 1 128 ? -2.064  -9.187  -3.518  1.00 0.00 ? 128 VAL A CA   2  
ATOM 4897  C C    . VAL A 1 128 ? -3.125  -9.964  -4.319  1.00 0.00 ? 128 VAL A C    2  
ATOM 4898  O O    . VAL A 1 128 ? -4.326  -9.815  -4.089  1.00 0.00 ? 128 VAL A O    2  
ATOM 4899  C CB   . VAL A 1 128 ? -1.287  -8.161  -4.370  1.00 0.00 ? 128 VAL A CB   2  
ATOM 4900  C CG1  . VAL A 1 128 ? -2.149  -7.279  -5.261  1.00 0.00 ? 128 VAL A CG1  2  
ATOM 4901  C CG2  . VAL A 1 128 ? -0.439  -7.234  -3.484  1.00 0.00 ? 128 VAL A CG2  2  
ATOM 4902  H H    . VAL A 1 128 ? -0.114  -9.965  -3.292  1.00 0.00 ? 128 VAL A H    2  
ATOM 4903  H HA   . VAL A 1 128 ? -2.529  -8.686  -2.665  1.00 0.00 ? 128 VAL A HA   2  
ATOM 4904  H HB   . VAL A 1 128 ? -0.626  -8.704  -5.041  1.00 0.00 ? 128 VAL A HB   2  
ATOM 4905  H HG11 . VAL A 1 128 ? -1.484  -6.742  -5.935  1.00 0.00 ? 128 VAL A HG11 2  
ATOM 4906  H HG12 . VAL A 1 128 ? -2.834  -7.867  -5.867  1.00 0.00 ? 128 VAL A HG12 2  
ATOM 4907  H HG13 . VAL A 1 128 ? -2.704  -6.573  -4.648  1.00 0.00 ? 128 VAL A HG13 2  
ATOM 4908  H HG21 . VAL A 1 128 ? -1.079  -6.597  -2.878  1.00 0.00 ? 128 VAL A HG21 2  
ATOM 4909  H HG22 . VAL A 1 128 ? 0.195   -7.810  -2.811  1.00 0.00 ? 128 VAL A HG22 2  
ATOM 4910  H HG23 . VAL A 1 128 ? 0.200   -6.610  -4.109  1.00 0.00 ? 128 VAL A HG23 2  
ATOM 4911  N N    . ARG A 1 129 ? -2.711  -10.814 -5.263  1.00 0.00 ? 129 ARG A N    2  
ATOM 4912  C CA   . ARG A 1 129 ? -3.599  -11.530 -6.175  1.00 0.00 ? 129 ARG A CA   2  
ATOM 4913  C C    . ARG A 1 129 ? -4.498  -12.525 -5.454  1.00 0.00 ? 129 ARG A C    2  
ATOM 4914  O O    . ARG A 1 129 ? -5.620  -12.734 -5.926  1.00 0.00 ? 129 ARG A O    2  
ATOM 4915  C CB   . ARG A 1 129 ? -2.780  -12.177 -7.306  1.00 0.00 ? 129 ARG A CB   2  
ATOM 4916  C CG   . ARG A 1 129 ? -3.661  -12.777 -8.413  1.00 0.00 ? 129 ARG A CG   2  
ATOM 4917  C CD   . ARG A 1 129 ? -2.956  -12.784 -9.779  1.00 0.00 ? 129 ARG A CD   2  
ATOM 4918  N NE   . ARG A 1 129 ? -3.081  -14.080 -10.461 1.00 0.00 ? 129 ARG A NE   2  
ATOM 4919  C CZ   . ARG A 1 129 ? -3.030  -14.305 -11.781 1.00 0.00 ? 129 ARG A CZ   2  
ATOM 4920  N NH1  . ARG A 1 129 ? -2.997  -13.308 -12.659 1.00 0.00 ? 129 ARG A NH1  2  
ATOM 4921  N NH2  . ARG A 1 129 ? -3.020  -15.556 -12.216 1.00 0.00 ? 129 ARG A NH2  2  
ATOM 4922  H H    . ARG A 1 129 ? -1.711  -10.910 -5.419  1.00 0.00 ? 129 ARG A H    2  
ATOM 4923  H HA   . ARG A 1 129 ? -4.248  -10.790 -6.627  1.00 0.00 ? 129 ARG A HA   2  
ATOM 4924  H HB2  . ARG A 1 129 ? -2.144  -11.412 -7.749  1.00 0.00 ? 129 ARG A HB2  2  
ATOM 4925  H HB3  . ARG A 1 129 ? -2.131  -12.953 -6.902  1.00 0.00 ? 129 ARG A HB3  2  
ATOM 4926  H HG2  . ARG A 1 129 ? -3.944  -13.790 -8.121  1.00 0.00 ? 129 ARG A HG2  2  
ATOM 4927  H HG3  . ARG A 1 129 ? -4.571  -12.183 -8.516  1.00 0.00 ? 129 ARG A HG3  2  
ATOM 4928  H HD2  . ARG A 1 129 ? -3.399  -11.999 -10.387 1.00 0.00 ? 129 ARG A HD2  2  
ATOM 4929  H HD3  . ARG A 1 129 ? -1.892  -12.571 -9.656  1.00 0.00 ? 129 ARG A HD3  2  
ATOM 4930  H HE   . ARG A 1 129 ? -2.986  -14.877 -9.841  1.00 0.00 ? 129 ARG A HE   2  
ATOM 4931  H HH11 . ARG A 1 129 ? -2.982  -12.340 -12.342 1.00 0.00 ? 129 ARG A HH11 2  
ATOM 4932  H HH12 . ARG A 1 129 ? -2.866  -13.445 -13.659 1.00 0.00 ? 129 ARG A HH12 2  
ATOM 4933  H HH21 . ARG A 1 129 ? -3.044  -16.336 -11.562 1.00 0.00 ? 129 ARG A HH21 2  
ATOM 4934  H HH22 . ARG A 1 129 ? -3.003  -15.784 -13.206 1.00 0.00 ? 129 ARG A HH22 2  
ATOM 4935  N N    . GLN A 1 130 ? -4.067  -13.089 -4.317  1.00 0.00 ? 130 GLN A N    2  
ATOM 4936  C CA   . GLN A 1 130 ? -4.933  -13.895 -3.455  1.00 0.00 ? 130 GLN A CA   2  
ATOM 4937  C C    . GLN A 1 130 ? -6.169  -13.061 -3.116  1.00 0.00 ? 130 GLN A C    2  
ATOM 4938  O O    . GLN A 1 130 ? -7.294  -13.419 -3.460  1.00 0.00 ? 130 GLN A O    2  
ATOM 4939  C CB   . GLN A 1 130 ? -4.233  -14.372 -2.174  1.00 0.00 ? 130 GLN A CB   2  
ATOM 4940  C CG   . GLN A 1 130 ? -2.941  -15.137 -2.438  1.00 0.00 ? 130 GLN A CG   2  
ATOM 4941  C CD   . GLN A 1 130 ? -2.752  -16.259 -1.436  1.00 0.00 ? 130 GLN A CD   2  
ATOM 4942  O OE1  . GLN A 1 130 ? -2.126  -16.086 -0.392  1.00 0.00 ? 130 GLN A OE1  2  
ATOM 4943  N NE2  . GLN A 1 130 ? -3.309  -17.413 -1.740  1.00 0.00 ? 130 GLN A NE2  2  
ATOM 4944  H H    . GLN A 1 130 ? -3.121  -12.889 -4.011  1.00 0.00 ? 130 GLN A H    2  
ATOM 4945  H HA   . GLN A 1 130 ? -5.227  -14.792 -3.993  1.00 0.00 ? 130 GLN A HA   2  
ATOM 4946  H HB2  . GLN A 1 130 ? -3.985  -13.539 -1.533  1.00 0.00 ? 130 GLN A HB2  2  
ATOM 4947  H HB3  . GLN A 1 130 ? -4.933  -15.015 -1.638  1.00 0.00 ? 130 GLN A HB3  2  
ATOM 4948  H HG2  . GLN A 1 130 ? -2.976  -15.552 -3.437  1.00 0.00 ? 130 GLN A HG2  2  
ATOM 4949  H HG3  . GLN A 1 130 ? -2.095  -14.459 -2.369  1.00 0.00 ? 130 GLN A HG3  2  
ATOM 4950  H HE21 . GLN A 1 130 ? -3.838  -17.522 -2.597  1.00 0.00 ? 130 GLN A HE21 2  
ATOM 4951  H HE22 . GLN A 1 130 ? -3.162  -18.217 -1.145  1.00 0.00 ? 130 GLN A HE22 2  
ATOM 4952  N N    . THR A 1 131 ? -5.913  -11.911 -2.508  1.00 0.00 ? 131 THR A N    2  
ATOM 4953  C CA   . THR A 1 131 ? -6.861  -10.934 -2.001  1.00 0.00 ? 131 THR A CA   2  
ATOM 4954  C C    . THR A 1 131 ? -7.760  -10.368 -3.100  1.00 0.00 ? 131 THR A C    2  
ATOM 4955  O O    . THR A 1 131 ? -8.953  -10.164 -2.884  1.00 0.00 ? 131 THR A O    2  
ATOM 4956  C CB   . THR A 1 131 ? -6.044  -9.803  -1.355  1.00 0.00 ? 131 THR A CB   2  
ATOM 4957  O OG1  . THR A 1 131 ? -4.891  -10.313 -0.719  1.00 0.00 ? 131 THR A OG1  2  
ATOM 4958  C CG2  . THR A 1 131 ? -6.873  -9.059  -0.321  1.00 0.00 ? 131 THR A CG2  2  
ATOM 4959  H H    . THR A 1 131 ? -4.956  -11.717 -2.247  1.00 0.00 ? 131 THR A H    2  
ATOM 4960  H HA   . THR A 1 131 ? -7.481  -11.420 -1.245  1.00 0.00 ? 131 THR A HA   2  
ATOM 4961  H HB   . THR A 1 131 ? -5.722  -9.095  -2.117  1.00 0.00 ? 131 THR A HB   2  
ATOM 4962  H HG1  . THR A 1 131 ? -4.142  -10.331 -1.328  1.00 0.00 ? 131 THR A HG1  2  
ATOM 4963  H HG21 . THR A 1 131 ? -7.730  -8.591  -0.802  1.00 0.00 ? 131 THR A HG21 2  
ATOM 4964  H HG22 . THR A 1 131 ? -7.223  -9.758  0.439   1.00 0.00 ? 131 THR A HG22 2  
ATOM 4965  H HG23 . THR A 1 131 ? -6.262  -8.292  0.154   1.00 0.00 ? 131 THR A HG23 2  
ATOM 4966  N N    . LEU A 1 132 ? -7.207  -10.133 -4.293  1.00 0.00 ? 132 LEU A N    2  
ATOM 4967  C CA   . LEU A 1 132 ? -7.965  -9.621  -5.431  1.00 0.00 ? 132 LEU A CA   2  
ATOM 4968  C C    . LEU A 1 132 ? -9.055  -10.610 -5.828  1.00 0.00 ? 132 LEU A C    2  
ATOM 4969  O O    . LEU A 1 132 ? -10.118 -10.187 -6.263  1.00 0.00 ? 132 LEU A O    2  
ATOM 4970  C CB   . LEU A 1 132 ? -7.041  -9.371  -6.634  1.00 0.00 ? 132 LEU A CB   2  
ATOM 4971  C CG   . LEU A 1 132 ? -6.259  -8.049  -6.597  1.00 0.00 ? 132 LEU A CG   2  
ATOM 4972  C CD1  . LEU A 1 132 ? -5.179  -8.061  -7.686  1.00 0.00 ? 132 LEU A CD1  2  
ATOM 4973  C CD2  . LEU A 1 132 ? -7.185  -6.842  -6.817  1.00 0.00 ? 132 LEU A CD2  2  
ATOM 4974  H H    . LEU A 1 132 ? -6.222  -10.340 -4.405  1.00 0.00 ? 132 LEU A H    2  
ATOM 4975  H HA   . LEU A 1 132 ? -8.460  -8.692  -5.147  1.00 0.00 ? 132 LEU A HA   2  
ATOM 4976  H HB2  . LEU A 1 132 ? -6.352  -10.209 -6.720  1.00 0.00 ? 132 LEU A HB2  2  
ATOM 4977  H HB3  . LEU A 1 132 ? -7.648  -9.369  -7.538  1.00 0.00 ? 132 LEU A HB3  2  
ATOM 4978  H HG   . LEU A 1 132 ? -5.768  -7.948  -5.629  1.00 0.00 ? 132 LEU A HG   2  
ATOM 4979  H HD11 . LEU A 1 132 ? -4.538  -7.192  -7.570  1.00 0.00 ? 132 LEU A HD11 2  
ATOM 4980  H HD12 . LEU A 1 132 ? -4.547  -8.940  -7.587  1.00 0.00 ? 132 LEU A HD12 2  
ATOM 4981  H HD13 . LEU A 1 132 ? -5.642  -8.041  -8.673  1.00 0.00 ? 132 LEU A HD13 2  
ATOM 4982  H HD21 . LEU A 1 132 ? -6.611  -5.926  -6.955  1.00 0.00 ? 132 LEU A HD21 2  
ATOM 4983  H HD22 . LEU A 1 132 ? -7.788  -6.987  -7.717  1.00 0.00 ? 132 LEU A HD22 2  
ATOM 4984  H HD23 . LEU A 1 132 ? -7.868  -6.720  -5.978  1.00 0.00 ? 132 LEU A HD23 2  
ATOM 4985  N N    . SER A 1 133 ? -8.805  -11.914 -5.684  1.00 0.00 ? 133 SER A N    2  
ATOM 4986  C CA   . SER A 1 133 ? -9.774  -12.947 -6.026  1.00 0.00 ? 133 SER A CA   2  
ATOM 4987  C C    . SER A 1 133 ? -10.826 -13.109 -4.922  1.00 0.00 ? 133 SER A C    2  
ATOM 4988  O O    . SER A 1 133 ? -11.795 -13.840 -5.119  1.00 0.00 ? 133 SER A O    2  
ATOM 4989  C CB   . SER A 1 133 ? -8.994  -14.240 -6.300  1.00 0.00 ? 133 SER A CB   2  
ATOM 4990  O OG   . SER A 1 133 ? -9.756  -15.321 -6.806  1.00 0.00 ? 133 SER A OG   2  
ATOM 4991  H H    . SER A 1 133 ? -7.952  -12.209 -5.226  1.00 0.00 ? 133 SER A H    2  
ATOM 4992  H HA   . SER A 1 133 ? -10.295 -12.644 -6.933  1.00 0.00 ? 133 SER A HA   2  
ATOM 4993  H HB2  . SER A 1 133 ? -8.220  -14.024 -7.033  1.00 0.00 ? 133 SER A HB2  2  
ATOM 4994  H HB3  . SER A 1 133 ? -8.509  -14.540 -5.376  1.00 0.00 ? 133 SER A HB3  2  
ATOM 4995  H HG   . SER A 1 133 ? -10.322 -14.970 -7.527  1.00 0.00 ? 133 SER A HG   2  
ATOM 4996  N N    . THR A 1 134 ? -10.670 -12.465 -3.766  1.00 0.00 ? 134 THR A N    2  
ATOM 4997  C CA   . THR A 1 134 ? -11.674 -12.506 -2.722  1.00 0.00 ? 134 THR A CA   2  
ATOM 4998  C C    . THR A 1 134 ? -12.647 -11.337 -2.952  1.00 0.00 ? 134 THR A C    2  
ATOM 4999  O O    . THR A 1 134 ? -12.197 -10.201 -3.127  1.00 0.00 ? 134 THR A O    2  
ATOM 5000  C CB   . THR A 1 134 ? -10.946 -12.432 -1.375  1.00 0.00 ? 134 THR A CB   2  
ATOM 5001  O OG1  . THR A 1 134 ? -10.221 -13.642 -1.210  1.00 0.00 ? 134 THR A OG1  2  
ATOM 5002  C CG2  . THR A 1 134 ? -11.903 -12.206 -0.203  1.00 0.00 ? 134 THR A CG2  2  
ATOM 5003  H H    . THR A 1 134 ? -9.916  -11.809 -3.621  1.00 0.00 ? 134 THR A H    2  
ATOM 5004  H HA   . THR A 1 134 ? -12.196 -13.461 -2.763  1.00 0.00 ? 134 THR A HA   2  
ATOM 5005  H HB   . THR A 1 134 ? -10.240 -11.604 -1.390  1.00 0.00 ? 134 THR A HB   2  
ATOM 5006  H HG1  . THR A 1 134 ? -9.618  -13.532 -0.441  1.00 0.00 ? 134 THR A HG1  2  
ATOM 5007  H HG21 . THR A 1 134 ? -12.420 -11.255 -0.320  1.00 0.00 ? 134 THR A HG21 2  
ATOM 5008  H HG22 . THR A 1 134 ? -12.645 -12.997 -0.160  1.00 0.00 ? 134 THR A HG22 2  
ATOM 5009  H HG23 . THR A 1 134 ? -11.341 -12.177 0.725   1.00 0.00 ? 134 THR A HG23 2  
ATOM 5010  N N    . PRO A 1 135 ? -13.968 -11.580 -2.878  1.00 0.00 ? 135 PRO A N    2  
ATOM 5011  C CA   . PRO A 1 135 ? -14.980 -10.544 -3.024  1.00 0.00 ? 135 PRO A CA   2  
ATOM 5012  C C    . PRO A 1 135 ? -15.206 -9.754  -1.738  1.00 0.00 ? 135 PRO A C    2  
ATOM 5013  O O    . PRO A 1 135 ? -15.483 -8.558  -1.814  1.00 0.00 ? 135 PRO A O    2  
ATOM 5014  C CB   . PRO A 1 135 ? -16.263 -11.283 -3.399  1.00 0.00 ? 135 PRO A CB   2  
ATOM 5015  C CG   . PRO A 1 135 ? -16.091 -12.683 -2.824  1.00 0.00 ? 135 PRO A CG   2  
ATOM 5016  C CD   . PRO A 1 135 ? -14.583 -12.897 -2.830  1.00 0.00 ? 135 PRO A CD   2  
ATOM 5017  H HA   . PRO A 1 135 ? -14.710 -9.852  -3.824  1.00 0.00 ? 135 PRO A HA   2  
ATOM 5018  H HB2  . PRO A 1 135 ? -17.131 -10.798 -2.959  1.00 0.00 ? 135 PRO A HB2  2  
ATOM 5019  H HB3  . PRO A 1 135 ? -16.353 -11.334 -4.483  1.00 0.00 ? 135 PRO A HB3  2  
ATOM 5020  H HG2  . PRO A 1 135 ? -16.463 -12.696 -1.802  1.00 0.00 ? 135 PRO A HG2  2  
ATOM 5021  H HG3  . PRO A 1 135 ? -16.602 -13.434 -3.425  1.00 0.00 ? 135 PRO A HG3  2  
ATOM 5022  H HD2  . PRO A 1 135 ? -14.286 -13.429 -1.932  1.00 0.00 ? 135 PRO A HD2  2  
ATOM 5023  H HD3  . PRO A 1 135 ? -14.284 -13.462 -3.711  1.00 0.00 ? 135 PRO A HD3  2  
ATOM 5024  N N    . GLY A 1 136 ? -15.153 -10.411 -0.570  1.00 0.00 ? 136 GLY A N    2  
ATOM 5025  C CA   . GLY A 1 136 ? -15.498 -9.794  0.703   1.00 0.00 ? 136 GLY A CA   2  
ATOM 5026  C C    . GLY A 1 136 ? -14.557 -8.641  1.022   1.00 0.00 ? 136 GLY A C    2  
ATOM 5027  O O    . GLY A 1 136 ? -15.016 -7.566  1.395   1.00 0.00 ? 136 GLY A O    2  
ATOM 5028  H H    . GLY A 1 136 ? -14.989 -11.410 -0.569  1.00 0.00 ? 136 GLY A H    2  
ATOM 5029  H HA2  . GLY A 1 136 ? -16.521 -9.421  0.653   1.00 0.00 ? 136 GLY A HA2  2  
ATOM 5030  H HA3  . GLY A 1 136 ? -15.435 -10.536 1.499   1.00 0.00 ? 136 GLY A HA3  2  
ATOM 5031  N N    . THR A 1 137 ? -13.253 -8.884  0.893   1.00 0.00 ? 137 THR A N    2  
ATOM 5032  C CA   . THR A 1 137 ? -12.178 -7.914  1.053   1.00 0.00 ? 137 THR A CA   2  
ATOM 5033  C C    . THR A 1 137 ? -12.262 -6.803  -0.001  1.00 0.00 ? 137 THR A C    2  
ATOM 5034  O O    . THR A 1 137 ? -12.745 -7.016  -1.117  1.00 0.00 ? 137 THR A O    2  
ATOM 5035  C CB   . THR A 1 137 ? -10.837 -8.667  1.036   1.00 0.00 ? 137 THR A CB   2  
ATOM 5036  O OG1  . THR A 1 137 ? -10.805 -9.623  2.092   1.00 0.00 ? 137 THR A OG1  2  
ATOM 5037  C CG2  . THR A 1 137 ? -9.641  -7.742  1.222   1.00 0.00 ? 137 THR A CG2  2  
ATOM 5038  H H    . THR A 1 137 ? -12.996 -9.815  0.625   1.00 0.00 ? 137 THR A H    2  
ATOM 5039  H HA   . THR A 1 137 ? -12.289 -7.447  2.021   1.00 0.00 ? 137 THR A HA   2  
ATOM 5040  H HB   . THR A 1 137 ? -10.723 -9.182  0.080   1.00 0.00 ? 137 THR A HB   2  
ATOM 5041  H HG1  . THR A 1 137 ? -10.352 -9.198  2.851   1.00 0.00 ? 137 THR A HG1  2  
ATOM 5042  H HG21 . THR A 1 137 ? -9.467  -7.147  0.325   1.00 0.00 ? 137 THR A HG21 2  
ATOM 5043  H HG22 . THR A 1 137 ? -9.784  -7.083  2.077   1.00 0.00 ? 137 THR A HG22 2  
ATOM 5044  H HG23 . THR A 1 137 ? -8.764  -8.355  1.393   1.00 0.00 ? 137 THR A HG23 2  
ATOM 5045  N N    . ILE A 1 138 ? -11.727 -5.623  0.332   1.00 0.00 ? 138 ILE A N    2  
ATOM 5046  C CA   . ILE A 1 138 ? -11.862 -4.409  -0.455  1.00 0.00 ? 138 ILE A CA   2  
ATOM 5047  C C    . ILE A 1 138 ? -10.481 -3.787  -0.377  1.00 0.00 ? 138 ILE A C    2  
ATOM 5048  O O    . ILE A 1 138 ? -10.083 -3.324  0.688   1.00 0.00 ? 138 ILE A O    2  
ATOM 5049  C CB   . ILE A 1 138 ? -12.982 -3.503  0.121   1.00 0.00 ? 138 ILE A CB   2  
ATOM 5050  C CG1  . ILE A 1 138 ? -14.383 -4.077  -0.173  1.00 0.00 ? 138 ILE A CG1  2  
ATOM 5051  C CG2  . ILE A 1 138 ? -12.873 -2.075  -0.435  1.00 0.00 ? 138 ILE A CG2  2  
ATOM 5052  C CD1  . ILE A 1 138 ? -15.523 -3.326  0.524   1.00 0.00 ? 138 ILE A CD1  2  
ATOM 5053  H H    . ILE A 1 138 ? -11.180 -5.517  1.190   1.00 0.00 ? 138 ILE A H    2  
ATOM 5054  H HA   . ILE A 1 138 ? -12.095 -4.651  -1.493  1.00 0.00 ? 138 ILE A HA   2  
ATOM 5055  H HB   . ILE A 1 138 ? -12.854 -3.441  1.200   1.00 0.00 ? 138 ILE A HB   2  
ATOM 5056  H HG12 . ILE A 1 138 ? -14.553 -4.058  -1.247  1.00 0.00 ? 138 ILE A HG12 2  
ATOM 5057  H HG13 . ILE A 1 138 ? -14.427 -5.112  0.163   1.00 0.00 ? 138 ILE A HG13 2  
ATOM 5058  H HG21 . ILE A 1 138 ? -12.947 -2.070  -1.522  1.00 0.00 ? 138 ILE A HG21 2  
ATOM 5059  H HG22 . ILE A 1 138 ? -13.641 -1.432  -0.010  1.00 0.00 ? 138 ILE A HG22 2  
ATOM 5060  H HG23 . ILE A 1 138 ? -11.919 -1.655  -0.128  1.00 0.00 ? 138 ILE A HG23 2  
ATOM 5061  H HD11 . ILE A 1 138 ? -15.642 -2.327  0.108   1.00 0.00 ? 138 ILE A HD11 2  
ATOM 5062  H HD12 . ILE A 1 138 ? -16.453 -3.866  0.362   1.00 0.00 ? 138 ILE A HD12 2  
ATOM 5063  H HD13 . ILE A 1 138 ? -15.327 -3.263  1.595   1.00 0.00 ? 138 ILE A HD13 2  
ATOM 5064  N N    . ILE A 1 139 ? -9.715  -3.851  -1.463  1.00 0.00 ? 139 ILE A N    2  
ATOM 5065  C CA   . ILE A 1 139 ? -8.395  -3.236  -1.498  1.00 0.00 ? 139 ILE A CA   2  
ATOM 5066  C C    . ILE A 1 139 ? -8.573  -1.717  -1.384  1.00 0.00 ? 139 ILE A C    2  
ATOM 5067  O O    . ILE A 1 139 ? -9.561  -1.165  -1.884  1.00 0.00 ? 139 ILE A O    2  
ATOM 5068  C CB   . ILE A 1 139 ? -7.635  -3.627  -2.783  1.00 0.00 ? 139 ILE A CB   2  
ATOM 5069  C CG1  . ILE A 1 139 ? -7.618  -5.151  -3.057  1.00 0.00 ? 139 ILE A CG1  2  
ATOM 5070  C CG2  . ILE A 1 139 ? -6.202  -3.069  -2.750  1.00 0.00 ? 139 ILE A CG2  2  
ATOM 5071  C CD1  . ILE A 1 139 ? -6.737  -5.986  -2.125  1.00 0.00 ? 139 ILE A CD1  2  
ATOM 5072  H H    . ILE A 1 139 ? -10.094 -4.228  -2.312  1.00 0.00 ? 139 ILE A H    2  
ATOM 5073  H HA   . ILE A 1 139 ? -7.833  -3.589  -0.632  1.00 0.00 ? 139 ILE A HA   2  
ATOM 5074  H HB   . ILE A 1 139 ? -8.149  -3.162  -3.624  1.00 0.00 ? 139 ILE A HB   2  
ATOM 5075  H HG12 . ILE A 1 139 ? -8.627  -5.553  -3.004  1.00 0.00 ? 139 ILE A HG12 2  
ATOM 5076  H HG13 . ILE A 1 139 ? -7.278  -5.308  -4.078  1.00 0.00 ? 139 ILE A HG13 2  
ATOM 5077  H HG21 . ILE A 1 139 ? -5.619  -3.491  -3.561  1.00 0.00 ? 139 ILE A HG21 2  
ATOM 5078  H HG22 . ILE A 1 139 ? -6.215  -1.987  -2.894  1.00 0.00 ? 139 ILE A HG22 2  
ATOM 5079  H HG23 . ILE A 1 139 ? -5.713  -3.299  -1.803  1.00 0.00 ? 139 ILE A HG23 2  
ATOM 5080  H HD11 . ILE A 1 139 ? -6.815  -7.031  -2.420  1.00 0.00 ? 139 ILE A HD11 2  
ATOM 5081  H HD12 . ILE A 1 139 ? -5.694  -5.683  -2.203  1.00 0.00 ? 139 ILE A HD12 2  
ATOM 5082  H HD13 . ILE A 1 139 ? -7.076  -5.876  -1.098  1.00 0.00 ? 139 ILE A HD13 2  
ATOM 5083  N N    . LEU A 1 140 ? -7.606  -1.062  -0.751  1.00 0.00 ? 140 LEU A N    2  
ATOM 5084  C CA   . LEU A 1 140 ? -7.507  0.369   -0.559  1.00 0.00 ? 140 LEU A CA   2  
ATOM 5085  C C    . LEU A 1 140 ? -6.016  0.720   -0.644  1.00 0.00 ? 140 LEU A C    2  
ATOM 5086  O O    . LEU A 1 140 ? -5.294  0.580   0.349   1.00 0.00 ? 140 LEU A O    2  
ATOM 5087  C CB   . LEU A 1 140 ? -8.117  0.707   0.812   1.00 0.00 ? 140 LEU A CB   2  
ATOM 5088  C CG   . LEU A 1 140 ? -8.135  2.216   1.078   1.00 0.00 ? 140 LEU A CG   2  
ATOM 5089  C CD1  . LEU A 1 140 ? -9.329  2.921   0.457   1.00 0.00 ? 140 LEU A CD1  2  
ATOM 5090  C CD2  . LEU A 1 140 ? -8.124  2.489   2.589   1.00 0.00 ? 140 LEU A CD2  2  
ATOM 5091  H H    . LEU A 1 140 ? -6.902  -1.610  -0.271  1.00 0.00 ? 140 LEU A H    2  
ATOM 5092  H HA   . LEU A 1 140 ? -8.058  0.889   -1.342  1.00 0.00 ? 140 LEU A HA   2  
ATOM 5093  H HB2  . LEU A 1 140 ? -9.128  0.312   0.876   1.00 0.00 ? 140 LEU A HB2  2  
ATOM 5094  H HB3  . LEU A 1 140 ? -7.527  0.211   1.582   1.00 0.00 ? 140 LEU A HB3  2  
ATOM 5095  H HG   . LEU A 1 140 ? -7.268  2.657   0.601   1.00 0.00 ? 140 LEU A HG   2  
ATOM 5096  H HD11 . LEU A 1 140 ? -9.329  2.760   -0.618  1.00 0.00 ? 140 LEU A HD11 2  
ATOM 5097  H HD12 . LEU A 1 140 ? -10.262 2.558   0.885   1.00 0.00 ? 140 LEU A HD12 2  
ATOM 5098  H HD13 . LEU A 1 140 ? -9.229  3.983   0.652   1.00 0.00 ? 140 LEU A HD13 2  
ATOM 5099  H HD21 . LEU A 1 140 ? -7.220  2.066   3.027   1.00 0.00 ? 140 LEU A HD21 2  
ATOM 5100  H HD22 . LEU A 1 140 ? -8.139  3.561   2.783   1.00 0.00 ? 140 LEU A HD22 2  
ATOM 5101  H HD23 . LEU A 1 140 ? -8.995  2.029   3.062   1.00 0.00 ? 140 LEU A HD23 2  
ATOM 5102  N N    . GLY A 1 141 ? -5.530  1.115   -1.822  1.00 0.00 ? 141 GLY A N    2  
ATOM 5103  C CA   . GLY A 1 141 ? -4.104  1.364   -2.050  1.00 0.00 ? 141 GLY A CA   2  
ATOM 5104  C C    . GLY A 1 141 ? -3.822  2.701   -2.725  1.00 0.00 ? 141 GLY A C    2  
ATOM 5105  O O    . GLY A 1 141 ? -4.761  3.373   -3.138  1.00 0.00 ? 141 GLY A O    2  
ATOM 5106  H H    . GLY A 1 141 ? -6.167  1.211   -2.607  1.00 0.00 ? 141 GLY A H    2  
ATOM 5107  H HA2  . GLY A 1 141 ? -3.591  1.367   -1.096  1.00 0.00 ? 141 GLY A HA2  2  
ATOM 5108  H HA3  . GLY A 1 141 ? -3.697  0.560   -2.662  1.00 0.00 ? 141 GLY A HA3  2  
ATOM 5109  N N    . THR A 1 142 ? -2.551  3.089   -2.872  1.00 0.00 ? 142 THR A N    2  
ATOM 5110  C CA   . THR A 1 142 ? -2.176  4.325   -3.585  1.00 0.00 ? 142 THR A CA   2  
ATOM 5111  C C    . THR A 1 142 ? -1.049  4.092   -4.626  1.00 0.00 ? 142 THR A C    2  
ATOM 5112  O O    . THR A 1 142 ? 0.136   4.091   -4.276  1.00 0.00 ? 142 THR A O    2  
ATOM 5113  C CB   . THR A 1 142 ? -1.787  5.402   -2.558  1.00 0.00 ? 142 THR A CB   2  
ATOM 5114  O OG1  . THR A 1 142 ? -2.786  5.585   -1.571  1.00 0.00 ? 142 THR A OG1  2  
ATOM 5115  C CG2  . THR A 1 142 ? -1.582  6.741   -3.276  1.00 0.00 ? 142 THR A CG2  2  
ATOM 5116  H H    . THR A 1 142 ? -1.831  2.557   -2.370  1.00 0.00 ? 142 THR A H    2  
ATOM 5117  H HA   . THR A 1 142 ? -3.059  4.721   -4.107  1.00 0.00 ? 142 THR A HA   2  
ATOM 5118  H HB   . THR A 1 142 ? -0.862  5.118   -2.066  1.00 0.00 ? 142 THR A HB   2  
ATOM 5119  H HG1  . THR A 1 142 ? -2.778  4.821   -0.964  1.00 0.00 ? 142 THR A HG1  2  
ATOM 5120  H HG21 . THR A 1 142 ? -2.288  6.860   -4.093  1.00 0.00 ? 142 THR A HG21 2  
ATOM 5121  H HG22 . THR A 1 142 ? -1.724  7.552   -2.570  1.00 0.00 ? 142 THR A HG22 2  
ATOM 5122  H HG23 . THR A 1 142 ? -0.576  6.777   -3.692  1.00 0.00 ? 142 THR A HG23 2  
ATOM 5123  N N    . ILE A 1 143 ? -1.385  3.944   -5.917  1.00 0.00 ? 143 ILE A N    2  
ATOM 5124  C CA   . ILE A 1 143 ? -0.395  3.766   -6.991  1.00 0.00 ? 143 ILE A CA   2  
ATOM 5125  C C    . ILE A 1 143 ? 0.224   5.111   -7.412  1.00 0.00 ? 143 ILE A C    2  
ATOM 5126  O O    . ILE A 1 143 ? -0.498  6.104   -7.550  1.00 0.00 ? 143 ILE A O    2  
ATOM 5127  C CB   . ILE A 1 143 ? -0.983  3.016   -8.219  1.00 0.00 ? 143 ILE A CB   2  
ATOM 5128  C CG1  . ILE A 1 143 ? -2.145  3.716   -8.972  1.00 0.00 ? 143 ILE A CG1  2  
ATOM 5129  C CG2  . ILE A 1 143 ? -1.411  1.621   -7.763  1.00 0.00 ? 143 ILE A CG2  2  
ATOM 5130  C CD1  . ILE A 1 143 ? -2.652  2.990   -10.241 1.00 0.00 ? 143 ILE A CD1  2  
ATOM 5131  H H    . ILE A 1 143 ? -2.344  4.121   -6.193  1.00 0.00 ? 143 ILE A H    2  
ATOM 5132  H HA   . ILE A 1 143 ? 0.397   3.138   -6.581  1.00 0.00 ? 143 ILE A HA   2  
ATOM 5133  H HB   . ILE A 1 143 ? -0.166  2.888   -8.932  1.00 0.00 ? 143 ILE A HB   2  
ATOM 5134  H HG12 . ILE A 1 143 ? -2.988  3.848   -8.293  1.00 0.00 ? 143 ILE A HG12 2  
ATOM 5135  H HG13 . ILE A 1 143 ? -1.807  4.700   -9.287  1.00 0.00 ? 143 ILE A HG13 2  
ATOM 5136  H HG21 . ILE A 1 143 ? -2.304  1.681   -7.148  1.00 0.00 ? 143 ILE A HG21 2  
ATOM 5137  H HG22 . ILE A 1 143 ? -1.636  1.020   -8.639  1.00 0.00 ? 143 ILE A HG22 2  
ATOM 5138  H HG23 . ILE A 1 143 ? -0.608  1.144   -7.200  1.00 0.00 ? 143 ILE A HG23 2  
ATOM 5139  H HD11 . ILE A 1 143 ? -3.134  2.042   -9.995  1.00 0.00 ? 143 ILE A HD11 2  
ATOM 5140  H HD12 . ILE A 1 143 ? -3.391  3.608   -10.753 1.00 0.00 ? 143 ILE A HD12 2  
ATOM 5141  H HD13 . ILE A 1 143 ? -1.837  2.798   -10.940 1.00 0.00 ? 143 ILE A HD13 2  
ATOM 5142  N N    . PRO A 1 144 ? 1.536   5.186   -7.704  1.00 0.00 ? 144 PRO A N    2  
ATOM 5143  C CA   . PRO A 1 144 ? 2.110   6.335   -8.379  1.00 0.00 ? 144 PRO A CA   2  
ATOM 5144  C C    . PRO A 1 144 ? 1.577   6.371   -9.808  1.00 0.00 ? 144 PRO A C    2  
ATOM 5145  O O    . PRO A 1 144 ? 1.457   5.341   -10.474 1.00 0.00 ? 144 PRO A O    2  
ATOM 5146  C CB   . PRO A 1 144 ? 3.625   6.144   -8.316  1.00 0.00 ? 144 PRO A CB   2  
ATOM 5147  C CG   . PRO A 1 144 ? 3.777   4.625   -8.312  1.00 0.00 ? 144 PRO A CG   2  
ATOM 5148  C CD   . PRO A 1 144 ? 2.532   4.140   -7.567  1.00 0.00 ? 144 PRO A CD   2  
ATOM 5149  H HA   . PRO A 1 144 ? 1.822   7.247   -7.862  1.00 0.00 ? 144 PRO A HA   2  
ATOM 5150  H HB2  . PRO A 1 144 ? 4.136   6.601   -9.164  1.00 0.00 ? 144 PRO A HB2  2  
ATOM 5151  H HB3  . PRO A 1 144 ? 3.997   6.556   -7.378  1.00 0.00 ? 144 PRO A HB3  2  
ATOM 5152  H HG2  . PRO A 1 144 ? 3.751   4.260   -9.339  1.00 0.00 ? 144 PRO A HG2  2  
ATOM 5153  H HG3  . PRO A 1 144 ? 4.695   4.312   -7.816  1.00 0.00 ? 144 PRO A HG3  2  
ATOM 5154  H HD2  . PRO A 1 144 ? 2.179   3.207   -8.007  1.00 0.00 ? 144 PRO A HD2  2  
ATOM 5155  H HD3  . PRO A 1 144 ? 2.764   4.006   -6.510  1.00 0.00 ? 144 PRO A HD3  2  
ATOM 5156  N N    . VAL A 1 145 ? 1.229   7.565   -10.272 1.00 0.00 ? 145 VAL A N    2  
ATOM 5157  C CA   . VAL A 1 145 ? 0.457   7.754   -11.478 1.00 0.00 ? 145 VAL A CA   2  
ATOM 5158  C C    . VAL A 1 145 ? 1.222   7.252   -12.710 1.00 0.00 ? 145 VAL A C    2  
ATOM 5159  O O    . VAL A 1 145 ? 2.420   7.523   -12.840 1.00 0.00 ? 145 VAL A O    2  
ATOM 5160  C CB   . VAL A 1 145 ? 0.048   9.232   -11.503 1.00 0.00 ? 145 VAL A CB   2  
ATOM 5161  C CG1  . VAL A 1 145 ? 1.180   10.195  -11.851 1.00 0.00 ? 145 VAL A CG1  2  
ATOM 5162  C CG2  . VAL A 1 145 ? -1.147  9.484   -12.400 1.00 0.00 ? 145 VAL A CG2  2  
ATOM 5163  H H    . VAL A 1 145 ? 1.349   8.397   -9.724  1.00 0.00 ? 145 VAL A H    2  
ATOM 5164  H HA   . VAL A 1 145 ? -0.441  7.147   -11.372 1.00 0.00 ? 145 VAL A HA   2  
ATOM 5165  H HB   . VAL A 1 145 ? -0.275  9.490   -10.496 1.00 0.00 ? 145 VAL A HB   2  
ATOM 5166  H HG11 . VAL A 1 145 ? 1.487   10.053  -12.888 1.00 0.00 ? 145 VAL A HG11 2  
ATOM 5167  H HG12 . VAL A 1 145 ? 0.832   11.220  -11.719 1.00 0.00 ? 145 VAL A HG12 2  
ATOM 5168  H HG13 . VAL A 1 145 ? 2.039   10.025  -11.202 1.00 0.00 ? 145 VAL A HG13 2  
ATOM 5169  H HG21 . VAL A 1 145 ? -1.974  8.865   -12.057 1.00 0.00 ? 145 VAL A HG21 2  
ATOM 5170  H HG22 . VAL A 1 145 ? -1.426  10.531  -12.323 1.00 0.00 ? 145 VAL A HG22 2  
ATOM 5171  H HG23 . VAL A 1 145 ? -0.903  9.235   -13.431 1.00 0.00 ? 145 VAL A HG23 2  
ATOM 5172  N N    . PRO A 1 146 ? 0.561   6.502   -13.601 1.00 0.00 ? 146 PRO A N    2  
ATOM 5173  C CA   . PRO A 1 146 ? 1.182   5.979   -14.803 1.00 0.00 ? 146 PRO A CA   2  
ATOM 5174  C C    . PRO A 1 146 ? 1.487   7.140   -15.750 1.00 0.00 ? 146 PRO A C    2  
ATOM 5175  O O    . PRO A 1 146 ? 0.612   7.973   -16.023 1.00 0.00 ? 146 PRO A O    2  
ATOM 5176  C CB   . PRO A 1 146 ? 0.180   4.977   -15.379 1.00 0.00 ? 146 PRO A CB   2  
ATOM 5177  C CG   . PRO A 1 146 ? -1.166  5.414   -14.809 1.00 0.00 ? 146 PRO A CG   2  
ATOM 5178  C CD   . PRO A 1 146 ? -0.822  6.077   -13.495 1.00 0.00 ? 146 PRO A CD   2  
ATOM 5179  H HA   . PRO A 1 146 ? 2.105   5.457   -14.543 1.00 0.00 ? 146 PRO A HA   2  
ATOM 5180  H HB2  . PRO A 1 146 ? 0.180   4.976   -16.468 1.00 0.00 ? 146 PRO A HB2  2  
ATOM 5181  H HB3  . PRO A 1 146 ? 0.404   3.982   -14.998 1.00 0.00 ? 146 PRO A HB3  2  
ATOM 5182  H HG2  . PRO A 1 146 ? -1.650  6.127   -15.477 1.00 0.00 ? 146 PRO A HG2  2  
ATOM 5183  H HG3  . PRO A 1 146 ? -1.799  4.566   -14.587 1.00 0.00 ? 146 PRO A HG3  2  
ATOM 5184  H HD2  . PRO A 1 146 ? -1.496  6.916   -13.327 1.00 0.00 ? 146 PRO A HD2  2  
ATOM 5185  H HD3  . PRO A 1 146 ? -0.911  5.352   -12.684 1.00 0.00 ? 146 PRO A HD3  2  
ATOM 5186  N N    . LYS A 1 147 ? 2.721   7.208   -16.249 1.00 0.00 ? 147 LYS A N    2  
ATOM 5187  C CA   . LYS A 1 147 ? 3.167   8.189   -17.232 1.00 0.00 ? 147 LYS A CA   2  
ATOM 5188  C C    . LYS A 1 147 ? 4.335   7.594   -18.011 1.00 0.00 ? 147 LYS A C    2  
ATOM 5189  O O    . LYS A 1 147 ? 4.221   7.470   -19.227 1.00 0.00 ? 147 LYS A O    2  
ATOM 5190  C CB   . LYS A 1 147 ? 3.503   9.531   -16.549 1.00 0.00 ? 147 LYS A CB   2  
ATOM 5191  C CG   . LYS A 1 147 ? 3.769   10.691  -17.532 1.00 0.00 ? 147 LYS A CG   2  
ATOM 5192  C CD   . LYS A 1 147 ? 5.181   10.708  -18.139 1.00 0.00 ? 147 LYS A CD   2  
ATOM 5193  C CE   . LYS A 1 147 ? 5.214   10.310  -19.619 1.00 0.00 ? 147 LYS A CE   2  
ATOM 5194  N NZ   . LYS A 1 147 ? 5.032   11.461  -20.522 1.00 0.00 ? 147 LYS A NZ   2  
ATOM 5195  H H    . LYS A 1 147 ? 3.316   6.398   -16.086 1.00 0.00 ? 147 LYS A H    2  
ATOM 5196  H HA   . LYS A 1 147 ? 2.347   8.364   -17.929 1.00 0.00 ? 147 LYS A HA   2  
ATOM 5197  H HB2  . LYS A 1 147 ? 2.648   9.824   -15.938 1.00 0.00 ? 147 LYS A HB2  2  
ATOM 5198  H HB3  . LYS A 1 147 ? 4.352   9.409   -15.877 1.00 0.00 ? 147 LYS A HB3  2  
ATOM 5199  H HG2  . LYS A 1 147 ? 3.026   10.676  -18.327 1.00 0.00 ? 147 LYS A HG2  2  
ATOM 5200  H HG3  . LYS A 1 147 ? 3.635   11.621  -16.980 1.00 0.00 ? 147 LYS A HG3  2  
ATOM 5201  H HD2  . LYS A 1 147 ? 5.611   11.704  -18.034 1.00 0.00 ? 147 LYS A HD2  2  
ATOM 5202  H HD3  . LYS A 1 147 ? 5.811   10.026  -17.573 1.00 0.00 ? 147 LYS A HD3  2  
ATOM 5203  H HE2  . LYS A 1 147 ? 6.179   9.850   -19.835 1.00 0.00 ? 147 LYS A HE2  2  
ATOM 5204  H HE3  . LYS A 1 147 ? 4.435   9.575   -19.820 1.00 0.00 ? 147 LYS A HE3  2  
ATOM 5205  H HZ1  . LYS A 1 147 ? 4.170   11.963  -20.329 1.00 0.00 ? 147 LYS A HZ1  2  
ATOM 5206  H HZ2  . LYS A 1 147 ? 5.814   12.105  -20.448 1.00 0.00 ? 147 LYS A HZ2  2  
ATOM 5207  H HZ3  . LYS A 1 147 ? 5.013   11.141  -21.487 1.00 0.00 ? 147 LYS A HZ3  2  
ATOM 5208  N N    . GLY A 1 148 ? 5.441   7.263   -17.342 1.00 0.00 ? 148 GLY A N    2  
ATOM 5209  C CA   . GLY A 1 148 ? 6.602   6.649   -17.970 1.00 0.00 ? 148 GLY A CA   2  
ATOM 5210  C C    . GLY A 1 148 ? 6.368   5.160   -18.135 1.00 0.00 ? 148 GLY A C    2  
ATOM 5211  O O    . GLY A 1 148 ? 5.383   4.754   -18.757 1.00 0.00 ? 148 GLY A O    2  
ATOM 5212  H H    . GLY A 1 148 ? 5.475   7.360   -16.339 1.00 0.00 ? 148 GLY A H    2  
ATOM 5213  H HA2  . GLY A 1 148 ? 6.778   7.052   -18.968 1.00 0.00 ? 148 GLY A HA2  2  
ATOM 5214  H HA3  . GLY A 1 148 ? 7.490   6.839   -17.371 1.00 0.00 ? 148 GLY A HA3  2  
ATOM 5215  N N    . LYS A 1 149 ? 7.291   4.334   -17.649 1.00 0.00 ? 149 LYS A N    2  
ATOM 5216  C CA   . LYS A 1 149 ? 7.256   2.901   -17.934 1.00 0.00 ? 149 LYS A CA   2  
ATOM 5217  C C    . LYS A 1 149 ? 6.103   2.212   -17.190 1.00 0.00 ? 149 LYS A C    2  
ATOM 5218  O O    . LYS A 1 149 ? 5.567   2.796   -16.241 1.00 0.00 ? 149 LYS A O    2  
ATOM 5219  C CB   . LYS A 1 149 ? 8.637   2.286   -17.648 1.00 0.00 ? 149 LYS A CB   2  
ATOM 5220  C CG   . LYS A 1 149 ? 9.739   2.728   -18.627 1.00 0.00 ? 149 LYS A CG   2  
ATOM 5221  C CD   . LYS A 1 149 ? 9.347   2.702   -20.114 1.00 0.00 ? 149 LYS A CD   2  
ATOM 5222  C CE   . LYS A 1 149 ? 9.000   4.105   -20.607 1.00 0.00 ? 149 LYS A CE   2  
ATOM 5223  N NZ   . LYS A 1 149 ? 10.151  4.749   -21.262 1.00 0.00 ? 149 LYS A NZ   2  
ATOM 5224  H H    . LYS A 1 149 ? 7.987   4.702   -17.006 1.00 0.00 ? 149 LYS A H    2  
ATOM 5225  H HA   . LYS A 1 149 ? 7.021   2.791   -18.989 1.00 0.00 ? 149 LYS A HA   2  
ATOM 5226  H HB2  . LYS A 1 149 ? 8.951   2.554   -16.640 1.00 0.00 ? 149 LYS A HB2  2  
ATOM 5227  H HB3  . LYS A 1 149 ? 8.567   1.201   -17.686 1.00 0.00 ? 149 LYS A HB3  2  
ATOM 5228  H HG2  . LYS A 1 149 ? 10.083  3.727   -18.355 1.00 0.00 ? 149 LYS A HG2  2  
ATOM 5229  H HG3  . LYS A 1 149 ? 10.578  2.049   -18.497 1.00 0.00 ? 149 LYS A HG3  2  
ATOM 5230  H HD2  . LYS A 1 149 ? 10.166  2.297   -20.706 1.00 0.00 ? 149 LYS A HD2  2  
ATOM 5231  H HD3  . LYS A 1 149 ? 8.489   2.052   -20.271 1.00 0.00 ? 149 LYS A HD3  2  
ATOM 5232  H HE2  . LYS A 1 149 ? 8.198   4.035   -21.336 1.00 0.00 ? 149 LYS A HE2  2  
ATOM 5233  H HE3  . LYS A 1 149 ? 8.640   4.699   -19.770 1.00 0.00 ? 149 LYS A HE3  2  
ATOM 5234  H HZ1  . LYS A 1 149 ? 10.945  4.835   -20.636 1.00 0.00 ? 149 LYS A HZ1  2  
ATOM 5235  H HZ2  . LYS A 1 149 ? 10.398  4.235   -22.102 1.00 0.00 ? 149 LYS A HZ2  2  
ATOM 5236  H HZ3  . LYS A 1 149 ? 9.895   5.687   -21.550 1.00 0.00 ? 149 LYS A HZ3  2  
ATOM 5237  N N    . PRO A 1 150 ? 5.623   1.047   -17.660 1.00 0.00 ? 150 PRO A N    2  
ATOM 5238  C CA   . PRO A 1 150 ? 4.459   0.385   -17.087 1.00 0.00 ? 150 PRO A CA   2  
ATOM 5239  C C    . PRO A 1 150 ? 4.885   -0.336  -15.808 1.00 0.00 ? 150 PRO A C    2  
ATOM 5240  O O    . PRO A 1 150 ? 5.545   -1.371  -15.875 1.00 0.00 ? 150 PRO A O    2  
ATOM 5241  C CB   . PRO A 1 150 ? 3.959   -0.560  -18.183 1.00 0.00 ? 150 PRO A CB   2  
ATOM 5242  C CG   . PRO A 1 150 ? 5.223   -0.935  -18.953 1.00 0.00 ? 150 PRO A CG   2  
ATOM 5243  C CD   . PRO A 1 150 ? 6.129   0.289   -18.802 1.00 0.00 ? 150 PRO A CD   2  
ATOM 5244  H HA   . PRO A 1 150 ? 3.679   1.110   -16.858 1.00 0.00 ? 150 PRO A HA   2  
ATOM 5245  H HB2  . PRO A 1 150 ? 3.460   -1.440  -17.781 1.00 0.00 ? 150 PRO A HB2  2  
ATOM 5246  H HB3  . PRO A 1 150 ? 3.286   -0.014  -18.844 1.00 0.00 ? 150 PRO A HB3  2  
ATOM 5247  H HG2  . PRO A 1 150 ? 5.697   -1.804  -18.493 1.00 0.00 ? 150 PRO A HG2  2  
ATOM 5248  H HG3  . PRO A 1 150 ? 4.992   -1.147  -19.994 1.00 0.00 ? 150 PRO A HG3  2  
ATOM 5249  H HD2  . PRO A 1 150 ? 7.147   -0.054  -18.625 1.00 0.00 ? 150 PRO A HD2  2  
ATOM 5250  H HD3  . PRO A 1 150 ? 6.105   0.907   -19.701 1.00 0.00 ? 150 PRO A HD3  2  
ATOM 5251  N N    . LEU A 1 151 ? 4.573   0.222   -14.636 1.00 0.00 ? 151 LEU A N    2  
ATOM 5252  C CA   . LEU A 1 151 ? 5.080   -0.315  -13.380 1.00 0.00 ? 151 LEU A CA   2  
ATOM 5253  C C    . LEU A 1 151 ? 4.534   -1.726  -13.152 1.00 0.00 ? 151 LEU A C    2  
ATOM 5254  O O    . LEU A 1 151 ? 3.325   -1.911  -13.102 1.00 0.00 ? 151 LEU A O    2  
ATOM 5255  C CB   . LEU A 1 151 ? 4.722   0.589   -12.190 1.00 0.00 ? 151 LEU A CB   2  
ATOM 5256  C CG   . LEU A 1 151 ? 5.809   1.620   -11.840 1.00 0.00 ? 151 LEU A CG   2  
ATOM 5257  C CD1  . LEU A 1 151 ? 5.687   2.898   -12.675 1.00 0.00 ? 151 LEU A CD1  2  
ATOM 5258  C CD2  . LEU A 1 151 ? 5.711   1.955   -10.352 1.00 0.00 ? 151 LEU A CD2  2  
ATOM 5259  H H    . LEU A 1 151 ? 3.983   1.044   -14.618 1.00 0.00 ? 151 LEU A H    2  
ATOM 5260  H HA   . LEU A 1 151 ? 6.163   -0.375  -13.477 1.00 0.00 ? 151 LEU A HA   2  
ATOM 5261  H HB2  . LEU A 1 151 ? 3.772   1.091   -12.369 1.00 0.00 ? 151 LEU A HB2  2  
ATOM 5262  H HB3  . LEU A 1 151 ? 4.587   -0.063  -11.329 1.00 0.00 ? 151 LEU A HB3  2  
ATOM 5263  H HG   . LEU A 1 151 ? 6.790   1.187   -12.017 1.00 0.00 ? 151 LEU A HG   2  
ATOM 5264  H HD11 . LEU A 1 151 ? 4.733   3.383   -12.485 1.00 0.00 ? 151 LEU A HD11 2  
ATOM 5265  H HD12 . LEU A 1 151 ? 6.496   3.582   -12.423 1.00 0.00 ? 151 LEU A HD12 2  
ATOM 5266  H HD13 . LEU A 1 151 ? 5.755   2.651   -13.732 1.00 0.00 ? 151 LEU A HD13 2  
ATOM 5267  H HD21 . LEU A 1 151 ? 4.719   2.329   -10.113 1.00 0.00 ? 151 LEU A HD21 2  
ATOM 5268  H HD22 . LEU A 1 151 ? 5.896   1.048   -9.775  1.00 0.00 ? 151 LEU A HD22 2  
ATOM 5269  H HD23 . LEU A 1 151 ? 6.471   2.689   -10.083 1.00 0.00 ? 151 LEU A HD23 2  
ATOM 5270  N N    . ALA A 1 152 ? 5.419   -2.699  -12.953 1.00 0.00 ? 152 ALA A N    2  
ATOM 5271  C CA   . ALA A 1 152 ? 5.119   -4.126  -12.981 1.00 0.00 ? 152 ALA A CA   2  
ATOM 5272  C C    . ALA A 1 152 ? 4.000   -4.531  -12.009 1.00 0.00 ? 152 ALA A C    2  
ATOM 5273  O O    . ALA A 1 152 ? 2.981   -5.051  -12.439 1.00 0.00 ? 152 ALA A O    2  
ATOM 5274  C CB   . ALA A 1 152 ? 6.413   -4.916  -12.756 1.00 0.00 ? 152 ALA A CB   2  
ATOM 5275  H H    . ALA A 1 152 ? 6.385   -2.439  -13.046 1.00 0.00 ? 152 ALA A H    2  
ATOM 5276  H HA   . ALA A 1 152 ? 4.771   -4.355  -13.989 1.00 0.00 ? 152 ALA A HA   2  
ATOM 5277  H HB1  . ALA A 1 152 ? 6.780   -4.783  -11.739 1.00 0.00 ? 152 ALA A HB1  2  
ATOM 5278  H HB2  . ALA A 1 152 ? 6.226   -5.975  -12.935 1.00 0.00 ? 152 ALA A HB2  2  
ATOM 5279  H HB3  . ALA A 1 152 ? 7.177   -4.589  -13.463 1.00 0.00 ? 152 ALA A HB3  2  
ATOM 5280  N N    . LEU A 1 153 ? 4.147   -4.307  -10.695 1.00 0.00 ? 153 LEU A N    2  
ATOM 5281  C CA   . LEU A 1 153 ? 3.076   -4.615  -9.729  1.00 0.00 ? 153 LEU A CA   2  
ATOM 5282  C C    . LEU A 1 153 ? 1.821   -3.754  -9.991  1.00 0.00 ? 153 LEU A C    2  
ATOM 5283  O O    . LEU A 1 153 ? 0.709   -4.197  -9.710  1.00 0.00 ? 153 LEU A O    2  
ATOM 5284  C CB   . LEU A 1 153 ? 3.572   -4.428  -8.291  1.00 0.00 ? 153 LEU A CB   2  
ATOM 5285  C CG   . LEU A 1 153 ? 2.486   -4.653  -7.216  1.00 0.00 ? 153 LEU A CG   2  
ATOM 5286  C CD1  . LEU A 1 153 ? 1.914   -6.077  -7.236  1.00 0.00 ? 153 LEU A CD1  2  
ATOM 5287  C CD2  . LEU A 1 153 ? 3.117   -4.417  -5.851  1.00 0.00 ? 153 LEU A CD2  2  
ATOM 5288  H H    . LEU A 1 153 ? 5.017   -3.907  -10.379 1.00 0.00 ? 153 LEU A H    2  
ATOM 5289  H HA   . LEU A 1 153 ? 2.818   -5.680  -9.796  1.00 0.00 ? 153 LEU A HA   2  
ATOM 5290  H HB2  . LEU A 1 153 ? 4.371   -5.151  -8.115  1.00 0.00 ? 153 LEU A HB2  2  
ATOM 5291  H HB3  . LEU A 1 153 ? 3.965   -3.418  -8.183  1.00 0.00 ? 153 LEU A HB3  2  
ATOM 5292  H HG   . LEU A 1 153 ? 1.673   -3.941  -7.336  1.00 0.00 ? 153 LEU A HG   2  
ATOM 5293  H HD11 . LEU A 1 153 ? 2.725   -6.795  -7.154  1.00 0.00 ? 153 LEU A HD11 2  
ATOM 5294  H HD12 . LEU A 1 153 ? 1.222   -6.210  -6.404  1.00 0.00 ? 153 LEU A HD12 2  
ATOM 5295  H HD13 . LEU A 1 153 ? 1.362   -6.252  -8.158  1.00 0.00 ? 153 LEU A HD13 2  
ATOM 5296  H HD21 . LEU A 1 153 ? 3.473   -3.396  -5.747  1.00 0.00 ? 153 LEU A HD21 2  
ATOM 5297  H HD22 . LEU A 1 153 ? 2.391   -4.610  -5.062  1.00 0.00 ? 153 LEU A HD22 2  
ATOM 5298  H HD23 . LEU A 1 153 ? 3.982   -5.061  -5.737  1.00 0.00 ? 153 LEU A HD23 2  
ATOM 5299  N N    . VAL A 1 154 ? 1.971   -2.528  -10.509 1.00 0.00 ? 154 VAL A N    2  
ATOM 5300  C CA   . VAL A 1 154 ? 0.827   -1.669  -10.818 1.00 0.00 ? 154 VAL A CA   2  
ATOM 5301  C C    . VAL A 1 154 ? 0.009   -2.317  -11.937 1.00 0.00 ? 154 VAL A C    2  
ATOM 5302  O O    . VAL A 1 154 ? -1.217  -2.374  -11.833 1.00 0.00 ? 154 VAL A O    2  
ATOM 5303  C CB   . VAL A 1 154 ? 1.266   -0.223  -11.146 1.00 0.00 ? 154 VAL A CB   2  
ATOM 5304  C CG1  . VAL A 1 154 ? 0.089   0.677   -11.548 1.00 0.00 ? 154 VAL A CG1  2  
ATOM 5305  C CG2  . VAL A 1 154 ? 1.960   0.437   -9.942  1.00 0.00 ? 154 VAL A CG2  2  
ATOM 5306  H H    . VAL A 1 154 ? 2.875   -2.246  -10.856 1.00 0.00 ? 154 VAL A H    2  
ATOM 5307  H HA   . VAL A 1 154 ? 0.198   -1.633  -9.935  1.00 0.00 ? 154 VAL A HA   2  
ATOM 5308  H HB   . VAL A 1 154 ? 1.957   -0.235  -11.980 1.00 0.00 ? 154 VAL A HB   2  
ATOM 5309  H HG11 . VAL A 1 154 ? -0.641  0.708   -10.742 1.00 0.00 ? 154 VAL A HG11 2  
ATOM 5310  H HG12 . VAL A 1 154 ? 0.431   1.689   -11.748 1.00 0.00 ? 154 VAL A HG12 2  
ATOM 5311  H HG13 . VAL A 1 154 ? -0.390  0.294   -12.449 1.00 0.00 ? 154 VAL A HG13 2  
ATOM 5312  H HG21 . VAL A 1 154 ? 2.806   -0.161  -9.607  1.00 0.00 ? 154 VAL A HG21 2  
ATOM 5313  H HG22 . VAL A 1 154 ? 2.329   1.426   -10.213 1.00 0.00 ? 154 VAL A HG22 2  
ATOM 5314  H HG23 . VAL A 1 154 ? 1.255   0.538   -9.118  1.00 0.00 ? 154 VAL A HG23 2  
ATOM 5315  N N    . GLU A 1 155 ? 0.668   -2.828  -12.975 1.00 0.00 ? 155 GLU A N    2  
ATOM 5316  C CA   . GLU A 1 155 ? 0.073   -3.510  -14.113 1.00 0.00 ? 155 GLU A CA   2  
ATOM 5317  C C    . GLU A 1 155 ? -0.801  -4.679  -13.651 1.00 0.00 ? 155 GLU A C    2  
ATOM 5318  O O    . GLU A 1 155 ? -1.890  -4.856  -14.199 1.00 0.00 ? 155 GLU A O    2  
ATOM 5319  C CB   . GLU A 1 155 ? 1.199   -3.963  -15.058 1.00 0.00 ? 155 GLU A CB   2  
ATOM 5320  C CG   . GLU A 1 155 ? 1.688   -2.847  -15.985 1.00 0.00 ? 155 GLU A CG   2  
ATOM 5321  C CD   . GLU A 1 155 ? 0.808   -2.741  -17.224 1.00 0.00 ? 155 GLU A CD   2  
ATOM 5322  O OE1  . GLU A 1 155 ? 1.100   -3.445  -18.223 1.00 0.00 ? 155 GLU A OE1  2  
ATOM 5323  O OE2  . GLU A 1 155 ? -0.159  -1.945  -17.209 1.00 0.00 ? 155 GLU A OE2  2  
ATOM 5324  H H    . GLU A 1 155 ? 1.681   -2.743  -12.994 1.00 0.00 ? 155 GLU A H    2  
ATOM 5325  H HA   . GLU A 1 155 ? -0.570  -2.811  -14.648 1.00 0.00 ? 155 GLU A HA   2  
ATOM 5326  H HB2  . GLU A 1 155 ? 2.060   -4.289  -14.479 1.00 0.00 ? 155 GLU A HB2  2  
ATOM 5327  H HB3  . GLU A 1 155 ? 0.856   -4.803  -15.662 1.00 0.00 ? 155 GLU A HB3  2  
ATOM 5328  H HG2  . GLU A 1 155 ? 1.709   -1.890  -15.460 1.00 0.00 ? 155 GLU A HG2  2  
ATOM 5329  H HG3  . GLU A 1 155 ? 2.707   -3.078  -16.299 1.00 0.00 ? 155 GLU A HG3  2  
ATOM 5330  N N    . GLU A 1 156 ? -0.394  -5.412  -12.604 1.00 0.00 ? 156 GLU A N    2  
ATOM 5331  C CA   . GLU A 1 156 ? -1.143  -6.563  -12.091 1.00 0.00 ? 156 GLU A CA   2  
ATOM 5332  C C    . GLU A 1 156 ? -2.567  -6.192  -11.677 1.00 0.00 ? 156 GLU A C    2  
ATOM 5333  O O    . GLU A 1 156 ? -3.467  -7.034  -11.719 1.00 0.00 ? 156 GLU A O    2  
ATOM 5334  C CB   . GLU A 1 156 ? -0.438  -7.223  -10.892 1.00 0.00 ? 156 GLU A CB   2  
ATOM 5335  C CG   . GLU A 1 156 ? 1.022   -7.620  -11.119 1.00 0.00 ? 156 GLU A CG   2  
ATOM 5336  C CD   . GLU A 1 156 ? 1.201   -8.544  -12.335 1.00 0.00 ? 156 GLU A CD   2  
ATOM 5337  O OE1  . GLU A 1 156 ? 0.942   -9.762  -12.234 1.00 0.00 ? 156 GLU A OE1  2  
ATOM 5338  O OE2  . GLU A 1 156 ? 1.612   -8.075  -13.426 1.00 0.00 ? 156 GLU A OE2  2  
ATOM 5339  H H    . GLU A 1 156 ? 0.520   -5.211  -12.215 1.00 0.00 ? 156 GLU A H    2  
ATOM 5340  H HA   . GLU A 1 156 ? -1.226  -7.290  -12.889 1.00 0.00 ? 156 GLU A HA   2  
ATOM 5341  H HB2  . GLU A 1 156 ? -0.478  -6.544  -10.040 1.00 0.00 ? 156 GLU A HB2  2  
ATOM 5342  H HB3  . GLU A 1 156 ? -0.992  -8.122  -10.620 1.00 0.00 ? 156 GLU A HB3  2  
ATOM 5343  H HG2  . GLU A 1 156 ? 1.600   -6.718  -11.274 1.00 0.00 ? 156 GLU A HG2  2  
ATOM 5344  H HG3  . GLU A 1 156 ? 1.395   -8.083  -10.194 1.00 0.00 ? 156 GLU A HG3  2  
ATOM 5345  N N    . ILE A 1 157 ? -2.772  -4.943  -11.266 1.00 0.00 ? 157 ILE A N    2  
ATOM 5346  C CA   . ILE A 1 157 ? -4.038  -4.436  -10.770 1.00 0.00 ? 157 ILE A CA   2  
ATOM 5347  C C    . ILE A 1 157 ? -4.668  -3.503  -11.804 1.00 0.00 ? 157 ILE A C    2  
ATOM 5348  O O    . ILE A 1 157 ? -5.890  -3.481  -11.951 1.00 0.00 ? 157 ILE A O    2  
ATOM 5349  C CB   . ILE A 1 157 ? -3.778  -3.753  -9.420  1.00 0.00 ? 157 ILE A CB   2  
ATOM 5350  C CG1  . ILE A 1 157 ? -3.432  -4.780  -8.321  1.00 0.00 ? 157 ILE A CG1  2  
ATOM 5351  C CG2  . ILE A 1 157 ? -4.976  -2.922  -8.971  1.00 0.00 ? 157 ILE A CG2  2  
ATOM 5352  C CD1  . ILE A 1 157 ? -2.386  -4.233  -7.353  1.00 0.00 ? 157 ILE A CD1  2  
ATOM 5353  H H    . ILE A 1 157 ? -1.975  -4.314  -11.278 1.00 0.00 ? 157 ILE A H    2  
ATOM 5354  H HA   . ILE A 1 157 ? -4.721  -5.267  -10.604 1.00 0.00 ? 157 ILE A HA   2  
ATOM 5355  H HB   . ILE A 1 157 ? -2.939  -3.074  -9.530  1.00 0.00 ? 157 ILE A HB   2  
ATOM 5356  H HG12 . ILE A 1 157 ? -4.333  -5.025  -7.761  1.00 0.00 ? 157 ILE A HG12 2  
ATOM 5357  H HG13 . ILE A 1 157 ? -3.036  -5.699  -8.752  1.00 0.00 ? 157 ILE A HG13 2  
ATOM 5358  H HG21 . ILE A 1 157 ? -4.689  -2.400  -8.070  1.00 0.00 ? 157 ILE A HG21 2  
ATOM 5359  H HG22 . ILE A 1 157 ? -5.225  -2.153  -9.702  1.00 0.00 ? 157 ILE A HG22 2  
ATOM 5360  H HG23 . ILE A 1 157 ? -5.836  -3.573  -8.799  1.00 0.00 ? 157 ILE A HG23 2  
ATOM 5361  H HD11 . ILE A 1 157 ? -2.687  -3.254  -6.992  1.00 0.00 ? 157 ILE A HD11 2  
ATOM 5362  H HD12 . ILE A 1 157 ? -2.308  -4.882  -6.492  1.00 0.00 ? 157 ILE A HD12 2  
ATOM 5363  H HD13 . ILE A 1 157 ? -1.421  -4.178  -7.860  1.00 0.00 ? 157 ILE A HD13 2  
ATOM 5364  N N    . ARG A 1 158 ? -3.869  -2.770  -12.580 1.00 0.00 ? 158 ARG A N    2  
ATOM 5365  C CA   . ARG A 1 158 ? -4.376  -1.917  -13.647 1.00 0.00 ? 158 ARG A CA   2  
ATOM 5366  C C    . ARG A 1 158 ? -5.117  -2.778  -14.668 1.00 0.00 ? 158 ARG A C    2  
ATOM 5367  O O    . ARG A 1 158 ? -6.141  -2.352  -15.201 1.00 0.00 ? 158 ARG A O    2  
ATOM 5368  C CB   . ARG A 1 158 ? -3.207  -1.142  -14.267 1.00 0.00 ? 158 ARG A CB   2  
ATOM 5369  C CG   . ARG A 1 158 ? -3.670  0.032   -15.139 1.00 0.00 ? 158 ARG A CG   2  
ATOM 5370  C CD   . ARG A 1 158 ? -2.939  1.342   -14.824 1.00 0.00 ? 158 ARG A CD   2  
ATOM 5371  N NE   . ARG A 1 158 ? -3.015  2.276   -15.961 1.00 0.00 ? 158 ARG A NE   2  
ATOM 5372  C CZ   . ARG A 1 158 ? -3.658  3.451   -16.030 1.00 0.00 ? 158 ARG A CZ   2  
ATOM 5373  N NH1  . ARG A 1 158 ? -4.479  3.852   -15.063 1.00 0.00 ? 158 ARG A NH1  2  
ATOM 5374  N NH2  . ARG A 1 158 ? -3.429  4.246   -17.066 1.00 0.00 ? 158 ARG A NH2  2  
ATOM 5375  H H    . ARG A 1 158 ? -2.866  -2.835  -12.444 1.00 0.00 ? 158 ARG A H    2  
ATOM 5376  H HA   . ARG A 1 158 ? -5.075  -1.209  -13.199 1.00 0.00 ? 158 ARG A HA   2  
ATOM 5377  H HB2  . ARG A 1 158 ? -2.573  -0.760  -13.466 1.00 0.00 ? 158 ARG A HB2  2  
ATOM 5378  H HB3  . ARG A 1 158 ? -2.624  -1.829  -14.885 1.00 0.00 ? 158 ARG A HB3  2  
ATOM 5379  H HG2  . ARG A 1 158 ? -3.464  -0.219  -16.167 1.00 0.00 ? 158 ARG A HG2  2  
ATOM 5380  H HG3  . ARG A 1 158 ? -4.743  0.177   -15.045 1.00 0.00 ? 158 ARG A HG3  2  
ATOM 5381  H HD2  . ARG A 1 158 ? -3.346  1.783   -13.914 1.00 0.00 ? 158 ARG A HD2  2  
ATOM 5382  H HD3  . ARG A 1 158 ? -1.884  1.122   -14.654 1.00 0.00 ? 158 ARG A HD3  2  
ATOM 5383  H HE   . ARG A 1 158 ? -2.468  1.971   -16.765 1.00 0.00 ? 158 ARG A HE   2  
ATOM 5384  H HH11 . ARG A 1 158 ? -4.807  3.177   -14.373 1.00 0.00 ? 158 ARG A HH11 2  
ATOM 5385  H HH12 . ARG A 1 158 ? -4.922  4.774   -15.070 1.00 0.00 ? 158 ARG A HH12 2  
ATOM 5386  H HH21 . ARG A 1 158 ? -2.787  3.914   -17.788 1.00 0.00 ? 158 ARG A HH21 2  
ATOM 5387  H HH22 . ARG A 1 158 ? -3.860  5.156   -17.198 1.00 0.00 ? 158 ARG A HH22 2  
ATOM 5388  N N    . ASN A 1 159 ? -4.659  -4.021  -14.861 1.00 0.00 ? 159 ASN A N    2  
ATOM 5389  C CA   . ASN A 1 159 ? -5.325  -5.019  -15.684 1.00 0.00 ? 159 ASN A CA   2  
ATOM 5390  C C    . ASN A 1 159 ? -6.657  -5.519  -15.114 1.00 0.00 ? 159 ASN A C    2  
ATOM 5391  O O    . ASN A 1 159 ? -7.325  -6.304  -15.786 1.00 0.00 ? 159 ASN A O    2  
ATOM 5392  C CB   . ASN A 1 159 ? -4.392  -6.215  -15.938 1.00 0.00 ? 159 ASN A CB   2  
ATOM 5393  C CG   . ASN A 1 159 ? -3.513  -5.964  -17.143 1.00 0.00 ? 159 ASN A CG   2  
ATOM 5394  O OD1  . ASN A 1 159 ? -4.024  -5.898  -18.256 1.00 0.00 ? 159 ASN A OD1  2  
ATOM 5395  N ND2  . ASN A 1 159 ? -2.217  -5.805  -16.953 1.00 0.00 ? 159 ASN A ND2  2  
ATOM 5396  H H    . ASN A 1 159 ? -3.784  -4.286  -14.416 1.00 0.00 ? 159 ASN A H    2  
ATOM 5397  H HA   . ASN A 1 159 ? -5.548  -4.541  -16.638 1.00 0.00 ? 159 ASN A HA   2  
ATOM 5398  H HB2  . ASN A 1 159 ? -3.806  -6.453  -15.049 1.00 0.00 ? 159 ASN A HB2  2  
ATOM 5399  H HB3  . ASN A 1 159 ? -4.986  -7.092  -16.186 1.00 0.00 ? 159 ASN A HB3  2  
ATOM 5400  H HD21 . ASN A 1 159 ? -1.825  -5.851  -16.014 1.00 0.00 ? 159 ASN A HD21 2  
ATOM 5401  H HD22 . ASN A 1 159 ? -1.604  -5.660  -17.744 1.00 0.00 ? 159 ASN A HD22 2  
ATOM 5402  N N    . ARG A 1 160 ? -7.066  -5.146  -13.896 1.00 0.00 ? 160 ARG A N    2  
ATOM 5403  C CA   . ARG A 1 160 ? -8.439  -5.373  -13.451 1.00 0.00 ? 160 ARG A CA   2  
ATOM 5404  C C    . ARG A 1 160 ? -9.365  -4.358  -14.086 1.00 0.00 ? 160 ARG A C    2  
ATOM 5405  O O    . ARG A 1 160 ? -10.470 -4.703  -14.480 1.00 0.00 ? 160 ARG A O    2  
ATOM 5406  C CB   . ARG A 1 160 ? -8.550  -5.303  -11.916 1.00 0.00 ? 160 ARG A CB   2  
ATOM 5407  C CG   . ARG A 1 160 ? -7.627  -6.253  -11.137 1.00 0.00 ? 160 ARG A CG   2  
ATOM 5408  C CD   . ARG A 1 160 ? -7.437  -7.563  -11.887 1.00 0.00 ? 160 ARG A CD   2  
ATOM 5409  N NE   . ARG A 1 160 ? -7.076  -8.708  -11.050 1.00 0.00 ? 160 ARG A NE   2  
ATOM 5410  C CZ   . ARG A 1 160 ? -6.449  -9.805  -11.493 1.00 0.00 ? 160 ARG A CZ   2  
ATOM 5411  N NH1  . ARG A 1 160 ? -5.854  -9.835  -12.684 1.00 0.00 ? 160 ARG A NH1  2  
ATOM 5412  N NH2  . ARG A 1 160 ? -6.426  -10.893 -10.740 1.00 0.00 ? 160 ARG A NH2  2  
ATOM 5413  H H    . ARG A 1 160 ? -6.485  -4.591  -13.278 1.00 0.00 ? 160 ARG A H    2  
ATOM 5414  H HA   . ARG A 1 160 ? -8.785  -6.348  -13.799 1.00 0.00 ? 160 ARG A HA   2  
ATOM 5415  H HB2  . ARG A 1 160 ? -8.358  -4.284  -11.587 1.00 0.00 ? 160 ARG A HB2  2  
ATOM 5416  H HB3  . ARG A 1 160 ? -9.577  -5.546  -11.649 1.00 0.00 ? 160 ARG A HB3  2  
ATOM 5417  H HG2  . ARG A 1 160 ? -6.660  -5.789  -10.997 1.00 0.00 ? 160 ARG A HG2  2  
ATOM 5418  H HG3  . ARG A 1 160 ? -8.054  -6.437  -10.161 1.00 0.00 ? 160 ARG A HG3  2  
ATOM 5419  H HD2  . ARG A 1 160 ? -8.381  -7.806  -12.357 1.00 0.00 ? 160 ARG A HD2  2  
ATOM 5420  H HD3  . ARG A 1 160 ? -6.680  -7.371  -12.638 1.00 0.00 ? 160 ARG A HD3  2  
ATOM 5421  H HE   . ARG A 1 160 ? -7.654  -8.775  -10.210 1.00 0.00 ? 160 ARG A HE   2  
ATOM 5422  H HH11 . ARG A 1 160 ? -5.865  -9.045  -13.311 1.00 0.00 ? 160 ARG A HH11 2  
ATOM 5423  H HH12 . ARG A 1 160 ? -5.401  -10.660 -13.051 1.00 0.00 ? 160 ARG A HH12 2  
ATOM 5424  H HH21 . ARG A 1 160 ? -6.947  -10.944 -9.866  1.00 0.00 ? 160 ARG A HH21 2  
ATOM 5425  H HH22 . ARG A 1 160 ? -6.106  -11.785 -11.114 1.00 0.00 ? 160 ARG A HH22 2  
ATOM 5426  N N    . LYS A 1 161 ? -8.916  -3.104  -14.194 1.00 0.00 ? 161 LYS A N    2  
ATOM 5427  C CA   . LYS A 1 161 ? -9.614  -1.965  -14.788 1.00 0.00 ? 161 LYS A CA   2  
ATOM 5428  C C    . LYS A 1 161 ? -10.923 -1.577  -14.083 1.00 0.00 ? 161 LYS A C    2  
ATOM 5429  O O    . LYS A 1 161 ? -11.322 -0.418  -14.162 1.00 0.00 ? 161 LYS A O    2  
ATOM 5430  C CB   . LYS A 1 161 ? -9.803  -2.234  -16.296 1.00 0.00 ? 161 LYS A CB   2  
ATOM 5431  C CG   . LYS A 1 161 ? -9.901  -0.964  -17.147 1.00 0.00 ? 161 LYS A CG   2  
ATOM 5432  C CD   . LYS A 1 161 ? -8.578  -0.213  -17.306 1.00 0.00 ? 161 LYS A CD   2  
ATOM 5433  C CE   . LYS A 1 161 ? -7.560  -1.005  -18.141 1.00 0.00 ? 161 LYS A CE   2  
ATOM 5434  N NZ   . LYS A 1 161 ? -6.608  -0.107  -18.826 1.00 0.00 ? 161 LYS A NZ   2  
ATOM 5435  H H    . LYS A 1 161 ? -7.962  -2.946  -13.897 1.00 0.00 ? 161 LYS A H    2  
ATOM 5436  H HA   . LYS A 1 161 ? -8.941  -1.118  -14.673 1.00 0.00 ? 161 LYS A HA   2  
ATOM 5437  H HB2  . LYS A 1 161 ? -8.973  -2.834  -16.671 1.00 0.00 ? 161 LYS A HB2  2  
ATOM 5438  H HB3  . LYS A 1 161 ? -10.715 -2.817  -16.435 1.00 0.00 ? 161 LYS A HB3  2  
ATOM 5439  H HG2  . LYS A 1 161 ? -10.249 -1.236  -18.142 1.00 0.00 ? 161 LYS A HG2  2  
ATOM 5440  H HG3  . LYS A 1 161 ? -10.634 -0.290  -16.710 1.00 0.00 ? 161 LYS A HG3  2  
ATOM 5441  H HD2  . LYS A 1 161 ? -8.809  0.729   -17.798 1.00 0.00 ? 161 LYS A HD2  2  
ATOM 5442  H HD3  . LYS A 1 161 ? -8.152  0.014   -16.330 1.00 0.00 ? 161 LYS A HD3  2  
ATOM 5443  H HE2  . LYS A 1 161 ? -7.014  -1.687  -17.483 1.00 0.00 ? 161 LYS A HE2  2  
ATOM 5444  H HE3  . LYS A 1 161 ? -8.090  -1.597  -18.892 1.00 0.00 ? 161 LYS A HE3  2  
ATOM 5445  H HZ1  . LYS A 1 161 ? -6.162  0.511   -18.151 1.00 0.00 ? 161 LYS A HZ1  2  
ATOM 5446  H HZ2  . LYS A 1 161 ? -5.899  -0.634  -19.322 1.00 0.00 ? 161 LYS A HZ2  2  
ATOM 5447  H HZ3  . LYS A 1 161 ? -7.095  0.466   -19.509 1.00 0.00 ? 161 LYS A HZ3  2  
ATOM 5448  N N    . ASP A 1 162 ? -11.580 -2.476  -13.353 1.00 0.00 ? 162 ASP A N    2  
ATOM 5449  C CA   . ASP A 1 162 ? -12.708 -2.186  -12.473 1.00 0.00 ? 162 ASP A CA   2  
ATOM 5450  C C    . ASP A 1 162 ? -12.322 -1.223  -11.342 1.00 0.00 ? 162 ASP A C    2  
ATOM 5451  O O    . ASP A 1 162 ? -13.172 -0.446  -10.884 1.00 0.00 ? 162 ASP A O    2  
ATOM 5452  C CB   . ASP A 1 162 ? -13.316 -3.495  -11.930 1.00 0.00 ? 162 ASP A CB   2  
ATOM 5453  C CG   . ASP A 1 162 ? -12.382 -4.366  -11.085 1.00 0.00 ? 162 ASP A CG   2  
ATOM 5454  O OD1  . ASP A 1 162 ? -11.889 -3.908  -10.033 1.00 0.00 ? 162 ASP A OD1  2  
ATOM 5455  O OD2  . ASP A 1 162 ? -12.174 -5.543  -11.465 1.00 0.00 ? 162 ASP A OD2  2  
ATOM 5456  H H    . ASP A 1 162 ? -11.319 -3.450  -13.471 1.00 0.00 ? 162 ASP A H    2  
ATOM 5457  H HA   . ASP A 1 162 ? -13.474 -1.699  -13.073 1.00 0.00 ? 162 ASP A HA   2  
ATOM 5458  H HB2  . ASP A 1 162 ? -14.177 -3.256  -11.313 1.00 0.00 ? 162 ASP A HB2  2  
ATOM 5459  H HB3  . ASP A 1 162 ? -13.678 -4.077  -12.779 1.00 0.00 ? 162 ASP A HB3  2  
ATOM 5460  N N    . VAL A 1 163 ? -11.050 -1.243  -10.930 1.00 0.00 ? 163 VAL A N    2  
ATOM 5461  C CA   . VAL A 1 163 ? -10.523 -0.517  -9.788  1.00 0.00 ? 163 VAL A CA   2  
ATOM 5462  C C    . VAL A 1 163 ? -10.828 0.974   -9.913  1.00 0.00 ? 163 VAL A C    2  
ATOM 5463  O O    . VAL A 1 163 ? -10.666 1.575   -10.978 1.00 0.00 ? 163 VAL A O    2  
ATOM 5464  C CB   . VAL A 1 163 ? -9.015  -0.805  -9.611  1.00 0.00 ? 163 VAL A CB   2  
ATOM 5465  C CG1  . VAL A 1 163 ? -8.763  -2.287  -9.299  1.00 0.00 ? 163 VAL A CG1  2  
ATOM 5466  C CG2  . VAL A 1 163 ? -8.129  -0.420  -10.805 1.00 0.00 ? 163 VAL A CG2  2  
ATOM 5467  H H    . VAL A 1 163 ? -10.436 -1.933  -11.327 1.00 0.00 ? 163 VAL A H    2  
ATOM 5468  H HA   . VAL A 1 163 ? -11.040 -0.891  -8.906  1.00 0.00 ? 163 VAL A HA   2  
ATOM 5469  H HB   . VAL A 1 163 ? -8.675  -0.229  -8.754  1.00 0.00 ? 163 VAL A HB   2  
ATOM 5470  H HG11 . VAL A 1 163 ? -9.189  -2.528  -8.328  1.00 0.00 ? 163 VAL A HG11 2  
ATOM 5471  H HG12 . VAL A 1 163 ? -9.202  -2.939  -10.053 1.00 0.00 ? 163 VAL A HG12 2  
ATOM 5472  H HG13 . VAL A 1 163 ? -7.699  -2.502  -9.270  1.00 0.00 ? 163 VAL A HG13 2  
ATOM 5473  H HG21 . VAL A 1 163 ? -8.246  0.640   -11.023 1.00 0.00 ? 163 VAL A HG21 2  
ATOM 5474  H HG22 . VAL A 1 163 ? -7.084  -0.601  -10.546 1.00 0.00 ? 163 VAL A HG22 2  
ATOM 5475  H HG23 . VAL A 1 163 ? -8.396  -1.005  -11.684 1.00 0.00 ? 163 VAL A HG23 2  
ATOM 5476  N N    . LYS A 1 164 ? -11.271 1.598   -8.818  1.00 0.00 ? 164 LYS A N    2  
ATOM 5477  C CA   . LYS A 1 164 ? -11.335 3.056   -8.794  1.00 0.00 ? 164 LYS A CA   2  
ATOM 5478  C C    . LYS A 1 164 ? -9.897  3.566   -8.820  1.00 0.00 ? 164 LYS A C    2  
ATOM 5479  O O    . LYS A 1 164 ? -9.029  2.949   -8.204  1.00 0.00 ? 164 LYS A O    2  
ATOM 5480  C CB   . LYS A 1 164 ? -12.100 3.540   -7.553  1.00 0.00 ? 164 LYS A CB   2  
ATOM 5481  C CG   . LYS A 1 164 ? -12.217 5.064   -7.411  1.00 0.00 ? 164 LYS A CG   2  
ATOM 5482  C CD   . LYS A 1 164 ? -12.896 5.823   -8.564  1.00 0.00 ? 164 LYS A CD   2  
ATOM 5483  C CE   . LYS A 1 164 ? -14.416 5.979   -8.415  1.00 0.00 ? 164 LYS A CE   2  
ATOM 5484  N NZ   . LYS A 1 164 ? -15.160 4.702   -8.332  1.00 0.00 ? 164 LYS A NZ   2  
ATOM 5485  H H    . LYS A 1 164 ? -11.303 1.070   -7.952  1.00 0.00 ? 164 LYS A H    2  
ATOM 5486  H HA   . LYS A 1 164 ? -11.851 3.379   -9.698  1.00 0.00 ? 164 LYS A HA   2  
ATOM 5487  H HB2  . LYS A 1 164 ? -13.100 3.123   -7.558  1.00 0.00 ? 164 LYS A HB2  2  
ATOM 5488  H HB3  . LYS A 1 164 ? -11.598 3.159   -6.667  1.00 0.00 ? 164 LYS A HB3  2  
ATOM 5489  H HG2  . LYS A 1 164 ? -12.787 5.250   -6.508  1.00 0.00 ? 164 LYS A HG2  2  
ATOM 5490  H HG3  . LYS A 1 164 ? -11.220 5.479   -7.262  1.00 0.00 ? 164 LYS A HG3  2  
ATOM 5491  H HD2  . LYS A 1 164 ? -12.481 6.833   -8.578  1.00 0.00 ? 164 LYS A HD2  2  
ATOM 5492  H HD3  . LYS A 1 164 ? -12.665 5.376   -9.530  1.00 0.00 ? 164 LYS A HD3  2  
ATOM 5493  H HE2  . LYS A 1 164 ? -14.630 6.584   -7.531  1.00 0.00 ? 164 LYS A HE2  2  
ATOM 5494  H HE3  . LYS A 1 164 ? -14.779 6.532   -9.283  1.00 0.00 ? 164 LYS A HE3  2  
ATOM 5495  H HZ1  . LYS A 1 164 ? -16.121 4.882   -8.623  1.00 0.00 ? 164 LYS A HZ1  2  
ATOM 5496  H HZ2  . LYS A 1 164 ? -14.785 3.993   -8.954  1.00 0.00 ? 164 LYS A HZ2  2  
ATOM 5497  H HZ3  . LYS A 1 164 ? -15.181 4.353   -7.384  1.00 0.00 ? 164 LYS A HZ3  2  
ATOM 5498  N N    . VAL A 1 165 ? -9.662  4.699   -9.475  1.00 0.00 ? 165 VAL A N    2  
ATOM 5499  C CA   . VAL A 1 165 ? -8.387  5.395   -9.467  1.00 0.00 ? 165 VAL A CA   2  
ATOM 5500  C C    . VAL A 1 165 ? -8.710  6.831   -9.059  1.00 0.00 ? 165 VAL A C    2  
ATOM 5501  O O    . VAL A 1 165 ? -9.055  7.667   -9.896  1.00 0.00 ? 165 VAL A O    2  
ATOM 5502  C CB   . VAL A 1 165 ? -7.668  5.234   -10.822 1.00 0.00 ? 165 VAL A CB   2  
ATOM 5503  C CG1  . VAL A 1 165 ? -6.318  5.959   -10.822 1.00 0.00 ? 165 VAL A CG1  2  
ATOM 5504  C CG2  . VAL A 1 165 ? -7.413  3.755   -11.152 1.00 0.00 ? 165 VAL A CG2  2  
ATOM 5505  H H    . VAL A 1 165 ? -10.405 5.150   -9.987  1.00 0.00 ? 165 VAL A H    2  
ATOM 5506  H HA   . VAL A 1 165 ? -7.740  4.960   -8.707  1.00 0.00 ? 165 VAL A HA   2  
ATOM 5507  H HB   . VAL A 1 165 ? -8.285  5.654   -11.613 1.00 0.00 ? 165 VAL A HB   2  
ATOM 5508  H HG11 . VAL A 1 165 ? -5.683  5.584   -10.018 1.00 0.00 ? 165 VAL A HG11 2  
ATOM 5509  H HG12 . VAL A 1 165 ? -5.817  5.816   -11.781 1.00 0.00 ? 165 VAL A HG12 2  
ATOM 5510  H HG13 . VAL A 1 165 ? -6.487  7.027   -10.692 1.00 0.00 ? 165 VAL A HG13 2  
ATOM 5511  H HG21 . VAL A 1 165 ? -8.358  3.236   -11.313 1.00 0.00 ? 165 VAL A HG21 2  
ATOM 5512  H HG22 . VAL A 1 165 ? -6.834  3.693   -12.070 1.00 0.00 ? 165 VAL A HG22 2  
ATOM 5513  H HG23 . VAL A 1 165 ? -6.867  3.273   -10.340 1.00 0.00 ? 165 VAL A HG23 2  
ATOM 5514  N N    . PHE A 1 166 ? -8.694  7.089   -7.752  1.00 0.00 ? 166 PHE A N    2  
ATOM 5515  C CA   . PHE A 1 166 ? -8.918  8.406   -7.187  1.00 0.00 ? 166 PHE A CA   2  
ATOM 5516  C C    . PHE A 1 166 ? -7.635  9.228   -7.311  1.00 0.00 ? 166 PHE A C    2  
ATOM 5517  O O    . PHE A 1 166 ? -6.679  9.018   -6.562  1.00 0.00 ? 166 PHE A O    2  
ATOM 5518  C CB   . PHE A 1 166 ? -9.340  8.302   -5.723  1.00 0.00 ? 166 PHE A CB   2  
ATOM 5519  C CG   . PHE A 1 166 ? -10.770 7.877   -5.471  1.00 0.00 ? 166 PHE A CG   2  
ATOM 5520  C CD1  . PHE A 1 166 ? -11.854 8.606   -5.996  1.00 0.00 ? 166 PHE A CD1  2  
ATOM 5521  C CD2  . PHE A 1 166 ? -11.022 6.804   -4.608  1.00 0.00 ? 166 PHE A CD2  2  
ATOM 5522  C CE1  . PHE A 1 166 ? -13.167 8.249   -5.645  1.00 0.00 ? 166 PHE A CE1  2  
ATOM 5523  C CE2  . PHE A 1 166 ? -12.333 6.431   -4.282  1.00 0.00 ? 166 PHE A CE2  2  
ATOM 5524  C CZ   . PHE A 1 166 ? -13.404 7.175   -4.779  1.00 0.00 ? 166 PHE A CZ   2  
ATOM 5525  H H    . PHE A 1 166 ? -8.426  6.340   -7.120  1.00 0.00 ? 166 PHE A H    2  
ATOM 5526  H HA   . PHE A 1 166 ? -9.725  8.888   -7.736  1.00 0.00 ? 166 PHE A HA   2  
ATOM 5527  H HB2  . PHE A 1 166 ? -8.656  7.637   -5.196  1.00 0.00 ? 166 PHE A HB2  2  
ATOM 5528  H HB3  . PHE A 1 166 ? -9.231  9.285   -5.289  1.00 0.00 ? 166 PHE A HB3  2  
ATOM 5529  H HD1  . PHE A 1 166 ? -11.696 9.469   -6.625  1.00 0.00 ? 166 PHE A HD1  2  
ATOM 5530  H HD2  . PHE A 1 166 ? -10.211 6.326   -4.087  1.00 0.00 ? 166 PHE A HD2  2  
ATOM 5531  H HE1  . PHE A 1 166 ? -14.004 8.818   -6.008  1.00 0.00 ? 166 PHE A HE1  2  
ATOM 5532  H HE2  . PHE A 1 166 ? -12.525 5.605   -3.615  1.00 0.00 ? 166 PHE A HE2  2  
ATOM 5533  H HZ   . PHE A 1 166 ? -14.400 6.925   -4.464  1.00 0.00 ? 166 PHE A HZ   2  
ATOM 5534  N N    . ASN A 1 167 ? -7.586  10.173  -8.245  1.00 0.00 ? 167 ASN A N    2  
ATOM 5535  C CA   . ASN A 1 167 ? -6.518  11.165  -8.311  1.00 0.00 ? 167 ASN A CA   2  
ATOM 5536  C C    . ASN A 1 167 ? -6.583  12.022  -7.043  1.00 0.00 ? 167 ASN A C    2  
ATOM 5537  O O    . ASN A 1 167 ? -7.482  12.849  -6.916  1.00 0.00 ? 167 ASN A O    2  
ATOM 5538  C CB   . ASN A 1 167 ? -6.657  12.007  -9.591  1.00 0.00 ? 167 ASN A CB   2  
ATOM 5539  C CG   . ASN A 1 167 ? -5.300  12.417  -10.140 1.00 0.00 ? 167 ASN A CG   2  
ATOM 5540  O OD1  . ASN A 1 167 ? -4.968  12.063  -11.271 1.00 0.00 ? 167 ASN A OD1  2  
ATOM 5541  N ND2  . ASN A 1 167 ? -4.483  13.125  -9.387  1.00 0.00 ? 167 ASN A ND2  2  
ATOM 5542  H H    . ASN A 1 167 ? -8.448  10.368  -8.744  1.00 0.00 ? 167 ASN A H    2  
ATOM 5543  H HA   . ASN A 1 167 ? -5.548  10.666  -8.348  1.00 0.00 ? 167 ASN A HA   2  
ATOM 5544  H HB2  . ASN A 1 167 ? -7.170  11.421  -10.354 1.00 0.00 ? 167 ASN A HB2  2  
ATOM 5545  H HB3  . ASN A 1 167 ? -7.261  12.898  -9.412  1.00 0.00 ? 167 ASN A HB3  2  
ATOM 5546  H HD21 . ASN A 1 167 ? -4.719  13.444  -8.448  1.00 0.00 ? 167 ASN A HD21 2  
ATOM 5547  H HD22 . ASN A 1 167 ? -3.607  13.475  -9.762  1.00 0.00 ? 167 ASN A HD22 2  
ATOM 5548  N N    . VAL A 1 168 ? -5.670  11.822  -6.092  1.00 0.00 ? 168 VAL A N    2  
ATOM 5549  C CA   . VAL A 1 168 ? -5.419  12.771  -5.014  1.00 0.00 ? 168 VAL A CA   2  
ATOM 5550  C C    . VAL A 1 168 ? -4.990  14.082  -5.685  1.00 0.00 ? 168 VAL A C    2  
ATOM 5551  O O    . VAL A 1 168 ? -4.395  14.068  -6.765  1.00 0.00 ? 168 VAL A O    2  
ATOM 5552  C CB   . VAL A 1 168 ? -4.330  12.175  -4.063  1.00 0.00 ? 168 VAL A CB   2  
ATOM 5553  C CG1  . VAL A 1 168 ? -3.061  13.015  -3.951  1.00 0.00 ? 168 VAL A CG1  2  
ATOM 5554  C CG2  . VAL A 1 168 ? -4.755  12.002  -2.603  1.00 0.00 ? 168 VAL A CG2  2  
ATOM 5555  H H    . VAL A 1 168 ? -4.934  11.146  -6.265  1.00 0.00 ? 168 VAL A H    2  
ATOM 5556  H HA   . VAL A 1 168 ? -6.352  12.960  -4.478  1.00 0.00 ? 168 VAL A HA   2  
ATOM 5557  H HB   . VAL A 1 168 ? -4.037  11.186  -4.416  1.00 0.00 ? 168 VAL A HB   2  
ATOM 5558  H HG11 . VAL A 1 168 ? -3.283  13.949  -3.421  1.00 0.00 ? 168 VAL A HG11 2  
ATOM 5559  H HG12 . VAL A 1 168 ? -2.320  12.439  -3.411  1.00 0.00 ? 168 VAL A HG12 2  
ATOM 5560  H HG13 . VAL A 1 168 ? -2.669  13.204  -4.947  1.00 0.00 ? 168 VAL A HG13 2  
ATOM 5561  H HG21 . VAL A 1 168 ? -5.488  11.209  -2.528  1.00 0.00 ? 168 VAL A HG21 2  
ATOM 5562  H HG22 . VAL A 1 168 ? -3.906  11.669  -1.992  1.00 0.00 ? 168 VAL A HG22 2  
ATOM 5563  H HG23 . VAL A 1 168 ? -5.153  12.951  -2.234  1.00 0.00 ? 168 VAL A HG23 2  
ATOM 5564  N N    . THR A 1 169 ? -5.173  15.208  -5.008  1.00 0.00 ? 169 THR A N    2  
ATOM 5565  C CA   . THR A 1 169 ? -4.364  16.388  -5.261  1.00 0.00 ? 169 THR A CA   2  
ATOM 5566  C C    . THR A 1 169 ? -3.956  16.939  -3.908  1.00 0.00 ? 169 THR A C    2  
ATOM 5567  O O    . THR A 1 169 ? -4.580  16.617  -2.896  1.00 0.00 ? 169 THR A O    2  
ATOM 5568  C CB   . THR A 1 169 ? -5.106  17.394  -6.160  1.00 0.00 ? 169 THR A CB   2  
ATOM 5569  O OG1  . THR A 1 169 ? -6.115  18.027  -5.424  1.00 0.00 ? 169 THR A OG1  2  
ATOM 5570  C CG2  . THR A 1 169 ? -5.755  16.780  -7.405  1.00 0.00 ? 169 THR A CG2  2  
ATOM 5571  H H    . THR A 1 169 ? -5.669  15.224  -4.128  1.00 0.00 ? 169 THR A H    2  
ATOM 5572  H HA   . THR A 1 169 ? -3.435  16.122  -5.746  1.00 0.00 ? 169 THR A HA   2  
ATOM 5573  H HB   . THR A 1 169 ? -4.395  18.158  -6.476  1.00 0.00 ? 169 THR A HB   2  
ATOM 5574  H HG1  . THR A 1 169 ? -6.975  17.669  -5.734  1.00 0.00 ? 169 THR A HG1  2  
ATOM 5575  H HG21 . THR A 1 169 ? -5.013  16.236  -7.985  1.00 0.00 ? 169 THR A HG21 2  
ATOM 5576  H HG22 . THR A 1 169 ? -6.542  16.078  -7.119  1.00 0.00 ? 169 THR A HG22 2  
ATOM 5577  H HG23 . THR A 1 169 ? -6.190  17.566  -8.021  1.00 0.00 ? 169 THR A HG23 2  
ATOM 5578  N N    . LYS A 1 170 ? -2.937  17.794  -3.869  1.00 0.00 ? 170 LYS A N    2  
ATOM 5579  C CA   . LYS A 1 170 ? -2.663  18.606  -2.685  1.00 0.00 ? 170 LYS A CA   2  
ATOM 5580  C C    . LYS A 1 170 ? -3.797  19.604  -2.446  1.00 0.00 ? 170 LYS A C    2  
ATOM 5581  O O    . LYS A 1 170 ? -3.896  20.146  -1.349  1.00 0.00 ? 170 LYS A O    2  
ATOM 5582  C CB   . LYS A 1 170 ? -1.318  19.331  -2.843  1.00 0.00 ? 170 LYS A CB   2  
ATOM 5583  C CG   . LYS A 1 170 ? -0.164  18.322  -2.965  1.00 0.00 ? 170 LYS A CG   2  
ATOM 5584  C CD   . LYS A 1 170 ? 1.217   18.984  -3.061  1.00 0.00 ? 170 LYS A CD   2  
ATOM 5585  C CE   . LYS A 1 170 ? 1.363   19.807  -4.346  1.00 0.00 ? 170 LYS A CE   2  
ATOM 5586  N NZ   . LYS A 1 170 ? 2.730   20.339  -4.509  1.00 0.00 ? 170 LYS A NZ   2  
ATOM 5587  H H    . LYS A 1 170 ? -2.432  17.994  -4.732  1.00 0.00 ? 170 LYS A H    2  
ATOM 5588  H HA   . LYS A 1 170 ? -2.614  17.955  -1.812  1.00 0.00 ? 170 LYS A HA   2  
ATOM 5589  H HB2  . LYS A 1 170 ? -1.358  19.973  -3.724  1.00 0.00 ? 170 LYS A HB2  2  
ATOM 5590  H HB3  . LYS A 1 170 ? -1.149  19.960  -1.966  1.00 0.00 ? 170 LYS A HB3  2  
ATOM 5591  H HG2  . LYS A 1 170 ? -0.170  17.683  -2.081  1.00 0.00 ? 170 LYS A HG2  2  
ATOM 5592  H HG3  . LYS A 1 170 ? -0.320  17.690  -3.844  1.00 0.00 ? 170 LYS A HG3  2  
ATOM 5593  H HD2  . LYS A 1 170 ? 1.377   19.623  -2.190  1.00 0.00 ? 170 LYS A HD2  2  
ATOM 5594  H HD3  . LYS A 1 170 ? 1.972   18.199  -3.053  1.00 0.00 ? 170 LYS A HD3  2  
ATOM 5595  H HE2  . LYS A 1 170 ? 1.119   19.180  -5.206  1.00 0.00 ? 170 LYS A HE2  2  
ATOM 5596  H HE3  . LYS A 1 170 ? 0.660   20.642  -4.311  1.00 0.00 ? 170 LYS A HE3  2  
ATOM 5597  H HZ1  . LYS A 1 170 ? 2.970   20.967  -3.749  1.00 0.00 ? 170 LYS A HZ1  2  
ATOM 5598  H HZ2  . LYS A 1 170 ? 3.413   19.593  -4.556  1.00 0.00 ? 170 LYS A HZ2  2  
ATOM 5599  H HZ3  . LYS A 1 170 ? 2.786   20.869  -5.374  1.00 0.00 ? 170 LYS A HZ3  2  
ATOM 5600  N N    . GLU A 1 171 ? -4.661  19.810  -3.441  1.00 0.00 ? 171 GLU A N    2  
ATOM 5601  C CA   . GLU A 1 171 ? -5.677  20.850  -3.397  1.00 0.00 ? 171 GLU A CA   2  
ATOM 5602  C C    . GLU A 1 171 ? -6.931  20.322  -2.698  1.00 0.00 ? 171 GLU A C    2  
ATOM 5603  O O    . GLU A 1 171 ? -7.380  20.902  -1.708  1.00 0.00 ? 171 GLU A O    2  
ATOM 5604  C CB   . GLU A 1 171 ? -5.987  21.378  -4.806  1.00 0.00 ? 171 GLU A CB   2  
ATOM 5605  C CG   . GLU A 1 171 ? -4.761  21.784  -5.642  1.00 0.00 ? 171 GLU A CG   2  
ATOM 5606  C CD   . GLU A 1 171 ? -3.987  22.978  -5.081  1.00 0.00 ? 171 GLU A CD   2  
ATOM 5607  O OE1  . GLU A 1 171 ? -3.543  22.943  -3.914  1.00 0.00 ? 171 GLU A OE1  2  
ATOM 5608  O OE2  . GLU A 1 171 ? -3.761  23.968  -5.818  1.00 0.00 ? 171 GLU A OE2  2  
ATOM 5609  H H    . GLU A 1 171 ? -4.592  19.232  -4.275  1.00 0.00 ? 171 GLU A H    2  
ATOM 5610  H HA   . GLU A 1 171 ? -5.291  21.690  -2.824  1.00 0.00 ? 171 GLU A HA   2  
ATOM 5611  H HB2  . GLU A 1 171 ? -6.537  20.621  -5.362  1.00 0.00 ? 171 GLU A HB2  2  
ATOM 5612  H HB3  . GLU A 1 171 ? -6.637  22.244  -4.698  1.00 0.00 ? 171 GLU A HB3  2  
ATOM 5613  H HG2  . GLU A 1 171 ? -4.085  20.934  -5.761  1.00 0.00 ? 171 GLU A HG2  2  
ATOM 5614  H HG3  . GLU A 1 171 ? -5.123  22.059  -6.627  1.00 0.00 ? 171 GLU A HG3  2  
ATOM 5615  N N    . ASN A 1 172 ? -7.470  19.195  -3.173  1.00 0.00 ? 172 ASN A N    2  
ATOM 5616  C CA   . ASN A 1 172 ? -8.701  18.576  -2.684  1.00 0.00 ? 172 ASN A CA   2  
ATOM 5617  C C    . ASN A 1 172 ? -8.387  17.391  -1.781  1.00 0.00 ? 172 ASN A C    2  
ATOM 5618  O O    . ASN A 1 172 ? -9.298  16.645  -1.438  1.00 0.00 ? 172 ASN A O    2  
ATOM 5619  C CB   . ASN A 1 172 ? -9.650  18.171  -3.830  1.00 0.00 ? 172 ASN A CB   2  
ATOM 5620  C CG   . ASN A 1 172 ? -9.170  16.992  -4.669  1.00 0.00 ? 172 ASN A CG   2  
ATOM 5621  O OD1  . ASN A 1 172 ? -8.578  17.192  -5.725  1.00 0.00 ? 172 ASN A OD1  2  
ATOM 5622  N ND2  . ASN A 1 172 ? -9.382  15.757  -4.256  1.00 0.00 ? 172 ASN A ND2  2  
ATOM 5623  H H    . ASN A 1 172 ? -6.970  18.698  -3.902  1.00 0.00 ? 172 ASN A H    2  
ATOM 5624  H HA   . ASN A 1 172 ? -9.234  19.311  -2.080  1.00 0.00 ? 172 ASN A HA   2  
ATOM 5625  H HB2  . ASN A 1 172 ? -10.621 17.917  -3.403  1.00 0.00 ? 172 ASN A HB2  2  
ATOM 5626  H HB3  . ASN A 1 172 ? -9.813  19.027  -4.482  1.00 0.00 ? 172 ASN A HB3  2  
ATOM 5627  H HD21 . ASN A 1 172 ? -9.946  15.583  -3.433  1.00 0.00 ? 172 ASN A HD21 2  
ATOM 5628  H HD22 . ASN A 1 172 ? -9.323  15.037  -4.976  1.00 0.00 ? 172 ASN A HD22 2  
ATOM 5629  N N    . ARG A 1 173 ? -7.118  17.215  -1.386  1.00 0.00 ? 173 ARG A N    2  
ATOM 5630  C CA   . ARG A 1 173 ? -6.608  16.167  -0.506  1.00 0.00 ? 173 ARG A CA   2  
ATOM 5631  C C    . ARG A 1 173 ? -7.669  15.709  0.500   1.00 0.00 ? 173 ARG A C    2  
ATOM 5632  O O    . ARG A 1 173 ? -8.130  14.573  0.454   1.00 0.00 ? 173 ARG A O    2  
ATOM 5633  C CB   . ARG A 1 173 ? -5.308  16.616  0.207   1.00 0.00 ? 173 ARG A CB   2  
ATOM 5634  C CG   . ARG A 1 173 ? -5.328  18.029  0.820   1.00 0.00 ? 173 ARG A CG   2  
ATOM 5635  C CD   . ARG A 1 173 ? -3.938  18.423  1.311   1.00 0.00 ? 173 ARG A CD   2  
ATOM 5636  N NE   . ARG A 1 173 ? -3.939  19.810  1.789   1.00 0.00 ? 173 ARG A NE   2  
ATOM 5637  C CZ   . ARG A 1 173 ? -4.040  20.211  3.061   1.00 0.00 ? 173 ARG A CZ   2  
ATOM 5638  N NH1  . ARG A 1 173 ? -4.242  19.345  4.052   1.00 0.00 ? 173 ARG A NH1  2  
ATOM 5639  N NH2  . ARG A 1 173 ? -3.917  21.494  3.358   1.00 0.00 ? 173 ARG A NH2  2  
ATOM 5640  H H    . ARG A 1 173 ? -6.425  17.798  -1.833  1.00 0.00 ? 173 ARG A H    2  
ATOM 5641  H HA   . ARG A 1 173 ? -6.344  15.344  -1.182  1.00 0.00 ? 173 ARG A HA   2  
ATOM 5642  H HB2  . ARG A 1 173 ? -5.070  15.899  0.994   1.00 0.00 ? 173 ARG A HB2  2  
ATOM 5643  H HB3  . ARG A 1 173 ? -4.485  16.573  -0.501  1.00 0.00 ? 173 ARG A HB3  2  
ATOM 5644  H HG2  . ARG A 1 173 ? -5.649  18.757  0.075   1.00 0.00 ? 173 ARG A HG2  2  
ATOM 5645  H HG3  . ARG A 1 173 ? -6.007  18.073  1.669   1.00 0.00 ? 173 ARG A HG3  2  
ATOM 5646  H HD2  . ARG A 1 173 ? -3.621  17.743  2.102   1.00 0.00 ? 173 ARG A HD2  2  
ATOM 5647  H HD3  . ARG A 1 173 ? -3.229  18.347  0.487   1.00 0.00 ? 173 ARG A HD3  2  
ATOM 5648  H HE   . ARG A 1 173 ? -3.850  20.506  1.052   1.00 0.00 ? 173 ARG A HE   2  
ATOM 5649  H HH11 . ARG A 1 173 ? -4.422  18.352  3.906   1.00 0.00 ? 173 ARG A HH11 2  
ATOM 5650  H HH12 . ARG A 1 173 ? -4.350  19.709  4.996   1.00 0.00 ? 173 ARG A HH12 2  
ATOM 5651  H HH21 . ARG A 1 173 ? -3.822  22.212  2.633   1.00 0.00 ? 173 ARG A HH21 2  
ATOM 5652  H HH22 . ARG A 1 173 ? -3.953  21.844  4.306   1.00 0.00 ? 173 ARG A HH22 2  
ATOM 5653  N N    . ASN A 1 174 ? -8.081  16.598  1.405   1.00 0.00 ? 174 ASN A N    2  
ATOM 5654  C CA   . ASN A 1 174 ? -8.903  16.248  2.553   1.00 0.00 ? 174 ASN A CA   2  
ATOM 5655  C C    . ASN A 1 174 ? -10.392 16.105  2.224   1.00 0.00 ? 174 ASN A C    2  
ATOM 5656  O O    . ASN A 1 174 ? -11.192 15.778  3.094   1.00 0.00 ? 174 ASN A O    2  
ATOM 5657  C CB   . ASN A 1 174 ? -8.670  17.311  3.637   1.00 0.00 ? 174 ASN A CB   2  
ATOM 5658  C CG   . ASN A 1 174 ? -9.248  16.898  4.979   1.00 0.00 ? 174 ASN A CG   2  
ATOM 5659  O OD1  . ASN A 1 174 ? -8.784  15.929  5.577   1.00 0.00 ? 174 ASN A OD1  2  
ATOM 5660  N ND2  . ASN A 1 174 ? -10.194 17.649  5.503   1.00 0.00 ? 174 ASN A ND2  2  
ATOM 5661  H H    . ASN A 1 174 ? -7.739  17.540  1.368   1.00 0.00 ? 174 ASN A H    2  
ATOM 5662  H HA   . ASN A 1 174 ? -8.563  15.286  2.902   1.00 0.00 ? 174 ASN A HA   2  
ATOM 5663  H HB2  . ASN A 1 174 ? -7.600  17.467  3.782   1.00 0.00 ? 174 ASN A HB2  2  
ATOM 5664  H HB3  . ASN A 1 174 ? -9.118  18.251  3.317   1.00 0.00 ? 174 ASN A HB3  2  
ATOM 5665  H HD21 . ASN A 1 174 ? -10.582 18.439  4.997   1.00 0.00 ? 174 ASN A HD21 2  
ATOM 5666  H HD22 . ASN A 1 174 ? -10.586 17.411  6.409   1.00 0.00 ? 174 ASN A HD22 2  
ATOM 5667  N N    . HIS A 1 175 ? -10.747 16.241  0.952   1.00 0.00 ? 175 HIS A N    2  
ATOM 5668  C CA   . HIS A 1 175 ? -12.049 15.943  0.365   1.00 0.00 ? 175 HIS A CA   2  
ATOM 5669  C C    . HIS A 1 175 ? -12.003 14.654  -0.438  1.00 0.00 ? 175 HIS A C    2  
ATOM 5670  O O    . HIS A 1 175 ? -13.053 14.170  -0.847  1.00 0.00 ? 175 HIS A O    2  
ATOM 5671  C CB   . HIS A 1 175 ? -12.518 17.094  -0.535  1.00 0.00 ? 175 HIS A CB   2  
ATOM 5672  C CG   . HIS A 1 175 ? -12.819 18.399  0.152   1.00 0.00 ? 175 HIS A CG   2  
ATOM 5673  N ND1  . HIS A 1 175 ? -13.264 18.580  1.444   1.00 0.00 ? 175 HIS A ND1  2  
ATOM 5674  C CD2  . HIS A 1 175 ? -12.868 19.610  -0.478  1.00 0.00 ? 175 HIS A CD2  2  
ATOM 5675  C CE1  . HIS A 1 175 ? -13.581 19.874  1.594   1.00 0.00 ? 175 HIS A CE1  2  
ATOM 5676  N NE2  . HIS A 1 175 ? -13.360 20.544  0.446   1.00 0.00 ? 175 HIS A NE2  2  
ATOM 5677  H H    . HIS A 1 175 ? -10.000 16.428  0.300   1.00 0.00 ? 175 HIS A H    2  
ATOM 5678  H HA   . HIS A 1 175 ? -12.789 15.769  1.136   1.00 0.00 ? 175 HIS A HA   2  
ATOM 5679  H HB2  . HIS A 1 175 ? -11.776 17.271  -1.313  1.00 0.00 ? 175 HIS A HB2  2  
ATOM 5680  H HB3  . HIS A 1 175 ? -13.435 16.785  -1.034  1.00 0.00 ? 175 HIS A HB3  2  
ATOM 5681  H HD1  . HIS A 1 175 ? -13.377 17.872  2.170   1.00 0.00 ? 175 HIS A HD1  2  
ATOM 5682  H HD2  . HIS A 1 175 ? -12.637 19.784  -1.523  1.00 0.00 ? 175 HIS A HD2  2  
ATOM 5683  H HE1  . HIS A 1 175 ? -13.970 20.300  2.511   1.00 0.00 ? 175 HIS A HE1  2  
ATOM 5684  N N    . LEU A 1 176 ? -10.829 14.051  -0.634  1.00 0.00 ? 176 LEU A N    2  
ATOM 5685  C CA   . LEU A 1 176 ? -10.784 12.784  -1.328  1.00 0.00 ? 176 LEU A CA   2  
ATOM 5686  C C    . LEU A 1 176 ? -11.128 11.642  -0.383  1.00 0.00 ? 176 LEU A C    2  
ATOM 5687  O O    . LEU A 1 176 ? -11.925 10.784  -0.735  1.00 0.00 ? 176 LEU A O    2  
ATOM 5688  C CB   . LEU A 1 176 ? -9.403  12.558  -1.922  1.00 0.00 ? 176 LEU A CB   2  
ATOM 5689  C CG   . LEU A 1 176 ? -9.475  11.433  -2.963  1.00 0.00 ? 176 LEU A CG   2  
ATOM 5690  C CD1  . LEU A 1 176 ? -9.882  12.007  -4.324  1.00 0.00 ? 176 LEU A CD1  2  
ATOM 5691  C CD2  . LEU A 1 176 ? -8.095  10.795  -2.981  1.00 0.00 ? 176 LEU A CD2  2  
ATOM 5692  H H    . LEU A 1 176 ? -9.964  14.450  -0.288  1.00 0.00 ? 176 LEU A H    2  
ATOM 5693  H HA   . LEU A 1 176 ? -11.537 12.832  -2.113  1.00 0.00 ? 176 LEU A HA   2  
ATOM 5694  H HB2  . LEU A 1 176 ? -9.038  13.461  -2.397  1.00 0.00 ? 176 LEU A HB2  2  
ATOM 5695  H HB3  . LEU A 1 176 ? -8.714  12.311  -1.112  1.00 0.00 ? 176 LEU A HB3  2  
ATOM 5696  H HG   . LEU A 1 176 ? -10.196 10.672  -2.676  1.00 0.00 ? 176 LEU A HG   2  
ATOM 5697  H HD11 . LEU A 1 176 ? -10.808 12.576  -4.229  1.00 0.00 ? 176 LEU A HD11 2  
ATOM 5698  H HD12 . LEU A 1 176 ? -9.105  12.662  -4.717  1.00 0.00 ? 176 LEU A HD12 2  
ATOM 5699  H HD13 . LEU A 1 176 ? -10.073 11.209  -5.034  1.00 0.00 ? 176 LEU A HD13 2  
ATOM 5700  H HD21 . LEU A 1 176 ? -8.085  9.930   -3.632  1.00 0.00 ? 176 LEU A HD21 2  
ATOM 5701  H HD22 . LEU A 1 176 ? -7.391  11.524  -3.352  1.00 0.00 ? 176 LEU A HD22 2  
ATOM 5702  H HD23 . LEU A 1 176 ? -7.841  10.475  -1.963  1.00 0.00 ? 176 LEU A HD23 2  
ATOM 5703  N N    . LEU A 1 177 ? -10.530 11.661  0.816   1.00 0.00 ? 177 LEU A N    2  
ATOM 5704  C CA   . LEU A 1 177 ? -10.846 10.810  1.966   1.00 0.00 ? 177 LEU A CA   2  
ATOM 5705  C C    . LEU A 1 177 ? -12.360 10.483  1.974   1.00 0.00 ? 177 LEU A C    2  
ATOM 5706  O O    . LEU A 1 177 ? -12.681 9.306   1.827   1.00 0.00 ? 177 LEU A O    2  
ATOM 5707  C CB   . LEU A 1 177 ? -10.338 11.540  3.233   1.00 0.00 ? 177 LEU A CB   2  
ATOM 5708  C CG   . LEU A 1 177 ? -11.013 11.196  4.578   1.00 0.00 ? 177 LEU A CG   2  
ATOM 5709  C CD1  . LEU A 1 177 ? -10.877 9.727   4.942   1.00 0.00 ? 177 LEU A CD1  2  
ATOM 5710  C CD2  . LEU A 1 177 ? -10.375 12.045  5.681   1.00 0.00 ? 177 LEU A CD2  2  
ATOM 5711  H H    . LEU A 1 177 ? -9.882  12.420  0.961   1.00 0.00 ? 177 LEU A H    2  
ATOM 5712  H HA   . LEU A 1 177 ? -10.277 9.855   1.879   1.00 0.00 ? 177 LEU A HA   2  
ATOM 5713  H HB2  . LEU A 1 177 ? -9.269  11.346  3.317   1.00 0.00 ? 177 LEU A HB2  2  
ATOM 5714  H HB3  . LEU A 1 177 ? -10.455 12.616  3.090   1.00 0.00 ? 177 LEU A HB3  2  
ATOM 5715  H HG   . LEU A 1 177 ? -12.074 11.434  4.545   1.00 0.00 ? 177 LEU A HG   2  
ATOM 5716  H HD11 . LEU A 1 177 ? -11.400 9.111   4.216   1.00 0.00 ? 177 LEU A HD11 2  
ATOM 5717  H HD12 . LEU A 1 177 ? -9.827  9.448   4.957   1.00 0.00 ? 177 LEU A HD12 2  
ATOM 5718  H HD13 . LEU A 1 177 ? -11.321 9.556   5.922   1.00 0.00 ? 177 LEU A HD13 2  
ATOM 5719  H HD21 . LEU A 1 177 ? -10.835 11.808  6.641   1.00 0.00 ? 177 LEU A HD21 2  
ATOM 5720  H HD22 . LEU A 1 177 ? -9.302  11.865  5.730   1.00 0.00 ? 177 LEU A HD22 2  
ATOM 5721  H HD23 . LEU A 1 177 ? -10.550 13.103  5.476   1.00 0.00 ? 177 LEU A HD23 2  
ATOM 5722  N N    . PRO A 1 178 ? -13.307 11.439  2.089   1.00 0.00 ? 178 PRO A N    2  
ATOM 5723  C CA   . PRO A 1 178 ? -14.729 11.106  2.154   1.00 0.00 ? 178 PRO A CA   2  
ATOM 5724  C C    . PRO A 1 178 ? -15.326 10.555  0.849   1.00 0.00 ? 178 PRO A C    2  
ATOM 5725  O O    . PRO A 1 178 ? -16.280 9.779   0.919   1.00 0.00 ? 178 PRO A O    2  
ATOM 5726  C CB   . PRO A 1 178 ? -15.430 12.397  2.567   1.00 0.00 ? 178 PRO A CB   2  
ATOM 5727  C CG   . PRO A 1 178 ? -14.502 13.497  2.076   1.00 0.00 ? 178 PRO A CG   2  
ATOM 5728  C CD   . PRO A 1 178 ? -13.132 12.870  2.310   1.00 0.00 ? 178 PRO A CD   2  
ATOM 5729  H HA   . PRO A 1 178 ? -14.889 10.365  2.936   1.00 0.00 ? 178 PRO A HA   2  
ATOM 5730  H HB2  . PRO A 1 178 ? -16.410 12.479  2.108   1.00 0.00 ? 178 PRO A HB2  2  
ATOM 5731  H HB3  . PRO A 1 178 ? -15.496 12.441  3.653   1.00 0.00 ? 178 PRO A HB3  2  
ATOM 5732  H HG2  . PRO A 1 178 ? -14.672 13.666  1.014   1.00 0.00 ? 178 PRO A HG2  2  
ATOM 5733  H HG3  . PRO A 1 178 ? -14.634 14.418  2.639   1.00 0.00 ? 178 PRO A HG3  2  
ATOM 5734  H HD2  . PRO A 1 178 ? -12.393 13.297  1.643   1.00 0.00 ? 178 PRO A HD2  2  
ATOM 5735  H HD3  . PRO A 1 178 ? -12.842 13.055  3.343   1.00 0.00 ? 178 PRO A HD3  2  
ATOM 5736  N N    . ASP A 1 179 ? -14.806 10.918  -0.325  1.00 0.00 ? 179 ASP A N    2  
ATOM 5737  C CA   . ASP A 1 179 ? -15.262 10.363  -1.608  1.00 0.00 ? 179 ASP A CA   2  
ATOM 5738  C C    . ASP A 1 179 ? -14.872 8.882   -1.703  1.00 0.00 ? 179 ASP A C    2  
ATOM 5739  O O    . ASP A 1 179 ? -15.630 8.043   -2.204  1.00 0.00 ? 179 ASP A O    2  
ATOM 5740  C CB   . ASP A 1 179 ? -14.675 11.169  -2.783  1.00 0.00 ? 179 ASP A CB   2  
ATOM 5741  C CG   . ASP A 1 179 ? -15.358 10.866  -4.123  1.00 0.00 ? 179 ASP A CG   2  
ATOM 5742  O OD1  . ASP A 1 179 ? -16.555 10.491  -4.145  1.00 0.00 ? 179 ASP A OD1  2  
ATOM 5743  O OD2  . ASP A 1 179 ? -14.751 11.078  -5.198  1.00 0.00 ? 179 ASP A OD2  2  
ATOM 5744  H H    . ASP A 1 179 ? -14.018 11.550  -0.343  1.00 0.00 ? 179 ASP A H    2  
ATOM 5745  H HA   . ASP A 1 179 ? -16.349 10.441  -1.648  1.00 0.00 ? 179 ASP A HA   2  
ATOM 5746  H HB2  . ASP A 1 179 ? -14.799 12.234  -2.580  1.00 0.00 ? 179 ASP A HB2  2  
ATOM 5747  H HB3  . ASP A 1 179 ? -13.607 10.965  -2.870  1.00 0.00 ? 179 ASP A HB3  2  
ATOM 5748  N N    . ILE A 1 180 ? -13.710 8.533   -1.143  1.00 0.00 ? 180 ILE A N    2  
ATOM 5749  C CA   . ILE A 1 180 ? -13.269 7.158   -0.978  1.00 0.00 ? 180 ILE A CA   2  
ATOM 5750  C C    . ILE A 1 180 ? -14.200 6.426   -0.001  1.00 0.00 ? 180 ILE A C    2  
ATOM 5751  O O    . ILE A 1 180 ? -14.640 5.323   -0.337  1.00 0.00 ? 180 ILE A O    2  
ATOM 5752  C CB   . ILE A 1 180 ? -11.774 7.109   -0.580  1.00 0.00 ? 180 ILE A CB   2  
ATOM 5753  C CG1  . ILE A 1 180 ? -10.820 7.593   -1.670  1.00 0.00 ? 180 ILE A CG1  2  
ATOM 5754  C CG2  . ILE A 1 180 ? -11.338 5.710   -0.116  1.00 0.00 ? 180 ILE A CG2  2  
ATOM 5755  C CD1  . ILE A 1 180 ? -9.579  8.331   -1.179  1.00 0.00 ? 180 ILE A CD1  2  
ATOM 5756  H H    . ILE A 1 180 ? -13.118 9.277   -0.781  1.00 0.00 ? 180 ILE A H    2  
ATOM 5757  H HA   . ILE A 1 180 ? -13.377 6.675   -1.941  1.00 0.00 ? 180 ILE A HA   2  
ATOM 5758  H HB   . ILE A 1 180 ? -11.599 7.798   0.209   1.00 0.00 ? 180 ILE A HB   2  
ATOM 5759  H HG12 . ILE A 1 180 ? -10.453 6.706   -2.161  1.00 0.00 ? 180 ILE A HG12 2  
ATOM 5760  H HG13 . ILE A 1 180 ? -11.341 8.246   -2.369  1.00 0.00 ? 180 ILE A HG13 2  
ATOM 5761  H HG21 . ILE A 1 180 ? -11.870 5.410   0.787   1.00 0.00 ? 180 ILE A HG21 2  
ATOM 5762  H HG22 . ILE A 1 180 ? -11.529 4.970   -0.891  1.00 0.00 ? 180 ILE A HG22 2  
ATOM 5763  H HG23 . ILE A 1 180 ? -10.278 5.741   0.114   1.00 0.00 ? 180 ILE A HG23 2  
ATOM 5764  H HD11 . ILE A 1 180 ? -8.964  8.542   -2.045  1.00 0.00 ? 180 ILE A HD11 2  
ATOM 5765  H HD12 . ILE A 1 180 ? -9.835  9.266   -0.684  1.00 0.00 ? 180 ILE A HD12 2  
ATOM 5766  H HD13 . ILE A 1 180 ? -9.003  7.701   -0.512  1.00 0.00 ? 180 ILE A HD13 2  
ATOM 5767  N N    . VAL A 1 181 ? -14.544 7.023   1.155   1.00 0.00 ? 181 VAL A N    2  
ATOM 5768  C CA   . VAL A 1 181 ? -15.472 6.418   2.125   1.00 0.00 ? 181 VAL A CA   2  
ATOM 5769  C C    . VAL A 1 181 ? -16.747 5.987   1.386   1.00 0.00 ? 181 VAL A C    2  
ATOM 5770  O O    . VAL A 1 181 ? -17.199 4.851   1.545   1.00 0.00 ? 181 VAL A O    2  
ATOM 5771  C CB   . VAL A 1 181 ? -15.795 7.369   3.311   1.00 0.00 ? 181 VAL A CB   2  
ATOM 5772  C CG1  . VAL A 1 181 ? -16.786 6.733   4.302   1.00 0.00 ? 181 VAL A CG1  2  
ATOM 5773  C CG2  . VAL A 1 181 ? -14.571 7.800   4.141   1.00 0.00 ? 181 VAL A CG2  2  
ATOM 5774  H H    . VAL A 1 181 ? -14.192 7.957   1.333   1.00 0.00 ? 181 VAL A H    2  
ATOM 5775  H HA   . VAL A 1 181 ? -15.001 5.518   2.522   1.00 0.00 ? 181 VAL A HA   2  
ATOM 5776  H HB   . VAL A 1 181 ? -16.257 8.270   2.916   1.00 0.00 ? 181 VAL A HB   2  
ATOM 5777  H HG11 . VAL A 1 181 ? -16.978 7.413   5.134   1.00 0.00 ? 181 VAL A HG11 2  
ATOM 5778  H HG12 . VAL A 1 181 ? -17.742 6.536   3.814   1.00 0.00 ? 181 VAL A HG12 2  
ATOM 5779  H HG13 . VAL A 1 181 ? -16.390 5.796   4.692   1.00 0.00 ? 181 VAL A HG13 2  
ATOM 5780  H HG21 . VAL A 1 181 ? -14.864 8.575   4.848   1.00 0.00 ? 181 VAL A HG21 2  
ATOM 5781  H HG22 . VAL A 1 181 ? -14.170 6.959   4.698   1.00 0.00 ? 181 VAL A HG22 2  
ATOM 5782  H HG23 . VAL A 1 181 ? -13.785 8.209   3.520   1.00 0.00 ? 181 VAL A HG23 2  
ATOM 5783  N N    . THR A 1 182 ? -17.284 6.858   0.532   1.00 0.00 ? 182 THR A N    2  
ATOM 5784  C CA   . THR A 1 182 ? -18.486 6.595   -0.232  1.00 0.00 ? 182 THR A CA   2  
ATOM 5785  C C    . THR A 1 182 ? -18.337 5.358   -1.115  1.00 0.00 ? 182 THR A C    2  
ATOM 5786  O O    . THR A 1 182 ? -19.175 4.464   -1.019  1.00 0.00 ? 182 THR A O    2  
ATOM 5787  C CB   . THR A 1 182 ? -18.863 7.868   -0.999  1.00 0.00 ? 182 THR A CB   2  
ATOM 5788  O OG1  . THR A 1 182 ? -19.073 8.902   -0.062  1.00 0.00 ? 182 THR A OG1  2  
ATOM 5789  C CG2  . THR A 1 182 ? -20.126 7.716   -1.839  1.00 0.00 ? 182 THR A CG2  2  
ATOM 5790  H H    . THR A 1 182 ? -16.872 7.777   0.417   1.00 0.00 ? 182 THR A H    2  
ATOM 5791  H HA   . THR A 1 182 ? -19.282 6.373   0.475   1.00 0.00 ? 182 THR A HA   2  
ATOM 5792  H HB   . THR A 1 182 ? -18.041 8.159   -1.645  1.00 0.00 ? 182 THR A HB   2  
ATOM 5793  H HG1  . THR A 1 182 ? -19.712 8.548   0.590   1.00 0.00 ? 182 THR A HG1  2  
ATOM 5794  H HG21 . THR A 1 182 ? -20.385 8.681   -2.274  1.00 0.00 ? 182 THR A HG21 2  
ATOM 5795  H HG22 . THR A 1 182 ? -19.961 7.003   -2.647  1.00 0.00 ? 182 THR A HG22 2  
ATOM 5796  H HG23 . THR A 1 182 ? -20.949 7.361   -1.220  1.00 0.00 ? 182 THR A HG23 2  
ATOM 5797  N N    . CYS A 1 183 ? -17.282 5.234   -1.928  1.00 0.00 ? 183 CYS A N    2  
ATOM 5798  C CA   . CYS A 1 183 ? -17.117 4.094   -2.809  1.00 0.00 ? 183 CYS A CA   2  
ATOM 5799  C C    . CYS A 1 183 ? -17.046 2.772   -2.035  1.00 0.00 ? 183 CYS A C    2  
ATOM 5800  O O    . CYS A 1 183 ? -17.471 1.737   -2.556  1.00 0.00 ? 183 CYS A O    2  
ATOM 5801  C CB   . CYS A 1 183 ? -15.826 4.293   -3.594  1.00 0.00 ? 183 CYS A CB   2  
ATOM 5802  S SG   . CYS A 1 183 ? -16.134 5.052   -5.211  1.00 0.00 ? 183 CYS A SG   2  
ATOM 5803  H H    . CYS A 1 183 ? -16.510 5.886   -1.938  1.00 0.00 ? 183 CYS A H    2  
ATOM 5804  H HA   . CYS A 1 183 ? -17.966 4.040   -3.493  1.00 0.00 ? 183 CYS A HA   2  
ATOM 5805  H HB2  . CYS A 1 183 ? -15.108 4.883   -3.019  1.00 0.00 ? 183 CYS A HB2  2  
ATOM 5806  H HB3  . CYS A 1 183 ? -15.414 3.311   -3.743  1.00 0.00 ? 183 CYS A HB3  2  
ATOM 5807  H HG   . CYS A 1 183 ? -17.185 4.288   -5.558  1.00 0.00 ? 183 CYS A HG   2  
ATOM 5808  N N    . VAL A 1 184 ? -16.514 2.785   -0.811  1.00 0.00 ? 184 VAL A N    2  
ATOM 5809  C CA   . VAL A 1 184 ? -16.509 1.624   0.066   1.00 0.00 ? 184 VAL A CA   2  
ATOM 5810  C C    . VAL A 1 184 ? -17.952 1.339   0.501   1.00 0.00 ? 184 VAL A C    2  
ATOM 5811  O O    . VAL A 1 184 ? -18.481 0.261   0.197   1.00 0.00 ? 184 VAL A O    2  
ATOM 5812  C CB   . VAL A 1 184 ? -15.527 1.852   1.239   1.00 0.00 ? 184 VAL A CB   2  
ATOM 5813  C CG1  . VAL A 1 184 ? -15.516 0.676   2.229   1.00 0.00 ? 184 VAL A CG1  2  
ATOM 5814  C CG2  . VAL A 1 184 ? -14.095 2.046   0.716   1.00 0.00 ? 184 VAL A CG2  2  
ATOM 5815  H H    . VAL A 1 184 ? -16.167 3.663   -0.435  1.00 0.00 ? 184 VAL A H    2  
ATOM 5816  H HA   . VAL A 1 184 ? -16.156 0.764   -0.505  1.00 0.00 ? 184 VAL A HA   2  
ATOM 5817  H HB   . VAL A 1 184 ? -15.813 2.751   1.781   1.00 0.00 ? 184 VAL A HB   2  
ATOM 5818  H HG11 . VAL A 1 184 ? -14.783 0.857   3.015   1.00 0.00 ? 184 VAL A HG11 2  
ATOM 5819  H HG12 . VAL A 1 184 ? -16.494 0.565   2.698   1.00 0.00 ? 184 VAL A HG12 2  
ATOM 5820  H HG13 . VAL A 1 184 ? -15.263 -0.251  1.713   1.00 0.00 ? 184 VAL A HG13 2  
ATOM 5821  H HG21 . VAL A 1 184 ? -13.762 1.146   0.199   1.00 0.00 ? 184 VAL A HG21 2  
ATOM 5822  H HG22 . VAL A 1 184 ? -14.037 2.882   0.022   1.00 0.00 ? 184 VAL A HG22 2  
ATOM 5823  H HG23 . VAL A 1 184 ? -13.422 2.257   1.545   1.00 0.00 ? 184 VAL A HG23 2  
ATOM 5824  N N    . GLN A 1 185 ? -18.604 2.272   1.207   1.00 0.00 ? 185 GLN A N    2  
ATOM 5825  C CA   . GLN A 1 185 ? -19.899 1.991   1.820   1.00 0.00 ? 185 GLN A CA   2  
ATOM 5826  C C    . GLN A 1 185 ? -21.035 1.835   0.810   1.00 0.00 ? 185 GLN A C    2  
ATOM 5827  O O    . GLN A 1 185 ? -22.052 1.232   1.152   1.00 0.00 ? 185 GLN A O    2  
ATOM 5828  C CB   . GLN A 1 185 ? -20.262 3.003   2.913   1.00 0.00 ? 185 GLN A CB   2  
ATOM 5829  C CG   . GLN A 1 185 ? -20.629 4.430   2.480   1.00 0.00 ? 185 GLN A CG   2  
ATOM 5830  C CD   . GLN A 1 185 ? -21.411 5.120   3.600   1.00 0.00 ? 185 GLN A CD   2  
ATOM 5831  O OE1  . GLN A 1 185 ? -20.986 5.138   4.752   1.00 0.00 ? 185 GLN A OE1  2  
ATOM 5832  N NE2  . GLN A 1 185 ? -22.595 5.638   3.311   1.00 0.00 ? 185 GLN A NE2  2  
ATOM 5833  H H    . GLN A 1 185 ? -18.164 3.174   1.381   1.00 0.00 ? 185 GLN A H    2  
ATOM 5834  H HA   . GLN A 1 185 ? -19.801 1.026   2.322   1.00 0.00 ? 185 GLN A HA   2  
ATOM 5835  H HB2  . GLN A 1 185 ? -21.126 2.594   3.438   1.00 0.00 ? 185 GLN A HB2  2  
ATOM 5836  H HB3  . GLN A 1 185 ? -19.438 3.059   3.621   1.00 0.00 ? 185 GLN A HB3  2  
ATOM 5837  H HG2  . GLN A 1 185 ? -19.720 4.994   2.278   1.00 0.00 ? 185 GLN A HG2  2  
ATOM 5838  H HG3  . GLN A 1 185 ? -21.236 4.411   1.575   1.00 0.00 ? 185 GLN A HG3  2  
ATOM 5839  H HE21 . GLN A 1 185 ? -22.923 5.695   2.354   1.00 0.00 ? 185 GLN A HE21 2  
ATOM 5840  H HE22 . GLN A 1 185 ? -23.077 6.119   4.057   1.00 0.00 ? 185 GLN A HE22 2  
ATOM 5841  N N    . SER A 1 186 ? -20.881 2.308   -0.431  1.00 0.00 ? 186 SER A N    2  
ATOM 5842  C CA   . SER A 1 186 ? -21.912 2.169   -1.451  1.00 0.00 ? 186 SER A CA   2  
ATOM 5843  C C    . SER A 1 186 ? -22.226 0.695   -1.738  1.00 0.00 ? 186 SER A C    2  
ATOM 5844  O O    . SER A 1 186 ? -23.307 0.408   -2.222  1.00 0.00 ? 186 SER A O    2  
ATOM 5845  C CB   . SER A 1 186 ? -21.543 2.942   -2.732  1.00 0.00 ? 186 SER A CB   2  
ATOM 5846  O OG   . SER A 1 186 ? -22.706 3.439   -3.377  1.00 0.00 ? 186 SER A OG   2  
ATOM 5847  H H    . SER A 1 186 ? -20.071 2.880   -0.648  1.00 0.00 ? 186 SER A H    2  
ATOM 5848  H HA   . SER A 1 186 ? -22.813 2.620   -1.041  1.00 0.00 ? 186 SER A HA   2  
ATOM 5849  H HB2  . SER A 1 186 ? -20.921 3.800   -2.487  1.00 0.00 ? 186 SER A HB2  2  
ATOM 5850  H HB3  . SER A 1 186 ? -20.964 2.310   -3.407  1.00 0.00 ? 186 SER A HB3  2  
ATOM 5851  H HG   . SER A 1 186 ? -23.299 2.693   -3.614  1.00 0.00 ? 186 SER A HG   2  
ATOM 5852  N N    . SER A 1 187 ? -21.359 -0.268  -1.393  1.00 0.00 ? 187 SER A N    2  
ATOM 5853  C CA   . SER A 1 187 ? -21.728 -1.671  -1.578  1.00 0.00 ? 187 SER A CA   2  
ATOM 5854  C C    . SER A 1 187 ? -22.819 -2.117  -0.583  1.00 0.00 ? 187 SER A C    2  
ATOM 5855  O O    . SER A 1 187 ? -23.457 -3.147  -0.806  1.00 0.00 ? 187 SER A O    2  
ATOM 5856  C CB   . SER A 1 187 ? -20.466 -2.536  -1.570  1.00 0.00 ? 187 SER A CB   2  
ATOM 5857  O OG   . SER A 1 187 ? -20.736 -3.874  -1.958  1.00 0.00 ? 187 SER A OG   2  
ATOM 5858  H H    . SER A 1 187 ? -20.485 -0.020  -0.949  1.00 0.00 ? 187 SER A H    2  
ATOM 5859  H HA   . SER A 1 187 ? -22.172 -1.759  -2.567  1.00 0.00 ? 187 SER A HA   2  
ATOM 5860  H HB2  . SER A 1 187 ? -19.751 -2.116  -2.275  1.00 0.00 ? 187 SER A HB2  2  
ATOM 5861  H HB3  . SER A 1 187 ? -20.021 -2.509  -0.579  1.00 0.00 ? 187 SER A HB3  2  
ATOM 5862  H HG   . SER A 1 187 ? -20.098 -4.163  -2.643  1.00 0.00 ? 187 SER A HG   2  
ATOM 5863  N N    . ARG A 1 188 ? -23.079 -1.341  0.477   1.00 0.00 ? 188 ARG A N    2  
ATOM 5864  C CA   . ARG A 1 188 ? -24.248 -1.502  1.337   1.00 0.00 ? 188 ARG A CA   2  
ATOM 5865  C C    . ARG A 1 188 ? -25.427 -0.731  0.756   1.00 0.00 ? 188 ARG A C    2  
ATOM 5866  O O    . ARG A 1 188 ? -26.528 -1.270  0.733   1.00 0.00 ? 188 ARG A O    2  
ATOM 5867  C CB   . ARG A 1 188 ? -23.971 -1.013  2.771   1.00 0.00 ? 188 ARG A CB   2  
ATOM 5868  C CG   . ARG A 1 188 ? -22.712 -1.631  3.394   1.00 0.00 ? 188 ARG A CG   2  
ATOM 5869  C CD   . ARG A 1 188 ? -22.450 -1.077  4.801   1.00 0.00 ? 188 ARG A CD   2  
ATOM 5870  N NE   . ARG A 1 188 ? -21.002 -1.051  5.074   1.00 0.00 ? 188 ARG A NE   2  
ATOM 5871  C CZ   . ARG A 1 188 ? -20.279 0.033   5.375   1.00 0.00 ? 188 ARG A CZ   2  
ATOM 5872  N NH1  . ARG A 1 188 ? -20.848 1.181   5.727   1.00 0.00 ? 188 ARG A NH1  2  
ATOM 5873  N NH2  . ARG A 1 188 ? -18.956 0.001   5.307   1.00 0.00 ? 188 ARG A NH2  2  
ATOM 5874  H H    . ARG A 1 188 ? -22.549 -0.485  0.584   1.00 0.00 ? 188 ARG A H    2  
ATOM 5875  H HA   . ARG A 1 188 ? -24.529 -2.555  1.365   1.00 0.00 ? 188 ARG A HA   2  
ATOM 5876  H HB2  . ARG A 1 188 ? -23.859 0.072   2.764   1.00 0.00 ? 188 ARG A HB2  2  
ATOM 5877  H HB3  . ARG A 1 188 ? -24.832 -1.259  3.396   1.00 0.00 ? 188 ARG A HB3  2  
ATOM 5878  H HG2  . ARG A 1 188 ? -22.821 -2.716  3.442   1.00 0.00 ? 188 ARG A HG2  2  
ATOM 5879  H HG3  . ARG A 1 188 ? -21.853 -1.393  2.764   1.00 0.00 ? 188 ARG A HG3  2  
ATOM 5880  H HD2  . ARG A 1 188 ? -22.853 -0.067  4.863   1.00 0.00 ? 188 ARG A HD2  2  
ATOM 5881  H HD3  . ARG A 1 188 ? -22.960 -1.696  5.539   1.00 0.00 ? 188 ARG A HD3  2  
ATOM 5882  H HE   . ARG A 1 188 ? -20.526 -1.937  4.890   1.00 0.00 ? 188 ARG A HE   2  
ATOM 5883  H HH11 . ARG A 1 188 ? -21.831 1.259   5.980   1.00 0.00 ? 188 ARG A HH11 2  
ATOM 5884  H HH12 . ARG A 1 188 ? -20.263 1.995   5.916   1.00 0.00 ? 188 ARG A HH12 2  
ATOM 5885  H HH21 . ARG A 1 188 ? -18.426 -0.835  5.044   1.00 0.00 ? 188 ARG A HH21 2  
ATOM 5886  H HH22 . ARG A 1 188 ? -18.430 0.834   5.556   1.00 0.00 ? 188 ARG A HH22 2  
ATOM 5887  N N    . LYS A 1 189 ? -25.216 0.539   0.385   1.00 0.00 ? 189 LYS A N    2  
ATOM 5888  C CA   . LYS A 1 189 ? -26.265 1.446   -0.081  1.00 0.00 ? 189 LYS A CA   2  
ATOM 5889  C C    . LYS A 1 189 ? -26.956 0.857   -1.297  1.00 0.00 ? 189 LYS A C    2  
ATOM 5890  O O    . LYS A 1 189 ? -28.200 0.746   -1.251  1.00 0.00 ? 189 LYS A O    2  
ATOM 5891  C CB   . LYS A 1 189 ? -25.699 2.842   -0.403  1.00 0.00 ? 189 LYS A CB   2  
ATOM 5892  C CG   . LYS A 1 189 ? -24.899 3.544   0.712   1.00 0.00 ? 189 LYS A CG   2  
ATOM 5893  C CD   . LYS A 1 189 ? -25.718 3.992   1.933   1.00 0.00 ? 189 LYS A CD   2  
ATOM 5894  C CE   . LYS A 1 189 ? -26.010 2.853   2.918   1.00 0.00 ? 189 LYS A CE   2  
ATOM 5895  N NZ   . LYS A 1 189 ? -26.689 3.334   4.138   1.00 0.00 ? 189 LYS A NZ   2  
ATOM 5896  H H    . LYS A 1 189 ? -24.269 0.887   0.396   1.00 0.00 ? 189 LYS A H    2  
ATOM 5897  H HA   . LYS A 1 189 ? -27.028 1.537   0.687   1.00 0.00 ? 189 LYS A HA   2  
ATOM 5898  H HB2  . LYS A 1 189 ? -25.051 2.749   -1.276  1.00 0.00 ? 189 LYS A HB2  2  
ATOM 5899  H HB3  . LYS A 1 189 ? -26.528 3.488   -0.698  1.00 0.00 ? 189 LYS A HB3  2  
ATOM 5900  H HG2  . LYS A 1 189 ? -24.073 2.915   1.040   1.00 0.00 ? 189 LYS A HG2  2  
ATOM 5901  H HG3  . LYS A 1 189 ? -24.465 4.440   0.267   1.00 0.00 ? 189 LYS A HG3  2  
ATOM 5902  H HD2  . LYS A 1 189 ? -25.155 4.765   2.456   1.00 0.00 ? 189 LYS A HD2  2  
ATOM 5903  H HD3  . LYS A 1 189 ? -26.654 4.427   1.587   1.00 0.00 ? 189 LYS A HD3  2  
ATOM 5904  H HE2  . LYS A 1 189 ? -26.656 2.125   2.432   1.00 0.00 ? 189 LYS A HE2  2  
ATOM 5905  H HE3  . LYS A 1 189 ? -25.077 2.362   3.197   1.00 0.00 ? 189 LYS A HE3  2  
ATOM 5906  H HZ1  . LYS A 1 189 ? -26.994 2.541   4.695   1.00 0.00 ? 189 LYS A HZ1  2  
ATOM 5907  H HZ2  . LYS A 1 189 ? -26.079 3.925   4.697   1.00 0.00 ? 189 LYS A HZ2  2  
ATOM 5908  H HZ3  . LYS A 1 189 ? -27.515 3.876   3.895   1.00 0.00 ? 189 LYS A HZ3  2  
ATOM 5909  N N    . ALA A 1 1   ? -19.655 -0.047  -4.795  1.00 0.00 ? 1   ALA A N    3  
ATOM 5910  C CA   . ALA A 1 1   ? -18.563 -0.592  -3.968  1.00 0.00 ? 1   ALA A CA   3  
ATOM 5911  C C    . ALA A 1 1   ? -17.713 -1.599  -4.745  1.00 0.00 ? 1   ALA A C    3  
ATOM 5912  O O    . ALA A 1 1   ? -18.253 -2.499  -5.381  1.00 0.00 ? 1   ALA A O    3  
ATOM 5913  C CB   . ALA A 1 1   ? -19.144 -1.203  -2.688  1.00 0.00 ? 1   ALA A CB   3  
ATOM 5914  H H1   . ALA A 1 1   ? -19.360 0.425   -5.626  1.00 0.00 ? 1   ALA A H1   3  
ATOM 5915  H HA   . ALA A 1 1   ? -17.910 0.231   -3.686  1.00 0.00 ? 1   ALA A HA   3  
ATOM 5916  H HB1  . ALA A 1 1   ? -19.730 -0.456  -2.153  1.00 0.00 ? 1   ALA A HB1  3  
ATOM 5917  H HB2  . ALA A 1 1   ? -19.788 -2.045  -2.928  1.00 0.00 ? 1   ALA A HB2  3  
ATOM 5918  H HB3  . ALA A 1 1   ? -18.342 -1.548  -2.042  1.00 0.00 ? 1   ALA A HB3  3  
ATOM 5919  N N    . ARG A 1 2   ? -16.384 -1.435  -4.748  1.00 0.00 ? 2   ARG A N    3  
ATOM 5920  C CA   . ARG A 1 2   ? -15.359 -2.442  -5.079  1.00 0.00 ? 2   ARG A CA   3  
ATOM 5921  C C    . ARG A 1 2   ? -14.020 -1.923  -4.539  1.00 0.00 ? 2   ARG A C    3  
ATOM 5922  O O    . ARG A 1 2   ? -14.017 -1.002  -3.724  1.00 0.00 ? 2   ARG A O    3  
ATOM 5923  C CB   . ARG A 1 2   ? -15.300 -2.828  -6.577  1.00 0.00 ? 2   ARG A CB   3  
ATOM 5924  C CG   . ARG A 1 2   ? -15.182 -1.668  -7.576  1.00 0.00 ? 2   ARG A CG   3  
ATOM 5925  C CD   . ARG A 1 2   ? -16.554 -1.440  -8.219  1.00 0.00 ? 2   ARG A CD   3  
ATOM 5926  N NE   . ARG A 1 2   ? -16.662 -0.137  -8.883  1.00 0.00 ? 2   ARG A NE   3  
ATOM 5927  C CZ   . ARG A 1 2   ? -17.675 0.726   -8.741  1.00 0.00 ? 2   ARG A CZ   3  
ATOM 5928  N NH1  . ARG A 1 2   ? -18.776 0.400   -8.066  1.00 0.00 ? 2   ARG A NH1  3  
ATOM 5929  N NH2  . ARG A 1 2   ? -17.592 1.929   -9.283  1.00 0.00 ? 2   ARG A NH2  3  
ATOM 5930  H H    . ARG A 1 2   ? -16.000 -0.682  -4.183  1.00 0.00 ? 2   ARG A H    3  
ATOM 5931  H HA   . ARG A 1 2   ? -15.589 -3.354  -4.531  1.00 0.00 ? 2   ARG A HA   3  
ATOM 5932  H HB2  . ARG A 1 2   ? -14.459 -3.502  -6.739  1.00 0.00 ? 2   ARG A HB2  3  
ATOM 5933  H HB3  . ARG A 1 2   ? -16.177 -3.425  -6.820  1.00 0.00 ? 2   ARG A HB3  3  
ATOM 5934  H HG2  . ARG A 1 2   ? -14.810 -0.770  -7.090  1.00 0.00 ? 2   ARG A HG2  3  
ATOM 5935  H HG3  . ARG A 1 2   ? -14.464 -1.936  -8.346  1.00 0.00 ? 2   ARG A HG3  3  
ATOM 5936  H HD2  . ARG A 1 2   ? -16.741 -2.234  -8.938  1.00 0.00 ? 2   ARG A HD2  3  
ATOM 5937  H HD3  . ARG A 1 2   ? -17.310 -1.511  -7.445  1.00 0.00 ? 2   ARG A HD3  3  
ATOM 5938  H HE   . ARG A 1 2   ? -15.913 0.071   -9.537  1.00 0.00 ? 2   ARG A HE   3  
ATOM 5939  H HH11 . ARG A 1 2   ? -19.005 -0.588  -7.920  1.00 0.00 ? 2   ARG A HH11 3  
ATOM 5940  H HH12 . ARG A 1 2   ? -19.569 1.046   -7.989  1.00 0.00 ? 2   ARG A HH12 3  
ATOM 5941  H HH21 . ARG A 1 2   ? -16.837 2.188   -9.914  1.00 0.00 ? 2   ARG A HH21 3  
ATOM 5942  H HH22 . ARG A 1 2   ? -18.406 2.536   -9.303  1.00 0.00 ? 2   ARG A HH22 3  
ATOM 5943  N N    . HIS A 1 3   ? -12.905 -2.516  -4.958  1.00 0.00 ? 3   HIS A N    3  
ATOM 5944  C CA   . HIS A 1 3   ? -11.540 -2.073  -4.704  1.00 0.00 ? 3   HIS A CA   3  
ATOM 5945  C C    . HIS A 1 3   ? -11.406 -0.562  -4.965  1.00 0.00 ? 3   HIS A C    3  
ATOM 5946  O O    . HIS A 1 3   ? -11.873 -0.088  -6.009  1.00 0.00 ? 3   HIS A O    3  
ATOM 5947  C CB   . HIS A 1 3   ? -10.607 -2.854  -5.640  1.00 0.00 ? 3   HIS A CB   3  
ATOM 5948  C CG   . HIS A 1 3   ? -10.870 -4.343  -5.758  1.00 0.00 ? 3   HIS A CG   3  
ATOM 5949  N ND1  . HIS A 1 3   ? -10.509 -5.338  -4.869  1.00 0.00 ? 3   HIS A ND1  3  
ATOM 5950  C CD2  . HIS A 1 3   ? -11.520 -4.946  -6.802  1.00 0.00 ? 3   HIS A CD2  3  
ATOM 5951  C CE1  . HIS A 1 3   ? -10.922 -6.515  -5.377  1.00 0.00 ? 3   HIS A CE1  3  
ATOM 5952  N NE2  . HIS A 1 3   ? -11.540 -6.324  -6.557  1.00 0.00 ? 3   HIS A NE2  3  
ATOM 5953  H H    . HIS A 1 3   ? -13.020 -3.363  -5.489  1.00 0.00 ? 3   HIS A H    3  
ATOM 5954  H HA   . HIS A 1 3   ? -11.263 -2.300  -3.682  1.00 0.00 ? 3   HIS A HA   3  
ATOM 5955  H HB2  . HIS A 1 3   ? -10.738 -2.431  -6.635  1.00 0.00 ? 3   HIS A HB2  3  
ATOM 5956  H HB3  . HIS A 1 3   ? -9.573  -2.680  -5.339  1.00 0.00 ? 3   HIS A HB3  3  
ATOM 5957  H HD1  . HIS A 1 3   ? -10.026 -5.227  -3.990  1.00 0.00 ? 3   HIS A HD1  3  
ATOM 5958  H HD2  . HIS A 1 3   ? -11.933 -4.446  -7.671  1.00 0.00 ? 3   HIS A HD2  3  
ATOM 5959  H HE1  . HIS A 1 3   ? -10.777 -7.482  -4.904  1.00 0.00 ? 3   HIS A HE1  3  
ATOM 5960  N N    . VAL A 1 4   ? -10.696 0.185   -4.113  1.00 0.00 ? 4   VAL A N    3  
ATOM 5961  C CA   . VAL A 1 4   ? -10.388 1.604   -4.328  1.00 0.00 ? 4   VAL A CA   3  
ATOM 5962  C C    . VAL A 1 4   ? -8.872  1.823   -4.217  1.00 0.00 ? 4   VAL A C    3  
ATOM 5963  O O    . VAL A 1 4   ? -8.177  1.171   -3.436  1.00 0.00 ? 4   VAL A O    3  
ATOM 5964  C CB   . VAL A 1 4   ? -11.232 2.526   -3.423  1.00 0.00 ? 4   VAL A CB   3  
ATOM 5965  C CG1  . VAL A 1 4   ? -11.005 3.999   -3.789  1.00 0.00 ? 4   VAL A CG1  3  
ATOM 5966  C CG2  . VAL A 1 4   ? -12.740 2.242   -3.536  1.00 0.00 ? 4   VAL A CG2  3  
ATOM 5967  H H    . VAL A 1 4   ? -10.254 -0.248  -3.304  1.00 0.00 ? 4   VAL A H    3  
ATOM 5968  H HA   . VAL A 1 4   ? -10.662 1.871   -5.343  1.00 0.00 ? 4   VAL A HA   3  
ATOM 5969  H HB   . VAL A 1 4   ? -10.943 2.382   -2.389  1.00 0.00 ? 4   VAL A HB   3  
ATOM 5970  H HG11 . VAL A 1 4   ? -11.196 4.185   -4.849  1.00 0.00 ? 4   VAL A HG11 3  
ATOM 5971  H HG12 . VAL A 1 4   ? -11.662 4.620   -3.189  1.00 0.00 ? 4   VAL A HG12 3  
ATOM 5972  H HG13 . VAL A 1 4   ? -9.984  4.288   -3.546  1.00 0.00 ? 4   VAL A HG13 3  
ATOM 5973  H HG21 . VAL A 1 4   ? -13.064 2.298   -4.576  1.00 0.00 ? 4   VAL A HG21 3  
ATOM 5974  H HG22 . VAL A 1 4   ? -12.955 1.251   -3.141  1.00 0.00 ? 4   VAL A HG22 3  
ATOM 5975  H HG23 . VAL A 1 4   ? -13.306 2.958   -2.941  1.00 0.00 ? 4   VAL A HG23 3  
ATOM 5976  N N    . PHE A 1 5   ? -8.364  2.723   -5.059  1.00 0.00 ? 5   PHE A N    3  
ATOM 5977  C CA   . PHE A 1 5   ? -6.967  3.095   -5.166  1.00 0.00 ? 5   PHE A CA   3  
ATOM 5978  C C    . PHE A 1 5   ? -6.880  4.601   -5.411  1.00 0.00 ? 5   PHE A C    3  
ATOM 5979  O O    . PHE A 1 5   ? -7.716  5.135   -6.138  1.00 0.00 ? 5   PHE A O    3  
ATOM 5980  C CB   . PHE A 1 5   ? -6.349  2.324   -6.341  1.00 0.00 ? 5   PHE A CB   3  
ATOM 5981  C CG   . PHE A 1 5   ? -5.725  1.009   -5.963  1.00 0.00 ? 5   PHE A CG   3  
ATOM 5982  C CD1  . PHE A 1 5   ? -4.468  1.021   -5.340  1.00 0.00 ? 5   PHE A CD1  3  
ATOM 5983  C CD2  . PHE A 1 5   ? -6.348  -0.210  -6.281  1.00 0.00 ? 5   PHE A CD2  3  
ATOM 5984  C CE1  . PHE A 1 5   ? -3.811  -0.187  -5.076  1.00 0.00 ? 5   PHE A CE1  3  
ATOM 5985  C CE2  . PHE A 1 5   ? -5.692  -1.421  -6.007  1.00 0.00 ? 5   PHE A CE2  3  
ATOM 5986  C CZ   . PHE A 1 5   ? -4.405  -1.405  -5.437  1.00 0.00 ? 5   PHE A CZ   3  
ATOM 5987  H H    . PHE A 1 5   ? -8.975  3.162   -5.740  1.00 0.00 ? 5   PHE A H    3  
ATOM 5988  H HA   . PHE A 1 5   ? -6.459  2.828   -4.248  1.00 0.00 ? 5   PHE A HA   3  
ATOM 5989  H HB2  . PHE A 1 5   ? -7.096  2.167   -7.117  1.00 0.00 ? 5   PHE A HB2  3  
ATOM 5990  H HB3  . PHE A 1 5   ? -5.553  2.911   -6.789  1.00 0.00 ? 5   PHE A HB3  3  
ATOM 5991  H HD1  . PHE A 1 5   ? -3.995  1.960   -5.095  1.00 0.00 ? 5   PHE A HD1  3  
ATOM 5992  H HD2  . PHE A 1 5   ? -7.313  -0.213  -6.765  1.00 0.00 ? 5   PHE A HD2  3  
ATOM 5993  H HE1  . PHE A 1 5   ? -2.840  -0.169  -4.615  1.00 0.00 ? 5   PHE A HE1  3  
ATOM 5994  H HE2  . PHE A 1 5   ? -6.156  -2.358  -6.276  1.00 0.00 ? 5   PHE A HE2  3  
ATOM 5995  H HZ   . PHE A 1 5   ? -3.849  -2.322  -5.308  1.00 0.00 ? 5   PHE A HZ   3  
ATOM 5996  N N    . LEU A 1 6   ? -5.850  5.293   -4.915  1.00 0.00 ? 6   LEU A N    3  
ATOM 5997  C CA   . LEU A 1 6   ? -5.604  6.708   -5.200  1.00 0.00 ? 6   LEU A CA   3  
ATOM 5998  C C    . LEU A 1 6   ? -4.464  6.881   -6.182  1.00 0.00 ? 6   LEU A C    3  
ATOM 5999  O O    . LEU A 1 6   ? -3.629  5.985   -6.319  1.00 0.00 ? 6   LEU A O    3  
ATOM 6000  C CB   . LEU A 1 6   ? -5.275  7.498   -3.929  1.00 0.00 ? 6   LEU A CB   3  
ATOM 6001  C CG   . LEU A 1 6   ? -6.353  7.529   -2.848  1.00 0.00 ? 6   LEU A CG   3  
ATOM 6002  C CD1  . LEU A 1 6   ? -7.766  7.639   -3.391  1.00 0.00 ? 6   LEU A CD1  3  
ATOM 6003  C CD2  . LEU A 1 6   ? -6.311  6.340   -1.909  1.00 0.00 ? 6   LEU A CD2  3  
ATOM 6004  H H    . LEU A 1 6   ? -5.249  4.852   -4.231  1.00 0.00 ? 6   LEU A H    3  
ATOM 6005  H HA   . LEU A 1 6   ? -6.492  7.136   -5.656  1.00 0.00 ? 6   LEU A HA   3  
ATOM 6006  H HB2  . LEU A 1 6   ? -4.357  7.120   -3.489  1.00 0.00 ? 6   LEU A HB2  3  
ATOM 6007  H HB3  . LEU A 1 6   ? -5.090  8.532   -4.223  1.00 0.00 ? 6   LEU A HB3  3  
ATOM 6008  H HG   . LEU A 1 6   ? -6.163  8.402   -2.251  1.00 0.00 ? 6   LEU A HG   3  
ATOM 6009  H HD11 . LEU A 1 6   ? -8.015  6.773   -3.998  1.00 0.00 ? 6   LEU A HD11 3  
ATOM 6010  H HD12 . LEU A 1 6   ? -8.452  7.642   -2.560  1.00 0.00 ? 6   LEU A HD12 3  
ATOM 6011  H HD13 . LEU A 1 6   ? -7.858  8.554   -3.972  1.00 0.00 ? 6   LEU A HD13 3  
ATOM 6012  H HD21 . LEU A 1 6   ? -6.694  5.467   -2.422  1.00 0.00 ? 6   LEU A HD21 3  
ATOM 6013  H HD22 . LEU A 1 6   ? -5.291  6.145   -1.586  1.00 0.00 ? 6   LEU A HD22 3  
ATOM 6014  H HD23 . LEU A 1 6   ? -6.926  6.541   -1.035  1.00 0.00 ? 6   LEU A HD23 3  
ATOM 6015  N N    . THR A 1 7   ? -4.441  8.020   -6.866  1.00 0.00 ? 7   THR A N    3  
ATOM 6016  C CA   . THR A 1 7   ? -3.412  8.383   -7.819  1.00 0.00 ? 7   THR A CA   3  
ATOM 6017  C C    . THR A 1 7   ? -3.254  9.909   -7.830  1.00 0.00 ? 7   THR A C    3  
ATOM 6018  O O    . THR A 1 7   ? -4.011  10.618  -7.162  1.00 0.00 ? 7   THR A O    3  
ATOM 6019  C CB   . THR A 1 7   ? -3.771  7.768   -9.187  1.00 0.00 ? 7   THR A CB   3  
ATOM 6020  O OG1  . THR A 1 7   ? -2.633  7.781   -10.016 1.00 0.00 ? 7   THR A OG1  3  
ATOM 6021  C CG2  . THR A 1 7   ? -4.941  8.447   -9.913  1.00 0.00 ? 7   THR A CG2  3  
ATOM 6022  H H    . THR A 1 7   ? -5.163  8.718   -6.703  1.00 0.00 ? 7   THR A H    3  
ATOM 6023  H HA   . THR A 1 7   ? -2.477  7.943   -7.478  1.00 0.00 ? 7   THR A HA   3  
ATOM 6024  H HB   . THR A 1 7   ? -4.048  6.727   -9.036  1.00 0.00 ? 7   THR A HB   3  
ATOM 6025  H HG1  . THR A 1 7   ? -2.434  6.847   -10.244 1.00 0.00 ? 7   THR A HG1  3  
ATOM 6026  H HG21 . THR A 1 7   ? -5.173  7.903   -10.829 1.00 0.00 ? 7   THR A HG21 3  
ATOM 6027  H HG22 . THR A 1 7   ? -5.824  8.429   -9.276  1.00 0.00 ? 7   THR A HG22 3  
ATOM 6028  H HG23 . THR A 1 7   ? -4.700  9.480   -10.164 1.00 0.00 ? 7   THR A HG23 3  
ATOM 6029  N N    . GLY A 1 8   ? -2.301  10.415  -8.617  1.00 0.00 ? 8   GLY A N    3  
ATOM 6030  C CA   . GLY A 1 8   ? -2.100  11.836  -8.886  1.00 0.00 ? 8   GLY A CA   3  
ATOM 6031  C C    . GLY A 1 8   ? -0.630  12.261  -8.759  1.00 0.00 ? 8   GLY A C    3  
ATOM 6032  O O    . GLY A 1 8   ? 0.248   11.410  -8.547  1.00 0.00 ? 8   GLY A O    3  
ATOM 6033  H H    . GLY A 1 8   ? -1.773  9.752   -9.170  1.00 0.00 ? 8   GLY A H    3  
ATOM 6034  H HA2  . GLY A 1 8   ? -2.437  12.047  -9.901  1.00 0.00 ? 8   GLY A HA2  3  
ATOM 6035  H HA3  . GLY A 1 8   ? -2.708  12.425  -8.202  1.00 0.00 ? 8   GLY A HA3  3  
ATOM 6036  N N    . PRO A 1 9   ? -0.330  13.564  -8.912  1.00 0.00 ? 9   PRO A N    3  
ATOM 6037  C CA   . PRO A 1 9   ? 1.009   14.133  -8.737  1.00 0.00 ? 9   PRO A CA   3  
ATOM 6038  C C    . PRO A 1 9   ? 1.424   14.104  -7.257  1.00 0.00 ? 9   PRO A C    3  
ATOM 6039  O O    . PRO A 1 9   ? 0.559   13.902  -6.401  1.00 0.00 ? 9   PRO A O    3  
ATOM 6040  C CB   . PRO A 1 9   ? 0.886   15.574  -9.248  1.00 0.00 ? 9   PRO A CB   3  
ATOM 6041  C CG   . PRO A 1 9   ? -0.559  15.938  -8.919  1.00 0.00 ? 9   PRO A CG   3  
ATOM 6042  C CD   . PRO A 1 9   ? -1.287  14.624  -9.195  1.00 0.00 ? 9   PRO A CD   3  
ATOM 6043  H HA   . PRO A 1 9   ? 1.737   13.589  -9.339  1.00 0.00 ? 9   PRO A HA   3  
ATOM 6044  H HB2  . PRO A 1 9   ? 1.587   16.258  -8.769  1.00 0.00 ? 9   PRO A HB2  3  
ATOM 6045  H HB3  . PRO A 1 9   ? 1.022   15.580  -10.330 1.00 0.00 ? 9   PRO A HB3  3  
ATOM 6046  H HG2  . PRO A 1 9   ? -0.647  16.196  -7.863  1.00 0.00 ? 9   PRO A HG2  3  
ATOM 6047  H HG3  . PRO A 1 9   ? -0.931  16.751  -9.542  1.00 0.00 ? 9   PRO A HG3  3  
ATOM 6048  H HD2  . PRO A 1 9   ? -2.176  14.556  -8.568  1.00 0.00 ? 9   PRO A HD2  3  
ATOM 6049  H HD3  . PRO A 1 9   ? -1.554  14.571  -10.249 1.00 0.00 ? 9   PRO A HD3  3  
ATOM 6050  N N    . PRO A 1 10  ? 2.712   14.316  -6.926  1.00 0.00 ? 10  PRO A N    3  
ATOM 6051  C CA   . PRO A 1 10  ? 3.171   14.326  -5.547  1.00 0.00 ? 10  PRO A CA   3  
ATOM 6052  C C    . PRO A 1 10  ? 2.685   15.584  -4.813  1.00 0.00 ? 10  PRO A C    3  
ATOM 6053  O O    . PRO A 1 10  ? 3.327   16.639  -4.859  1.00 0.00 ? 10  PRO A O    3  
ATOM 6054  C CB   . PRO A 1 10  ? 4.695   14.192  -5.608  1.00 0.00 ? 10  PRO A CB   3  
ATOM 6055  C CG   . PRO A 1 10  ? 5.043   14.835  -6.948  1.00 0.00 ? 10  PRO A CG   3  
ATOM 6056  C CD   . PRO A 1 10  ? 3.840   14.492  -7.831  1.00 0.00 ? 10  PRO A CD   3  
ATOM 6057  H HA   . PRO A 1 10  ? 2.764   13.453  -5.047  1.00 0.00 ? 10  PRO A HA   3  
ATOM 6058  H HB2  . PRO A 1 10  ? 5.192   14.690  -4.774  1.00 0.00 ? 10  PRO A HB2  3  
ATOM 6059  H HB3  . PRO A 1 10  ? 4.963   13.135  -5.629  1.00 0.00 ? 10  PRO A HB3  3  
ATOM 6060  H HG2  . PRO A 1 10  ? 5.108   15.914  -6.818  1.00 0.00 ? 10  PRO A HG2  3  
ATOM 6061  H HG3  . PRO A 1 10  ? 5.975   14.446  -7.360  1.00 0.00 ? 10  PRO A HG3  3  
ATOM 6062  H HD2  . PRO A 1 10  ? 3.663   15.299  -8.542  1.00 0.00 ? 10  PRO A HD2  3  
ATOM 6063  H HD3  . PRO A 1 10  ? 4.029   13.557  -8.359  1.00 0.00 ? 10  PRO A HD3  3  
ATOM 6064  N N    . GLY A 1 11  ? 1.547   15.471  -4.128  1.00 0.00 ? 11  GLY A N    3  
ATOM 6065  C CA   . GLY A 1 11  ? 1.006   16.530  -3.296  1.00 0.00 ? 11  GLY A CA   3  
ATOM 6066  C C    . GLY A 1 11  ? 1.621   16.518  -1.914  1.00 0.00 ? 11  GLY A C    3  
ATOM 6067  O O    . GLY A 1 11  ? 1.845   17.587  -1.356  1.00 0.00 ? 11  GLY A O    3  
ATOM 6068  H H    . GLY A 1 11  ? 1.059   14.583  -4.100  1.00 0.00 ? 11  GLY A H    3  
ATOM 6069  H HA2  . GLY A 1 11  ? 1.155   17.498  -3.773  1.00 0.00 ? 11  GLY A HA2  3  
ATOM 6070  H HA3  . GLY A 1 11  ? -0.054  16.358  -3.135  1.00 0.00 ? 11  GLY A HA3  3  
ATOM 6071  N N    . VAL A 1 12  ? 1.913   15.313  -1.416  1.00 0.00 ? 12  VAL A N    3  
ATOM 6072  C CA   . VAL A 1 12  ? 1.998   14.916  -0.027  1.00 0.00 ? 12  VAL A CA   3  
ATOM 6073  C C    . VAL A 1 12  ? 0.659   15.154  0.669   1.00 0.00 ? 12  VAL A C    3  
ATOM 6074  O O    . VAL A 1 12  ? 0.241   16.285  0.918   1.00 0.00 ? 12  VAL A O    3  
ATOM 6075  C CB   . VAL A 1 12  ? 3.222   15.553  0.636   1.00 0.00 ? 12  VAL A CB   3  
ATOM 6076  C CG1  . VAL A 1 12  ? 3.182   15.394  2.156   1.00 0.00 ? 12  VAL A CG1  3  
ATOM 6077  C CG2  . VAL A 1 12  ? 4.489   14.902  0.075   1.00 0.00 ? 12  VAL A CG2  3  
ATOM 6078  H H    . VAL A 1 12  ? 1.881   14.527  -2.044  1.00 0.00 ? 12  VAL A H    3  
ATOM 6079  H HA   . VAL A 1 12  ? 2.171   13.839  -0.024  1.00 0.00 ? 12  VAL A HA   3  
ATOM 6080  H HB   . VAL A 1 12  ? 3.251   16.606  0.392   1.00 0.00 ? 12  VAL A HB   3  
ATOM 6081  H HG11 . VAL A 1 12  ? 2.339   15.962  2.548   1.00 0.00 ? 12  VAL A HG11 3  
ATOM 6082  H HG12 . VAL A 1 12  ? 3.074   14.343  2.417   1.00 0.00 ? 12  VAL A HG12 3  
ATOM 6083  H HG13 . VAL A 1 12  ? 4.095   15.795  2.591   1.00 0.00 ? 12  VAL A HG13 3  
ATOM 6084  H HG21 . VAL A 1 12  ? 4.538   15.054  -1.003  1.00 0.00 ? 12  VAL A HG21 3  
ATOM 6085  H HG22 . VAL A 1 12  ? 5.350   15.380  0.531   1.00 0.00 ? 12  VAL A HG22 3  
ATOM 6086  H HG23 . VAL A 1 12  ? 4.494   13.832  0.292   1.00 0.00 ? 12  VAL A HG23 3  
ATOM 6087  N N    . GLY A 1 13  ? -0.021  14.057  1.001   1.00 0.00 ? 13  GLY A N    3  
ATOM 6088  C CA   . GLY A 1 13  ? -1.206  14.101  1.845   1.00 0.00 ? 13  GLY A CA   3  
ATOM 6089  C C    . GLY A 1 13  ? -2.066  12.847  1.764   1.00 0.00 ? 13  GLY A C    3  
ATOM 6090  O O    . GLY A 1 13  ? -3.238  12.934  2.110   1.00 0.00 ? 13  GLY A O    3  
ATOM 6091  H H    . GLY A 1 13  ? 0.357   13.162  0.724   1.00 0.00 ? 13  GLY A H    3  
ATOM 6092  H HA2  . GLY A 1 13  ? -0.900  14.254  2.879   1.00 0.00 ? 13  GLY A HA2  3  
ATOM 6093  H HA3  . GLY A 1 13  ? -1.819  14.954  1.551   1.00 0.00 ? 13  GLY A HA3  3  
ATOM 6094  N N    . LYS A 1 14  ? -1.546  11.723  1.262   1.00 0.00 ? 14  LYS A N    3  
ATOM 6095  C CA   . LYS A 1 14  ? -2.336  10.566  0.836   1.00 0.00 ? 14  LYS A CA   3  
ATOM 6096  C C    . LYS A 1 14  ? -2.450  9.549   1.960   1.00 0.00 ? 14  LYS A C    3  
ATOM 6097  O O    . LYS A 1 14  ? -3.545  9.227   2.415   1.00 0.00 ? 14  LYS A O    3  
ATOM 6098  C CB   . LYS A 1 14  ? -1.686  9.961   -0.423  1.00 0.00 ? 14  LYS A CB   3  
ATOM 6099  C CG   . LYS A 1 14  ? -2.008  10.842  -1.638  1.00 0.00 ? 14  LYS A CG   3  
ATOM 6100  C CD   . LYS A 1 14  ? -1.227  10.502  -2.913  1.00 0.00 ? 14  LYS A CD   3  
ATOM 6101  C CE   . LYS A 1 14  ? 0.294   10.631  -2.730  1.00 0.00 ? 14  LYS A CE   3  
ATOM 6102  N NZ   . LYS A 1 14  ? 1.008   9.336   -2.691  1.00 0.00 ? 14  LYS A NZ   3  
ATOM 6103  H H    . LYS A 1 14  ? -0.539  11.639  1.165   1.00 0.00 ? 14  LYS A H    3  
ATOM 6104  H HA   . LYS A 1 14  ? -3.354  10.871  0.588   1.00 0.00 ? 14  LYS A HA   3  
ATOM 6105  H HB2  . LYS A 1 14  ? -0.610  9.896   -0.275  1.00 0.00 ? 14  LYS A HB2  3  
ATOM 6106  H HB3  . LYS A 1 14  ? -2.064  8.954   -0.601  1.00 0.00 ? 14  LYS A HB3  3  
ATOM 6107  H HG2  . LYS A 1 14  ? -3.073  10.747  -1.852  1.00 0.00 ? 14  LYS A HG2  3  
ATOM 6108  H HG3  . LYS A 1 14  ? -1.805  11.882  -1.390  1.00 0.00 ? 14  LYS A HG3  3  
ATOM 6109  H HD2  . LYS A 1 14  ? -1.519  9.519   -3.272  1.00 0.00 ? 14  LYS A HD2  3  
ATOM 6110  H HD3  . LYS A 1 14  ? -1.521  11.212  -3.687  1.00 0.00 ? 14  LYS A HD3  3  
ATOM 6111  H HE2  . LYS A 1 14  ? 0.681   11.204  -3.571  1.00 0.00 ? 14  LYS A HE2  3  
ATOM 6112  H HE3  . LYS A 1 14  ? 0.514   11.203  -1.826  1.00 0.00 ? 14  LYS A HE3  3  
ATOM 6113  H HZ1  . LYS A 1 14  ? 2.004   9.500   -2.642  1.00 0.00 ? 14  LYS A HZ1  3  
ATOM 6114  H HZ2  . LYS A 1 14  ? 0.740   8.768   -1.887  1.00 0.00 ? 14  LYS A HZ2  3  
ATOM 6115  H HZ3  . LYS A 1 14  ? 0.850   8.786   -3.529  1.00 0.00 ? 14  LYS A HZ3  3  
ATOM 6116  N N    . THR A 1 15  ? -1.306  9.112   2.468   1.00 0.00 ? 15  THR A N    3  
ATOM 6117  C CA   . THR A 1 15  ? -1.150  8.063   3.468   1.00 0.00 ? 15  THR A CA   3  
ATOM 6118  C C    . THR A 1 15  ? -2.053  8.360   4.677   1.00 0.00 ? 15  THR A C    3  
ATOM 6119  O O    . THR A 1 15  ? -2.763  7.478   5.141   1.00 0.00 ? 15  THR A O    3  
ATOM 6120  C CB   . THR A 1 15  ? 0.360   7.955   3.786   1.00 0.00 ? 15  THR A CB   3  
ATOM 6121  O OG1  . THR A 1 15  ? 1.066   7.958   2.554   1.00 0.00 ? 15  THR A OG1  3  
ATOM 6122  C CG2  . THR A 1 15  ? 0.806   6.716   4.577   1.00 0.00 ? 15  THR A CG2  3  
ATOM 6123  H H    . THR A 1 15  ? -0.447  9.446   2.060   1.00 0.00 ? 15  THR A H    3  
ATOM 6124  H HA   . THR A 1 15  ? -1.476  7.122   3.017   1.00 0.00 ? 15  THR A HA   3  
ATOM 6125  H HB   . THR A 1 15  ? 0.654   8.849   4.337   1.00 0.00 ? 15  THR A HB   3  
ATOM 6126  H HG1  . THR A 1 15  ? 0.799   7.134   2.090   1.00 0.00 ? 15  THR A HG1  3  
ATOM 6127  H HG21 . THR A 1 15  ? 0.547   5.806   4.035   1.00 0.00 ? 15  THR A HG21 3  
ATOM 6128  H HG22 . THR A 1 15  ? 1.890   6.734   4.740   1.00 0.00 ? 15  THR A HG22 3  
ATOM 6129  H HG23 . THR A 1 15  ? 0.320   6.688   5.551   1.00 0.00 ? 15  THR A HG23 3  
ATOM 6130  N N    . THR A 1 16  ? -2.138  9.619   5.122   1.00 0.00 ? 16  THR A N    3  
ATOM 6131  C CA   . THR A 1 16  ? -3.024  10.080  6.187   1.00 0.00 ? 16  THR A CA   3  
ATOM 6132  C C    . THR A 1 16  ? -4.515  9.810   5.913   1.00 0.00 ? 16  THR A C    3  
ATOM 6133  O O    . THR A 1 16  ? -5.257  9.473   6.834   1.00 0.00 ? 16  THR A O    3  
ATOM 6134  C CB   . THR A 1 16  ? -2.801  11.590  6.321   1.00 0.00 ? 16  THR A CB   3  
ATOM 6135  O OG1  . THR A 1 16  ? -1.425  11.897  6.427   1.00 0.00 ? 16  THR A OG1  3  
ATOM 6136  C CG2  . THR A 1 16  ? -3.547  12.212  7.500   1.00 0.00 ? 16  THR A CG2  3  
ATOM 6137  H H    . THR A 1 16  ? -1.525  10.329  4.749   1.00 0.00 ? 16  THR A H    3  
ATOM 6138  H HA   . THR A 1 16  ? -2.743  9.584   7.118   1.00 0.00 ? 16  THR A HA   3  
ATOM 6139  H HB   . THR A 1 16  ? -3.155  12.056  5.400   1.00 0.00 ? 16  THR A HB   3  
ATOM 6140  H HG1  . THR A 1 16  ? -1.058  11.418  7.205   1.00 0.00 ? 16  THR A HG1  3  
ATOM 6141  H HG21 . THR A 1 16  ? -3.389  13.287  7.493   1.00 0.00 ? 16  THR A HG21 3  
ATOM 6142  H HG22 . THR A 1 16  ? -4.618  12.028  7.414   1.00 0.00 ? 16  THR A HG22 3  
ATOM 6143  H HG23 . THR A 1 16  ? -3.183  11.783  8.433   1.00 0.00 ? 16  THR A HG23 3  
ATOM 6144  N N    . LEU A 1 17  ? -4.992  10.021  4.683   1.00 0.00 ? 17  LEU A N    3  
ATOM 6145  C CA   . LEU A 1 17  ? -6.402  9.840   4.346   1.00 0.00 ? 17  LEU A CA   3  
ATOM 6146  C C    . LEU A 1 17  ? -6.684  8.347   4.408   1.00 0.00 ? 17  LEU A C    3  
ATOM 6147  O O    . LEU A 1 17  ? -7.636  7.940   5.063   1.00 0.00 ? 17  LEU A O    3  
ATOM 6148  C CB   . LEU A 1 17  ? -6.733  10.379  2.937   1.00 0.00 ? 17  LEU A CB   3  
ATOM 6149  C CG   . LEU A 1 17  ? -6.846  11.911  2.760   1.00 0.00 ? 17  LEU A CG   3  
ATOM 6150  C CD1  . LEU A 1 17  ? -6.084  12.767  3.783   1.00 0.00 ? 17  LEU A CD1  3  
ATOM 6151  C CD2  . LEU A 1 17  ? -6.380  12.267  1.343   1.00 0.00 ? 17  LEU A CD2  3  
ATOM 6152  H H    . LEU A 1 17  ? -4.351  10.185  3.915   1.00 0.00 ? 17  LEU A H    3  
ATOM 6153  H HA   . LEU A 1 17  ? -7.030  10.343  5.094   1.00 0.00 ? 17  LEU A HA   3  
ATOM 6154  H HB2  . LEU A 1 17  ? -6.024  9.969   2.215   1.00 0.00 ? 17  LEU A HB2  3  
ATOM 6155  H HB3  . LEU A 1 17  ? -7.695  9.960   2.643   1.00 0.00 ? 17  LEU A HB3  3  
ATOM 6156  H HG   . LEU A 1 17  ? -7.900  12.183  2.847   1.00 0.00 ? 17  LEU A HG   3  
ATOM 6157  H HD11 . LEU A 1 17  ? -5.027  12.520  3.764   1.00 0.00 ? 17  LEU A HD11 3  
ATOM 6158  H HD12 . LEU A 1 17  ? -6.198  13.826  3.549   1.00 0.00 ? 17  LEU A HD12 3  
ATOM 6159  H HD13 . LEU A 1 17  ? -6.478  12.601  4.786   1.00 0.00 ? 17  LEU A HD13 3  
ATOM 6160  H HD21 . LEU A 1 17  ? -7.104  11.906  0.613   1.00 0.00 ? 17  LEU A HD21 3  
ATOM 6161  H HD22 . LEU A 1 17  ? -6.275  13.344  1.239   1.00 0.00 ? 17  LEU A HD22 3  
ATOM 6162  H HD23 . LEU A 1 17  ? -5.411  11.815  1.135   1.00 0.00 ? 17  LEU A HD23 3  
ATOM 6163  N N    . ILE A 1 18  ? -5.833  7.530   3.778   1.00 0.00 ? 18  ILE A N    3  
ATOM 6164  C CA   . ILE A 1 18  ? -5.955  6.078   3.840   1.00 0.00 ? 18  ILE A CA   3  
ATOM 6165  C C    . ILE A 1 18  ? -5.905  5.611   5.308   1.00 0.00 ? 18  ILE A C    3  
ATOM 6166  O O    . ILE A 1 18  ? -6.690  4.754   5.700   1.00 0.00 ? 18  ILE A O    3  
ATOM 6167  C CB   . ILE A 1 18  ? -4.822  5.433   2.993   1.00 0.00 ? 18  ILE A CB   3  
ATOM 6168  C CG1  . ILE A 1 18  ? -5.112  5.474   1.478   1.00 0.00 ? 18  ILE A CG1  3  
ATOM 6169  C CG2  . ILE A 1 18  ? -4.450  3.999   3.412   1.00 0.00 ? 18  ILE A CG2  3  
ATOM 6170  C CD1  . ILE A 1 18  ? -6.212  4.514   1.000   1.00 0.00 ? 18  ILE A CD1  3  
ATOM 6171  H H    . ILE A 1 18  ? -5.041  7.929   3.286   1.00 0.00 ? 18  ILE A H    3  
ATOM 6172  H HA   . ILE A 1 18  ? -6.950  5.851   3.429   1.00 0.00 ? 18  ILE A HA   3  
ATOM 6173  H HB   . ILE A 1 18  ? -3.922  6.028   3.153   1.00 0.00 ? 18  ILE A HB   3  
ATOM 6174  H HG12 . ILE A 1 18  ? -5.382  6.489   1.190   1.00 0.00 ? 18  ILE A HG12 3  
ATOM 6175  H HG13 . ILE A 1 18  ? -4.192  5.219   0.951   1.00 0.00 ? 18  ILE A HG13 3  
ATOM 6176  H HG21 . ILE A 1 18  ? -3.963  3.998   4.387   1.00 0.00 ? 18  ILE A HG21 3  
ATOM 6177  H HG22 . ILE A 1 18  ? -5.341  3.375   3.469   1.00 0.00 ? 18  ILE A HG22 3  
ATOM 6178  H HG23 . ILE A 1 18  ? -3.745  3.563   2.702   1.00 0.00 ? 18  ILE A HG23 3  
ATOM 6179  H HD11 . ILE A 1 18  ? -6.256  4.537   -0.084  1.00 0.00 ? 18  ILE A HD11 3  
ATOM 6180  H HD12 . ILE A 1 18  ? -5.989  3.488   1.289   1.00 0.00 ? 18  ILE A HD12 3  
ATOM 6181  H HD13 . ILE A 1 18  ? -7.180  4.817   1.399   1.00 0.00 ? 18  ILE A HD13 3  
ATOM 6182  N N    . HIS A 1 19  ? -5.022  6.182   6.136   1.00 0.00 ? 19  HIS A N    3  
ATOM 6183  C CA   . HIS A 1 19  ? -4.942  5.863   7.555   1.00 0.00 ? 19  HIS A CA   3  
ATOM 6184  C C    . HIS A 1 19  ? -6.289  6.087   8.220   1.00 0.00 ? 19  HIS A C    3  
ATOM 6185  O O    . HIS A 1 19  ? -6.836  5.177   8.847   1.00 0.00 ? 19  HIS A O    3  
ATOM 6186  C CB   . HIS A 1 19  ? -3.893  6.715   8.278   1.00 0.00 ? 19  HIS A CB   3  
ATOM 6187  C CG   . HIS A 1 19  ? -2.524  6.115   8.305   1.00 0.00 ? 19  HIS A CG   3  
ATOM 6188  N ND1  . HIS A 1 19  ? -2.159  5.009   9.035   1.00 0.00 ? 19  HIS A ND1  3  
ATOM 6189  C CD2  . HIS A 1 19  ? -1.390  6.687   7.804   1.00 0.00 ? 19  HIS A CD2  3  
ATOM 6190  C CE1  . HIS A 1 19  ? -0.822  4.930   8.981   1.00 0.00 ? 19  HIS A CE1  3  
ATOM 6191  N NE2  . HIS A 1 19  ? -0.309  5.917   8.229   1.00 0.00 ? 19  HIS A NE2  3  
ATOM 6192  H H    . HIS A 1 19  ? -4.336  6.821   5.752   1.00 0.00 ? 19  HIS A H    3  
ATOM 6193  H HA   . HIS A 1 19  ? -4.680  4.810   7.642   1.00 0.00 ? 19  HIS A HA   3  
ATOM 6194  H HB2  . HIS A 1 19  ? -3.843  7.706   7.839   1.00 0.00 ? 19  HIS A HB2  3  
ATOM 6195  H HB3  . HIS A 1 19  ? -4.196  6.842   9.319   1.00 0.00 ? 19  HIS A HB3  3  
ATOM 6196  H HD1  . HIS A 1 19  ? -2.768  4.436   9.613   1.00 0.00 ? 19  HIS A HD1  3  
ATOM 6197  H HD2  . HIS A 1 19  ? -1.326  7.616   7.258   1.00 0.00 ? 19  HIS A HD2  3  
ATOM 6198  H HE1  . HIS A 1 19  ? -0.240  4.202   9.514   1.00 0.00 ? 19  HIS A HE1  3  
ATOM 6199  N N    . LYS A 1 20  ? -6.826  7.300   8.094   1.00 0.00 ? 20  LYS A N    3  
ATOM 6200  C CA   . LYS A 1 20  ? -8.105  7.647   8.692   1.00 0.00 ? 20  LYS A CA   3  
ATOM 6201  C C    . LYS A 1 20  ? -9.215  6.753   8.168   1.00 0.00 ? 20  LYS A C    3  
ATOM 6202  O O    . LYS A 1 20  ? -10.111 6.429   8.939   1.00 0.00 ? 20  LYS A O    3  
ATOM 6203  C CB   . LYS A 1 20  ? -8.424  9.102   8.436   1.00 0.00 ? 20  LYS A CB   3  
ATOM 6204  C CG   . LYS A 1 20  ? -7.638  9.952   9.436   1.00 0.00 ? 20  LYS A CG   3  
ATOM 6205  C CD   . LYS A 1 20  ? -7.603  11.359  8.884   1.00 0.00 ? 20  LYS A CD   3  
ATOM 6206  C CE   . LYS A 1 20  ? -6.892  12.286  9.869   1.00 0.00 ? 20  LYS A CE   3  
ATOM 6207  N NZ   . LYS A 1 20  ? -7.257  13.696  9.659   1.00 0.00 ? 20  LYS A NZ   3  
ATOM 6208  H H    . LYS A 1 20  ? -6.332  8.003   7.552   1.00 0.00 ? 20  LYS A H    3  
ATOM 6209  H HA   . LYS A 1 20  ? -8.023  7.543   9.769   1.00 0.00 ? 20  LYS A HA   3  
ATOM 6210  H HB2  . LYS A 1 20  ? -8.155  9.345   7.408   1.00 0.00 ? 20  LYS A HB2  3  
ATOM 6211  H HB3  . LYS A 1 20  ? -9.489  9.277   8.593   1.00 0.00 ? 20  LYS A HB3  3  
ATOM 6212  H HG2  . LYS A 1 20  ? -8.130  9.928   10.411  1.00 0.00 ? 20  LYS A HG2  3  
ATOM 6213  H HG3  . LYS A 1 20  ? -6.612  9.592   9.532   1.00 0.00 ? 20  LYS A HG3  3  
ATOM 6214  H HD2  . LYS A 1 20  ? -7.040  11.295  7.959   1.00 0.00 ? 20  LYS A HD2  3  
ATOM 6215  H HD3  . LYS A 1 20  ? -8.616  11.699  8.664   1.00 0.00 ? 20  LYS A HD3  3  
ATOM 6216  H HE2  . LYS A 1 20  ? -7.169  12.015  10.890  1.00 0.00 ? 20  LYS A HE2  3  
ATOM 6217  H HE3  . LYS A 1 20  ? -5.816  12.152  9.752   1.00 0.00 ? 20  LYS A HE3  3  
ATOM 6218  H HZ1  . LYS A 1 20  ? -7.379  13.885  8.666   1.00 0.00 ? 20  LYS A HZ1  3  
ATOM 6219  H HZ2  . LYS A 1 20  ? -8.124  13.885  10.143  1.00 0.00 ? 20  LYS A HZ2  3  
ATOM 6220  H HZ3  . LYS A 1 20  ? -6.535  14.306  10.029  1.00 0.00 ? 20  LYS A HZ3  3  
ATOM 6221  N N    . ALA A 1 21  ? -9.136  6.291   6.917   1.00 0.00 ? 21  ALA A N    3  
ATOM 6222  C CA   . ALA A 1 21  ? -10.102 5.364   6.352   1.00 0.00 ? 21  ALA A CA   3  
ATOM 6223  C C    . ALA A 1 21  ? -10.287 4.173   7.285   1.00 0.00 ? 21  ALA A C    3  
ATOM 6224  O O    . ALA A 1 21  ? -11.419 3.776   7.558   1.00 0.00 ? 21  ALA A O    3  
ATOM 6225  C CB   . ALA A 1 21  ? -9.643  4.861   4.984   1.00 0.00 ? 21  ALA A CB   3  
ATOM 6226  H H    . ALA A 1 21  ? -8.390  6.620   6.315   1.00 0.00 ? 21  ALA A H    3  
ATOM 6227  H HA   . ALA A 1 21  ? -11.043 5.904   6.227   1.00 0.00 ? 21  ALA A HA   3  
ATOM 6228  H HB1  . ALA A 1 21  ? -9.230  5.679   4.396   1.00 0.00 ? 21  ALA A HB1  3  
ATOM 6229  H HB2  . ALA A 1 21  ? -8.903  4.071   5.085   1.00 0.00 ? 21  ALA A HB2  3  
ATOM 6230  H HB3  . ALA A 1 21  ? -10.496 4.430   4.470   1.00 0.00 ? 21  ALA A HB3  3  
ATOM 6231  N N    . SER A 1 22  ? -9.182  3.631   7.810   1.00 0.00 ? 22  SER A N    3  
ATOM 6232  C CA   . SER A 1 22  ? -9.217  2.498   8.711   1.00 0.00 ? 22  SER A CA   3  
ATOM 6233  C C    . SER A 1 22  ? -10.060 2.852   9.934   1.00 0.00 ? 22  SER A C    3  
ATOM 6234  O O    . SER A 1 22  ? -10.932 2.095   10.336  1.00 0.00 ? 22  SER A O    3  
ATOM 6235  C CB   . SER A 1 22  ? -7.797  2.101   9.141   1.00 0.00 ? 22  SER A CB   3  
ATOM 6236  O OG   . SER A 1 22  ? -6.866  2.123   8.072   1.00 0.00 ? 22  SER A OG   3  
ATOM 6237  H H    . SER A 1 22  ? -8.283  4.078   7.660   1.00 0.00 ? 22  SER A H    3  
ATOM 6238  H HA   . SER A 1 22  ? -9.681  1.672   8.180   1.00 0.00 ? 22  SER A HA   3  
ATOM 6239  H HB2  . SER A 1 22  ? -7.450  2.791   9.910   1.00 0.00 ? 22  SER A HB2  3  
ATOM 6240  H HB3  . SER A 1 22  ? -7.828  1.105   9.580   1.00 0.00 ? 22  SER A HB3  3  
ATOM 6241  H HG   . SER A 1 22  ? -7.248  1.691   7.299   1.00 0.00 ? 22  SER A HG   3  
ATOM 6242  N N    . GLU A 1 23  ? -9.813  4.021   10.511  1.00 0.00 ? 23  GLU A N    3  
ATOM 6243  C CA   . GLU A 1 23  ? -10.351 4.500   11.777  1.00 0.00 ? 23  GLU A CA   3  
ATOM 6244  C C    . GLU A 1 23  ? -11.851 4.807   11.677  1.00 0.00 ? 23  GLU A C    3  
ATOM 6245  O O    . GLU A 1 23  ? -12.563 4.780   12.679  1.00 0.00 ? 23  GLU A O    3  
ATOM 6246  C CB   . GLU A 1 23  ? -9.529  5.737   12.192  1.00 0.00 ? 23  GLU A CB   3  
ATOM 6247  C CG   . GLU A 1 23  ? -8.039  5.360   12.207  1.00 0.00 ? 23  GLU A CG   3  
ATOM 6248  C CD   . GLU A 1 23  ? -7.093  6.339   12.891  1.00 0.00 ? 23  GLU A CD   3  
ATOM 6249  O OE1  . GLU A 1 23  ? -7.213  7.572   12.713  1.00 0.00 ? 23  GLU A OE1  3  
ATOM 6250  O OE2  . GLU A 1 23  ? -6.150  5.840   13.554  1.00 0.00 ? 23  GLU A OE2  3  
ATOM 6251  H H    . GLU A 1 23  ? -9.168  4.646   10.044  1.00 0.00 ? 23  GLU A H    3  
ATOM 6252  H HA   . GLU A 1 23  ? -10.214 3.726   12.534  1.00 0.00 ? 23  GLU A HA   3  
ATOM 6253  H HB2  . GLU A 1 23  ? -9.683  6.539   11.471  1.00 0.00 ? 23  GLU A HB2  3  
ATOM 6254  H HB3  . GLU A 1 23  ? -9.839  6.064   13.184  1.00 0.00 ? 23  GLU A HB3  3  
ATOM 6255  H HG2  . GLU A 1 23  ? -7.963  4.397   12.702  1.00 0.00 ? 23  GLU A HG2  3  
ATOM 6256  H HG3  . GLU A 1 23  ? -7.686  5.234   11.187  1.00 0.00 ? 23  GLU A HG3  3  
ATOM 6257  N N    . VAL A 1 24  ? -12.343 5.075   10.470  1.00 0.00 ? 24  VAL A N    3  
ATOM 6258  C CA   . VAL A 1 24  ? -13.736 5.363   10.148  1.00 0.00 ? 24  VAL A CA   3  
ATOM 6259  C C    . VAL A 1 24  ? -14.494 4.057   9.977   1.00 0.00 ? 24  VAL A C    3  
ATOM 6260  O O    . VAL A 1 24  ? -15.554 3.878   10.572  1.00 0.00 ? 24  VAL A O    3  
ATOM 6261  C CB   . VAL A 1 24  ? -13.745 6.179   8.850   1.00 0.00 ? 24  VAL A CB   3  
ATOM 6262  C CG1  . VAL A 1 24  ? -15.151 6.421   8.288   1.00 0.00 ? 24  VAL A CG1  3  
ATOM 6263  C CG2  . VAL A 1 24  ? -13.066 7.532   9.091   1.00 0.00 ? 24  VAL A CG2  3  
ATOM 6264  H H    . VAL A 1 24  ? -11.676 5.144   9.707   1.00 0.00 ? 24  VAL A H    3  
ATOM 6265  H HA   . VAL A 1 24  ? -14.201 5.935   10.951  1.00 0.00 ? 24  VAL A HA   3  
ATOM 6266  H HB   . VAL A 1 24  ? -13.167 5.610   8.120   1.00 0.00 ? 24  VAL A HB   3  
ATOM 6267  H HG11 . VAL A 1 24  ? -15.791 6.865   9.050   1.00 0.00 ? 24  VAL A HG11 3  
ATOM 6268  H HG12 . VAL A 1 24  ? -15.099 7.101   7.438   1.00 0.00 ? 24  VAL A HG12 3  
ATOM 6269  H HG13 . VAL A 1 24  ? -15.590 5.484   7.947   1.00 0.00 ? 24  VAL A HG13 3  
ATOM 6270  H HG21 . VAL A 1 24  ? -13.753 8.208   9.593   1.00 0.00 ? 24  VAL A HG21 3  
ATOM 6271  H HG22 . VAL A 1 24  ? -12.167 7.421   9.697   1.00 0.00 ? 24  VAL A HG22 3  
ATOM 6272  H HG23 . VAL A 1 24  ? -12.791 7.965   8.133   1.00 0.00 ? 24  VAL A HG23 3  
ATOM 6273  N N    . LEU A 1 25  ? -13.938 3.124   9.201   1.00 0.00 ? 25  LEU A N    3  
ATOM 6274  C CA   . LEU A 1 25  ? -14.491 1.784   9.060   1.00 0.00 ? 25  LEU A CA   3  
ATOM 6275  C C    . LEU A 1 25  ? -14.556 1.149   10.438  1.00 0.00 ? 25  LEU A C    3  
ATOM 6276  O O    . LEU A 1 25  ? -15.587 0.594   10.801  1.00 0.00 ? 25  LEU A O    3  
ATOM 6277  C CB   . LEU A 1 25  ? -13.597 0.931   8.164   1.00 0.00 ? 25  LEU A CB   3  
ATOM 6278  C CG   . LEU A 1 25  ? -13.454 1.460   6.728   1.00 0.00 ? 25  LEU A CG   3  
ATOM 6279  C CD1  . LEU A 1 25  ? -12.197 0.859   6.109   1.00 0.00 ? 25  LEU A CD1  3  
ATOM 6280  C CD2  . LEU A 1 25  ? -14.670 1.134   5.858   1.00 0.00 ? 25  LEU A CD2  3  
ATOM 6281  H H    . LEU A 1 25  ? -13.044 3.329   8.764   1.00 0.00 ? 25  LEU A H    3  
ATOM 6282  H HA   . LEU A 1 25  ? -15.494 1.842   8.638   1.00 0.00 ? 25  LEU A HA   3  
ATOM 6283  H HB2  . LEU A 1 25  ? -12.638 0.871   8.664   1.00 0.00 ? 25  LEU A HB2  3  
ATOM 6284  H HB3  . LEU A 1 25  ? -13.962 -0.090  8.126   1.00 0.00 ? 25  LEU A HB3  3  
ATOM 6285  H HG   . LEU A 1 25  ? -13.349 2.541   6.731   1.00 0.00 ? 25  LEU A HG   3  
ATOM 6286  H HD11 . LEU A 1 25  ? -12.090 1.222   5.086   1.00 0.00 ? 25  LEU A HD11 3  
ATOM 6287  H HD12 . LEU A 1 25  ? -11.326 1.153   6.695   1.00 0.00 ? 25  LEU A HD12 3  
ATOM 6288  H HD13 . LEU A 1 25  ? -12.255 -0.228  6.140   1.00 0.00 ? 25  LEU A HD13 3  
ATOM 6289  H HD21 . LEU A 1 25  ? -14.525 1.528   4.854   1.00 0.00 ? 25  LEU A HD21 3  
ATOM 6290  H HD22 . LEU A 1 25  ? -14.823 0.059   5.808   1.00 0.00 ? 25  LEU A HD22 3  
ATOM 6291  H HD23 . LEU A 1 25  ? -15.558 1.597   6.285   1.00 0.00 ? 25  LEU A HD23 3  
ATOM 6292  N N    . LYS A 1 26  ? -13.489 1.285   11.230  1.00 0.00 ? 26  LYS A N    3  
ATOM 6293  C CA   . LYS A 1 26  ? -13.458 0.768   12.590  1.00 0.00 ? 26  LYS A CA   3  
ATOM 6294  C C    . LYS A 1 26  ? -14.551 1.428   13.420  1.00 0.00 ? 26  LYS A C    3  
ATOM 6295  O O    . LYS A 1 26  ? -15.283 0.718   14.106  1.00 0.00 ? 26  LYS A O    3  
ATOM 6296  C CB   . LYS A 1 26  ? -12.069 0.978   13.193  1.00 0.00 ? 26  LYS A CB   3  
ATOM 6297  C CG   . LYS A 1 26  ? -11.062 -0.010  12.585  1.00 0.00 ? 26  LYS A CG   3  
ATOM 6298  C CD   . LYS A 1 26  ? -9.622  0.357   12.969  1.00 0.00 ? 26  LYS A CD   3  
ATOM 6299  C CE   . LYS A 1 26  ? -8.664  -0.799  12.673  1.00 0.00 ? 26  LYS A CE   3  
ATOM 6300  N NZ   . LYS A 1 26  ? -8.650  -1.819  13.750  1.00 0.00 ? 26  LYS A NZ   3  
ATOM 6301  H H    . LYS A 1 26  ? -12.669 1.776   10.868  1.00 0.00 ? 26  LYS A H    3  
ATOM 6302  H HA   . LYS A 1 26  ? -13.669 -0.303  12.551  1.00 0.00 ? 26  LYS A HA   3  
ATOM 6303  H HB2  . LYS A 1 26  ? -11.754 2.007   13.023  1.00 0.00 ? 26  LYS A HB2  3  
ATOM 6304  H HB3  . LYS A 1 26  ? -12.118 0.803   14.268  1.00 0.00 ? 26  LYS A HB3  3  
ATOM 6305  H HG2  . LYS A 1 26  ? -11.313 -1.008  12.923  1.00 0.00 ? 26  LYS A HG2  3  
ATOM 6306  H HG3  . LYS A 1 26  ? -11.142 -0.034  11.500  1.00 0.00 ? 26  LYS A HG3  3  
ATOM 6307  H HD2  . LYS A 1 26  ? -9.320  1.221   12.375  1.00 0.00 ? 26  LYS A HD2  3  
ATOM 6308  H HD3  . LYS A 1 26  ? -9.567  0.633   14.020  1.00 0.00 ? 26  LYS A HD3  3  
ATOM 6309  H HE2  . LYS A 1 26  ? -8.981  -1.247  11.732  1.00 0.00 ? 26  LYS A HE2  3  
ATOM 6310  H HE3  . LYS A 1 26  ? -7.656  -0.395  12.551  1.00 0.00 ? 26  LYS A HE3  3  
ATOM 6311  H HZ1  . LYS A 1 26  ? -8.189  -2.677  13.469  1.00 0.00 ? 26  LYS A HZ1  3  
ATOM 6312  H HZ2  . LYS A 1 26  ? -8.114  -1.494  14.552  1.00 0.00 ? 26  LYS A HZ2  3  
ATOM 6313  H HZ3  . LYS A 1 26  ? -9.576  -2.075  14.059  1.00 0.00 ? 26  LYS A HZ3  3  
ATOM 6314  N N    . SER A 1 27  ? -14.742 2.742   13.306  1.00 0.00 ? 27  SER A N    3  
ATOM 6315  C CA   . SER A 1 27  ? -15.834 3.423   13.989  1.00 0.00 ? 27  SER A CA   3  
ATOM 6316  C C    . SER A 1 27  ? -17.211 2.922   13.529  1.00 0.00 ? 27  SER A C    3  
ATOM 6317  O O    . SER A 1 27  ? -18.165 2.965   14.304  1.00 0.00 ? 27  SER A O    3  
ATOM 6318  C CB   . SER A 1 27  ? -15.659 4.939   13.823  1.00 0.00 ? 27  SER A CB   3  
ATOM 6319  O OG   . SER A 1 27  ? -16.448 5.669   14.738  1.00 0.00 ? 27  SER A OG   3  
ATOM 6320  H H    . SER A 1 27  ? -14.093 3.291   12.758  1.00 0.00 ? 27  SER A H    3  
ATOM 6321  H HA   . SER A 1 27  ? -15.747 3.172   15.041  1.00 0.00 ? 27  SER A HA   3  
ATOM 6322  H HB2  . SER A 1 27  ? -14.621 5.199   14.018  1.00 0.00 ? 27  SER A HB2  3  
ATOM 6323  H HB3  . SER A 1 27  ? -15.915 5.235   12.805  1.00 0.00 ? 27  SER A HB3  3  
ATOM 6324  H HG   . SER A 1 27  ? -17.337 5.765   14.337  1.00 0.00 ? 27  SER A HG   3  
ATOM 6325  N N    . SER A 1 28  ? -17.320 2.412   12.304  1.00 0.00 ? 28  SER A N    3  
ATOM 6326  C CA   . SER A 1 28  ? -18.518 1.812   11.732  1.00 0.00 ? 28  SER A CA   3  
ATOM 6327  C C    . SER A 1 28  ? -18.612 0.305   12.025  1.00 0.00 ? 28  SER A C    3  
ATOM 6328  O O    . SER A 1 28  ? -19.544 -0.332  11.532  1.00 0.00 ? 28  SER A O    3  
ATOM 6329  C CB   . SER A 1 28  ? -18.483 2.084   10.223  1.00 0.00 ? 28  SER A CB   3  
ATOM 6330  O OG   . SER A 1 28  ? -19.649 1.647   9.536   1.00 0.00 ? 28  SER A OG   3  
ATOM 6331  H H    . SER A 1 28  ? -16.488 2.424   11.723  1.00 0.00 ? 28  SER A H    3  
ATOM 6332  H HA   . SER A 1 28  ? -19.394 2.303   12.158  1.00 0.00 ? 28  SER A HA   3  
ATOM 6333  H HB2  . SER A 1 28  ? -18.369 3.157   10.066  1.00 0.00 ? 28  SER A HB2  3  
ATOM 6334  H HB3  . SER A 1 28  ? -17.615 1.581   9.793   1.00 0.00 ? 28  SER A HB3  3  
ATOM 6335  H HG   . SER A 1 28  ? -19.832 0.743   9.859   1.00 0.00 ? 28  SER A HG   3  
ATOM 6336  N N    . GLY A 1 29  ? -17.668 -0.283  12.762  1.00 0.00 ? 29  GLY A N    3  
ATOM 6337  C CA   . GLY A 1 29  ? -17.662 -1.703  13.078  1.00 0.00 ? 29  GLY A CA   3  
ATOM 6338  C C    . GLY A 1 29  ? -17.192 -2.593  11.928  1.00 0.00 ? 29  GLY A C    3  
ATOM 6339  O O    . GLY A 1 29  ? -17.371 -3.804  12.021  1.00 0.00 ? 29  GLY A O    3  
ATOM 6340  H H    . GLY A 1 29  ? -16.886 0.270   13.090  1.00 0.00 ? 29  GLY A H    3  
ATOM 6341  H HA2  . GLY A 1 29  ? -17.012 -1.869  13.933  1.00 0.00 ? 29  GLY A HA2  3  
ATOM 6342  H HA3  . GLY A 1 29  ? -18.670 -2.010  13.357  1.00 0.00 ? 29  GLY A HA3  3  
ATOM 6343  N N    . VAL A 1 30  ? -16.623 -2.044  10.851  1.00 0.00 ? 30  VAL A N    3  
ATOM 6344  C CA   . VAL A 1 30  ? -16.134 -2.824  9.726   1.00 0.00 ? 30  VAL A CA   3  
ATOM 6345  C C    . VAL A 1 30  ? -14.717 -3.290  10.086  1.00 0.00 ? 30  VAL A C    3  
ATOM 6346  O O    . VAL A 1 30  ? -13.851 -2.430  10.287  1.00 0.00 ? 30  VAL A O    3  
ATOM 6347  C CB   . VAL A 1 30  ? -16.175 -1.944  8.463   1.00 0.00 ? 30  VAL A CB   3  
ATOM 6348  C CG1  . VAL A 1 30  ? -15.373 -2.528  7.291   1.00 0.00 ? 30  VAL A CG1  3  
ATOM 6349  C CG2  . VAL A 1 30  ? -17.618 -1.677  8.018   1.00 0.00 ? 30  VAL A CG2  3  
ATOM 6350  H H    . VAL A 1 30  ? -16.324 -1.071  10.847  1.00 0.00 ? 30  VAL A H    3  
ATOM 6351  H HA   . VAL A 1 30  ? -16.790 -3.679  9.569   1.00 0.00 ? 30  VAL A HA   3  
ATOM 6352  H HB   . VAL A 1 30  ? -15.757 -0.975  8.712   1.00 0.00 ? 30  VAL A HB   3  
ATOM 6353  H HG11 . VAL A 1 30  ? -14.304 -2.466  7.501   1.00 0.00 ? 30  VAL A HG11 3  
ATOM 6354  H HG12 . VAL A 1 30  ? -15.635 -3.571  7.139   1.00 0.00 ? 30  VAL A HG12 3  
ATOM 6355  H HG13 . VAL A 1 30  ? -15.582 -1.977  6.377   1.00 0.00 ? 30  VAL A HG13 3  
ATOM 6356  H HG21 . VAL A 1 30  ? -17.626 -1.094  7.098   1.00 0.00 ? 30  VAL A HG21 3  
ATOM 6357  H HG22 . VAL A 1 30  ? -18.139 -2.622  7.853   1.00 0.00 ? 30  VAL A HG22 3  
ATOM 6358  H HG23 . VAL A 1 30  ? -18.140 -1.110  8.787   1.00 0.00 ? 30  VAL A HG23 3  
ATOM 6359  N N    . PRO A 1 31  ? -14.445 -4.606  10.179  1.00 0.00 ? 31  PRO A N    3  
ATOM 6360  C CA   . PRO A 1 31  ? -13.094 -5.098  10.367  1.00 0.00 ? 31  PRO A CA   3  
ATOM 6361  C C    . PRO A 1 31  ? -12.211 -4.715  9.180   1.00 0.00 ? 31  PRO A C    3  
ATOM 6362  O O    . PRO A 1 31  ? -12.466 -5.022  8.011   1.00 0.00 ? 31  PRO A O    3  
ATOM 6363  C CB   . PRO A 1 31  ? -13.179 -6.607  10.586  1.00 0.00 ? 31  PRO A CB   3  
ATOM 6364  C CG   . PRO A 1 31  ? -14.539 -6.979  10.017  1.00 0.00 ? 31  PRO A CG   3  
ATOM 6365  C CD   . PRO A 1 31  ? -15.383 -5.718  10.176  1.00 0.00 ? 31  PRO A CD   3  
ATOM 6366  H HA   . PRO A 1 31  ? -12.691 -4.649  11.276  1.00 0.00 ? 31  PRO A HA   3  
ATOM 6367  H HB2  . PRO A 1 31  ? -12.371 -7.144  10.086  1.00 0.00 ? 31  PRO A HB2  3  
ATOM 6368  H HB3  . PRO A 1 31  ? -13.165 -6.816  11.657  1.00 0.00 ? 31  PRO A HB3  3  
ATOM 6369  H HG2  . PRO A 1 31  ? -14.443 -7.227  8.959   1.00 0.00 ? 31  PRO A HG2  3  
ATOM 6370  H HG3  . PRO A 1 31  ? -14.964 -7.805  10.580  1.00 0.00 ? 31  PRO A HG3  3  
ATOM 6371  H HD2  . PRO A 1 31  ? -16.097 -5.648  9.360   1.00 0.00 ? 31  PRO A HD2  3  
ATOM 6372  H HD3  . PRO A 1 31  ? -15.909 -5.750  11.130  1.00 0.00 ? 31  PRO A HD3  3  
ATOM 6373  N N    . VAL A 1 32  ? -11.141 -4.021  9.523   1.00 0.00 ? 32  VAL A N    3  
ATOM 6374  C CA   . VAL A 1 32  ? -10.045 -3.676  8.646   1.00 0.00 ? 32  VAL A CA   3  
ATOM 6375  C C    . VAL A 1 32  ? -9.008  -4.790  8.730   1.00 0.00 ? 32  VAL A C    3  
ATOM 6376  O O    . VAL A 1 32  ? -8.946  -5.528  9.715   1.00 0.00 ? 32  VAL A O    3  
ATOM 6377  C CB   . VAL A 1 32  ? -9.541  -2.297  9.119   1.00 0.00 ? 32  VAL A CB   3  
ATOM 6378  C CG1  . VAL A 1 32  ? -8.033  -2.046  9.090   1.00 0.00 ? 32  VAL A CG1  3  
ATOM 6379  C CG2  . VAL A 1 32  ? -10.238 -1.214  8.319   1.00 0.00 ? 32  VAL A CG2  3  
ATOM 6380  H H    . VAL A 1 32  ? -10.995 -3.874  10.509  1.00 0.00 ? 32  VAL A H    3  
ATOM 6381  H HA   . VAL A 1 32  ? -10.395 -3.618  7.614   1.00 0.00 ? 32  VAL A HA   3  
ATOM 6382  H HB   . VAL A 1 32  ? -9.861  -2.135  10.143  1.00 0.00 ? 32  VAL A HB   3  
ATOM 6383  H HG11 . VAL A 1 32  ? -7.520  -2.784  9.708   1.00 0.00 ? 32  VAL A HG11 3  
ATOM 6384  H HG12 . VAL A 1 32  ? -7.658  -2.111  8.067   1.00 0.00 ? 32  VAL A HG12 3  
ATOM 6385  H HG13 . VAL A 1 32  ? -7.812  -1.059  9.487   1.00 0.00 ? 32  VAL A HG13 3  
ATOM 6386  H HG21 . VAL A 1 32  ? -11.307 -1.421  8.289   1.00 0.00 ? 32  VAL A HG21 3  
ATOM 6387  H HG22 . VAL A 1 32  ? -10.082 -0.271  8.833   1.00 0.00 ? 32  VAL A HG22 3  
ATOM 6388  H HG23 . VAL A 1 32  ? -9.822  -1.206  7.310   1.00 0.00 ? 32  VAL A HG23 3  
ATOM 6389  N N    . ASP A 1 33  ? -8.145  -4.856  7.731   1.00 0.00 ? 33  ASP A N    3  
ATOM 6390  C CA   . ASP A 1 33  ? -6.856  -5.521  7.799   1.00 0.00 ? 33  ASP A CA   3  
ATOM 6391  C C    . ASP A 1 33  ? -5.881  -4.663  6.980   1.00 0.00 ? 33  ASP A C    3  
ATOM 6392  O O    . ASP A 1 33  ? -6.308  -3.681  6.370   1.00 0.00 ? 33  ASP A O    3  
ATOM 6393  C CB   . ASP A 1 33  ? -6.985  -6.961  7.249   1.00 0.00 ? 33  ASP A CB   3  
ATOM 6394  C CG   . ASP A 1 33  ? -6.437  -8.043  8.177   1.00 0.00 ? 33  ASP A CG   3  
ATOM 6395  O OD1  . ASP A 1 33  ? -5.382  -7.825  8.809   1.00 0.00 ? 33  ASP A OD1  3  
ATOM 6396  O OD2  . ASP A 1 33  ? -7.050  -9.141  8.262   1.00 0.00 ? 33  ASP A OD2  3  
ATOM 6397  H H    . ASP A 1 33  ? -8.213  -4.182  6.968   1.00 0.00 ? 33  ASP A H    3  
ATOM 6398  H HA   . ASP A 1 33  ? -6.554  -5.507  8.842   1.00 0.00 ? 33  ASP A HA   3  
ATOM 6399  H HB2  . ASP A 1 33  ? -8.032  -7.188  7.049   1.00 0.00 ? 33  ASP A HB2  3  
ATOM 6400  H HB3  . ASP A 1 33  ? -6.458  -7.030  6.300   1.00 0.00 ? 33  ASP A HB3  3  
ATOM 6401  N N    . GLY A 1 34  ? -4.590  -4.985  6.888   1.00 0.00 ? 34  GLY A N    3  
ATOM 6402  C CA   . GLY A 1 34  ? -3.730  -4.350  5.891   1.00 0.00 ? 34  GLY A CA   3  
ATOM 6403  C C    . GLY A 1 34  ? -2.332  -4.042  6.413   1.00 0.00 ? 34  GLY A C    3  
ATOM 6404  O O    . GLY A 1 34  ? -1.913  -4.543  7.463   1.00 0.00 ? 34  GLY A O    3  
ATOM 6405  H H    . GLY A 1 34  ? -4.162  -5.619  7.548   1.00 0.00 ? 34  GLY A H    3  
ATOM 6406  H HA2  . GLY A 1 34  ? -3.686  -4.940  4.992   1.00 0.00 ? 34  GLY A HA2  3  
ATOM 6407  H HA3  . GLY A 1 34  ? -4.185  -3.448  5.524   1.00 0.00 ? 34  GLY A HA3  3  
ATOM 6408  N N    . PHE A 1 35  ? -1.610  -3.182  5.700   1.00 0.00 ? 35  PHE A N    3  
ATOM 6409  C CA   . PHE A 1 35  ? -0.371  -2.600  6.157   1.00 0.00 ? 35  PHE A CA   3  
ATOM 6410  C C    . PHE A 1 35  ? -0.170  -1.224  5.532   1.00 0.00 ? 35  PHE A C    3  
ATOM 6411  O O    . PHE A 1 35  ? -0.714  -0.896  4.478   1.00 0.00 ? 35  PHE A O    3  
ATOM 6412  C CB   . PHE A 1 35  ? 0.788   -3.557  5.865   1.00 0.00 ? 35  PHE A CB   3  
ATOM 6413  C CG   . PHE A 1 35  ? 1.099   -3.874  4.414   1.00 0.00 ? 35  PHE A CG   3  
ATOM 6414  C CD1  . PHE A 1 35  ? 0.292   -4.773  3.688   1.00 0.00 ? 35  PHE A CD1  3  
ATOM 6415  C CD2  . PHE A 1 35  ? 2.241   -3.323  3.806   1.00 0.00 ? 35  PHE A CD2  3  
ATOM 6416  C CE1  . PHE A 1 35  ? 0.630   -5.124  2.371   1.00 0.00 ? 35  PHE A CE1  3  
ATOM 6417  C CE2  . PHE A 1 35  ? 2.580   -3.672  2.489   1.00 0.00 ? 35  PHE A CE2  3  
ATOM 6418  C CZ   . PHE A 1 35  ? 1.785   -4.586  1.779   1.00 0.00 ? 35  PHE A CZ   3  
ATOM 6419  H H    . PHE A 1 35  ? -2.027  -2.675  4.918   1.00 0.00 ? 35  PHE A H    3  
ATOM 6420  H HA   . PHE A 1 35  ? -0.445  -2.466  7.236   1.00 0.00 ? 35  PHE A HA   3  
ATOM 6421  H HB2  . PHE A 1 35  ? 1.692   -3.172  6.343   1.00 0.00 ? 35  PHE A HB2  3  
ATOM 6422  H HB3  . PHE A 1 35  ? 0.529   -4.493  6.347   1.00 0.00 ? 35  PHE A HB3  3  
ATOM 6423  H HD1  . PHE A 1 35  ? -0.595  -5.196  4.132   1.00 0.00 ? 35  PHE A HD1  3  
ATOM 6424  H HD2  . PHE A 1 35  ? 2.862   -2.622  4.342   1.00 0.00 ? 35  PHE A HD2  3  
ATOM 6425  H HE1  . PHE A 1 35  ? -0.002  -5.801  1.816   1.00 0.00 ? 35  PHE A HE1  3  
ATOM 6426  H HE2  . PHE A 1 35  ? 3.444   -3.220  2.021   1.00 0.00 ? 35  PHE A HE2  3  
ATOM 6427  H HZ   . PHE A 1 35  ? 2.046   -4.843  0.765   1.00 0.00 ? 35  PHE A HZ   3  
ATOM 6428  N N    . TYR A 1 36  ? 0.605   -0.414  6.230   1.00 0.00 ? 36  TYR A N    3  
ATOM 6429  C CA   . TYR A 1 36  ? 1.258   0.783   5.763   1.00 0.00 ? 36  TYR A CA   3  
ATOM 6430  C C    . TYR A 1 36  ? 2.756   0.502   5.944   1.00 0.00 ? 36  TYR A C    3  
ATOM 6431  O O    . TYR A 1 36  ? 3.169   -0.616  6.274   1.00 0.00 ? 36  TYR A O    3  
ATOM 6432  C CB   . TYR A 1 36  ? 0.701   1.997   6.514   1.00 0.00 ? 36  TYR A CB   3  
ATOM 6433  C CG   . TYR A 1 36  ? 0.985   2.116   7.996   1.00 0.00 ? 36  TYR A CG   3  
ATOM 6434  C CD1  . TYR A 1 36  ? 0.124   1.497   8.921   1.00 0.00 ? 36  TYR A CD1  3  
ATOM 6435  C CD2  . TYR A 1 36  ? 2.016   2.960   8.448   1.00 0.00 ? 36  TYR A CD2  3  
ATOM 6436  C CE1  . TYR A 1 36  ? 0.252   1.762   10.293  1.00 0.00 ? 36  TYR A CE1  3  
ATOM 6437  C CE2  . TYR A 1 36  ? 2.163   3.222   9.822   1.00 0.00 ? 36  TYR A CE2  3  
ATOM 6438  C CZ   . TYR A 1 36  ? 1.259   2.647   10.747  1.00 0.00 ? 36  TYR A CZ   3  
ATOM 6439  O OH   . TYR A 1 36  ? 1.300   3.013   12.058  1.00 0.00 ? 36  TYR A OH   3  
ATOM 6440  H H    . TYR A 1 36  ? 1.065   -0.812  7.043   1.00 0.00 ? 36  TYR A H    3  
ATOM 6441  H HA   . TYR A 1 36  ? 1.034   0.928   4.699   1.00 0.00 ? 36  TYR A HA   3  
ATOM 6442  H HB2  . TYR A 1 36  ? 1.021   2.908   6.016   1.00 0.00 ? 36  TYR A HB2  3  
ATOM 6443  H HB3  . TYR A 1 36  ? -0.377  1.970   6.401   1.00 0.00 ? 36  TYR A HB3  3  
ATOM 6444  H HD1  . TYR A 1 36  ? -0.653  0.827   8.583   1.00 0.00 ? 36  TYR A HD1  3  
ATOM 6445  H HD2  . TYR A 1 36  ? 2.670   3.442   7.738   1.00 0.00 ? 36  TYR A HD2  3  
ATOM 6446  H HE1  . TYR A 1 36  ? -0.436  1.284   10.976  1.00 0.00 ? 36  TYR A HE1  3  
ATOM 6447  H HE2  . TYR A 1 36  ? 2.958   3.876   10.154  1.00 0.00 ? 36  TYR A HE2  3  
ATOM 6448  H HH   . TYR A 1 36  ? 0.687   3.776   12.176  1.00 0.00 ? 36  TYR A HH   3  
ATOM 6449  N N    . THR A 1 37  ? 3.615   1.449   5.611   1.00 0.00 ? 37  THR A N    3  
ATOM 6450  C CA   . THR A 1 37  ? 5.043   1.232   5.416   1.00 0.00 ? 37  THR A CA   3  
ATOM 6451  C C    . THR A 1 37  ? 5.571   2.676   5.526   1.00 0.00 ? 37  THR A C    3  
ATOM 6452  O O    . THR A 1 37  ? 5.406   3.457   4.579   1.00 0.00 ? 37  THR A O    3  
ATOM 6453  C CB   . THR A 1 37  ? 5.182   0.607   4.004   1.00 0.00 ? 37  THR A CB   3  
ATOM 6454  O OG1  . THR A 1 37  ? 4.563   -0.668  3.958   1.00 0.00 ? 37  THR A OG1  3  
ATOM 6455  C CG2  . THR A 1 37  ? 6.578   0.353   3.463   1.00 0.00 ? 37  THR A CG2  3  
ATOM 6456  H H    . THR A 1 37  ? 3.262   2.336   5.285   1.00 0.00 ? 37  THR A H    3  
ATOM 6457  H HA   . THR A 1 37  ? 5.456   0.540   6.182   1.00 0.00 ? 37  THR A HA   3  
ATOM 6458  H HB   . THR A 1 37  ? 4.670   1.266   3.305   1.00 0.00 ? 37  THR A HB   3  
ATOM 6459  H HG1  . THR A 1 37  ? 4.054   -0.786  4.779   1.00 0.00 ? 37  THR A HG1  3  
ATOM 6460  H HG21 . THR A 1 37  ? 6.506   0.153   2.396   1.00 0.00 ? 37  THR A HG21 3  
ATOM 6461  H HG22 . THR A 1 37  ? 7.226   1.215   3.622   1.00 0.00 ? 37  THR A HG22 3  
ATOM 6462  H HG23 . THR A 1 37  ? 6.984   -0.539  3.940   1.00 0.00 ? 37  THR A HG23 3  
ATOM 6463  N N    . GLU A 1 38  ? 6.018   3.109   6.712   1.00 0.00 ? 38  GLU A N    3  
ATOM 6464  C CA   . GLU A 1 38  ? 6.276   4.535   6.983   1.00 0.00 ? 38  GLU A CA   3  
ATOM 6465  C C    . GLU A 1 38  ? 7.773   4.841   7.007   1.00 0.00 ? 38  GLU A C    3  
ATOM 6466  O O    . GLU A 1 38  ? 8.588   3.946   7.255   1.00 0.00 ? 38  GLU A O    3  
ATOM 6467  C CB   . GLU A 1 38  ? 5.540   5.063   8.235   1.00 0.00 ? 38  GLU A CB   3  
ATOM 6468  C CG   . GLU A 1 38  ? 6.128   4.650   9.597   1.00 0.00 ? 38  GLU A CG   3  
ATOM 6469  C CD   . GLU A 1 38  ? 5.500   5.409   10.778  1.00 0.00 ? 38  GLU A CD   3  
ATOM 6470  O OE1  . GLU A 1 38  ? 5.406   6.660   10.747  1.00 0.00 ? 38  GLU A OE1  3  
ATOM 6471  O OE2  . GLU A 1 38  ? 5.120   4.766   11.787  1.00 0.00 ? 38  GLU A OE2  3  
ATOM 6472  H H    . GLU A 1 38  ? 6.223   2.424   7.429   1.00 0.00 ? 38  GLU A H    3  
ATOM 6473  H HA   . GLU A 1 38  ? 5.860   5.109   6.160   1.00 0.00 ? 38  GLU A HA   3  
ATOM 6474  H HB2  . GLU A 1 38  ? 5.557   6.152   8.172   1.00 0.00 ? 38  GLU A HB2  3  
ATOM 6475  H HB3  . GLU A 1 38  ? 4.496   4.755   8.197   1.00 0.00 ? 38  GLU A HB3  3  
ATOM 6476  H HG2  . GLU A 1 38  ? 5.976   3.578   9.728   1.00 0.00 ? 38  GLU A HG2  3  
ATOM 6477  H HG3  . GLU A 1 38  ? 7.197   4.846   9.614   1.00 0.00 ? 38  GLU A HG3  3  
ATOM 6478  N N    . GLU A 1 39  ? 8.136   6.109   6.762   1.00 0.00 ? 39  GLU A N    3  
ATOM 6479  C CA   . GLU A 1 39  ? 9.533   6.534   6.885   1.00 0.00 ? 39  GLU A CA   3  
ATOM 6480  C C    . GLU A 1 39  ? 9.928   6.486   8.359   1.00 0.00 ? 39  GLU A C    3  
ATOM 6481  O O    . GLU A 1 39  ? 9.483   7.305   9.167   1.00 0.00 ? 39  GLU A O    3  
ATOM 6482  C CB   . GLU A 1 39  ? 9.845   7.914   6.267   1.00 0.00 ? 39  GLU A CB   3  
ATOM 6483  C CG   . GLU A 1 39  ? 11.380  8.089   6.174   1.00 0.00 ? 39  GLU A CG   3  
ATOM 6484  C CD   . GLU A 1 39  ? 11.880  9.450   5.673   1.00 0.00 ? 39  GLU A CD   3  
ATOM 6485  O OE1  . GLU A 1 39  ? 12.149  10.345  6.508   1.00 0.00 ? 39  GLU A OE1  3  
ATOM 6486  O OE2  . GLU A 1 39  ? 12.140  9.616   4.460   1.00 0.00 ? 39  GLU A OE2  3  
ATOM 6487  H H    . GLU A 1 39  ? 7.407   6.779   6.551   1.00 0.00 ? 39  GLU A H    3  
ATOM 6488  H HA   . GLU A 1 39  ? 10.128  5.797   6.345   1.00 0.00 ? 39  GLU A HA   3  
ATOM 6489  H HB2  . GLU A 1 39  ? 9.427   7.949   5.266   1.00 0.00 ? 39  GLU A HB2  3  
ATOM 6490  H HB3  . GLU A 1 39  ? 9.399   8.708   6.867   1.00 0.00 ? 39  GLU A HB3  3  
ATOM 6491  H HG2  . GLU A 1 39  ? 11.828  7.916   7.153   1.00 0.00 ? 39  GLU A HG2  3  
ATOM 6492  H HG3  . GLU A 1 39  ? 11.770  7.318   5.512   1.00 0.00 ? 39  GLU A HG3  3  
ATOM 6493  N N    . VAL A 1 40  ? 10.779  5.523   8.696   1.00 0.00 ? 40  VAL A N    3  
ATOM 6494  C CA   . VAL A 1 40  ? 11.347  5.373   10.023  1.00 0.00 ? 40  VAL A CA   3  
ATOM 6495  C C    . VAL A 1 40  ? 12.340  6.519   10.206  1.00 0.00 ? 40  VAL A C    3  
ATOM 6496  O O    . VAL A 1 40  ? 13.375  6.592   9.535   1.00 0.00 ? 40  VAL A O    3  
ATOM 6497  C CB   . VAL A 1 40  ? 11.910  3.946   10.194  1.00 0.00 ? 40  VAL A CB   3  
ATOM 6498  C CG1  . VAL A 1 40  ? 12.827  3.733   11.399  1.00 0.00 ? 40  VAL A CG1  3  
ATOM 6499  C CG2  . VAL A 1 40  ? 10.720  2.994   10.358  1.00 0.00 ? 40  VAL A CG2  3  
ATOM 6500  H H    . VAL A 1 40  ? 11.163  4.971   7.943   1.00 0.00 ? 40  VAL A H    3  
ATOM 6501  H HA   . VAL A 1 40  ? 10.542  5.500   10.749  1.00 0.00 ? 40  VAL A HA   3  
ATOM 6502  H HB   . VAL A 1 40  ? 12.475  3.661   9.308   1.00 0.00 ? 40  VAL A HB   3  
ATOM 6503  H HG11 . VAL A 1 40  ? 13.038  2.670   11.527  1.00 0.00 ? 40  VAL A HG11 3  
ATOM 6504  H HG12 . VAL A 1 40  ? 13.776  4.217   11.203  1.00 0.00 ? 40  VAL A HG12 3  
ATOM 6505  H HG13 . VAL A 1 40  ? 12.382  4.133   12.311  1.00 0.00 ? 40  VAL A HG13 3  
ATOM 6506  H HG21 . VAL A 1 40  ? 10.017  3.112   9.535   1.00 0.00 ? 40  VAL A HG21 3  
ATOM 6507  H HG22 . VAL A 1 40  ? 11.088  1.970   10.369  1.00 0.00 ? 40  VAL A HG22 3  
ATOM 6508  H HG23 . VAL A 1 40  ? 10.196  3.200   11.291  1.00 0.00 ? 40  VAL A HG23 3  
ATOM 6509  N N    . ARG A 1 41  ? 11.954  7.457   11.072  1.00 0.00 ? 41  ARG A N    3  
ATOM 6510  C CA   . ARG A 1 41  ? 12.674  8.664   11.427  1.00 0.00 ? 41  ARG A CA   3  
ATOM 6511  C C    . ARG A 1 41  ? 12.962  8.601   12.921  1.00 0.00 ? 41  ARG A C    3  
ATOM 6512  O O    . ARG A 1 41  ? 12.040  8.799   13.724  1.00 0.00 ? 41  ARG A O    3  
ATOM 6513  C CB   . ARG A 1 41  ? 11.786  9.870   11.092  1.00 0.00 ? 41  ARG A CB   3  
ATOM 6514  C CG   . ARG A 1 41  ? 11.540  10.050  9.591   1.00 0.00 ? 41  ARG A CG   3  
ATOM 6515  C CD   . ARG A 1 41  ? 10.271  10.883  9.388   1.00 0.00 ? 41  ARG A CD   3  
ATOM 6516  N NE   . ARG A 1 41  ? 10.255  11.554  8.078   1.00 0.00 ? 41  ARG A NE   3  
ATOM 6517  C CZ   . ARG A 1 41  ? 9.442   12.551  7.715   1.00 0.00 ? 41  ARG A CZ   3  
ATOM 6518  N NH1  . ARG A 1 41  ? 8.401   12.862  8.480   1.00 0.00 ? 41  ARG A NH1  3  
ATOM 6519  N NH2  . ARG A 1 41  ? 9.672   13.220  6.589   1.00 0.00 ? 41  ARG A NH2  3  
ATOM 6520  H H    . ARG A 1 41  ? 11.005  7.414   11.414  1.00 0.00 ? 41  ARG A H    3  
ATOM 6521  H HA   . ARG A 1 41  ? 13.606  8.704   10.861  1.00 0.00 ? 41  ARG A HA   3  
ATOM 6522  H HB2  . ARG A 1 41  ? 10.827  9.739   11.598  1.00 0.00 ? 41  ARG A HB2  3  
ATOM 6523  H HB3  . ARG A 1 41  ? 12.250  10.781  11.476  1.00 0.00 ? 41  ARG A HB3  3  
ATOM 6524  H HG2  . ARG A 1 41  ? 12.405  10.554  9.168   1.00 0.00 ? 41  ARG A HG2  3  
ATOM 6525  H HG3  . ARG A 1 41  ? 11.418  9.093   9.088   1.00 0.00 ? 41  ARG A HG3  3  
ATOM 6526  H HD2  . ARG A 1 41  ? 9.397   10.236  9.489   1.00 0.00 ? 41  ARG A HD2  3  
ATOM 6527  H HD3  . ARG A 1 41  ? 10.238  11.633  10.177  1.00 0.00 ? 41  ARG A HD3  3  
ATOM 6528  H HE   . ARG A 1 41  ? 10.981  11.227  7.435   1.00 0.00 ? 41  ARG A HE   3  
ATOM 6529  H HH11 . ARG A 1 41  ? 8.187   12.266  9.268   1.00 0.00 ? 41  ARG A HH11 3  
ATOM 6530  H HH12 . ARG A 1 41  ? 7.798   13.668  8.322   1.00 0.00 ? 41  ARG A HH12 3  
ATOM 6531  H HH21 . ARG A 1 41  ? 10.473  12.993  6.008   1.00 0.00 ? 41  ARG A HH21 3  
ATOM 6532  H HH22 . ARG A 1 41  ? 9.094   13.991  6.268   1.00 0.00 ? 41  ARG A HH22 3  
ATOM 6533  N N    . GLN A 1 42  ? 14.206  8.314   13.296  1.00 0.00 ? 42  GLN A N    3  
ATOM 6534  C CA   . GLN A 1 42  ? 14.640  8.289   14.686  1.00 0.00 ? 42  GLN A CA   3  
ATOM 6535  C C    . GLN A 1 42  ? 15.165  9.686   15.002  1.00 0.00 ? 42  GLN A C    3  
ATOM 6536  O O    . GLN A 1 42  ? 16.249  10.042  14.550  1.00 0.00 ? 42  GLN A O    3  
ATOM 6537  C CB   . GLN A 1 42  ? 15.706  7.189   14.886  1.00 0.00 ? 42  GLN A CB   3  
ATOM 6538  C CG   . GLN A 1 42  ? 15.809  6.690   16.328  1.00 0.00 ? 42  GLN A CG   3  
ATOM 6539  C CD   . GLN A 1 42  ? 14.683  5.699   16.608  1.00 0.00 ? 42  GLN A CD   3  
ATOM 6540  O OE1  . GLN A 1 42  ? 13.522  6.081   16.697  1.00 0.00 ? 42  GLN A OE1  3  
ATOM 6541  N NE2  . GLN A 1 42  ? 14.979  4.413   16.695  1.00 0.00 ? 42  GLN A NE2  3  
ATOM 6542  H H    . GLN A 1 42  ? 14.917  8.228   12.577  1.00 0.00 ? 42  GLN A H    3  
ATOM 6543  H HA   . GLN A 1 42  ? 13.781  8.077   15.323  1.00 0.00 ? 42  GLN A HA   3  
ATOM 6544  H HB2  . GLN A 1 42  ? 15.442  6.321   14.286  1.00 0.00 ? 42  GLN A HB2  3  
ATOM 6545  H HB3  . GLN A 1 42  ? 16.683  7.543   14.555  1.00 0.00 ? 42  GLN A HB3  3  
ATOM 6546  H HG2  . GLN A 1 42  ? 16.770  6.193   16.462  1.00 0.00 ? 42  GLN A HG2  3  
ATOM 6547  H HG3  . GLN A 1 42  ? 15.755  7.531   17.017  1.00 0.00 ? 42  GLN A HG3  3  
ATOM 6548  H HE21 . GLN A 1 42  ? 15.921  4.087   16.527  1.00 0.00 ? 42  GLN A HE21 3  
ATOM 6549  H HE22 . GLN A 1 42  ? 14.212  3.746   16.684  1.00 0.00 ? 42  GLN A HE22 3  
ATOM 6550  N N    . GLY A 1 43  ? 14.391  10.516  15.703  1.00 0.00 ? 43  GLY A N    3  
ATOM 6551  C CA   . GLY A 1 43  ? 14.741  11.902  16.012  1.00 0.00 ? 43  GLY A CA   3  
ATOM 6552  C C    . GLY A 1 43  ? 15.321  12.666  14.821  1.00 0.00 ? 43  GLY A C    3  
ATOM 6553  O O    . GLY A 1 43  ? 16.401  13.253  14.936  1.00 0.00 ? 43  GLY A O    3  
ATOM 6554  H H    . GLY A 1 43  ? 13.531  10.157  16.104  1.00 0.00 ? 43  GLY A H    3  
ATOM 6555  H HA2  . GLY A 1 43  ? 13.849  12.421  16.360  1.00 0.00 ? 43  GLY A HA2  3  
ATOM 6556  H HA3  . GLY A 1 43  ? 15.477  11.897  16.813  1.00 0.00 ? 43  GLY A HA3  3  
ATOM 6557  N N    . GLY A 1 44  ? 14.635  12.624  13.676  1.00 0.00 ? 44  GLY A N    3  
ATOM 6558  C CA   . GLY A 1 44  ? 15.014  13.298  12.437  1.00 0.00 ? 44  GLY A CA   3  
ATOM 6559  C C    . GLY A 1 44  ? 16.089  12.581  11.615  1.00 0.00 ? 44  GLY A C    3  
ATOM 6560  O O    . GLY A 1 44  ? 16.359  13.002  10.492  1.00 0.00 ? 44  GLY A O    3  
ATOM 6561  H H    . GLY A 1 44  ? 13.736  12.147  13.697  1.00 0.00 ? 44  GLY A H    3  
ATOM 6562  H HA2  . GLY A 1 44  ? 14.123  13.402  11.818  1.00 0.00 ? 44  GLY A HA2  3  
ATOM 6563  H HA3  . GLY A 1 44  ? 15.377  14.299  12.665  1.00 0.00 ? 44  GLY A HA3  3  
ATOM 6564  N N    . ARG A 1 45  ? 16.704  11.502  12.112  1.00 0.00 ? 45  ARG A N    3  
ATOM 6565  C CA   . ARG A 1 45  ? 17.583  10.679  11.286  1.00 0.00 ? 45  ARG A CA   3  
ATOM 6566  C C    . ARG A 1 45  ? 16.704  9.830   10.391  1.00 0.00 ? 45  ARG A C    3  
ATOM 6567  O O    . ARG A 1 45  ? 15.895  9.063   10.907  1.00 0.00 ? 45  ARG A O    3  
ATOM 6568  C CB   . ARG A 1 45  ? 18.501  9.765   12.110  1.00 0.00 ? 45  ARG A CB   3  
ATOM 6569  C CG   . ARG A 1 45  ? 19.554  10.529  12.914  1.00 0.00 ? 45  ARG A CG   3  
ATOM 6570  C CD   . ARG A 1 45  ? 19.066  10.980  14.286  1.00 0.00 ? 45  ARG A CD   3  
ATOM 6571  N NE   . ARG A 1 45  ? 20.124  11.756  14.938  1.00 0.00 ? 45  ARG A NE   3  
ATOM 6572  C CZ   . ARG A 1 45  ? 20.227  13.085  14.984  1.00 0.00 ? 45  ARG A CZ   3  
ATOM 6573  N NH1  . ARG A 1 45  ? 19.172  13.857  14.753  1.00 0.00 ? 45  ARG A NH1  3  
ATOM 6574  N NH2  . ARG A 1 45  ? 21.399  13.632  15.280  1.00 0.00 ? 45  ARG A NH2  3  
ATOM 6575  H H    . ARG A 1 45  ? 16.419  11.128  13.012  1.00 0.00 ? 45  ARG A H    3  
ATOM 6576  H HA   . ARG A 1 45  ? 18.204  11.327  10.672  1.00 0.00 ? 45  ARG A HA   3  
ATOM 6577  H HB2  . ARG A 1 45  ? 17.918  9.115   12.763  1.00 0.00 ? 45  ARG A HB2  3  
ATOM 6578  H HB3  . ARG A 1 45  ? 19.040  9.132   11.405  1.00 0.00 ? 45  ARG A HB3  3  
ATOM 6579  H HG2  . ARG A 1 45  ? 20.398  9.867   13.085  1.00 0.00 ? 45  ARG A HG2  3  
ATOM 6580  H HG3  . ARG A 1 45  ? 19.906  11.384  12.336  1.00 0.00 ? 45  ARG A HG3  3  
ATOM 6581  H HD2  . ARG A 1 45  ? 18.166  11.576  14.183  1.00 0.00 ? 45  ARG A HD2  3  
ATOM 6582  H HD3  . ARG A 1 45  ? 18.837  10.090  14.877  1.00 0.00 ? 45  ARG A HD3  3  
ATOM 6583  H HE   . ARG A 1 45  ? 20.936  11.189  15.186  1.00 0.00 ? 45  ARG A HE   3  
ATOM 6584  H HH11 . ARG A 1 45  ? 18.250  13.459  14.578  1.00 0.00 ? 45  ARG A HH11 3  
ATOM 6585  H HH12 . ARG A 1 45  ? 19.167  14.865  14.918  1.00 0.00 ? 45  ARG A HH12 3  
ATOM 6586  H HH21 . ARG A 1 45  ? 22.238  13.054  15.314  1.00 0.00 ? 45  ARG A HH21 3  
ATOM 6587  H HH22 . ARG A 1 45  ? 21.512  14.646  15.305  1.00 0.00 ? 45  ARG A HH22 3  
ATOM 6588  N N    . ARG A 1 46  ? 16.864  9.934   9.075   1.00 0.00 ? 46  ARG A N    3  
ATOM 6589  C CA   . ARG A 1 46  ? 16.415  8.899   8.147   1.00 0.00 ? 46  ARG A CA   3  
ATOM 6590  C C    . ARG A 1 46  ? 17.356  7.708   8.294   1.00 0.00 ? 46  ARG A C    3  
ATOM 6591  O O    . ARG A 1 46  ? 18.571  7.873   8.171   1.00 0.00 ? 46  ARG A O    3  
ATOM 6592  C CB   . ARG A 1 46  ? 16.351  9.442   6.705   1.00 0.00 ? 46  ARG A CB   3  
ATOM 6593  C CG   . ARG A 1 46  ? 17.612  10.155  6.187   1.00 0.00 ? 46  ARG A CG   3  
ATOM 6594  C CD   . ARG A 1 46  ? 17.276  11.187  5.105   1.00 0.00 ? 46  ARG A CD   3  
ATOM 6595  N NE   . ARG A 1 46  ? 17.215  10.613  3.749   1.00 0.00 ? 46  ARG A NE   3  
ATOM 6596  C CZ   . ARG A 1 46  ? 17.866  11.085  2.674   1.00 0.00 ? 46  ARG A CZ   3  
ATOM 6597  N NH1  . ARG A 1 46  ? 18.704  12.114  2.772   1.00 0.00 ? 46  ARG A NH1  3  
ATOM 6598  N NH2  . ARG A 1 46  ? 17.672  10.519  1.490   1.00 0.00 ? 46  ARG A NH2  3  
ATOM 6599  H H    . ARG A 1 46  ? 17.551  10.594  8.740   1.00 0.00 ? 46  ARG A H    3  
ATOM 6600  H HA   . ARG A 1 46  ? 15.409  8.592   8.441   1.00 0.00 ? 46  ARG A HA   3  
ATOM 6601  H HB2  . ARG A 1 46  ? 16.125  8.630   6.020   1.00 0.00 ? 46  ARG A HB2  3  
ATOM 6602  H HB3  . ARG A 1 46  ? 15.513  10.133  6.668   1.00 0.00 ? 46  ARG A HB3  3  
ATOM 6603  H HG2  . ARG A 1 46  ? 18.083  10.703  6.997   1.00 0.00 ? 46  ARG A HG2  3  
ATOM 6604  H HG3  . ARG A 1 46  ? 18.331  9.425   5.811   1.00 0.00 ? 46  ARG A HG3  3  
ATOM 6605  H HD2  . ARG A 1 46  ? 16.330  11.674  5.344   1.00 0.00 ? 46  ARG A HD2  3  
ATOM 6606  H HD3  . ARG A 1 46  ? 18.038  11.956  5.142   1.00 0.00 ? 46  ARG A HD3  3  
ATOM 6607  H HE   . ARG A 1 46  ? 16.564  9.841   3.637   1.00 0.00 ? 46  ARG A HE   3  
ATOM 6608  H HH11 . ARG A 1 46  ? 18.839  12.573  3.663   1.00 0.00 ? 46  ARG A HH11 3  
ATOM 6609  H HH12 . ARG A 1 46  ? 19.312  12.401  2.006   1.00 0.00 ? 46  ARG A HH12 3  
ATOM 6610  H HH21 . ARG A 1 46  ? 17.063  9.702   1.422   1.00 0.00 ? 46  ARG A HH21 3  
ATOM 6611  H HH22 . ARG A 1 46  ? 17.988  10.964  0.628   1.00 0.00 ? 46  ARG A HH22 3  
ATOM 6612  N N    . ILE A 1 47  ? 16.813  6.528   8.592   1.00 0.00 ? 47  ILE A N    3  
ATOM 6613  C CA   . ILE A 1 47  ? 17.589  5.298   8.784   1.00 0.00 ? 47  ILE A CA   3  
ATOM 6614  C C    . ILE A 1 47  ? 16.991  4.101   8.045   1.00 0.00 ? 47  ILE A C    3  
ATOM 6615  O O    . ILE A 1 47  ? 17.639  3.056   7.948   1.00 0.00 ? 47  ILE A O    3  
ATOM 6616  C CB   . ILE A 1 47  ? 17.761  4.987   10.290  1.00 0.00 ? 47  ILE A CB   3  
ATOM 6617  C CG1  . ILE A 1 47  ? 16.441  4.746   11.045  1.00 0.00 ? 47  ILE A CG1  3  
ATOM 6618  C CG2  . ILE A 1 47  ? 18.671  6.028   10.971  1.00 0.00 ? 47  ILE A CG2  3  
ATOM 6619  C CD1  . ILE A 1 47  ? 15.779  6.000   11.613  1.00 0.00 ? 47  ILE A CD1  3  
ATOM 6620  H H    . ILE A 1 47  ? 15.822  6.489   8.785   1.00 0.00 ? 47  ILE A H    3  
ATOM 6621  H HA   . ILE A 1 47  ? 18.577  5.433   8.337   1.00 0.00 ? 47  ILE A HA   3  
ATOM 6622  H HB   . ILE A 1 47  ? 18.260  4.027   10.357  1.00 0.00 ? 47  ILE A HB   3  
ATOM 6623  H HG12 . ILE A 1 47  ? 15.744  4.238   10.382  1.00 0.00 ? 47  ILE A HG12 3  
ATOM 6624  H HG13 . ILE A 1 47  ? 16.629  4.065   11.871  1.00 0.00 ? 47  ILE A HG13 3  
ATOM 6625  H HG21 . ILE A 1 47  ? 18.218  7.021   10.941  1.00 0.00 ? 47  ILE A HG21 3  
ATOM 6626  H HG22 . ILE A 1 47  ? 18.834  5.755   12.014  1.00 0.00 ? 47  ILE A HG22 3  
ATOM 6627  H HG23 . ILE A 1 47  ? 19.635  6.068   10.464  1.00 0.00 ? 47  ILE A HG23 3  
ATOM 6628  H HD11 . ILE A 1 47  ? 15.484  6.649   10.802  1.00 0.00 ? 47  ILE A HD11 3  
ATOM 6629  H HD12 . ILE A 1 47  ? 14.897  5.732   12.188  1.00 0.00 ? 47  ILE A HD12 3  
ATOM 6630  H HD13 . ILE A 1 47  ? 16.465  6.526   12.270  1.00 0.00 ? 47  ILE A HD13 3  
ATOM 6631  N N    . GLY A 1 48  ? 15.774  4.235   7.519   1.00 0.00 ? 48  GLY A N    3  
ATOM 6632  C CA   . GLY A 1 48  ? 15.091  3.150   6.849   1.00 0.00 ? 48  GLY A CA   3  
ATOM 6633  C C    . GLY A 1 48  ? 13.606  3.447   6.753   1.00 0.00 ? 48  GLY A C    3  
ATOM 6634  O O    . GLY A 1 48  ? 13.184  4.597   6.908   1.00 0.00 ? 48  GLY A O    3  
ATOM 6635  H H    . GLY A 1 48  ? 15.229  5.071   7.680   1.00 0.00 ? 48  GLY A H    3  
ATOM 6636  H HA2  . GLY A 1 48  ? 15.499  3.023   5.847   1.00 0.00 ? 48  GLY A HA2  3  
ATOM 6637  H HA3  . GLY A 1 48  ? 15.247  2.240   7.424   1.00 0.00 ? 48  GLY A HA3  3  
ATOM 6638  N N    . PHE A 1 49  ? 12.824  2.418   6.465   1.00 0.00 ? 49  PHE A N    3  
ATOM 6639  C CA   . PHE A 1 49  ? 11.375  2.403   6.544   1.00 0.00 ? 49  PHE A CA   3  
ATOM 6640  C C    . PHE A 1 49  ? 11.045  1.032   7.133   1.00 0.00 ? 49  PHE A C    3  
ATOM 6641  O O    . PHE A 1 49  ? 11.666  0.053   6.716   1.00 0.00 ? 49  PHE A O    3  
ATOM 6642  C CB   . PHE A 1 49  ? 10.731  2.551   5.147   1.00 0.00 ? 49  PHE A CB   3  
ATOM 6643  C CG   . PHE A 1 49  ? 10.837  3.876   4.406   1.00 0.00 ? 49  PHE A CG   3  
ATOM 6644  C CD1  . PHE A 1 49  ? 12.072  4.354   3.927   1.00 0.00 ? 49  PHE A CD1  3  
ATOM 6645  C CD2  . PHE A 1 49  ? 9.662   4.588   4.096   1.00 0.00 ? 49  PHE A CD2  3  
ATOM 6646  C CE1  . PHE A 1 49  ? 12.140  5.577   3.235   1.00 0.00 ? 49  PHE A CE1  3  
ATOM 6647  C CE2  . PHE A 1 49  ? 9.725   5.805   3.395   1.00 0.00 ? 49  PHE A CE2  3  
ATOM 6648  C CZ   . PHE A 1 49  ? 10.967  6.309   2.975   1.00 0.00 ? 49  PHE A CZ   3  
ATOM 6649  H H    . PHE A 1 49  ? 13.238  1.492   6.395   1.00 0.00 ? 49  PHE A H    3  
ATOM 6650  H HA   . PHE A 1 49  ? 11.018  3.189   7.205   1.00 0.00 ? 49  PHE A HA   3  
ATOM 6651  H HB2  . PHE A 1 49  ? 11.088  1.764   4.488   1.00 0.00 ? 49  PHE A HB2  3  
ATOM 6652  H HB3  . PHE A 1 49  ? 9.673   2.366   5.292   1.00 0.00 ? 49  PHE A HB3  3  
ATOM 6653  H HD1  . PHE A 1 49  ? 12.969  3.769   4.063   1.00 0.00 ? 49  PHE A HD1  3  
ATOM 6654  H HD2  . PHE A 1 49  ? 8.698   4.192   4.384   1.00 0.00 ? 49  PHE A HD2  3  
ATOM 6655  H HE1  . PHE A 1 49  ? 13.090  5.937   2.872   1.00 0.00 ? 49  PHE A HE1  3  
ATOM 6656  H HE2  . PHE A 1 49  ? 8.816   6.340   3.160   1.00 0.00 ? 49  PHE A HE2  3  
ATOM 6657  H HZ   . PHE A 1 49  ? 11.010  7.236   2.421   1.00 0.00 ? 49  PHE A HZ   3  
ATOM 6658  N N    . ASP A 1 50  ? 10.032  0.911   7.989   1.00 0.00 ? 50  ASP A N    3  
ATOM 6659  C CA   . ASP A 1 50  ? 9.537   -0.380  8.492   1.00 0.00 ? 50  ASP A CA   3  
ATOM 6660  C C    . ASP A 1 50  ? 8.110   -0.545  7.954   1.00 0.00 ? 50  ASP A C    3  
ATOM 6661  O O    . ASP A 1 50  ? 7.410   0.450   7.732   1.00 0.00 ? 50  ASP A O    3  
ATOM 6662  C CB   . ASP A 1 50  ? 9.578   -0.484  10.037  1.00 0.00 ? 50  ASP A CB   3  
ATOM 6663  C CG   . ASP A 1 50  ? 10.893  -1.036  10.622  1.00 0.00 ? 50  ASP A CG   3  
ATOM 6664  O OD1  . ASP A 1 50  ? 11.981  -0.454  10.385  1.00 0.00 ? 50  ASP A OD1  3  
ATOM 6665  O OD2  . ASP A 1 50  ? 10.839  -2.019  11.397  1.00 0.00 ? 50  ASP A OD2  3  
ATOM 6666  H H    . ASP A 1 50  ? 9.451   1.721   8.178   1.00 0.00 ? 50  ASP A H    3  
ATOM 6667  H HA   . ASP A 1 50  ? 10.156  -1.185  8.094   1.00 0.00 ? 50  ASP A HA   3  
ATOM 6668  H HB2  . ASP A 1 50  ? 9.358   0.485   10.484  1.00 0.00 ? 50  ASP A HB2  3  
ATOM 6669  H HB3  . ASP A 1 50  ? 8.776   -1.153  10.358  1.00 0.00 ? 50  ASP A HB3  3  
ATOM 6670  N N    . VAL A 1 51  ? 7.704   -1.776  7.644   1.00 0.00 ? 51  VAL A N    3  
ATOM 6671  C CA   . VAL A 1 51  ? 6.307   -2.127  7.379   1.00 0.00 ? 51  VAL A CA   3  
ATOM 6672  C C    . VAL A 1 51  ? 5.565   -1.864  8.701   1.00 0.00 ? 51  VAL A C    3  
ATOM 6673  O O    . VAL A 1 51  ? 6.168   -2.022  9.768   1.00 0.00 ? 51  VAL A O    3  
ATOM 6674  C CB   . VAL A 1 51  ? 6.185   -3.631  7.078   1.00 0.00 ? 51  VAL A CB   3  
ATOM 6675  C CG1  . VAL A 1 51  ? 4.866   -4.105  6.477   1.00 0.00 ? 51  VAL A CG1  3  
ATOM 6676  C CG2  . VAL A 1 51  ? 7.271   -4.381  6.302   1.00 0.00 ? 51  VAL A CG2  3  
ATOM 6677  H H    . VAL A 1 51  ? 8.326   -2.527  7.919   1.00 0.00 ? 51  VAL A H    3  
ATOM 6678  H HA   . VAL A 1 51  ? 5.885   -1.539  6.564   1.00 0.00 ? 51  VAL A HA   3  
ATOM 6679  H HB   . VAL A 1 51  ? 6.228   -4.020  8.061   1.00 0.00 ? 51  VAL A HB   3  
ATOM 6680  H HG11 . VAL A 1 51  ? 4.025   -3.652  6.995   1.00 0.00 ? 51  VAL A HG11 3  
ATOM 6681  H HG12 . VAL A 1 51  ? 4.836   -3.849  5.417   1.00 0.00 ? 51  VAL A HG12 3  
ATOM 6682  H HG13 . VAL A 1 51  ? 4.818   -5.192  6.623   1.00 0.00 ? 51  VAL A HG13 3  
ATOM 6683  H HG21 . VAL A 1 51  ? 8.209   -4.317  6.839   1.00 0.00 ? 51  VAL A HG21 3  
ATOM 6684  H HG22 . VAL A 1 51  ? 7.013   -5.446  6.246   1.00 0.00 ? 51  VAL A HG22 3  
ATOM 6685  H HG23 . VAL A 1 51  ? 7.354   -3.977  5.295   1.00 0.00 ? 51  VAL A HG23 3  
ATOM 6686  N N    . VAL A 1 52  ? 4.265   -1.584  8.676   1.00 0.00 ? 52  VAL A N    3  
ATOM 6687  C CA   . VAL A 1 52  ? 3.462   -1.473  9.878   1.00 0.00 ? 52  VAL A CA   3  
ATOM 6688  C C    . VAL A 1 52  ? 2.066   -2.015  9.551   1.00 0.00 ? 52  VAL A C    3  
ATOM 6689  O O    . VAL A 1 52  ? 1.437   -1.566  8.600   1.00 0.00 ? 52  VAL A O    3  
ATOM 6690  C CB   . VAL A 1 52  ? 3.438   -0.004  10.353  1.00 0.00 ? 52  VAL A CB   3  
ATOM 6691  C CG1  . VAL A 1 52  ? 2.993   0.034   11.815  1.00 0.00 ? 52  VAL A CG1  3  
ATOM 6692  C CG2  . VAL A 1 52  ? 4.763   0.777   10.254  1.00 0.00 ? 52  VAL A CG2  3  
ATOM 6693  H H    . VAL A 1 52  ? 3.774   -1.413  7.803   1.00 0.00 ? 52  VAL A H    3  
ATOM 6694  H HA   . VAL A 1 52  ? 3.912   -2.093  10.652  1.00 0.00 ? 52  VAL A HA   3  
ATOM 6695  H HB   . VAL A 1 52  ? 2.712   0.525   9.745   1.00 0.00 ? 52  VAL A HB   3  
ATOM 6696  H HG11 . VAL A 1 52  ? 3.047   1.053   12.187  1.00 0.00 ? 52  VAL A HG11 3  
ATOM 6697  H HG12 . VAL A 1 52  ? 1.965   -0.306  11.876  1.00 0.00 ? 52  VAL A HG12 3  
ATOM 6698  H HG13 . VAL A 1 52  ? 3.635   -0.604  12.425  1.00 0.00 ? 52  VAL A HG13 3  
ATOM 6699  H HG21 . VAL A 1 52  ? 5.082   0.866   9.216   1.00 0.00 ? 52  VAL A HG21 3  
ATOM 6700  H HG22 . VAL A 1 52  ? 4.630   1.788   10.638  1.00 0.00 ? 52  VAL A HG22 3  
ATOM 6701  H HG23 . VAL A 1 52  ? 5.542   0.283   10.835  1.00 0.00 ? 52  VAL A HG23 3  
ATOM 6702  N N    . THR A 1 53  ? 1.569   -3.011  10.282  1.00 0.00 ? 53  THR A N    3  
ATOM 6703  C CA   . THR A 1 53  ? 0.184   -3.478  10.133  1.00 0.00 ? 53  THR A CA   3  
ATOM 6704  C C    . THR A 1 53  ? -0.781  -2.446  10.723  1.00 0.00 ? 53  THR A C    3  
ATOM 6705  O O    . THR A 1 53  ? -0.360  -1.467  11.338  1.00 0.00 ? 53  THR A O    3  
ATOM 6706  C CB   . THR A 1 53  ? 0.001   -4.819  10.866  1.00 0.00 ? 53  THR A CB   3  
ATOM 6707  O OG1  . THR A 1 53  ? 0.361   -4.700  12.229  1.00 0.00 ? 53  THR A OG1  3  
ATOM 6708  C CG2  . THR A 1 53  ? 0.808   -5.942  10.235  1.00 0.00 ? 53  THR A CG2  3  
ATOM 6709  H H    . THR A 1 53  ? 2.113   -3.312  11.084  1.00 0.00 ? 53  THR A H    3  
ATOM 6710  H HA   . THR A 1 53  ? -0.059  -3.600  9.067   1.00 0.00 ? 53  THR A HA   3  
ATOM 6711  H HB   . THR A 1 53  ? -1.049  -5.108  10.810  1.00 0.00 ? 53  THR A HB   3  
ATOM 6712  H HG1  . THR A 1 53  ? 1.289   -4.426  12.256  1.00 0.00 ? 53  THR A HG1  3  
ATOM 6713  H HG21 . THR A 1 53  ? 0.611   -6.877  10.758  1.00 0.00 ? 53  THR A HG21 3  
ATOM 6714  H HG22 . THR A 1 53  ? 0.497   -6.050  9.199   1.00 0.00 ? 53  THR A HG22 3  
ATOM 6715  H HG23 . THR A 1 53  ? 1.871   -5.720  10.271  1.00 0.00 ? 53  THR A HG23 3  
ATOM 6716  N N    . LEU A 1 54  ? -2.085  -2.712  10.654  1.00 0.00 ? 54  LEU A N    3  
ATOM 6717  C CA   . LEU A 1 54  ? -3.087  -2.012  11.455  1.00 0.00 ? 54  LEU A CA   3  
ATOM 6718  C C    . LEU A 1 54  ? -3.297  -2.692  12.809  1.00 0.00 ? 54  LEU A C    3  
ATOM 6719  O O    . LEU A 1 54  ? -3.927  -2.108  13.696  1.00 0.00 ? 54  LEU A O    3  
ATOM 6720  C CB   . LEU A 1 54  ? -4.442  -1.969  10.724  1.00 0.00 ? 54  LEU A CB   3  
ATOM 6721  C CG   . LEU A 1 54  ? -4.487  -1.312  9.342   1.00 0.00 ? 54  LEU A CG   3  
ATOM 6722  C CD1  . LEU A 1 54  ? -4.128  0.182   9.347   1.00 0.00 ? 54  LEU A CD1  3  
ATOM 6723  C CD2  . LEU A 1 54  ? -3.682  -2.052  8.306   1.00 0.00 ? 54  LEU A CD2  3  
ATOM 6724  H H    . LEU A 1 54  ? -2.415  -3.462  10.063  1.00 0.00 ? 54  LEU A H    3  
ATOM 6725  H HA   . LEU A 1 54  ? -2.737  -1.001  11.649  1.00 0.00 ? 54  LEU A HA   3  
ATOM 6726  H HB2  . LEU A 1 54  ? -4.801  -2.990  10.590  1.00 0.00 ? 54  LEU A HB2  3  
ATOM 6727  H HB3  . LEU A 1 54  ? -5.163  -1.453  11.361  1.00 0.00 ? 54  LEU A HB3  3  
ATOM 6728  H HG   . LEU A 1 54  ? -5.498  -1.463  8.986   1.00 0.00 ? 54  LEU A HG   3  
ATOM 6729  H HD11 . LEU A 1 54  ? -4.277  0.601   8.350   1.00 0.00 ? 54  LEU A HD11 3  
ATOM 6730  H HD12 . LEU A 1 54  ? -4.765  0.710   10.059  1.00 0.00 ? 54  LEU A HD12 3  
ATOM 6731  H HD13 . LEU A 1 54  ? -3.081  0.334   9.626   1.00 0.00 ? 54  LEU A HD13 3  
ATOM 6732  H HD21 . LEU A 1 54  ? -2.670  -1.658  8.225   1.00 0.00 ? 54  LEU A HD21 3  
ATOM 6733  H HD22 . LEU A 1 54  ? -3.676  -3.107  8.560   1.00 0.00 ? 54  LEU A HD22 3  
ATOM 6734  H HD23 . LEU A 1 54  ? -4.223  -1.948  7.376   1.00 0.00 ? 54  LEU A HD23 3  
ATOM 6735  N N    . SER A 1 55  ? -2.804  -3.920  12.985  1.00 0.00 ? 55  SER A N    3  
ATOM 6736  C CA   . SER A 1 55  ? -3.025  -4.718  14.173  1.00 0.00 ? 55  SER A CA   3  
ATOM 6737  C C    . SER A 1 55  ? -2.221  -4.070  15.296  1.00 0.00 ? 55  SER A C    3  
ATOM 6738  O O    . SER A 1 55  ? -2.775  -3.718  16.338  1.00 0.00 ? 55  SER A O    3  
ATOM 6739  C CB   . SER A 1 55  ? -2.613  -6.175  13.892  1.00 0.00 ? 55  SER A CB   3  
ATOM 6740  O OG   . SER A 1 55  ? -3.128  -7.062  14.866  1.00 0.00 ? 55  SER A OG   3  
ATOM 6741  H H    . SER A 1 55  ? -2.235  -4.339  12.272  1.00 0.00 ? 55  SER A H    3  
ATOM 6742  H HA   . SER A 1 55  ? -4.088  -4.688  14.415  1.00 0.00 ? 55  SER A HA   3  
ATOM 6743  H HB2  . SER A 1 55  ? -2.991  -6.485  12.916  1.00 0.00 ? 55  SER A HB2  3  
ATOM 6744  H HB3  . SER A 1 55  ? -1.525  -6.253  13.875  1.00 0.00 ? 55  SER A HB3  3  
ATOM 6745  H HG   . SER A 1 55  ? -4.050  -7.293  14.608  1.00 0.00 ? 55  SER A HG   3  
ATOM 6746  N N    . GLY A 1 56  ? -0.939  -3.799  15.050  1.00 0.00 ? 56  GLY A N    3  
ATOM 6747  C CA   . GLY A 1 56  ? -0.002  -3.389  16.082  1.00 0.00 ? 56  GLY A CA   3  
ATOM 6748  C C    . GLY A 1 56  ? 1.286   -4.196  15.997  1.00 0.00 ? 56  GLY A C    3  
ATOM 6749  O O    . GLY A 1 56  ? 1.713   -4.746  17.010  1.00 0.00 ? 56  GLY A O    3  
ATOM 6750  H H    . GLY A 1 56  ? -0.569  -3.938  14.117  1.00 0.00 ? 56  GLY A H    3  
ATOM 6751  H HA2  . GLY A 1 56  ? 0.223   -2.327  15.995  1.00 0.00 ? 56  GLY A HA2  3  
ATOM 6752  H HA3  . GLY A 1 56  ? -0.462  -3.568  17.045  1.00 0.00 ? 56  GLY A HA3  3  
ATOM 6753  N N    . THR A 1 57  ? 1.875   -4.301  14.806  1.00 0.00 ? 57  THR A N    3  
ATOM 6754  C CA   . THR A 1 57  ? 3.113   -5.000  14.510  1.00 0.00 ? 57  THR A CA   3  
ATOM 6755  C C    . THR A 1 57  ? 3.841   -4.210  13.422  1.00 0.00 ? 57  THR A C    3  
ATOM 6756  O O    . THR A 1 57  ? 3.195   -3.639  12.537  1.00 0.00 ? 57  THR A O    3  
ATOM 6757  C CB   . THR A 1 57  ? 2.805   -6.432  14.052  1.00 0.00 ? 57  THR A CB   3  
ATOM 6758  O OG1  . THR A 1 57  ? 2.166   -7.151  15.084  1.00 0.00 ? 57  THR A OG1  3  
ATOM 6759  C CG2  . THR A 1 57  ? 4.067   -7.185  13.663  1.00 0.00 ? 57  THR A CG2  3  
ATOM 6760  H H    . THR A 1 57  ? 1.552   -3.726  14.042  1.00 0.00 ? 57  THR A H    3  
ATOM 6761  H HA   . THR A 1 57  ? 3.729   -5.035  15.406  1.00 0.00 ? 57  THR A HA   3  
ATOM 6762  H HB   . THR A 1 57  ? 2.162   -6.393  13.178  1.00 0.00 ? 57  THR A HB   3  
ATOM 6763  H HG1  . THR A 1 57  ? 1.724   -7.914  14.654  1.00 0.00 ? 57  THR A HG1  3  
ATOM 6764  H HG21 . THR A 1 57  ? 3.846   -8.241  13.526  1.00 0.00 ? 57  THR A HG21 3  
ATOM 6765  H HG22 . THR A 1 57  ? 4.441   -6.784  12.723  1.00 0.00 ? 57  THR A HG22 3  
ATOM 6766  H HG23 . THR A 1 57  ? 4.821   -7.054  14.434  1.00 0.00 ? 57  THR A HG23 3  
ATOM 6767  N N    . ARG A 1 58  ? 5.172   -4.240  13.471  1.00 0.00 ? 58  ARG A N    3  
ATOM 6768  C CA   . ARG A 1 58  ? 6.131   -3.552  12.606  1.00 0.00 ? 58  ARG A CA   3  
ATOM 6769  C C    . ARG A 1 58  ? 6.988   -4.592  11.888  1.00 0.00 ? 58  ARG A C    3  
ATOM 6770  O O    . ARG A 1 58  ? 7.076   -5.716  12.379  1.00 0.00 ? 58  ARG A O    3  
ATOM 6771  C CB   . ARG A 1 58  ? 7.010   -2.618  13.463  1.00 0.00 ? 58  ARG A CB   3  
ATOM 6772  C CG   . ARG A 1 58  ? 7.852   -3.392  14.500  1.00 0.00 ? 58  ARG A CG   3  
ATOM 6773  C CD   . ARG A 1 58  ? 8.562   -2.457  15.478  1.00 0.00 ? 58  ARG A CD   3  
ATOM 6774  N NE   . ARG A 1 58  ? 9.141   -3.214  16.603  1.00 0.00 ? 58  ARG A NE   3  
ATOM 6775  C CZ   . ARG A 1 58  ? 9.541   -2.694  17.769  1.00 0.00 ? 58  ARG A CZ   3  
ATOM 6776  N NH1  . ARG A 1 58  ? 9.501   -1.383  17.975  1.00 0.00 ? 58  ARG A NH1  3  
ATOM 6777  N NH2  . ARG A 1 58  ? 9.979   -3.498  18.729  1.00 0.00 ? 58  ARG A NH2  3  
ATOM 6778  H H    . ARG A 1 58  ? 5.570   -4.919  14.103  1.00 0.00 ? 58  ARG A H    3  
ATOM 6779  H HA   . ARG A 1 58  ? 5.587   -2.959  11.873  1.00 0.00 ? 58  ARG A HA   3  
ATOM 6780  H HB2  . ARG A 1 58  ? 7.677   -2.052  12.810  1.00 0.00 ? 58  ARG A HB2  3  
ATOM 6781  H HB3  . ARG A 1 58  ? 6.362   -1.909  13.982  1.00 0.00 ? 58  ARG A HB3  3  
ATOM 6782  H HG2  . ARG A 1 58  ? 7.203   -4.050  15.077  1.00 0.00 ? 58  ARG A HG2  3  
ATOM 6783  H HG3  . ARG A 1 58  ? 8.600   -4.002  13.991  1.00 0.00 ? 58  ARG A HG3  3  
ATOM 6784  H HD2  . ARG A 1 58  ? 9.338   -1.900  14.954  1.00 0.00 ? 58  ARG A HD2  3  
ATOM 6785  H HD3  . ARG A 1 58  ? 7.837   -1.746  15.868  1.00 0.00 ? 58  ARG A HD3  3  
ATOM 6786  H HE   . ARG A 1 58  ? 9.185   -4.218  16.477  1.00 0.00 ? 58  ARG A HE   3  
ATOM 6787  H HH11 . ARG A 1 58  ? 9.256   -0.754  17.211  1.00 0.00 ? 58  ARG A HH11 3  
ATOM 6788  H HH12 . ARG A 1 58  ? 9.669   -0.974  18.893  1.00 0.00 ? 58  ARG A HH12 3  
ATOM 6789  H HH21 . ARG A 1 58  ? 9.912   -4.506  18.626  1.00 0.00 ? 58  ARG A HH21 3  
ATOM 6790  H HH22 . ARG A 1 58  ? 10.451  -3.131  19.555  1.00 0.00 ? 58  ARG A HH22 3  
ATOM 6791  N N    . GLY A 1 59  ? 7.659   -4.234  10.792  1.00 0.00 ? 59  GLY A N    3  
ATOM 6792  C CA   . GLY A 1 59  ? 8.475   -5.164  10.014  1.00 0.00 ? 59  GLY A CA   3  
ATOM 6793  C C    . GLY A 1 59  ? 9.736   -4.496  9.471   1.00 0.00 ? 59  GLY A C    3  
ATOM 6794  O O    . GLY A 1 59  ? 9.627   -3.420  8.888   1.00 0.00 ? 59  GLY A O    3  
ATOM 6795  H H    . GLY A 1 59  ? 7.555   -3.288  10.437  1.00 0.00 ? 59  GLY A H    3  
ATOM 6796  H HA2  . GLY A 1 59  ? 8.729   -6.034  10.617  1.00 0.00 ? 59  GLY A HA2  3  
ATOM 6797  H HA3  . GLY A 1 59  ? 7.903   -5.519  9.163   1.00 0.00 ? 59  GLY A HA3  3  
ATOM 6798  N N    . PRO A 1 60  ? 10.912  -5.135  9.580   1.00 0.00 ? 60  PRO A N    3  
ATOM 6799  C CA   . PRO A 1 60  ? 12.231  -4.602  9.211   1.00 0.00 ? 60  PRO A CA   3  
ATOM 6800  C C    . PRO A 1 60  ? 12.456  -4.475  7.683   1.00 0.00 ? 60  PRO A C    3  
ATOM 6801  O O    . PRO A 1 60  ? 13.305  -5.154  7.104   1.00 0.00 ? 60  PRO A O    3  
ATOM 6802  C CB   . PRO A 1 60  ? 13.198  -5.589  9.889   1.00 0.00 ? 60  PRO A CB   3  
ATOM 6803  C CG   . PRO A 1 60  ? 12.451  -6.931  9.872   1.00 0.00 ? 60  PRO A CG   3  
ATOM 6804  C CD   . PRO A 1 60  ? 11.014  -6.496  10.089  1.00 0.00 ? 60  PRO A CD   3  
ATOM 6805  H HA   . PRO A 1 60  ? 12.352  -3.609  9.650   1.00 0.00 ? 60  PRO A HA   3  
ATOM 6806  H HB2  . PRO A 1 60  ? 14.169  -5.643  9.402   1.00 0.00 ? 60  PRO A HB2  3  
ATOM 6807  H HB3  . PRO A 1 60  ? 13.342  -5.286  10.927  1.00 0.00 ? 60  PRO A HB3  3  
ATOM 6808  H HG2  . PRO A 1 60  ? 12.499  -7.439  8.908   1.00 0.00 ? 60  PRO A HG2  3  
ATOM 6809  H HG3  . PRO A 1 60  ? 12.790  -7.590  10.672  1.00 0.00 ? 60  PRO A HG3  3  
ATOM 6810  H HD2  . PRO A 1 60  ? 10.315  -7.155  9.559   1.00 0.00 ? 60  PRO A HD2  3  
ATOM 6811  H HD3  . PRO A 1 60  ? 10.786  -6.505  11.154  1.00 0.00 ? 60  PRO A HD3  3  
ATOM 6812  N N    . LEU A 1 61  ? 11.646  -3.652  7.005   1.00 0.00 ? 61  LEU A N    3  
ATOM 6813  C CA   . LEU A 1 61  ? 11.533  -3.542  5.542   1.00 0.00 ? 61  LEU A CA   3  
ATOM 6814  C C    . LEU A 1 61  ? 12.813  -3.022  4.922   1.00 0.00 ? 61  LEU A C    3  
ATOM 6815  O O    . LEU A 1 61  ? 13.424  -3.767  4.166   1.00 0.00 ? 61  LEU A O    3  
ATOM 6816  C CB   . LEU A 1 61  ? 10.298  -2.697  5.192   1.00 0.00 ? 61  LEU A CB   3  
ATOM 6817  C CG   . LEU A 1 61  ? 9.658   -2.836  3.792   1.00 0.00 ? 61  LEU A CG   3  
ATOM 6818  C CD1  . LEU A 1 61  ? 10.180  -1.765  2.836   1.00 0.00 ? 61  LEU A CD1  3  
ATOM 6819  C CD2  . LEU A 1 61  ? 9.768   -4.246  3.189   1.00 0.00 ? 61  LEU A CD2  3  
ATOM 6820  H H    . LEU A 1 61  ? 10.988  -3.122  7.569   1.00 0.00 ? 61  LEU A H    3  
ATOM 6821  H HA   . LEU A 1 61  ? 11.412  -4.527  5.096   1.00 0.00 ? 61  LEU A HA   3  
ATOM 6822  H HB2  . LEU A 1 61  ? 9.524   -2.934  5.910   1.00 0.00 ? 61  LEU A HB2  3  
ATOM 6823  H HB3  . LEU A 1 61  ? 10.549  -1.659  5.358   1.00 0.00 ? 61  LEU A HB3  3  
ATOM 6824  H HG   . LEU A 1 61  ? 8.595   -2.628  3.908   1.00 0.00 ? 61  LEU A HG   3  
ATOM 6825  H HD11 . LEU A 1 61  ? 9.821   -1.969  1.827   1.00 0.00 ? 61  LEU A HD11 3  
ATOM 6826  H HD12 . LEU A 1 61  ? 9.777   -0.796  3.132   1.00 0.00 ? 61  LEU A HD12 3  
ATOM 6827  H HD13 . LEU A 1 61  ? 11.262  -1.719  2.862   1.00 0.00 ? 61  LEU A HD13 3  
ATOM 6828  H HD21 . LEU A 1 61  ? 9.243   -4.275  2.235   1.00 0.00 ? 61  LEU A HD21 3  
ATOM 6829  H HD22 . LEU A 1 61  ? 10.804  -4.525  3.013   1.00 0.00 ? 61  LEU A HD22 3  
ATOM 6830  H HD23 . LEU A 1 61  ? 9.298   -4.973  3.850   1.00 0.00 ? 61  LEU A HD23 3  
ATOM 6831  N N    . SER A 1 62  ? 13.238  -1.798  5.233   1.00 0.00 ? 62  SER A N    3  
ATOM 6832  C CA   . SER A 1 62  ? 14.532  -1.289  4.792   1.00 0.00 ? 62  SER A CA   3  
ATOM 6833  C C    . SER A 1 62  ? 15.266  -0.710  5.989   1.00 0.00 ? 62  SER A C    3  
ATOM 6834  O O    . SER A 1 62  ? 14.676  0.008   6.800   1.00 0.00 ? 62  SER A O    3  
ATOM 6835  C CB   . SER A 1 62  ? 14.376  -0.279  3.640   1.00 0.00 ? 62  SER A CB   3  
ATOM 6836  O OG   . SER A 1 62  ? 13.233  0.538   3.817   1.00 0.00 ? 62  SER A OG   3  
ATOM 6837  H H    . SER A 1 62  ? 12.719  -1.242  5.911   1.00 0.00 ? 62  SER A H    3  
ATOM 6838  H HA   . SER A 1 62  ? 15.128  -2.123  4.421   1.00 0.00 ? 62  SER A HA   3  
ATOM 6839  H HB2  . SER A 1 62  ? 15.265  0.357   3.552   1.00 0.00 ? 62  SER A HB2  3  
ATOM 6840  H HB3  . SER A 1 62  ? 14.275  -0.833  2.708   1.00 0.00 ? 62  SER A HB3  3  
ATOM 6841  H HG   . SER A 1 62  ? 12.614  0.047   4.373   1.00 0.00 ? 62  SER A HG   3  
ATOM 6842  N N    . ARG A 1 63  ? 16.558  -1.014  6.089   1.00 0.00 ? 63  ARG A N    3  
ATOM 6843  C CA   . ARG A 1 63  ? 17.508  -0.379  6.994   1.00 0.00 ? 63  ARG A CA   3  
ATOM 6844  C C    . ARG A 1 63  ? 18.876  -0.400  6.326   1.00 0.00 ? 63  ARG A C    3  
ATOM 6845  O O    . ARG A 1 63  ? 19.050  -1.058  5.298   1.00 0.00 ? 63  ARG A O    3  
ATOM 6846  C CB   . ARG A 1 63  ? 17.544  -1.094  8.357   1.00 0.00 ? 63  ARG A CB   3  
ATOM 6847  C CG   . ARG A 1 63  ? 17.945  -2.572  8.280   1.00 0.00 ? 63  ARG A CG   3  
ATOM 6848  C CD   . ARG A 1 63  ? 18.158  -3.129  9.691   1.00 0.00 ? 63  ARG A CD   3  
ATOM 6849  N NE   . ARG A 1 63  ? 18.589  -4.528  9.626   1.00 0.00 ? 63  ARG A NE   3  
ATOM 6850  C CZ   . ARG A 1 63  ? 17.952  -5.601  10.101  1.00 0.00 ? 63  ARG A CZ   3  
ATOM 6851  N NH1  . ARG A 1 63  ? 16.835  -5.500  10.819  1.00 0.00 ? 63  ARG A NH1  3  
ATOM 6852  N NH2  . ARG A 1 63  ? 18.451  -6.796  9.837   1.00 0.00 ? 63  ARG A NH2  3  
ATOM 6853  H H    . ARG A 1 63  ? 16.985  -1.618  5.388   1.00 0.00 ? 63  ARG A H    3  
ATOM 6854  H HA   . ARG A 1 63  ? 17.213  0.660   7.151   1.00 0.00 ? 63  ARG A HA   3  
ATOM 6855  H HB2  . ARG A 1 63  ? 18.245  -0.567  9.006   1.00 0.00 ? 63  ARG A HB2  3  
ATOM 6856  H HB3  . ARG A 1 63  ? 16.559  -1.039  8.813   1.00 0.00 ? 63  ARG A HB3  3  
ATOM 6857  H HG2  . ARG A 1 63  ? 17.159  -3.135  7.773   1.00 0.00 ? 63  ARG A HG2  3  
ATOM 6858  H HG3  . ARG A 1 63  ? 18.870  -2.684  7.716   1.00 0.00 ? 63  ARG A HG3  3  
ATOM 6859  H HD2  . ARG A 1 63  ? 18.937  -2.554  10.189  1.00 0.00 ? 63  ARG A HD2  3  
ATOM 6860  H HD3  . ARG A 1 63  ? 17.234  -3.032  10.260  1.00 0.00 ? 63  ARG A HD3  3  
ATOM 6861  H HE   . ARG A 1 63  ? 19.362  -4.705  8.990   1.00 0.00 ? 63  ARG A HE   3  
ATOM 6862  H HH11 . ARG A 1 63  ? 16.396  -4.623  11.073  1.00 0.00 ? 63  ARG A HH11 3  
ATOM 6863  H HH12 . ARG A 1 63  ? 16.305  -6.365  10.945  1.00 0.00 ? 63  ARG A HH12 3  
ATOM 6864  H HH21 . ARG A 1 63  ? 19.330  -6.937  9.342   1.00 0.00 ? 63  ARG A HH21 3  
ATOM 6865  H HH22 . ARG A 1 63  ? 17.953  -7.660  10.056  1.00 0.00 ? 63  ARG A HH22 3  
ATOM 6866  N N    . VAL A 1 64  ? 19.835  0.322   6.891   1.00 0.00 ? 64  VAL A N    3  
ATOM 6867  C CA   . VAL A 1 64  ? 21.222  0.300   6.493   1.00 0.00 ? 64  VAL A CA   3  
ATOM 6868  C C    . VAL A 1 64  ? 21.764  -1.140  6.562   1.00 0.00 ? 64  VAL A C    3  
ATOM 6869  O O    . VAL A 1 64  ? 21.291  -1.934  7.377   1.00 0.00 ? 64  VAL A O    3  
ATOM 6870  C CB   . VAL A 1 64  ? 21.958  1.294   7.414   1.00 0.00 ? 64  VAL A CB   3  
ATOM 6871  C CG1  . VAL A 1 64  ? 21.220  2.641   7.583   1.00 0.00 ? 64  VAL A CG1  3  
ATOM 6872  C CG2  . VAL A 1 64  ? 22.214  0.737   8.821   1.00 0.00 ? 64  VAL A CG2  3  
ATOM 6873  H H    . VAL A 1 64  ? 19.693  0.849   7.736   1.00 0.00 ? 64  VAL A H    3  
ATOM 6874  H HA   . VAL A 1 64  ? 21.293  0.652   5.464   1.00 0.00 ? 64  VAL A HA   3  
ATOM 6875  H HB   . VAL A 1 64  ? 22.903  1.497   6.945   1.00 0.00 ? 64  VAL A HB   3  
ATOM 6876  H HG11 . VAL A 1 64  ? 20.844  2.999   6.628   1.00 0.00 ? 64  VAL A HG11 3  
ATOM 6877  H HG12 . VAL A 1 64  ? 20.380  2.548   8.274   1.00 0.00 ? 64  VAL A HG12 3  
ATOM 6878  H HG13 . VAL A 1 64  ? 21.910  3.385   7.983   1.00 0.00 ? 64  VAL A HG13 3  
ATOM 6879  H HG21 . VAL A 1 64  ? 22.854  -0.142  8.769   1.00 0.00 ? 64  VAL A HG21 3  
ATOM 6880  H HG22 . VAL A 1 64  ? 22.715  1.481   9.435   1.00 0.00 ? 64  VAL A HG22 3  
ATOM 6881  H HG23 . VAL A 1 64  ? 21.274  0.455   9.296   1.00 0.00 ? 64  VAL A HG23 3  
ATOM 6882  N N    . GLY A 1 65  ? 22.767  -1.475  5.750   1.00 0.00 ? 65  GLY A N    3  
ATOM 6883  C CA   . GLY A 1 65  ? 23.344  -2.812  5.758   1.00 0.00 ? 65  GLY A CA   3  
ATOM 6884  C C    . GLY A 1 65  ? 24.445  -2.953  4.719   1.00 0.00 ? 65  GLY A C    3  
ATOM 6885  O O    . GLY A 1 65  ? 24.452  -3.937  3.976   1.00 0.00 ? 65  GLY A O    3  
ATOM 6886  H H    . GLY A 1 65  ? 23.132  -0.824  5.069   1.00 0.00 ? 65  GLY A H    3  
ATOM 6887  H HA2  . GLY A 1 65  ? 23.757  -3.023  6.744   1.00 0.00 ? 65  GLY A HA2  3  
ATOM 6888  H HA3  . GLY A 1 65  ? 22.561  -3.541  5.555   1.00 0.00 ? 65  GLY A HA3  3  
ATOM 6889  N N    . LEU A 1 66  ? 25.360  -1.975  4.667   1.00 0.00 ? 66  LEU A N    3  
ATOM 6890  C CA   . LEU A 1 66  ? 26.384  -1.809  3.633   1.00 0.00 ? 66  LEU A CA   3  
ATOM 6891  C C    . LEU A 1 66  ? 25.770  -1.783  2.224   1.00 0.00 ? 66  LEU A C    3  
ATOM 6892  O O    . LEU A 1 66  ? 24.556  -1.625  2.063   1.00 0.00 ? 66  LEU A O    3  
ATOM 6893  C CB   . LEU A 1 66  ? 27.508  -2.852  3.832   1.00 0.00 ? 66  LEU A CB   3  
ATOM 6894  C CG   . LEU A 1 66  ? 28.576  -2.523  4.892   1.00 0.00 ? 66  LEU A CG   3  
ATOM 6895  C CD1  . LEU A 1 66  ? 29.347  -1.229  4.592   1.00 0.00 ? 66  LEU A CD1  3  
ATOM 6896  C CD2  . LEU A 1 66  ? 28.006  -2.472  6.313   1.00 0.00 ? 66  LEU A CD2  3  
ATOM 6897  H H    . LEU A 1 66  ? 25.357  -1.269  5.388   1.00 0.00 ? 66  LEU A H    3  
ATOM 6898  H HA   . LEU A 1 66  ? 26.819  -0.821  3.759   1.00 0.00 ? 66  LEU A HA   3  
ATOM 6899  H HB2  . LEU A 1 66  ? 27.054  -3.807  4.082   1.00 0.00 ? 66  LEU A HB2  3  
ATOM 6900  H HB3  . LEU A 1 66  ? 28.039  -3.010  2.899   1.00 0.00 ? 66  LEU A HB3  3  
ATOM 6901  H HG   . LEU A 1 66  ? 29.294  -3.339  4.870   1.00 0.00 ? 66  LEU A HG   3  
ATOM 6902  H HD11 . LEU A 1 66  ? 28.714  -0.352  4.715   1.00 0.00 ? 66  LEU A HD11 3  
ATOM 6903  H HD12 . LEU A 1 66  ? 30.196  -1.143  5.270   1.00 0.00 ? 66  LEU A HD12 3  
ATOM 6904  H HD13 . LEU A 1 66  ? 29.730  -1.260  3.570   1.00 0.00 ? 66  LEU A HD13 3  
ATOM 6905  H HD21 . LEU A 1 66  ? 27.364  -1.602  6.427   1.00 0.00 ? 66  LEU A HD21 3  
ATOM 6906  H HD22 . LEU A 1 66  ? 27.429  -3.377  6.506   1.00 0.00 ? 66  LEU A HD22 3  
ATOM 6907  H HD23 . LEU A 1 66  ? 28.820  -2.411  7.034   1.00 0.00 ? 66  LEU A HD23 3  
ATOM 6908  N N    . GLU A 1 67  ? 26.614  -1.861  1.197   1.00 0.00 ? 67  GLU A N    3  
ATOM 6909  C CA   . GLU A 1 67  ? 26.214  -1.863  -0.204  1.00 0.00 ? 67  GLU A CA   3  
ATOM 6910  C C    . GLU A 1 67  ? 26.658  -3.154  -0.896  1.00 0.00 ? 67  GLU A C    3  
ATOM 6911  O O    . GLU A 1 67  ? 27.741  -3.663  -0.582  1.00 0.00 ? 67  GLU A O    3  
ATOM 6912  C CB   . GLU A 1 67  ? 26.857  -0.690  -0.941  1.00 0.00 ? 67  GLU A CB   3  
ATOM 6913  C CG   . GLU A 1 67  ? 26.178  0.659   -0.670  1.00 0.00 ? 67  GLU A CG   3  
ATOM 6914  C CD   . GLU A 1 67  ? 25.908  1.415   -1.970  1.00 0.00 ? 67  GLU A CD   3  
ATOM 6915  O OE1  . GLU A 1 67  ? 25.438  0.796   -2.947  1.00 0.00 ? 67  GLU A OE1  3  
ATOM 6916  O OE2  . GLU A 1 67  ? 26.040  2.656   -2.018  1.00 0.00 ? 67  GLU A OE2  3  
ATOM 6917  H H    . GLU A 1 67  ? 27.588  -2.055  1.394   1.00 0.00 ? 67  GLU A H    3  
ATOM 6918  H HA   . GLU A 1 67  ? 25.133  -1.763  -0.264  1.00 0.00 ? 67  GLU A HA   3  
ATOM 6919  H HB2  . GLU A 1 67  ? 27.899  -0.632  -0.661  1.00 0.00 ? 67  GLU A HB2  3  
ATOM 6920  H HB3  . GLU A 1 67  ? 26.846  -0.912  -2.008  1.00 0.00 ? 67  GLU A HB3  3  
ATOM 6921  H HG2  . GLU A 1 67  ? 25.230  0.514   -0.147  1.00 0.00 ? 67  GLU A HG2  3  
ATOM 6922  H HG3  . GLU A 1 67  ? 26.826  1.253   -0.026  1.00 0.00 ? 67  GLU A HG3  3  
ATOM 6923  N N    . PRO A 1 68  ? 25.877  -3.638  -1.884  1.00 0.00 ? 68  PRO A N    3  
ATOM 6924  C CA   . PRO A 1 68  ? 26.255  -4.779  -2.694  1.00 0.00 ? 68  PRO A CA   3  
ATOM 6925  C C    . PRO A 1 68  ? 27.422  -4.355  -3.593  1.00 0.00 ? 68  PRO A C    3  
ATOM 6926  O O    . PRO A 1 68  ? 27.285  -3.399  -4.365  1.00 0.00 ? 68  PRO A O    3  
ATOM 6927  C CB   . PRO A 1 68  ? 25.017  -5.157  -3.513  1.00 0.00 ? 68  PRO A CB   3  
ATOM 6928  C CG   . PRO A 1 68  ? 24.129  -3.910  -3.508  1.00 0.00 ? 68  PRO A CG   3  
ATOM 6929  C CD   . PRO A 1 68  ? 24.652  -3.030  -2.370  1.00 0.00 ? 68  PRO A CD   3  
ATOM 6930  H HA   . PRO A 1 68  ? 26.532  -5.614  -2.050  1.00 0.00 ? 68  PRO A HA   3  
ATOM 6931  H HB2  . PRO A 1 68  ? 25.282  -5.434  -4.533  1.00 0.00 ? 68  PRO A HB2  3  
ATOM 6932  H HB3  . PRO A 1 68  ? 24.509  -5.992  -3.038  1.00 0.00 ? 68  PRO A HB3  3  
ATOM 6933  H HG2  . PRO A 1 68  ? 24.257  -3.381  -4.452  1.00 0.00 ? 68  PRO A HG2  3  
ATOM 6934  H HG3  . PRO A 1 68  ? 23.079  -4.169  -3.364  1.00 0.00 ? 68  PRO A HG3  3  
ATOM 6935  H HD2  . PRO A 1 68  ? 24.853  -2.029  -2.754  1.00 0.00 ? 68  PRO A HD2  3  
ATOM 6936  H HD3  . PRO A 1 68  ? 23.947  -2.965  -1.546  1.00 0.00 ? 68  PRO A HD3  3  
ATOM 6937  N N    . PRO A 1 69  ? 28.556  -5.062  -3.534  1.00 0.00 ? 69  PRO A N    3  
ATOM 6938  C CA   . PRO A 1 69  ? 29.742  -4.747  -4.312  1.00 0.00 ? 69  PRO A CA   3  
ATOM 6939  C C    . PRO A 1 69  ? 29.578  -5.205  -5.768  1.00 0.00 ? 69  PRO A C    3  
ATOM 6940  O O    . PRO A 1 69  ? 28.662  -5.969  -6.080  1.00 0.00 ? 69  PRO A O    3  
ATOM 6941  C CB   . PRO A 1 69  ? 30.879  -5.470  -3.583  1.00 0.00 ? 69  PRO A CB   3  
ATOM 6942  C CG   . PRO A 1 69  ? 30.208  -6.624  -2.836  1.00 0.00 ? 69  PRO A CG   3  
ATOM 6943  C CD   . PRO A 1 69  ? 28.753  -6.222  -2.688  1.00 0.00 ? 69  PRO A CD   3  
ATOM 6944  H HA   . PRO A 1 69  ? 29.917  -3.670  -4.291  1.00 0.00 ? 69  PRO A HA   3  
ATOM 6945  H HB2  . PRO A 1 69  ? 31.642  -5.849  -4.260  1.00 0.00 ? 69  PRO A HB2  3  
ATOM 6946  H HB3  . PRO A 1 69  ? 31.328  -4.772  -2.876  1.00 0.00 ? 69  PRO A HB3  3  
ATOM 6947  H HG2  . PRO A 1 69  ? 30.263  -7.532  -3.428  1.00 0.00 ? 69  PRO A HG2  3  
ATOM 6948  H HG3  . PRO A 1 69  ? 30.648  -6.770  -1.853  1.00 0.00 ? 69  PRO A HG3  3  
ATOM 6949  H HD2  . PRO A 1 69  ? 28.097  -7.026  -3.013  1.00 0.00 ? 69  PRO A HD2  3  
ATOM 6950  H HD3  . PRO A 1 69  ? 28.522  -5.988  -1.650  1.00 0.00 ? 69  PRO A HD3  3  
ATOM 6951  N N    . PRO A 1 70  ? 30.486  -4.832  -6.686  1.00 0.00 ? 70  PRO A N    3  
ATOM 6952  C CA   . PRO A 1 70  ? 30.361  -5.190  -8.099  1.00 0.00 ? 70  PRO A CA   3  
ATOM 6953  C C    . PRO A 1 70  ? 30.419  -6.704  -8.374  1.00 0.00 ? 70  PRO A C    3  
ATOM 6954  O O    . PRO A 1 70  ? 30.111  -7.116  -9.491  1.00 0.00 ? 70  PRO A O    3  
ATOM 6955  C CB   . PRO A 1 70  ? 31.467  -4.414  -8.827  1.00 0.00 ? 70  PRO A CB   3  
ATOM 6956  C CG   . PRO A 1 70  ? 32.478  -4.070  -7.735  1.00 0.00 ? 70  PRO A CG   3  
ATOM 6957  C CD   . PRO A 1 70  ? 31.633  -3.963  -6.467  1.00 0.00 ? 70  PRO A CD   3  
ATOM 6958  H HA   . PRO A 1 70  ? 29.399  -4.832  -8.467  1.00 0.00 ? 70  PRO A HA   3  
ATOM 6959  H HB2  . PRO A 1 70  ? 31.927  -4.998  -9.626  1.00 0.00 ? 70  PRO A HB2  3  
ATOM 6960  H HB3  . PRO A 1 70  ? 31.051  -3.492  -9.233  1.00 0.00 ? 70  PRO A HB3  3  
ATOM 6961  H HG2  . PRO A 1 70  ? 33.189  -4.891  -7.627  1.00 0.00 ? 70  PRO A HG2  3  
ATOM 6962  H HG3  . PRO A 1 70  ? 33.004  -3.139  -7.951  1.00 0.00 ? 70  PRO A HG3  3  
ATOM 6963  H HD2  . PRO A 1 70  ? 32.229  -4.273  -5.612  1.00 0.00 ? 70  PRO A HD2  3  
ATOM 6964  H HD3  . PRO A 1 70  ? 31.286  -2.941  -6.310  1.00 0.00 ? 70  PRO A HD3  3  
ATOM 6965  N N    . GLY A 1 71  ? 30.767  -7.538  -7.387  1.00 0.00 ? 71  GLY A N    3  
ATOM 6966  C CA   . GLY A 1 71  ? 30.778  -8.990  -7.519  1.00 0.00 ? 71  GLY A CA   3  
ATOM 6967  C C    . GLY A 1 71  ? 29.510  -9.680  -7.002  1.00 0.00 ? 71  GLY A C    3  
ATOM 6968  O O    . GLY A 1 71  ? 29.336  -10.869 -7.271  1.00 0.00 ? 71  GLY A O    3  
ATOM 6969  H H    . GLY A 1 71  ? 30.976  -7.144  -6.484  1.00 0.00 ? 71  GLY A H    3  
ATOM 6970  H HA2  . GLY A 1 71  ? 30.924  -9.265  -8.564  1.00 0.00 ? 71  GLY A HA2  3  
ATOM 6971  H HA3  . GLY A 1 71  ? 31.627  -9.378  -6.957  1.00 0.00 ? 71  GLY A HA3  3  
ATOM 6972  N N    . LYS A 1 72  ? 28.624  -9.001  -6.264  1.00 0.00 ? 72  LYS A N    3  
ATOM 6973  C CA   . LYS A 1 72  ? 27.520  -9.623  -5.522  1.00 0.00 ? 72  LYS A CA   3  
ATOM 6974  C C    . LYS A 1 72  ? 26.292  -8.744  -5.677  1.00 0.00 ? 72  LYS A C    3  
ATOM 6975  O O    . LYS A 1 72  ? 26.388  -7.522  -5.611  1.00 0.00 ? 72  LYS A O    3  
ATOM 6976  C CB   . LYS A 1 72  ? 27.965  -9.792  -4.057  1.00 0.00 ? 72  LYS A CB   3  
ATOM 6977  C CG   . LYS A 1 72  ? 26.903  -9.933  -2.947  1.00 0.00 ? 72  LYS A CG   3  
ATOM 6978  C CD   . LYS A 1 72  ? 26.543  -11.384 -2.613  1.00 0.00 ? 72  LYS A CD   3  
ATOM 6979  C CE   . LYS A 1 72  ? 25.523  -11.978 -3.584  1.00 0.00 ? 72  LYS A CE   3  
ATOM 6980  N NZ   . LYS A 1 72  ? 25.337  -13.420 -3.344  1.00 0.00 ? 72  LYS A NZ   3  
ATOM 6981  H H    . LYS A 1 72  ? 28.704  -7.992  -6.161  1.00 0.00 ? 72  LYS A H    3  
ATOM 6982  H HA   . LYS A 1 72  ? 27.304  -10.607 -5.939  1.00 0.00 ? 72  LYS A HA   3  
ATOM 6983  H HB2  . LYS A 1 72  ? 28.629  -10.652 -4.019  1.00 0.00 ? 72  LYS A HB2  3  
ATOM 6984  H HB3  . LYS A 1 72  ? 28.565  -8.928  -3.794  1.00 0.00 ? 72  LYS A HB3  3  
ATOM 6985  H HG2  . LYS A 1 72  ? 27.334  -9.502  -2.042  1.00 0.00 ? 72  LYS A HG2  3  
ATOM 6986  H HG3  . LYS A 1 72  ? 26.004  -9.357  -3.166  1.00 0.00 ? 72  LYS A HG3  3  
ATOM 6987  H HD2  . LYS A 1 72  ? 27.452  -11.984 -2.588  1.00 0.00 ? 72  LYS A HD2  3  
ATOM 6988  H HD3  . LYS A 1 72  ? 26.110  -11.401 -1.614  1.00 0.00 ? 72  LYS A HD3  3  
ATOM 6989  H HE2  . LYS A 1 72  ? 24.569  -11.465 -3.436  1.00 0.00 ? 72  LYS A HE2  3  
ATOM 6990  H HE3  . LYS A 1 72  ? 25.855  -11.829 -4.611  1.00 0.00 ? 72  LYS A HE3  3  
ATOM 6991  H HZ1  . LYS A 1 72  ? 25.204  -13.618 -2.355  1.00 0.00 ? 72  LYS A HZ1  3  
ATOM 6992  H HZ2  . LYS A 1 72  ? 24.518  -13.767 -3.840  1.00 0.00 ? 72  LYS A HZ2  3  
ATOM 6993  H HZ3  . LYS A 1 72  ? 26.135  -13.951 -3.678  1.00 0.00 ? 72  LYS A HZ3  3  
ATOM 6994  N N    . ARG A 1 73  ? 25.132  -9.359  -5.888  1.00 0.00 ? 73  ARG A N    3  
ATOM 6995  C CA   . ARG A 1 73  ? 23.897  -8.647  -6.188  1.00 0.00 ? 73  ARG A CA   3  
ATOM 6996  C C    . ARG A 1 73  ? 22.863  -8.929  -5.117  1.00 0.00 ? 73  ARG A C    3  
ATOM 6997  O O    . ARG A 1 73  ? 22.495  -10.086 -4.895  1.00 0.00 ? 73  ARG A O    3  
ATOM 6998  C CB   . ARG A 1 73  ? 23.403  -9.006  -7.604  1.00 0.00 ? 73  ARG A CB   3  
ATOM 6999  C CG   . ARG A 1 73  ? 23.858  -7.961  -8.633  1.00 0.00 ? 73  ARG A CG   3  
ATOM 7000  C CD   . ARG A 1 73  ? 23.046  -6.667  -8.487  1.00 0.00 ? 73  ARG A CD   3  
ATOM 7001  N NE   . ARG A 1 73  ? 21.682  -6.847  -9.006  1.00 0.00 ? 73  ARG A NE   3  
ATOM 7002  C CZ   . ARG A 1 73  ? 20.625  -6.107  -8.663  1.00 0.00 ? 73  ARG A CZ   3  
ATOM 7003  N NH1  . ARG A 1 73  ? 20.782  -4.974  -7.988  1.00 0.00 ? 73  ARG A NH1  3  
ATOM 7004  N NH2  . ARG A 1 73  ? 19.413  -6.519  -8.991  1.00 0.00 ? 73  ARG A NH2  3  
ATOM 7005  H H    . ARG A 1 73  ? 25.111  -10.372 -5.908  1.00 0.00 ? 73  ARG A H    3  
ATOM 7006  H HA   . ARG A 1 73  ? 24.106  -7.579  -6.150  1.00 0.00 ? 73  ARG A HA   3  
ATOM 7007  H HB2  . ARG A 1 73  ? 23.784  -9.982  -7.901  1.00 0.00 ? 73  ARG A HB2  3  
ATOM 7008  H HB3  . ARG A 1 73  ? 22.314  -9.069  -7.615  1.00 0.00 ? 73  ARG A HB3  3  
ATOM 7009  H HG2  . ARG A 1 73  ? 24.918  -7.746  -8.491  1.00 0.00 ? 73  ARG A HG2  3  
ATOM 7010  H HG3  . ARG A 1 73  ? 23.724  -8.363  -9.639  1.00 0.00 ? 73  ARG A HG3  3  
ATOM 7011  H HD2  . ARG A 1 73  ? 22.990  -6.392  -7.423  1.00 0.00 ? 73  ARG A HD2  3  
ATOM 7012  H HD3  . ARG A 1 73  ? 23.536  -5.871  -9.050  1.00 0.00 ? 73  ARG A HD3  3  
ATOM 7013  H HE   . ARG A 1 73  ? 21.534  -7.644  -9.614  1.00 0.00 ? 73  ARG A HE   3  
ATOM 7014  H HH11 . ARG A 1 73  ? 21.703  -4.562  -7.868  1.00 0.00 ? 73  ARG A HH11 3  
ATOM 7015  H HH12 . ARG A 1 73  ? 19.987  -4.421  -7.681  1.00 0.00 ? 73  ARG A HH12 3  
ATOM 7016  H HH21 . ARG A 1 73  ? 19.252  -7.316  -9.599  1.00 0.00 ? 73  ARG A HH21 3  
ATOM 7017  H HH22 . ARG A 1 73  ? 18.573  -5.999  -8.732  1.00 0.00 ? 73  ARG A HH22 3  
ATOM 7018  N N    . GLU A 1 74  ? 22.377  -7.870  -4.481  1.00 0.00 ? 74  GLU A N    3  
ATOM 7019  C CA   . GLU A 1 74  ? 21.263  -7.870  -3.550  1.00 0.00 ? 74  GLU A CA   3  
ATOM 7020  C C    . GLU A 1 74  ? 20.515  -6.535  -3.717  1.00 0.00 ? 74  GLU A C    3  
ATOM 7021  O O    . GLU A 1 74  ? 20.953  -5.664  -4.483  1.00 0.00 ? 74  GLU A O    3  
ATOM 7022  C CB   . GLU A 1 74  ? 21.792  -8.122  -2.118  1.00 0.00 ? 74  GLU A CB   3  
ATOM 7023  C CG   . GLU A 1 74  ? 21.537  -9.565  -1.625  1.00 0.00 ? 74  GLU A CG   3  
ATOM 7024  C CD   . GLU A 1 74  ? 22.707  -10.243 -0.896  1.00 0.00 ? 74  GLU A CD   3  
ATOM 7025  O OE1  . GLU A 1 74  ? 23.885  -10.011 -1.251  1.00 0.00 ? 74  GLU A OE1  3  
ATOM 7026  O OE2  . GLU A 1 74  ? 22.473  -11.040 0.043   1.00 0.00 ? 74  GLU A OE2  3  
ATOM 7027  H H    . GLU A 1 74  ? 22.664  -6.931  -4.718  1.00 0.00 ? 74  GLU A H    3  
ATOM 7028  H HA   . GLU A 1 74  ? 20.579  -8.658  -3.851  1.00 0.00 ? 74  GLU A HA   3  
ATOM 7029  H HB2  . GLU A 1 74  ? 22.856  -7.893  -2.090  1.00 0.00 ? 74  GLU A HB2  3  
ATOM 7030  H HB3  . GLU A 1 74  ? 21.299  -7.439  -1.427  1.00 0.00 ? 74  GLU A HB3  3  
ATOM 7031  H HG2  . GLU A 1 74  ? 20.690  -9.524  -0.940  1.00 0.00 ? 74  GLU A HG2  3  
ATOM 7032  H HG3  . GLU A 1 74  ? 21.266  -10.199 -2.467  1.00 0.00 ? 74  GLU A HG3  3  
ATOM 7033  N N    . CYS A 1 75  ? 19.357  -6.384  -3.067  1.00 0.00 ? 75  CYS A N    3  
ATOM 7034  C CA   . CYS A 1 75  ? 18.548  -5.168  -3.156  1.00 0.00 ? 75  CYS A CA   3  
ATOM 7035  C C    . CYS A 1 75  ? 19.275  -4.013  -2.467  1.00 0.00 ? 75  CYS A C    3  
ATOM 7036  O O    . CYS A 1 75  ? 19.915  -4.221  -1.441  1.00 0.00 ? 75  CYS A O    3  
ATOM 7037  C CB   . CYS A 1 75  ? 17.208  -5.397  -2.443  1.00 0.00 ? 75  CYS A CB   3  
ATOM 7038  S SG   . CYS A 1 75  ? 16.181  -6.581  -3.354  1.00 0.00 ? 75  CYS A SG   3  
ATOM 7039  H H    . CYS A 1 75  ? 19.064  -7.095  -2.400  1.00 0.00 ? 75  CYS A H    3  
ATOM 7040  H HA   . CYS A 1 75  ? 18.375  -4.917  -4.204  1.00 0.00 ? 75  CYS A HA   3  
ATOM 7041  H HB2  . CYS A 1 75  ? 17.397  -5.778  -1.436  1.00 0.00 ? 75  CYS A HB2  3  
ATOM 7042  H HB3  . CYS A 1 75  ? 16.669  -4.452  -2.363  1.00 0.00 ? 75  CYS A HB3  3  
ATOM 7043  H HG   . CYS A 1 75  ? 15.612  -7.153  -2.275  1.00 0.00 ? 75  CYS A HG   3  
ATOM 7044  N N    . ARG A 1 76  ? 19.104  -2.778  -2.945  1.00 0.00 ? 76  ARG A N    3  
ATOM 7045  C CA   . ARG A 1 76  ? 19.567  -1.586  -2.238  1.00 0.00 ? 76  ARG A CA   3  
ATOM 7046  C C    . ARG A 1 76  ? 18.702  -0.392  -2.633  1.00 0.00 ? 76  ARG A C    3  
ATOM 7047  O O    . ARG A 1 76  ? 18.288  -0.287  -3.788  1.00 0.00 ? 76  ARG A O    3  
ATOM 7048  C CB   . ARG A 1 76  ? 21.081  -1.406  -2.482  1.00 0.00 ? 76  ARG A CB   3  
ATOM 7049  C CG   . ARG A 1 76  ? 21.649  -0.035  -2.085  1.00 0.00 ? 76  ARG A CG   3  
ATOM 7050  C CD   . ARG A 1 76  ? 21.614  0.946   -3.265  1.00 0.00 ? 76  ARG A CD   3  
ATOM 7051  N NE   . ARG A 1 76  ? 22.925  0.983   -3.915  1.00 0.00 ? 76  ARG A NE   3  
ATOM 7052  C CZ   . ARG A 1 76  ? 23.257  1.446   -5.115  1.00 0.00 ? 76  ARG A CZ   3  
ATOM 7053  N NH1  . ARG A 1 76  ? 22.343  1.772   -6.013  1.00 0.00 ? 76  ARG A NH1  3  
ATOM 7054  N NH2  . ARG A 1 76  ? 24.542  1.566   -5.404  1.00 0.00 ? 76  ARG A NH2  3  
ATOM 7055  H H    . ARG A 1 76  ? 18.619  -2.635  -3.823  1.00 0.00 ? 76  ARG A H    3  
ATOM 7056  H HA   . ARG A 1 76  ? 19.442  -1.769  -1.176  1.00 0.00 ? 76  ARG A HA   3  
ATOM 7057  H HB2  . ARG A 1 76  ? 21.596  -2.159  -1.879  1.00 0.00 ? 76  ARG A HB2  3  
ATOM 7058  H HB3  . ARG A 1 76  ? 21.309  -1.598  -3.531  1.00 0.00 ? 76  ARG A HB3  3  
ATOM 7059  H HG2  . ARG A 1 76  ? 21.095  0.378   -1.246  1.00 0.00 ? 76  ARG A HG2  3  
ATOM 7060  H HG3  . ARG A 1 76  ? 22.680  -0.163  -1.749  1.00 0.00 ? 76  ARG A HG3  3  
ATOM 7061  H HD2  . ARG A 1 76  ? 20.852  0.648   -3.983  1.00 0.00 ? 76  ARG A HD2  3  
ATOM 7062  H HD3  . ARG A 1 76  ? 21.374  1.944   -2.898  1.00 0.00 ? 76  ARG A HD3  3  
ATOM 7063  H HE   . ARG A 1 76  ? 23.733  0.761   -3.326  1.00 0.00 ? 76  ARG A HE   3  
ATOM 7064  H HH11 . ARG A 1 76  ? 21.354  1.564   -5.892  1.00 0.00 ? 76  ARG A HH11 3  
ATOM 7065  H HH12 . ARG A 1 76  ? 22.644  2.199   -6.885  1.00 0.00 ? 76  ARG A HH12 3  
ATOM 7066  H HH21 . ARG A 1 76  ? 25.209  1.308   -4.662  1.00 0.00 ? 76  ARG A HH21 3  
ATOM 7067  H HH22 . ARG A 1 76  ? 24.877  2.002   -6.251  1.00 0.00 ? 76  ARG A HH22 3  
ATOM 7068  N N    . VAL A 1 77  ? 18.435  0.505   -1.678  1.00 0.00 ? 77  VAL A N    3  
ATOM 7069  C CA   . VAL A 1 77  ? 17.569  1.670   -1.807  1.00 0.00 ? 77  VAL A CA   3  
ATOM 7070  C C    . VAL A 1 77  ? 18.334  2.886   -1.260  1.00 0.00 ? 77  VAL A C    3  
ATOM 7071  O O    . VAL A 1 77  ? 18.190  3.264   -0.096  1.00 0.00 ? 77  VAL A O    3  
ATOM 7072  C CB   . VAL A 1 77  ? 16.188  1.436   -1.135  1.00 0.00 ? 77  VAL A CB   3  
ATOM 7073  C CG1  . VAL A 1 77  ? 15.129  2.201   -1.934  1.00 0.00 ? 77  VAL A CG1  3  
ATOM 7074  C CG2  . VAL A 1 77  ? 15.782  -0.039  -0.967  1.00 0.00 ? 77  VAL A CG2  3  
ATOM 7075  H H    . VAL A 1 77  ? 18.772  0.321   -0.738  1.00 0.00 ? 77  VAL A H    3  
ATOM 7076  H HA   . VAL A 1 77  ? 17.388  1.830   -2.868  1.00 0.00 ? 77  VAL A HA   3  
ATOM 7077  H HB   . VAL A 1 77  ? 16.188  1.840   -0.128  1.00 0.00 ? 77  VAL A HB   3  
ATOM 7078  H HG11 . VAL A 1 77  ? 15.061  1.808   -2.949  1.00 0.00 ? 77  VAL A HG11 3  
ATOM 7079  H HG12 . VAL A 1 77  ? 14.162  2.111   -1.438  1.00 0.00 ? 77  VAL A HG12 3  
ATOM 7080  H HG13 . VAL A 1 77  ? 15.403  3.258   -1.969  1.00 0.00 ? 77  VAL A HG13 3  
ATOM 7081  H HG21 . VAL A 1 77  ? 14.748  -0.098  -0.623  1.00 0.00 ? 77  VAL A HG21 3  
ATOM 7082  H HG22 . VAL A 1 77  ? 15.875  -0.574  -1.906  1.00 0.00 ? 77  VAL A HG22 3  
ATOM 7083  H HG23 . VAL A 1 77  ? 16.415  -0.518  -0.221  1.00 0.00 ? 77  VAL A HG23 3  
ATOM 7084  N N    . GLY A 1 78  ? 19.237  3.440   -2.078  1.00 0.00 ? 78  GLY A N    3  
ATOM 7085  C CA   . GLY A 1 78  ? 20.032  4.656   -1.841  1.00 0.00 ? 78  GLY A CA   3  
ATOM 7086  C C    . GLY A 1 78  ? 20.887  4.711   -0.562  1.00 0.00 ? 78  GLY A C    3  
ATOM 7087  O O    . GLY A 1 78  ? 21.511  5.734   -0.293  1.00 0.00 ? 78  GLY A O    3  
ATOM 7088  H H    . GLY A 1 78  ? 19.251  3.081   -3.028  1.00 0.00 ? 78  GLY A H    3  
ATOM 7089  H HA2  . GLY A 1 78  ? 20.698  4.800   -2.692  1.00 0.00 ? 78  GLY A HA2  3  
ATOM 7090  H HA3  . GLY A 1 78  ? 19.354  5.510   -1.816  1.00 0.00 ? 78  GLY A HA3  3  
ATOM 7091  N N    . GLN A 1 79  ? 20.895  3.664   0.263   1.00 0.00 ? 79  GLN A N    3  
ATOM 7092  C CA   . GLN A 1 79  ? 21.572  3.561   1.555   1.00 0.00 ? 79  GLN A CA   3  
ATOM 7093  C C    . GLN A 1 79  ? 21.211  2.195   2.132   1.00 0.00 ? 79  GLN A C    3  
ATOM 7094  O O    . GLN A 1 79  ? 22.068  1.451   2.596   1.00 0.00 ? 79  GLN A O    3  
ATOM 7095  C CB   . GLN A 1 79  ? 21.081  4.640   2.555   1.00 0.00 ? 79  GLN A CB   3  
ATOM 7096  C CG   . GLN A 1 79  ? 22.175  5.343   3.367   1.00 0.00 ? 79  GLN A CG   3  
ATOM 7097  C CD   . GLN A 1 79  ? 23.228  4.420   3.969   1.00 0.00 ? 79  GLN A CD   3  
ATOM 7098  O OE1  . GLN A 1 79  ? 24.410  4.505   3.654   1.00 0.00 ? 79  GLN A OE1  3  
ATOM 7099  N NE2  . GLN A 1 79  ? 22.846  3.530   4.866   1.00 0.00 ? 79  GLN A NE2  3  
ATOM 7100  H H    . GLN A 1 79  ? 20.306  2.885   0.005   1.00 0.00 ? 79  GLN A H    3  
ATOM 7101  H HA   . GLN A 1 79  ? 22.650  3.636   1.405   1.00 0.00 ? 79  GLN A HA   3  
ATOM 7102  H HB2  . GLN A 1 79  ? 20.514  5.407   2.035   1.00 0.00 ? 79  GLN A HB2  3  
ATOM 7103  H HB3  . GLN A 1 79  ? 20.393  4.198   3.271   1.00 0.00 ? 79  GLN A HB3  3  
ATOM 7104  H HG2  . GLN A 1 79  ? 22.668  6.074   2.730   1.00 0.00 ? 79  GLN A HG2  3  
ATOM 7105  H HG3  . GLN A 1 79  ? 21.679  5.857   4.188   1.00 0.00 ? 79  GLN A HG3  3  
ATOM 7106  H HE21 . GLN A 1 79  ? 21.891  3.508   5.178   1.00 0.00 ? 79  GLN A HE21 3  
ATOM 7107  H HE22 . GLN A 1 79  ? 23.533  2.885   5.226   1.00 0.00 ? 79  GLN A HE22 3  
ATOM 7108  N N    . TYR A 1 80  ? 19.908  1.910   2.173   1.00 0.00 ? 80  TYR A N    3  
ATOM 7109  C CA   . TYR A 1 80  ? 19.356  0.733   2.807   1.00 0.00 ? 80  TYR A CA   3  
ATOM 7110  C C    . TYR A 1 80  ? 19.486  -0.473  1.888   1.00 0.00 ? 80  TYR A C    3  
ATOM 7111  O O    . TYR A 1 80  ? 19.636  -0.296  0.680   1.00 0.00 ? 80  TYR A O    3  
ATOM 7112  C CB   . TYR A 1 80  ? 17.875  1.021   3.104   1.00 0.00 ? 80  TYR A CB   3  
ATOM 7113  C CG   . TYR A 1 80  ? 17.603  2.416   3.643   1.00 0.00 ? 80  TYR A CG   3  
ATOM 7114  C CD1  . TYR A 1 80  ? 18.396  2.951   4.677   1.00 0.00 ? 80  TYR A CD1  3  
ATOM 7115  C CD2  . TYR A 1 80  ? 16.625  3.219   3.031   1.00 0.00 ? 80  TYR A CD2  3  
ATOM 7116  C CE1  . TYR A 1 80  ? 18.228  4.285   5.086   1.00 0.00 ? 80  TYR A CE1  3  
ATOM 7117  C CE2  . TYR A 1 80  ? 16.390  4.526   3.495   1.00 0.00 ? 80  TYR A CE2  3  
ATOM 7118  C CZ   . TYR A 1 80  ? 17.181  5.060   4.542   1.00 0.00 ? 80  TYR A CZ   3  
ATOM 7119  O OH   . TYR A 1 80  ? 16.924  6.288   5.074   1.00 0.00 ? 80  TYR A OH   3  
ATOM 7120  H H    . TYR A 1 80  ? 19.213  2.593   1.889   1.00 0.00 ? 80  TYR A H    3  
ATOM 7121  H HA   . TYR A 1 80  ? 19.903  0.548   3.727   1.00 0.00 ? 80  TYR A HA   3  
ATOM 7122  H HB2  . TYR A 1 80  ? 17.314  0.899   2.176   1.00 0.00 ? 80  TYR A HB2  3  
ATOM 7123  H HB3  . TYR A 1 80  ? 17.493  0.284   3.805   1.00 0.00 ? 80  TYR A HB3  3  
ATOM 7124  H HD1  . TYR A 1 80  ? 19.153  2.344   5.144   1.00 0.00 ? 80  TYR A HD1  3  
ATOM 7125  H HD2  . TYR A 1 80  ? 16.052  2.828   2.199   1.00 0.00 ? 80  TYR A HD2  3  
ATOM 7126  H HE1  . TYR A 1 80  ? 18.874  4.712   5.845   1.00 0.00 ? 80  TYR A HE1  3  
ATOM 7127  H HE2  . TYR A 1 80  ? 15.612  5.111   3.026   1.00 0.00 ? 80  TYR A HE2  3  
ATOM 7128  H HH   . TYR A 1 80  ? 15.978  6.499   5.120   1.00 0.00 ? 80  TYR A HH   3  
ATOM 7129  N N    . VAL A 1 81  ? 19.279  -1.672  2.419   1.00 0.00 ? 81  VAL A N    3  
ATOM 7130  C CA   . VAL A 1 81  ? 18.840  -2.834  1.659   1.00 0.00 ? 81  VAL A CA   3  
ATOM 7131  C C    . VAL A 1 81  ? 17.412  -3.107  2.126   1.00 0.00 ? 81  VAL A C    3  
ATOM 7132  O O    . VAL A 1 81  ? 17.128  -3.002  3.322   1.00 0.00 ? 81  VAL A O    3  
ATOM 7133  C CB   . VAL A 1 81  ? 19.848  -4.006  1.776   1.00 0.00 ? 81  VAL A CB   3  
ATOM 7134  C CG1  . VAL A 1 81  ? 20.487  -4.201  3.159   1.00 0.00 ? 81  VAL A CG1  3  
ATOM 7135  C CG2  . VAL A 1 81  ? 19.240  -5.350  1.362   1.00 0.00 ? 81  VAL A CG2  3  
ATOM 7136  H H    . VAL A 1 81  ? 19.138  -1.744  3.424   1.00 0.00 ? 81  VAL A H    3  
ATOM 7137  H HA   . VAL A 1 81  ? 18.784  -2.572  0.606   1.00 0.00 ? 81  VAL A HA   3  
ATOM 7138  H HB   . VAL A 1 81  ? 20.658  -3.790  1.080   1.00 0.00 ? 81  VAL A HB   3  
ATOM 7139  H HG11 . VAL A 1 81  ? 19.714  -4.333  3.914   1.00 0.00 ? 81  VAL A HG11 3  
ATOM 7140  H HG12 . VAL A 1 81  ? 21.130  -5.084  3.144   1.00 0.00 ? 81  VAL A HG12 3  
ATOM 7141  H HG13 . VAL A 1 81  ? 21.111  -3.340  3.398   1.00 0.00 ? 81  VAL A HG13 3  
ATOM 7142  H HG21 . VAL A 1 81  ? 18.604  -5.738  2.157   1.00 0.00 ? 81  VAL A HG21 3  
ATOM 7143  H HG22 . VAL A 1 81  ? 18.646  -5.235  0.459   1.00 0.00 ? 81  VAL A HG22 3  
ATOM 7144  H HG23 . VAL A 1 81  ? 20.034  -6.063  1.157   1.00 0.00 ? 81  VAL A HG23 3  
ATOM 7145  N N    . VAL A 1 82  ? 16.489  -3.337  1.185   1.00 0.00 ? 82  VAL A N    3  
ATOM 7146  C CA   . VAL A 1 82  ? 15.161  -3.818  1.516   1.00 0.00 ? 82  VAL A CA   3  
ATOM 7147  C C    . VAL A 1 82  ? 15.233  -5.322  1.782   1.00 0.00 ? 82  VAL A C    3  
ATOM 7148  O O    . VAL A 1 82  ? 16.194  -5.978  1.374   1.00 0.00 ? 82  VAL A O    3  
ATOM 7149  C CB   . VAL A 1 82  ? 14.154  -3.460  0.400   1.00 0.00 ? 82  VAL A CB   3  
ATOM 7150  C CG1  . VAL A 1 82  ? 13.921  -4.564  -0.641  1.00 0.00 ? 82  VAL A CG1  3  
ATOM 7151  C CG2  . VAL A 1 82  ? 12.826  -3.078  1.048   1.00 0.00 ? 82  VAL A CG2  3  
ATOM 7152  H H    . VAL A 1 82  ? 16.727  -3.423  0.215   1.00 0.00 ? 82  VAL A H    3  
ATOM 7153  H HA   . VAL A 1 82  ? 14.871  -3.308  2.428   1.00 0.00 ? 82  VAL A HA   3  
ATOM 7154  H HB   . VAL A 1 82  ? 14.515  -2.579  -0.134  1.00 0.00 ? 82  VAL A HB   3  
ATOM 7155  H HG11 . VAL A 1 82  ? 13.433  -5.422  -0.176  1.00 0.00 ? 82  VAL A HG11 3  
ATOM 7156  H HG12 . VAL A 1 82  ? 13.287  -4.195  -1.446  1.00 0.00 ? 82  VAL A HG12 3  
ATOM 7157  H HG13 . VAL A 1 82  ? 14.873  -4.890  -1.050  1.00 0.00 ? 82  VAL A HG13 3  
ATOM 7158  H HG21 . VAL A 1 82  ? 12.510  -3.820  1.788   1.00 0.00 ? 82  VAL A HG21 3  
ATOM 7159  H HG22 . VAL A 1 82  ? 12.964  -2.126  1.551   1.00 0.00 ? 82  VAL A HG22 3  
ATOM 7160  H HG23 . VAL A 1 82  ? 12.058  -2.969  0.288   1.00 0.00 ? 82  VAL A HG23 3  
ATOM 7161  N N    . ASP A 1 83  ? 14.186  -5.890  2.371   1.00 0.00 ? 83  ASP A N    3  
ATOM 7162  C CA   . ASP A 1 83  ? 14.093  -7.318  2.614   1.00 0.00 ? 83  ASP A CA   3  
ATOM 7163  C C    . ASP A 1 83  ? 12.667  -7.771  2.317   1.00 0.00 ? 83  ASP A C    3  
ATOM 7164  O O    . ASP A 1 83  ? 11.752  -7.468  3.078   1.00 0.00 ? 83  ASP A O    3  
ATOM 7165  C CB   . ASP A 1 83  ? 14.532  -7.589  4.060   1.00 0.00 ? 83  ASP A CB   3  
ATOM 7166  C CG   . ASP A 1 83  ? 15.190  -8.958  4.233   1.00 0.00 ? 83  ASP A CG   3  
ATOM 7167  O OD1  . ASP A 1 83  ? 14.710  -9.939  3.614   1.00 0.00 ? 83  ASP A OD1  3  
ATOM 7168  O OD2  . ASP A 1 83  ? 16.220  -9.033  4.945   1.00 0.00 ? 83  ASP A OD2  3  
ATOM 7169  H H    . ASP A 1 83  ? 13.471  -5.302  2.782   1.00 0.00 ? 83  ASP A H    3  
ATOM 7170  H HA   . ASP A 1 83  ? 14.773  -7.838  1.939   1.00 0.00 ? 83  ASP A HA   3  
ATOM 7171  H HB2  . ASP A 1 83  ? 15.254  -6.819  4.323   1.00 0.00 ? 83  ASP A HB2  3  
ATOM 7172  H HB3  . ASP A 1 83  ? 13.692  -7.486  4.746   1.00 0.00 ? 83  ASP A HB3  3  
ATOM 7173  N N    . LEU A 1 84  ? 12.437  -8.450  1.191   1.00 0.00 ? 84  LEU A N    3  
ATOM 7174  C CA   . LEU A 1 84  ? 11.114  -8.967  0.801   1.00 0.00 ? 84  LEU A CA   3  
ATOM 7175  C C    . LEU A 1 84  ? 10.561  -9.948  1.844   1.00 0.00 ? 84  LEU A C    3  
ATOM 7176  O O    . LEU A 1 84  ? 9.347   -10.119 1.952   1.00 0.00 ? 84  LEU A O    3  
ATOM 7177  C CB   . LEU A 1 84  ? 11.214  -9.691  -0.556  1.00 0.00 ? 84  LEU A CB   3  
ATOM 7178  C CG   . LEU A 1 84  ? 11.132  -8.843  -1.841  1.00 0.00 ? 84  LEU A CG   3  
ATOM 7179  C CD1  . LEU A 1 84  ? 9.695   -8.431  -2.169  1.00 0.00 ? 84  LEU A CD1  3  
ATOM 7180  C CD2  . LEU A 1 84  ? 12.012  -7.593  -1.806  1.00 0.00 ? 84  LEU A CD2  3  
ATOM 7181  H H    . LEU A 1 84  ? 13.208  -8.619  0.560   1.00 0.00 ? 84  LEU A H    3  
ATOM 7182  H HA   . LEU A 1 84  ? 10.411  -8.138  0.720   1.00 0.00 ? 84  LEU A HA   3  
ATOM 7183  H HB2  . LEU A 1 84  ? 12.159  -10.223 -0.563  1.00 0.00 ? 84  LEU A HB2  3  
ATOM 7184  H HB3  . LEU A 1 84  ? 10.431  -10.450 -0.614  1.00 0.00 ? 84  LEU A HB3  3  
ATOM 7185  H HG   . LEU A 1 84  ? 11.481  -9.463  -2.666  1.00 0.00 ? 84  LEU A HG   3  
ATOM 7186  H HD11 . LEU A 1 84  ? 9.277   -7.823  -1.368  1.00 0.00 ? 84  LEU A HD11 3  
ATOM 7187  H HD12 . LEU A 1 84  ? 9.676   -7.883  -3.110  1.00 0.00 ? 84  LEU A HD12 3  
ATOM 7188  H HD13 . LEU A 1 84  ? 9.080   -9.324  -2.277  1.00 0.00 ? 84  LEU A HD13 3  
ATOM 7189  H HD21 . LEU A 1 84  ? 11.952  -7.104  -2.774  1.00 0.00 ? 84  LEU A HD21 3  
ATOM 7190  H HD22 . LEU A 1 84  ? 11.685  -6.905  -1.029  1.00 0.00 ? 84  LEU A HD22 3  
ATOM 7191  H HD23 . LEU A 1 84  ? 13.049  -7.881  -1.631  1.00 0.00 ? 84  LEU A HD23 3  
ATOM 7192  N N    . THR A 1 85  ? 11.431  -10.580 2.630   1.00 0.00 ? 85  THR A N    3  
ATOM 7193  C CA   . THR A 1 85  ? 11.047  -11.398 3.768   1.00 0.00 ? 85  THR A CA   3  
ATOM 7194  C C    . THR A 1 85  ? 10.365  -10.545 4.839   1.00 0.00 ? 85  THR A C    3  
ATOM 7195  O O    . THR A 1 85  ? 9.459   -11.048 5.485   1.00 0.00 ? 85  THR A O    3  
ATOM 7196  C CB   . THR A 1 85  ? 12.283  -12.157 4.289   1.00 0.00 ? 85  THR A CB   3  
ATOM 7197  O OG1  . THR A 1 85  ? 12.182  -13.507 3.888   1.00 0.00 ? 85  THR A OG1  3  
ATOM 7198  C CG2  . THR A 1 85  ? 12.515  -12.075 5.801   1.00 0.00 ? 85  THR A CG2  3  
ATOM 7199  H H    . THR A 1 85  ? 12.411  -10.380 2.503   1.00 0.00 ? 85  THR A H    3  
ATOM 7200  H HA   . THR A 1 85  ? 10.310  -12.131 3.435   1.00 0.00 ? 85  THR A HA   3  
ATOM 7201  H HB   . THR A 1 85  ? 13.164  -11.745 3.809   1.00 0.00 ? 85  THR A HB   3  
ATOM 7202  H HG1  . THR A 1 85  ? 12.696  -14.057 4.505   1.00 0.00 ? 85  THR A HG1  3  
ATOM 7203  H HG21 . THR A 1 85  ? 11.649  -12.463 6.337   1.00 0.00 ? 85  THR A HG21 3  
ATOM 7204  H HG22 . THR A 1 85  ? 13.394  -12.651 6.073   1.00 0.00 ? 85  THR A HG22 3  
ATOM 7205  H HG23 . THR A 1 85  ? 12.702  -11.041 6.092   1.00 0.00 ? 85  THR A HG23 3  
ATOM 7206  N N    . SER A 1 86  ? 10.758  -9.280  5.038   1.00 0.00 ? 86  SER A N    3  
ATOM 7207  C CA   . SER A 1 86  ? 10.132  -8.403  6.023   1.00 0.00 ? 86  SER A CA   3  
ATOM 7208  C C    . SER A 1 86  ? 8.639   -8.283  5.738   1.00 0.00 ? 86  SER A C    3  
ATOM 7209  O O    . SER A 1 86  ? 7.813   -8.459  6.634   1.00 0.00 ? 86  SER A O    3  
ATOM 7210  C CB   . SER A 1 86  ? 10.792  -7.031  5.982   1.00 0.00 ? 86  SER A CB   3  
ATOM 7211  O OG   . SER A 1 86  ? 10.156  -6.173  6.894   1.00 0.00 ? 86  SER A OG   3  
ATOM 7212  H H    . SER A 1 86  ? 11.451  -8.878  4.418   1.00 0.00 ? 86  SER A H    3  
ATOM 7213  H HA   . SER A 1 86  ? 10.273  -8.821  7.017   1.00 0.00 ? 86  SER A HA   3  
ATOM 7214  H HB2  . SER A 1 86  ? 11.850  -7.122  6.230   1.00 0.00 ? 86  SER A HB2  3  
ATOM 7215  H HB3  . SER A 1 86  ? 10.682  -6.599  4.992   1.00 0.00 ? 86  SER A HB3  3  
ATOM 7216  H HG   . SER A 1 86  ? 10.521  -5.292  6.761   1.00 0.00 ? 86  SER A HG   3  
ATOM 7217  N N    . PHE A 1 87  ? 8.303   -8.015  4.473   1.00 0.00 ? 87  PHE A N    3  
ATOM 7218  C CA   . PHE A 1 87  ? 6.929   -8.053  4.023   1.00 0.00 ? 87  PHE A CA   3  
ATOM 7219  C C    . PHE A 1 87  ? 6.345   -9.421  4.332   1.00 0.00 ? 87  PHE A C    3  
ATOM 7220  O O    . PHE A 1 87  ? 5.281   -9.493  4.929   1.00 0.00 ? 87  PHE A O    3  
ATOM 7221  C CB   . PHE A 1 87  ? 6.841   -7.775  2.520   1.00 0.00 ? 87  PHE A CB   3  
ATOM 7222  C CG   . PHE A 1 87  ? 6.869   -6.332  2.058   1.00 0.00 ? 87  PHE A CG   3  
ATOM 7223  C CD1  . PHE A 1 87  ? 6.257   -5.295  2.795   1.00 0.00 ? 87  PHE A CD1  3  
ATOM 7224  C CD2  . PHE A 1 87  ? 7.405   -6.054  0.789   1.00 0.00 ? 87  PHE A CD2  3  
ATOM 7225  C CE1  . PHE A 1 87  ? 6.200   -3.992  2.269   1.00 0.00 ? 87  PHE A CE1  3  
ATOM 7226  C CE2  . PHE A 1 87  ? 7.306   -4.763  0.248   1.00 0.00 ? 87  PHE A CE2  3  
ATOM 7227  C CZ   . PHE A 1 87  ? 6.713   -3.727  0.990   1.00 0.00 ? 87  PHE A CZ   3  
ATOM 7228  H H    . PHE A 1 87  ? 9.039   -7.895  3.792   1.00 0.00 ? 87  PHE A H    3  
ATOM 7229  H HA   . PHE A 1 87  ? 6.355   -7.321  4.587   1.00 0.00 ? 87  PHE A HA   3  
ATOM 7230  H HB2  . PHE A 1 87  ? 7.662   -8.307  2.039   1.00 0.00 ? 87  PHE A HB2  3  
ATOM 7231  H HB3  . PHE A 1 87  ? 5.911   -8.207  2.144   1.00 0.00 ? 87  PHE A HB3  3  
ATOM 7232  H HD1  . PHE A 1 87  ? 5.809   -5.475  3.759   1.00 0.00 ? 87  PHE A HD1  3  
ATOM 7233  H HD2  . PHE A 1 87  ? 7.860   -6.845  0.208   1.00 0.00 ? 87  PHE A HD2  3  
ATOM 7234  H HE1  . PHE A 1 87  ? 5.742   -3.190  2.834   1.00 0.00 ? 87  PHE A HE1  3  
ATOM 7235  H HE2  . PHE A 1 87  ? 7.682   -4.581  -0.745  1.00 0.00 ? 87  PHE A HE2  3  
ATOM 7236  H HZ   . PHE A 1 87  ? 6.639   -2.725  0.585   1.00 0.00 ? 87  PHE A HZ   3  
ATOM 7237  N N    . GLU A 1 88  ? 7.012   -10.509 3.954   1.00 0.00 ? 88  GLU A N    3  
ATOM 7238  C CA   . GLU A 1 88  ? 6.412   -11.828 4.089   1.00 0.00 ? 88  GLU A CA   3  
ATOM 7239  C C    . GLU A 1 88  ? 6.172   -12.219 5.566   1.00 0.00 ? 88  GLU A C    3  
ATOM 7240  O O    . GLU A 1 88  ? 5.303   -13.046 5.826   1.00 0.00 ? 88  GLU A O    3  
ATOM 7241  C CB   . GLU A 1 88  ? 7.180   -12.849 3.227   1.00 0.00 ? 88  GLU A CB   3  
ATOM 7242  C CG   . GLU A 1 88  ? 7.901   -13.993 3.947   1.00 0.00 ? 88  GLU A CG   3  
ATOM 7243  C CD   . GLU A 1 88  ? 6.982   -15.179 4.245   1.00 0.00 ? 88  GLU A CD   3  
ATOM 7244  O OE1  . GLU A 1 88  ? 6.216   -15.605 3.351   1.00 0.00 ? 88  GLU A OE1  3  
ATOM 7245  O OE2  . GLU A 1 88  ? 7.079   -15.778 5.339   1.00 0.00 ? 88  GLU A OE2  3  
ATOM 7246  H H    . GLU A 1 88  ? 7.911   -10.432 3.495   1.00 0.00 ? 88  GLU A H    3  
ATOM 7247  H HA   . GLU A 1 88  ? 5.429   -11.744 3.638   1.00 0.00 ? 88  GLU A HA   3  
ATOM 7248  H HB2  . GLU A 1 88  ? 6.492   -13.255 2.488   1.00 0.00 ? 88  GLU A HB2  3  
ATOM 7249  H HB3  . GLU A 1 88  ? 7.937   -12.315 2.652   1.00 0.00 ? 88  GLU A HB3  3  
ATOM 7250  H HG2  . GLU A 1 88  ? 8.688   -14.353 3.286   1.00 0.00 ? 88  GLU A HG2  3  
ATOM 7251  H HG3  . GLU A 1 88  ? 8.361   -13.628 4.863   1.00 0.00 ? 88  GLU A HG3  3  
ATOM 7252  N N    . GLN A 1 89  ? 6.845   -11.587 6.539   1.00 0.00 ? 89  GLN A N    3  
ATOM 7253  C CA   . GLN A 1 89  ? 6.583   -11.830 7.956   1.00 0.00 ? 89  GLN A CA   3  
ATOM 7254  C C    . GLN A 1 89  ? 5.188   -11.354 8.373   1.00 0.00 ? 89  GLN A C    3  
ATOM 7255  O O    . GLN A 1 89  ? 4.504   -12.053 9.126   1.00 0.00 ? 89  GLN A O    3  
ATOM 7256  C CB   . GLN A 1 89  ? 7.619   -11.170 8.884   1.00 0.00 ? 89  GLN A CB   3  
ATOM 7257  C CG   . GLN A 1 89  ? 9.090   -11.358 8.515   1.00 0.00 ? 89  GLN A CG   3  
ATOM 7258  C CD   . GLN A 1 89  ? 10.082  -11.264 9.682   1.00 0.00 ? 89  GLN A CD   3  
ATOM 7259  O OE1  . GLN A 1 89  ? 9.730   -11.257 10.857  1.00 0.00 ? 89  GLN A OE1  3  
ATOM 7260  N NE2  . GLN A 1 89  ? 11.378  -11.204 9.410   1.00 0.00 ? 89  GLN A NE2  3  
ATOM 7261  H H    . GLN A 1 89  ? 7.593   -10.962 6.270   1.00 0.00 ? 89  GLN A H    3  
ATOM 7262  H HA   . GLN A 1 89  ? 6.617   -12.904 8.107   1.00 0.00 ? 89  GLN A HA   3  
ATOM 7263  H HB2  . GLN A 1 89  ? 7.462   -10.101 8.874   1.00 0.00 ? 89  GLN A HB2  3  
ATOM 7264  H HB3  . GLN A 1 89  ? 7.426   -11.533 9.891   1.00 0.00 ? 89  GLN A HB3  3  
ATOM 7265  H HG2  . GLN A 1 89  ? 9.231   -12.312 8.010   1.00 0.00 ? 89  GLN A HG2  3  
ATOM 7266  H HG3  . GLN A 1 89  ? 9.287   -10.537 7.834   1.00 0.00 ? 89  GLN A HG3  3  
ATOM 7267  H HE21 . GLN A 1 89  ? 11.697  -11.239 8.452   1.00 0.00 ? 89  GLN A HE21 3  
ATOM 7268  H HE22 . GLN A 1 89  ? 11.981  -11.503 10.174  1.00 0.00 ? 89  GLN A HE22 3  
ATOM 7269  N N    . LEU A 1 90  ? 4.778   -10.146 7.954   1.00 0.00 ? 90  LEU A N    3  
ATOM 7270  C CA   . LEU A 1 90  ? 3.535   -9.536  8.443   1.00 0.00 ? 90  LEU A CA   3  
ATOM 7271  C C    . LEU A 1 90  ? 2.568   -9.176  7.322   1.00 0.00 ? 90  LEU A C    3  
ATOM 7272  O O    . LEU A 1 90  ? 1.363   -9.410  7.455   1.00 0.00 ? 90  LEU A O    3  
ATOM 7273  C CB   . LEU A 1 90  ? 3.780   -8.336  9.382   1.00 0.00 ? 90  LEU A CB   3  
ATOM 7274  C CG   . LEU A 1 90  ? 4.925   -7.365  9.032   1.00 0.00 ? 90  LEU A CG   3  
ATOM 7275  C CD1  . LEU A 1 90  ? 4.608   -5.950  9.541   1.00 0.00 ? 90  LEU A CD1  3  
ATOM 7276  C CD2  . LEU A 1 90  ? 6.229   -7.772  9.692   1.00 0.00 ? 90  LEU A CD2  3  
ATOM 7277  H H    . LEU A 1 90  ? 5.398   -9.605  7.355   1.00 0.00 ? 90  LEU A H    3  
ATOM 7278  H HA   . LEU A 1 90  ? 3.009   -10.272 9.046   1.00 0.00 ? 90  LEU A HA   3  
ATOM 7279  H HB2  . LEU A 1 90  ? 2.847   -7.774  9.428   1.00 0.00 ? 90  LEU A HB2  3  
ATOM 7280  H HB3  . LEU A 1 90  ? 3.954   -8.719  10.386  1.00 0.00 ? 90  LEU A HB3  3  
ATOM 7281  H HG   . LEU A 1 90  ? 5.137   -7.379  7.961   1.00 0.00 ? 90  LEU A HG   3  
ATOM 7282  H HD11 . LEU A 1 90  ? 4.264   -5.994  10.573  1.00 0.00 ? 90  LEU A HD11 3  
ATOM 7283  H HD12 . LEU A 1 90  ? 5.497   -5.333  9.509   1.00 0.00 ? 90  LEU A HD12 3  
ATOM 7284  H HD13 . LEU A 1 90  ? 3.839   -5.488  8.934   1.00 0.00 ? 90  LEU A HD13 3  
ATOM 7285  H HD21 . LEU A 1 90  ? 6.231   -8.835  9.891   1.00 0.00 ? 90  LEU A HD21 3  
ATOM 7286  H HD22 . LEU A 1 90  ? 7.029   -7.495  9.006   1.00 0.00 ? 90  LEU A HD22 3  
ATOM 7287  H HD23 . LEU A 1 90  ? 6.359   -7.280  10.649  1.00 0.00 ? 90  LEU A HD23 3  
ATOM 7288  N N    . ALA A 1 91  ? 3.073   -8.664  6.206   1.00 0.00 ? 91  ALA A N    3  
ATOM 7289  C CA   . ALA A 1 91  ? 2.317   -8.271  5.023   1.00 0.00 ? 91  ALA A CA   3  
ATOM 7290  C C    . ALA A 1 91  ? 2.121   -9.502  4.131   1.00 0.00 ? 91  ALA A C    3  
ATOM 7291  O O    . ALA A 1 91  ? 2.434   -9.482  2.937   1.00 0.00 ? 91  ALA A O    3  
ATOM 7292  C CB   . ALA A 1 91  ? 3.054   -7.148  4.271   1.00 0.00 ? 91  ALA A CB   3  
ATOM 7293  H H    . ALA A 1 91  ? 4.080   -8.737  6.100   1.00 0.00 ? 91  ALA A H    3  
ATOM 7294  H HA   . ALA A 1 91  ? 1.339   -7.897  5.350   1.00 0.00 ? 91  ALA A HA   3  
ATOM 7295  H HB1  . ALA A 1 91  ? 4.013   -7.500  3.899   1.00 0.00 ? 91  ALA A HB1  3  
ATOM 7296  H HB2  . ALA A 1 91  ? 2.457   -6.842  3.415   1.00 0.00 ? 91  ALA A HB2  3  
ATOM 7297  H HB3  . ALA A 1 91  ? 3.217   -6.286  4.912   1.00 0.00 ? 91  ALA A HB3  3  
ATOM 7298  N N    . LEU A 1 92  ? 1.628   -10.588 4.726   1.00 0.00 ? 92  LEU A N    3  
ATOM 7299  C CA   . LEU A 1 92  ? 1.417   -11.885 4.092   1.00 0.00 ? 92  LEU A CA   3  
ATOM 7300  C C    . LEU A 1 92  ? 0.152   -12.504 4.691   1.00 0.00 ? 92  LEU A C    3  
ATOM 7301  O O    . LEU A 1 92  ? -0.823  -12.623 3.945   1.00 0.00 ? 92  LEU A O    3  
ATOM 7302  C CB   . LEU A 1 92  ? 2.696   -12.746 4.211   1.00 0.00 ? 92  LEU A CB   3  
ATOM 7303  C CG   . LEU A 1 92  ? 3.117   -13.593 2.998   1.00 0.00 ? 92  LEU A CG   3  
ATOM 7304  C CD1  . LEU A 1 92  ? 2.100   -14.702 2.703   1.00 0.00 ? 92  LEU A CD1  3  
ATOM 7305  C CD2  . LEU A 1 92  ? 3.336   -12.724 1.752   1.00 0.00 ? 92  LEU A CD2  3  
ATOM 7306  H H    . LEU A 1 92  ? 1.456   -10.516 5.721   1.00 0.00 ? 92  LEU A H    3  
ATOM 7307  H HA   . LEU A 1 92  ? 1.216   -11.697 3.037   1.00 0.00 ? 92  LEU A HA   3  
ATOM 7308  H HB2  . LEU A 1 92  ? 3.514   -12.064 4.421   1.00 0.00 ? 92  LEU A HB2  3  
ATOM 7309  H HB3  . LEU A 1 92  ? 2.641   -13.418 5.062   1.00 0.00 ? 92  LEU A HB3  3  
ATOM 7310  H HG   . LEU A 1 92  ? 4.080   -14.052 3.245   1.00 0.00 ? 92  LEU A HG   3  
ATOM 7311  H HD11 . LEU A 1 92  ? 1.150   -14.283 2.374   1.00 0.00 ? 92  LEU A HD11 3  
ATOM 7312  H HD12 . LEU A 1 92  ? 2.492   -15.370 1.938   1.00 0.00 ? 92  LEU A HD12 3  
ATOM 7313  H HD13 . LEU A 1 92  ? 1.938   -15.295 3.606   1.00 0.00 ? 92  LEU A HD13 3  
ATOM 7314  H HD21 . LEU A 1 92  ? 2.385   -12.413 1.323   1.00 0.00 ? 92  LEU A HD21 3  
ATOM 7315  H HD22 . LEU A 1 92  ? 3.899   -11.840 2.044   1.00 0.00 ? 92  LEU A HD22 3  
ATOM 7316  H HD23 . LEU A 1 92  ? 3.910   -13.285 1.015   1.00 0.00 ? 92  LEU A HD23 3  
ATOM 7317  N N    . PRO A 1 93  ? 0.057   -12.768 6.013   1.00 0.00 ? 93  PRO A N    3  
ATOM 7318  C CA   . PRO A 1 93  ? -1.209  -13.161 6.626   1.00 0.00 ? 93  PRO A CA   3  
ATOM 7319  C C    . PRO A 1 93  ? -2.266  -12.051 6.528   1.00 0.00 ? 93  PRO A C    3  
ATOM 7320  O O    . PRO A 1 93  ? -3.426  -12.336 6.234   1.00 0.00 ? 93  PRO A O    3  
ATOM 7321  C CB   . PRO A 1 93  ? -0.884  -13.529 8.077   1.00 0.00 ? 93  PRO A CB   3  
ATOM 7322  C CG   . PRO A 1 93  ? 0.411   -12.769 8.361   1.00 0.00 ? 93  PRO A CG   3  
ATOM 7323  C CD   . PRO A 1 93  ? 1.118   -12.818 7.013   1.00 0.00 ? 93  PRO A CD   3  
ATOM 7324  H HA   . PRO A 1 93  ? -1.588  -14.046 6.118   1.00 0.00 ? 93  PRO A HA   3  
ATOM 7325  H HB2  . PRO A 1 93  ? -1.685  -13.246 8.760   1.00 0.00 ? 93  PRO A HB2  3  
ATOM 7326  H HB3  . PRO A 1 93  ? -0.693  -14.600 8.142   1.00 0.00 ? 93  PRO A HB3  3  
ATOM 7327  H HG2  . PRO A 1 93  ? 0.190   -11.733 8.615   1.00 0.00 ? 93  PRO A HG2  3  
ATOM 7328  H HG3  . PRO A 1 93  ? 1.004   -13.245 9.143   1.00 0.00 ? 93  PRO A HG3  3  
ATOM 7329  H HD2  . PRO A 1 93  ? 1.828   -11.998 6.913   1.00 0.00 ? 93  PRO A HD2  3  
ATOM 7330  H HD3  . PRO A 1 93  ? 1.641   -13.773 6.936   1.00 0.00 ? 93  PRO A HD3  3  
ATOM 7331  N N    . VAL A 1 94  ? -1.876  -10.776 6.685   1.00 0.00 ? 94  VAL A N    3  
ATOM 7332  C CA   . VAL A 1 94  ? -2.790  -9.632  6.652   1.00 0.00 ? 94  VAL A CA   3  
ATOM 7333  C C    . VAL A 1 94  ? -3.581  -9.613  5.343   1.00 0.00 ? 94  VAL A C    3  
ATOM 7334  O O    . VAL A 1 94  ? -4.749  -9.232  5.321   1.00 0.00 ? 94  VAL A O    3  
ATOM 7335  C CB   . VAL A 1 94  ? -1.960  -8.331  6.838   1.00 0.00 ? 94  VAL A CB   3  
ATOM 7336  C CG1  . VAL A 1 94  ? -1.923  -7.351  5.668   1.00 0.00 ? 94  VAL A CG1  3  
ATOM 7337  C CG2  . VAL A 1 94  ? -2.183  -7.632  8.165   1.00 0.00 ? 94  VAL A CG2  3  
ATOM 7338  H H    . VAL A 1 94  ? -0.914  -10.555 6.895   1.00 0.00 ? 94  VAL A H    3  
ATOM 7339  H HA   . VAL A 1 94  ? -3.495  -9.752  7.482   1.00 0.00 ? 94  VAL A HA   3  
ATOM 7340  H HB   . VAL A 1 94  ? -0.926  -8.603  6.902   1.00 0.00 ? 94  VAL A HB   3  
ATOM 7341  H HG11 . VAL A 1 94  ? -1.504  -7.854  4.801   1.00 0.00 ? 94  VAL A HG11 3  
ATOM 7342  H HG12 . VAL A 1 94  ? -2.925  -7.001  5.450   1.00 0.00 ? 94  VAL A HG12 3  
ATOM 7343  H HG13 . VAL A 1 94  ? -1.275  -6.516  5.908   1.00 0.00 ? 94  VAL A HG13 3  
ATOM 7344  H HG21 . VAL A 1 94  ? -1.368  -6.932  8.326   1.00 0.00 ? 94  VAL A HG21 3  
ATOM 7345  H HG22 . VAL A 1 94  ? -3.123  -7.101  8.140   1.00 0.00 ? 94  VAL A HG22 3  
ATOM 7346  H HG23 . VAL A 1 94  ? -2.184  -8.364  8.971   1.00 0.00 ? 94  VAL A HG23 3  
ATOM 7347  N N    . LEU A 1 95  ? -2.926  -10.003 4.242   1.00 0.00 ? 95  LEU A N    3  
ATOM 7348  C CA   . LEU A 1 95  ? -3.495  -9.889  2.911   1.00 0.00 ? 95  LEU A CA   3  
ATOM 7349  C C    . LEU A 1 95  ? -4.734  -10.761 2.767   1.00 0.00 ? 95  LEU A C    3  
ATOM 7350  O O    . LEU A 1 95  ? -5.605  -10.409 1.969   1.00 0.00 ? 95  LEU A O    3  
ATOM 7351  C CB   . LEU A 1 95  ? -2.466  -10.277 1.826   1.00 0.00 ? 95  LEU A CB   3  
ATOM 7352  C CG   . LEU A 1 95  ? -1.698  -9.149  1.105   1.00 0.00 ? 95  LEU A CG   3  
ATOM 7353  C CD1  . LEU A 1 95  ? -2.426  -7.806  0.996   1.00 0.00 ? 95  LEU A CD1  3  
ATOM 7354  C CD2  . LEU A 1 95  ? -0.332  -8.927  1.743   1.00 0.00 ? 95  LEU A CD2  3  
ATOM 7355  H H    . LEU A 1 95  ? -1.997  -10.376 4.359   1.00 0.00 ? 95  LEU A H    3  
ATOM 7356  H HA   . LEU A 1 95  ? -3.832  -8.865  2.775   1.00 0.00 ? 95  LEU A HA   3  
ATOM 7357  H HB2  . LEU A 1 95  ? -1.762  -11.006 2.225   1.00 0.00 ? 95  LEU A HB2  3  
ATOM 7358  H HB3  . LEU A 1 95  ? -2.994  -10.820 1.050   1.00 0.00 ? 95  LEU A HB3  3  
ATOM 7359  H HG   . LEU A 1 95  ? -1.515  -9.488  0.085   1.00 0.00 ? 95  LEU A HG   3  
ATOM 7360  H HD11 . LEU A 1 95  ? -2.523  -7.324  1.976   1.00 0.00 ? 95  LEU A HD11 3  
ATOM 7361  H HD12 . LEU A 1 95  ? -1.857  -7.151  0.340   1.00 0.00 ? 95  LEU A HD12 3  
ATOM 7362  H HD13 . LEU A 1 95  ? -3.409  -7.962  0.553   1.00 0.00 ? 95  LEU A HD13 3  
ATOM 7363  H HD21 . LEU A 1 95  ? 0.226   -8.185  1.175   1.00 0.00 ? 95  LEU A HD21 3  
ATOM 7364  H HD22 . LEU A 1 95  ? -0.431  -8.601  2.776   1.00 0.00 ? 95  LEU A HD22 3  
ATOM 7365  H HD23 . LEU A 1 95  ? 0.229   -9.860  1.704   1.00 0.00 ? 95  LEU A HD23 3  
ATOM 7366  N N    . ARG A 1 96  ? -4.790  -11.891 3.477   1.00 0.00 ? 96  ARG A N    3  
ATOM 7367  C CA   . ARG A 1 96  ? -5.913  -12.812 3.529   1.00 0.00 ? 96  ARG A CA   3  
ATOM 7368  C C    . ARG A 1 96  ? -5.573  -13.857 4.571   1.00 0.00 ? 96  ARG A C    3  
ATOM 7369  O O    . ARG A 1 96  ? -4.730  -14.727 4.335   1.00 0.00 ? 96  ARG A O    3  
ATOM 7370  C CB   . ARG A 1 96  ? -6.188  -13.437 2.154   1.00 0.00 ? 96  ARG A CB   3  
ATOM 7371  C CG   . ARG A 1 96  ? -7.345  -14.443 2.162   1.00 0.00 ? 96  ARG A CG   3  
ATOM 7372  C CD   . ARG A 1 96  ? -6.905  -15.899 2.394   1.00 0.00 ? 96  ARG A CD   3  
ATOM 7373  N NE   . ARG A 1 96  ? -7.623  -16.794 1.479   1.00 0.00 ? 96  ARG A NE   3  
ATOM 7374  C CZ   . ARG A 1 96  ? -8.097  -18.018 1.703   1.00 0.00 ? 96  ARG A CZ   3  
ATOM 7375  N NH1  . ARG A 1 96  ? -7.773  -18.713 2.791   1.00 0.00 ? 96  ARG A NH1  3  
ATOM 7376  N NH2  . ARG A 1 96  ? -8.919  -18.532 0.802   1.00 0.00 ? 96  ARG A NH2  3  
ATOM 7377  H H    . ARG A 1 96  ? -4.060  -12.057 4.166   1.00 0.00 ? 96  ARG A H    3  
ATOM 7378  H HA   . ARG A 1 96  ? -6.804  -12.275 3.857   1.00 0.00 ? 96  ARG A HA   3  
ATOM 7379  H HB2  . ARG A 1 96  ? -6.468  -12.648 1.457   1.00 0.00 ? 96  ARG A HB2  3  
ATOM 7380  H HB3  . ARG A 1 96  ? -5.279  -13.903 1.778   1.00 0.00 ? 96  ARG A HB3  3  
ATOM 7381  H HG2  . ARG A 1 96  ? -8.081  -14.160 2.913   1.00 0.00 ? 96  ARG A HG2  3  
ATOM 7382  H HG3  . ARG A 1 96  ? -7.836  -14.362 1.194   1.00 0.00 ? 96  ARG A HG3  3  
ATOM 7383  H HD2  . ARG A 1 96  ? -5.835  -16.002 2.210   1.00 0.00 ? 96  ARG A HD2  3  
ATOM 7384  H HD3  . ARG A 1 96  ? -7.108  -16.170 3.430   1.00 0.00 ? 96  ARG A HD3  3  
ATOM 7385  H HE   . ARG A 1 96  ? -7.833  -16.390 0.566   1.00 0.00 ? 96  ARG A HE   3  
ATOM 7386  H HH11 . ARG A 1 96  ? -7.079  -18.352 3.435   1.00 0.00 ? 96  ARG A HH11 3  
ATOM 7387  H HH12 . ARG A 1 96  ? -8.156  -19.629 2.980   1.00 0.00 ? 96  ARG A HH12 3  
ATOM 7388  H HH21 . ARG A 1 96  ? -9.155  -17.980 -0.020  1.00 0.00 ? 96  ARG A HH21 3  
ATOM 7389  H HH22 . ARG A 1 96  ? -9.446  -19.385 0.976   1.00 0.00 ? 96  ARG A HH22 3  
ATOM 7390  N N    . ASN A 1 97  ? -6.263  -13.774 5.695   1.00 0.00 ? 97  ASN A N    3  
ATOM 7391  C CA   . ASN A 1 97  ? -6.377  -14.827 6.683   1.00 0.00 ? 97  ASN A CA   3  
ATOM 7392  C C    . ASN A 1 97  ? -7.750  -15.475 6.530   1.00 0.00 ? 97  ASN A C    3  
ATOM 7393  O O    . ASN A 1 97  ? -8.595  -14.983 5.770   1.00 0.00 ? 97  ASN A O    3  
ATOM 7394  C CB   . ASN A 1 97  ? -6.095  -14.180 8.042   1.00 0.00 ? 97  ASN A CB   3  
ATOM 7395  C CG   . ASN A 1 97  ? -6.037  -15.148 9.208   1.00 0.00 ? 97  ASN A CG   3  
ATOM 7396  O OD1  . ASN A 1 97  ? -5.915  -16.359 9.037   1.00 0.00 ? 97  ASN A OD1  3  
ATOM 7397  N ND2  . ASN A 1 97  ? -6.086  -14.616 10.413  1.00 0.00 ? 97  ASN A ND2  3  
ATOM 7398  H H    . ASN A 1 97  ? -6.886  -12.983 5.834   1.00 0.00 ? 97  ASN A H    3  
ATOM 7399  H HA   . ASN A 1 97  ? -5.662  -15.621 6.504   1.00 0.00 ? 97  ASN A HA   3  
ATOM 7400  H HB2  . ASN A 1 97  ? -5.123  -13.683 7.993   1.00 0.00 ? 97  ASN A HB2  3  
ATOM 7401  H HB3  . ASN A 1 97  ? -6.866  -13.428 8.221   1.00 0.00 ? 97  ASN A HB3  3  
ATOM 7402  H HD21 . ASN A 1 97  ? -6.057  -13.603 10.515  1.00 0.00 ? 97  ASN A HD21 3  
ATOM 7403  H HD22 . ASN A 1 97  ? -6.261  -15.230 11.212  1.00 0.00 ? 97  ASN A HD22 3  
ATOM 7404  N N    . ALA A 1 98  ? -7.965  -16.633 7.155   1.00 0.00 ? 98  ALA A N    3  
ATOM 7405  C CA   . ALA A 1 98  ? -9.207  -17.376 7.026   1.00 0.00 ? 98  ALA A CA   3  
ATOM 7406  C C    . ALA A 1 98  ? -9.506  -18.178 8.291   1.00 0.00 ? 98  ALA A C    3  
ATOM 7407  O O    . ALA A 1 98  ? -9.730  -19.392 8.233   1.00 0.00 ? 98  ALA A O    3  
ATOM 7408  C CB   . ALA A 1 98  ? -9.195  -18.242 5.758   1.00 0.00 ? 98  ALA A CB   3  
ATOM 7409  H H    . ALA A 1 98  ? -7.265  -16.970 7.814   1.00 0.00 ? 98  ALA A H    3  
ATOM 7410  H HA   . ALA A 1 98  ? -9.980  -16.631 6.927   1.00 0.00 ? 98  ALA A HA   3  
ATOM 7411  H HB1  . ALA A 1 98  ? -8.405  -18.989 5.820   1.00 0.00 ? 98  ALA A HB1  3  
ATOM 7412  H HB2  . ALA A 1 98  ? -10.158 -18.745 5.653   1.00 0.00 ? 98  ALA A HB2  3  
ATOM 7413  H HB3  . ALA A 1 98  ? -9.037  -17.609 4.887   1.00 0.00 ? 98  ALA A HB3  3  
ATOM 7414  N N    . ASP A 1 99  ? -9.473  -17.489 9.429   1.00 0.00 ? 99  ASP A N    3  
ATOM 7415  C CA   . ASP A 1 99  ? -9.499  -18.066 10.766  1.00 0.00 ? 99  ASP A CA   3  
ATOM 7416  C C    . ASP A 1 99  ? -10.328 -17.175 11.705  1.00 0.00 ? 99  ASP A C    3  
ATOM 7417  O O    . ASP A 1 99  ? -10.705 -16.059 11.330  1.00 0.00 ? 99  ASP A O    3  
ATOM 7418  C CB   . ASP A 1 99  ? -8.039  -18.281 11.225  1.00 0.00 ? 99  ASP A CB   3  
ATOM 7419  C CG   . ASP A 1 99  ? -7.633  -17.481 12.464  1.00 0.00 ? 99  ASP A CG   3  
ATOM 7420  O OD1  . ASP A 1 99  ? -7.429  -16.252 12.365  1.00 0.00 ? 99  ASP A OD1  3  
ATOM 7421  O OD2  . ASP A 1 99  ? -7.540  -18.124 13.538  1.00 0.00 ? 99  ASP A OD2  3  
ATOM 7422  H H    . ASP A 1 99  ? -9.336  -16.487 9.414   1.00 0.00 ? 99  ASP A H    3  
ATOM 7423  H HA   . ASP A 1 99  ? -9.987  -19.040 10.711  1.00 0.00 ? 99  ASP A HA   3  
ATOM 7424  H HB2  . ASP A 1 99  ? -7.899  -19.342 11.439  1.00 0.00 ? 99  ASP A HB2  3  
ATOM 7425  H HB3  . ASP A 1 99  ? -7.359  -18.038 10.408  1.00 0.00 ? 99  ASP A HB3  3  
ATOM 7426  N N    . CYS A 1 100 ? -10.621 -17.680 12.911  1.00 0.00 ? 100 CYS A N    3  
ATOM 7427  C CA   . CYS A 1 100 ? -11.468 -17.092 13.943  1.00 0.00 ? 100 CYS A CA   3  
ATOM 7428  C C    . CYS A 1 100 ? -12.918 -16.944 13.459  1.00 0.00 ? 100 CYS A C    3  
ATOM 7429  O O    . CYS A 1 100 ? -13.237 -16.099 12.620  1.00 0.00 ? 100 CYS A O    3  
ATOM 7430  C CB   . CYS A 1 100 ? -10.861 -15.786 14.474  1.00 0.00 ? 100 CYS A CB   3  
ATOM 7431  S SG   . CYS A 1 100 ? -11.720 -15.294 15.996  1.00 0.00 ? 100 CYS A SG   3  
ATOM 7432  H H    . CYS A 1 100 ? -10.243 -18.593 13.123  1.00 0.00 ? 100 CYS A H    3  
ATOM 7433  H HA   . CYS A 1 100 ? -11.458 -17.796 14.777  1.00 0.00 ? 100 CYS A HA   3  
ATOM 7434  H HB2  . CYS A 1 100 ? -9.803  -15.944 14.697  1.00 0.00 ? 100 CYS A HB2  3  
ATOM 7435  H HB3  . CYS A 1 100 ? -10.948 -15.000 13.722  1.00 0.00 ? 100 CYS A HB3  3  
ATOM 7436  H HG   . CYS A 1 100 ? -12.906 -14.991 15.437  1.00 0.00 ? 100 CYS A HG   3  
ATOM 7437  N N    . SER A 1 101 ? -13.805 -17.779 13.987  1.00 0.00 ? 101 SER A N    3  
ATOM 7438  C CA   . SER A 1 101 ? -15.222 -17.916 13.659  1.00 0.00 ? 101 SER A CA   3  
ATOM 7439  C C    . SER A 1 101 ? -16.086 -16.754 14.194  1.00 0.00 ? 101 SER A C    3  
ATOM 7440  O O    . SER A 1 101 ? -17.115 -16.970 14.836  1.00 0.00 ? 101 SER A O    3  
ATOM 7441  C CB   . SER A 1 101 ? -15.659 -19.311 14.159  1.00 0.00 ? 101 SER A CB   3  
ATOM 7442  O OG   . SER A 1 101 ? -14.961 -19.669 15.350  1.00 0.00 ? 101 SER A OG   3  
ATOM 7443  H H    . SER A 1 101 ? -13.522 -18.458 14.684  1.00 0.00 ? 101 SER A H    3  
ATOM 7444  H HA   . SER A 1 101 ? -15.326 -17.899 12.576  1.00 0.00 ? 101 SER A HA   3  
ATOM 7445  H HB2  . SER A 1 101 ? -16.738 -19.355 14.318  1.00 0.00 ? 101 SER A HB2  3  
ATOM 7446  H HB3  . SER A 1 101 ? -15.411 -20.044 13.389  1.00 0.00 ? 101 SER A HB3  3  
ATOM 7447  H HG   . SER A 1 101 ? -15.233 -20.577 15.595  1.00 0.00 ? 101 SER A HG   3  
ATOM 7448  N N    . SER A 1 102 ? -15.673 -15.510 13.944  1.00 0.00 ? 102 SER A N    3  
ATOM 7449  C CA   . SER A 1 102 ? -16.400 -14.302 14.322  1.00 0.00 ? 102 SER A CA   3  
ATOM 7450  C C    . SER A 1 102 ? -17.144 -13.722 13.107  1.00 0.00 ? 102 SER A C    3  
ATOM 7451  O O    . SER A 1 102 ? -16.870 -14.124 11.972  1.00 0.00 ? 102 SER A O    3  
ATOM 7452  C CB   . SER A 1 102 ? -15.418 -13.281 14.914  1.00 0.00 ? 102 SER A CB   3  
ATOM 7453  O OG   . SER A 1 102 ? -14.537 -13.865 15.863  1.00 0.00 ? 102 SER A OG   3  
ATOM 7454  H H    . SER A 1 102 ? -14.846 -15.391 13.375  1.00 0.00 ? 102 SER A H    3  
ATOM 7455  H HA   . SER A 1 102 ? -17.133 -14.553 15.090  1.00 0.00 ? 102 SER A HA   3  
ATOM 7456  H HB2  . SER A 1 102 ? -14.823 -12.836 14.118  1.00 0.00 ? 102 SER A HB2  3  
ATOM 7457  H HB3  . SER A 1 102 ? -15.995 -12.493 15.395  1.00 0.00 ? 102 SER A HB3  3  
ATOM 7458  H HG   . SER A 1 102 ? -14.061 -13.141 16.307  1.00 0.00 ? 102 SER A HG   3  
ATOM 7459  N N    . GLY A 1 103 ? -18.028 -12.747 13.349  1.00 0.00 ? 103 GLY A N    3  
ATOM 7460  C CA   . GLY A 1 103 ? -18.980 -12.142 12.417  1.00 0.00 ? 103 GLY A CA   3  
ATOM 7461  C C    . GLY A 1 103 ? -18.483 -11.938 10.974  1.00 0.00 ? 103 GLY A C    3  
ATOM 7462  O O    . GLY A 1 103 ? -17.344 -11.495 10.792  1.00 0.00 ? 103 GLY A O    3  
ATOM 7463  H H    . GLY A 1 103 ? -18.211 -12.519 14.318  1.00 0.00 ? 103 GLY A H    3  
ATOM 7464  H HA2  . GLY A 1 103 ? -19.879 -12.749 12.435  1.00 0.00 ? 103 GLY A HA2  3  
ATOM 7465  H HA3  . GLY A 1 103 ? -19.254 -11.163 12.809  1.00 0.00 ? 103 GLY A HA3  3  
ATOM 7466  N N    . PRO A 1 104 ? -19.333 -12.175 9.956   1.00 0.00 ? 104 PRO A N    3  
ATOM 7467  C CA   . PRO A 1 104 ? -19.058 -11.900 8.548   1.00 0.00 ? 104 PRO A CA   3  
ATOM 7468  C C    . PRO A 1 104 ? -19.298 -10.431 8.198   1.00 0.00 ? 104 PRO A C    3  
ATOM 7469  O O    . PRO A 1 104 ? -19.585 -9.593  9.064   1.00 0.00 ? 104 PRO A O    3  
ATOM 7470  C CB   . PRO A 1 104 ? -20.016 -12.826 7.788   1.00 0.00 ? 104 PRO A CB   3  
ATOM 7471  C CG   . PRO A 1 104 ? -21.255 -12.806 8.677   1.00 0.00 ? 104 PRO A CG   3  
ATOM 7472  C CD   . PRO A 1 104 ? -20.660 -12.758 10.083  1.00 0.00 ? 104 PRO A CD   3  
ATOM 7473  H HA   . PRO A 1 104 ? -18.020 -12.119 8.293   1.00 0.00 ? 104 PRO A HA   3  
ATOM 7474  H HB2  . PRO A 1 104 ? -20.245 -12.487 6.777   1.00 0.00 ? 104 PRO A HB2  3  
ATOM 7475  H HB3  . PRO A 1 104 ? -19.605 -13.834 7.757   1.00 0.00 ? 104 PRO A HB3  3  
ATOM 7476  H HG2  . PRO A 1 104 ? -21.826 -11.896 8.491   1.00 0.00 ? 104 PRO A HG2  3  
ATOM 7477  H HG3  . PRO A 1 104 ? -21.876 -13.687 8.528   1.00 0.00 ? 104 PRO A HG3  3  
ATOM 7478  H HD2  . PRO A 1 104 ? -21.292 -12.156 10.737  1.00 0.00 ? 104 PRO A HD2  3  
ATOM 7479  H HD3  . PRO A 1 104 ? -20.558 -13.769 10.474  1.00 0.00 ? 104 PRO A HD3  3  
ATOM 7480  N N    . GLY A 1 105 ? -19.145 -10.123 6.913   1.00 0.00 ? 105 GLY A N    3  
ATOM 7481  C CA   . GLY A 1 105 ? -18.903 -8.807  6.391   1.00 0.00 ? 105 GLY A CA   3  
ATOM 7482  C C    . GLY A 1 105 ? -17.749 -8.982  5.416   1.00 0.00 ? 105 GLY A C    3  
ATOM 7483  O O    . GLY A 1 105 ? -17.666 -9.990  4.704   1.00 0.00 ? 105 GLY A O    3  
ATOM 7484  H H    . GLY A 1 105 ? -18.864 -10.814 6.227   1.00 0.00 ? 105 GLY A H    3  
ATOM 7485  H HA2  . GLY A 1 105 ? -19.792 -8.447  5.876   1.00 0.00 ? 105 GLY A HA2  3  
ATOM 7486  H HA3  . GLY A 1 105 ? -18.623 -8.114  7.183   1.00 0.00 ? 105 GLY A HA3  3  
ATOM 7487  N N    . GLN A 1 106 ? -16.851 -8.011  5.401   1.00 0.00 ? 106 GLN A N    3  
ATOM 7488  C CA   . GLN A 1 106 ? -15.699 -7.939  4.527   1.00 0.00 ? 106 GLN A CA   3  
ATOM 7489  C C    . GLN A 1 106 ? -14.462 -7.459  5.272   1.00 0.00 ? 106 GLN A C    3  
ATOM 7490  O O    . GLN A 1 106 ? -14.549 -6.696  6.234   1.00 0.00 ? 106 GLN A O    3  
ATOM 7491  C CB   . GLN A 1 106 ? -15.999 -6.992  3.358   1.00 0.00 ? 106 GLN A CB   3  
ATOM 7492  C CG   . GLN A 1 106 ? -17.127 -7.559  2.511   1.00 0.00 ? 106 GLN A CG   3  
ATOM 7493  C CD   . GLN A 1 106 ? -17.371 -6.690  1.281   1.00 0.00 ? 106 GLN A CD   3  
ATOM 7494  O OE1  . GLN A 1 106 ? -18.164 -5.749  1.311   1.00 0.00 ? 106 GLN A OE1  3  
ATOM 7495  N NE2  . GLN A 1 106 ? -16.703 -6.961  0.172   1.00 0.00 ? 106 GLN A NE2  3  
ATOM 7496  H H    . GLN A 1 106 ? -16.951 -7.299  6.103   1.00 0.00 ? 106 GLN A H    3  
ATOM 7497  H HA   . GLN A 1 106 ? -15.502 -8.941  4.145   1.00 0.00 ? 106 GLN A HA   3  
ATOM 7498  H HB2  . GLN A 1 106 ? -16.269 -6.004  3.736   1.00 0.00 ? 106 GLN A HB2  3  
ATOM 7499  H HB3  . GLN A 1 106 ? -15.120 -6.909  2.721   1.00 0.00 ? 106 GLN A HB3  3  
ATOM 7500  H HG2  . GLN A 1 106 ? -16.866 -8.574  2.235   1.00 0.00 ? 106 GLN A HG2  3  
ATOM 7501  H HG3  . GLN A 1 106 ? -18.019 -7.627  3.123   1.00 0.00 ? 106 GLN A HG3  3  
ATOM 7502  H HE21 . GLN A 1 106 ? -16.075 -7.749  0.127   1.00 0.00 ? 106 GLN A HE21 3  
ATOM 7503  H HE22 . GLN A 1 106 ? -16.751 -6.379  -0.655  1.00 0.00 ? 106 GLN A HE22 3  
ATOM 7504  N N    . ARG A 1 107 ? -13.310 -7.876  4.752   1.00 0.00 ? 107 ARG A N    3  
ATOM 7505  C CA   . ARG A 1 107 ? -11.973 -7.473  5.167   1.00 0.00 ? 107 ARG A CA   3  
ATOM 7506  C C    . ARG A 1 107 ? -11.541 -6.244  4.399   1.00 0.00 ? 107 ARG A C    3  
ATOM 7507  O O    . ARG A 1 107 ? -11.073 -6.401  3.283   1.00 0.00 ? 107 ARG A O    3  
ATOM 7508  C CB   . ARG A 1 107 ? -10.944 -8.609  4.986   1.00 0.00 ? 107 ARG A CB   3  
ATOM 7509  C CG   . ARG A 1 107 ? -10.923 -9.599  6.151   1.00 0.00 ? 107 ARG A CG   3  
ATOM 7510  C CD   . ARG A 1 107 ? -11.812 -10.815 5.890   1.00 0.00 ? 107 ARG A CD   3  
ATOM 7511  N NE   . ARG A 1 107 ? -11.392 -11.952 6.718   1.00 0.00 ? 107 ARG A NE   3  
ATOM 7512  C CZ   . ARG A 1 107 ? -11.737 -13.224 6.503   1.00 0.00 ? 107 ARG A CZ   3  
ATOM 7513  N NH1  . ARG A 1 107 ? -12.582 -13.535 5.524   1.00 0.00 ? 107 ARG A NH1  3  
ATOM 7514  N NH2  . ARG A 1 107 ? -11.240 -14.182 7.271   1.00 0.00 ? 107 ARG A NH2  3  
ATOM 7515  H H    . ARG A 1 107 ? -13.446 -8.379  3.880   1.00 0.00 ? 107 ARG A H    3  
ATOM 7516  H HA   . ARG A 1 107 ? -12.001 -7.195  6.199   1.00 0.00 ? 107 ARG A HA   3  
ATOM 7517  H HB2  . ARG A 1 107 ? -11.089 -9.150  4.045   1.00 0.00 ? 107 ARG A HB2  3  
ATOM 7518  H HB3  . ARG A 1 107 ? -9.950  -8.159  4.947   1.00 0.00 ? 107 ARG A HB3  3  
ATOM 7519  H HG2  . ARG A 1 107 ? -9.895  -9.930  6.276   1.00 0.00 ? 107 ARG A HG2  3  
ATOM 7520  H HG3  . ARG A 1 107 ? -11.227 -9.106  7.071   1.00 0.00 ? 107 ARG A HG3  3  
ATOM 7521  H HD2  . ARG A 1 107 ? -12.851 -10.564 6.103   1.00 0.00 ? 107 ARG A HD2  3  
ATOM 7522  H HD3  . ARG A 1 107 ? -11.729 -11.097 4.840   1.00 0.00 ? 107 ARG A HD3  3  
ATOM 7523  H HE   . ARG A 1 107 ? -10.801 -11.717 7.512   1.00 0.00 ? 107 ARG A HE   3  
ATOM 7524  H HH11 . ARG A 1 107 ? -12.978 -12.804 4.927   1.00 0.00 ? 107 ARG A HH11 3  
ATOM 7525  H HH12 . ARG A 1 107 ? -12.887 -14.475 5.282   1.00 0.00 ? 107 ARG A HH12 3  
ATOM 7526  H HH21 . ARG A 1 107 ? -10.544 -13.969 7.989   1.00 0.00 ? 107 ARG A HH21 3  
ATOM 7527  H HH22 . ARG A 1 107 ? -11.580 -15.141 7.211   1.00 0.00 ? 107 ARG A HH22 3  
ATOM 7528  N N    . VAL A 1 108 ? -11.662 -5.025  4.910   1.00 0.00 ? 108 VAL A N    3  
ATOM 7529  C CA   . VAL A 1 108 ? -11.077 -3.908  4.188   1.00 0.00 ? 108 VAL A CA   3  
ATOM 7530  C C    . VAL A 1 108 ? -9.561  -3.966  4.396   1.00 0.00 ? 108 VAL A C    3  
ATOM 7531  O O    . VAL A 1 108 ? -9.079  -3.485  5.419   1.00 0.00 ? 108 VAL A O    3  
ATOM 7532  C CB   . VAL A 1 108 ? -11.731 -2.584  4.597   1.00 0.00 ? 108 VAL A CB   3  
ATOM 7533  C CG1  . VAL A 1 108 ? -11.166 -1.491  3.689   1.00 0.00 ? 108 VAL A CG1  3  
ATOM 7534  C CG2  . VAL A 1 108 ? -13.256 -2.627  4.412   1.00 0.00 ? 108 VAL A CG2  3  
ATOM 7535  H H    . VAL A 1 108 ? -12.017 -4.842  5.839   1.00 0.00 ? 108 VAL A H    3  
ATOM 7536  H HA   . VAL A 1 108 ? -11.264 -4.044  3.126   1.00 0.00 ? 108 VAL A HA   3  
ATOM 7537  H HB   . VAL A 1 108 ? -11.511 -2.359  5.641   1.00 0.00 ? 108 VAL A HB   3  
ATOM 7538  H HG11 . VAL A 1 108 ? -11.225 -1.810  2.650   1.00 0.00 ? 108 VAL A HG11 3  
ATOM 7539  H HG12 . VAL A 1 108 ? -11.728 -0.572  3.807   1.00 0.00 ? 108 VAL A HG12 3  
ATOM 7540  H HG13 . VAL A 1 108 ? -10.124 -1.320  3.956   1.00 0.00 ? 108 VAL A HG13 3  
ATOM 7541  H HG21 . VAL A 1 108 ? -13.497 -2.856  3.377   1.00 0.00 ? 108 VAL A HG21 3  
ATOM 7542  H HG22 . VAL A 1 108 ? -13.696 -3.382  5.064   1.00 0.00 ? 108 VAL A HG22 3  
ATOM 7543  H HG23 . VAL A 1 108 ? -13.688 -1.661  4.671   1.00 0.00 ? 108 VAL A HG23 3  
ATOM 7544  N N    . CYS A 1 109 ? -8.835  -4.600  3.467   1.00 0.00 ? 109 CYS A N    3  
ATOM 7545  C CA   . CYS A 1 109 ? -7.385  -4.619  3.457   1.00 0.00 ? 109 CYS A CA   3  
ATOM 7546  C C    . CYS A 1 109 ? -6.835  -3.253  3.052   1.00 0.00 ? 109 CYS A C    3  
ATOM 7547  O O    . CYS A 1 109 ? -7.551  -2.448  2.458   1.00 0.00 ? 109 CYS A O    3  
ATOM 7548  C CB   . CYS A 1 109 ? -6.810  -5.718  2.549   1.00 0.00 ? 109 CYS A CB   3  
ATOM 7549  S SG   . CYS A 1 109 ? -6.748  -7.288  3.459   1.00 0.00 ? 109 CYS A SG   3  
ATOM 7550  H H    . CYS A 1 109 ? -9.288  -4.871  2.605   1.00 0.00 ? 109 CYS A H    3  
ATOM 7551  H HA   . CYS A 1 109 ? -7.105  -4.836  4.465   1.00 0.00 ? 109 CYS A HA   3  
ATOM 7552  H HB2  . CYS A 1 109 ? -7.404  -5.805  1.641   1.00 0.00 ? 109 CYS A HB2  3  
ATOM 7553  H HB3  . CYS A 1 109 ? -5.791  -5.454  2.265   1.00 0.00 ? 109 CYS A HB3  3  
ATOM 7554  H HG   . CYS A 1 109 ? -6.167  -8.020  2.500   1.00 0.00 ? 109 CYS A HG   3  
ATOM 7555  N N    . VAL A 1 110 ? -5.538  -3.028  3.289   1.00 0.00 ? 110 VAL A N    3  
ATOM 7556  C CA   . VAL A 1 110 ? -4.891  -1.755  3.013   1.00 0.00 ? 110 VAL A CA   3  
ATOM 7557  C C    . VAL A 1 110 ? -3.466  -1.946  2.539   1.00 0.00 ? 110 VAL A C    3  
ATOM 7558  O O    . VAL A 1 110 ? -2.788  -2.827  3.074   1.00 0.00 ? 110 VAL A O    3  
ATOM 7559  C CB   . VAL A 1 110 ? -4.980  -0.868  4.263   1.00 0.00 ? 110 VAL A CB   3  
ATOM 7560  C CG1  . VAL A 1 110 ? -3.762  -0.688  5.149   1.00 0.00 ? 110 VAL A CG1  3  
ATOM 7561  C CG2  . VAL A 1 110 ? -5.192  0.558   3.773   1.00 0.00 ? 110 VAL A CG2  3  
ATOM 7562  H H    . VAL A 1 110 ? -4.973  -3.722  3.750   1.00 0.00 ? 110 VAL A H    3  
ATOM 7563  H HA   . VAL A 1 110 ? -5.456  -1.296  2.211   1.00 0.00 ? 110 VAL A HA   3  
ATOM 7564  H HB   . VAL A 1 110 ? -5.751  -1.295  4.907   1.00 0.00 ? 110 VAL A HB   3  
ATOM 7565  H HG11 . VAL A 1 110 ? -2.969  -0.197  4.603   1.00 0.00 ? 110 VAL A HG11 3  
ATOM 7566  H HG12 . VAL A 1 110 ? -4.020  -0.096  6.025   1.00 0.00 ? 110 VAL A HG12 3  
ATOM 7567  H HG13 . VAL A 1 110 ? -3.426  -1.645  5.464   1.00 0.00 ? 110 VAL A HG13 3  
ATOM 7568  H HG21 . VAL A 1 110 ? -6.090  0.628   3.173   1.00 0.00 ? 110 VAL A HG21 3  
ATOM 7569  H HG22 . VAL A 1 110 ? -5.235  1.246   4.615   1.00 0.00 ? 110 VAL A HG22 3  
ATOM 7570  H HG23 . VAL A 1 110 ? -4.317  0.790   3.150   1.00 0.00 ? 110 VAL A HG23 3  
ATOM 7571  N N    . ILE A 1 111 ? -3.040  -1.155  1.544   1.00 0.00 ? 111 ILE A N    3  
ATOM 7572  C CA   . ILE A 1 111 ? -1.719  -1.224  0.952   1.00 0.00 ? 111 ILE A CA   3  
ATOM 7573  C C    . ILE A 1 111 ? -1.355  0.166   0.409   1.00 0.00 ? 111 ILE A C    3  
ATOM 7574  O O    . ILE A 1 111 ? -1.828  0.557   -0.662  1.00 0.00 ? 111 ILE A O    3  
ATOM 7575  C CB   . ILE A 1 111 ? -1.679  -2.288  -0.175  1.00 0.00 ? 111 ILE A CB   3  
ATOM 7576  C CG1  . ILE A 1 111 ? -2.483  -3.575  0.131   1.00 0.00 ? 111 ILE A CG1  3  
ATOM 7577  C CG2  . ILE A 1 111 ? -0.195  -2.580  -0.434  1.00 0.00 ? 111 ILE A CG2  3  
ATOM 7578  C CD1  . ILE A 1 111 ? -2.463  -4.626  -0.978  1.00 0.00 ? 111 ILE A CD1  3  
ATOM 7579  H H    . ILE A 1 111 ? -3.673  -0.498  1.098   1.00 0.00 ? 111 ILE A H    3  
ATOM 7580  H HA   . ILE A 1 111 ? -1.007  -1.502  1.734   1.00 0.00 ? 111 ILE A HA   3  
ATOM 7581  H HB   . ILE A 1 111 ? -2.117  -1.867  -1.080  1.00 0.00 ? 111 ILE A HB   3  
ATOM 7582  H HG12 . ILE A 1 111 ? -2.096  -4.033  1.040   1.00 0.00 ? 111 ILE A HG12 3  
ATOM 7583  H HG13 . ILE A 1 111 ? -3.530  -3.300  0.291   1.00 0.00 ? 111 ILE A HG13 3  
ATOM 7584  H HG21 . ILE A 1 111 ? 0.330   -1.667  -0.716  1.00 0.00 ? 111 ILE A HG21 3  
ATOM 7585  H HG22 . ILE A 1 111 ? 0.261   -2.968  0.474   1.00 0.00 ? 111 ILE A HG22 3  
ATOM 7586  H HG23 . ILE A 1 111 ? -0.091  -3.303  -1.228  1.00 0.00 ? 111 ILE A HG23 3  
ATOM 7587  H HD11 . ILE A 1 111 ? -1.468  -5.061  -1.041  1.00 0.00 ? 111 ILE A HD11 3  
ATOM 7588  H HD12 . ILE A 1 111 ? -3.173  -5.416  -0.738  1.00 0.00 ? 111 ILE A HD12 3  
ATOM 7589  H HD13 . ILE A 1 111 ? -2.741  -4.171  -1.928  1.00 0.00 ? 111 ILE A HD13 3  
ATOM 7590  N N    . ASP A 1 112 ? -0.498  0.908   1.107   1.00 0.00 ? 112 ASP A N    3  
ATOM 7591  C CA   . ASP A 1 112 ? 0.163   2.093   0.551   1.00 0.00 ? 112 ASP A CA   3  
ATOM 7592  C C    . ASP A 1 112 ? 1.635   1.725   0.263   1.00 0.00 ? 112 ASP A C    3  
ATOM 7593  O O    . ASP A 1 112 ? 1.993   0.544   0.272   1.00 0.00 ? 112 ASP A O    3  
ATOM 7594  C CB   . ASP A 1 112 ? -0.064  3.322   1.458   1.00 0.00 ? 112 ASP A CB   3  
ATOM 7595  C CG   . ASP A 1 112 ? 0.201   4.671   0.750   1.00 0.00 ? 112 ASP A CG   3  
ATOM 7596  O OD1  . ASP A 1 112 ? 0.706   4.679   -0.395  1.00 0.00 ? 112 ASP A OD1  3  
ATOM 7597  O OD2  . ASP A 1 112 ? -0.131  5.754   1.286   1.00 0.00 ? 112 ASP A OD2  3  
ATOM 7598  H H    . ASP A 1 112 ? -0.110  0.530   1.964   1.00 0.00 ? 112 ASP A H    3  
ATOM 7599  H HA   . ASP A 1 112 ? -0.301  2.336   -0.405  1.00 0.00 ? 112 ASP A HA   3  
ATOM 7600  H HB2  . ASP A 1 112 ? -1.099  3.310   1.796   1.00 0.00 ? 112 ASP A HB2  3  
ATOM 7601  H HB3  . ASP A 1 112 ? 0.542   3.218   2.353   1.00 0.00 ? 112 ASP A HB3  3  
ATOM 7602  N N    . GLU A 1 113 ? 2.492   2.695   -0.051  1.00 0.00 ? 113 GLU A N    3  
ATOM 7603  C CA   . GLU A 1 113 ? 3.846   2.562   -0.574  1.00 0.00 ? 113 GLU A CA   3  
ATOM 7604  C C    . GLU A 1 113 ? 3.943   1.484   -1.663  1.00 0.00 ? 113 GLU A C    3  
ATOM 7605  O O    . GLU A 1 113 ? 4.810   0.609   -1.659  1.00 0.00 ? 113 GLU A O    3  
ATOM 7606  C CB   . GLU A 1 113 ? 4.883   2.421   0.552   1.00 0.00 ? 113 GLU A CB   3  
ATOM 7607  C CG   . GLU A 1 113 ? 6.181   3.158   0.192   1.00 0.00 ? 113 GLU A CG   3  
ATOM 7608  C CD   . GLU A 1 113 ? 6.799   2.726   -1.150  1.00 0.00 ? 113 GLU A CD   3  
ATOM 7609  O OE1  . GLU A 1 113 ? 6.457   3.327   -2.206  1.00 0.00 ? 113 GLU A OE1  3  
ATOM 7610  O OE2  . GLU A 1 113 ? 7.654   1.819   -1.152  1.00 0.00 ? 113 GLU A OE2  3  
ATOM 7611  H H    . GLU A 1 113 ? 2.106   3.633   -0.101  1.00 0.00 ? 113 GLU A H    3  
ATOM 7612  H HA   . GLU A 1 113 ? 4.047   3.516   -1.062  1.00 0.00 ? 113 GLU A HA   3  
ATOM 7613  H HB2  . GLU A 1 113 ? 4.494   2.872   1.465   1.00 0.00 ? 113 GLU A HB2  3  
ATOM 7614  H HB3  . GLU A 1 113 ? 5.083   1.371   0.761   1.00 0.00 ? 113 GLU A HB3  3  
ATOM 7615  H HG2  . GLU A 1 113 ? 5.958   4.225   0.150   1.00 0.00 ? 113 GLU A HG2  3  
ATOM 7616  H HG3  . GLU A 1 113 ? 6.900   3.002   0.999   1.00 0.00 ? 113 GLU A HG3  3  
ATOM 7617  N N    . ILE A 1 114 ? 3.029   1.545   -2.624  1.00 0.00 ? 114 ILE A N    3  
ATOM 7618  C CA   . ILE A 1 114 ? 3.193   0.846   -3.882  1.00 0.00 ? 114 ILE A CA   3  
ATOM 7619  C C    . ILE A 1 114 ? 3.966   1.854   -4.730  1.00 0.00 ? 114 ILE A C    3  
ATOM 7620  O O    . ILE A 1 114 ? 3.437   2.922   -5.038  1.00 0.00 ? 114 ILE A O    3  
ATOM 7621  C CB   . ILE A 1 114 ? 1.818   0.438   -4.447  1.00 0.00 ? 114 ILE A CB   3  
ATOM 7622  C CG1  . ILE A 1 114 ? 1.066   -0.492  -3.461  1.00 0.00 ? 114 ILE A CG1  3  
ATOM 7623  C CG2  . ILE A 1 114 ? 2.009   -0.265  -5.800  1.00 0.00 ? 114 ILE A CG2  3  
ATOM 7624  C CD1  . ILE A 1 114 ? -0.437  -0.577  -3.732  1.00 0.00 ? 114 ILE A CD1  3  
ATOM 7625  H H    . ILE A 1 114 ? 2.335   2.278   -2.582  1.00 0.00 ? 114 ILE A H    3  
ATOM 7626  H HA   . ILE A 1 114 ? 3.792   -0.055  -3.734  1.00 0.00 ? 114 ILE A HA   3  
ATOM 7627  H HB   . ILE A 1 114 ? 1.223   1.338   -4.599  1.00 0.00 ? 114 ILE A HB   3  
ATOM 7628  H HG12 . ILE A 1 114 ? 1.494   -1.493  -3.502  1.00 0.00 ? 114 ILE A HG12 3  
ATOM 7629  H HG13 . ILE A 1 114 ? 1.172   -0.126  -2.441  1.00 0.00 ? 114 ILE A HG13 3  
ATOM 7630  H HG21 . ILE A 1 114 ? 2.448   0.424   -6.521  1.00 0.00 ? 114 ILE A HG21 3  
ATOM 7631  H HG22 . ILE A 1 114 ? 2.665   -1.126  -5.680  1.00 0.00 ? 114 ILE A HG22 3  
ATOM 7632  H HG23 . ILE A 1 114 ? 1.048   -0.597  -6.186  1.00 0.00 ? 114 ILE A HG23 3  
ATOM 7633  H HD11 . ILE A 1 114 ? -0.933  -1.091  -2.906  1.00 0.00 ? 114 ILE A HD11 3  
ATOM 7634  H HD12 . ILE A 1 114 ? -0.853  0.427   -3.797  1.00 0.00 ? 114 ILE A HD12 3  
ATOM 7635  H HD13 . ILE A 1 114 ? -0.631  -1.133  -4.651  1.00 0.00 ? 114 ILE A HD13 3  
ATOM 7636  N N    . GLY A 1 115 ? 5.233   1.586   -5.039  1.00 0.00 ? 115 GLY A N    3  
ATOM 7637  C CA   . GLY A 1 115 ? 6.063   2.478   -5.836  1.00 0.00 ? 115 GLY A CA   3  
ATOM 7638  C C    . GLY A 1 115 ? 7.549   2.276   -5.578  1.00 0.00 ? 115 GLY A C    3  
ATOM 7639  O O    . GLY A 1 115 ? 8.241   1.892   -6.516  1.00 0.00 ? 115 GLY A O    3  
ATOM 7640  H H    . GLY A 1 115 ? 5.604   0.679   -4.774  1.00 0.00 ? 115 GLY A H    3  
ATOM 7641  H HA2  . GLY A 1 115 ? 5.865   2.276   -6.887  1.00 0.00 ? 115 GLY A HA2  3  
ATOM 7642  H HA3  . GLY A 1 115 ? 5.802   3.523   -5.677  1.00 0.00 ? 115 GLY A HA3  3  
ATOM 7643  N N    . LYS A 1 116 ? 8.081   2.529   -4.369  1.00 0.00 ? 116 LYS A N    3  
ATOM 7644  C CA   . LYS A 1 116 ? 9.534   2.402   -4.137  1.00 0.00 ? 116 LYS A CA   3  
ATOM 7645  C C    . LYS A 1 116 ? 9.966   0.942   -4.248  1.00 0.00 ? 116 LYS A C    3  
ATOM 7646  O O    . LYS A 1 116 ? 11.120  0.683   -4.584  1.00 0.00 ? 116 LYS A O    3  
ATOM 7647  C CB   . LYS A 1 116 ? 9.965   3.004   -2.785  1.00 0.00 ? 116 LYS A CB   3  
ATOM 7648  C CG   . LYS A 1 116 ? 11.446  3.435   -2.710  1.00 0.00 ? 116 LYS A CG   3  
ATOM 7649  C CD   . LYS A 1 116 ? 11.662  4.943   -2.477  1.00 0.00 ? 116 LYS A CD   3  
ATOM 7650  C CE   . LYS A 1 116 ? 11.719  5.794   -3.748  1.00 0.00 ? 116 LYS A CE   3  
ATOM 7651  N NZ   . LYS A 1 116 ? 12.992  5.630   -4.479  1.00 0.00 ? 116 LYS A NZ   3  
ATOM 7652  H H    . LYS A 1 116 ? 7.474   2.710   -3.563  1.00 0.00 ? 116 LYS A H    3  
ATOM 7653  H HA   . LYS A 1 116 ? 10.057  2.937   -4.924  1.00 0.00 ? 116 LYS A HA   3  
ATOM 7654  H HB2  . LYS A 1 116 ? 9.319   3.845   -2.528  1.00 0.00 ? 116 LYS A HB2  3  
ATOM 7655  H HB3  . LYS A 1 116 ? 9.831   2.244   -2.018  1.00 0.00 ? 116 LYS A HB3  3  
ATOM 7656  H HG2  . LYS A 1 116 ? 11.886  2.909   -1.862  1.00 0.00 ? 116 LYS A HG2  3  
ATOM 7657  H HG3  . LYS A 1 116 ? 11.990  3.115   -3.598  1.00 0.00 ? 116 LYS A HG3  3  
ATOM 7658  H HD2  . LYS A 1 116 ? 10.866  5.334   -1.843  1.00 0.00 ? 116 LYS A HD2  3  
ATOM 7659  H HD3  . LYS A 1 116 ? 12.595  5.081   -1.931  1.00 0.00 ? 116 LYS A HD3  3  
ATOM 7660  H HE2  . LYS A 1 116 ? 10.881  5.543   -4.399  1.00 0.00 ? 116 LYS A HE2  3  
ATOM 7661  H HE3  . LYS A 1 116 ? 11.627  6.841   -3.450  1.00 0.00 ? 116 LYS A HE3  3  
ATOM 7662  H HZ1  . LYS A 1 116 ? 13.787  5.766   -3.854  1.00 0.00 ? 116 LYS A HZ1  3  
ATOM 7663  H HZ2  . LYS A 1 116 ? 13.042  4.720   -4.924  1.00 0.00 ? 116 LYS A HZ2  3  
ATOM 7664  H HZ3  . LYS A 1 116 ? 13.059  6.315   -5.216  1.00 0.00 ? 116 LYS A HZ3  3  
ATOM 7665  N N    . MET A 1 117 ? 9.046   0.002   -4.031  1.00 0.00 ? 117 MET A N    3  
ATOM 7666  C CA   . MET A 1 117 ? 9.277   -1.420  -4.234  1.00 0.00 ? 117 MET A CA   3  
ATOM 7667  C C    . MET A 1 117 ? 9.438   -1.805  -5.704  1.00 0.00 ? 117 MET A C    3  
ATOM 7668  O O    . MET A 1 117 ? 9.873   -2.926  -5.934  1.00 0.00 ? 117 MET A O    3  
ATOM 7669  C CB   . MET A 1 117 ? 8.152   -2.241  -3.586  1.00 0.00 ? 117 MET A CB   3  
ATOM 7670  C CG   . MET A 1 117 ? 8.097   -2.049  -2.067  1.00 0.00 ? 117 MET A CG   3  
ATOM 7671  S SD   . MET A 1 117 ? 9.623   -2.490  -1.176  1.00 0.00 ? 117 MET A SD   3  
ATOM 7672  C CE   . MET A 1 117 ? 10.333  -0.840  -0.929  1.00 0.00 ? 117 MET A CE   3  
ATOM 7673  H H    . MET A 1 117 ? 8.153   0.295   -3.653  1.00 0.00 ? 117 MET A H    3  
ATOM 7674  H HA   . MET A 1 117 ? 10.211  -1.686  -3.747  1.00 0.00 ? 117 MET A HA   3  
ATOM 7675  H HB2  . MET A 1 117 ? 7.198   -1.940  -4.007  1.00 0.00 ? 117 MET A HB2  3  
ATOM 7676  H HB3  . MET A 1 117 ? 8.292   -3.304  -3.810  1.00 0.00 ? 117 MET A HB3  3  
ATOM 7677  H HG2  . MET A 1 117 ? 7.832   -1.015  -1.838  1.00 0.00 ? 117 MET A HG2  3  
ATOM 7678  H HG3  . MET A 1 117 ? 7.283   -2.667  -1.693  1.00 0.00 ? 117 MET A HG3  3  
ATOM 7679  H HE1  . MET A 1 117 ? 11.123  -0.880  -0.180  1.00 0.00 ? 117 MET A HE1  3  
ATOM 7680  H HE2  . MET A 1 117 ? 10.741  -0.455  -1.862  1.00 0.00 ? 117 MET A HE2  3  
ATOM 7681  H HE3  . MET A 1 117 ? 9.548   -0.173  -0.577  1.00 0.00 ? 117 MET A HE3  3  
ATOM 7682  N N    . GLU A 1 118 ? 9.158   -0.917  -6.673  1.00 0.00 ? 118 GLU A N    3  
ATOM 7683  C CA   . GLU A 1 118 ? 9.086   -1.164  -8.122  1.00 0.00 ? 118 GLU A CA   3  
ATOM 7684  C C    . GLU A 1 118 ? 9.904   -2.364  -8.605  1.00 0.00 ? 118 GLU A C    3  
ATOM 7685  O O    . GLU A 1 118 ? 9.331   -3.369  -9.009  1.00 0.00 ? 118 GLU A O    3  
ATOM 7686  C CB   . GLU A 1 118 ? 9.413   0.112   -8.934  1.00 0.00 ? 118 GLU A CB   3  
ATOM 7687  C CG   . GLU A 1 118 ? 10.678  0.901   -8.513  1.00 0.00 ? 118 GLU A CG   3  
ATOM 7688  C CD   . GLU A 1 118 ? 11.777  1.038   -9.574  1.00 0.00 ? 118 GLU A CD   3  
ATOM 7689  O OE1  . GLU A 1 118 ? 11.492  1.324   -10.758 1.00 0.00 ? 118 GLU A OE1  3  
ATOM 7690  O OE2  . GLU A 1 118 ? 12.965  0.903   -9.189  1.00 0.00 ? 118 GLU A OE2  3  
ATOM 7691  H H    . GLU A 1 118 ? 8.852   0.005   -6.386  1.00 0.00 ? 118 GLU A H    3  
ATOM 7692  H HA   . GLU A 1 118 ? 8.047   -1.418  -8.345  1.00 0.00 ? 118 GLU A HA   3  
ATOM 7693  H HB2  . GLU A 1 118 ? 9.472   -0.159  -9.988  1.00 0.00 ? 118 GLU A HB2  3  
ATOM 7694  H HB3  . GLU A 1 118 ? 8.565   0.787   -8.830  1.00 0.00 ? 118 GLU A HB3  3  
ATOM 7695  H HG2  . GLU A 1 118 ? 10.373  1.909   -8.231  1.00 0.00 ? 118 GLU A HG2  3  
ATOM 7696  H HG3  . GLU A 1 118 ? 11.126  0.436   -7.635  1.00 0.00 ? 118 GLU A HG3  3  
ATOM 7697  N N    . LEU A 1 119 ? 11.235  -2.258  -8.542  1.00 0.00 ? 119 LEU A N    3  
ATOM 7698  C CA   . LEU A 1 119 ? 12.140  -3.279  -9.049  1.00 0.00 ? 119 LEU A CA   3  
ATOM 7699  C C    . LEU A 1 119 ? 12.111  -4.535  -8.173  1.00 0.00 ? 119 LEU A C    3  
ATOM 7700  O O    . LEU A 1 119 ? 12.074  -5.653  -8.683  1.00 0.00 ? 119 LEU A O    3  
ATOM 7701  C CB   . LEU A 1 119 ? 13.562  -2.681  -9.113  1.00 0.00 ? 119 LEU A CB   3  
ATOM 7702  C CG   . LEU A 1 119 ? 14.459  -3.222  -10.238 1.00 0.00 ? 119 LEU A CG   3  
ATOM 7703  C CD1  . LEU A 1 119 ? 14.675  -4.734  -10.182 1.00 0.00 ? 119 LEU A CD1  3  
ATOM 7704  C CD2  . LEU A 1 119 ? 13.930  -2.814  -11.612 1.00 0.00 ? 119 LEU A CD2  3  
ATOM 7705  H H    . LEU A 1 119 ? 11.627  -1.408  -8.170  1.00 0.00 ? 119 LEU A H    3  
ATOM 7706  H HA   . LEU A 1 119 ? 11.803  -3.554  -10.048 1.00 0.00 ? 119 LEU A HA   3  
ATOM 7707  H HB2  . LEU A 1 119 ? 13.492  -1.604  -9.257  1.00 0.00 ? 119 LEU A HB2  3  
ATOM 7708  H HB3  . LEU A 1 119 ? 14.067  -2.832  -8.157  1.00 0.00 ? 119 LEU A HB3  3  
ATOM 7709  H HG   . LEU A 1 119 ? 15.431  -2.748  -10.116 1.00 0.00 ? 119 LEU A HG   3  
ATOM 7710  H HD11 . LEU A 1 119 ? 14.873  -5.042  -9.157  1.00 0.00 ? 119 LEU A HD11 3  
ATOM 7711  H HD12 . LEU A 1 119 ? 13.788  -5.259  -10.537 1.00 0.00 ? 119 LEU A HD12 3  
ATOM 7712  H HD13 . LEU A 1 119 ? 15.513  -5.015  -10.821 1.00 0.00 ? 119 LEU A HD13 3  
ATOM 7713  H HD21 . LEU A 1 119 ? 13.026  -3.368  -11.857 1.00 0.00 ? 119 LEU A HD21 3  
ATOM 7714  H HD22 . LEU A 1 119 ? 13.696  -1.752  -11.610 1.00 0.00 ? 119 LEU A HD22 3  
ATOM 7715  H HD23 . LEU A 1 119 ? 14.684  -3.022  -12.368 1.00 0.00 ? 119 LEU A HD23 3  
ATOM 7716  N N    . PHE A 1 120 ? 12.172  -4.354  -6.852  1.00 0.00 ? 120 PHE A N    3  
ATOM 7717  C CA   . PHE A 1 120 ? 12.354  -5.424  -5.876  1.00 0.00 ? 120 PHE A CA   3  
ATOM 7718  C C    . PHE A 1 120 ? 11.132  -6.343  -5.791  1.00 0.00 ? 120 PHE A C    3  
ATOM 7719  O O    . PHE A 1 120 ? 11.283  -7.513  -5.447  1.00 0.00 ? 120 PHE A O    3  
ATOM 7720  C CB   . PHE A 1 120 ? 12.627  -4.831  -4.484  1.00 0.00 ? 120 PHE A CB   3  
ATOM 7721  C CG   . PHE A 1 120 ? 13.537  -3.625  -4.425  1.00 0.00 ? 120 PHE A CG   3  
ATOM 7722  C CD1  . PHE A 1 120 ? 14.795  -3.656  -5.055  1.00 0.00 ? 120 PHE A CD1  3  
ATOM 7723  C CD2  . PHE A 1 120 ? 13.128  -2.475  -3.719  1.00 0.00 ? 120 PHE A CD2  3  
ATOM 7724  C CE1  . PHE A 1 120 ? 15.623  -2.526  -5.010  1.00 0.00 ? 120 PHE A CE1  3  
ATOM 7725  C CE2  . PHE A 1 120 ? 13.959  -1.346  -3.670  1.00 0.00 ? 120 PHE A CE2  3  
ATOM 7726  C CZ   . PHE A 1 120 ? 15.196  -1.370  -4.333  1.00 0.00 ? 120 PHE A CZ   3  
ATOM 7727  H H    . PHE A 1 120 ? 12.069  -3.415  -6.496  1.00 0.00 ? 120 PHE A H    3  
ATOM 7728  H HA   . PHE A 1 120 ? 13.216  -6.012  -6.183  1.00 0.00 ? 120 PHE A HA   3  
ATOM 7729  H HB2  . PHE A 1 120 ? 11.672  -4.558  -4.036  1.00 0.00 ? 120 PHE A HB2  3  
ATOM 7730  H HB3  . PHE A 1 120 ? 13.078  -5.603  -3.866  1.00 0.00 ? 120 PHE A HB3  3  
ATOM 7731  H HD1  . PHE A 1 120 ? 15.130  -4.539  -5.581  1.00 0.00 ? 120 PHE A HD1  3  
ATOM 7732  H HD2  . PHE A 1 120 ? 12.180  -2.458  -3.203  1.00 0.00 ? 120 PHE A HD2  3  
ATOM 7733  H HE1  . PHE A 1 120 ? 16.582  -2.543  -5.508  1.00 0.00 ? 120 PHE A HE1  3  
ATOM 7734  H HE2  . PHE A 1 120 ? 13.664  -0.458  -3.123  1.00 0.00 ? 120 PHE A HE2  3  
ATOM 7735  H HZ   . PHE A 1 120 ? 15.818  -0.489  -4.314  1.00 0.00 ? 120 PHE A HZ   3  
ATOM 7736  N N    . SER A 1 121 ? 9.953   -5.801  -6.095  1.00 0.00 ? 121 SER A N    3  
ATOM 7737  C CA   . SER A 1 121 ? 8.621   -6.363  -5.957  1.00 0.00 ? 121 SER A CA   3  
ATOM 7738  C C    . SER A 1 121 ? 8.580   -7.836  -6.381  1.00 0.00 ? 121 SER A C    3  
ATOM 7739  O O    . SER A 1 121 ? 8.772   -8.128  -7.560  1.00 0.00 ? 121 SER A O    3  
ATOM 7740  C CB   . SER A 1 121 ? 7.710   -5.466  -6.807  1.00 0.00 ? 121 SER A CB   3  
ATOM 7741  O OG   . SER A 1 121 ? 6.342   -5.739  -6.616  1.00 0.00 ? 121 SER A OG   3  
ATOM 7742  H H    . SER A 1 121 ? 9.974   -4.824  -6.368  1.00 0.00 ? 121 SER A H    3  
ATOM 7743  H HA   . SER A 1 121 ? 8.320   -6.271  -4.914  1.00 0.00 ? 121 SER A HA   3  
ATOM 7744  H HB2  . SER A 1 121 ? 7.879   -4.426  -6.529  1.00 0.00 ? 121 SER A HB2  3  
ATOM 7745  H HB3  . SER A 1 121 ? 7.959   -5.585  -7.864  1.00 0.00 ? 121 SER A HB3  3  
ATOM 7746  H HG   . SER A 1 121 ? 6.045   -6.228  -7.393  1.00 0.00 ? 121 SER A HG   3  
ATOM 7747  N N    . GLN A 1 122 ? 8.324   -8.763  -5.445  1.00 0.00 ? 122 GLN A N    3  
ATOM 7748  C CA   . GLN A 1 122 ? 8.246   -10.195 -5.741  1.00 0.00 ? 122 GLN A CA   3  
ATOM 7749  C C    . GLN A 1 122 ? 6.943   -10.803 -5.223  1.00 0.00 ? 122 GLN A C    3  
ATOM 7750  O O    . GLN A 1 122 ? 5.961   -10.850 -5.967  1.00 0.00 ? 122 GLN A O    3  
ATOM 7751  C CB   . GLN A 1 122 ? 9.495   -10.947 -5.235  1.00 0.00 ? 122 GLN A CB   3  
ATOM 7752  C CG   . GLN A 1 122 ? 10.665  -10.889 -6.226  1.00 0.00 ? 122 GLN A CG   3  
ATOM 7753  C CD   . GLN A 1 122 ? 10.361  -11.544 -7.575  1.00 0.00 ? 122 GLN A CD   3  
ATOM 7754  O OE1  . GLN A 1 122 ? 10.679  -10.999 -8.630  1.00 0.00 ? 122 GLN A OE1  3  
ATOM 7755  N NE2  . GLN A 1 122 ? 9.750   -12.717 -7.600  1.00 0.00 ? 122 GLN A NE2  3  
ATOM 7756  H H    . GLN A 1 122 ? 8.234   -8.472  -4.485  1.00 0.00 ? 122 GLN A H    3  
ATOM 7757  H HA   . GLN A 1 122 ? 8.200   -10.299 -6.822  1.00 0.00 ? 122 GLN A HA   3  
ATOM 7758  H HB2  . GLN A 1 122 ? 9.817   -10.527 -4.283  1.00 0.00 ? 122 GLN A HB2  3  
ATOM 7759  H HB3  . GLN A 1 122 ? 9.250   -11.996 -5.067  1.00 0.00 ? 122 GLN A HB3  3  
ATOM 7760  H HG2  . GLN A 1 122 ? 10.916  -9.847  -6.403  1.00 0.00 ? 122 GLN A HG2  3  
ATOM 7761  H HG3  . GLN A 1 122 ? 11.531  -11.379 -5.778  1.00 0.00 ? 122 GLN A HG3  3  
ATOM 7762  H HE21 . GLN A 1 122 ? 9.520   -13.219 -6.750  1.00 0.00 ? 122 GLN A HE21 3  
ATOM 7763  H HE22 . GLN A 1 122 ? 9.508   -13.123 -8.497  1.00 0.00 ? 122 GLN A HE22 3  
ATOM 7764  N N    . LEU A 1 123 ? 6.899   -11.258 -3.963  1.00 0.00 ? 123 LEU A N    3  
ATOM 7765  C CA   . LEU A 1 123 ? 5.691   -11.854 -3.381  1.00 0.00 ? 123 LEU A CA   3  
ATOM 7766  C C    . LEU A 1 123 ? 4.557   -10.836 -3.306  1.00 0.00 ? 123 LEU A C    3  
ATOM 7767  O O    . LEU A 1 123 ? 3.405   -11.239 -3.217  1.00 0.00 ? 123 LEU A O    3  
ATOM 7768  C CB   . LEU A 1 123 ? 5.974   -12.449 -1.989  1.00 0.00 ? 123 LEU A CB   3  
ATOM 7769  C CG   . LEU A 1 123 ? 7.015   -13.581 -1.943  1.00 0.00 ? 123 LEU A CG   3  
ATOM 7770  C CD1  . LEU A 1 123 ? 7.221   -14.020 -0.489  1.00 0.00 ? 123 LEU A CD1  3  
ATOM 7771  C CD2  . LEU A 1 123 ? 6.604   -14.783 -2.798  1.00 0.00 ? 123 LEU A CD2  3  
ATOM 7772  H H    . LEU A 1 123 ? 7.729   -11.210 -3.389  1.00 0.00 ? 123 LEU A H    3  
ATOM 7773  H HA   . LEU A 1 123 ? 5.316   -12.646 -4.031  1.00 0.00 ? 123 LEU A HA   3  
ATOM 7774  H HB2  . LEU A 1 123 ? 6.323   -11.647 -1.343  1.00 0.00 ? 123 LEU A HB2  3  
ATOM 7775  H HB3  . LEU A 1 123 ? 5.034   -12.821 -1.576  1.00 0.00 ? 123 LEU A HB3  3  
ATOM 7776  H HG   . LEU A 1 123 ? 7.967   -13.202 -2.318  1.00 0.00 ? 123 LEU A HG   3  
ATOM 7777  H HD11 . LEU A 1 123 ? 6.295   -14.409 -0.064  1.00 0.00 ? 123 LEU A HD11 3  
ATOM 7778  H HD12 . LEU A 1 123 ? 7.984   -14.796 -0.437  1.00 0.00 ? 123 LEU A HD12 3  
ATOM 7779  H HD13 . LEU A 1 123 ? 7.561   -13.174 0.108   1.00 0.00 ? 123 LEU A HD13 3  
ATOM 7780  H HD21 . LEU A 1 123 ? 6.579   -14.507 -3.851  1.00 0.00 ? 123 LEU A HD21 3  
ATOM 7781  H HD22 . LEU A 1 123 ? 7.329   -15.586 -2.674  1.00 0.00 ? 123 LEU A HD22 3  
ATOM 7782  H HD23 . LEU A 1 123 ? 5.620   -15.144 -2.500  1.00 0.00 ? 123 LEU A HD23 3  
ATOM 7783  N N    . PHE A 1 124 ? 4.871   -9.544  -3.423  1.00 0.00 ? 124 PHE A N    3  
ATOM 7784  C CA   . PHE A 1 124 ? 3.952   -8.438  -3.550  1.00 0.00 ? 124 PHE A CA   3  
ATOM 7785  C C    . PHE A 1 124 ? 2.905   -8.712  -4.627  1.00 0.00 ? 124 PHE A C    3  
ATOM 7786  O O    . PHE A 1 124 ? 1.756   -8.941  -4.268  1.00 0.00 ? 124 PHE A O    3  
ATOM 7787  C CB   . PHE A 1 124 ? 4.791   -7.161  -3.736  1.00 0.00 ? 124 PHE A CB   3  
ATOM 7788  C CG   . PHE A 1 124 ? 4.195   -5.840  -3.295  1.00 0.00 ? 124 PHE A CG   3  
ATOM 7789  C CD1  . PHE A 1 124 ? 2.980   -5.770  -2.589  1.00 0.00 ? 124 PHE A CD1  3  
ATOM 7790  C CD2  . PHE A 1 124 ? 4.939   -4.666  -3.510  1.00 0.00 ? 124 PHE A CD2  3  
ATOM 7791  C CE1  . PHE A 1 124 ? 2.518   -4.541  -2.101  1.00 0.00 ? 124 PHE A CE1  3  
ATOM 7792  C CE2  . PHE A 1 124 ? 4.472   -3.430  -3.026  1.00 0.00 ? 124 PHE A CE2  3  
ATOM 7793  C CZ   . PHE A 1 124 ? 3.262   -3.370  -2.313  1.00 0.00 ? 124 PHE A CZ   3  
ATOM 7794  H H    . PHE A 1 124 ? 5.840   -9.287  -3.407  1.00 0.00 ? 124 PHE A H    3  
ATOM 7795  H HA   . PHE A 1 124 ? 3.406   -8.394  -2.619  1.00 0.00 ? 124 PHE A HA   3  
ATOM 7796  H HB2  . PHE A 1 124 ? 5.706   -7.269  -3.151  1.00 0.00 ? 124 PHE A HB2  3  
ATOM 7797  H HB3  . PHE A 1 124 ? 5.093   -7.085  -4.778  1.00 0.00 ? 124 PHE A HB3  3  
ATOM 7798  H HD1  . PHE A 1 124 ? 2.405   -6.655  -2.369  1.00 0.00 ? 124 PHE A HD1  3  
ATOM 7799  H HD2  . PHE A 1 124 ? 5.886   -4.737  -4.028  1.00 0.00 ? 124 PHE A HD2  3  
ATOM 7800  H HE1  . PHE A 1 124 ? 1.604   -4.524  -1.532  1.00 0.00 ? 124 PHE A HE1  3  
ATOM 7801  H HE2  . PHE A 1 124 ? 5.046   -2.526  -3.173  1.00 0.00 ? 124 PHE A HE2  3  
ATOM 7802  H HZ   . PHE A 1 124 ? 2.917   -2.429  -1.907  1.00 0.00 ? 124 PHE A HZ   3  
ATOM 7803  N N    . ILE A 1 125 ? 3.283   -8.768  -5.912  1.00 0.00 ? 125 ILE A N    3  
ATOM 7804  C CA   . ILE A 1 125 ? 2.440   -9.162  -7.024  1.00 0.00 ? 125 ILE A CA   3  
ATOM 7805  C C    . ILE A 1 125 ? 1.478   -10.289 -6.647  1.00 0.00 ? 125 ILE A C    3  
ATOM 7806  O O    . ILE A 1 125 ? 0.266   -10.151 -6.796  1.00 0.00 ? 125 ILE A O    3  
ATOM 7807  C CB   . ILE A 1 125 ? 3.351   -9.567  -8.217  1.00 0.00 ? 125 ILE A CB   3  
ATOM 7808  C CG1  . ILE A 1 125 ? 4.140   -8.362  -8.788  1.00 0.00 ? 125 ILE A CG1  3  
ATOM 7809  C CG2  . ILE A 1 125 ? 2.580   -10.313 -9.321  1.00 0.00 ? 125 ILE A CG2  3  
ATOM 7810  C CD1  . ILE A 1 125 ? 5.598   -8.356  -8.321  1.00 0.00 ? 125 ILE A CD1  3  
ATOM 7811  H H    . ILE A 1 125 ? 4.157   -8.391  -6.235  1.00 0.00 ? 125 ILE A H    3  
ATOM 7812  H HA   . ILE A 1 125 ? 1.854   -8.278  -7.253  1.00 0.00 ? 125 ILE A HA   3  
ATOM 7813  H HB   . ILE A 1 125 ? 4.077   -10.294 -7.848  1.00 0.00 ? 125 ILE A HB   3  
ATOM 7814  H HG12 . ILE A 1 125 ? 4.151   -8.396  -9.876  1.00 0.00 ? 125 ILE A HG12 3  
ATOM 7815  H HG13 . ILE A 1 125 ? 3.668   -7.424  -8.504  1.00 0.00 ? 125 ILE A HG13 3  
ATOM 7816  H HG21 . ILE A 1 125 ? 2.325   -11.315 -8.982  1.00 0.00 ? 125 ILE A HG21 3  
ATOM 7817  H HG22 . ILE A 1 125 ? 1.663   -9.787  -9.571  1.00 0.00 ? 125 ILE A HG22 3  
ATOM 7818  H HG23 . ILE A 1 125 ? 3.202   -10.412 -10.211 1.00 0.00 ? 125 ILE A HG23 3  
ATOM 7819  H HD11 . ILE A 1 125 ? 6.094   -9.271  -8.647  1.00 0.00 ? 125 ILE A HD11 3  
ATOM 7820  H HD12 . ILE A 1 125 ? 6.116   -7.504  -8.761  1.00 0.00 ? 125 ILE A HD12 3  
ATOM 7821  H HD13 . ILE A 1 125 ? 5.646   -8.290  -7.234  1.00 0.00 ? 125 ILE A HD13 3  
ATOM 7822  N N    . GLN A 1 126 ? 2.028   -11.410 -6.185  1.00 0.00 ? 126 GLN A N    3  
ATOM 7823  C CA   . GLN A 1 126 ? 1.268   -12.615 -5.907  1.00 0.00 ? 126 GLN A CA   3  
ATOM 7824  C C    . GLN A 1 126 ? 0.239   -12.370 -4.829  1.00 0.00 ? 126 GLN A C    3  
ATOM 7825  O O    . GLN A 1 126 ? -0.937  -12.673 -5.033  1.00 0.00 ? 126 GLN A O    3  
ATOM 7826  C CB   . GLN A 1 126 ? 2.199   -13.721 -5.449  1.00 0.00 ? 126 GLN A CB   3  
ATOM 7827  C CG   . GLN A 1 126 ? 3.072   -14.121 -6.648  1.00 0.00 ? 126 GLN A CG   3  
ATOM 7828  C CD   . GLN A 1 126 ? 3.742   -15.445 -6.386  1.00 0.00 ? 126 GLN A CD   3  
ATOM 7829  O OE1  . GLN A 1 126 ? 4.804   -15.486 -5.770  1.00 0.00 ? 126 GLN A OE1  3  
ATOM 7830  N NE2  . GLN A 1 126 ? 3.128   -16.521 -6.835  1.00 0.00 ? 126 GLN A NE2  3  
ATOM 7831  H H    . GLN A 1 126 ? 3.023   -11.416 -6.012  1.00 0.00 ? 126 GLN A H    3  
ATOM 7832  H HA   . GLN A 1 126 ? 0.761   -12.957 -6.810  1.00 0.00 ? 126 GLN A HA   3  
ATOM 7833  H HB2  . GLN A 1 126 ? 2.800   -13.388 -4.602  1.00 0.00 ? 126 GLN A HB2  3  
ATOM 7834  H HB3  . GLN A 1 126 ? 1.577   -14.543 -5.088  1.00 0.00 ? 126 GLN A HB3  3  
ATOM 7835  H HG2  . GLN A 1 126 ? 2.462   -14.210 -7.549  1.00 0.00 ? 126 GLN A HG2  3  
ATOM 7836  H HG3  . GLN A 1 126 ? 3.834   -13.360 -6.826  1.00 0.00 ? 126 GLN A HG3  3  
ATOM 7837  H HE21 . GLN A 1 126 ? 2.275   -16.436 -7.385  1.00 0.00 ? 126 GLN A HE21 3  
ATOM 7838  H HE22 . GLN A 1 126 ? 3.388   -17.432 -6.498  1.00 0.00 ? 126 GLN A HE22 3  
ATOM 7839  N N    . ALA A 1 127 ? 0.694   -11.867 -3.681  1.00 0.00 ? 127 ALA A N    3  
ATOM 7840  C CA   . ALA A 1 127 ? -0.160  -11.728 -2.531  1.00 0.00 ? 127 ALA A CA   3  
ATOM 7841  C C    . ALA A 1 127 ? -1.304  -10.762 -2.863  1.00 0.00 ? 127 ALA A C    3  
ATOM 7842  O O    . ALA A 1 127 ? -2.460  -11.038 -2.551  1.00 0.00 ? 127 ALA A O    3  
ATOM 7843  C CB   . ALA A 1 127 ? 0.654   -11.266 -1.319  1.00 0.00 ? 127 ALA A CB   3  
ATOM 7844  H H    . ALA A 1 127 ? 1.682   -11.636 -3.579  1.00 0.00 ? 127 ALA A H    3  
ATOM 7845  H HA   . ALA A 1 127 ? -0.535  -12.731 -2.345  1.00 0.00 ? 127 ALA A HA   3  
ATOM 7846  H HB1  . ALA A 1 127 ? 1.475   -11.961 -1.145  1.00 0.00 ? 127 ALA A HB1  3  
ATOM 7847  H HB2  . ALA A 1 127 ? 1.059   -10.267 -1.487  1.00 0.00 ? 127 ALA A HB2  3  
ATOM 7848  H HB3  . ALA A 1 127 ? 0.011   -11.253 -0.440  1.00 0.00 ? 127 ALA A HB3  3  
ATOM 7849  N N    . VAL A 1 128 ? -0.985  -9.656  -3.541  1.00 0.00 ? 128 VAL A N    3  
ATOM 7850  C CA   . VAL A 1 128 ? -1.930  -8.638  -3.981  1.00 0.00 ? 128 VAL A CA   3  
ATOM 7851  C C    . VAL A 1 128 ? -2.932  -9.258  -4.960  1.00 0.00 ? 128 VAL A C    3  
ATOM 7852  O O    . VAL A 1 128 ? -4.133  -9.073  -4.777  1.00 0.00 ? 128 VAL A O    3  
ATOM 7853  C CB   . VAL A 1 128 ? -1.153  -7.431  -4.558  1.00 0.00 ? 128 VAL A CB   3  
ATOM 7854  C CG1  . VAL A 1 128 ? -2.056  -6.311  -5.105  1.00 0.00 ? 128 VAL A CG1  3  
ATOM 7855  C CG2  . VAL A 1 128 ? -0.273  -6.797  -3.471  1.00 0.00 ? 128 VAL A CG2  3  
ATOM 7856  H H    . VAL A 1 128 ? -0.009  -9.501  -3.780  1.00 0.00 ? 128 VAL A H    3  
ATOM 7857  H HA   . VAL A 1 128 ? -2.486  -8.300  -3.106  1.00 0.00 ? 128 VAL A HA   3  
ATOM 7858  H HB   . VAL A 1 128 ? -0.510  -7.782  -5.366  1.00 0.00 ? 128 VAL A HB   3  
ATOM 7859  H HG11 . VAL A 1 128 ? -1.449  -5.455  -5.414  1.00 0.00 ? 128 VAL A HG11 3  
ATOM 7860  H HG12 . VAL A 1 128 ? -2.616  -6.662  -5.968  1.00 0.00 ? 128 VAL A HG12 3  
ATOM 7861  H HG13 . VAL A 1 128 ? -2.746  -5.967  -4.334  1.00 0.00 ? 128 VAL A HG13 3  
ATOM 7862  H HG21 . VAL A 1 128 ? -0.894  -6.256  -2.766  1.00 0.00 ? 128 VAL A HG21 3  
ATOM 7863  H HG22 . VAL A 1 128 ? 0.292   -7.537  -2.913  1.00 0.00 ? 128 VAL A HG22 3  
ATOM 7864  H HG23 . VAL A 1 128 ? 0.429   -6.110  -3.939  1.00 0.00 ? 128 VAL A HG23 3  
ATOM 7865  N N    . ARG A 1 129 ? -2.501  -10.033 -5.966  1.00 0.00 ? 129 ARG A N    3  
ATOM 7866  C CA   . ARG A 1 129 ? -3.428  -10.699 -6.891  1.00 0.00 ? 129 ARG A CA   3  
ATOM 7867  C C    . ARG A 1 129 ? -4.322  -11.692 -6.158  1.00 0.00 ? 129 ARG A C    3  
ATOM 7868  O O    . ARG A 1 129 ? -5.528  -11.684 -6.384  1.00 0.00 ? 129 ARG A O    3  
ATOM 7869  C CB   . ARG A 1 129 ? -2.690  -11.377 -8.055  1.00 0.00 ? 129 ARG A CB   3  
ATOM 7870  C CG   . ARG A 1 129 ? -2.154  -10.334 -9.048  1.00 0.00 ? 129 ARG A CG   3  
ATOM 7871  C CD   . ARG A 1 129 ? -1.326  -10.981 -10.158 1.00 0.00 ? 129 ARG A CD   3  
ATOM 7872  N NE   . ARG A 1 129 ? -2.145  -11.417 -11.305 1.00 0.00 ? 129 ARG A NE   3  
ATOM 7873  C CZ   . ARG A 1 129 ? -1.668  -11.683 -12.529 1.00 0.00 ? 129 ARG A CZ   3  
ATOM 7874  N NH1  . ARG A 1 129 ? -0.412  -11.383 -12.851 1.00 0.00 ? 129 ARG A NH1  3  
ATOM 7875  N NH2  . ARG A 1 129 ? -2.465  -12.257 -13.419 1.00 0.00 ? 129 ARG A NH2  3  
ATOM 7876  H H    . ARG A 1 129 ? -1.502  -10.176 -6.089  1.00 0.00 ? 129 ARG A H    3  
ATOM 7877  H HA   . ARG A 1 129 ? -4.090  -9.947  -7.316  1.00 0.00 ? 129 ARG A HA   3  
ATOM 7878  H HB2  . ARG A 1 129 ? -1.871  -11.983 -7.665  1.00 0.00 ? 129 ARG A HB2  3  
ATOM 7879  H HB3  . ARG A 1 129 ? -3.386  -12.033 -8.581  1.00 0.00 ? 129 ARG A HB3  3  
ATOM 7880  H HG2  . ARG A 1 129 ? -2.976  -9.761  -9.483  1.00 0.00 ? 129 ARG A HG2  3  
ATOM 7881  H HG3  . ARG A 1 129 ? -1.511  -9.636  -8.516  1.00 0.00 ? 129 ARG A HG3  3  
ATOM 7882  H HD2  . ARG A 1 129 ? -0.604  -10.245 -10.492 1.00 0.00 ? 129 ARG A HD2  3  
ATOM 7883  H HD3  . ARG A 1 129 ? -0.776  -11.834 -9.755  1.00 0.00 ? 129 ARG A HD3  3  
ATOM 7884  H HE   . ARG A 1 129 ? -3.127  -11.603 -11.121 1.00 0.00 ? 129 ARG A HE   3  
ATOM 7885  H HH11 . ARG A 1 129 ? 0.072   -10.666 -12.305 1.00 0.00 ? 129 ARG A HH11 3  
ATOM 7886  H HH12 . ARG A 1 129 ? -0.019  -11.601 -13.761 1.00 0.00 ? 129 ARG A HH12 3  
ATOM 7887  H HH21 . ARG A 1 129 ? -3.460  -12.356 -13.204 1.00 0.00 ? 129 ARG A HH21 3  
ATOM 7888  H HH22 . ARG A 1 129 ? -2.201  -12.533 -14.360 1.00 0.00 ? 129 ARG A HH22 3  
ATOM 7889  N N    . GLN A 1 130 ? -3.780  -12.512 -5.258  1.00 0.00 ? 130 GLN A N    3  
ATOM 7890  C CA   . GLN A 1 130 ? -4.570  -13.455 -4.469  1.00 0.00 ? 130 GLN A CA   3  
ATOM 7891  C C    . GLN A 1 130 ? -5.654  -12.710 -3.668  1.00 0.00 ? 130 GLN A C    3  
ATOM 7892  O O    . GLN A 1 130 ? -6.786  -13.187 -3.548  1.00 0.00 ? 130 GLN A O    3  
ATOM 7893  C CB   . GLN A 1 130 ? -3.659  -14.281 -3.559  1.00 0.00 ? 130 GLN A CB   3  
ATOM 7894  C CG   . GLN A 1 130 ? -2.791  -15.282 -4.335  1.00 0.00 ? 130 GLN A CG   3  
ATOM 7895  C CD   . GLN A 1 130 ? -3.401  -16.678 -4.470  1.00 0.00 ? 130 GLN A CD   3  
ATOM 7896  O OE1  . GLN A 1 130 ? -3.719  -17.121 -5.574  1.00 0.00 ? 130 GLN A OE1  3  
ATOM 7897  N NE2  . GLN A 1 130 ? -3.550  -17.407 -3.377  1.00 0.00 ? 130 GLN A NE2  3  
ATOM 7898  H H    . GLN A 1 130 ? -2.777  -12.468 -5.110  1.00 0.00 ? 130 GLN A H    3  
ATOM 7899  H HA   . GLN A 1 130 ? -5.038  -14.165 -5.144  1.00 0.00 ? 130 GLN A HA   3  
ATOM 7900  H HB2  . GLN A 1 130 ? -3.001  -13.612 -3.010  1.00 0.00 ? 130 GLN A HB2  3  
ATOM 7901  H HB3  . GLN A 1 130 ? -4.270  -14.822 -2.841  1.00 0.00 ? 130 GLN A HB3  3  
ATOM 7902  H HG2  . GLN A 1 130 ? -2.548  -14.892 -5.324  1.00 0.00 ? 130 GLN A HG2  3  
ATOM 7903  H HG3  . GLN A 1 130 ? -1.862  -15.373 -3.795  1.00 0.00 ? 130 GLN A HG3  3  
ATOM 7904  H HE21 . GLN A 1 130 ? -3.272  -17.072 -2.463  1.00 0.00 ? 130 GLN A HE21 3  
ATOM 7905  H HE22 . GLN A 1 130 ? -3.894  -18.361 -3.451  1.00 0.00 ? 130 GLN A HE22 3  
ATOM 7906  N N    . THR A 1 131 ? -5.337  -11.531 -3.131  1.00 0.00 ? 131 THR A N    3  
ATOM 7907  C CA   . THR A 1 131 ? -6.296  -10.703 -2.419  1.00 0.00 ? 131 THR A CA   3  
ATOM 7908  C C    . THR A 1 131 ? -7.284  -10.015 -3.371  1.00 0.00 ? 131 THR A C    3  
ATOM 7909  O O    . THR A 1 131 ? -8.466  -9.952  -3.055  1.00 0.00 ? 131 THR A O    3  
ATOM 7910  C CB   . THR A 1 131 ? -5.538  -9.703  -1.541  1.00 0.00 ? 131 THR A CB   3  
ATOM 7911  O OG1  . THR A 1 131 ? -4.677  -10.403 -0.674  1.00 0.00 ? 131 THR A OG1  3  
ATOM 7912  C CG2  . THR A 1 131 ? -6.505  -8.938  -0.652  1.00 0.00 ? 131 THR A CG2  3  
ATOM 7913  H H    . THR A 1 131 ? -4.374  -11.207 -3.145  1.00 0.00 ? 131 THR A H    3  
ATOM 7914  H HA   . THR A 1 131 ? -6.873  -11.352 -1.760  1.00 0.00 ? 131 THR A HA   3  
ATOM 7915  H HB   . THR A 1 131 ? -4.959  -9.017  -2.160  1.00 0.00 ? 131 THR A HB   3  
ATOM 7916  H HG1  . THR A 1 131 ? -5.116  -10.458 0.193   1.00 0.00 ? 131 THR A HG1  3  
ATOM 7917  H HG21 . THR A 1 131 ? -7.188  -8.335  -1.248  1.00 0.00 ? 131 THR A HG21 3  
ATOM 7918  H HG22 . THR A 1 131 ? -7.089  -9.662  -0.085  1.00 0.00 ? 131 THR A HG22 3  
ATOM 7919  H HG23 . THR A 1 131 ? -5.959  -8.285  0.031   1.00 0.00 ? 131 THR A HG23 3  
ATOM 7920  N N    . LEU A 1 132 ? -6.863  -9.534  -4.544  1.00 0.00 ? 132 LEU A N    3  
ATOM 7921  C CA   . LEU A 1 132 ? -7.775  -8.974  -5.546  1.00 0.00 ? 132 LEU A CA   3  
ATOM 7922  C C    . LEU A 1 132 ? -8.774  -10.043 -5.998  1.00 0.00 ? 132 LEU A C    3  
ATOM 7923  O O    . LEU A 1 132 ? -9.938  -9.735  -6.242  1.00 0.00 ? 132 LEU A O    3  
ATOM 7924  C CB   . LEU A 1 132 ? -6.988  -8.426  -6.753  1.00 0.00 ? 132 LEU A CB   3  
ATOM 7925  C CG   . LEU A 1 132 ? -6.275  -7.087  -6.477  1.00 0.00 ? 132 LEU A CG   3  
ATOM 7926  C CD1  . LEU A 1 132 ? -5.133  -6.859  -7.469  1.00 0.00 ? 132 LEU A CD1  3  
ATOM 7927  C CD2  . LEU A 1 132 ? -7.250  -5.906  -6.565  1.00 0.00 ? 132 LEU A CD2  3  
ATOM 7928  H H    . LEU A 1 132 ? -5.874  -9.590  -4.766  1.00 0.00 ? 132 LEU A H    3  
ATOM 7929  H HA   . LEU A 1 132 ? -8.342  -8.164  -5.089  1.00 0.00 ? 132 LEU A HA   3  
ATOM 7930  H HB2  . LEU A 1 132 ? -6.256  -9.176  -7.046  1.00 0.00 ? 132 LEU A HB2  3  
ATOM 7931  H HB3  . LEU A 1 132 ? -7.670  -8.292  -7.594  1.00 0.00 ? 132 LEU A HB3  3  
ATOM 7932  H HG   . LEU A 1 132 ? -5.843  -7.105  -5.478  1.00 0.00 ? 132 LEU A HG   3  
ATOM 7933  H HD11 . LEU A 1 132 ? -5.505  -6.851  -8.490  1.00 0.00 ? 132 LEU A HD11 3  
ATOM 7934  H HD12 . LEU A 1 132 ? -4.644  -5.908  -7.261  1.00 0.00 ? 132 LEU A HD12 3  
ATOM 7935  H HD13 . LEU A 1 132 ? -4.393  -7.652  -7.366  1.00 0.00 ? 132 LEU A HD13 3  
ATOM 7936  H HD21 . LEU A 1 132 ? -8.044  -6.029  -5.835  1.00 0.00 ? 132 LEU A HD21 3  
ATOM 7937  H HD22 . LEU A 1 132 ? -6.725  -4.973  -6.357  1.00 0.00 ? 132 LEU A HD22 3  
ATOM 7938  H HD23 . LEU A 1 132 ? -7.698  -5.852  -7.557  1.00 0.00 ? 132 LEU A HD23 3  
ATOM 7939  N N    . SER A 1 133 ? -8.326  -11.298 -6.085  1.00 0.00 ? 133 SER A N    3  
ATOM 7940  C CA   . SER A 1 133 ? -9.106  -12.466 -6.476  1.00 0.00 ? 133 SER A CA   3  
ATOM 7941  C C    . SER A 1 133 ? -10.094 -12.853 -5.365  1.00 0.00 ? 133 SER A C    3  
ATOM 7942  O O    . SER A 1 133 ? -11.115 -13.493 -5.640  1.00 0.00 ? 133 SER A O    3  
ATOM 7943  C CB   . SER A 1 133 ? -8.096  -13.585 -6.808  1.00 0.00 ? 133 SER A CB   3  
ATOM 7944  O OG   . SER A 1 133 ? -8.618  -14.684 -7.535  1.00 0.00 ? 133 SER A OG   3  
ATOM 7945  H H    . SER A 1 133 ? -7.343  -11.446 -5.891  1.00 0.00 ? 133 SER A H    3  
ATOM 7946  H HA   . SER A 1 133 ? -9.676  -12.221 -7.373  1.00 0.00 ? 133 SER A HA   3  
ATOM 7947  H HB2  . SER A 1 133 ? -7.303  -13.158 -7.422  1.00 0.00 ? 133 SER A HB2  3  
ATOM 7948  H HB3  . SER A 1 133 ? -7.652  -13.950 -5.882  1.00 0.00 ? 133 SER A HB3  3  
ATOM 7949  H HG   . SER A 1 133 ? -7.950  -14.925 -8.197  1.00 0.00 ? 133 SER A HG   3  
ATOM 7950  N N    . THR A 1 134 ? -9.834  -12.445 -4.119  1.00 0.00 ? 134 THR A N    3  
ATOM 7951  C CA   . THR A 1 134 ? -10.753 -12.632 -3.014  1.00 0.00 ? 134 THR A CA   3  
ATOM 7952  C C    . THR A 1 134 ? -11.874 -11.587 -3.164  1.00 0.00 ? 134 THR A C    3  
ATOM 7953  O O    . THR A 1 134 ? -11.591 -10.411 -3.378  1.00 0.00 ? 134 THR A O    3  
ATOM 7954  C CB   . THR A 1 134 ? -9.975  -12.481 -1.696  1.00 0.00 ? 134 THR A CB   3  
ATOM 7955  O OG1  . THR A 1 134 ? -8.960  -13.479 -1.666  1.00 0.00 ? 134 THR A OG1  3  
ATOM 7956  C CG2  . THR A 1 134 ? -10.867 -12.581 -0.445  1.00 0.00 ? 134 THR A CG2  3  
ATOM 7957  H H    . THR A 1 134 ? -9.106  -11.764 -3.962  1.00 0.00 ? 134 THR A H    3  
ATOM 7958  H HA   . THR A 1 134 ? -11.142 -13.646 -3.067  1.00 0.00 ? 134 THR A HA   3  
ATOM 7959  H HB   . THR A 1 134 ? -9.497  -11.507 -1.678  1.00 0.00 ? 134 THR A HB   3  
ATOM 7960  H HG1  . THR A 1 134 ? -8.329  -13.281 -2.379  1.00 0.00 ? 134 THR A HG1  3  
ATOM 7961  H HG21 . THR A 1 134 ? -11.261 -13.590 -0.333  1.00 0.00 ? 134 THR A HG21 3  
ATOM 7962  H HG22 . THR A 1 134 ? -10.295 -12.312 0.447   1.00 0.00 ? 134 THR A HG22 3  
ATOM 7963  H HG23 . THR A 1 134 ? -11.705 -11.885 -0.513  1.00 0.00 ? 134 THR A HG23 3  
ATOM 7964  N N    . PRO A 1 135 ? -13.147 -11.985 -3.013  1.00 0.00 ? 135 PRO A N    3  
ATOM 7965  C CA   . PRO A 1 135 ? -14.284 -11.082 -3.151  1.00 0.00 ? 135 PRO A CA   3  
ATOM 7966  C C    . PRO A 1 135 ? -14.515 -10.241 -1.892  1.00 0.00 ? 135 PRO A C    3  
ATOM 7967  O O    . PRO A 1 135 ? -14.817 -9.051  -1.979  1.00 0.00 ? 135 PRO A O    3  
ATOM 7968  C CB   . PRO A 1 135 ? -15.479 -12.000 -3.405  1.00 0.00 ? 135 PRO A CB   3  
ATOM 7969  C CG   . PRO A 1 135 ? -15.091 -13.337 -2.774  1.00 0.00 ? 135 PRO A CG   3  
ATOM 7970  C CD   . PRO A 1 135 ? -13.576 -13.368 -2.902  1.00 0.00 ? 135 PRO A CD   3  
ATOM 7971  H HA   . PRO A 1 135 ? -14.143 -10.416 -4.005  1.00 0.00 ? 135 PRO A HA   3  
ATOM 7972  H HB2  . PRO A 1 135 ? -16.372 -11.601 -2.931  1.00 0.00 ? 135 PRO A HB2  3  
ATOM 7973  H HB3  . PRO A 1 135 ? -15.622 -12.124 -4.480  1.00 0.00 ? 135 PRO A HB3  3  
ATOM 7974  H HG2  . PRO A 1 135 ? -15.370 -13.342 -1.719  1.00 0.00 ? 135 PRO A HG2  3  
ATOM 7975  H HG3  . PRO A 1 135 ? -15.546 -14.180 -3.289  1.00 0.00 ? 135 PRO A HG3  3  
ATOM 7976  H HD2  . PRO A 1 135 ? -13.145 -13.839 -2.020  1.00 0.00 ? 135 PRO A HD2  3  
ATOM 7977  H HD3  . PRO A 1 135 ? -13.276 -13.905 -3.804  1.00 0.00 ? 135 PRO A HD3  3  
ATOM 7978  N N    . GLY A 1 136 ? -14.412 -10.873 -0.717  1.00 0.00 ? 136 GLY A N    3  
ATOM 7979  C CA   . GLY A 1 136 ? -14.830 -10.275 0.538   1.00 0.00 ? 136 GLY A CA   3  
ATOM 7980  C C    . GLY A 1 136 ? -13.702 -9.587  1.282   1.00 0.00 ? 136 GLY A C    3  
ATOM 7981  O O    . GLY A 1 136 ? -13.982 -8.993  2.306   1.00 0.00 ? 136 GLY A O    3  
ATOM 7982  H H    . GLY A 1 136 ? -14.166 -11.850 -0.708  1.00 0.00 ? 136 GLY A H    3  
ATOM 7983  H HA2  . GLY A 1 136 ? -15.612 -9.544  0.339   1.00 0.00 ? 136 GLY A HA2  3  
ATOM 7984  H HA3  . GLY A 1 136 ? -15.260 -11.016 1.205   1.00 0.00 ? 136 GLY A HA3  3  
ATOM 7985  N N    . THR A 1 137 ? -12.459 -9.611  0.813   1.00 0.00 ? 137 THR A N    3  
ATOM 7986  C CA   . THR A 1 137 ? -11.534 -8.551  1.189   1.00 0.00 ? 137 THR A CA   3  
ATOM 7987  C C    . THR A 1 137 ? -11.860 -7.353  0.274   1.00 0.00 ? 137 THR A C    3  
ATOM 7988  O O    . THR A 1 137 ? -12.430 -7.539  -0.805  1.00 0.00 ? 137 THR A O    3  
ATOM 7989  C CB   . THR A 1 137 ? -10.100 -9.064  0.986   1.00 0.00 ? 137 THR A CB   3  
ATOM 7990  O OG1  . THR A 1 137 ? -9.788  -10.062 1.936   1.00 0.00 ? 137 THR A OG1  3  
ATOM 7991  C CG2  . THR A 1 137 ? -9.044  -7.973  1.144   1.00 0.00 ? 137 THR A CG2  3  
ATOM 7992  H H    . THR A 1 137 ? -12.327 -9.986  -0.112  1.00 0.00 ? 137 THR A H    3  
ATOM 7993  H HA   . THR A 1 137 ? -11.693 -8.287  2.251   1.00 0.00 ? 137 THR A HA   3  
ATOM 7994  H HB   . THR A 1 137 ? -10.003 -9.497  -0.011  1.00 0.00 ? 137 THR A HB   3  
ATOM 7995  H HG1  . THR A 1 137 ? -10.484 -10.739 1.960   1.00 0.00 ? 137 THR A HG1  3  
ATOM 7996  H HG21 . THR A 1 137 ? -9.264  -7.350  2.004   1.00 0.00 ? 137 THR A HG21 3  
ATOM 7997  H HG22 . THR A 1 137 ? -8.079  -8.427  1.329   1.00 0.00 ? 137 THR A HG22 3  
ATOM 7998  H HG23 . THR A 1 137 ? -8.987  -7.355  0.245   1.00 0.00 ? 137 THR A HG23 3  
ATOM 7999  N N    . ILE A 1 138 ? -11.454 -6.134  0.631   1.00 0.00 ? 138 ILE A N    3  
ATOM 8000  C CA   . ILE A 1 138 ? -11.523 -4.967  -0.240  1.00 0.00 ? 138 ILE A CA   3  
ATOM 8001  C C    . ILE A 1 138 ? -10.077 -4.496  -0.289  1.00 0.00 ? 138 ILE A C    3  
ATOM 8002  O O    . ILE A 1 138 ? -9.379  -4.560  0.719   1.00 0.00 ? 138 ILE A O    3  
ATOM 8003  C CB   . ILE A 1 138 ? -12.554 -3.938  0.294   1.00 0.00 ? 138 ILE A CB   3  
ATOM 8004  C CG1  . ILE A 1 138 ? -13.982 -4.520  0.146   1.00 0.00 ? 138 ILE A CG1  3  
ATOM 8005  C CG2  . ILE A 1 138 ? -12.445 -2.588  -0.446  1.00 0.00 ? 138 ILE A CG2  3  
ATOM 8006  C CD1  . ILE A 1 138 ? -15.077 -3.740  0.884   1.00 0.00 ? 138 ILE A CD1  3  
ATOM 8007  H H    . ILE A 1 138 ? -10.874 -6.013  1.480   1.00 0.00 ? 138 ILE A H    3  
ATOM 8008  H HA   . ILE A 1 138 ? -11.827 -5.260  -1.246  1.00 0.00 ? 138 ILE A HA   3  
ATOM 8009  H HB   . ILE A 1 138 ? -12.359 -3.760  1.349   1.00 0.00 ? 138 ILE A HB   3  
ATOM 8010  H HG12 . ILE A 1 138 ? -14.237 -4.571  -0.912  1.00 0.00 ? 138 ILE A HG12 3  
ATOM 8011  H HG13 . ILE A 1 138 ? -14.009 -5.535  0.543   1.00 0.00 ? 138 ILE A HG13 3  
ATOM 8012  H HG21 . ILE A 1 138 ? -12.630 -2.722  -1.512  1.00 0.00 ? 138 ILE A HG21 3  
ATOM 8013  H HG22 . ILE A 1 138 ? -13.167 -1.873  -0.053  1.00 0.00 ? 138 ILE A HG22 3  
ATOM 8014  H HG23 . ILE A 1 138 ? -11.456 -2.152  -0.299  1.00 0.00 ? 138 ILE A HG23 3  
ATOM 8015  H HD11 . ILE A 1 138 ? -16.048 -4.159  0.629   1.00 0.00 ? 138 ILE A HD11 3  
ATOM 8016  H HD12 . ILE A 1 138 ? -14.933 -3.824  1.960   1.00 0.00 ? 138 ILE A HD12 3  
ATOM 8017  H HD13 . ILE A 1 138 ? -15.077 -2.693  0.595   1.00 0.00 ? 138 ILE A HD13 3  
ATOM 8018  N N    . ILE A 1 139 ? -9.596  -4.101  -1.465  1.00 0.00 ? 139 ILE A N    3  
ATOM 8019  C CA   . ILE A 1 139 ? -8.282  -3.484  -1.574  1.00 0.00 ? 139 ILE A CA   3  
ATOM 8020  C C    . ILE A 1 139 ? -8.525  -1.986  -1.477  1.00 0.00 ? 139 ILE A C    3  
ATOM 8021  O O    . ILE A 1 139 ? -9.474  -1.477  -2.084  1.00 0.00 ? 139 ILE A O    3  
ATOM 8022  C CB   . ILE A 1 139 ? -7.574  -3.918  -2.872  1.00 0.00 ? 139 ILE A CB   3  
ATOM 8023  C CG1  . ILE A 1 139 ? -7.151  -5.405  -2.836  1.00 0.00 ? 139 ILE A CG1  3  
ATOM 8024  C CG2  . ILE A 1 139 ? -6.350  -3.042  -3.173  1.00 0.00 ? 139 ILE A CG2  3  
ATOM 8025  C CD1  . ILE A 1 139 ? -6.065  -5.751  -1.807  1.00 0.00 ? 139 ILE A CD1  3  
ATOM 8026  H H    . ILE A 1 139 ? -10.261 -3.891  -2.191  1.00 0.00 ? 139 ILE A H    3  
ATOM 8027  H HA   . ILE A 1 139 ? -7.659  -3.776  -0.727  1.00 0.00 ? 139 ILE A HA   3  
ATOM 8028  H HB   . ILE A 1 139 ? -8.270  -3.792  -3.701  1.00 0.00 ? 139 ILE A HB   3  
ATOM 8029  H HG12 . ILE A 1 139 ? -8.024  -6.033  -2.651  1.00 0.00 ? 139 ILE A HG12 3  
ATOM 8030  H HG13 . ILE A 1 139 ? -6.761  -5.671  -3.816  1.00 0.00 ? 139 ILE A HG13 3  
ATOM 8031  H HG21 . ILE A 1 139 ? -5.771  -3.480  -3.985  1.00 0.00 ? 139 ILE A HG21 3  
ATOM 8032  H HG22 . ILE A 1 139 ? -6.672  -2.042  -3.467  1.00 0.00 ? 139 ILE A HG22 3  
ATOM 8033  H HG23 . ILE A 1 139 ? -5.716  -2.954  -2.290  1.00 0.00 ? 139 ILE A HG23 3  
ATOM 8034  H HD11 . ILE A 1 139 ? -5.694  -6.752  -2.010  1.00 0.00 ? 139 ILE A HD11 3  
ATOM 8035  H HD12 . ILE A 1 139 ? -5.218  -5.077  -1.893  1.00 0.00 ? 139 ILE A HD12 3  
ATOM 8036  H HD13 . ILE A 1 139 ? -6.469  -5.708  -0.796  1.00 0.00 ? 139 ILE A HD13 3  
ATOM 8037  N N    . LEU A 1 140 ? -7.668  -1.321  -0.711  1.00 0.00 ? 140 LEU A N    3  
ATOM 8038  C CA   . LEU A 1 140 ? -7.709  0.087   -0.394  1.00 0.00 ? 140 LEU A CA   3  
ATOM 8039  C C    . LEU A 1 140 ? -6.253  0.550   -0.437  1.00 0.00 ? 140 LEU A C    3  
ATOM 8040  O O    . LEU A 1 140 ? -5.451  0.050   0.349   1.00 0.00 ? 140 LEU A O    3  
ATOM 8041  C CB   . LEU A 1 140 ? -8.330  0.231   1.008   1.00 0.00 ? 140 LEU A CB   3  
ATOM 8042  C CG   . LEU A 1 140 ? -8.942  1.608   1.264   1.00 0.00 ? 140 LEU A CG   3  
ATOM 8043  C CD1  . LEU A 1 140 ? -10.251 1.720   0.482   1.00 0.00 ? 140 LEU A CD1  3  
ATOM 8044  C CD2  . LEU A 1 140 ? -9.216  1.822   2.755   1.00 0.00 ? 140 LEU A CD2  3  
ATOM 8045  H H    . LEU A 1 140 ? -6.935  -1.819  -0.220  1.00 0.00 ? 140 LEU A H    3  
ATOM 8046  H HA   . LEU A 1 140 ? -8.309  0.614   -1.130  1.00 0.00 ? 140 LEU A HA   3  
ATOM 8047  H HB2  . LEU A 1 140 ? -9.101  -0.528  1.155   1.00 0.00 ? 140 LEU A HB2  3  
ATOM 8048  H HB3  . LEU A 1 140 ? -7.565  0.037   1.751   1.00 0.00 ? 140 LEU A HB3  3  
ATOM 8049  H HG   . LEU A 1 140 ? -8.260  2.386   0.923   1.00 0.00 ? 140 LEU A HG   3  
ATOM 8050  H HD11 . LEU A 1 140 ? -10.849 2.528   0.880   1.00 0.00 ? 140 LEU A HD11 3  
ATOM 8051  H HD12 . LEU A 1 140 ? -10.017 1.922   -0.561  1.00 0.00 ? 140 LEU A HD12 3  
ATOM 8052  H HD13 . LEU A 1 140 ? -10.827 0.797   0.556   1.00 0.00 ? 140 LEU A HD13 3  
ATOM 8053  H HD21 . LEU A 1 140 ? -9.654  2.807   2.910   1.00 0.00 ? 140 LEU A HD21 3  
ATOM 8054  H HD22 . LEU A 1 140 ? -9.890  1.055   3.133   1.00 0.00 ? 140 LEU A HD22 3  
ATOM 8055  H HD23 . LEU A 1 140 ? -8.279  1.773   3.311   1.00 0.00 ? 140 LEU A HD23 3  
ATOM 8056  N N    . GLY A 1 141 ? -5.852  1.407   -1.376  1.00 0.00 ? 141 GLY A N    3  
ATOM 8057  C CA   . GLY A 1 141 ? -4.427  1.706   -1.510  1.00 0.00 ? 141 GLY A CA   3  
ATOM 8058  C C    . GLY A 1 141 ? -4.115  2.952   -2.317  1.00 0.00 ? 141 GLY A C    3  
ATOM 8059  O O    . GLY A 1 141 ? -5.029  3.668   -2.720  1.00 0.00 ? 141 GLY A O    3  
ATOM 8060  H H    . GLY A 1 141 ? -6.497  1.715   -2.095  1.00 0.00 ? 141 GLY A H    3  
ATOM 8061  H HA2  . GLY A 1 141 ? -4.007  1.838   -0.512  1.00 0.00 ? 141 GLY A HA2  3  
ATOM 8062  H HA3  . GLY A 1 141 ? -3.945  0.852   -1.985  1.00 0.00 ? 141 GLY A HA3  3  
ATOM 8063  N N    . THR A 1 142 ? -2.835  3.211   -2.581  1.00 0.00 ? 142 THR A N    3  
ATOM 8064  C CA   . THR A 1 142 ? -2.386  4.368   -3.358  1.00 0.00 ? 142 THR A CA   3  
ATOM 8065  C C    . THR A 1 142 ? -1.288  3.913   -4.327  1.00 0.00 ? 142 THR A C    3  
ATOM 8066  O O    . THR A 1 142 ? -0.353  3.231   -3.901  1.00 0.00 ? 142 THR A O    3  
ATOM 8067  C CB   . THR A 1 142 ? -1.858  5.438   -2.392  1.00 0.00 ? 142 THR A CB   3  
ATOM 8068  O OG1  . THR A 1 142 ? -2.784  5.768   -1.379  1.00 0.00 ? 142 THR A OG1  3  
ATOM 8069  C CG2  . THR A 1 142 ? -1.440  6.727   -3.097  1.00 0.00 ? 142 THR A CG2  3  
ATOM 8070  H H    . THR A 1 142 ? -2.123  2.595   -2.198  1.00 0.00 ? 142 THR A H    3  
ATOM 8071  H HA   . THR A 1 142 ? -3.221  4.794   -3.915  1.00 0.00 ? 142 THR A HA   3  
ATOM 8072  H HB   . THR A 1 142 ? -0.987  5.025   -1.905  1.00 0.00 ? 142 THR A HB   3  
ATOM 8073  H HG1  . THR A 1 142 ? -2.290  5.731   -0.550  1.00 0.00 ? 142 THR A HG1  3  
ATOM 8074  H HG21 . THR A 1 142 ? -0.582  6.525   -3.731  1.00 0.00 ? 142 THR A HG21 3  
ATOM 8075  H HG22 . THR A 1 142 ? -2.237  7.122   -3.719  1.00 0.00 ? 142 THR A HG22 3  
ATOM 8076  H HG23 . THR A 1 142 ? -1.164  7.462   -2.346  1.00 0.00 ? 142 THR A HG23 3  
ATOM 8077  N N    . ILE A 1 143 ? -1.365  4.315   -5.600  1.00 0.00 ? 143 ILE A N    3  
ATOM 8078  C CA   . ILE A 1 143 ? -0.416  3.979   -6.664  1.00 0.00 ? 143 ILE A CA   3  
ATOM 8079  C C    . ILE A 1 143 ? 0.018   5.263   -7.397  1.00 0.00 ? 143 ILE A C    3  
ATOM 8080  O O    . ILE A 1 143 ? -0.787  6.190   -7.512  1.00 0.00 ? 143 ILE A O    3  
ATOM 8081  C CB   . ILE A 1 143 ? -1.047  2.947   -7.637  1.00 0.00 ? 143 ILE A CB   3  
ATOM 8082  C CG1  . ILE A 1 143 ? -2.486  3.313   -8.081  1.00 0.00 ? 143 ILE A CG1  3  
ATOM 8083  C CG2  . ILE A 1 143 ? -1.035  1.558   -6.985  1.00 0.00 ? 143 ILE A CG2  3  
ATOM 8084  C CD1  . ILE A 1 143 ? -3.017  2.487   -9.261  1.00 0.00 ? 143 ILE A CD1  3  
ATOM 8085  H H    . ILE A 1 143 ? -2.118  4.936   -5.877  1.00 0.00 ? 143 ILE A H    3  
ATOM 8086  H HA   . ILE A 1 143 ? 0.469   3.535   -6.205  1.00 0.00 ? 143 ILE A HA   3  
ATOM 8087  H HB   . ILE A 1 143 ? -0.414  2.900   -8.524  1.00 0.00 ? 143 ILE A HB   3  
ATOM 8088  H HG12 . ILE A 1 143 ? -3.169  3.189   -7.241  1.00 0.00 ? 143 ILE A HG12 3  
ATOM 8089  H HG13 . ILE A 1 143 ? -2.516  4.361   -8.372  1.00 0.00 ? 143 ILE A HG13 3  
ATOM 8090  H HG21 . ILE A 1 143 ? -0.025  1.330   -6.660  1.00 0.00 ? 143 ILE A HG21 3  
ATOM 8091  H HG22 . ILE A 1 143 ? -1.691  1.540   -6.115  1.00 0.00 ? 143 ILE A HG22 3  
ATOM 8092  H HG23 . ILE A 1 143 ? -1.351  0.790   -7.691  1.00 0.00 ? 143 ILE A HG23 3  
ATOM 8093  H HD11 . ILE A 1 143 ? -3.990  2.875   -9.566  1.00 0.00 ? 143 ILE A HD11 3  
ATOM 8094  H HD12 . ILE A 1 143 ? -2.333  2.554   -10.107 1.00 0.00 ? 143 ILE A HD12 3  
ATOM 8095  H HD13 . ILE A 1 143 ? -3.138  1.444   -8.972  1.00 0.00 ? 143 ILE A HD13 3  
ATOM 8096  N N    . PRO A 1 144 ? 1.258   5.369   -7.912  1.00 0.00 ? 144 PRO A N    3  
ATOM 8097  C CA   . PRO A 1 144 ? 1.717   6.550   -8.635  1.00 0.00 ? 144 PRO A CA   3  
ATOM 8098  C C    . PRO A 1 144 ? 1.036   6.661   -10.001 1.00 0.00 ? 144 PRO A C    3  
ATOM 8099  O O    . PRO A 1 144 ? 0.721   5.651   -10.638 1.00 0.00 ? 144 PRO A O    3  
ATOM 8100  C CB   . PRO A 1 144 ? 3.234   6.382   -8.776  1.00 0.00 ? 144 PRO A CB   3  
ATOM 8101  C CG   . PRO A 1 144 ? 3.430   4.865   -8.739  1.00 0.00 ? 144 PRO A CG   3  
ATOM 8102  C CD   . PRO A 1 144 ? 2.339   4.412   -7.772  1.00 0.00 ? 144 PRO A CD   3  
ATOM 8103  H HA   . PRO A 1 144 ? 1.501   7.442   -8.046  1.00 0.00 ? 144 PRO A HA   3  
ATOM 8104  H HB2  . PRO A 1 144 ? 3.612   6.807   -9.705  1.00 0.00 ? 144 PRO A HB2  3  
ATOM 8105  H HB3  . PRO A 1 144 ? 3.725   6.850   -7.922  1.00 0.00 ? 144 PRO A HB3  3  
ATOM 8106  H HG2  . PRO A 1 144 ? 3.242   4.443   -9.727  1.00 0.00 ? 144 PRO A HG2  3  
ATOM 8107  H HG3  . PRO A 1 144 ? 4.426   4.588   -8.390  1.00 0.00 ? 144 PRO A HG3  3  
ATOM 8108  H HD2  . PRO A 1 144 ? 1.999   3.404   -8.006  1.00 0.00 ? 144 PRO A HD2  3  
ATOM 8109  H HD3  . PRO A 1 144 ? 2.723   4.472   -6.755  1.00 0.00 ? 144 PRO A HD3  3  
ATOM 8110  N N    . VAL A 1 145 ? 0.834   7.890   -10.478 1.00 0.00 ? 145 VAL A N    3  
ATOM 8111  C CA   . VAL A 1 145 ? 0.162   8.154   -11.735 1.00 0.00 ? 145 VAL A CA   3  
ATOM 8112  C C    . VAL A 1 145 ? 1.063   7.739   -12.914 1.00 0.00 ? 145 VAL A C    3  
ATOM 8113  O O    . VAL A 1 145 ? 2.259   8.070   -12.937 1.00 0.00 ? 145 VAL A O    3  
ATOM 8114  C CB   . VAL A 1 145 ? -0.299  9.629   -11.727 1.00 0.00 ? 145 VAL A CB   3  
ATOM 8115  C CG1  . VAL A 1 145 ? 0.713   10.651  -12.250 1.00 0.00 ? 145 VAL A CG1  3  
ATOM 8116  C CG2  . VAL A 1 145 ? -1.609  9.807   -12.477 1.00 0.00 ? 145 VAL A CG2  3  
ATOM 8117  H H    . VAL A 1 145 ? 1.062   8.710   -9.941  1.00 0.00 ? 145 VAL A H    3  
ATOM 8118  H HA   . VAL A 1 145 ? -0.726  7.520   -11.745 1.00 0.00 ? 145 VAL A HA   3  
ATOM 8119  H HB   . VAL A 1 145 ? -0.514  9.900   -10.695 1.00 0.00 ? 145 VAL A HB   3  
ATOM 8120  H HG11 . VAL A 1 145 ? 1.674   10.504  -11.764 1.00 0.00 ? 145 VAL A HG11 3  
ATOM 8121  H HG12 . VAL A 1 145 ? 0.827   10.529  -13.327 1.00 0.00 ? 145 VAL A HG12 3  
ATOM 8122  H HG13 . VAL A 1 145 ? 0.351   11.660  -12.044 1.00 0.00 ? 145 VAL A HG13 3  
ATOM 8123  H HG21 . VAL A 1 145 ? -1.995  10.804  -12.274 1.00 0.00 ? 145 VAL A HG21 3  
ATOM 8124  H HG22 . VAL A 1 145 ? -1.462  9.667   -13.546 1.00 0.00 ? 145 VAL A HG22 3  
ATOM 8125  H HG23 . VAL A 1 145 ? -2.331  9.086   -12.111 1.00 0.00 ? 145 VAL A HG23 3  
ATOM 8126  N N    . PRO A 1 146 ? 0.532   6.986   -13.888 1.00 0.00 ? 146 PRO A N    3  
ATOM 8127  C CA   . PRO A 1 146 ? 1.235   6.651   -15.111 1.00 0.00 ? 146 PRO A CA   3  
ATOM 8128  C C    . PRO A 1 146 ? 1.305   7.905   -15.989 1.00 0.00 ? 146 PRO A C    3  
ATOM 8129  O O    . PRO A 1 146 ? 0.290   8.379   -16.504 1.00 0.00 ? 146 PRO A O    3  
ATOM 8130  C CB   . PRO A 1 146 ? 0.448   5.496   -15.735 1.00 0.00 ? 146 PRO A CB   3  
ATOM 8131  C CG   . PRO A 1 146 ? -0.970  5.655   -15.189 1.00 0.00 ? 146 PRO A CG   3  
ATOM 8132  C CD   . PRO A 1 146 ? -0.805  6.417   -13.888 1.00 0.00 ? 146 PRO A CD   3  
ATOM 8133  H HA   . PRO A 1 146 ? 2.244   6.301   -14.886 1.00 0.00 ? 146 PRO A HA   3  
ATOM 8134  H HB2  . PRO A 1 146 ? 0.455   5.530   -16.822 1.00 0.00 ? 146 PRO A HB2  3  
ATOM 8135  H HB3  . PRO A 1 146 ? 0.871   4.556   -15.383 1.00 0.00 ? 146 PRO A HB3  3  
ATOM 8136  H HG2  . PRO A 1 146 ? -1.572  6.231   -15.889 1.00 0.00 ? 146 PRO A HG2  3  
ATOM 8137  H HG3  . PRO A 1 146 ? -1.433  4.697   -14.969 1.00 0.00 ? 146 PRO A HG3  3  
ATOM 8138  H HD2  . PRO A 1 146 ? -1.569  7.192   -13.814 1.00 0.00 ? 146 PRO A HD2  3  
ATOM 8139  H HD3  . PRO A 1 146 ? -0.892  5.718   -13.058 1.00 0.00 ? 146 PRO A HD3  3  
ATOM 8140  N N    . LYS A 1 147 ? 2.507   8.477   -16.112 1.00 0.00 ? 147 LYS A N    3  
ATOM 8141  C CA   . LYS A 1 147 ? 2.787   9.547   -17.074 1.00 0.00 ? 147 LYS A CA   3  
ATOM 8142  C C    . LYS A 1 147 ? 2.635   8.948   -18.466 1.00 0.00 ? 147 LYS A C    3  
ATOM 8143  O O    . LYS A 1 147 ? 1.762   9.348   -19.235 1.00 0.00 ? 147 LYS A O    3  
ATOM 8144  C CB   . LYS A 1 147 ? 4.191   10.131  -16.807 1.00 0.00 ? 147 LYS A CB   3  
ATOM 8145  C CG   . LYS A 1 147 ? 4.642   11.280  -17.732 1.00 0.00 ? 147 LYS A CG   3  
ATOM 8146  C CD   . LYS A 1 147 ? 5.257   10.873  -19.089 1.00 0.00 ? 147 LYS A CD   3  
ATOM 8147  C CE   . LYS A 1 147 ? 4.339   10.995  -20.322 1.00 0.00 ? 147 LYS A CE   3  
ATOM 8148  N NZ   . LYS A 1 147 ? 4.261   12.368  -20.862 1.00 0.00 ? 147 LYS A NZ   3  
ATOM 8149  H H    . LYS A 1 147 ? 3.268   8.037   -15.614 1.00 0.00 ? 147 LYS A H    3  
ATOM 8150  H HA   . LYS A 1 147 ? 2.039   10.336  -16.956 1.00 0.00 ? 147 LYS A HA   3  
ATOM 8151  H HB2  . LYS A 1 147 ? 4.185   10.526  -15.792 1.00 0.00 ? 147 LYS A HB2  3  
ATOM 8152  H HB3  . LYS A 1 147 ? 4.939   9.338   -16.828 1.00 0.00 ? 147 LYS A HB3  3  
ATOM 8153  H HG2  . LYS A 1 147 ? 3.825   11.983  -17.873 1.00 0.00 ? 147 LYS A HG2  3  
ATOM 8154  H HG3  . LYS A 1 147 ? 5.424   11.808  -17.186 1.00 0.00 ? 147 LYS A HG3  3  
ATOM 8155  H HD2  . LYS A 1 147 ? 6.138   11.494  -19.254 1.00 0.00 ? 147 LYS A HD2  3  
ATOM 8156  H HD3  . LYS A 1 147 ? 5.619   9.846   -19.026 1.00 0.00 ? 147 LYS A HD3  3  
ATOM 8157  H HE2  . LYS A 1 147 ? 4.723   10.338  -21.102 1.00 0.00 ? 147 LYS A HE2  3  
ATOM 8158  H HE3  . LYS A 1 147 ? 3.332   10.662  -20.079 1.00 0.00 ? 147 LYS A HE3  3  
ATOM 8159  H HZ1  . LYS A 1 147 ? 3.822   12.372  -21.774 1.00 0.00 ? 147 LYS A HZ1  3  
ATOM 8160  H HZ2  . LYS A 1 147 ? 3.688   12.941  -20.244 1.00 0.00 ? 147 LYS A HZ2  3  
ATOM 8161  H HZ3  . LYS A 1 147 ? 5.177   12.789  -20.966 1.00 0.00 ? 147 LYS A HZ3  3  
ATOM 8162  N N    . GLY A 1 148 ? 3.520   7.998   -18.762 1.00 0.00 ? 148 GLY A N    3  
ATOM 8163  C CA   . GLY A 1 148 ? 3.448   7.073   -19.871 1.00 0.00 ? 148 GLY A CA   3  
ATOM 8164  C C    . GLY A 1 148 ? 3.226   5.722   -19.234 1.00 0.00 ? 148 GLY A C    3  
ATOM 8165  O O    . GLY A 1 148 ? 2.154   5.498   -18.676 1.00 0.00 ? 148 GLY A O    3  
ATOM 8166  H H    . GLY A 1 148 ? 4.152   7.725   -18.027 1.00 0.00 ? 148 GLY A H    3  
ATOM 8167  H HA2  . GLY A 1 148 ? 2.601   7.277   -20.525 1.00 0.00 ? 148 GLY A HA2  3  
ATOM 8168  H HA3  . GLY A 1 148 ? 4.374   7.095   -20.442 1.00 0.00 ? 148 GLY A HA3  3  
ATOM 8169  N N    . LYS A 1 149 ? 4.217   4.831   -19.260 1.00 0.00 ? 149 LYS A N    3  
ATOM 8170  C CA   . LYS A 1 149 ? 4.006   3.493   -18.710 1.00 0.00 ? 149 LYS A CA   3  
ATOM 8171  C C    . LYS A 1 149 ? 3.822   3.521   -17.182 1.00 0.00 ? 149 LYS A C    3  
ATOM 8172  O O    . LYS A 1 149 ? 4.403   4.390   -16.528 1.00 0.00 ? 149 LYS A O    3  
ATOM 8173  C CB   . LYS A 1 149 ? 5.139   2.537   -19.118 1.00 0.00 ? 149 LYS A CB   3  
ATOM 8174  C CG   . LYS A 1 149 ? 4.713   1.359   -20.025 1.00 0.00 ? 149 LYS A CG   3  
ATOM 8175  C CD   . LYS A 1 149 ? 3.835   1.721   -21.238 1.00 0.00 ? 149 LYS A CD   3  
ATOM 8176  C CE   . LYS A 1 149 ? 4.418   2.874   -22.041 1.00 0.00 ? 149 LYS A CE   3  
ATOM 8177  N NZ   . LYS A 1 149 ? 5.796   2.607   -22.519 1.00 0.00 ? 149 LYS A NZ   3  
ATOM 8178  H H    . LYS A 1 149 ? 5.096   5.064   -19.709 1.00 0.00 ? 149 LYS A H    3  
ATOM 8179  H HA   . LYS A 1 149 ? 3.079   3.157   -19.159 1.00 0.00 ? 149 LYS A HA   3  
ATOM 8180  H HB2  . LYS A 1 149 ? 5.903   3.116   -19.624 1.00 0.00 ? 149 LYS A HB2  3  
ATOM 8181  H HB3  . LYS A 1 149 ? 5.609   2.124   -18.223 1.00 0.00 ? 149 LYS A HB3  3  
ATOM 8182  H HG2  . LYS A 1 149 ? 5.616   0.877   -20.395 1.00 0.00 ? 149 LYS A HG2  3  
ATOM 8183  H HG3  . LYS A 1 149 ? 4.195   0.608   -19.434 1.00 0.00 ? 149 LYS A HG3  3  
ATOM 8184  H HD2  . LYS A 1 149 ? 3.720   0.849   -21.882 1.00 0.00 ? 149 LYS A HD2  3  
ATOM 8185  H HD3  . LYS A 1 149 ? 2.839   2.027   -20.909 1.00 0.00 ? 149 LYS A HD3  3  
ATOM 8186  H HE2  . LYS A 1 149 ? 3.765   3.080   -22.890 1.00 0.00 ? 149 LYS A HE2  3  
ATOM 8187  H HE3  . LYS A 1 149 ? 4.393   3.740   -21.379 1.00 0.00 ? 149 LYS A HE3  3  
ATOM 8188  H HZ1  . LYS A 1 149 ? 6.451   2.532   -21.745 1.00 0.00 ? 149 LYS A HZ1  3  
ATOM 8189  H HZ2  . LYS A 1 149 ? 5.833   1.741   -23.047 1.00 0.00 ? 149 LYS A HZ2  3  
ATOM 8190  H HZ3  . LYS A 1 149 ? 6.121   3.354   -23.119 1.00 0.00 ? 149 LYS A HZ3  3  
ATOM 8191  N N    . PRO A 1 150 ? 3.046   2.577   -16.629 1.00 0.00 ? 150 PRO A N    3  
ATOM 8192  C CA   . PRO A 1 150 ? 2.988   2.236   -15.205 1.00 0.00 ? 150 PRO A CA   3  
ATOM 8193  C C    . PRO A 1 150 ? 4.266   1.499   -14.725 1.00 0.00 ? 150 PRO A C    3  
ATOM 8194  O O    . PRO A 1 150 ? 5.310   1.553   -15.379 1.00 0.00 ? 150 PRO A O    3  
ATOM 8195  C CB   . PRO A 1 150 ? 1.688   1.426   -15.053 1.00 0.00 ? 150 PRO A CB   3  
ATOM 8196  C CG   . PRO A 1 150 ? 1.370   0.897   -16.451 1.00 0.00 ? 150 PRO A CG   3  
ATOM 8197  C CD   . PRO A 1 150 ? 2.168   1.738   -17.422 1.00 0.00 ? 150 PRO A CD   3  
ATOM 8198  H HA   . PRO A 1 150 ? 2.899   3.150   -14.621 1.00 0.00 ? 150 PRO A HA   3  
ATOM 8199  H HB2  . PRO A 1 150 ? 1.771   0.607   -14.338 1.00 0.00 ? 150 PRO A HB2  3  
ATOM 8200  H HB3  . PRO A 1 150 ? 0.881   2.087   -14.742 1.00 0.00 ? 150 PRO A HB3  3  
ATOM 8201  H HG2  . PRO A 1 150 ? 1.755   -0.105  -16.559 1.00 0.00 ? 150 PRO A HG2  3  
ATOM 8202  H HG3  . PRO A 1 150 ? 0.302   0.933   -16.666 1.00 0.00 ? 150 PRO A HG3  3  
ATOM 8203  H HD2  . PRO A 1 150 ? 2.757   1.062   -18.034 1.00 0.00 ? 150 PRO A HD2  3  
ATOM 8204  H HD3  . PRO A 1 150 ? 1.540   2.345   -18.081 1.00 0.00 ? 150 PRO A HD3  3  
ATOM 8205  N N    . LEU A 1 151 ? 4.219   0.864   -13.544 1.00 0.00 ? 151 LEU A N    3  
ATOM 8206  C CA   . LEU A 1 151 ? 5.268   0.033   -12.960 1.00 0.00 ? 151 LEU A CA   3  
ATOM 8207  C C    . LEU A 1 151 ? 4.754   -1.396  -12.817 1.00 0.00 ? 151 LEU A C    3  
ATOM 8208  O O    . LEU A 1 151 ? 3.554   -1.629  -12.836 1.00 0.00 ? 151 LEU A O    3  
ATOM 8209  C CB   . LEU A 1 151 ? 5.626   0.522   -11.539 1.00 0.00 ? 151 LEU A CB   3  
ATOM 8210  C CG   . LEU A 1 151 ? 6.669   1.635   -11.382 1.00 0.00 ? 151 LEU A CG   3  
ATOM 8211  C CD1  . LEU A 1 151 ? 7.893   1.477   -12.287 1.00 0.00 ? 151 LEU A CD1  3  
ATOM 8212  C CD2  . LEU A 1 151 ? 5.999   2.981   -11.600 1.00 0.00 ? 151 LEU A CD2  3  
ATOM 8213  H H    . LEU A 1 151 ? 3.346   0.756   -13.056 1.00 0.00 ? 151 LEU A H    3  
ATOM 8214  H HA   . LEU A 1 151 ? 6.147   0.017   -13.605 1.00 0.00 ? 151 LEU A HA   3  
ATOM 8215  H HB2  . LEU A 1 151 ? 4.712   0.807   -11.020 1.00 0.00 ? 151 LEU A HB2  3  
ATOM 8216  H HB3  . LEU A 1 151 ? 6.009   -0.325  -10.985 1.00 0.00 ? 151 LEU A HB3  3  
ATOM 8217  H HG   . LEU A 1 151 ? 7.015   1.615   -10.350 1.00 0.00 ? 151 LEU A HG   3  
ATOM 8218  H HD11 . LEU A 1 151 ? 8.648   2.206   -11.995 1.00 0.00 ? 151 LEU A HD11 3  
ATOM 8219  H HD12 . LEU A 1 151 ? 8.325   0.482   -12.169 1.00 0.00 ? 151 LEU A HD12 3  
ATOM 8220  H HD13 . LEU A 1 151 ? 7.634   1.640   -13.333 1.00 0.00 ? 151 LEU A HD13 3  
ATOM 8221  H HD21 . LEU A 1 151 ? 5.529   2.987   -12.579 1.00 0.00 ? 151 LEU A HD21 3  
ATOM 8222  H HD22 . LEU A 1 151 ? 5.244   3.127   -10.825 1.00 0.00 ? 151 LEU A HD22 3  
ATOM 8223  H HD23 . LEU A 1 151 ? 6.739   3.773   -11.519 1.00 0.00 ? 151 LEU A HD23 3  
ATOM 8224  N N    . ALA A 1 152 ? 5.682   -2.302  -12.528 1.00 0.00 ? 152 ALA A N    3  
ATOM 8225  C CA   . ALA A 1 152 ? 5.506   -3.739  -12.327 1.00 0.00 ? 152 ALA A CA   3  
ATOM 8226  C C    . ALA A 1 152 ? 4.323   -4.083  -11.414 1.00 0.00 ? 152 ALA A C    3  
ATOM 8227  O O    . ALA A 1 152 ? 3.352   -4.665  -11.889 1.00 0.00 ? 152 ALA A O    3  
ATOM 8228  C CB   . ALA A 1 152 ? 6.819   -4.349  -11.819 1.00 0.00 ? 152 ALA A CB   3  
ATOM 8229  H H    . ALA A 1 152 ? 6.607   -1.912  -12.529 1.00 0.00 ? 152 ALA A H    3  
ATOM 8230  H HA   . ALA A 1 152 ? 5.287   -4.181  -13.297 1.00 0.00 ? 152 ALA A HA   3  
ATOM 8231  H HB1  . ALA A 1 152 ? 6.683   -5.420  -11.661 1.00 0.00 ? 152 ALA A HB1  3  
ATOM 8232  H HB2  . ALA A 1 152 ? 7.607   -4.203  -12.561 1.00 0.00 ? 152 ALA A HB2  3  
ATOM 8233  H HB3  . ALA A 1 152 ? 7.121   -3.887  -10.879 1.00 0.00 ? 152 ALA A HB3  3  
ATOM 8234  N N    . LEU A 1 153 ? 4.386   -3.741  -10.116 1.00 0.00 ? 153 LEU A N    3  
ATOM 8235  C CA   . LEU A 1 153 ? 3.278   -3.994  -9.183  1.00 0.00 ? 153 LEU A CA   3  
ATOM 8236  C C    . LEU A 1 153 ? 2.027   -3.263  -9.683  1.00 0.00 ? 153 LEU A C    3  
ATOM 8237  O O    . LEU A 1 153 ? 0.942   -3.834  -9.723  1.00 0.00 ? 153 LEU A O    3  
ATOM 8238  C CB   . LEU A 1 153 ? 3.648   -3.559  -7.754  1.00 0.00 ? 153 LEU A CB   3  
ATOM 8239  C CG   . LEU A 1 153 ? 2.702   -4.056  -6.632  1.00 0.00 ? 153 LEU A CG   3  
ATOM 8240  C CD1  . LEU A 1 153 ? 1.254   -3.635  -6.736  1.00 0.00 ? 153 LEU A CD1  3  
ATOM 8241  C CD2  . LEU A 1 153 ? 2.741   -5.571  -6.441  1.00 0.00 ? 153 LEU A CD2  3  
ATOM 8242  H H    . LEU A 1 153 ? 5.229   -3.299  -9.782  1.00 0.00 ? 153 LEU A H    3  
ATOM 8243  H HA   . LEU A 1 153 ? 3.085   -5.068  -9.144  1.00 0.00 ? 153 LEU A HA   3  
ATOM 8244  H HB2  . LEU A 1 153 ? 4.641   -3.948  -7.536  1.00 0.00 ? 153 LEU A HB2  3  
ATOM 8245  H HB3  . LEU A 1 153 ? 3.704   -2.470  -7.715  1.00 0.00 ? 153 LEU A HB3  3  
ATOM 8246  H HG   . LEU A 1 153 ? 3.020   -3.587  -5.717  1.00 0.00 ? 153 LEU A HG   3  
ATOM 8247  H HD11 . LEU A 1 153 ? 0.690   -4.331  -7.355  1.00 0.00 ? 153 LEU A HD11 3  
ATOM 8248  H HD12 . LEU A 1 153 ? 0.817   -3.642  -5.742  1.00 0.00 ? 153 LEU A HD12 3  
ATOM 8249  H HD13 . LEU A 1 153 ? 1.192   -2.627  -7.137  1.00 0.00 ? 153 LEU A HD13 3  
ATOM 8250  H HD21 . LEU A 1 153 ? 3.770   -5.900  -6.331  1.00 0.00 ? 153 LEU A HD21 3  
ATOM 8251  H HD22 . LEU A 1 153 ? 2.191   -5.839  -5.538  1.00 0.00 ? 153 LEU A HD22 3  
ATOM 8252  H HD23 . LEU A 1 153 ? 2.279   -6.070  -7.290  1.00 0.00 ? 153 LEU A HD23 3  
ATOM 8253  N N    . VAL A 1 154 ? 2.173   -1.992  -10.072 1.00 0.00 ? 154 VAL A N    3  
ATOM 8254  C CA   . VAL A 1 154 ? 1.050   -1.153  -10.475 1.00 0.00 ? 154 VAL A CA   3  
ATOM 8255  C C    . VAL A 1 154 ? 0.277   -1.812  -11.626 1.00 0.00 ? 154 VAL A C    3  
ATOM 8256  O O    . VAL A 1 154 ? -0.943  -1.717  -11.635 1.00 0.00 ? 154 VAL A O    3  
ATOM 8257  C CB   . VAL A 1 154 ? 1.533   0.279   -10.802 1.00 0.00 ? 154 VAL A CB   3  
ATOM 8258  C CG1  . VAL A 1 154 ? 0.394   1.207   -11.248 1.00 0.00 ? 154 VAL A CG1  3  
ATOM 8259  C CG2  . VAL A 1 154 ? 2.214   0.928   -9.586  1.00 0.00 ? 154 VAL A CG2  3  
ATOM 8260  H H    . VAL A 1 154 ? 3.101   -1.606  -10.102 1.00 0.00 ? 154 VAL A H    3  
ATOM 8261  H HA   . VAL A 1 154 ? 0.369   -1.096  -9.624  1.00 0.00 ? 154 VAL A HA   3  
ATOM 8262  H HB   . VAL A 1 154 ? 2.257   0.238   -11.612 1.00 0.00 ? 154 VAL A HB   3  
ATOM 8263  H HG11 . VAL A 1 154 ? -0.033  0.849   -12.185 1.00 0.00 ? 154 VAL A HG11 3  
ATOM 8264  H HG12 . VAL A 1 154 ? -0.386  1.223   -10.489 1.00 0.00 ? 154 VAL A HG12 3  
ATOM 8265  H HG13 . VAL A 1 154 ? 0.770   2.218   -11.408 1.00 0.00 ? 154 VAL A HG13 3  
ATOM 8266  H HG21 . VAL A 1 154 ? 2.577   1.921   -9.851  1.00 0.00 ? 154 VAL A HG21 3  
ATOM 8267  H HG22 . VAL A 1 154 ? 1.503   1.014   -8.764  1.00 0.00 ? 154 VAL A HG22 3  
ATOM 8268  H HG23 . VAL A 1 154 ? 3.060   0.330   -9.256  1.00 0.00 ? 154 VAL A HG23 3  
ATOM 8269  N N    . GLU A 1 155 ? 0.934   -2.512  -12.550 1.00 0.00 ? 155 GLU A N    3  
ATOM 8270  C CA   . GLU A 1 155 ? 0.332   -3.222  -13.672 1.00 0.00 ? 155 GLU A CA   3  
ATOM 8271  C C    . GLU A 1 155 ? -0.537  -4.401  -13.210 1.00 0.00 ? 155 GLU A C    3  
ATOM 8272  O O    . GLU A 1 155 ? -1.534  -4.713  -13.869 1.00 0.00 ? 155 GLU A O    3  
ATOM 8273  C CB   . GLU A 1 155 ? 1.452   -3.677  -14.629 1.00 0.00 ? 155 GLU A CB   3  
ATOM 8274  C CG   . GLU A 1 155 ? 1.809   -2.599  -15.652 1.00 0.00 ? 155 GLU A CG   3  
ATOM 8275  C CD   . GLU A 1 155 ? 0.758   -2.444  -16.763 1.00 0.00 ? 155 GLU A CD   3  
ATOM 8276  O OE1  . GLU A 1 155 ? -0.307  -1.824  -16.529 1.00 0.00 ? 155 GLU A OE1  3  
ATOM 8277  O OE2  . GLU A 1 155 ? 1.016   -2.847  -17.919 1.00 0.00 ? 155 GLU A OE2  3  
ATOM 8278  H H    . GLU A 1 155 ? 1.948   -2.554  -12.501 1.00 0.00 ? 155 GLU A H    3  
ATOM 8279  H HA   . GLU A 1 155 ? -0.326  -2.536  -14.202 1.00 0.00 ? 155 GLU A HA   3  
ATOM 8280  H HB2  . GLU A 1 155 ? 2.366   -3.887  -14.062 1.00 0.00 ? 155 GLU A HB2  3  
ATOM 8281  H HB3  . GLU A 1 155 ? 1.146   -4.575  -15.163 1.00 0.00 ? 155 GLU A HB3  3  
ATOM 8282  H HG2  . GLU A 1 155 ? 1.943   -1.654  -15.121 1.00 0.00 ? 155 GLU A HG2  3  
ATOM 8283  H HG3  . GLU A 1 155 ? 2.767   -2.860  -16.107 1.00 0.00 ? 155 GLU A HG3  3  
ATOM 8284  N N    . GLU A 1 156 ? -0.238  -5.008  -12.055 1.00 0.00 ? 156 GLU A N    3  
ATOM 8285  C CA   . GLU A 1 156 ? -1.077  -6.049  -11.457 1.00 0.00 ? 156 GLU A CA   3  
ATOM 8286  C C    . GLU A 1 156 ? -2.456  -5.477  -11.112 1.00 0.00 ? 156 GLU A C    3  
ATOM 8287  O O    . GLU A 1 156 ? -3.474  -6.159  -11.226 1.00 0.00 ? 156 GLU A O    3  
ATOM 8288  C CB   . GLU A 1 156 ? -0.425  -6.677  -10.200 1.00 0.00 ? 156 GLU A CB   3  
ATOM 8289  C CG   . GLU A 1 156 ? 1.051   -7.100  -10.349 1.00 0.00 ? 156 GLU A CG   3  
ATOM 8290  C CD   . GLU A 1 156 ? 1.327   -8.056  -11.518 1.00 0.00 ? 156 GLU A CD   3  
ATOM 8291  O OE1  . GLU A 1 156 ? 0.413   -8.775  -11.992 1.00 0.00 ? 156 GLU A OE1  3  
ATOM 8292  O OE2  . GLU A 1 156 ? 2.485   -8.109  -11.982 1.00 0.00 ? 156 GLU A OE2  3  
ATOM 8293  H H    . GLU A 1 156 ? 0.546   -4.659  -11.513 1.00 0.00 ? 156 GLU A H    3  
ATOM 8294  H HA   . GLU A 1 156 ? -1.226  -6.830  -12.195 1.00 0.00 ? 156 GLU A HA   3  
ATOM 8295  H HB2  . GLU A 1 156 ? -0.487  -5.972  -9.369  1.00 0.00 ? 156 GLU A HB2  3  
ATOM 8296  H HB3  . GLU A 1 156 ? -1.010  -7.551  -9.914  1.00 0.00 ? 156 GLU A HB3  3  
ATOM 8297  H HG2  . GLU A 1 156 ? 1.647   -6.208  -10.510 1.00 0.00 ? 156 GLU A HG2  3  
ATOM 8298  H HG3  . GLU A 1 156 ? 1.414   -7.538  -9.407  1.00 0.00 ? 156 GLU A HG3  3  
ATOM 8299  N N    . ILE A 1 157 ? -2.488  -4.207  -10.706 1.00 0.00 ? 157 ILE A N    3  
ATOM 8300  C CA   . ILE A 1 157 ? -3.687  -3.479  -10.312 1.00 0.00 ? 157 ILE A CA   3  
ATOM 8301  C C    . ILE A 1 157 ? -4.306  -2.804  -11.543 1.00 0.00 ? 157 ILE A C    3  
ATOM 8302  O O    . ILE A 1 157 ? -5.526  -2.785  -11.711 1.00 0.00 ? 157 ILE A O    3  
ATOM 8303  C CB   . ILE A 1 157 ? -3.291  -2.501  -9.186  1.00 0.00 ? 157 ILE A CB   3  
ATOM 8304  C CG1  . ILE A 1 157 ? -2.912  -3.299  -7.916  1.00 0.00 ? 157 ILE A CG1  3  
ATOM 8305  C CG2  . ILE A 1 157 ? -4.365  -1.445  -8.904  1.00 0.00 ? 157 ILE A CG2  3  
ATOM 8306  C CD1  . ILE A 1 157 ? -1.688  -2.676  -7.241  1.00 0.00 ? 157 ILE A CD1  3  
ATOM 8307  H H    . ILE A 1 157 ? -1.598  -3.721  -10.671 1.00 0.00 ? 157 ILE A H    3  
ATOM 8308  H HA   . ILE A 1 157 ? -4.413  -4.182  -9.908  1.00 0.00 ? 157 ILE A HA   3  
ATOM 8309  H HB   . ILE A 1 157 ? -2.413  -1.942  -9.488  1.00 0.00 ? 157 ILE A HB   3  
ATOM 8310  H HG12 . ILE A 1 157 ? -3.758  -3.357  -7.235  1.00 0.00 ? 157 ILE A HG12 3  
ATOM 8311  H HG13 . ILE A 1 157 ? -2.638  -4.325  -8.163  1.00 0.00 ? 157 ILE A HG13 3  
ATOM 8312  H HG21 . ILE A 1 157 ? -4.519  -0.809  -9.774  1.00 0.00 ? 157 ILE A HG21 3  
ATOM 8313  H HG22 . ILE A 1 157 ? -5.302  -1.929  -8.639  1.00 0.00 ? 157 ILE A HG22 3  
ATOM 8314  H HG23 . ILE A 1 157 ? -4.034  -0.801  -8.090  1.00 0.00 ? 157 ILE A HG23 3  
ATOM 8315  H HD11 . ILE A 1 157 ? -1.387  -3.265  -6.375  1.00 0.00 ? 157 ILE A HD11 3  
ATOM 8316  H HD12 . ILE A 1 157 ? -0.864  -2.685  -7.955  1.00 0.00 ? 157 ILE A HD12 3  
ATOM 8317  H HD13 . ILE A 1 157 ? -1.882  -1.651  -6.935  1.00 0.00 ? 157 ILE A HD13 3  
ATOM 8318  N N    . ARG A 1 158 ? -3.493  -2.262  -12.446 1.00 0.00 ? 158 ARG A N    3  
ATOM 8319  C CA   . ARG A 1 158 ? -3.974  -1.513  -13.597 1.00 0.00 ? 158 ARG A CA   3  
ATOM 8320  C C    . ARG A 1 158 ? -4.686  -2.426  -14.587 1.00 0.00 ? 158 ARG A C    3  
ATOM 8321  O O    . ARG A 1 158 ? -5.570  -1.962  -15.310 1.00 0.00 ? 158 ARG A O    3  
ATOM 8322  C CB   . ARG A 1 158 ? -2.789  -0.803  -14.264 1.00 0.00 ? 158 ARG A CB   3  
ATOM 8323  C CG   . ARG A 1 158 ? -3.229  0.379   -15.129 1.00 0.00 ? 158 ARG A CG   3  
ATOM 8324  C CD   . ARG A 1 158 ? -3.000  0.133   -16.619 1.00 0.00 ? 158 ARG A CD   3  
ATOM 8325  N NE   . ARG A 1 158 ? -3.726  1.141   -17.391 1.00 0.00 ? 158 ARG A NE   3  
ATOM 8326  C CZ   . ARG A 1 158 ? -3.996  1.123   -18.697 1.00 0.00 ? 158 ARG A CZ   3  
ATOM 8327  N NH1  . ARG A 1 158 ? -3.478  0.190   -19.481 1.00 0.00 ? 158 ARG A NH1  3  
ATOM 8328  N NH2  . ARG A 1 158 ? -4.817  2.046   -19.181 1.00 0.00 ? 158 ARG A NH2  3  
ATOM 8329  H H    . ARG A 1 158 ? -2.496  -2.288  -12.259 1.00 0.00 ? 158 ARG A H    3  
ATOM 8330  H HA   . ARG A 1 158 ? -4.693  -0.782  -13.220 1.00 0.00 ? 158 ARG A HA   3  
ATOM 8331  H HB2  . ARG A 1 158 ? -2.116  -0.421  -13.500 1.00 0.00 ? 158 ARG A HB2  3  
ATOM 8332  H HB3  . ARG A 1 158 ? -2.251  -1.527  -14.872 1.00 0.00 ? 158 ARG A HB3  3  
ATOM 8333  H HG2  . ARG A 1 158 ? -4.287  0.576   -14.958 1.00 0.00 ? 158 ARG A HG2  3  
ATOM 8334  H HG3  . ARG A 1 158 ? -2.669  1.267   -14.828 1.00 0.00 ? 158 ARG A HG3  3  
ATOM 8335  H HD2  . ARG A 1 158 ? -1.935  0.200   -16.838 1.00 0.00 ? 158 ARG A HD2  3  
ATOM 8336  H HD3  . ARG A 1 158 ? -3.360  -0.859  -16.888 1.00 0.00 ? 158 ARG A HD3  3  
ATOM 8337  H HE   . ARG A 1 158 ? -4.048  1.925   -16.831 1.00 0.00 ? 158 ARG A HE   3  
ATOM 8338  H HH11 . ARG A 1 158 ? -2.703  -0.391  -19.152 1.00 0.00 ? 158 ARG A HH11 3  
ATOM 8339  H HH12 . ARG A 1 158 ? -3.674  0.110   -20.481 1.00 0.00 ? 158 ARG A HH12 3  
ATOM 8340  H HH21 . ARG A 1 158 ? -5.169  2.792   -18.589 1.00 0.00 ? 158 ARG A HH21 3  
ATOM 8341  H HH22 . ARG A 1 158 ? -4.983  2.183   -20.176 1.00 0.00 ? 158 ARG A HH22 3  
ATOM 8342  N N    . ASN A 1 159 ? -4.341  -3.716  -14.619 1.00 0.00 ? 159 ASN A N    3  
ATOM 8343  C CA   . ASN A 1 159 ? -5.068  -4.722  -15.389 1.00 0.00 ? 159 ASN A CA   3  
ATOM 8344  C C    . ASN A 1 159 ? -6.526  -4.813  -14.951 1.00 0.00 ? 159 ASN A C    3  
ATOM 8345  O O    . ASN A 1 159 ? -7.410  -5.007  -15.779 1.00 0.00 ? 159 ASN A O    3  
ATOM 8346  C CB   . ASN A 1 159 ? -4.410  -6.102  -15.236 1.00 0.00 ? 159 ASN A CB   3  
ATOM 8347  C CG   . ASN A 1 159 ? -3.561  -6.406  -16.453 1.00 0.00 ? 159 ASN A CG   3  
ATOM 8348  O OD1  . ASN A 1 159 ? -4.079  -6.844  -17.478 1.00 0.00 ? 159 ASN A OD1  3  
ATOM 8349  N ND2  . ASN A 1 159 ? -2.278  -6.122  -16.386 1.00 0.00 ? 159 ASN A ND2  3  
ATOM 8350  H H    . ASN A 1 159 ? -3.533  -4.016  -14.081 1.00 0.00 ? 159 ASN A H    3  
ATOM 8351  H HA   . ASN A 1 159 ? -5.052  -4.439  -16.442 1.00 0.00 ? 159 ASN A HA   3  
ATOM 8352  H HB2  . ASN A 1 159 ? -3.819  -6.167  -14.320 1.00 0.00 ? 159 ASN A HB2  3  
ATOM 8353  H HB3  . ASN A 1 159 ? -5.181  -6.871  -15.175 1.00 0.00 ? 159 ASN A HB3  3  
ATOM 8354  H HD21 . ASN A 1 159 ? -1.861  -5.726  -15.548 1.00 0.00 ? 159 ASN A HD21 3  
ATOM 8355  H HD22 . ASN A 1 159 ? -1.694  -6.332  -17.191 1.00 0.00 ? 159 ASN A HD22 3  
ATOM 8356  N N    . ARG A 1 160 ? -6.780  -4.678  -13.645 1.00 0.00 ? 160 ARG A N    3  
ATOM 8357  C CA   . ARG A 1 160 ? -8.063  -5.001  -13.027 1.00 0.00 ? 160 ARG A CA   3  
ATOM 8358  C C    . ARG A 1 160 ? -9.194  -4.146  -13.580 1.00 0.00 ? 160 ARG A C    3  
ATOM 8359  O O    . ARG A 1 160 ? -10.304 -4.651  -13.743 1.00 0.00 ? 160 ARG A O    3  
ATOM 8360  C CB   . ARG A 1 160 ? -7.964  -4.831  -11.502 1.00 0.00 ? 160 ARG A CB   3  
ATOM 8361  C CG   . ARG A 1 160 ? -6.786  -5.574  -10.836 1.00 0.00 ? 160 ARG A CG   3  
ATOM 8362  C CD   . ARG A 1 160 ? -6.732  -7.075  -11.116 1.00 0.00 ? 160 ARG A CD   3  
ATOM 8363  N NE   . ARG A 1 160 ? -7.994  -7.698  -10.725 1.00 0.00 ? 160 ARG A NE   3  
ATOM 8364  C CZ   . ARG A 1 160 ? -8.561  -8.748  -11.309 1.00 0.00 ? 160 ARG A CZ   3  
ATOM 8365  N NH1  . ARG A 1 160 ? -7.857  -9.591  -12.059 1.00 0.00 ? 160 ARG A NH1  3  
ATOM 8366  N NH2  . ARG A 1 160 ? -9.861  -8.913  -11.136 1.00 0.00 ? 160 ARG A NH2  3  
ATOM 8367  H H    . ARG A 1 160 ? -6.008  -4.444  -13.031 1.00 0.00 ? 160 ARG A H    3  
ATOM 8368  H HA   . ARG A 1 160 ? -8.301  -6.041  -13.258 1.00 0.00 ? 160 ARG A HA   3  
ATOM 8369  H HB2  . ARG A 1 160 ? -7.866  -3.770  -11.273 1.00 0.00 ? 160 ARG A HB2  3  
ATOM 8370  H HB3  . ARG A 1 160 ? -8.899  -5.167  -11.056 1.00 0.00 ? 160 ARG A HB3  3  
ATOM 8371  H HG2  . ARG A 1 160 ? -5.850  -5.162  -11.189 1.00 0.00 ? 160 ARG A HG2  3  
ATOM 8372  H HG3  . ARG A 1 160 ? -6.839  -5.410  -9.761  1.00 0.00 ? 160 ARG A HG3  3  
ATOM 8373  H HD2  . ARG A 1 160 ? -6.548  -7.232  -12.181 1.00 0.00 ? 160 ARG A HD2  3  
ATOM 8374  H HD3  . ARG A 1 160 ? -5.911  -7.521  -10.559 1.00 0.00 ? 160 ARG A HD3  3  
ATOM 8375  H HE   . ARG A 1 160 ? -8.568  -7.178  -10.059 1.00 0.00 ? 160 ARG A HE   3  
ATOM 8376  H HH11 . ARG A 1 160 ? -6.844  -9.587  -12.024 1.00 0.00 ? 160 ARG A HH11 3  
ATOM 8377  H HH12 . ARG A 1 160 ? -8.315  -10.418 -12.440 1.00 0.00 ? 160 ARG A HH12 3  
ATOM 8378  H HH21 . ARG A 1 160 ? -10.383 -8.289  -10.528 1.00 0.00 ? 160 ARG A HH21 3  
ATOM 8379  H HH22 . ARG A 1 160 ? -10.355 -9.725  -11.488 1.00 0.00 ? 160 ARG A HH22 3  
ATOM 8380  N N    . LYS A 1 161 ? -8.919  -2.871  -13.874 1.00 0.00 ? 161 LYS A N    3  
ATOM 8381  C CA   . LYS A 1 161 ? -9.808  -1.836  -14.415 1.00 0.00 ? 161 LYS A CA   3  
ATOM 8382  C C    . LYS A 1 161 ? -11.014 -1.467  -13.535 1.00 0.00 ? 161 LYS A C    3  
ATOM 8383  O O    . LYS A 1 161 ? -11.290 -0.279  -13.418 1.00 0.00 ? 161 LYS A O    3  
ATOM 8384  C CB   . LYS A 1 161 ? -10.240 -2.170  -15.858 1.00 0.00 ? 161 LYS A CB   3  
ATOM 8385  C CG   . LYS A 1 161 ? -10.122 -0.965  -16.812 1.00 0.00 ? 161 LYS A CG   3  
ATOM 8386  C CD   . LYS A 1 161 ? -8.777  -0.892  -17.574 1.00 0.00 ? 161 LYS A CD   3  
ATOM 8387  C CE   . LYS A 1 161 ? -7.768  0.164   -17.091 1.00 0.00 ? 161 LYS A CE   3  
ATOM 8388  N NZ   . LYS A 1 161 ? -8.169  1.541   -17.463 1.00 0.00 ? 161 LYS A NZ   3  
ATOM 8389  H H    . LYS A 1 161 ? -7.954  -2.606  -13.730 1.00 0.00 ? 161 LYS A H    3  
ATOM 8390  H HA   . LYS A 1 161 ? -9.193  -0.937  -14.460 1.00 0.00 ? 161 LYS A HA   3  
ATOM 8391  H HB2  . LYS A 1 161 ? -9.666  -3.009  -16.254 1.00 0.00 ? 161 LYS A HB2  3  
ATOM 8392  H HB3  . LYS A 1 161 ? -11.284 -2.488  -15.835 1.00 0.00 ? 161 LYS A HB3  3  
ATOM 8393  H HG2  . LYS A 1 161 ? -10.917 -1.067  -17.551 1.00 0.00 ? 161 LYS A HG2  3  
ATOM 8394  H HG3  . LYS A 1 161 ? -10.318 -0.047  -16.258 1.00 0.00 ? 161 LYS A HG3  3  
ATOM 8395  H HD2  . LYS A 1 161 ? -8.288  -1.865  -17.534 1.00 0.00 ? 161 LYS A HD2  3  
ATOM 8396  H HD3  . LYS A 1 161 ? -8.988  -0.701  -18.628 1.00 0.00 ? 161 LYS A HD3  3  
ATOM 8397  H HE2  . LYS A 1 161 ? -7.633  0.081   -16.011 1.00 0.00 ? 161 LYS A HE2  3  
ATOM 8398  H HE3  . LYS A 1 161 ? -6.804  -0.058  -17.557 1.00 0.00 ? 161 LYS A HE3  3  
ATOM 8399  H HZ1  . LYS A 1 161 ? -7.425  2.212   -17.305 1.00 0.00 ? 161 LYS A HZ1  3  
ATOM 8400  H HZ2  . LYS A 1 161 ? -8.410  1.624   -18.449 1.00 0.00 ? 161 LYS A HZ2  3  
ATOM 8401  H HZ3  . LYS A 1 161 ? -8.960  1.877   -16.915 1.00 0.00 ? 161 LYS A HZ3  3  
ATOM 8402  N N    . ASP A 1 162 ? -11.688 -2.420  -12.885 1.00 0.00 ? 162 ASP A N    3  
ATOM 8403  C CA   . ASP A 1 162 ? -12.791 -2.172  -11.936 1.00 0.00 ? 162 ASP A CA   3  
ATOM 8404  C C    . ASP A 1 162 ? -12.312 -1.319  -10.767 1.00 0.00 ? 162 ASP A C    3  
ATOM 8405  O O    . ASP A 1 162 ? -13.088 -0.543  -10.212 1.00 0.00 ? 162 ASP A O    3  
ATOM 8406  C CB   . ASP A 1 162 ? -13.362 -3.492  -11.376 1.00 0.00 ? 162 ASP A CB   3  
ATOM 8407  C CG   . ASP A 1 162 ? -14.744 -3.363  -10.716 1.00 0.00 ? 162 ASP A CG   3  
ATOM 8408  O OD1  . ASP A 1 162 ? -15.592 -2.604  -11.237 1.00 0.00 ? 162 ASP A OD1  3  
ATOM 8409  O OD2  . ASP A 1 162 ? -14.998 -4.040  -9.692  1.00 0.00 ? 162 ASP A OD2  3  
ATOM 8410  H H    . ASP A 1 162 ? -11.453 -3.374  -13.118 1.00 0.00 ? 162 ASP A H    3  
ATOM 8411  H HA   . ASP A 1 162 ? -13.579 -1.623  -12.453 1.00 0.00 ? 162 ASP A HA   3  
ATOM 8412  H HB2  . ASP A 1 162 ? -13.443 -4.215  -12.186 1.00 0.00 ? 162 ASP A HB2  3  
ATOM 8413  H HB3  . ASP A 1 162 ? -12.668 -3.869  -10.622 1.00 0.00 ? 162 ASP A HB3  3  
ATOM 8414  N N    . VAL A 1 163 ? -11.020 -1.428  -10.431 1.00 0.00 ? 163 VAL A N    3  
ATOM 8415  C CA   . VAL A 1 163 ? -10.318 -0.572  -9.492  1.00 0.00 ? 163 VAL A CA   3  
ATOM 8416  C C    . VAL A 1 163 ? -10.575 0.901   -9.857  1.00 0.00 ? 163 VAL A C    3  
ATOM 8417  O O    . VAL A 1 163 ? -10.116 1.428   -10.871 1.00 0.00 ? 163 VAL A O    3  
ATOM 8418  C CB   . VAL A 1 163 ? -8.825  -0.984  -9.374  1.00 0.00 ? 163 VAL A CB   3  
ATOM 8419  C CG1  . VAL A 1 163 ? -8.640  -2.409  -8.816  1.00 0.00 ? 163 VAL A CG1  3  
ATOM 8420  C CG2  . VAL A 1 163 ? -8.012  -0.777  -10.635 1.00 0.00 ? 163 VAL A CG2  3  
ATOM 8421  H H    . VAL A 1 163 ? -10.440 -2.045  -10.974 1.00 0.00 ? 163 VAL A H    3  
ATOM 8422  H HA   . VAL A 1 163 ? -10.749 -0.720  -8.502  1.00 0.00 ? 163 VAL A HA   3  
ATOM 8423  H HB   . VAL A 1 163 ? -8.314  -0.333  -8.689  1.00 0.00 ? 163 VAL A HB   3  
ATOM 8424  H HG11 . VAL A 1 163 ? -9.252  -3.134  -9.351  1.00 0.00 ? 163 VAL A HG11 3  
ATOM 8425  H HG12 . VAL A 1 163 ? -7.590  -2.691  -8.894  1.00 0.00 ? 163 VAL A HG12 3  
ATOM 8426  H HG13 . VAL A 1 163 ? -8.907  -2.428  -7.758  1.00 0.00 ? 163 VAL A HG13 3  
ATOM 8427  H HG21 . VAL A 1 163 ? -8.421  -1.350  -11.458 1.00 0.00 ? 163 VAL A HG21 3  
ATOM 8428  H HG22 . VAL A 1 163 ? -8.017  0.286   -10.855 1.00 0.00 ? 163 VAL A HG22 3  
ATOM 8429  H HG23 . VAL A 1 163 ? -6.981  -1.040  -10.408 1.00 0.00 ? 163 VAL A HG23 3  
ATOM 8430  N N    . LYS A 1 164 ? -11.364 1.569   -9.023  1.00 0.00 ? 164 LYS A N    3  
ATOM 8431  C CA   . LYS A 1 164 ? -11.497 3.019   -9.054  1.00 0.00 ? 164 LYS A CA   3  
ATOM 8432  C C    . LYS A 1 164 ? -10.166 3.629   -8.664  1.00 0.00 ? 164 LYS A C    3  
ATOM 8433  O O    . LYS A 1 164 ? -9.683  3.336   -7.568  1.00 0.00 ? 164 LYS A O    3  
ATOM 8434  C CB   . LYS A 1 164 ? -12.579 3.519   -8.080  1.00 0.00 ? 164 LYS A CB   3  
ATOM 8435  C CG   . LYS A 1 164 ? -13.886 3.902   -8.782  1.00 0.00 ? 164 LYS A CG   3  
ATOM 8436  C CD   . LYS A 1 164 ? -13.711 4.940   -9.897  1.00 0.00 ? 164 LYS A CD   3  
ATOM 8437  C CE   . LYS A 1 164 ? -14.992 5.735   -10.165 1.00 0.00 ? 164 LYS A CE   3  
ATOM 8438  N NZ   . LYS A 1 164 ? -14.842 6.587   -11.357 1.00 0.00 ? 164 LYS A NZ   3  
ATOM 8439  H H    . LYS A 1 164 ? -11.571 1.037   -8.195  1.00 0.00 ? 164 LYS A H    3  
ATOM 8440  H HA   . LYS A 1 164 ? -11.724 3.313   -10.077 1.00 0.00 ? 164 LYS A HA   3  
ATOM 8441  H HB2  . LYS A 1 164 ? -12.796 2.755   -7.332  1.00 0.00 ? 164 LYS A HB2  3  
ATOM 8442  H HB3  . LYS A 1 164 ? -12.197 4.393   -7.550  1.00 0.00 ? 164 LYS A HB3  3  
ATOM 8443  H HG2  . LYS A 1 164 ? -14.281 3.006   -9.230  1.00 0.00 ? 164 LYS A HG2  3  
ATOM 8444  H HG3  . LYS A 1 164 ? -14.596 4.261   -8.036  1.00 0.00 ? 164 LYS A HG3  3  
ATOM 8445  H HD2  . LYS A 1 164 ? -12.911 5.632   -9.630  1.00 0.00 ? 164 LYS A HD2  3  
ATOM 8446  H HD3  . LYS A 1 164 ? -13.435 4.406   -10.807 1.00 0.00 ? 164 LYS A HD3  3  
ATOM 8447  H HE2  . LYS A 1 164 ? -15.826 5.054   -10.301 1.00 0.00 ? 164 LYS A HE2  3  
ATOM 8448  H HE3  . LYS A 1 164 ? -15.226 6.357   -9.302  1.00 0.00 ? 164 LYS A HE3  3  
ATOM 8449  H HZ1  . LYS A 1 164 ? -14.771 6.040   -12.211 1.00 0.00 ? 164 LYS A HZ1  3  
ATOM 8450  H HZ2  . LYS A 1 164 ? -15.619 7.235   -11.452 1.00 0.00 ? 164 LYS A HZ2  3  
ATOM 8451  H HZ3  . LYS A 1 164 ? -13.985 7.129   -11.294 1.00 0.00 ? 164 LYS A HZ3  3  
ATOM 8452  N N    . VAL A 1 165 ? -9.604  4.470   -9.521  1.00 0.00 ? 165 VAL A N    3  
ATOM 8453  C CA   . VAL A 1 165 ? -8.343  5.108   -9.324  1.00 0.00 ? 165 VAL A CA   3  
ATOM 8454  C C    . VAL A 1 165 ? -8.576  6.613   -9.126  1.00 0.00 ? 165 VAL A C    3  
ATOM 8455  O O    . VAL A 1 165 ? -8.544  7.412   -10.067 1.00 0.00 ? 165 VAL A O    3  
ATOM 8456  C CB   . VAL A 1 165 ? -7.431  4.684   -10.469 1.00 0.00 ? 165 VAL A CB   3  
ATOM 8457  C CG1  . VAL A 1 165 ? -6.977  3.222   -10.333 1.00 0.00 ? 165 VAL A CG1  3  
ATOM 8458  C CG2  . VAL A 1 165 ? -7.901  4.878   -11.906 1.00 0.00 ? 165 VAL A CG2  3  
ATOM 8459  H H    . VAL A 1 165 ? -9.961  4.634   -10.452 1.00 0.00 ? 165 VAL A H    3  
ATOM 8460  H HA   . VAL A 1 165 ? -7.887  4.720   -8.420  1.00 0.00 ? 165 VAL A HA   3  
ATOM 8461  H HB   . VAL A 1 165 ? -6.599  5.331   -10.372 1.00 0.00 ? 165 VAL A HB   3  
ATOM 8462  H HG11 . VAL A 1 165 ? -7.807  2.547   -10.536 1.00 0.00 ? 165 VAL A HG11 3  
ATOM 8463  H HG12 . VAL A 1 165 ? -6.162  3.042   -11.030 1.00 0.00 ? 165 VAL A HG12 3  
ATOM 8464  H HG13 . VAL A 1 165 ? -6.615  3.032   -9.324  1.00 0.00 ? 165 VAL A HG13 3  
ATOM 8465  H HG21 . VAL A 1 165 ? -7.023  4.747   -12.532 1.00 0.00 ? 165 VAL A HG21 3  
ATOM 8466  H HG22 . VAL A 1 165 ? -8.676  4.159   -12.173 1.00 0.00 ? 165 VAL A HG22 3  
ATOM 8467  H HG23 . VAL A 1 165 ? -8.263  5.888   -12.040 1.00 0.00 ? 165 VAL A HG23 3  
ATOM 8468  N N    . PHE A 1 166 ? -8.923  6.996   -7.898  1.00 0.00 ? 166 PHE A N    3  
ATOM 8469  C CA   . PHE A 1 166 ? -9.335  8.347   -7.550  1.00 0.00 ? 166 PHE A CA   3  
ATOM 8470  C C    . PHE A 1 166 ? -8.125  9.306   -7.576  1.00 0.00 ? 166 PHE A C    3  
ATOM 8471  O O    . PHE A 1 166 ? -7.161  9.119   -6.830  1.00 0.00 ? 166 PHE A O    3  
ATOM 8472  C CB   . PHE A 1 166 ? -10.024 8.323   -6.181  1.00 0.00 ? 166 PHE A CB   3  
ATOM 8473  C CG   . PHE A 1 166 ? -11.355 7.601   -6.041  1.00 0.00 ? 166 PHE A CG   3  
ATOM 8474  C CD1  . PHE A 1 166 ? -12.216 7.385   -7.138  1.00 0.00 ? 166 PHE A CD1  3  
ATOM 8475  C CD2  . PHE A 1 166 ? -11.774 7.195   -4.757  1.00 0.00 ? 166 PHE A CD2  3  
ATOM 8476  C CE1  . PHE A 1 166 ? -13.429 6.709   -6.947  1.00 0.00 ? 166 PHE A CE1  3  
ATOM 8477  C CE2  . PHE A 1 166 ? -12.979 6.497   -4.589  1.00 0.00 ? 166 PHE A CE2  3  
ATOM 8478  C CZ   . PHE A 1 166 ? -13.783 6.200   -5.692  1.00 0.00 ? 166 PHE A CZ   3  
ATOM 8479  H H    . PHE A 1 166 ? -8.868  6.312   -7.147  1.00 0.00 ? 166 PHE A H    3  
ATOM 8480  H HA   . PHE A 1 166 ? -10.066 8.671   -8.283  1.00 0.00 ? 166 PHE A HA   3  
ATOM 8481  H HB2  . PHE A 1 166 ? -9.334  7.872   -5.478  1.00 0.00 ? 166 PHE A HB2  3  
ATOM 8482  H HB3  . PHE A 1 166 ? -10.193 9.345   -5.873  1.00 0.00 ? 166 PHE A HB3  3  
ATOM 8483  H HD1  . PHE A 1 166 ? -11.986 7.725   -8.137  1.00 0.00 ? 166 PHE A HD1  3  
ATOM 8484  H HD2  . PHE A 1 166 ? -11.173 7.411   -3.884  1.00 0.00 ? 166 PHE A HD2  3  
ATOM 8485  H HE1  . PHE A 1 166 ? -14.101 6.567   -7.770  1.00 0.00 ? 166 PHE A HE1  3  
ATOM 8486  H HE2  . PHE A 1 166 ? -13.281 6.155   -3.618  1.00 0.00 ? 166 PHE A HE2  3  
ATOM 8487  H HZ   . PHE A 1 166 ? -14.681 5.608   -5.568  1.00 0.00 ? 166 PHE A HZ   3  
ATOM 8488  N N    . ASN A 1 167 ? -8.153  10.331  -8.436  1.00 0.00 ? 167 ASN A N    3  
ATOM 8489  C CA   . ASN A 1 167 ? -7.083  11.325  -8.590  1.00 0.00 ? 167 ASN A CA   3  
ATOM 8490  C C    . ASN A 1 167 ? -7.146  12.363  -7.468  1.00 0.00 ? 167 ASN A C    3  
ATOM 8491  O O    . ASN A 1 167 ? -7.891  13.340  -7.578  1.00 0.00 ? 167 ASN A O    3  
ATOM 8492  C CB   . ASN A 1 167 ? -7.154  11.978  -9.975  1.00 0.00 ? 167 ASN A CB   3  
ATOM 8493  C CG   . ASN A 1 167 ? -5.861  12.731  -10.221 1.00 0.00 ? 167 ASN A CG   3  
ATOM 8494  O OD1  . ASN A 1 167 ? -5.004  12.318  -10.996 1.00 0.00 ? 167 ASN A OD1  3  
ATOM 8495  N ND2  . ASN A 1 167 ? -5.663  13.828  -9.525  1.00 0.00 ? 167 ASN A ND2  3  
ATOM 8496  H H    . ASN A 1 167 ? -8.996  10.478  -8.973  1.00 0.00 ? 167 ASN A H    3  
ATOM 8497  H HA   . ASN A 1 167 ? -6.089  10.880  -8.552  1.00 0.00 ? 167 ASN A HA   3  
ATOM 8498  H HB2  . ASN A 1 167 ? -7.267  11.206  -10.737 1.00 0.00 ? 167 ASN A HB2  3  
ATOM 8499  H HB3  . ASN A 1 167 ? -7.990  12.675  -10.027 1.00 0.00 ? 167 ASN A HB3  3  
ATOM 8500  H HD21 . ASN A 1 167 ? -6.379  14.183  -8.904  1.00 0.00 ? 167 ASN A HD21 3  
ATOM 8501  H HD22 . ASN A 1 167 ? -4.735  14.204  -9.502  1.00 0.00 ? 167 ASN A HD22 3  
ATOM 8502  N N    . VAL A 1 168 ? -6.340  12.207  -6.418  1.00 0.00 ? 168 VAL A N    3  
ATOM 8503  C CA   . VAL A 1 168 ? -6.167  13.247  -5.406  1.00 0.00 ? 168 VAL A CA   3  
ATOM 8504  C C    . VAL A 1 168 ? -5.437  14.431  -6.056  1.00 0.00 ? 168 VAL A C    3  
ATOM 8505  O O    . VAL A 1 168 ? -4.409  14.274  -6.726  1.00 0.00 ? 168 VAL A O    3  
ATOM 8506  C CB   . VAL A 1 168 ? -5.466  12.674  -4.145  1.00 0.00 ? 168 VAL A CB   3  
ATOM 8507  C CG1  . VAL A 1 168 ? -3.970  12.968  -4.081  1.00 0.00 ? 168 VAL A CG1  3  
ATOM 8508  C CG2  . VAL A 1 168 ? -5.997  13.245  -2.823  1.00 0.00 ? 168 VAL A CG2  3  
ATOM 8509  H H    . VAL A 1 168 ? -5.674  11.442  -6.432  1.00 0.00 ? 168 VAL A H    3  
ATOM 8510  H HA   . VAL A 1 168 ? -7.160  13.586  -5.111  1.00 0.00 ? 168 VAL A HA   3  
ATOM 8511  H HB   . VAL A 1 168 ? -5.607  11.592  -4.125  1.00 0.00 ? 168 VAL A HB   3  
ATOM 8512  H HG11 . VAL A 1 168 ? -3.553  12.511  -3.191  1.00 0.00 ? 168 VAL A HG11 3  
ATOM 8513  H HG12 . VAL A 1 168 ? -3.480  12.568  -4.968  1.00 0.00 ? 168 VAL A HG12 3  
ATOM 8514  H HG13 . VAL A 1 168 ? -3.831  14.054  -4.010  1.00 0.00 ? 168 VAL A HG13 3  
ATOM 8515  H HG21 . VAL A 1 168 ? -5.593  12.665  -1.989  1.00 0.00 ? 168 VAL A HG21 3  
ATOM 8516  H HG22 . VAL A 1 168 ? -5.677  14.279  -2.722  1.00 0.00 ? 168 VAL A HG22 3  
ATOM 8517  H HG23 . VAL A 1 168 ? -7.081  13.213  -2.772  1.00 0.00 ? 168 VAL A HG23 3  
ATOM 8518  N N    . THR A 1 169 ? -5.947  15.633  -5.833  1.00 0.00 ? 169 THR A N    3  
ATOM 8519  C CA   . THR A 1 169 ? -5.175  16.856  -5.965  1.00 0.00 ? 169 THR A CA   3  
ATOM 8520  C C    . THR A 1 169 ? -4.677  17.160  -4.565  1.00 0.00 ? 169 THR A C    3  
ATOM 8521  O O    . THR A 1 169 ? -5.320  16.816  -3.573  1.00 0.00 ? 169 THR A O    3  
ATOM 8522  C CB   . THR A 1 169 ? -6.034  17.955  -6.608  1.00 0.00 ? 169 THR A CB   3  
ATOM 8523  O OG1  . THR A 1 169 ? -7.003  18.390  -5.690  1.00 0.00 ? 169 THR A OG1  3  
ATOM 8524  C CG2  . THR A 1 169 ? -6.700  17.430  -7.888  1.00 0.00 ? 169 THR A CG2  3  
ATOM 8525  H H    . THR A 1 169 ? -6.785  15.737  -5.276  1.00 0.00 ? 169 THR A H    3  
ATOM 8526  H HA   . THR A 1 169 ? -4.294  16.749  -6.586  1.00 0.00 ? 169 THR A HA   3  
ATOM 8527  H HB   . THR A 1 169 ? -5.397  18.803  -6.859  1.00 0.00 ? 169 THR A HB   3  
ATOM 8528  H HG1  . THR A 1 169 ? -7.793  18.687  -6.177  1.00 0.00 ? 169 THR A HG1  3  
ATOM 8529  H HG21 . THR A 1 169 ? -7.416  16.639  -7.664  1.00 0.00 ? 169 THR A HG21 3  
ATOM 8530  H HG22 . THR A 1 169 ? -7.227  18.237  -8.391  1.00 0.00 ? 169 THR A HG22 3  
ATOM 8531  H HG23 . THR A 1 169 ? -5.935  17.031  -8.555  1.00 0.00 ? 169 THR A HG23 3  
ATOM 8532  N N    . LYS A 1 170 ? -3.531  17.822  -4.467  1.00 0.00 ? 170 LYS A N    3  
ATOM 8533  C CA   . LYS A 1 170 ? -3.116  18.434  -3.215  1.00 0.00 ? 170 LYS A CA   3  
ATOM 8534  C C    . LYS A 1 170 ? -4.172  19.438  -2.735  1.00 0.00 ? 170 LYS A C    3  
ATOM 8535  O O    . LYS A 1 170 ? -4.385  19.571  -1.534  1.00 0.00 ? 170 LYS A O    3  
ATOM 8536  C CB   . LYS A 1 170 ? -1.719  19.032  -3.402  1.00 0.00 ? 170 LYS A CB   3  
ATOM 8537  C CG   . LYS A 1 170 ? -1.655  20.168  -4.431  1.00 0.00 ? 170 LYS A CG   3  
ATOM 8538  C CD   . LYS A 1 170 ? -0.203  20.486  -4.808  1.00 0.00 ? 170 LYS A CD   3  
ATOM 8539  C CE   . LYS A 1 170 ? 0.480   21.358  -3.753  1.00 0.00 ? 170 LYS A CE   3  
ATOM 8540  N NZ   . LYS A 1 170 ? 1.896   21.612  -4.090  1.00 0.00 ? 170 LYS A NZ   3  
ATOM 8541  H H    . LYS A 1 170 ? -2.993  18.013  -5.299  1.00 0.00 ? 170 LYS A H    3  
ATOM 8542  H HA   . LYS A 1 170 ? -3.035  17.658  -2.459  1.00 0.00 ? 170 LYS A HA   3  
ATOM 8543  H HB2  . LYS A 1 170 ? -1.336  19.374  -2.444  1.00 0.00 ? 170 LYS A HB2  3  
ATOM 8544  H HB3  . LYS A 1 170 ? -1.075  18.229  -3.747  1.00 0.00 ? 170 LYS A HB3  3  
ATOM 8545  H HG2  . LYS A 1 170 ? -2.177  19.857  -5.336  1.00 0.00 ? 170 LYS A HG2  3  
ATOM 8546  H HG3  . LYS A 1 170 ? -2.149  21.054  -4.033  1.00 0.00 ? 170 LYS A HG3  3  
ATOM 8547  H HD2  . LYS A 1 170 ? 0.352   19.559  -4.953  1.00 0.00 ? 170 LYS A HD2  3  
ATOM 8548  H HD3  . LYS A 1 170 ? -0.206  21.023  -5.753  1.00 0.00 ? 170 LYS A HD3  3  
ATOM 8549  H HE2  . LYS A 1 170 ? -0.052  22.311  -3.700  1.00 0.00 ? 170 LYS A HE2  3  
ATOM 8550  H HE3  . LYS A 1 170 ? 0.415   20.881  -2.774  1.00 0.00 ? 170 LYS A HE3  3  
ATOM 8551  H HZ1  . LYS A 1 170 ? 1.987   21.859  -5.064  1.00 0.00 ? 170 LYS A HZ1  3  
ATOM 8552  H HZ2  . LYS A 1 170 ? 2.215   22.406  -3.540  1.00 0.00 ? 170 LYS A HZ2  3  
ATOM 8553  H HZ3  . LYS A 1 170 ? 2.474   20.798  -3.886  1.00 0.00 ? 170 LYS A HZ3  3  
ATOM 8554  N N    . GLU A 1 171 ? -4.904  20.061  -3.662  1.00 0.00 ? 171 GLU A N    3  
ATOM 8555  C CA   . GLU A 1 171 ? -5.821  21.151  -3.326  1.00 0.00 ? 171 GLU A CA   3  
ATOM 8556  C C    . GLU A 1 171 ? -7.031  20.625  -2.546  1.00 0.00 ? 171 GLU A C    3  
ATOM 8557  O O    . GLU A 1 171 ? -7.326  21.075  -1.433  1.00 0.00 ? 171 GLU A O    3  
ATOM 8558  C CB   . GLU A 1 171 ? -6.252  21.903  -4.602  1.00 0.00 ? 171 GLU A CB   3  
ATOM 8559  C CG   . GLU A 1 171 ? -5.130  22.739  -5.250  1.00 0.00 ? 171 GLU A CG   3  
ATOM 8560  C CD   . GLU A 1 171 ? -4.758  23.968  -4.411  1.00 0.00 ? 171 GLU A CD   3  
ATOM 8561  O OE1  . GLU A 1 171 ? -4.105  23.803  -3.353  1.00 0.00 ? 171 GLU A OE1  3  
ATOM 8562  O OE2  . GLU A 1 171 ? -5.164  25.101  -4.756  1.00 0.00 ? 171 GLU A OE2  3  
ATOM 8563  H H    . GLU A 1 171 ? -4.789  19.767  -4.628  1.00 0.00 ? 171 GLU A H    3  
ATOM 8564  H HA   . GLU A 1 171 ? -5.298  21.842  -2.665  1.00 0.00 ? 171 GLU A HA   3  
ATOM 8565  H HB2  . GLU A 1 171 ? -6.613  21.179  -5.334  1.00 0.00 ? 171 GLU A HB2  3  
ATOM 8566  H HB3  . GLU A 1 171 ? -7.082  22.567  -4.356  1.00 0.00 ? 171 GLU A HB3  3  
ATOM 8567  H HG2  . GLU A 1 171 ? -4.248  22.116  -5.403  1.00 0.00 ? 171 GLU A HG2  3  
ATOM 8568  H HG3  . GLU A 1 171 ? -5.468  23.072  -6.233  1.00 0.00 ? 171 GLU A HG3  3  
ATOM 8569  N N    . ASN A 1 172 ? -7.727  19.626  -3.090  1.00 0.00 ? 172 ASN A N    3  
ATOM 8570  C CA   . ASN A 1 172 ? -8.946  19.059  -2.511  1.00 0.00 ? 172 ASN A CA   3  
ATOM 8571  C C    . ASN A 1 172 ? -8.660  17.714  -1.849  1.00 0.00 ? 172 ASN A C    3  
ATOM 8572  O O    . ASN A 1 172 ? -9.585  16.934  -1.644  1.00 0.00 ? 172 ASN A O    3  
ATOM 8573  C CB   . ASN A 1 172 ? -10.121 19.047  -3.506  1.00 0.00 ? 172 ASN A CB   3  
ATOM 8574  C CG   . ASN A 1 172 ? -9.848  18.333  -4.818  1.00 0.00 ? 172 ASN A CG   3  
ATOM 8575  O OD1  . ASN A 1 172 ? -9.643  18.981  -5.842  1.00 0.00 ? 172 ASN A OD1  3  
ATOM 8576  N ND2  . ASN A 1 172 ? -9.838  17.016  -4.849  1.00 0.00 ? 172 ASN A ND2  3  
ATOM 8577  H H    . ASN A 1 172 ? -7.357  19.174  -3.923  1.00 0.00 ? 172 ASN A H    3  
ATOM 8578  H HA   . ASN A 1 172 ? -9.279  19.709  -1.708  1.00 0.00 ? 172 ASN A HA   3  
ATOM 8579  H HB2  . ASN A 1 172 ? -10.997 18.597  -3.033  1.00 0.00 ? 172 ASN A HB2  3  
ATOM 8580  H HB3  . ASN A 1 172 ? -10.389 20.077  -3.735  1.00 0.00 ? 172 ASN A HB3  3  
ATOM 8581  H HD21 . ASN A 1 172 ? -9.899  16.412  -4.026  1.00 0.00 ? 172 ASN A HD21 3  
ATOM 8582  H HD22 . ASN A 1 172 ? -9.692  16.549  -5.744  1.00 0.00 ? 172 ASN A HD22 3  
ATOM 8583  N N    . ARG A 1 173 ? -7.401  17.465  -1.458  1.00 0.00 ? 173 ARG A N    3  
ATOM 8584  C CA   . ARG A 1 173 ? -6.955  16.210  -0.858  1.00 0.00 ? 173 ARG A CA   3  
ATOM 8585  C C    . ARG A 1 173 ? -7.884  15.733  0.254   1.00 0.00 ? 173 ARG A C    3  
ATOM 8586  O O    . ARG A 1 173 ? -8.213  14.552  0.307   1.00 0.00 ? 173 ARG A O    3  
ATOM 8587  C CB   . ARG A 1 173 ? -5.486  16.315  -0.387  1.00 0.00 ? 173 ARG A CB   3  
ATOM 8588  C CG   . ARG A 1 173 ? -5.254  17.126  0.901   1.00 0.00 ? 173 ARG A CG   3  
ATOM 8589  C CD   . ARG A 1 173 ? -3.779  17.536  1.045   1.00 0.00 ? 173 ARG A CD   3  
ATOM 8590  N NE   . ARG A 1 173 ? -3.340  17.729  2.438   1.00 0.00 ? 173 ARG A NE   3  
ATOM 8591  C CZ   . ARG A 1 173 ? -3.825  18.544  3.381   1.00 0.00 ? 173 ARG A CZ   3  
ATOM 8592  N NH1  . ARG A 1 173 ? -4.911  19.275  3.170   1.00 0.00 ? 173 ARG A NH1  3  
ATOM 8593  N NH2  . ARG A 1 173 ? -3.200  18.612  4.549   1.00 0.00 ? 173 ARG A NH2  3  
ATOM 8594  H H    . ARG A 1 173 ? -6.692  18.141  -1.710  1.00 0.00 ? 173 ARG A H    3  
ATOM 8595  H HA   . ARG A 1 173 ? -7.000  15.472  -1.662  1.00 0.00 ? 173 ARG A HA   3  
ATOM 8596  H HB2  . ARG A 1 173 ? -5.109  15.304  -0.223  1.00 0.00 ? 173 ARG A HB2  3  
ATOM 8597  H HB3  . ARG A 1 173 ? -4.888  16.758  -1.179  1.00 0.00 ? 173 ARG A HB3  3  
ATOM 8598  H HG2  . ARG A 1 173 ? -5.863  18.030  0.880   1.00 0.00 ? 173 ARG A HG2  3  
ATOM 8599  H HG3  . ARG A 1 173 ? -5.548  16.512  1.754   1.00 0.00 ? 173 ARG A HG3  3  
ATOM 8600  H HD2  . ARG A 1 173 ? -3.153  16.758  0.607   1.00 0.00 ? 173 ARG A HD2  3  
ATOM 8601  H HD3  . ARG A 1 173 ? -3.599  18.455  0.489   1.00 0.00 ? 173 ARG A HD3  3  
ATOM 8602  H HE   . ARG A 1 173 ? -2.437  17.312  2.656   1.00 0.00 ? 173 ARG A HE   3  
ATOM 8603  H HH11 . ARG A 1 173 ? -5.132  19.523  2.212   1.00 0.00 ? 173 ARG A HH11 3  
ATOM 8604  H HH12 . ARG A 1 173 ? -5.328  19.864  3.890   1.00 0.00 ? 173 ARG A HH12 3  
ATOM 8605  H HH21 . ARG A 1 173 ? -2.305  18.142  4.650   1.00 0.00 ? 173 ARG A HH21 3  
ATOM 8606  H HH22 . ARG A 1 173 ? -3.504  19.242  5.283   1.00 0.00 ? 173 ARG A HH22 3  
ATOM 8607  N N    . ASN A 1 174 ? -8.314  16.630  1.150   1.00 0.00 ? 174 ASN A N    3  
ATOM 8608  C CA   . ASN A 1 174 ? -9.068  16.234  2.333   1.00 0.00 ? 174 ASN A CA   3  
ATOM 8609  C C    . ASN A 1 174 ? -10.520 15.864  2.034   1.00 0.00 ? 174 ASN A C    3  
ATOM 8610  O O    . ASN A 1 174 ? -11.260 15.475  2.935   1.00 0.00 ? 174 ASN A O    3  
ATOM 8611  C CB   . ASN A 1 174 ? -8.984  17.309  3.433   1.00 0.00 ? 174 ASN A CB   3  
ATOM 8612  C CG   . ASN A 1 174 ? -8.317  16.729  4.670   1.00 0.00 ? 174 ASN A CG   3  
ATOM 8613  O OD1  . ASN A 1 174 ? -8.802  15.767  5.255   1.00 0.00 ? 174 ASN A OD1  3  
ATOM 8614  N ND2  . ASN A 1 174 ? -7.172  17.262  5.063   1.00 0.00 ? 174 ASN A ND2  3  
ATOM 8615  H H    . ASN A 1 174 ? -8.088  17.604  1.034   1.00 0.00 ? 174 ASN A H    3  
ATOM 8616  H HA   . ASN A 1 174 ? -8.588  15.332  2.684   1.00 0.00 ? 174 ASN A HA   3  
ATOM 8617  H HB2  . ASN A 1 174 ? -8.434  18.182  3.083   1.00 0.00 ? 174 ASN A HB2  3  
ATOM 8618  H HB3  . ASN A 1 174 ? -9.989  17.639  3.704   1.00 0.00 ? 174 ASN A HB3  3  
ATOM 8619  H HD21 . ASN A 1 174 ? -6.774  18.079  4.624   1.00 0.00 ? 174 ASN A HD21 3  
ATOM 8620  H HD22 . ASN A 1 174 ? -6.605  16.774  5.761   1.00 0.00 ? 174 ASN A HD22 3  
ATOM 8621  N N    . HIS A 1 175 ? -10.893 15.874  0.761   1.00 0.00 ? 175 HIS A N    3  
ATOM 8622  C CA   . HIS A 1 175 ? -12.138 15.368  0.224   1.00 0.00 ? 175 HIS A CA   3  
ATOM 8623  C C    . HIS A 1 175 ? -11.750 14.254  -0.734  1.00 0.00 ? 175 HIS A C    3  
ATOM 8624  O O    . HIS A 1 175 ? -11.929 14.336  -1.949  1.00 0.00 ? 175 HIS A O    3  
ATOM 8625  C CB   . HIS A 1 175 ? -12.943 16.512  -0.392  1.00 0.00 ? 175 HIS A CB   3  
ATOM 8626  C CG   . HIS A 1 175 ? -13.450 17.436  0.676   1.00 0.00 ? 175 HIS A CG   3  
ATOM 8627  N ND1  . HIS A 1 175 ? -14.567 17.235  1.449   1.00 0.00 ? 175 HIS A ND1  3  
ATOM 8628  C CD2  . HIS A 1 175 ? -12.794 18.529  1.157   1.00 0.00 ? 175 HIS A CD2  3  
ATOM 8629  C CE1  . HIS A 1 175 ? -14.581 18.196  2.388   1.00 0.00 ? 175 HIS A CE1  3  
ATOM 8630  N NE2  . HIS A 1 175 ? -13.502 18.994  2.269   1.00 0.00 ? 175 HIS A NE2  3  
ATOM 8631  H H    . HIS A 1 175 ? -10.201 16.129  0.068   1.00 0.00 ? 175 HIS A H    3  
ATOM 8632  H HA   . HIS A 1 175 ? -12.744 14.928  1.017   1.00 0.00 ? 175 HIS A HA   3  
ATOM 8633  H HB2  . HIS A 1 175 ? -12.330 17.057  -1.111  1.00 0.00 ? 175 HIS A HB2  3  
ATOM 8634  H HB3  . HIS A 1 175 ? -13.801 16.103  -0.911  1.00 0.00 ? 175 HIS A HB3  3  
ATOM 8635  H HD1  . HIS A 1 175 ? -15.249 16.490  1.315   1.00 0.00 ? 175 HIS A HD1  3  
ATOM 8636  H HD2  . HIS A 1 175 ? -11.867 18.900  0.756   1.00 0.00 ? 175 HIS A HD2  3  
ATOM 8637  H HE1  . HIS A 1 175 ? -15.342 18.300  3.147   1.00 0.00 ? 175 HIS A HE1  3  
ATOM 8638  N N    . LEU A 1 176 ? -11.126 13.227  -0.151  1.00 0.00 ? 176 LEU A N    3  
ATOM 8639  C CA   . LEU A 1 176 ? -11.046 11.913  -0.760  1.00 0.00 ? 176 LEU A CA   3  
ATOM 8640  C C    . LEU A 1 176 ? -11.219 10.795  0.253   1.00 0.00 ? 176 LEU A C    3  
ATOM 8641  O O    . LEU A 1 176 ? -11.908 9.831   -0.050  1.00 0.00 ? 176 LEU A O    3  
ATOM 8642  C CB   . LEU A 1 176 ? -9.748  11.728  -1.557  1.00 0.00 ? 176 LEU A CB   3  
ATOM 8643  C CG   . LEU A 1 176 ? -10.086 11.275  -2.984  1.00 0.00 ? 176 LEU A CG   3  
ATOM 8644  C CD1  . LEU A 1 176 ? -8.818  11.296  -3.837  1.00 0.00 ? 176 LEU A CD1  3  
ATOM 8645  C CD2  . LEU A 1 176 ? -10.656 9.879   -3.015  1.00 0.00 ? 176 LEU A CD2  3  
ATOM 8646  H H    . LEU A 1 176 ? -10.882 13.348  0.816   1.00 0.00 ? 176 LEU A H    3  
ATOM 8647  H HA   . LEU A 1 176 ? -11.896 11.848  -1.441  1.00 0.00 ? 176 LEU A HA   3  
ATOM 8648  H HB2  . LEU A 1 176 ? -9.201  12.663  -1.600  1.00 0.00 ? 176 LEU A HB2  3  
ATOM 8649  H HB3  . LEU A 1 176 ? -9.102  10.995  -1.074  1.00 0.00 ? 176 LEU A HB3  3  
ATOM 8650  H HG   . LEU A 1 176 ? -10.861 11.913  -3.400  1.00 0.00 ? 176 LEU A HG   3  
ATOM 8651  H HD11 . LEU A 1 176 ? -8.568  12.327  -4.051  1.00 0.00 ? 176 LEU A HD11 3  
ATOM 8652  H HD12 . LEU A 1 176 ? -7.997  10.820  -3.299  1.00 0.00 ? 176 LEU A HD12 3  
ATOM 8653  H HD13 . LEU A 1 176 ? -8.977  10.801  -4.791  1.00 0.00 ? 176 LEU A HD13 3  
ATOM 8654  H HD21 . LEU A 1 176 ? -11.469 9.792   -2.320  1.00 0.00 ? 176 LEU A HD21 3  
ATOM 8655  H HD22 . LEU A 1 176 ? -11.074 9.687   -3.994  1.00 0.00 ? 176 LEU A HD22 3  
ATOM 8656  H HD23 . LEU A 1 176 ? -9.901  9.159   -2.754  1.00 0.00 ? 176 LEU A HD23 3  
ATOM 8657  N N    . LEU A 1 177 ? -10.650 10.913  1.460   1.00 0.00 ? 177 LEU A N    3  
ATOM 8658  C CA   . LEU A 1 177 ? -10.958 9.990   2.561   1.00 0.00 ? 177 LEU A CA   3  
ATOM 8659  C C    . LEU A 1 177 ? -12.468 9.658   2.578   1.00 0.00 ? 177 LEU A C    3  
ATOM 8660  O O    . LEU A 1 177 ? -12.796 8.482   2.416   1.00 0.00 ? 177 LEU A O    3  
ATOM 8661  C CB   . LEU A 1 177 ? -10.480 10.578  3.910   1.00 0.00 ? 177 LEU A CB   3  
ATOM 8662  C CG   . LEU A 1 177 ? -11.221 10.073  5.173   1.00 0.00 ? 177 LEU A CG   3  
ATOM 8663  C CD1  . LEU A 1 177 ? -11.075 8.567   5.388   1.00 0.00 ? 177 LEU A CD1  3  
ATOM 8664  C CD2  . LEU A 1 177 ? -10.664 10.808  6.389   1.00 0.00 ? 177 LEU A CD2  3  
ATOM 8665  H H    . LEU A 1 177 ? -10.080 11.722  1.645   1.00 0.00 ? 177 LEU A H    3  
ATOM 8666  H HA   . LEU A 1 177 ? -10.399 9.060   2.351   1.00 0.00 ? 177 LEU A HA   3  
ATOM 8667  H HB2  . LEU A 1 177 ? -9.420  10.365  4.024   1.00 0.00 ? 177 LEU A HB2  3  
ATOM 8668  H HB3  . LEU A 1 177 ? -10.588 11.663  3.877   1.00 0.00 ? 177 LEU A HB3  3  
ATOM 8669  H HG   . LEU A 1 177 ? -12.281 10.311  5.117   1.00 0.00 ? 177 LEU A HG   3  
ATOM 8670  H HD11 . LEU A 1 177 ? -10.040 8.268   5.262   1.00 0.00 ? 177 LEU A HD11 3  
ATOM 8671  H HD12 . LEU A 1 177 ? -11.412 8.295   6.385   1.00 0.00 ? 177 LEU A HD12 3  
ATOM 8672  H HD13 . LEU A 1 177 ? -11.684 8.019   4.677   1.00 0.00 ? 177 LEU A HD13 3  
ATOM 8673  H HD21 . LEU A 1 177 ? -11.110 10.394  7.296   1.00 0.00 ? 177 LEU A HD21 3  
ATOM 8674  H HD22 . LEU A 1 177 ? -9.584  10.704  6.424   1.00 0.00 ? 177 LEU A HD22 3  
ATOM 8675  H HD23 . LEU A 1 177 ? -10.925 11.863  6.331   1.00 0.00 ? 177 LEU A HD23 3  
ATOM 8676  N N    . PRO A 1 178 ? -13.385 10.641  2.701   1.00 0.00 ? 178 PRO A N    3  
ATOM 8677  C CA   . PRO A 1 178 ? -14.812 10.347  2.758   1.00 0.00 ? 178 PRO A CA   3  
ATOM 8678  C C    . PRO A 1 178 ? -15.363 9.757   1.458   1.00 0.00 ? 178 PRO A C    3  
ATOM 8679  O O    . PRO A 1 178 ? -16.334 9.007   1.490   1.00 0.00 ? 178 PRO A O    3  
ATOM 8680  C CB   . PRO A 1 178 ? -15.492 11.681  3.067   1.00 0.00 ? 178 PRO A CB   3  
ATOM 8681  C CG   . PRO A 1 178 ? -14.496 12.729  2.594   1.00 0.00 ? 178 PRO A CG   3  
ATOM 8682  C CD   . PRO A 1 178 ? -13.165 12.070  2.906   1.00 0.00 ? 178 PRO A CD   3  
ATOM 8683  H HA   . PRO A 1 178 ? -15.010 9.648   3.571   1.00 0.00 ? 178 PRO A HA   3  
ATOM 8684  H HB2  . PRO A 1 178 ? -16.443 11.778  2.546   1.00 0.00 ? 178 PRO A HB2  3  
ATOM 8685  H HB3  . PRO A 1 178 ? -15.617 11.780  4.141   1.00 0.00 ? 178 PRO A HB3  3  
ATOM 8686  H HG2  . PRO A 1 178 ? -14.580 12.853  1.518   1.00 0.00 ? 178 PRO A HG2  3  
ATOM 8687  H HG3  . PRO A 1 178 ? -14.617 13.680  3.114   1.00 0.00 ? 178 PRO A HG3  3  
ATOM 8688  H HD2  . PRO A 1 178 ? -12.406 12.484  2.248   1.00 0.00 ? 178 PRO A HD2  3  
ATOM 8689  H HD3  . PRO A 1 178 ? -12.906 12.258  3.949   1.00 0.00 ? 178 PRO A HD3  3  
ATOM 8690  N N    . ASP A 1 179 ? -14.771 10.072  0.309   1.00 0.00 ? 179 ASP A N    3  
ATOM 8691  C CA   . ASP A 1 179 ? -15.293 9.696   -0.999  1.00 0.00 ? 179 ASP A CA   3  
ATOM 8692  C C    . ASP A 1 179 ? -15.096 8.204   -1.206  1.00 0.00 ? 179 ASP A C    3  
ATOM 8693  O O    . ASP A 1 179 ? -15.948 7.516   -1.770  1.00 0.00 ? 179 ASP A O    3  
ATOM 8694  C CB   . ASP A 1 179 ? -14.548 10.439  -2.113  1.00 0.00 ? 179 ASP A CB   3  
ATOM 8695  C CG   . ASP A 1 179 ? -14.753 11.946  -2.074  1.00 0.00 ? 179 ASP A CG   3  
ATOM 8696  O OD1  . ASP A 1 179 ? -14.420 12.594  -1.059  1.00 0.00 ? 179 ASP A OD1  3  
ATOM 8697  O OD2  . ASP A 1 179 ? -15.297 12.458  -3.082  1.00 0.00 ? 179 ASP A OD2  3  
ATOM 8698  H H    . ASP A 1 179 ? -13.933 10.641  0.311   1.00 0.00 ? 179 ASP A H    3  
ATOM 8699  H HA   . ASP A 1 179 ? -16.354 9.941   -1.047  1.00 0.00 ? 179 ASP A HA   3  
ATOM 8700  H HB2  . ASP A 1 179 ? -13.491 10.229  -2.045  1.00 0.00 ? 179 ASP A HB2  3  
ATOM 8701  H HB3  . ASP A 1 179 ? -14.890 10.054  -3.077  1.00 0.00 ? 179 ASP A HB3  3  
ATOM 8702  N N    . ILE A 1 180 ? -13.957 7.706   -0.737  1.00 0.00 ? 180 ILE A N    3  
ATOM 8703  C CA   . ILE A 1 180 ? -13.601 6.304   -0.711  1.00 0.00 ? 180 ILE A CA   3  
ATOM 8704  C C    . ILE A 1 180 ? -14.539 5.596   0.273   1.00 0.00 ? 180 ILE A C    3  
ATOM 8705  O O    . ILE A 1 180 ? -15.109 4.576   -0.105  1.00 0.00 ? 180 ILE A O    3  
ATOM 8706  C CB   . ILE A 1 180 ? -12.124 6.204   -0.294  1.00 0.00 ? 180 ILE A CB   3  
ATOM 8707  C CG1  . ILE A 1 180 ? -11.120 6.951   -1.189  1.00 0.00 ? 180 ILE A CG1  3  
ATOM 8708  C CG2  . ILE A 1 180 ? -11.642 4.777   -0.047  1.00 0.00 ? 180 ILE A CG2  3  
ATOM 8709  C CD1  . ILE A 1 180 ? -9.921  7.454   -0.372  1.00 0.00 ? 180 ILE A CD1  3  
ATOM 8710  H H    . ILE A 1 180 ? -13.325 8.363   -0.284  1.00 0.00 ? 180 ILE A H    3  
ATOM 8711  H HA   . ILE A 1 180 ? -13.746 5.875   -1.700  1.00 0.00 ? 180 ILE A HA   3  
ATOM 8712  H HB   . ILE A 1 180 ? -12.105 6.727   0.643   1.00 0.00 ? 180 ILE A HB   3  
ATOM 8713  H HG12 . ILE A 1 180 ? -10.768 6.347   -2.026  1.00 0.00 ? 180 ILE A HG12 3  
ATOM 8714  H HG13 . ILE A 1 180 ? -11.618 7.810   -1.612  1.00 0.00 ? 180 ILE A HG13 3  
ATOM 8715  H HG21 . ILE A 1 180 ? -10.628 4.800   0.354   1.00 0.00 ? 180 ILE A HG21 3  
ATOM 8716  H HG22 . ILE A 1 180 ? -12.279 4.294   0.691   1.00 0.00 ? 180 ILE A HG22 3  
ATOM 8717  H HG23 . ILE A 1 180 ? -11.660 4.194   -0.963  1.00 0.00 ? 180 ILE A HG23 3  
ATOM 8718  H HD11 . ILE A 1 180 ? -9.521  8.356   -0.830  1.00 0.00 ? 180 ILE A HD11 3  
ATOM 8719  H HD12 . ILE A 1 180 ? -10.219 7.739   0.633   1.00 0.00 ? 180 ILE A HD12 3  
ATOM 8720  H HD13 . ILE A 1 180 ? -9.158  6.678   -0.315  1.00 0.00 ? 180 ILE A HD13 3  
ATOM 8721  N N    . VAL A 1 181 ? -14.747 6.136   1.484   1.00 0.00 ? 181 VAL A N    3  
ATOM 8722  C CA   . VAL A 1 181 ? -15.672 5.564   2.469   1.00 0.00 ? 181 VAL A CA   3  
ATOM 8723  C C    . VAL A 1 181 ? -17.063 5.440   1.840   1.00 0.00 ? 181 VAL A C    3  
ATOM 8724  O O    . VAL A 1 181 ? -17.688 4.390   1.962   1.00 0.00 ? 181 VAL A O    3  
ATOM 8725  C CB   . VAL A 1 181 ? -15.703 6.408   3.767   1.00 0.00 ? 181 VAL A CB   3  
ATOM 8726  C CG1  . VAL A 1 181 ? -16.718 5.880   4.795   1.00 0.00 ? 181 VAL A CG1  3  
ATOM 8727  C CG2  . VAL A 1 181 ? -14.334 6.454   4.460   1.00 0.00 ? 181 VAL A CG2  3  
ATOM 8728  H H    . VAL A 1 181 ? -14.263 6.989   1.741   1.00 0.00 ? 181 VAL A H    3  
ATOM 8729  H HA   . VAL A 1 181 ? -15.318 4.561   2.719   1.00 0.00 ? 181 VAL A HA   3  
ATOM 8730  H HB   . VAL A 1 181 ? -15.981 7.429   3.511   1.00 0.00 ? 181 VAL A HB   3  
ATOM 8731  H HG11 . VAL A 1 181 ? -16.695 6.503   5.690   1.00 0.00 ? 181 VAL A HG11 3  
ATOM 8732  H HG12 . VAL A 1 181 ? -17.730 5.914   4.391   1.00 0.00 ? 181 VAL A HG12 3  
ATOM 8733  H HG13 . VAL A 1 181 ? -16.482 4.852   5.071   1.00 0.00 ? 181 VAL A HG13 3  
ATOM 8734  H HG21 . VAL A 1 181 ? -13.551 6.662   3.745   1.00 0.00 ? 181 VAL A HG21 3  
ATOM 8735  H HG22 . VAL A 1 181 ? -14.328 7.253   5.202   1.00 0.00 ? 181 VAL A HG22 3  
ATOM 8736  H HG23 . VAL A 1 181 ? -14.117 5.506   4.948   1.00 0.00 ? 181 VAL A HG23 3  
ATOM 8737  N N    . THR A 1 182 ? -17.517 6.470   1.122   1.00 0.00 ? 182 THR A N    3  
ATOM 8738  C CA   . THR A 1 182 ? -18.792 6.500   0.420   1.00 0.00 ? 182 THR A CA   3  
ATOM 8739  C C    . THR A 1 182 ? -18.843 5.335   -0.582  1.00 0.00 ? 182 THR A C    3  
ATOM 8740  O O    . THR A 1 182 ? -19.805 4.566   -0.611  1.00 0.00 ? 182 THR A O    3  
ATOM 8741  C CB   . THR A 1 182 ? -18.964 7.885   -0.233  1.00 0.00 ? 182 THR A CB   3  
ATOM 8742  O OG1  . THR A 1 182 ? -18.911 8.903   0.745   1.00 0.00 ? 182 THR A OG1  3  
ATOM 8743  C CG2  . THR A 1 182 ? -20.298 8.055   -0.952  1.00 0.00 ? 182 THR A CG2  3  
ATOM 8744  H H    . THR A 1 182 ? -16.931 7.294   1.045   1.00 0.00 ? 182 THR A H    3  
ATOM 8745  H HA   . THR A 1 182 ? -19.591 6.373   1.149   1.00 0.00 ? 182 THR A HA   3  
ATOM 8746  H HB   . THR A 1 182 ? -18.170 8.054   -0.954  1.00 0.00 ? 182 THR A HB   3  
ATOM 8747  H HG1  . THR A 1 182 ? -18.004 8.991   1.092   1.00 0.00 ? 182 THR A HG1  3  
ATOM 8748  H HG21 . THR A 1 182 ? -20.410 7.303   -1.732  1.00 0.00 ? 182 THR A HG21 3  
ATOM 8749  H HG22 . THR A 1 182 ? -21.106 7.959   -0.228  1.00 0.00 ? 182 THR A HG22 3  
ATOM 8750  H HG23 . THR A 1 182 ? -20.337 9.044   -1.408  1.00 0.00 ? 182 THR A HG23 3  
ATOM 8751  N N    . CYS A 1 183 ? -17.780 5.161   -1.373  1.00 0.00 ? 183 CYS A N    3  
ATOM 8752  C CA   . CYS A 1 183 ? -17.697 4.098   -2.361  1.00 0.00 ? 183 CYS A CA   3  
ATOM 8753  C C    . CYS A 1 183 ? -17.697 2.710   -1.703  1.00 0.00 ? 183 CYS A C    3  
ATOM 8754  O O    . CYS A 1 183 ? -18.308 1.794   -2.250  1.00 0.00 ? 183 CYS A O    3  
ATOM 8755  C CB   . CYS A 1 183 ? -16.447 4.321   -3.221  1.00 0.00 ? 183 CYS A CB   3  
ATOM 8756  S SG   . CYS A 1 183 ? -16.677 3.543   -4.849  1.00 0.00 ? 183 CYS A SG   3  
ATOM 8757  H H    . CYS A 1 183 ? -16.988 5.785   -1.273  1.00 0.00 ? 183 CYS A H    3  
ATOM 8758  H HA   . CYS A 1 183 ? -18.583 4.177   -2.994  1.00 0.00 ? 183 CYS A HA   3  
ATOM 8759  H HB2  . CYS A 1 183 ? -16.290 5.393   -3.349  1.00 0.00 ? 183 CYS A HB2  3  
ATOM 8760  H HB3  . CYS A 1 183 ? -15.575 3.893   -2.723  1.00 0.00 ? 183 CYS A HB3  3  
ATOM 8761  H HG   . CYS A 1 183 ? -17.772 4.237   -5.196  1.00 0.00 ? 183 CYS A HG   3  
ATOM 8762  N N    . VAL A 1 184 ? -17.037 2.540   -0.550  1.00 0.00 ? 184 VAL A N    3  
ATOM 8763  C CA   . VAL A 1 184 ? -17.030 1.286   0.200   1.00 0.00 ? 184 VAL A CA   3  
ATOM 8764  C C    . VAL A 1 184 ? -18.433 1.018   0.759   1.00 0.00 ? 184 VAL A C    3  
ATOM 8765  O O    . VAL A 1 184 ? -18.995 -0.048  0.494   1.00 0.00 ? 184 VAL A O    3  
ATOM 8766  C CB   . VAL A 1 184 ? -15.908 1.289   1.272   1.00 0.00 ? 184 VAL A CB   3  
ATOM 8767  C CG1  . VAL A 1 184 ? -15.998 0.078   2.216   1.00 0.00 ? 184 VAL A CG1  3  
ATOM 8768  C CG2  . VAL A 1 184 ? -14.522 1.259   0.599   1.00 0.00 ? 184 VAL A CG2  3  
ATOM 8769  H H    . VAL A 1 184 ? -16.525 3.327   -0.161  1.00 0.00 ? 184 VAL A H    3  
ATOM 8770  H HA   . VAL A 1 184 ? -16.804 0.480   -0.500  1.00 0.00 ? 184 VAL A HA   3  
ATOM 8771  H HB   . VAL A 1 184 ? -15.967 2.191   1.885   1.00 0.00 ? 184 VAL A HB   3  
ATOM 8772  H HG11 . VAL A 1 184 ? -16.044 -0.844  1.637   1.00 0.00 ? 184 VAL A HG11 3  
ATOM 8773  H HG12 . VAL A 1 184 ? -15.131 0.038   2.875   1.00 0.00 ? 184 VAL A HG12 3  
ATOM 8774  H HG13 . VAL A 1 184 ? -16.893 0.146   2.835   1.00 0.00 ? 184 VAL A HG13 3  
ATOM 8775  H HG21 . VAL A 1 184 ? -14.395 2.119   -0.057  1.00 0.00 ? 184 VAL A HG21 3  
ATOM 8776  H HG22 . VAL A 1 184 ? -13.735 1.281   1.353   1.00 0.00 ? 184 VAL A HG22 3  
ATOM 8777  H HG23 . VAL A 1 184 ? -14.418 0.350   0.005   1.00 0.00 ? 184 VAL A HG23 3  
ATOM 8778  N N    . GLN A 1 185 ? -19.012 1.954   1.525   1.00 0.00 ? 185 GLN A N    3  
ATOM 8779  C CA   . GLN A 1 185 ? -20.289 1.744   2.204   1.00 0.00 ? 185 GLN A CA   3  
ATOM 8780  C C    . GLN A 1 185 ? -21.434 1.544   1.219   1.00 0.00 ? 185 GLN A C    3  
ATOM 8781  O O    . GLN A 1 185 ? -22.387 0.862   1.587   1.00 0.00 ? 185 GLN A O    3  
ATOM 8782  C CB   . GLN A 1 185 ? -20.604 2.862   3.221   1.00 0.00 ? 185 GLN A CB   3  
ATOM 8783  C CG   . GLN A 1 185 ? -21.018 4.231   2.639   1.00 0.00 ? 185 GLN A CG   3  
ATOM 8784  C CD   . GLN A 1 185 ? -22.421 4.334   2.010   1.00 0.00 ? 185 GLN A CD   3  
ATOM 8785  O OE1  . GLN A 1 185 ? -22.618 5.068   1.045   1.00 0.00 ? 185 GLN A OE1  3  
ATOM 8786  N NE2  . GLN A 1 185 ? -23.421 3.607   2.494   1.00 0.00 ? 185 GLN A NE2  3  
ATOM 8787  H H    . GLN A 1 185 ? -18.544 2.846   1.659   1.00 0.00 ? 185 GLN A H    3  
ATOM 8788  H HA   . GLN A 1 185 ? -20.198 0.814   2.767   1.00 0.00 ? 185 GLN A HA   3  
ATOM 8789  H HB2  . GLN A 1 185 ? -21.394 2.511   3.887   1.00 0.00 ? 185 GLN A HB2  3  
ATOM 8790  H HB3  . GLN A 1 185 ? -19.718 3.019   3.839   1.00 0.00 ? 185 GLN A HB3  3  
ATOM 8791  H HG2  . GLN A 1 185 ? -20.946 4.971   3.435   1.00 0.00 ? 185 GLN A HG2  3  
ATOM 8792  H HG3  . GLN A 1 185 ? -20.285 4.506   1.887   1.00 0.00 ? 185 GLN A HG3  3  
ATOM 8793  H HE21 . GLN A 1 185 ? -23.262 2.933   3.233   1.00 0.00 ? 185 GLN A HE21 3  
ATOM 8794  H HE22 . GLN A 1 185 ? -24.314 3.675   2.017   1.00 0.00 ? 185 GLN A HE22 3  
ATOM 8795  N N    . SER A 1 186 ? -21.338 2.121   0.010   1.00 0.00 ? 186 SER A N    3  
ATOM 8796  C CA   . SER A 1 186 ? -22.329 2.114   -1.045  1.00 0.00 ? 186 SER A CA   3  
ATOM 8797  C C    . SER A 1 186 ? -23.125 0.809   -1.062  1.00 0.00 ? 186 SER A C    3  
ATOM 8798  O O    . SER A 1 186 ? -24.354 0.856   -1.013  1.00 0.00 ? 186 SER A O    3  
ATOM 8799  C CB   . SER A 1 186 ? -21.638 2.505   -2.373  1.00 0.00 ? 186 SER A CB   3  
ATOM 8800  O OG   . SER A 1 186 ? -21.722 1.556   -3.424  1.00 0.00 ? 186 SER A OG   3  
ATOM 8801  H H    . SER A 1 186 ? -20.650 2.849   -0.138  1.00 0.00 ? 186 SER A H    3  
ATOM 8802  H HA   . SER A 1 186 ? -23.025 2.916   -0.799  1.00 0.00 ? 186 SER A HA   3  
ATOM 8803  H HB2  . SER A 1 186 ? -22.072 3.441   -2.721  1.00 0.00 ? 186 SER A HB2  3  
ATOM 8804  H HB3  . SER A 1 186 ? -20.586 2.709   -2.191  1.00 0.00 ? 186 SER A HB3  3  
ATOM 8805  H HG   . SER A 1 186 ? -22.226 1.999   -4.140  1.00 0.00 ? 186 SER A HG   3  
ATOM 8806  N N    . SER A 1 187 ? -22.448 -0.346  -1.061  1.00 0.00 ? 187 SER A N    3  
ATOM 8807  C CA   . SER A 1 187 ? -23.036 -1.672  -1.168  1.00 0.00 ? 187 SER A CA   3  
ATOM 8808  C C    . SER A 1 187 ? -23.748 -1.761  -2.521  1.00 0.00 ? 187 SER A C    3  
ATOM 8809  O O    . SER A 1 187 ? -23.122 -2.160  -3.501  1.00 0.00 ? 187 SER A O    3  
ATOM 8810  C CB   . SER A 1 187 ? -23.888 -1.969  0.082   1.00 0.00 ? 187 SER A CB   3  
ATOM 8811  O OG   . SER A 1 187 ? -24.233 -3.337  0.184   1.00 0.00 ? 187 SER A OG   3  
ATOM 8812  H H    . SER A 1 187 ? -21.444 -0.279  -1.023  1.00 0.00 ? 187 SER A H    3  
ATOM 8813  H HA   . SER A 1 187 ? -22.215 -2.388  -1.179  1.00 0.00 ? 187 SER A HA   3  
ATOM 8814  H HB2  . SER A 1 187 ? -23.313 -1.699  0.969   1.00 0.00 ? 187 SER A HB2  3  
ATOM 8815  H HB3  . SER A 1 187 ? -24.800 -1.375  0.071   1.00 0.00 ? 187 SER A HB3  3  
ATOM 8816  H HG   . SER A 1 187 ? -23.889 -3.636  1.062   1.00 0.00 ? 187 SER A HG   3  
ATOM 8817  N N    . ARG A 1 188 ? -25.005 -1.329  -2.624  1.00 0.00 ? 188 ARG A N    3  
ATOM 8818  C CA   . ARG A 1 188 ? -25.630 -1.017  -3.905  1.00 0.00 ? 188 ARG A CA   3  
ATOM 8819  C C    . ARG A 1 188 ? -25.132 0.317   -4.456  1.00 0.00 ? 188 ARG A C    3  
ATOM 8820  O O    . ARG A 1 188 ? -24.751 0.376   -5.624  1.00 0.00 ? 188 ARG A O    3  
ATOM 8821  C CB   . ARG A 1 188 ? -27.152 -0.969  -3.725  1.00 0.00 ? 188 ARG A CB   3  
ATOM 8822  C CG   . ARG A 1 188 ? -27.760 -2.373  -3.823  1.00 0.00 ? 188 ARG A CG   3  
ATOM 8823  C CD   . ARG A 1 188 ? -29.286 -2.324  -3.945  1.00 0.00 ? 188 ARG A CD   3  
ATOM 8824  N NE   . ARG A 1 188 ? -29.825 -3.671  -4.193  1.00 0.00 ? 188 ARG A NE   3  
ATOM 8825  C CZ   . ARG A 1 188 ? -30.978 -3.989  -4.792  1.00 0.00 ? 188 ARG A CZ   3  
ATOM 8826  N NH1  . ARG A 1 188 ? -31.811 -3.044  -5.226  1.00 0.00 ? 188 ARG A NH1  3  
ATOM 8827  N NH2  . ARG A 1 188 ? -31.275 -5.275  -4.956  1.00 0.00 ? 188 ARG A NH2  3  
ATOM 8828  H H    . ARG A 1 188 ? -25.418 -0.944  -1.784  1.00 0.00 ? 188 ARG A H    3  
ATOM 8829  H HA   . ARG A 1 188 ? -25.373 -1.786  -4.641  1.00 0.00 ? 188 ARG A HA   3  
ATOM 8830  H HB2  . ARG A 1 188 ? -27.422 -0.524  -2.766  1.00 0.00 ? 188 ARG A HB2  3  
ATOM 8831  H HB3  . ARG A 1 188 ? -27.566 -0.339  -4.509  1.00 0.00 ? 188 ARG A HB3  3  
ATOM 8832  H HG2  . ARG A 1 188 ? -27.366 -2.869  -4.710  1.00 0.00 ? 188 ARG A HG2  3  
ATOM 8833  H HG3  . ARG A 1 188 ? -27.484 -2.955  -2.943  1.00 0.00 ? 188 ARG A HG3  3  
ATOM 8834  H HD2  . ARG A 1 188 ? -29.721 -1.921  -3.029  1.00 0.00 ? 188 ARG A HD2  3  
ATOM 8835  H HD3  . ARG A 1 188 ? -29.553 -1.671  -4.776  1.00 0.00 ? 188 ARG A HD3  3  
ATOM 8836  H HE   . ARG A 1 188 ? -29.222 -4.442  -3.913  1.00 0.00 ? 188 ARG A HE   3  
ATOM 8837  H HH11 . ARG A 1 188 ? -31.504 -2.079  -5.201  1.00 0.00 ? 188 ARG A HH11 3  
ATOM 8838  H HH12 . ARG A 1 188 ? -32.679 -3.254  -5.695  1.00 0.00 ? 188 ARG A HH12 3  
ATOM 8839  H HH21 . ARG A 1 188 ? -30.571 -5.961  -4.686  1.00 0.00 ? 188 ARG A HH21 3  
ATOM 8840  H HH22 . ARG A 1 188 ? -32.101 -5.603  -5.436  1.00 0.00 ? 188 ARG A HH22 3  
ATOM 8841  N N    . LYS A 1 189 ? -25.046 1.353   -3.616  1.00 0.00 ? 189 LYS A N    3  
ATOM 8842  C CA   . LYS A 1 189 ? -25.827 2.577   -3.745  1.00 0.00 ? 189 LYS A CA   3  
ATOM 8843  C C    . LYS A 1 189 ? -26.292 2.816   -5.168  1.00 0.00 ? 189 LYS A C    3  
ATOM 8844  O O    . LYS A 1 189 ? -25.511 3.345   -5.988  1.00 0.00 ? 189 LYS A O    3  
ATOM 8845  C CB   . LYS A 1 189 ? -25.012 3.746   -3.155  1.00 0.00 ? 189 LYS A CB   3  
ATOM 8846  C CG   . LYS A 1 189 ? -25.741 4.735   -2.247  1.00 0.00 ? 189 LYS A CG   3  
ATOM 8847  C CD   . LYS A 1 189 ? -26.003 4.282   -0.806  1.00 0.00 ? 189 LYS A CD   3  
ATOM 8848  C CE   . LYS A 1 189 ? -26.868 3.020   -0.676  1.00 0.00 ? 189 LYS A CE   3  
ATOM 8849  N NZ   . LYS A 1 189 ? -27.542 2.963   0.634   1.00 0.00 ? 189 LYS A NZ   3  
ATOM 8850  H H    . LYS A 1 189 ? -25.027 1.098   -2.635  1.00 0.00 ? 189 LYS A H    3  
ATOM 8851  H HA   . LYS A 1 189 ? -26.729 2.446   -3.154  1.00 0.00 ? 189 LYS A HA   3  
ATOM 8852  H HB2  . LYS A 1 189 ? -24.195 3.355   -2.573  1.00 0.00 ? 189 LYS A HB2  3  
ATOM 8853  H HB3  . LYS A 1 189 ? -24.564 4.322   -3.963  1.00 0.00 ? 189 LYS A HB3  3  
ATOM 8854  H HG2  . LYS A 1 189 ? -25.075 5.592   -2.166  1.00 0.00 ? 189 LYS A HG2  3  
ATOM 8855  H HG3  . LYS A 1 189 ? -26.671 5.050   -2.714  1.00 0.00 ? 189 LYS A HG3  3  
ATOM 8856  H HD2  . LYS A 1 189 ? -25.047 4.115   -0.309  1.00 0.00 ? 189 LYS A HD2  3  
ATOM 8857  H HD3  . LYS A 1 189 ? -26.495 5.116   -0.301  1.00 0.00 ? 189 LYS A HD3  3  
ATOM 8858  H HE2  . LYS A 1 189 ? -27.633 3.012   -1.458  1.00 0.00 ? 189 LYS A HE2  3  
ATOM 8859  H HE3  . LYS A 1 189 ? -26.243 2.133   -0.808  1.00 0.00 ? 189 LYS A HE3  3  
ATOM 8860  H HZ1  . LYS A 1 189 ? -28.354 3.573   0.612   1.00 0.00 ? 189 LYS A HZ1  3  
ATOM 8861  H HZ2  . LYS A 1 189 ? -27.856 2.011   0.811   1.00 0.00 ? 189 LYS A HZ2  3  
ATOM 8862  H HZ3  . LYS A 1 189 ? -26.927 3.272   1.380   1.00 0.00 ? 189 LYS A HZ3  3  
ATOM 8863  N N    . ALA A 1 1   ? -19.356 -0.806  -6.913  1.00 0.00 ? 1   ALA A N    4  
ATOM 8864  C CA   . ALA A 1 1   ? -18.322 -0.444  -5.938  1.00 0.00 ? 1   ALA A CA   4  
ATOM 8865  C C    . ALA A 1 1   ? -17.592 -1.706  -5.518  1.00 0.00 ? 1   ALA A C    4  
ATOM 8866  O O    . ALA A 1 1   ? -18.214 -2.624  -4.986  1.00 0.00 ? 1   ALA A O    4  
ATOM 8867  C CB   . ALA A 1 1   ? -18.942 0.226   -4.720  1.00 0.00 ? 1   ALA A CB   4  
ATOM 8868  H H1   . ALA A 1 1   ? -19.019 -1.009  -7.832  1.00 0.00 ? 1   ALA A H1   4  
ATOM 8869  H HA   . ALA A 1 1   ? -17.623 0.255   -6.398  1.00 0.00 ? 1   ALA A HA   4  
ATOM 8870  H HB1  . ALA A 1 1   ? -18.165 0.472   -3.998  1.00 0.00 ? 1   ALA A HB1  4  
ATOM 8871  H HB2  . ALA A 1 1   ? -19.454 1.131   -5.034  1.00 0.00 ? 1   ALA A HB2  4  
ATOM 8872  H HB3  . ALA A 1 1   ? -19.661 -0.447  -4.266  1.00 0.00 ? 1   ALA A HB3  4  
ATOM 8873  N N    . ARG A 1 2   ? -16.291 -1.766  -5.788  1.00 0.00 ? 2   ARG A N    4  
ATOM 8874  C CA   . ARG A 1 2   ? -15.458 -2.941  -5.565  1.00 0.00 ? 2   ARG A CA   4  
ATOM 8875  C C    . ARG A 1 2   ? -14.239 -2.500  -4.766  1.00 0.00 ? 2   ARG A C    4  
ATOM 8876  O O    . ARG A 1 2   ? -14.362 -2.210  -3.580  1.00 0.00 ? 2   ARG A O    4  
ATOM 8877  C CB   . ARG A 1 2   ? -15.137 -3.647  -6.901  1.00 0.00 ? 2   ARG A CB   4  
ATOM 8878  C CG   . ARG A 1 2   ? -14.735 -2.697  -8.052  1.00 0.00 ? 2   ARG A CG   4  
ATOM 8879  C CD   . ARG A 1 2   ? -15.903 -2.410  -9.009  1.00 0.00 ? 2   ARG A CD   4  
ATOM 8880  N NE   . ARG A 1 2   ? -15.924 -1.003  -9.461  1.00 0.00 ? 2   ARG A NE   4  
ATOM 8881  C CZ   . ARG A 1 2   ? -17.026 -0.303  -9.758  1.00 0.00 ? 2   ARG A CZ   4  
ATOM 8882  N NH1  . ARG A 1 2   ? -18.203 -0.915  -9.781  1.00 0.00 ? 2   ARG A NH1  4  
ATOM 8883  N NH2  . ARG A 1 2   ? -16.985 1.000   -9.983  1.00 0.00 ? 2   ARG A NH2  4  
ATOM 8884  H H    . ARG A 1 2   ? -15.818 -0.917  -6.087  1.00 0.00 ? 2   ARG A H    4  
ATOM 8885  H HA   . ARG A 1 2   ? -15.996 -3.665  -4.950  1.00 0.00 ? 2   ARG A HA   4  
ATOM 8886  H HB2  . ARG A 1 2   ? -14.328 -4.359  -6.729  1.00 0.00 ? 2   ARG A HB2  4  
ATOM 8887  H HB3  . ARG A 1 2   ? -16.001 -4.240  -7.202  1.00 0.00 ? 2   ARG A HB3  4  
ATOM 8888  H HG2  . ARG A 1 2   ? -14.344 -1.758  -7.658  1.00 0.00 ? 2   ARG A HG2  4  
ATOM 8889  H HG3  . ARG A 1 2   ? -13.929 -3.164  -8.609  1.00 0.00 ? 2   ARG A HG3  4  
ATOM 8890  H HD2  . ARG A 1 2   ? -15.833 -3.077  -9.870  1.00 0.00 ? 2   ARG A HD2  4  
ATOM 8891  H HD3  . ARG A 1 2   ? -16.836 -2.632  -8.491  1.00 0.00 ? 2   ARG A HD3  4  
ATOM 8892  H HE   . ARG A 1 2   ? -15.004 -0.572  -9.585  1.00 0.00 ? 2   ARG A HE   4  
ATOM 8893  H HH11 . ARG A 1 2   ? -18.219 -1.914  -10.003 1.00 0.00 ? 2   ARG A HH11 4  
ATOM 8894  H HH12 . ARG A 1 2   ? -19.089 -0.429  -9.966  1.00 0.00 ? 2   ARG A HH12 4  
ATOM 8895  H HH21 . ARG A 1 2   ? -16.145 1.568   -9.844  1.00 0.00 ? 2   ARG A HH21 4  
ATOM 8896  H HH22 . ARG A 1 2   ? -17.810 1.501   -10.311 1.00 0.00 ? 2   ARG A HH22 4  
ATOM 8897  N N    . HIS A 1 3   ? -13.086 -2.405  -5.415  1.00 0.00 ? 3   HIS A N    4  
ATOM 8898  C CA   . HIS A 1 3   ? -11.810 -2.017  -4.848  1.00 0.00 ? 3   HIS A CA   4  
ATOM 8899  C C    . HIS A 1 3   ? -11.619 -0.511  -5.019  1.00 0.00 ? 3   HIS A C    4  
ATOM 8900  O O    . HIS A 1 3   ? -12.202 0.087   -5.934  1.00 0.00 ? 3   HIS A O    4  
ATOM 8901  C CB   . HIS A 1 3   ? -10.737 -2.774  -5.634  1.00 0.00 ? 3   HIS A CB   4  
ATOM 8902  C CG   . HIS A 1 3   ? -10.971 -4.264  -5.740  1.00 0.00 ? 3   HIS A CG   4  
ATOM 8903  N ND1  . HIS A 1 3   ? -11.223 -5.130  -4.698  1.00 0.00 ? 3   HIS A ND1  4  
ATOM 8904  C CD2  . HIS A 1 3   ? -11.063 -4.983  -6.903  1.00 0.00 ? 3   HIS A CD2  4  
ATOM 8905  C CE1  . HIS A 1 3   ? -11.429 -6.351  -5.222  1.00 0.00 ? 3   HIS A CE1  4  
ATOM 8906  N NE2  . HIS A 1 3   ? -11.347 -6.305  -6.559  1.00 0.00 ? 3   HIS A NE2  4  
ATOM 8907  H H    . HIS A 1 3   ? -13.085 -2.647  -6.392  1.00 0.00 ? 3   HIS A H    4  
ATOM 8908  H HA   . HIS A 1 3   ? -11.767 -2.284  -3.793  1.00 0.00 ? 3   HIS A HA   4  
ATOM 8909  H HB2  . HIS A 1 3   ? -10.745 -2.375  -6.648  1.00 0.00 ? 3   HIS A HB2  4  
ATOM 8910  H HB3  . HIS A 1 3   ? -9.760  -2.585  -5.186  1.00 0.00 ? 3   HIS A HB3  4  
ATOM 8911  H HD1  . HIS A 1 3   ? -11.336 -4.893  -3.727  1.00 0.00 ? 3   HIS A HD1  4  
ATOM 8912  H HD2  . HIS A 1 3   ? -10.972 -4.600  -7.911  1.00 0.00 ? 3   HIS A HD2  4  
ATOM 8913  H HE1  . HIS A 1 3   ? -11.660 -7.246  -4.660  1.00 0.00 ? 3   HIS A HE1  4  
ATOM 8914  N N    . VAL A 1 4   ? -10.743 0.097   -4.224  1.00 0.00 ? 4   VAL A N    4  
ATOM 8915  C CA   . VAL A 1 4   ? -10.369 1.503   -4.360  1.00 0.00 ? 4   VAL A CA   4  
ATOM 8916  C C    . VAL A 1 4   ? -8.853  1.597   -4.275  1.00 0.00 ? 4   VAL A C    4  
ATOM 8917  O O    . VAL A 1 4   ? -8.208  0.809   -3.587  1.00 0.00 ? 4   VAL A O    4  
ATOM 8918  C CB   . VAL A 1 4   ? -11.047 2.368   -3.276  1.00 0.00 ? 4   VAL A CB   4  
ATOM 8919  C CG1  . VAL A 1 4   ? -10.761 3.871   -3.473  1.00 0.00 ? 4   VAL A CG1  4  
ATOM 8920  C CG2  . VAL A 1 4   ? -12.573 2.194   -3.273  1.00 0.00 ? 4   VAL A CG2  4  
ATOM 8921  H H    . VAL A 1 4   ? -10.286 -0.425  -3.481  1.00 0.00 ? 4   VAL A H    4  
ATOM 8922  H HA   . VAL A 1 4   ? -10.680 1.869   -5.337  1.00 0.00 ? 4   VAL A HA   4  
ATOM 8923  H HB   . VAL A 1 4   ? -10.648 2.069   -2.305  1.00 0.00 ? 4   VAL A HB   4  
ATOM 8924  H HG11 . VAL A 1 4   ? -11.330 4.447   -2.747  1.00 0.00 ? 4   VAL A HG11 4  
ATOM 8925  H HG12 . VAL A 1 4   ? -9.706  4.092   -3.312  1.00 0.00 ? 4   VAL A HG12 4  
ATOM 8926  H HG13 . VAL A 1 4   ? -11.042 4.201   -4.475  1.00 0.00 ? 4   VAL A HG13 4  
ATOM 8927  H HG21 . VAL A 1 4   ? -12.976 2.498   -4.235  1.00 0.00 ? 4   VAL A HG21 4  
ATOM 8928  H HG22 . VAL A 1 4   ? -12.848 1.158   -3.077  1.00 0.00 ? 4   VAL A HG22 4  
ATOM 8929  H HG23 . VAL A 1 4   ? -13.004 2.799   -2.476  1.00 0.00 ? 4   VAL A HG23 4  
ATOM 8930  N N    . PHE A 1 5   ? -8.292  2.570   -4.980  1.00 0.00 ? 5   PHE A N    4  
ATOM 8931  C CA   . PHE A 1 5   ? -6.904  2.955   -4.934  1.00 0.00 ? 5   PHE A CA   4  
ATOM 8932  C C    . PHE A 1 5   ? -6.789  4.465   -5.091  1.00 0.00 ? 5   PHE A C    4  
ATOM 8933  O O    . PHE A 1 5   ? -7.667  5.119   -5.655  1.00 0.00 ? 5   PHE A O    4  
ATOM 8934  C CB   . PHE A 1 5   ? -6.129  2.230   -6.038  1.00 0.00 ? 5   PHE A CB   4  
ATOM 8935  C CG   . PHE A 1 5   ? -5.639  0.861   -5.620  1.00 0.00 ? 5   PHE A CG   4  
ATOM 8936  C CD1  . PHE A 1 5   ? -4.383  0.737   -5.001  1.00 0.00 ? 5   PHE A CD1  4  
ATOM 8937  C CD2  . PHE A 1 5   ? -6.431  -0.282  -5.832  1.00 0.00 ? 5   PHE A CD2  4  
ATOM 8938  C CE1  . PHE A 1 5   ? -3.901  -0.529  -4.636  1.00 0.00 ? 5   PHE A CE1  4  
ATOM 8939  C CE2  . PHE A 1 5   ? -5.958  -1.549  -5.450  1.00 0.00 ? 5   PHE A CE2  4  
ATOM 8940  C CZ   . PHE A 1 5   ? -4.674  -1.676  -4.889  1.00 0.00 ? 5   PHE A CZ   4  
ATOM 8941  H H    . PHE A 1 5   ? -8.872  3.169   -5.560  1.00 0.00 ? 5   PHE A H    4  
ATOM 8942  H HA   . PHE A 1 5   ? -6.516  2.681   -3.963  1.00 0.00 ? 5   PHE A HA   4  
ATOM 8943  H HB2  . PHE A 1 5   ? -6.750  2.144   -6.932  1.00 0.00 ? 5   PHE A HB2  4  
ATOM 8944  H HB3  . PHE A 1 5   ? -5.264  2.833   -6.299  1.00 0.00 ? 5   PHE A HB3  4  
ATOM 8945  H HD1  . PHE A 1 5   ? -3.771  1.609   -4.829  1.00 0.00 ? 5   PHE A HD1  4  
ATOM 8946  H HD2  . PHE A 1 5   ? -7.397  -0.192  -6.303  1.00 0.00 ? 5   PHE A HD2  4  
ATOM 8947  H HE1  . PHE A 1 5   ? -2.923  -0.611  -4.189  1.00 0.00 ? 5   PHE A HE1  4  
ATOM 8948  H HE2  . PHE A 1 5   ? -6.555  -2.428  -5.640  1.00 0.00 ? 5   PHE A HE2  4  
ATOM 8949  H HZ   . PHE A 1 5   ? -4.255  -2.658  -4.719  1.00 0.00 ? 5   PHE A HZ   4  
ATOM 8950  N N    . LEU A 1 6   ? -5.676  5.023   -4.633  1.00 0.00 ? 6   LEU A N    4  
ATOM 8951  C CA   . LEU A 1 6   ? -5.357  6.439   -4.738  1.00 0.00 ? 6   LEU A CA   4  
ATOM 8952  C C    . LEU A 1 6   ? -4.233  6.567   -5.748  1.00 0.00 ? 6   LEU A C    4  
ATOM 8953  O O    . LEU A 1 6   ? -3.247  5.838   -5.657  1.00 0.00 ? 6   LEU A O    4  
ATOM 8954  C CB   . LEU A 1 6   ? -4.904  6.966   -3.366  1.00 0.00 ? 6   LEU A CB   4  
ATOM 8955  C CG   . LEU A 1 6   ? -6.030  7.314   -2.385  1.00 0.00 ? 6   LEU A CG   4  
ATOM 8956  C CD1  . LEU A 1 6   ? -6.841  8.523   -2.857  1.00 0.00 ? 6   LEU A CD1  4  
ATOM 8957  C CD2  . LEU A 1 6   ? -6.970  6.141   -2.118  1.00 0.00 ? 6   LEU A CD2  4  
ATOM 8958  H H    . LEU A 1 6   ? -5.050  4.432   -4.099  1.00 0.00 ? 6   LEU A H    4  
ATOM 8959  H HA   . LEU A 1 6   ? -6.226  7.003   -5.082  1.00 0.00 ? 6   LEU A HA   4  
ATOM 8960  H HB2  . LEU A 1 6   ? -4.258  6.224   -2.903  1.00 0.00 ? 6   LEU A HB2  4  
ATOM 8961  H HB3  . LEU A 1 6   ? -4.300  7.859   -3.498  1.00 0.00 ? 6   LEU A HB3  4  
ATOM 8962  H HG   . LEU A 1 6   ? -5.553  7.576   -1.441  1.00 0.00 ? 6   LEU A HG   4  
ATOM 8963  H HD11 . LEU A 1 6   ? -6.479  8.904   -3.810  1.00 0.00 ? 6   LEU A HD11 4  
ATOM 8964  H HD12 . LEU A 1 6   ? -7.888  8.235   -2.966  1.00 0.00 ? 6   LEU A HD12 4  
ATOM 8965  H HD13 . LEU A 1 6   ? -6.768  9.304   -2.104  1.00 0.00 ? 6   LEU A HD13 4  
ATOM 8966  H HD21 . LEU A 1 6   ? -6.373  5.238   -2.006  1.00 0.00 ? 6   LEU A HD21 4  
ATOM 8967  H HD22 . LEU A 1 6   ? -7.533  6.330   -1.207  1.00 0.00 ? 6   LEU A HD22 4  
ATOM 8968  H HD23 . LEU A 1 6   ? -7.667  5.995   -2.942  1.00 0.00 ? 6   LEU A HD23 4  
ATOM 8969  N N    . THR A 1 7   ? -4.319  7.525   -6.664  1.00 0.00 ? 7   THR A N    4  
ATOM 8970  C CA   . THR A 1 7   ? -3.273  7.805   -7.634  1.00 0.00 ? 7   THR A CA   4  
ATOM 8971  C C    . THR A 1 7   ? -3.132  9.327   -7.768  1.00 0.00 ? 7   THR A C    4  
ATOM 8972  O O    . THR A 1 7   ? -3.712  10.069  -6.972  1.00 0.00 ? 7   THR A O    4  
ATOM 8973  C CB   . THR A 1 7   ? -3.504  6.968   -8.911  1.00 0.00 ? 7   THR A CB   4  
ATOM 8974  O OG1  . THR A 1 7   ? -2.236  6.653   -9.456  1.00 0.00 ? 7   THR A OG1  4  
ATOM 8975  C CG2  . THR A 1 7   ? -4.414  7.605   -9.968  1.00 0.00 ? 7   THR A CG2  4  
ATOM 8976  H H    . THR A 1 7   ? -5.071  8.211   -6.613  1.00 0.00 ? 7   THR A H    4  
ATOM 8977  H HA   . THR A 1 7   ? -2.337  7.463   -7.207  1.00 0.00 ? 7   THR A HA   4  
ATOM 8978  H HB   . THR A 1 7   ? -3.977  6.024   -8.632  1.00 0.00 ? 7   THR A HB   4  
ATOM 8979  H HG1  . THR A 1 7   ? -1.722  6.232   -8.736  1.00 0.00 ? 7   THR A HG1  4  
ATOM 8980  H HG21 . THR A 1 7   ? -5.384  7.835   -9.526  1.00 0.00 ? 7   THR A HG21 4  
ATOM 8981  H HG22 . THR A 1 7   ? -3.975  8.513   -10.377 1.00 0.00 ? 7   THR A HG22 4  
ATOM 8982  H HG23 . THR A 1 7   ? -4.562  6.896   -10.785 1.00 0.00 ? 7   THR A HG23 4  
ATOM 8983  N N    . GLY A 1 8   ? -2.336  9.817   -8.714  1.00 0.00 ? 8   GLY A N    4  
ATOM 8984  C CA   . GLY A 1 8   ? -2.053  11.240  -8.870  1.00 0.00 ? 8   GLY A CA   4  
ATOM 8985  C C    . GLY A 1 8   ? -0.687  11.604  -8.278  1.00 0.00 ? 8   GLY A C    4  
ATOM 8986  O O    . GLY A 1 8   ? 0.092   10.705  -7.939  1.00 0.00 ? 8   GLY A O    4  
ATOM 8987  H H    . GLY A 1 8   ? -1.847  9.171   -9.318  1.00 0.00 ? 8   GLY A H    4  
ATOM 8988  H HA2  . GLY A 1 8   ? -2.046  11.481  -9.933  1.00 0.00 ? 8   GLY A HA2  4  
ATOM 8989  H HA3  . GLY A 1 8   ? -2.832  11.831  -8.388  1.00 0.00 ? 8   GLY A HA3  4  
ATOM 8990  N N    . PRO A 1 9   ? -0.355  12.903  -8.205  1.00 0.00 ? 9   PRO A N    4  
ATOM 8991  C CA   . PRO A 1 9   ? 1.009   13.367  -7.976  1.00 0.00 ? 9   PRO A CA   4  
ATOM 8992  C C    . PRO A 1 9   ? 1.513   13.118  -6.541  1.00 0.00 ? 9   PRO A C    4  
ATOM 8993  O O    . PRO A 1 9   ? 0.714   12.926  -5.617  1.00 0.00 ? 9   PRO A O    4  
ATOM 8994  C CB   . PRO A 1 9   ? 0.970   14.865  -8.301  1.00 0.00 ? 9   PRO A CB   4  
ATOM 8995  C CG   . PRO A 1 9   ? -0.480  15.268  -8.036  1.00 0.00 ? 9   PRO A CG   4  
ATOM 8996  C CD   . PRO A 1 9   ? -1.254  14.023  -8.442  1.00 0.00 ? 9   PRO A CD   4  
ATOM 8997  H HA   . PRO A 1 9   ? 1.667   12.861  -8.684  1.00 0.00 ? 9   PRO A HA   4  
ATOM 8998  H HB2  . PRO A 1 9   ? 1.667   15.436  -7.690  1.00 0.00 ? 9   PRO A HB2  4  
ATOM 8999  H HB3  . PRO A 1 9   ? 1.196   15.012  -9.353  1.00 0.00 ? 9   PRO A HB3  4  
ATOM 9000  H HG2  . PRO A 1 9   ? -0.633  15.442  -6.973  1.00 0.00 ? 9   PRO A HG2  4  
ATOM 9001  H HG3  . PRO A 1 9   ? -0.776  16.139  -8.621  1.00 0.00 ? 9   PRO A HG3  4  
ATOM 9002  H HD2  . PRO A 1 9   ? -2.157  13.938  -7.843  1.00 0.00 ? 9   PRO A HD2  4  
ATOM 9003  H HD3  . PRO A 1 9   ? -1.519  14.078  -9.494  1.00 0.00 ? 9   PRO A HD3  4  
ATOM 9004  N N    . PRO A 1 10  ? 2.841   13.187  -6.315  1.00 0.00 ? 10  PRO A N    4  
ATOM 9005  C CA   . PRO A 1 10  ? 3.473   13.042  -5.005  1.00 0.00 ? 10  PRO A CA   4  
ATOM 9006  C C    . PRO A 1 10  ? 3.343   14.315  -4.170  1.00 0.00 ? 10  PRO A C    4  
ATOM 9007  O O    . PRO A 1 10  ? 4.315   15.025  -3.916  1.00 0.00 ? 10  PRO A O    4  
ATOM 9008  C CB   . PRO A 1 10  ? 4.933   12.683  -5.306  1.00 0.00 ? 10  PRO A CB   4  
ATOM 9009  C CG   . PRO A 1 10  ? 5.190   13.478  -6.578  1.00 0.00 ? 10  PRO A CG   4  
ATOM 9010  C CD   . PRO A 1 10  ? 3.876   13.309  -7.338  1.00 0.00 ? 10  PRO A CD   4  
ATOM 9011  H HA   . PRO A 1 10  ? 3.005   12.241  -4.444  1.00 0.00 ? 10  PRO A HA   4  
ATOM 9012  H HB2  . PRO A 1 10  ? 5.619   12.958  -4.507  1.00 0.00 ? 10  PRO A HB2  4  
ATOM 9013  H HB3  . PRO A 1 10  ? 5.020   11.619  -5.517  1.00 0.00 ? 10  PRO A HB3  4  
ATOM 9014  H HG2  . PRO A 1 10  ? 5.337   14.527  -6.335  1.00 0.00 ? 10  PRO A HG2  4  
ATOM 9015  H HG3  . PRO A 1 10  ? 6.051   13.099  -7.120  1.00 0.00 ? 10  PRO A HG3  4  
ATOM 9016  H HD2  . PRO A 1 10  ? 3.708   14.166  -7.990  1.00 0.00 ? 10  PRO A HD2  4  
ATOM 9017  H HD3  . PRO A 1 10  ? 3.910   12.392  -7.927  1.00 0.00 ? 10  PRO A HD3  4  
ATOM 9018  N N    . GLY A 1 11  ? 2.140   14.600  -3.686  1.00 0.00 ? 11  GLY A N    4  
ATOM 9019  C CA   . GLY A 1 11  ? 1.859   15.701  -2.776  1.00 0.00 ? 11  GLY A CA   4  
ATOM 9020  C C    . GLY A 1 11  ? 1.912   15.277  -1.315  1.00 0.00 ? 11  GLY A C    4  
ATOM 9021  O O    . GLY A 1 11  ? 1.269   15.915  -0.492  1.00 0.00 ? 11  GLY A O    4  
ATOM 9022  H H    . GLY A 1 11  ? 1.349   13.999  -3.904  1.00 0.00 ? 11  GLY A H    4  
ATOM 9023  H HA2  . GLY A 1 11  ? 2.602   16.479  -2.933  1.00 0.00 ? 11  GLY A HA2  4  
ATOM 9024  H HA3  . GLY A 1 11  ? 0.870   16.109  -2.977  1.00 0.00 ? 11  GLY A HA3  4  
ATOM 9025  N N    . VAL A 1 12  ? 2.664   14.214  -1.002  1.00 0.00 ? 12  VAL A N    4  
ATOM 9026  C CA   . VAL A 1 12  ? 3.171   13.818  0.297   1.00 0.00 ? 12  VAL A CA   4  
ATOM 9027  C C    . VAL A 1 12  ? 2.192   13.940  1.477   1.00 0.00 ? 12  VAL A C    4  
ATOM 9028  O O    . VAL A 1 12  ? 2.590   14.240  2.608   1.00 0.00 ? 12  VAL A O    4  
ATOM 9029  C CB   . VAL A 1 12  ? 4.520   14.526  0.470   1.00 0.00 ? 12  VAL A CB   4  
ATOM 9030  C CG1  . VAL A 1 12  ? 5.547   14.080  -0.584  1.00 0.00 ? 12  VAL A CG1  4  
ATOM 9031  C CG2  . VAL A 1 12  ? 4.421   16.059  0.491   1.00 0.00 ? 12  VAL A CG2  4  
ATOM 9032  H H    . VAL A 1 12  ? 3.313   13.897  -1.693  1.00 0.00 ? 12  VAL A H    4  
ATOM 9033  H HA   . VAL A 1 12  ? 3.389   12.751  0.236   1.00 0.00 ? 12  VAL A HA   4  
ATOM 9034  H HB   . VAL A 1 12  ? 4.898   14.186  1.409   1.00 0.00 ? 12  VAL A HB   4  
ATOM 9035  H HG11 . VAL A 1 12  ? 5.292   14.458  -1.573  1.00 0.00 ? 12  VAL A HG11 4  
ATOM 9036  H HG12 . VAL A 1 12  ? 6.529   14.465  -0.308  1.00 0.00 ? 12  VAL A HG12 4  
ATOM 9037  H HG13 . VAL A 1 12  ? 5.602   12.991  -0.596  1.00 0.00 ? 12  VAL A HG13 4  
ATOM 9038  H HG21 . VAL A 1 12  ? 4.249   16.453  -0.511  1.00 0.00 ? 12  VAL A HG21 4  
ATOM 9039  H HG22 . VAL A 1 12  ? 3.596   16.365  1.139   1.00 0.00 ? 12  VAL A HG22 4  
ATOM 9040  H HG23 . VAL A 1 12  ? 5.358   16.465  0.867   1.00 0.00 ? 12  VAL A HG23 4  
ATOM 9041  N N    . GLY A 1 13  ? 0.912   13.682  1.215   1.00 0.00 ? 13  GLY A N    4  
ATOM 9042  C CA   . GLY A 1 13  ? -0.172  13.715  2.184   1.00 0.00 ? 13  GLY A CA   4  
ATOM 9043  C C    . GLY A 1 13  ? -1.163  12.573  1.979   1.00 0.00 ? 13  GLY A C    4  
ATOM 9044  O O    . GLY A 1 13  ? -2.243  12.577  2.564   1.00 0.00 ? 13  GLY A O    4  
ATOM 9045  H H    . GLY A 1 13  ? 0.661   13.550  0.248   1.00 0.00 ? 13  GLY A H    4  
ATOM 9046  H HA2  . GLY A 1 13  ? 0.221   13.631  3.188   1.00 0.00 ? 13  GLY A HA2  4  
ATOM 9047  H HA3  . GLY A 1 13  ? -0.673  14.677  2.089   1.00 0.00 ? 13  GLY A HA3  4  
ATOM 9048  N N    . LYS A 1 14  ? -0.827  11.609  1.120   1.00 0.00 ? 14  LYS A N    4  
ATOM 9049  C CA   . LYS A 1 14  ? -1.732  10.579  0.622   1.00 0.00 ? 14  LYS A CA   4  
ATOM 9050  C C    . LYS A 1 14  ? -1.974  9.536   1.700   1.00 0.00 ? 14  LYS A C    4  
ATOM 9051  O O    . LYS A 1 14  ? -3.134  9.269   2.017   1.00 0.00 ? 14  LYS A O    4  
ATOM 9052  C CB   . LYS A 1 14  ? -1.131  9.945   -0.637  1.00 0.00 ? 14  LYS A CB   4  
ATOM 9053  C CG   . LYS A 1 14  ? -1.003  10.964  -1.775  1.00 0.00 ? 14  LYS A CG   4  
ATOM 9054  C CD   . LYS A 1 14  ? -0.173  10.415  -2.934  1.00 0.00 ? 14  LYS A CD   4  
ATOM 9055  C CE   . LYS A 1 14  ? 1.344   10.501  -2.689  1.00 0.00 ? 14  LYS A CE   4  
ATOM 9056  N NZ   . LYS A 1 14  ? 1.992   9.207   -2.375  1.00 0.00 ? 14  LYS A NZ   4  
ATOM 9057  H H    . LYS A 1 14  ? 0.138   11.565  0.810   1.00 0.00 ? 14  LYS A H    4  
ATOM 9058  H HA   . LYS A 1 14  ? -2.694  11.024  0.366   1.00 0.00 ? 14  LYS A HA   4  
ATOM 9059  H HB2  . LYS A 1 14  ? -0.149  9.537   -0.401  1.00 0.00 ? 14  LYS A HB2  4  
ATOM 9060  H HB3  . LYS A 1 14  ? -1.778  9.133   -0.974  1.00 0.00 ? 14  LYS A HB3  4  
ATOM 9061  H HG2  . LYS A 1 14  ? -2.002  11.211  -2.135  1.00 0.00 ? 14  LYS A HG2  4  
ATOM 9062  H HG3  . LYS A 1 14  ? -0.540  11.883  -1.425  1.00 0.00 ? 14  LYS A HG3  4  
ATOM 9063  H HD2  . LYS A 1 14  ? -0.491  9.397   -3.133  1.00 0.00 ? 14  LYS A HD2  4  
ATOM 9064  H HD3  . LYS A 1 14  ? -0.400  11.012  -3.818  1.00 0.00 ? 14  LYS A HD3  4  
ATOM 9065  H HE2  . LYS A 1 14  ? 1.794   10.873  -3.611  1.00 0.00 ? 14  LYS A HE2  4  
ATOM 9066  H HE3  . LYS A 1 14  ? 1.542   11.218  -1.888  1.00 0.00 ? 14  LYS A HE3  4  
ATOM 9067  H HZ1  . LYS A 1 14  ? 1.678   8.809   -1.492  1.00 0.00 ? 14  LYS A HZ1  4  
ATOM 9068  H HZ2  . LYS A 1 14  ? 1.840   8.540   -3.121  1.00 0.00 ? 14  LYS A HZ2  4  
ATOM 9069  H HZ3  . LYS A 1 14  ? 2.997   9.341   -2.306  1.00 0.00 ? 14  LYS A HZ3  4  
ATOM 9070  N N    . THR A 1 15  ? -0.903  9.021   2.308   1.00 0.00 ? 15  THR A N    4  
ATOM 9071  C CA   . THR A 1 15  ? -0.984  8.018   3.361   1.00 0.00 ? 15  THR A CA   4  
ATOM 9072  C C    . THR A 1 15  ? -1.833  8.552   4.519   1.00 0.00 ? 15  THR A C    4  
ATOM 9073  O O    . THR A 1 15  ? -2.610  7.807   5.101   1.00 0.00 ? 15  THR A O    4  
ATOM 9074  C CB   . THR A 1 15  ? 0.450   7.619   3.765   1.00 0.00 ? 15  THR A CB   4  
ATOM 9075  O OG1  . THR A 1 15  ? 1.113   7.128   2.614   1.00 0.00 ? 15  THR A OG1  4  
ATOM 9076  C CG2  . THR A 1 15  ? 0.542   6.552   4.859   1.00 0.00 ? 15  THR A CG2  4  
ATOM 9077  H H    . THR A 1 15  ? 0.023   9.226   1.961   1.00 0.00 ? 15  THR A H    4  
ATOM 9078  H HA   . THR A 1 15  ? -1.491  7.144   2.948   1.00 0.00 ? 15  THR A HA   4  
ATOM 9079  H HB   . THR A 1 15  ? 0.974   8.510   4.113   1.00 0.00 ? 15  THR A HB   4  
ATOM 9080  H HG1  . THR A 1 15  ? 0.674   6.263   2.421   1.00 0.00 ? 15  THR A HG1  4  
ATOM 9081  H HG21 . THR A 1 15  ? 1.587   6.281   5.026   1.00 0.00 ? 15  THR A HG21 4  
ATOM 9082  H HG22 . THR A 1 15  ? 0.135   6.939   5.791   1.00 0.00 ? 15  THR A HG22 4  
ATOM 9083  H HG23 . THR A 1 15  ? -0.015  5.658   4.570   1.00 0.00 ? 15  THR A HG23 4  
ATOM 9084  N N    . THR A 1 16  ? -1.766  9.852   4.815   1.00 0.00 ? 16  THR A N    4  
ATOM 9085  C CA   . THR A 1 16  ? -2.600  10.494  5.821   1.00 0.00 ? 16  THR A CA   4  
ATOM 9086  C C    . THR A 1 16  ? -4.097  10.444  5.463   1.00 0.00 ? 16  THR A C    4  
ATOM 9087  O O    . THR A 1 16  ? -4.920  10.253  6.358   1.00 0.00 ? 16  THR A O    4  
ATOM 9088  C CB   . THR A 1 16  ? -2.083  11.926  6.010   1.00 0.00 ? 16  THR A CB   4  
ATOM 9089  O OG1  . THR A 1 16  ? -0.699  11.882  6.327   1.00 0.00 ? 16  THR A OG1  4  
ATOM 9090  C CG2  . THR A 1 16  ? -2.843  12.693  7.092   1.00 0.00 ? 16  THR A CG2  4  
ATOM 9091  H H    . THR A 1 16  ? -1.095  10.444  4.352   1.00 0.00 ? 16  THR A H    4  
ATOM 9092  H HA   . THR A 1 16  ? -2.466  9.965   6.764   1.00 0.00 ? 16  THR A HA   4  
ATOM 9093  H HB   . THR A 1 16  ? -2.196  12.467  5.074   1.00 0.00 ? 16  THR A HB   4  
ATOM 9094  H HG1  . THR A 1 16  ? -0.407  12.793  6.464   1.00 0.00 ? 16  THR A HG1  4  
ATOM 9095  H HG21 . THR A 1 16  ? -3.877  12.859  6.784   1.00 0.00 ? 16  THR A HG21 4  
ATOM 9096  H HG22 . THR A 1 16  ? -2.846  12.120  8.018   1.00 0.00 ? 16  THR A HG22 4  
ATOM 9097  H HG23 . THR A 1 16  ? -2.372  13.661  7.259   1.00 0.00 ? 16  THR A HG23 4  
ATOM 9098  N N    . LEU A 1 17  ? -4.486  10.612  4.190   1.00 0.00 ? 17  LEU A N    4  
ATOM 9099  C CA   . LEU A 1 17  ? -5.899  10.536  3.810   1.00 0.00 ? 17  LEU A CA   4  
ATOM 9100  C C    . LEU A 1 17  ? -6.367  9.095   3.966   1.00 0.00 ? 17  LEU A C    4  
ATOM 9101  O O    . LEU A 1 17  ? -7.377  8.861   4.615   1.00 0.00 ? 17  LEU A O    4  
ATOM 9102  C CB   . LEU A 1 17  ? -6.181  11.049  2.380   1.00 0.00 ? 17  LEU A CB   4  
ATOM 9103  C CG   . LEU A 1 17  ? -6.097  12.576  2.130   1.00 0.00 ? 17  LEU A CG   4  
ATOM 9104  C CD1  . LEU A 1 17  ? -5.566  13.447  3.280   1.00 0.00 ? 17  LEU A CD1  4  
ATOM 9105  C CD2  . LEU A 1 17  ? -5.253  12.846  0.877   1.00 0.00 ? 17  LEU A CD2  4  
ATOM 9106  H H    . LEU A 1 17  ? -3.805  10.707  3.449   1.00 0.00 ? 17  LEU A H    4  
ATOM 9107  H HA   . LEU A 1 17  ? -6.484  11.134  4.511   1.00 0.00 ? 17  LEU A HA   4  
ATOM 9108  H HB2  . LEU A 1 17  ? -5.569  10.509  1.655   1.00 0.00 ? 17  LEU A HB2  4  
ATOM 9109  H HB3  . LEU A 1 17  ? -7.207  10.758  2.144   1.00 0.00 ? 17  LEU A HB3  4  
ATOM 9110  H HG   . LEU A 1 17  ? -7.108  12.923  1.923   1.00 0.00 ? 17  LEU A HG   4  
ATOM 9111  H HD11 . LEU A 1 17  ? -6.200  13.327  4.160   1.00 0.00 ? 17  LEU A HD11 4  
ATOM 9112  H HD12 . LEU A 1 17  ? -4.543  13.173  3.530   1.00 0.00 ? 17  LEU A HD12 4  
ATOM 9113  H HD13 . LEU A 1 17  ? -5.595  14.497  2.996   1.00 0.00 ? 17  LEU A HD13 4  
ATOM 9114  H HD21 . LEU A 1 17  ? -5.728  12.381  0.011   1.00 0.00 ? 17  LEU A HD21 4  
ATOM 9115  H HD22 . LEU A 1 17  ? -5.168  13.915  0.699   1.00 0.00 ? 17  LEU A HD22 4  
ATOM 9116  H HD23 . LEU A 1 17  ? -4.257  12.431  1.008   1.00 0.00 ? 17  LEU A HD23 4  
ATOM 9117  N N    . ILE A 1 18  ? -5.632  8.123   3.422   1.00 0.00 ? 18  ILE A N    4  
ATOM 9118  C CA   . ILE A 1 18  ? -5.969  6.711   3.578   1.00 0.00 ? 18  ILE A CA   4  
ATOM 9119  C C    . ILE A 1 18  ? -6.021  6.318   5.058   1.00 0.00 ? 18  ILE A C    4  
ATOM 9120  O O    . ILE A 1 18  ? -6.937  5.600   5.448   1.00 0.00 ? 18  ILE A O    4  
ATOM 9121  C CB   . ILE A 1 18  ? -4.912  5.862   2.815   1.00 0.00 ? 18  ILE A CB   4  
ATOM 9122  C CG1  . ILE A 1 18  ? -5.220  5.774   1.310   1.00 0.00 ? 18  ILE A CG1  4  
ATOM 9123  C CG2  . ILE A 1 18  ? -4.656  4.454   3.395   1.00 0.00 ? 18  ILE A CG2  4  
ATOM 9124  C CD1  . ILE A 1 18  ? -6.465  4.952   0.980   1.00 0.00 ? 18  ILE A CD1  4  
ATOM 9125  H H    . ILE A 1 18  ? -4.807  8.359   2.882   1.00 0.00 ? 18  ILE A H    4  
ATOM 9126  H HA   . ILE A 1 18  ? -6.997  6.601   3.180   1.00 0.00 ? 18  ILE A HA   4  
ATOM 9127  H HB   . ILE A 1 18  ? -3.953  6.378   2.897   1.00 0.00 ? 18  ILE A HB   4  
ATOM 9128  H HG12 . ILE A 1 18  ? -5.331  6.774   0.894   1.00 0.00 ? 18  ILE A HG12 4  
ATOM 9129  H HG13 . ILE A 1 18  ? -4.370  5.318   0.808   1.00 0.00 ? 18  ILE A HG13 4  
ATOM 9130  H HG21 . ILE A 1 18  ? -4.080  4.530   4.318   1.00 0.00 ? 18  ILE A HG21 4  
ATOM 9131  H HG22 . ILE A 1 18  ? -5.593  3.939   3.610   1.00 0.00 ? 18  ILE A HG22 4  
ATOM 9132  H HG23 . ILE A 1 18  ? -4.078  3.858   2.687   1.00 0.00 ? 18  ILE A HG23 4  
ATOM 9133  H HD11 . ILE A 1 18  ? -6.538  4.085   1.625   1.00 0.00 ? 18  ILE A HD11 4  
ATOM 9134  H HD12 . ILE A 1 18  ? -7.358  5.571   1.073   1.00 0.00 ? 18  ILE A HD12 4  
ATOM 9135  H HD13 . ILE A 1 18  ? -6.373  4.572   -0.031  1.00 0.00 ? 18  ILE A HD13 4  
ATOM 9136  N N    . HIS A 1 19  ? -5.095  6.796   5.895   1.00 0.00 ? 19  HIS A N    4  
ATOM 9137  C CA   . HIS A 1 19  ? -5.101  6.539   7.332   1.00 0.00 ? 19  HIS A CA   4  
ATOM 9138  C C    . HIS A 1 19  ? -6.476  6.852   7.914   1.00 0.00 ? 19  HIS A C    4  
ATOM 9139  O O    . HIS A 1 19  ? -7.012  6.076   8.717   1.00 0.00 ? 19  HIS A O    4  
ATOM 9140  C CB   . HIS A 1 19  ? -4.052  7.402   8.051   1.00 0.00 ? 19  HIS A CB   4  
ATOM 9141  C CG   . HIS A 1 19  ? -2.786  6.704   8.464   1.00 0.00 ? 19  HIS A CG   4  
ATOM 9142  N ND1  . HIS A 1 19  ? -2.673  5.744   9.447   1.00 0.00 ? 19  HIS A ND1  4  
ATOM 9143  C CD2  . HIS A 1 19  ? -1.524  7.107   8.127   1.00 0.00 ? 19  HIS A CD2  4  
ATOM 9144  C CE1  . HIS A 1 19  ? -1.366  5.558   9.690   1.00 0.00 ? 19  HIS A CE1  4  
ATOM 9145  N NE2  . HIS A 1 19  ? -0.630  6.400   8.940   1.00 0.00 ? 19  HIS A NE2  4  
ATOM 9146  H H    . HIS A 1 19  ? -4.313  7.317   5.512   1.00 0.00 ? 19  HIS A H    4  
ATOM 9147  H HA   . HIS A 1 19  ? -4.882  5.487   7.490   1.00 0.00 ? 19  HIS A HA   4  
ATOM 9148  H HB2  . HIS A 1 19  ? -3.795  8.259   7.437   1.00 0.00 ? 19  HIS A HB2  4  
ATOM 9149  H HB3  . HIS A 1 19  ? -4.490  7.809   8.962   1.00 0.00 ? 19  HIS A HB3  4  
ATOM 9150  H HD1  . HIS A 1 19  ? -3.438  5.252   9.909   1.00 0.00 ? 19  HIS A HD1  4  
ATOM 9151  H HD2  . HIS A 1 19  ? -1.276  7.905   7.442   1.00 0.00 ? 19  HIS A HD2  4  
ATOM 9152  H HE1  . HIS A 1 19  ? -0.974  4.874   10.433  1.00 0.00 ? 19  HIS A HE1  4  
ATOM 9153  N N    . LYS A 1 20  ? -7.034  8.000   7.529   1.00 0.00 ? 20  LYS A N    4  
ATOM 9154  C CA   . LYS A 1 20  ? -8.324  8.459   8.012   1.00 0.00 ? 20  LYS A CA   4  
ATOM 9155  C C    . LYS A 1 20  ? -9.475  7.617   7.471   1.00 0.00 ? 20  LYS A C    4  
ATOM 9156  O O    . LYS A 1 20  ? -10.542 7.604   8.076   1.00 0.00 ? 20  LYS A O    4  
ATOM 9157  C CB   . LYS A 1 20  ? -8.500  9.938   7.701   1.00 0.00 ? 20  LYS A CB   4  
ATOM 9158  C CG   . LYS A 1 20  ? -7.644  10.720  8.704   1.00 0.00 ? 20  LYS A CG   4  
ATOM 9159  C CD   . LYS A 1 20  ? -7.313  12.088  8.135   1.00 0.00 ? 20  LYS A CD   4  
ATOM 9160  C CE   . LYS A 1 20  ? -6.441  12.861  9.124   1.00 0.00 ? 20  LYS A CE   4  
ATOM 9161  N NZ   . LYS A 1 20  ? -7.173  13.224  10.353  1.00 0.00 ? 20  LYS A NZ   4  
ATOM 9162  H H    . LYS A 1 20  ? -6.549  8.577   6.849   1.00 0.00 ? 20  LYS A H    4  
ATOM 9163  H HA   . LYS A 1 20  ? -8.313  8.398   9.091   1.00 0.00 ? 20  LYS A HA   4  
ATOM 9164  H HB2  . LYS A 1 20  ? -8.196  10.143  6.674   1.00 0.00 ? 20  LYS A HB2  4  
ATOM 9165  H HB3  . LYS A 1 20  ? -9.544  10.227  7.834   1.00 0.00 ? 20  LYS A HB3  4  
ATOM 9166  H HG2  . LYS A 1 20  ? -8.191  10.812  9.641   1.00 0.00 ? 20  LYS A HG2  4  
ATOM 9167  H HG3  . LYS A 1 20  ? -6.700  10.205  8.898   1.00 0.00 ? 20  LYS A HG3  4  
ATOM 9168  H HD2  . LYS A 1 20  ? -6.760  11.911  7.217   1.00 0.00 ? 20  LYS A HD2  4  
ATOM 9169  H HD3  . LYS A 1 20  ? -8.223  12.633  7.906   1.00 0.00 ? 20  LYS A HD3  4  
ATOM 9170  H HE2  . LYS A 1 20  ? -5.597  12.226  9.382   1.00 0.00 ? 20  LYS A HE2  4  
ATOM 9171  H HE3  . LYS A 1 20  ? -6.059  13.766  8.653   1.00 0.00 ? 20  LYS A HE3  4  
ATOM 9172  H HZ1  . LYS A 1 20  ? -7.656  14.112  10.245  1.00 0.00 ? 20  LYS A HZ1  4  
ATOM 9173  H HZ2  . LYS A 1 20  ? -7.862  12.523  10.608  1.00 0.00 ? 20  LYS A HZ2  4  
ATOM 9174  H HZ3  . LYS A 1 20  ? -6.552  13.289  11.158  1.00 0.00 ? 20  LYS A HZ3  4  
ATOM 9175  N N    . ALA A 1 21  ? -9.287  6.881   6.375   1.00 0.00 ? 21  ALA A N    4  
ATOM 9176  C CA   . ALA A 1 21  ? -10.324 5.995   5.876   1.00 0.00 ? 21  ALA A CA   4  
ATOM 9177  C C    . ALA A 1 21  ? -10.521 4.813   6.820   1.00 0.00 ? 21  ALA A C    4  
ATOM 9178  O O    . ALA A 1 21  ? -11.634 4.305   6.938   1.00 0.00 ? 21  ALA A O    4  
ATOM 9179  C CB   . ALA A 1 21  ? -9.982  5.494   4.477   1.00 0.00 ? 21  ALA A CB   4  
ATOM 9180  H H    . ALA A 1 21  ? -8.392  6.878   5.903   1.00 0.00 ? 21  ALA A H    4  
ATOM 9181  H HA   . ALA A 1 21  ? -11.250 6.555   5.805   1.00 0.00 ? 21  ALA A HA   4  
ATOM 9182  H HB1  . ALA A 1 21  ? -9.763  6.336   3.823   1.00 0.00 ? 21  ALA A HB1  4  
ATOM 9183  H HB2  . ALA A 1 21  ? -9.136  4.814   4.531   1.00 0.00 ? 21  ALA A HB2  4  
ATOM 9184  H HB3  . ALA A 1 21  ? -10.840 4.947   4.090   1.00 0.00 ? 21  ALA A HB3  4  
ATOM 9185  N N    . SER A 1 22  ? -9.450  4.367   7.476   1.00 0.00 ? 22  SER A N    4  
ATOM 9186  C CA   . SER A 1 22  ? -9.463  3.136   8.242   1.00 0.00 ? 22  SER A CA   4  
ATOM 9187  C C    . SER A 1 22  ? -10.073 3.386   9.609   1.00 0.00 ? 22  SER A C    4  
ATOM 9188  O O    . SER A 1 22  ? -10.891 2.593   10.057  1.00 0.00 ? 22  SER A O    4  
ATOM 9189  C CB   . SER A 1 22  ? -8.044  2.593   8.373   1.00 0.00 ? 22  SER A CB   4  
ATOM 9190  O OG   . SER A 1 22  ? -7.416  2.520   7.105   1.00 0.00 ? 22  SER A OG   4  
ATOM 9191  H H    . SER A 1 22  ? -8.573  4.865   7.408   1.00 0.00 ? 22  SER A H    4  
ATOM 9192  H HA   . SER A 1 22  ? -10.071 2.396   7.719   1.00 0.00 ? 22  SER A HA   4  
ATOM 9193  H HB2  . SER A 1 22  ? -7.463  3.245   9.023   1.00 0.00 ? 22  SER A HB2  4  
ATOM 9194  H HB3  . SER A 1 22  ? -8.084  1.598   8.817   1.00 0.00 ? 22  SER A HB3  4  
ATOM 9195  H HG   . SER A 1 22  ? -6.580  2.029   7.247   1.00 0.00 ? 22  SER A HG   4  
ATOM 9196  N N    . GLU A 1 23  ? -9.713  4.497   10.256  1.00 0.00 ? 23  GLU A N    4  
ATOM 9197  C CA   . GLU A 1 23  ? -10.275 4.886   11.546  1.00 0.00 ? 23  GLU A CA   4  
ATOM 9198  C C    . GLU A 1 23  ? -11.802 4.956   11.486  1.00 0.00 ? 23  GLU A C    4  
ATOM 9199  O O    . GLU A 1 23  ? -12.479 4.469   12.386  1.00 0.00 ? 23  GLU A O    4  
ATOM 9200  C CB   . GLU A 1 23  ? -9.594  6.158   12.052  1.00 0.00 ? 23  GLU A CB   4  
ATOM 9201  C CG   . GLU A 1 23  ? -9.904  7.371   11.199  1.00 0.00 ? 23  GLU A CG   4  
ATOM 9202  C CD   . GLU A 1 23  ? -9.279  8.682   11.690  1.00 0.00 ? 23  GLU A CD   4  
ATOM 9203  O OE1  . GLU A 1 23  ? -8.036  8.786   11.603  1.00 0.00 ? 23  GLU A OE1  4  
ATOM 9204  O OE2  . GLU A 1 23  ? -10.012 9.628   12.058  1.00 0.00 ? 23  GLU A OE2  4  
ATOM 9205  H H    . GLU A 1 23  ? -9.061  5.134   9.821   1.00 0.00 ? 23  GLU A H    4  
ATOM 9206  H HA   . GLU A 1 23  ? -10.035 4.136   12.277  1.00 0.00 ? 23  GLU A HA   4  
ATOM 9207  H HB2  . GLU A 1 23  ? -9.927  6.342   13.063  1.00 0.00 ? 23  GLU A HB2  4  
ATOM 9208  H HB3  . GLU A 1 23  ? -8.524  5.990   12.024  1.00 0.00 ? 23  GLU A HB3  4  
ATOM 9209  H HG2  . GLU A 1 23  ? -9.520  7.151   10.213  1.00 0.00 ? 23  GLU A HG2  4  
ATOM 9210  H HG3  . GLU A 1 23  ? -10.978 7.447   11.148  1.00 0.00 ? 23  GLU A HG3  4  
ATOM 9211  N N    . VAL A 1 24  ? -12.334 5.460   10.375  1.00 0.00 ? 24  VAL A N    4  
ATOM 9212  C CA   . VAL A 1 24  ? -13.775 5.577   10.127  1.00 0.00 ? 24  VAL A CA   4  
ATOM 9213  C C    . VAL A 1 24  ? -14.426 4.201   10.138  1.00 0.00 ? 24  VAL A C    4  
ATOM 9214  O O    . VAL A 1 24  ? -15.398 3.980   10.862  1.00 0.00 ? 24  VAL A O    4  
ATOM 9215  C CB   . VAL A 1 24  ? -13.971 6.305   8.786   1.00 0.00 ? 24  VAL A CB   4  
ATOM 9216  C CG1  . VAL A 1 24  ? -15.389 6.255   8.197   1.00 0.00 ? 24  VAL A CG1  4  
ATOM 9217  C CG2  . VAL A 1 24  ? -13.579 7.774   8.966   1.00 0.00 ? 24  VAL A CG2  4  
ATOM 9218  H H    . VAL A 1 24  ? -11.661 5.847   9.715   1.00 0.00 ? 24  VAL A H    4  
ATOM 9219  H HA   . VAL A 1 24  ? -14.234 6.145   10.937  1.00 0.00 ? 24  VAL A HA   4  
ATOM 9220  H HB   . VAL A 1 24  ? -13.297 5.836   8.071   1.00 0.00 ? 24  VAL A HB   4  
ATOM 9221  H HG11 . VAL A 1 24  ? -15.690 5.225   8.003   1.00 0.00 ? 24  VAL A HG11 4  
ATOM 9222  H HG12 . VAL A 1 24  ? -16.103 6.712   8.882   1.00 0.00 ? 24  VAL A HG12 4  
ATOM 9223  H HG13 . VAL A 1 24  ? -15.410 6.794   7.251   1.00 0.00 ? 24  VAL A HG13 4  
ATOM 9224  H HG21 . VAL A 1 24  ? -14.316 8.272   9.595   1.00 0.00 ? 24  VAL A HG21 4  
ATOM 9225  H HG22 . VAL A 1 24  ? -12.609 7.841   9.453   1.00 0.00 ? 24  VAL A HG22 4  
ATOM 9226  H HG23 . VAL A 1 24  ? -13.520 8.262   7.995   1.00 0.00 ? 24  VAL A HG23 4  
ATOM 9227  N N    . LEU A 1 25  ? -13.874 3.265   9.369   1.00 0.00 ? 25  LEU A N    4  
ATOM 9228  C CA   . LEU A 1 25  ? -14.372 1.897   9.311   1.00 0.00 ? 25  LEU A CA   4  
ATOM 9229  C C    . LEU A 1 25  ? -14.224 1.240   10.676  1.00 0.00 ? 25  LEU A C    4  
ATOM 9230  O O    . LEU A 1 25  ? -15.090 0.464   11.070  1.00 0.00 ? 25  LEU A O    4  
ATOM 9231  C CB   . LEU A 1 25  ? -13.557 1.106   8.289   1.00 0.00 ? 25  LEU A CB   4  
ATOM 9232  C CG   . LEU A 1 25  ? -13.662 1.648   6.852   1.00 0.00 ? 25  LEU A CG   4  
ATOM 9233  C CD1  . LEU A 1 25  ? -12.582 1.023   5.972   1.00 0.00 ? 25  LEU A CD1  4  
ATOM 9234  C CD2  . LEU A 1 25  ? -15.029 1.423   6.199   1.00 0.00 ? 25  LEU A CD2  4  
ATOM 9235  H H    . LEU A 1 25  ? -13.039 3.503   8.849   1.00 0.00 ? 25  LEU A H    4  
ATOM 9236  H HA   . LEU A 1 25  ? -15.428 1.906   9.035   1.00 0.00 ? 25  LEU A HA   4  
ATOM 9237  H HB2  . LEU A 1 25  ? -12.544 1.136   8.672   1.00 0.00 ? 25  LEU A HB2  4  
ATOM 9238  H HB3  . LEU A 1 25  ? -13.838 0.060   8.282   1.00 0.00 ? 25  LEU A HB3  4  
ATOM 9239  H HG   . LEU A 1 25  ? -13.501 2.718   6.872   1.00 0.00 ? 25  LEU A HG   4  
ATOM 9240  H HD11 . LEU A 1 25  ? -12.622 1.454   4.970   1.00 0.00 ? 25  LEU A HD11 4  
ATOM 9241  H HD12 . LEU A 1 25  ? -11.607 1.241   6.404   1.00 0.00 ? 25  LEU A HD12 4  
ATOM 9242  H HD13 . LEU A 1 25  ? -12.717 -0.055  5.925   1.00 0.00 ? 25  LEU A HD13 4  
ATOM 9243  H HD21 . LEU A 1 25  ? -15.208 0.363   6.032   1.00 0.00 ? 25  LEU A HD21 4  
ATOM 9244  H HD22 . LEU A 1 25  ? -15.815 1.813   6.841   1.00 0.00 ? 25  LEU A HD22 4  
ATOM 9245  H HD23 . LEU A 1 25  ? -15.083 1.954   5.248   1.00 0.00 ? 25  LEU A HD23 4  
ATOM 9246  N N    . LYS A 1 26  ? -13.158 1.554   11.419  1.00 0.00 ? 26  LYS A N    4  
ATOM 9247  C CA   . LYS A 1 26  ? -13.012 1.040   12.781  1.00 0.00 ? 26  LYS A CA   4  
ATOM 9248  C C    . LYS A 1 26  ? -14.110 1.610   13.677  1.00 0.00 ? 26  LYS A C    4  
ATOM 9249  O O    . LYS A 1 26  ? -14.698 0.857   14.448  1.00 0.00 ? 26  LYS A O    4  
ATOM 9250  C CB   . LYS A 1 26  ? -11.622 1.333   13.350  1.00 0.00 ? 26  LYS A CB   4  
ATOM 9251  C CG   . LYS A 1 26  ? -10.520 0.505   12.681  1.00 0.00 ? 26  LYS A CG   4  
ATOM 9252  C CD   . LYS A 1 26  ? -9.185  0.805   13.369  1.00 0.00 ? 26  LYS A CD   4  
ATOM 9253  C CE   . LYS A 1 26  ? -8.013  0.123   12.657  1.00 0.00 ? 26  LYS A CE   4  
ATOM 9254  N NZ   . LYS A 1 26  ? -6.765  0.318   13.423  1.00 0.00 ? 26  LYS A NZ   4  
ATOM 9255  H H    . LYS A 1 26  ? -12.484 2.222   11.028  1.00 0.00 ? 26  LYS A H    4  
ATOM 9256  H HA   . LYS A 1 26  ? -13.151 -0.043  12.760  1.00 0.00 ? 26  LYS A HA   4  
ATOM 9257  H HB2  . LYS A 1 26  ? -11.394 2.389   13.234  1.00 0.00 ? 26  LYS A HB2  4  
ATOM 9258  H HB3  . LYS A 1 26  ? -11.632 1.090   14.413  1.00 0.00 ? 26  LYS A HB3  4  
ATOM 9259  H HG2  . LYS A 1 26  ? -10.755 -0.554  12.772  1.00 0.00 ? 26  LYS A HG2  4  
ATOM 9260  H HG3  . LYS A 1 26  ? -10.449 0.752   11.625  1.00 0.00 ? 26  LYS A HG3  4  
ATOM 9261  H HD2  . LYS A 1 26  ? -9.015  1.883   13.376  1.00 0.00 ? 26  LYS A HD2  4  
ATOM 9262  H HD3  . LYS A 1 26  ? -9.241  0.450   14.400  1.00 0.00 ? 26  LYS A HD3  4  
ATOM 9263  H HE2  . LYS A 1 26  ? -8.224  -0.943  12.566  1.00 0.00 ? 26  LYS A HE2  4  
ATOM 9264  H HE3  . LYS A 1 26  ? -7.906  0.537   11.652  1.00 0.00 ? 26  LYS A HE3  4  
ATOM 9265  H HZ1  . LYS A 1 26  ? -6.878  -0.043  14.368  1.00 0.00 ? 26  LYS A HZ1  4  
ATOM 9266  H HZ2  . LYS A 1 26  ? -5.985  -0.205  13.031  1.00 0.00 ? 26  LYS A HZ2  4  
ATOM 9267  H HZ3  . LYS A 1 26  ? -6.505  1.301   13.470  1.00 0.00 ? 26  LYS A HZ3  4  
ATOM 9268  N N    . SER A 1 27  ? -14.488 2.877   13.514  1.00 0.00 ? 27  SER A N    4  
ATOM 9269  C CA   . SER A 1 27  ? -15.629 3.491   14.183  1.00 0.00 ? 27  SER A CA   4  
ATOM 9270  C C    . SER A 1 27  ? -16.973 2.926   13.710  1.00 0.00 ? 27  SER A C    4  
ATOM 9271  O O    . SER A 1 27  ? -18.016 3.298   14.249  1.00 0.00 ? 27  SER A O    4  
ATOM 9272  C CB   . SER A 1 27  ? -15.577 5.006   13.965  1.00 0.00 ? 27  SER A CB   4  
ATOM 9273  O OG   . SER A 1 27  ? -15.111 5.670   15.119  1.00 0.00 ? 27  SER A OG   4  
ATOM 9274  H H    . SER A 1 27  ? -13.996 3.453   12.837  1.00 0.00 ? 27  SER A H    4  
ATOM 9275  H HA   . SER A 1 27  ? -15.563 3.272   15.247  1.00 0.00 ? 27  SER A HA   4  
ATOM 9276  H HB2  . SER A 1 27  ? -14.943 5.255   13.114  1.00 0.00 ? 27  SER A HB2  4  
ATOM 9277  H HB3  . SER A 1 27  ? -16.578 5.364   13.747  1.00 0.00 ? 27  SER A HB3  4  
ATOM 9278  H HG   . SER A 1 27  ? -15.837 6.256   15.414  1.00 0.00 ? 27  SER A HG   4  
ATOM 9279  N N    . SER A 1 28  ? -16.975 2.048   12.714  1.00 0.00 ? 28  SER A N    4  
ATOM 9280  C CA   . SER A 1 28  ? -18.124 1.269   12.269  1.00 0.00 ? 28  SER A CA   4  
ATOM 9281  C C    . SER A 1 28  ? -17.970 -0.221  12.621  1.00 0.00 ? 28  SER A C    4  
ATOM 9282  O O    . SER A 1 28  ? -18.894 -1.013  12.418  1.00 0.00 ? 28  SER A O    4  
ATOM 9283  C CB   . SER A 1 28  ? -18.260 1.497   10.763  1.00 0.00 ? 28  SER A CB   4  
ATOM 9284  O OG   . SER A 1 28  ? -18.363 2.890   10.518  1.00 0.00 ? 28  SER A OG   4  
ATOM 9285  H H    . SER A 1 28  ? -16.126 1.952   12.171  1.00 0.00 ? 28  SER A H    4  
ATOM 9286  H HA   . SER A 1 28  ? -19.032 1.629   12.753  1.00 0.00 ? 28  SER A HA   4  
ATOM 9287  H HB2  . SER A 1 28  ? -17.375 1.113   10.248  1.00 0.00 ? 28  SER A HB2  4  
ATOM 9288  H HB3  . SER A 1 28  ? -19.145 0.987   10.384  1.00 0.00 ? 28  SER A HB3  4  
ATOM 9289  H HG   . SER A 1 28  ? -18.081 3.024   9.585   1.00 0.00 ? 28  SER A HG   4  
ATOM 9290  N N    . GLY A 1 29  ? -16.818 -0.621  13.165  1.00 0.00 ? 29  GLY A N    4  
ATOM 9291  C CA   . GLY A 1 29  ? -16.477 -1.996  13.474  1.00 0.00 ? 29  GLY A CA   4  
ATOM 9292  C C    . GLY A 1 29  ? -16.251 -2.847  12.230  1.00 0.00 ? 29  GLY A C    4  
ATOM 9293  O O    . GLY A 1 29  ? -16.314 -4.072  12.325  1.00 0.00 ? 29  GLY A O    4  
ATOM 9294  H H    . GLY A 1 29  ? -16.098 0.067   13.341  1.00 0.00 ? 29  GLY A H    4  
ATOM 9295  H HA2  . GLY A 1 29  ? -15.575 -2.010  14.084  1.00 0.00 ? 29  GLY A HA2  4  
ATOM 9296  H HA3  . GLY A 1 29  ? -17.278 -2.440  14.051  1.00 0.00 ? 29  GLY A HA3  4  
ATOM 9297  N N    . VAL A 1 30  ? -16.009 -2.255  11.061  1.00 0.00 ? 30  VAL A N    4  
ATOM 9298  C CA   . VAL A 1 30  ? -15.692 -3.009  9.857   1.00 0.00 ? 30  VAL A CA   4  
ATOM 9299  C C    . VAL A 1 30  ? -14.346 -3.717  10.106  1.00 0.00 ? 30  VAL A C    4  
ATOM 9300  O O    . VAL A 1 30  ? -13.425 -3.097  10.653  1.00 0.00 ? 30  VAL A O    4  
ATOM 9301  C CB   . VAL A 1 30  ? -15.713 -2.042  8.667   1.00 0.00 ? 30  VAL A CB   4  
ATOM 9302  C CG1  . VAL A 1 30  ? -15.031 -2.577  7.400   1.00 0.00 ? 30  VAL A CG1  4  
ATOM 9303  C CG2  . VAL A 1 30  ? -17.142 -1.598  8.321   1.00 0.00 ? 30  VAL A CG2  4  
ATOM 9304  H H    . VAL A 1 30  ? -15.833 -1.253  11.028  1.00 0.00 ? 30  VAL A H    4  
ATOM 9305  H HA   . VAL A 1 30  ? -16.473 -3.738  9.693   1.00 0.00 ? 30  VAL A HA   4  
ATOM 9306  H HB   . VAL A 1 30  ? -15.195 -1.158  8.999   1.00 0.00 ? 30  VAL A HB   4  
ATOM 9307  H HG11 . VAL A 1 30  ? -15.526 -3.491  7.064   1.00 0.00 ? 30  VAL A HG11 4  
ATOM 9308  H HG12 . VAL A 1 30  ? -15.095 -1.829  6.610   1.00 0.00 ? 30  VAL A HG12 4  
ATOM 9309  H HG13 . VAL A 1 30  ? -13.976 -2.778  7.594   1.00 0.00 ? 30  VAL A HG13 4  
ATOM 9310  H HG21 . VAL A 1 30  ? -17.648 -1.204  9.203   1.00 0.00 ? 30  VAL A HG21 4  
ATOM 9311  H HG22 . VAL A 1 30  ? -17.116 -0.811  7.566   1.00 0.00 ? 30  VAL A HG22 4  
ATOM 9312  H HG23 . VAL A 1 30  ? -17.717 -2.435  7.928   1.00 0.00 ? 30  VAL A HG23 4  
ATOM 9313  N N    . PRO A 1 31  ? -14.208 -5.015  9.785   1.00 0.00 ? 31  PRO A N    4  
ATOM 9314  C CA   . PRO A 1 31  ? -12.990 -5.761  10.050  1.00 0.00 ? 31  PRO A CA   4  
ATOM 9315  C C    . PRO A 1 31  ? -11.932 -5.426  9.002   1.00 0.00 ? 31  PRO A C    4  
ATOM 9316  O O    . PRO A 1 31  ? -11.889 -6.008  7.913   1.00 0.00 ? 31  PRO A O    4  
ATOM 9317  C CB   . PRO A 1 31  ? -13.394 -7.230  10.059  1.00 0.00 ? 31  PRO A CB   4  
ATOM 9318  C CG   . PRO A 1 31  ? -14.619 -7.282  9.148   1.00 0.00 ? 31  PRO A CG   4  
ATOM 9319  C CD   . PRO A 1 31  ? -15.229 -5.883  9.216   1.00 0.00 ? 31  PRO A CD   4  
ATOM 9320  H HA   . PRO A 1 31  ? -12.593 -5.499  11.029  1.00 0.00 ? 31  PRO A HA   4  
ATOM 9321  H HB2  . PRO A 1 31  ? -12.586 -7.874  9.711   1.00 0.00 ? 31  PRO A HB2  4  
ATOM 9322  H HB3  . PRO A 1 31  ? -13.687 -7.509  11.070  1.00 0.00 ? 31  PRO A HB3  4  
ATOM 9323  H HG2  . PRO A 1 31  ? -14.316 -7.503  8.128   1.00 0.00 ? 31  PRO A HG2  4  
ATOM 9324  H HG3  . PRO A 1 31  ? -15.326 -8.025  9.504   1.00 0.00 ? 31  PRO A HG3  4  
ATOM 9325  H HD2  . PRO A 1 31  ? -15.512 -5.549  8.218   1.00 0.00 ? 31  PRO A HD2  4  
ATOM 9326  H HD3  . PRO A 1 31  ? -16.104 -5.900  9.864   1.00 0.00 ? 31  PRO A HD3  4  
ATOM 9327  N N    . VAL A 1 32  ? -11.068 -4.479  9.339   1.00 0.00 ? 32  VAL A N    4  
ATOM 9328  C CA   . VAL A 1 32  ? -9.946  -4.060  8.520   1.00 0.00 ? 32  VAL A CA   4  
ATOM 9329  C C    . VAL A 1 32  ? -8.679  -4.766  8.998   1.00 0.00 ? 32  VAL A C    4  
ATOM 9330  O O    . VAL A 1 32  ? -8.426  -4.838  10.200  1.00 0.00 ? 32  VAL A O    4  
ATOM 9331  C CB   . VAL A 1 32  ? -9.850  -2.522  8.527   1.00 0.00 ? 32  VAL A CB   4  
ATOM 9332  C CG1  . VAL A 1 32  ? -9.636  -1.879  9.909   1.00 0.00 ? 32  VAL A CG1  4  
ATOM 9333  C CG2  . VAL A 1 32  ? -8.751  -2.060  7.564   1.00 0.00 ? 32  VAL A CG2  4  
ATOM 9334  H H    . VAL A 1 32  ? -11.182 -4.032  10.235  1.00 0.00 ? 32  VAL A H    4  
ATOM 9335  H HA   . VAL A 1 32  ? -10.141 -4.365  7.494   1.00 0.00 ? 32  VAL A HA   4  
ATOM 9336  H HB   . VAL A 1 32  ? -10.802 -2.153  8.151   1.00 0.00 ? 32  VAL A HB   4  
ATOM 9337  H HG11 . VAL A 1 32  ? -9.615  -0.794  9.803   1.00 0.00 ? 32  VAL A HG11 4  
ATOM 9338  H HG12 . VAL A 1 32  ? -10.457 -2.140  10.577  1.00 0.00 ? 32  VAL A HG12 4  
ATOM 9339  H HG13 . VAL A 1 32  ? -8.694  -2.214  10.344  1.00 0.00 ? 32  VAL A HG13 4  
ATOM 9340  H HG21 . VAL A 1 32  ? -8.793  -0.978  7.435   1.00 0.00 ? 32  VAL A HG21 4  
ATOM 9341  H HG22 . VAL A 1 32  ? -7.767  -2.351  7.935   1.00 0.00 ? 32  VAL A HG22 4  
ATOM 9342  H HG23 . VAL A 1 32  ? -8.899  -2.536  6.595   1.00 0.00 ? 32  VAL A HG23 4  
ATOM 9343  N N    . ASP A 1 33  ? -7.885  -5.244  8.044   1.00 0.00 ? 33  ASP A N    4  
ATOM 9344  C CA   . ASP A 1 33  ? -6.531  -5.774  8.193   1.00 0.00 ? 33  ASP A CA   4  
ATOM 9345  C C    . ASP A 1 33  ? -5.727  -5.209  7.015   1.00 0.00 ? 33  ASP A C    4  
ATOM 9346  O O    . ASP A 1 33  ? -6.281  -4.574  6.115   1.00 0.00 ? 33  ASP A O    4  
ATOM 9347  C CB   . ASP A 1 33  ? -6.509  -7.318  8.135   1.00 0.00 ? 33  ASP A CB   4  
ATOM 9348  C CG   . ASP A 1 33  ? -6.154  -8.062  9.425   1.00 0.00 ? 33  ASP A CG   4  
ATOM 9349  O OD1  . ASP A 1 33  ? -6.027  -7.463  10.517  1.00 0.00 ? 33  ASP A OD1  4  
ATOM 9350  O OD2  . ASP A 1 33  ? -6.068  -9.311  9.349   1.00 0.00 ? 33  ASP A OD2  4  
ATOM 9351  H H    . ASP A 1 33  ? -8.154  -5.105  7.072   1.00 0.00 ? 33  ASP A H    4  
ATOM 9352  H HA   . ASP A 1 33  ? -6.106  -5.438  9.136   1.00 0.00 ? 33  ASP A HA   4  
ATOM 9353  H HB2  . ASP A 1 33  ? -7.471  -7.684  7.807   1.00 0.00 ? 33  ASP A HB2  4  
ATOM 9354  H HB3  . ASP A 1 33  ? -5.800  -7.633  7.371   1.00 0.00 ? 33  ASP A HB3  4  
ATOM 9355  N N    . GLY A 1 34  ? -4.417  -5.444  6.990   1.00 0.00 ? 34  GLY A N    4  
ATOM 9356  C CA   . GLY A 1 34  ? -3.530  -5.081  5.890   1.00 0.00 ? 34  GLY A CA   4  
ATOM 9357  C C    . GLY A 1 34  ? -2.206  -4.611  6.469   1.00 0.00 ? 34  GLY A C    4  
ATOM 9358  O O    . GLY A 1 34  ? -1.909  -4.966  7.616   1.00 0.00 ? 34  GLY A O    4  
ATOM 9359  H H    . GLY A 1 34  ? -3.958  -5.781  7.822   1.00 0.00 ? 34  GLY A H    4  
ATOM 9360  H HA2  . GLY A 1 34  ? -3.378  -5.929  5.230   1.00 0.00 ? 34  GLY A HA2  4  
ATOM 9361  H HA3  . GLY A 1 34  ? -3.970  -4.295  5.297   1.00 0.00 ? 34  GLY A HA3  4  
ATOM 9362  N N    . PHE A 1 35  ? -1.430  -3.810  5.737   1.00 0.00 ? 35  PHE A N    4  
ATOM 9363  C CA   . PHE A 1 35  ? -0.247  -3.142  6.272   1.00 0.00 ? 35  PHE A CA   4  
ATOM 9364  C C    . PHE A 1 35  ? -0.098  -1.728  5.704   1.00 0.00 ? 35  PHE A C    4  
ATOM 9365  O O    . PHE A 1 35  ? -0.730  -1.410  4.690   1.00 0.00 ? 35  PHE A O    4  
ATOM 9366  C CB   . PHE A 1 35  ? 1.018   -3.974  6.010   1.00 0.00 ? 35  PHE A CB   4  
ATOM 9367  C CG   . PHE A 1 35  ? 1.371   -4.121  4.538   1.00 0.00 ? 35  PHE A CG   4  
ATOM 9368  C CD1  . PHE A 1 35  ? 0.802   -5.159  3.775   1.00 0.00 ? 35  PHE A CD1  4  
ATOM 9369  C CD2  . PHE A 1 35  ? 2.268   -3.224  3.923   1.00 0.00 ? 35  PHE A CD2  4  
ATOM 9370  C CE1  . PHE A 1 35  ? 1.170   -5.339  2.432   1.00 0.00 ? 35  PHE A CE1  4  
ATOM 9371  C CE2  . PHE A 1 35  ? 2.632   -3.399  2.576   1.00 0.00 ? 35  PHE A CE2  4  
ATOM 9372  C CZ   . PHE A 1 35  ? 2.095   -4.466  1.836   1.00 0.00 ? 35  PHE A CZ   4  
ATOM 9373  H H    . PHE A 1 35  ? -1.754  -3.475  4.829   1.00 0.00 ? 35  PHE A H    4  
ATOM 9374  H HA   . PHE A 1 35  ? -0.397  -3.065  7.339   1.00 0.00 ? 35  PHE A HA   4  
ATOM 9375  H HB2  . PHE A 1 35  ? 1.856   -3.501  6.528   1.00 0.00 ? 35  PHE A HB2  4  
ATOM 9376  H HB3  . PHE A 1 35  ? 0.884   -4.967  6.444   1.00 0.00 ? 35  PHE A HB3  4  
ATOM 9377  H HD1  . PHE A 1 35  ? 0.082   -5.827  4.214   1.00 0.00 ? 35  PHE A HD1  4  
ATOM 9378  H HD2  . PHE A 1 35  ? 2.680   -2.391  4.475   1.00 0.00 ? 35  PHE A HD2  4  
ATOM 9379  H HE1  . PHE A 1 35  ? 0.739   -6.148  1.858   1.00 0.00 ? 35  PHE A HE1  4  
ATOM 9380  H HE2  . PHE A 1 35  ? 3.320   -2.707  2.112   1.00 0.00 ? 35  PHE A HE2  4  
ATOM 9381  H HZ   . PHE A 1 35  ? 2.372   -4.604  0.803   1.00 0.00 ? 35  PHE A HZ   4  
ATOM 9382  N N    . TYR A 1 36  ? 0.766   -0.894  6.309   1.00 0.00 ? 36  TYR A N    4  
ATOM 9383  C CA   . TYR A 1 36  ? 1.158   0.362   5.669   1.00 0.00 ? 36  TYR A CA   4  
ATOM 9384  C C    . TYR A 1 36  ? 2.637   0.605   5.953   1.00 0.00 ? 36  TYR A C    4  
ATOM 9385  O O    . TYR A 1 36  ? 3.269   -0.228  6.614   1.00 0.00 ? 36  TYR A O    4  
ATOM 9386  C CB   . TYR A 1 36  ? 0.220   1.505   6.103   1.00 0.00 ? 36  TYR A CB   4  
ATOM 9387  C CG   . TYR A 1 36  ? 0.194   1.809   7.585   1.00 0.00 ? 36  TYR A CG   4  
ATOM 9388  C CD1  . TYR A 1 36  ? -0.501  0.955   8.460   1.00 0.00 ? 36  TYR A CD1  4  
ATOM 9389  C CD2  . TYR A 1 36  ? 0.855   2.943   8.093   1.00 0.00 ? 36  TYR A CD2  4  
ATOM 9390  C CE1  . TYR A 1 36  ? -0.512  1.218   9.836   1.00 0.00 ? 36  TYR A CE1  4  
ATOM 9391  C CE2  . TYR A 1 36  ? 0.843   3.203   9.474   1.00 0.00 ? 36  TYR A CE2  4  
ATOM 9392  C CZ   . TYR A 1 36  ? 0.167   2.331   10.354  1.00 0.00 ? 36  TYR A CZ   4  
ATOM 9393  O OH   . TYR A 1 36  ? 0.156   2.517   11.697  1.00 0.00 ? 36  TYR A OH   4  
ATOM 9394  H H    . TYR A 1 36  ? 1.263   -1.097  7.201   1.00 0.00 ? 36  TYR A H    4  
ATOM 9395  H HA   . TYR A 1 36  ? 1.062   0.262   4.588   1.00 0.00 ? 36  TYR A HA   4  
ATOM 9396  H HB2  . TYR A 1 36  ? 0.488   2.409   5.554   1.00 0.00 ? 36  TYR A HB2  4  
ATOM 9397  H HB3  . TYR A 1 36  ? -0.799  1.246   5.809   1.00 0.00 ? 36  TYR A HB3  4  
ATOM 9398  H HD1  . TYR A 1 36  ? -0.998  0.071   8.091   1.00 0.00 ? 36  TYR A HD1  4  
ATOM 9399  H HD2  . TYR A 1 36  ? 1.381   3.613   7.429   1.00 0.00 ? 36  TYR A HD2  4  
ATOM 9400  H HE1  . TYR A 1 36  ? -1.005  0.559   10.527  1.00 0.00 ? 36  TYR A HE1  4  
ATOM 9401  H HE2  . TYR A 1 36  ? 1.361   4.064   9.860   1.00 0.00 ? 36  TYR A HE2  4  
ATOM 9402  H HH   . TYR A 1 36  ? 0.527   3.355   12.017  1.00 0.00 ? 36  TYR A HH   4  
ATOM 9403  N N    . THR A 1 37  ? 3.208   1.702   5.451   1.00 0.00 ? 37  THR A N    4  
ATOM 9404  C CA   . THR A 1 37  ? 4.553   2.138   5.820   1.00 0.00 ? 37  THR A CA   4  
ATOM 9405  C C    . THR A 1 37  ? 4.485   3.646   6.077   1.00 0.00 ? 37  THR A C    4  
ATOM 9406  O O    . THR A 1 37  ? 3.830   4.367   5.320   1.00 0.00 ? 37  THR A O    4  
ATOM 9407  C CB   . THR A 1 37  ? 5.579   1.760   4.738   1.00 0.00 ? 37  THR A CB   4  
ATOM 9408  O OG1  . THR A 1 37  ? 5.400   2.468   3.536   1.00 0.00 ? 37  THR A OG1  4  
ATOM 9409  C CG2  . THR A 1 37  ? 5.577   0.272   4.393   1.00 0.00 ? 37  THR A CG2  4  
ATOM 9410  H H    . THR A 1 37  ? 2.667   2.341   4.875   1.00 0.00 ? 37  THR A H    4  
ATOM 9411  H HA   . THR A 1 37  ? 4.866   1.622   6.734   1.00 0.00 ? 37  THR A HA   4  
ATOM 9412  H HB   . THR A 1 37  ? 6.571   2.005   5.114   1.00 0.00 ? 37  THR A HB   4  
ATOM 9413  H HG1  . THR A 1 37  ? 4.472   2.731   3.455   1.00 0.00 ? 37  THR A HG1  4  
ATOM 9414  H HG21 . THR A 1 37  ? 4.602   -0.047  4.031   1.00 0.00 ? 37  THR A HG21 4  
ATOM 9415  H HG22 . THR A 1 37  ? 6.313   0.072   3.622   1.00 0.00 ? 37  THR A HG22 4  
ATOM 9416  H HG23 . THR A 1 37  ? 5.842   -0.284  5.285   1.00 0.00 ? 37  THR A HG23 4  
ATOM 9417  N N    . GLU A 1 38  ? 5.125   4.129   7.140   1.00 0.00 ? 38  GLU A N    4  
ATOM 9418  C CA   . GLU A 1 38  ? 4.918   5.493   7.645   1.00 0.00 ? 38  GLU A CA   4  
ATOM 9419  C C    . GLU A 1 38  ? 6.228   6.248   7.893   1.00 0.00 ? 38  GLU A C    4  
ATOM 9420  O O    . GLU A 1 38  ? 6.284   7.142   8.738   1.00 0.00 ? 38  GLU A O    4  
ATOM 9421  C CB   . GLU A 1 38  ? 3.989   5.463   8.866   1.00 0.00 ? 38  GLU A CB   4  
ATOM 9422  C CG   . GLU A 1 38  ? 4.536   4.735   10.104  1.00 0.00 ? 38  GLU A CG   4  
ATOM 9423  C CD   . GLU A 1 38  ? 3.908   5.319   11.368  1.00 0.00 ? 38  GLU A CD   4  
ATOM 9424  O OE1  . GLU A 1 38  ? 2.663   5.400   11.453  1.00 0.00 ? 38  GLU A OE1  4  
ATOM 9425  O OE2  . GLU A 1 38  ? 4.629   5.804   12.271  1.00 0.00 ? 38  GLU A OE2  4  
ATOM 9426  H H    . GLU A 1 38  ? 5.626   3.475   7.725   1.00 0.00 ? 38  GLU A H    4  
ATOM 9427  H HA   . GLU A 1 38  ? 4.397   6.069   6.880   1.00 0.00 ? 38  GLU A HA   4  
ATOM 9428  H HB2  . GLU A 1 38  ? 3.772   6.493   9.139   1.00 0.00 ? 38  GLU A HB2  4  
ATOM 9429  H HB3  . GLU A 1 38  ? 3.042   5.008   8.576   1.00 0.00 ? 38  GLU A HB3  4  
ATOM 9430  H HG2  . GLU A 1 38  ? 4.309   3.670   10.032  1.00 0.00 ? 38  GLU A HG2  4  
ATOM 9431  H HG3  . GLU A 1 38  ? 5.618   4.850   10.167  1.00 0.00 ? 38  GLU A HG3  4  
ATOM 9432  N N    . GLU A 1 39  ? 7.266   5.864   7.142   1.00 0.00 ? 39  GLU A N    4  
ATOM 9433  C CA   . GLU A 1 39  ? 8.679   6.168   7.360   1.00 0.00 ? 39  GLU A CA   4  
ATOM 9434  C C    . GLU A 1 39  ? 9.138   5.870   8.799   1.00 0.00 ? 39  GLU A C    4  
ATOM 9435  O O    . GLU A 1 39  ? 8.404   5.298   9.603   1.00 0.00 ? 39  GLU A O    4  
ATOM 9436  C CB   . GLU A 1 39  ? 9.087   7.548   6.793   1.00 0.00 ? 39  GLU A CB   4  
ATOM 9437  C CG   . GLU A 1 39  ? 8.571   8.815   7.503   1.00 0.00 ? 39  GLU A CG   4  
ATOM 9438  C CD   . GLU A 1 39  ? 7.201   9.341   7.042   1.00 0.00 ? 39  GLU A CD   4  
ATOM 9439  O OE1  . GLU A 1 39  ? 6.716   8.967   5.946   1.00 0.00 ? 39  GLU A OE1  4  
ATOM 9440  O OE2  . GLU A 1 39  ? 6.646   10.212  7.756   1.00 0.00 ? 39  GLU A OE2  4  
ATOM 9441  H H    . GLU A 1 39  ? 7.053   5.171   6.446   1.00 0.00 ? 39  GLU A H    4  
ATOM 9442  H HA   . GLU A 1 39  ? 9.224   5.450   6.751   1.00 0.00 ? 39  GLU A HA   4  
ATOM 9443  H HB2  . GLU A 1 39  ? 10.175  7.587   6.816   1.00 0.00 ? 39  GLU A HB2  4  
ATOM 9444  H HB3  . GLU A 1 39  ? 8.824   7.592   5.739   1.00 0.00 ? 39  GLU A HB3  4  
ATOM 9445  H HG2  . GLU A 1 39  ? 8.565   8.651   8.580   1.00 0.00 ? 39  GLU A HG2  4  
ATOM 9446  H HG3  . GLU A 1 39  ? 9.293   9.609   7.313   1.00 0.00 ? 39  GLU A HG3  4  
ATOM 9447  N N    . VAL A 1 40  ? 10.408  6.139   9.108   1.00 0.00 ? 40  VAL A N    4  
ATOM 9448  C CA   . VAL A 1 40  ? 11.004  5.891   10.417  1.00 0.00 ? 40  VAL A CA   4  
ATOM 9449  C C    . VAL A 1 40  ? 11.994  7.025   10.644  1.00 0.00 ? 40  VAL A C    4  
ATOM 9450  O O    . VAL A 1 40  ? 12.892  7.226   9.820   1.00 0.00 ? 40  VAL A O    4  
ATOM 9451  C CB   . VAL A 1 40  ? 11.680  4.497   10.463  1.00 0.00 ? 40  VAL A CB   4  
ATOM 9452  C CG1  . VAL A 1 40  ? 12.362  4.240   11.811  1.00 0.00 ? 40  VAL A CG1  4  
ATOM 9453  C CG2  . VAL A 1 40  ? 10.677  3.356   10.266  1.00 0.00 ? 40  VAL A CG2  4  
ATOM 9454  H H    . VAL A 1 40  ? 11.017  6.557   8.418   1.00 0.00 ? 40  VAL A H    4  
ATOM 9455  H HA   . VAL A 1 40  ? 10.228  5.928   11.185  1.00 0.00 ? 40  VAL A HA   4  
ATOM 9456  H HB   . VAL A 1 40  ? 12.439  4.435   9.681   1.00 0.00 ? 40  VAL A HB   4  
ATOM 9457  H HG11 . VAL A 1 40  ? 12.861  3.270   11.802  1.00 0.00 ? 40  VAL A HG11 4  
ATOM 9458  H HG12 . VAL A 1 40  ? 13.111  4.999   11.988  1.00 0.00 ? 40  VAL A HG12 4  
ATOM 9459  H HG13 . VAL A 1 40  ? 11.636  4.268   12.625  1.00 0.00 ? 40  VAL A HG13 4  
ATOM 9460  H HG21 . VAL A 1 40  ? 9.876   3.424   11.003  1.00 0.00 ? 40  VAL A HG21 4  
ATOM 9461  H HG22 . VAL A 1 40  ? 10.238  3.427   9.279   1.00 0.00 ? 40  VAL A HG22 4  
ATOM 9462  H HG23 . VAL A 1 40  ? 11.179  2.393   10.349  1.00 0.00 ? 40  VAL A HG23 4  
ATOM 9463  N N    . ARG A 1 41  ? 11.799  7.823   11.700  1.00 0.00 ? 41  ARG A N    4  
ATOM 9464  C CA   . ARG A 1 41  ? 12.619  8.991   11.994  1.00 0.00 ? 41  ARG A CA   4  
ATOM 9465  C C    . ARG A 1 41  ? 13.077  8.908   13.447  1.00 0.00 ? 41  ARG A C    4  
ATOM 9466  O O    . ARG A 1 41  ? 12.260  9.115   14.345  1.00 0.00 ? 41  ARG A O    4  
ATOM 9467  C CB   . ARG A 1 41  ? 11.784  10.257  11.769  1.00 0.00 ? 41  ARG A CB   4  
ATOM 9468  C CG   . ARG A 1 41  ? 11.098  10.339  10.395  1.00 0.00 ? 41  ARG A CG   4  
ATOM 9469  C CD   . ARG A 1 41  ? 9.683   10.907  10.513  1.00 0.00 ? 41  ARG A CD   4  
ATOM 9470  N NE   . ARG A 1 41  ? 8.780   10.061  11.321  1.00 0.00 ? 41  ARG A NE   4  
ATOM 9471  C CZ   . ARG A 1 41  ? 7.748   10.488  12.059  1.00 0.00 ? 41  ARG A CZ   4  
ATOM 9472  N NH1  . ARG A 1 41  ? 7.408   11.775  12.101  1.00 0.00 ? 41  ARG A NH1  4  
ATOM 9473  N NH2  . ARG A 1 41  ? 7.054   9.604   12.763  1.00 0.00 ? 41  ARG A NH2  4  
ATOM 9474  H H    . ARG A 1 41  ? 10.932  7.772   12.218  1.00 0.00 ? 41  ARG A H    4  
ATOM 9475  H HA   . ARG A 1 41  ? 13.474  9.000   11.317  1.00 0.00 ? 41  ARG A HA   4  
ATOM 9476  H HB2  . ARG A 1 41  ? 11.019  10.293  12.543  1.00 0.00 ? 41  ARG A HB2  4  
ATOM 9477  H HB3  . ARG A 1 41  ? 12.419  11.134  11.896  1.00 0.00 ? 41  ARG A HB3  4  
ATOM 9478  H HG2  . ARG A 1 41  ? 11.713  10.966  9.755   1.00 0.00 ? 41  ARG A HG2  4  
ATOM 9479  H HG3  . ARG A 1 41  ? 11.013  9.375   9.907   1.00 0.00 ? 41  ARG A HG3  4  
ATOM 9480  H HD2  . ARG A 1 41  ? 9.768   11.890  10.962  1.00 0.00 ? 41  ARG A HD2  4  
ATOM 9481  H HD3  . ARG A 1 41  ? 9.266   10.987  9.515   1.00 0.00 ? 41  ARG A HD3  4  
ATOM 9482  H HE   . ARG A 1 41  ? 8.906   9.062   11.237  1.00 0.00 ? 41  ARG A HE   4  
ATOM 9483  H HH11 . ARG A 1 41  ? 7.923   12.466  11.556  1.00 0.00 ? 41  ARG A HH11 4  
ATOM 9484  H HH12 . ARG A 1 41  ? 6.656   12.106  12.689  1.00 0.00 ? 41  ARG A HH12 4  
ATOM 9485  H HH21 . ARG A 1 41  ? 7.411   8.666   12.949  1.00 0.00 ? 41  ARG A HH21 4  
ATOM 9486  H HH22 . ARG A 1 41  ? 6.147   9.828   13.172  1.00 0.00 ? 41  ARG A HH22 4  
ATOM 9487  N N    . GLN A 1 42  ? 14.350  8.597   13.703  1.00 0.00 ? 42  GLN A N    4  
ATOM 9488  C CA   . GLN A 1 42  ? 14.822  8.338   15.069  1.00 0.00 ? 42  GLN A CA   4  
ATOM 9489  C C    . GLN A 1 42  ? 15.295  9.657   15.678  1.00 0.00 ? 42  GLN A C    4  
ATOM 9490  O O    . GLN A 1 42  ? 16.495  9.909   15.804  1.00 0.00 ? 42  GLN A O    4  
ATOM 9491  C CB   . GLN A 1 42  ? 15.867  7.206   15.101  1.00 0.00 ? 42  GLN A CB   4  
ATOM 9492  C CG   . GLN A 1 42  ? 16.151  6.638   16.506  1.00 0.00 ? 42  GLN A CG   4  
ATOM 9493  C CD   . GLN A 1 42  ? 15.810  5.148   16.636  1.00 0.00 ? 42  GLN A CD   4  
ATOM 9494  O OE1  . GLN A 1 42  ? 16.665  4.295   16.876  1.00 0.00 ? 42  GLN A OE1  4  
ATOM 9495  N NE2  . GLN A 1 42  ? 14.549  4.777   16.513  1.00 0.00 ? 42  GLN A NE2  4  
ATOM 9496  H H    . GLN A 1 42  ? 15.003  8.605   12.932  1.00 0.00 ? 42  GLN A H    4  
ATOM 9497  H HA   . GLN A 1 42  ? 13.974  7.991   15.654  1.00 0.00 ? 42  GLN A HA   4  
ATOM 9498  H HB2  . GLN A 1 42  ? 15.497  6.390   14.496  1.00 0.00 ? 42  GLN A HB2  4  
ATOM 9499  H HB3  . GLN A 1 42  ? 16.794  7.550   14.652  1.00 0.00 ? 42  GLN A HB3  4  
ATOM 9500  H HG2  . GLN A 1 42  ? 17.210  6.763   16.726  1.00 0.00 ? 42  GLN A HG2  4  
ATOM 9501  H HG3  . GLN A 1 42  ? 15.588  7.197   17.254  1.00 0.00 ? 42  GLN A HG3  4  
ATOM 9502  H HE21 . GLN A 1 42  ? 13.816  5.472   16.426  1.00 0.00 ? 42  GLN A HE21 4  
ATOM 9503  H HE22 . GLN A 1 42  ? 14.279  3.809   16.596  1.00 0.00 ? 42  GLN A HE22 4  
ATOM 9504  N N    . GLY A 1 43  ? 14.344  10.545  15.972  1.00 0.00 ? 43  GLY A N    4  
ATOM 9505  C CA   . GLY A 1 43  ? 14.628  11.955  16.188  1.00 0.00 ? 43  GLY A CA   4  
ATOM 9506  C C    . GLY A 1 43  ? 15.051  12.566  14.857  1.00 0.00 ? 43  GLY A C    4  
ATOM 9507  O O    . GLY A 1 43  ? 16.242  12.771  14.602  1.00 0.00 ? 43  GLY A O    4  
ATOM 9508  H H    . GLY A 1 43  ? 13.377  10.261  15.861  1.00 0.00 ? 43  GLY A H    4  
ATOM 9509  H HA2  . GLY A 1 43  ? 13.734  12.461  16.557  1.00 0.00 ? 43  GLY A HA2  4  
ATOM 9510  H HA3  . GLY A 1 43  ? 15.432  12.066  16.917  1.00 0.00 ? 43  GLY A HA3  4  
ATOM 9511  N N    . GLY A 1 44  ? 14.078  12.795  13.976  1.00 0.00 ? 44  GLY A N    4  
ATOM 9512  C CA   . GLY A 1 44  ? 14.217  13.622  12.787  1.00 0.00 ? 44  GLY A CA   4  
ATOM 9513  C C    . GLY A 1 44  ? 14.847  12.952  11.568  1.00 0.00 ? 44  GLY A C    4  
ATOM 9514  O O    . GLY A 1 44  ? 14.394  13.207  10.452  1.00 0.00 ? 44  GLY A O    4  
ATOM 9515  H H    . GLY A 1 44  ? 13.123  12.636  14.275  1.00 0.00 ? 44  GLY A H    4  
ATOM 9516  H HA2  . GLY A 1 44  ? 13.229  13.978  12.503  1.00 0.00 ? 44  GLY A HA2  4  
ATOM 9517  H HA3  . GLY A 1 44  ? 14.816  14.495  13.042  1.00 0.00 ? 44  GLY A HA3  4  
ATOM 9518  N N    . ARG A 1 45  ? 15.887  12.124  11.729  1.00 0.00 ? 45  ARG A N    4  
ATOM 9519  C CA   . ARG A 1 45  ? 16.693  11.730  10.568  1.00 0.00 ? 45  ARG A CA   4  
ATOM 9520  C C    . ARG A 1 45  ? 15.944  10.732  9.692   1.00 0.00 ? 45  ARG A C    4  
ATOM 9521  O O    . ARG A 1 45  ? 15.241  9.875   10.223  1.00 0.00 ? 45  ARG A O    4  
ATOM 9522  C CB   . ARG A 1 45  ? 18.075  11.189  10.967  1.00 0.00 ? 45  ARG A CB   4  
ATOM 9523  C CG   . ARG A 1 45  ? 18.067  9.890   11.794  1.00 0.00 ? 45  ARG A CG   4  
ATOM 9524  C CD   . ARG A 1 45  ? 18.179  10.110  13.294  1.00 0.00 ? 45  ARG A CD   4  
ATOM 9525  N NE   . ARG A 1 45  ? 19.546  10.492  13.650  1.00 0.00 ? 45  ARG A NE   4  
ATOM 9526  C CZ   . ARG A 1 45  ? 19.927  11.512  14.418  1.00 0.00 ? 45  ARG A CZ   4  
ATOM 9527  N NH1  . ARG A 1 45  ? 19.044  12.228  15.111  1.00 0.00 ? 45  ARG A NH1  4  
ATOM 9528  N NH2  . ARG A 1 45  ? 21.213  11.815  14.453  1.00 0.00 ? 45  ARG A NH2  4  
ATOM 9529  H H    . ARG A 1 45  ? 16.150  11.846  12.665  1.00 0.00 ? 45  ARG A H    4  
ATOM 9530  H HA   . ARG A 1 45  ? 16.856  12.631  9.977   1.00 0.00 ? 45  ARG A HA   4  
ATOM 9531  H HB2  . ARG A 1 45  ? 18.614  10.980  10.040  1.00 0.00 ? 45  ARG A HB2  4  
ATOM 9532  H HB3  . ARG A 1 45  ? 18.627  11.967  11.501  1.00 0.00 ? 45  ARG A HB3  4  
ATOM 9533  H HG2  . ARG A 1 45  ? 17.178  9.295   11.603  1.00 0.00 ? 45  ARG A HG2  4  
ATOM 9534  H HG3  . ARG A 1 45  ? 18.922  9.298   11.487  1.00 0.00 ? 45  ARG A HG3  4  
ATOM 9535  H HD2  . ARG A 1 45  ? 17.459  10.864  13.597  1.00 0.00 ? 45  ARG A HD2  4  
ATOM 9536  H HD3  . ARG A 1 45  ? 17.952  9.173   13.795  1.00 0.00 ? 45  ARG A HD3  4  
ATOM 9537  H HE   . ARG A 1 45  ? 20.255  9.856   13.283  1.00 0.00 ? 45  ARG A HE   4  
ATOM 9538  H HH11 . ARG A 1 45  ? 18.056  11.988  15.091  1.00 0.00 ? 45  ARG A HH11 4  
ATOM 9539  H HH12 . ARG A 1 45  ? 19.316  13.011  15.703  1.00 0.00 ? 45  ARG A HH12 4  
ATOM 9540  H HH21 . ARG A 1 45  ? 21.854  11.303  13.851  1.00 0.00 ? 45  ARG A HH21 4  
ATOM 9541  H HH22 . ARG A 1 45  ? 21.567  12.582  15.023  1.00 0.00 ? 45  ARG A HH22 4  
ATOM 9542  N N    . ARG A 1 46  ? 16.178  10.752  8.378   1.00 0.00 ? 46  ARG A N    4  
ATOM 9543  C CA   . ARG A 1 46  ? 15.815  9.612   7.534   1.00 0.00 ? 46  ARG A CA   4  
ATOM 9544  C C    . ARG A 1 46  ? 16.748  8.459   7.873   1.00 0.00 ? 46  ARG A C    4  
ATOM 9545  O O    . ARG A 1 46  ? 17.964  8.658   7.873   1.00 0.00 ? 46  ARG A O    4  
ATOM 9546  C CB   . ARG A 1 46  ? 15.989  9.953   6.043   1.00 0.00 ? 46  ARG A CB   4  
ATOM 9547  C CG   . ARG A 1 46  ? 14.702  10.323  5.299   1.00 0.00 ? 46  ARG A CG   4  
ATOM 9548  C CD   . ARG A 1 46  ? 14.074  11.636  5.768   1.00 0.00 ? 46  ARG A CD   4  
ATOM 9549  N NE   . ARG A 1 46  ? 13.395  12.294  4.638   1.00 0.00 ? 46  ARG A NE   4  
ATOM 9550  C CZ   . ARG A 1 46  ? 13.388  13.611  4.416   1.00 0.00 ? 46  ARG A CZ   4  
ATOM 9551  N NH1  . ARG A 1 46  ? 13.678  14.473  5.382   1.00 0.00 ? 46  ARG A NH1  4  
ATOM 9552  N NH2  . ARG A 1 46  ? 13.102  14.062  3.205   1.00 0.00 ? 46  ARG A NH2  4  
ATOM 9553  H H    . ARG A 1 46  ? 16.814  11.451  8.011   1.00 0.00 ? 46  ARG A H    4  
ATOM 9554  H HA   . ARG A 1 46  ? 14.789  9.317   7.771   1.00 0.00 ? 46  ARG A HA   4  
ATOM 9555  H HB2  . ARG A 1 46  ? 16.721  10.754  5.928   1.00 0.00 ? 46  ARG A HB2  4  
ATOM 9556  H HB3  . ARG A 1 46  ? 16.402  9.081   5.533   1.00 0.00 ? 46  ARG A HB3  4  
ATOM 9557  H HG2  . ARG A 1 46  ? 14.967  10.409  4.244   1.00 0.00 ? 46  ARG A HG2  4  
ATOM 9558  H HG3  . ARG A 1 46  ? 13.970  9.523   5.391   1.00 0.00 ? 46  ARG A HG3  4  
ATOM 9559  H HD2  . ARG A 1 46  ? 13.368  11.441  6.578   1.00 0.00 ? 46  ARG A HD2  4  
ATOM 9560  H HD3  . ARG A 1 46  ? 14.865  12.287  6.142   1.00 0.00 ? 46  ARG A HD3  4  
ATOM 9561  H HE   . ARG A 1 46  ? 13.107  11.679  3.889   1.00 0.00 ? 46  ARG A HE   4  
ATOM 9562  H HH11 . ARG A 1 46  ? 13.705  14.155  6.358   1.00 0.00 ? 46  ARG A HH11 4  
ATOM 9563  H HH12 . ARG A 1 46  ? 13.691  15.470  5.221   1.00 0.00 ? 46  ARG A HH12 4  
ATOM 9564  H HH21 . ARG A 1 46  ? 12.790  13.442  2.458   1.00 0.00 ? 46  ARG A HH21 4  
ATOM 9565  H HH22 . ARG A 1 46  ? 13.213  15.050  3.000   1.00 0.00 ? 46  ARG A HH22 4  
ATOM 9566  N N    . ILE A 1 47  ? 16.212  7.256   8.086   1.00 0.00 ? 47  ILE A N    4  
ATOM 9567  C CA   . ILE A 1 47  ? 16.996  6.054   8.391   1.00 0.00 ? 47  ILE A CA   4  
ATOM 9568  C C    . ILE A 1 47  ? 16.418  4.771   7.814   1.00 0.00 ? 47  ILE A C    4  
ATOM 9569  O O    . ILE A 1 47  ? 17.180  3.854   7.524   1.00 0.00 ? 47  ILE A O    4  
ATOM 9570  C CB   . ILE A 1 47  ? 17.154  5.855   9.912   1.00 0.00 ? 47  ILE A CB   4  
ATOM 9571  C CG1  . ILE A 1 47  ? 15.853  6.139   10.684  1.00 0.00 ? 47  ILE A CG1  4  
ATOM 9572  C CG2  . ILE A 1 47  ? 18.322  6.693   10.434  1.00 0.00 ? 47  ILE A CG2  4  
ATOM 9573  C CD1  . ILE A 1 47  ? 15.872  5.511   12.071  1.00 0.00 ? 47  ILE A CD1  4  
ATOM 9574  H H    . ILE A 1 47  ? 15.206  7.171   8.040   1.00 0.00 ? 47  ILE A H    4  
ATOM 9575  H HA   . ILE A 1 47  ? 17.972  6.157   7.919   1.00 0.00 ? 47  ILE A HA   4  
ATOM 9576  H HB   . ILE A 1 47  ? 17.400  4.811   10.085  1.00 0.00 ? 47  ILE A HB   4  
ATOM 9577  H HG12 . ILE A 1 47  ? 15.693  7.213   10.776  1.00 0.00 ? 47  ILE A HG12 4  
ATOM 9578  H HG13 . ILE A 1 47  ? 15.011  5.706   10.149  1.00 0.00 ? 47  ILE A HG13 4  
ATOM 9579  H HG21 . ILE A 1 47  ? 18.399  6.623   11.516  1.00 0.00 ? 47  ILE A HG21 4  
ATOM 9580  H HG22 . ILE A 1 47  ? 19.254  6.327   10.004  1.00 0.00 ? 47  ILE A HG22 4  
ATOM 9581  H HG23 . ILE A 1 47  ? 18.183  7.729   10.158  1.00 0.00 ? 47  ILE A HG23 4  
ATOM 9582  H HD11 . ILE A 1 47  ? 15.947  4.428   11.991  1.00 0.00 ? 47  ILE A HD11 4  
ATOM 9583  H HD12 . ILE A 1 47  ? 16.708  5.889   12.653  1.00 0.00 ? 47  ILE A HD12 4  
ATOM 9584  H HD13 . ILE A 1 47  ? 14.950  5.773   12.575  1.00 0.00 ? 47  ILE A HD13 4  
ATOM 9585  N N    . GLY A 1 48  ? 15.114  4.680   7.597   1.00 0.00 ? 48  GLY A N    4  
ATOM 9586  C CA   . GLY A 1 48  ? 14.533  3.437   7.141   1.00 0.00 ? 48  GLY A CA   4  
ATOM 9587  C C    . GLY A 1 48  ? 13.065  3.613   6.843   1.00 0.00 ? 48  GLY A C    4  
ATOM 9588  O O    . GLY A 1 48  ? 12.539  4.731   6.886   1.00 0.00 ? 48  GLY A O    4  
ATOM 9589  H H    . GLY A 1 48  ? 14.472  5.421   7.844   1.00 0.00 ? 48  GLY A H    4  
ATOM 9590  H HA2  . GLY A 1 48  ? 15.043  3.098   6.240   1.00 0.00 ? 48  GLY A HA2  4  
ATOM 9591  H HA3  . GLY A 1 48  ? 14.656  2.691   7.927   1.00 0.00 ? 48  GLY A HA3  4  
ATOM 9592  N N    . PHE A 1 49  ? 12.420  2.499   6.537   1.00 0.00 ? 49  PHE A N    4  
ATOM 9593  C CA   . PHE A 1 49  ? 10.984  2.346   6.612   1.00 0.00 ? 49  PHE A CA   4  
ATOM 9594  C C    . PHE A 1 49  ? 10.765  1.113   7.477   1.00 0.00 ? 49  PHE A C    4  
ATOM 9595  O O    . PHE A 1 49  ? 11.620  0.224   7.524   1.00 0.00 ? 49  PHE A O    4  
ATOM 9596  C CB   . PHE A 1 49  ? 10.354  2.222   5.213   1.00 0.00 ? 49  PHE A CB   4  
ATOM 9597  C CG   . PHE A 1 49  ? 10.188  3.559   4.508   1.00 0.00 ? 49  PHE A CG   4  
ATOM 9598  C CD1  . PHE A 1 49  ? 11.309  4.266   4.028   1.00 0.00 ? 49  PHE A CD1  4  
ATOM 9599  C CD2  . PHE A 1 49  ? 8.908   4.134   4.392   1.00 0.00 ? 49  PHE A CD2  4  
ATOM 9600  C CE1  . PHE A 1 49  ? 11.157  5.554   3.482   1.00 0.00 ? 49  PHE A CE1  4  
ATOM 9601  C CE2  . PHE A 1 49  ? 8.754   5.420   3.849   1.00 0.00 ? 49  PHE A CE2  4  
ATOM 9602  C CZ   . PHE A 1 49  ? 9.880   6.138   3.414   1.00 0.00 ? 49  PHE A CZ   4  
ATOM 9603  H H    . PHE A 1 49  ? 12.916  1.617   6.635   1.00 0.00 ? 49  PHE A H    4  
ATOM 9604  H HA   . PHE A 1 49  ? 10.547  3.210   7.114   1.00 0.00 ? 49  PHE A HA   4  
ATOM 9605  H HB2  . PHE A 1 49  ? 10.939  1.544   4.592   1.00 0.00 ? 49  PHE A HB2  4  
ATOM 9606  H HB3  . PHE A 1 49  ? 9.366   1.772   5.327   1.00 0.00 ? 49  PHE A HB3  4  
ATOM 9607  H HD1  . PHE A 1 49  ? 12.298  3.844   4.117   1.00 0.00 ? 49  PHE A HD1  4  
ATOM 9608  H HD2  . PHE A 1 49  ? 8.034   3.609   4.745   1.00 0.00 ? 49  PHE A HD2  4  
ATOM 9609  H HE1  . PHE A 1 49  ? 12.023  6.100   3.134   1.00 0.00 ? 49  PHE A HE1  4  
ATOM 9610  H HE2  . PHE A 1 49  ? 7.770   5.867   3.790   1.00 0.00 ? 49  PHE A HE2  4  
ATOM 9611  H HZ   . PHE A 1 49  ? 9.744   7.132   3.015   1.00 0.00 ? 49  PHE A HZ   4  
ATOM 9612  N N    . ASP A 1 50  ? 9.619   1.073   8.136   1.00 0.00 ? 50  ASP A N    4  
ATOM 9613  C CA   . ASP A 1 50  ? 9.075   -0.094  8.801   1.00 0.00 ? 50  ASP A CA   4  
ATOM 9614  C C    . ASP A 1 50  ? 7.760   -0.370  8.077   1.00 0.00 ? 50  ASP A C    4  
ATOM 9615  O O    . ASP A 1 50  ? 7.216   0.504   7.393   1.00 0.00 ? 50  ASP A O    4  
ATOM 9616  C CB   . ASP A 1 50  ? 8.838   0.156   10.307  1.00 0.00 ? 50  ASP A CB   4  
ATOM 9617  C CG   . ASP A 1 50  ? 9.975   -0.299  11.231  1.00 0.00 ? 50  ASP A CG   4  
ATOM 9618  O OD1  . ASP A 1 50  ? 11.165  -0.226  10.868  1.00 0.00 ? 50  ASP A OD1  4  
ATOM 9619  O OD2  . ASP A 1 50  ? 9.667   -0.615  12.418  1.00 0.00 ? 50  ASP A OD2  4  
ATOM 9620  H H    . ASP A 1 50  ? 8.922   1.783   7.962   1.00 0.00 ? 50  ASP A H    4  
ATOM 9621  H HA   . ASP A 1 50  ? 9.749   -0.941  8.680   1.00 0.00 ? 50  ASP A HA   4  
ATOM 9622  H HB2  . ASP A 1 50  ? 8.634   1.214   10.478  1.00 0.00 ? 50  ASP A HB2  4  
ATOM 9623  H HB3  . ASP A 1 50  ? 7.943   -0.387  10.612  1.00 0.00 ? 50  ASP A HB3  4  
ATOM 9624  N N    . VAL A 1 51  ? 7.244   -1.578  8.245   1.00 0.00 ? 51  VAL A N    4  
ATOM 9625  C CA   . VAL A 1 51  ? 5.967   -2.036  7.733   1.00 0.00 ? 51  VAL A CA   4  
ATOM 9626  C C    . VAL A 1 51  ? 5.071   -2.326  8.912   1.00 0.00 ? 51  VAL A C    4  
ATOM 9627  O O    . VAL A 1 51  ? 5.583   -2.796  9.914   1.00 0.00 ? 51  VAL A O    4  
ATOM 9628  C CB   . VAL A 1 51  ? 6.190   -3.263  6.839   1.00 0.00 ? 51  VAL A CB   4  
ATOM 9629  C CG1  . VAL A 1 51  ? 7.108   -4.384  7.319   1.00 0.00 ? 51  VAL A CG1  4  
ATOM 9630  C CG2  . VAL A 1 51  ? 4.863   -3.771  6.276   1.00 0.00 ? 51  VAL A CG2  4  
ATOM 9631  H H    . VAL A 1 51  ? 7.726   -2.194  8.887   1.00 0.00 ? 51  VAL A H    4  
ATOM 9632  H HA   . VAL A 1 51  ? 5.510   -1.241  7.150   1.00 0.00 ? 51  VAL A HA   4  
ATOM 9633  H HB   . VAL A 1 51  ? 6.782   -2.909  6.045   1.00 0.00 ? 51  VAL A HB   4  
ATOM 9634  H HG11 . VAL A 1 51  ? 6.862   -5.318  6.801   1.00 0.00 ? 51  VAL A HG11 4  
ATOM 9635  H HG12 . VAL A 1 51  ? 8.142   -4.129  7.087   1.00 0.00 ? 51  VAL A HG12 4  
ATOM 9636  H HG13 . VAL A 1 51  ? 7.026   -4.484  8.387   1.00 0.00 ? 51  VAL A HG13 4  
ATOM 9637  H HG21 . VAL A 1 51  ? 5.050   -4.387  5.406   1.00 0.00 ? 51  VAL A HG21 4  
ATOM 9638  H HG22 . VAL A 1 51  ? 4.324   -4.349  7.025   1.00 0.00 ? 51  VAL A HG22 4  
ATOM 9639  H HG23 . VAL A 1 51  ? 4.257   -2.920  5.966   1.00 0.00 ? 51  VAL A HG23 4  
ATOM 9640  N N    . VAL A 1 52  ? 3.765   -2.096  8.840   1.00 0.00 ? 52  VAL A N    4  
ATOM 9641  C CA   . VAL A 1 52  ? 2.944   -2.110  10.040  1.00 0.00 ? 52  VAL A CA   4  
ATOM 9642  C C    . VAL A 1 52  ? 1.604   -2.734  9.737   1.00 0.00 ? 52  VAL A C    4  
ATOM 9643  O O    . VAL A 1 52  ? 0.816   -2.159  8.994   1.00 0.00 ? 52  VAL A O    4  
ATOM 9644  C CB   . VAL A 1 52  ? 2.915   -0.702  10.642  1.00 0.00 ? 52  VAL A CB   4  
ATOM 9645  C CG1  . VAL A 1 52  ? 2.960   0.469   9.665   1.00 0.00 ? 52  VAL A CG1  4  
ATOM 9646  C CG2  . VAL A 1 52  ? 1.882   -0.545  11.763  1.00 0.00 ? 52  VAL A CG2  4  
ATOM 9647  H H    . VAL A 1 52  ? 3.378   -1.609  8.035   1.00 0.00 ? 52  VAL A H    4  
ATOM 9648  H HA   . VAL A 1 52  ? 3.405   -2.741  10.796  1.00 0.00 ? 52  VAL A HA   4  
ATOM 9649  H HB   . VAL A 1 52  ? 3.883   -0.632  11.083  1.00 0.00 ? 52  VAL A HB   4  
ATOM 9650  H HG11 . VAL A 1 52  ? 2.917   1.408   10.215  1.00 0.00 ? 52  VAL A HG11 4  
ATOM 9651  H HG12 . VAL A 1 52  ? 3.918   0.440   9.143   1.00 0.00 ? 52  VAL A HG12 4  
ATOM 9652  H HG13 . VAL A 1 52  ? 2.141   0.404   8.956   1.00 0.00 ? 52  VAL A HG13 4  
ATOM 9653  H HG21 . VAL A 1 52  ? 1.976   -1.364  12.475  1.00 0.00 ? 52  VAL A HG21 4  
ATOM 9654  H HG22 . VAL A 1 52  ? 2.036   0.401   12.283  1.00 0.00 ? 52  VAL A HG22 4  
ATOM 9655  H HG23 . VAL A 1 52  ? 0.872   -0.561  11.357  1.00 0.00 ? 52  VAL A HG23 4  
ATOM 9656  N N    . THR A 1 53  ? 1.385   -3.943  10.259  1.00 0.00 ? 53  THR A N    4  
ATOM 9657  C CA   . THR A 1 53  ? 0.122   -4.630  10.071  1.00 0.00 ? 53  THR A CA   4  
ATOM 9658  C C    . THR A 1 53  ? -0.947  -3.894  10.867  1.00 0.00 ? 53  THR A C    4  
ATOM 9659  O O    . THR A 1 53  ? -0.687  -3.497  12.007  1.00 0.00 ? 53  THR A O    4  
ATOM 9660  C CB   . THR A 1 53  ? 0.204   -6.075  10.578  1.00 0.00 ? 53  THR A CB   4  
ATOM 9661  O OG1  . THR A 1 53  ? 0.557   -6.068  11.941  1.00 0.00 ? 53  THR A OG1  4  
ATOM 9662  C CG2  . THR A 1 53  ? 1.243   -6.922  9.857   1.00 0.00 ? 53  THR A CG2  4  
ATOM 9663  H H    . THR A 1 53  ? 2.017   -4.310  10.963  1.00 0.00 ? 53  THR A H    4  
ATOM 9664  H HA   . THR A 1 53  ? -0.117  -4.626  9.012   1.00 0.00 ? 53  THR A HA   4  
ATOM 9665  H HB   . THR A 1 53  ? -0.773  -6.541  10.460  1.00 0.00 ? 53  THR A HB   4  
ATOM 9666  H HG1  . THR A 1 53  ? 0.643   -5.135  12.199  1.00 0.00 ? 53  THR A HG1  4  
ATOM 9667  H HG21 . THR A 1 53  ? 1.063   -7.976  10.071  1.00 0.00 ? 53  THR A HG21 4  
ATOM 9668  H HG22 . THR A 1 53  ? 1.189   -6.757  8.780   1.00 0.00 ? 53  THR A HG22 4  
ATOM 9669  H HG23 . THR A 1 53  ? 2.226   -6.655  10.225  1.00 0.00 ? 53  THR A HG23 4  
ATOM 9670  N N    . LEU A 1 54  ? -2.176  -3.839  10.362  1.00 0.00 ? 54  LEU A N    4  
ATOM 9671  C CA   . LEU A 1 54  ? -3.291  -3.340  11.144  1.00 0.00 ? 54  LEU A CA   4  
ATOM 9672  C C    . LEU A 1 54  ? -3.703  -4.281  12.281  1.00 0.00 ? 54  LEU A C    4  
ATOM 9673  O O    . LEU A 1 54  ? -4.505  -3.876  13.118  1.00 0.00 ? 54  LEU A O    4  
ATOM 9674  C CB   . LEU A 1 54  ? -4.458  -3.000  10.212  1.00 0.00 ? 54  LEU A CB   4  
ATOM 9675  C CG   . LEU A 1 54  ? -4.208  -1.804  9.275   1.00 0.00 ? 54  LEU A CG   4  
ATOM 9676  C CD1  . LEU A 1 54  ? -3.478  -0.639  9.949   1.00 0.00 ? 54  LEU A CD1  4  
ATOM 9677  C CD2  . LEU A 1 54  ? -3.463  -2.090  7.981   1.00 0.00 ? 54  LEU A CD2  4  
ATOM 9678  H H    . LEU A 1 54  ? -2.360  -4.091  9.397   1.00 0.00 ? 54  LEU A H    4  
ATOM 9679  H HA   . LEU A 1 54  ? -2.962  -2.432  11.649  1.00 0.00 ? 54  LEU A HA   4  
ATOM 9680  H HB2  . LEU A 1 54  ? -4.720  -3.876  9.623   1.00 0.00 ? 54  LEU A HB2  4  
ATOM 9681  H HB3  . LEU A 1 54  ? -5.320  -2.754  10.835  1.00 0.00 ? 54  LEU A HB3  4  
ATOM 9682  H HG   . LEU A 1 54  ? -5.190  -1.508  8.956   1.00 0.00 ? 54  LEU A HG   4  
ATOM 9683  H HD11 . LEU A 1 54  ? -3.994  -0.348  10.861  1.00 0.00 ? 54  LEU A HD11 4  
ATOM 9684  H HD12 . LEU A 1 54  ? -2.467  -0.947  10.200  1.00 0.00 ? 54  LEU A HD12 4  
ATOM 9685  H HD13 . LEU A 1 54  ? -3.382  0.222   9.288   1.00 0.00 ? 54  LEU A HD13 4  
ATOM 9686  H HD21 . LEU A 1 54  ? -4.012  -2.844  7.428   1.00 0.00 ? 54  LEU A HD21 4  
ATOM 9687  H HD22 . LEU A 1 54  ? -3.428  -1.190  7.367   1.00 0.00 ? 54  LEU A HD22 4  
ATOM 9688  H HD23 . LEU A 1 54  ? -2.445  -2.405  8.188   1.00 0.00 ? 54  LEU A HD23 4  
ATOM 9689  N N    . SER A 1 55  ? -3.121  -5.477  12.389  1.00 0.00 ? 55  SER A N    4  
ATOM 9690  C CA   . SER A 1 55  ? -3.239  -6.339  13.554  1.00 0.00 ? 55  SER A CA   4  
ATOM 9691  C C    . SER A 1 55  ? -2.205  -5.966  14.634  1.00 0.00 ? 55  SER A C    4  
ATOM 9692  O O    . SER A 1 55  ? -2.053  -6.687  15.618  1.00 0.00 ? 55  SER A O    4  
ATOM 9693  C CB   . SER A 1 55  ? -3.117  -7.792  13.085  1.00 0.00 ? 55  SER A CB   4  
ATOM 9694  O OG   . SER A 1 55  ? -1.856  -8.007  12.477  1.00 0.00 ? 55  SER A OG   4  
ATOM 9695  H H    . SER A 1 55  ? -2.444  -5.792  11.717  1.00 0.00 ? 55  SER A H    4  
ATOM 9696  H HA   . SER A 1 55  ? -4.234  -6.211  13.985  1.00 0.00 ? 55  SER A HA   4  
ATOM 9697  H HB2  . SER A 1 55  ? -3.247  -8.464  13.934  1.00 0.00 ? 55  SER A HB2  4  
ATOM 9698  H HB3  . SER A 1 55  ? -3.901  -7.991  12.353  1.00 0.00 ? 55  SER A HB3  4  
ATOM 9699  H HG   . SER A 1 55  ? -1.948  -8.774  11.866  1.00 0.00 ? 55  SER A HG   4  
ATOM 9700  N N    . GLY A 1 56  ? -1.457  -4.864  14.483  1.00 0.00 ? 56  GLY A N    4  
ATOM 9701  C CA   . GLY A 1 56  ? -0.616  -4.283  15.527  1.00 0.00 ? 56  GLY A CA   4  
ATOM 9702  C C    . GLY A 1 56  ? 0.799   -4.865  15.617  1.00 0.00 ? 56  GLY A C    4  
ATOM 9703  O O    . GLY A 1 56  ? 1.565   -4.486  16.507  1.00 0.00 ? 56  GLY A O    4  
ATOM 9704  H H    . GLY A 1 56  ? -1.549  -4.318  13.636  1.00 0.00 ? 56  GLY A H    4  
ATOM 9705  H HA2  . GLY A 1 56  ? -0.530  -3.211  15.347  1.00 0.00 ? 56  GLY A HA2  4  
ATOM 9706  H HA3  . GLY A 1 56  ? -1.115  -4.415  16.484  1.00 0.00 ? 56  GLY A HA3  4  
ATOM 9707  N N    . THR A 1 57  ? 1.175   -5.778  14.723  1.00 0.00 ? 57  THR A N    4  
ATOM 9708  C CA   . THR A 1 57  ? 2.571   -6.139  14.480  1.00 0.00 ? 57  THR A CA   4  
ATOM 9709  C C    . THR A 1 57  ? 3.215   -5.092  13.551  1.00 0.00 ? 57  THR A C    4  
ATOM 9710  O O    . THR A 1 57  ? 2.524   -4.268  12.939  1.00 0.00 ? 57  THR A O    4  
ATOM 9711  C CB   . THR A 1 57  ? 2.606   -7.596  13.971  1.00 0.00 ? 57  THR A CB   4  
ATOM 9712  O OG1  . THR A 1 57  ? 2.112   -8.409  15.015  1.00 0.00 ? 57  THR A OG1  4  
ATOM 9713  C CG2  . THR A 1 57  ? 3.993   -8.125  13.589  1.00 0.00 ? 57  THR A CG2  4  
ATOM 9714  H H    . THR A 1 57  ? 0.527   -6.045  13.993  1.00 0.00 ? 57  THR A H    4  
ATOM 9715  H HA   . THR A 1 57  ? 3.113   -6.106  15.419  1.00 0.00 ? 57  THR A HA   4  
ATOM 9716  H HB   . THR A 1 57  ? 1.955   -7.716  13.107  1.00 0.00 ? 57  THR A HB   4  
ATOM 9717  H HG1  . THR A 1 57  ? 1.147   -8.361  15.019  1.00 0.00 ? 57  THR A HG1  4  
ATOM 9718  H HG21 . THR A 1 57  ? 4.713   -7.900  14.372  1.00 0.00 ? 57  THR A HG21 4  
ATOM 9719  H HG22 . THR A 1 57  ? 3.948   -9.204  13.446  1.00 0.00 ? 57  THR A HG22 4  
ATOM 9720  H HG23 . THR A 1 57  ? 4.321   -7.676  12.652  1.00 0.00 ? 57  THR A HG23 4  
ATOM 9721  N N    . ARG A 1 58  ? 4.545   -5.090  13.443  1.00 0.00 ? 58  ARG A N    4  
ATOM 9722  C CA   . ARG A 1 58  ? 5.288   -4.326  12.441  1.00 0.00 ? 58  ARG A CA   4  
ATOM 9723  C C    . ARG A 1 58  ? 6.539   -5.085  12.021  1.00 0.00 ? 58  ARG A C    4  
ATOM 9724  O O    . ARG A 1 58  ? 6.894   -6.073  12.680  1.00 0.00 ? 58  ARG A O    4  
ATOM 9725  C CB   . ARG A 1 58  ? 5.633   -2.918  12.965  1.00 0.00 ? 58  ARG A CB   4  
ATOM 9726  C CG   . ARG A 1 58  ? 6.467   -2.908  14.253  1.00 0.00 ? 58  ARG A CG   4  
ATOM 9727  C CD   . ARG A 1 58  ? 6.669   -1.452  14.667  1.00 0.00 ? 58  ARG A CD   4  
ATOM 9728  N NE   . ARG A 1 58  ? 7.355   -1.336  15.956  1.00 0.00 ? 58  ARG A NE   4  
ATOM 9729  C CZ   . ARG A 1 58  ? 8.645   -1.065  16.167  1.00 0.00 ? 58  ARG A CZ   4  
ATOM 9730  N NH1  . ARG A 1 58  ? 9.512   -0.960  15.165  1.00 0.00 ? 58  ARG A NH1  4  
ATOM 9731  N NH2  . ARG A 1 58  ? 9.067   -0.870  17.409  1.00 0.00 ? 58  ARG A NH2  4  
ATOM 9732  H H    . ARG A 1 58  ? 5.082   -5.779  13.959  1.00 0.00 ? 58  ARG A H    4  
ATOM 9733  H HA   . ARG A 1 58  ? 4.660   -4.223  11.560  1.00 0.00 ? 58  ARG A HA   4  
ATOM 9734  H HB2  . ARG A 1 58  ? 6.215   -2.385  12.216  1.00 0.00 ? 58  ARG A HB2  4  
ATOM 9735  H HB3  . ARG A 1 58  ? 4.708   -2.352  13.101  1.00 0.00 ? 58  ARG A HB3  4  
ATOM 9736  H HG2  . ARG A 1 58  ? 5.941   -3.434  15.048  1.00 0.00 ? 58  ARG A HG2  4  
ATOM 9737  H HG3  . ARG A 1 58  ? 7.436   -3.379  14.083  1.00 0.00 ? 58  ARG A HG3  4  
ATOM 9738  H HD2  . ARG A 1 58  ? 7.216   -0.914  13.892  1.00 0.00 ? 58  ARG A HD2  4  
ATOM 9739  H HD3  . ARG A 1 58  ? 5.688   -0.993  14.773  1.00 0.00 ? 58  ARG A HD3  4  
ATOM 9740  H HE   . ARG A 1 58  ? 6.748   -1.465  16.766  1.00 0.00 ? 58  ARG A HE   4  
ATOM 9741  H HH11 . ARG A 1 58  ? 9.242   -0.952  14.179  1.00 0.00 ? 58  ARG A HH11 4  
ATOM 9742  H HH12 . ARG A 1 58  ? 10.515  -0.971  15.356  1.00 0.00 ? 58  ARG A HH12 4  
ATOM 9743  H HH21 . ARG A 1 58  ? 8.390   -0.801  18.169  1.00 0.00 ? 58  ARG A HH21 4  
ATOM 9744  H HH22 . ARG A 1 58  ? 9.957   -0.405  17.565  1.00 0.00 ? 58  ARG A HH22 4  
ATOM 9745  N N    . GLY A 1 59  ? 7.231   -4.642  10.968  1.00 0.00 ? 59  GLY A N    4  
ATOM 9746  C CA   . GLY A 1 59  ? 8.554   -5.156  10.698  1.00 0.00 ? 59  GLY A CA   4  
ATOM 9747  C C    . GLY A 1 59  ? 9.461   -4.166  10.003  1.00 0.00 ? 59  GLY A C    4  
ATOM 9748  O O    . GLY A 1 59  ? 9.069   -3.022  9.801   1.00 0.00 ? 59  GLY A O    4  
ATOM 9749  H H    . GLY A 1 59  ? 6.900   -3.874  10.358  1.00 0.00 ? 59  GLY A H    4  
ATOM 9750  H HA2  . GLY A 1 59  ? 8.999   -5.412  11.646  1.00 0.00 ? 59  GLY A HA2  4  
ATOM 9751  H HA3  . GLY A 1 59  ? 8.518   -6.058  10.110  1.00 0.00 ? 59  GLY A HA3  4  
ATOM 9752  N N    . PRO A 1 60  ? 10.677  -4.597  9.651   1.00 0.00 ? 60  PRO A N    4  
ATOM 9753  C CA   . PRO A 1 60  ? 11.837  -3.712  9.708   1.00 0.00 ? 60  PRO A CA   4  
ATOM 9754  C C    . PRO A 1 60  ? 12.376  -3.288  8.334   1.00 0.00 ? 60  PRO A C    4  
ATOM 9755  O O    . PRO A 1 60  ? 13.534  -2.883  8.252   1.00 0.00 ? 60  PRO A O    4  
ATOM 9756  C CB   . PRO A 1 60  ? 12.840  -4.550  10.497  1.00 0.00 ? 60  PRO A CB   4  
ATOM 9757  C CG   . PRO A 1 60  ? 12.627  -5.923  9.861   1.00 0.00 ? 60  PRO A CG   4  
ATOM 9758  C CD   . PRO A 1 60  ? 11.114  -5.993  9.697   1.00 0.00 ? 60  PRO A CD   4  
ATOM 9759  H HA   . PRO A 1 60  ? 11.602  -2.810  10.266  1.00 0.00 ? 60  PRO A HA   4  
ATOM 9760  H HB2  . PRO A 1 60  ? 13.857  -4.171  10.424  1.00 0.00 ? 60  PRO A HB2  4  
ATOM 9761  H HB3  . PRO A 1 60  ? 12.554  -4.581  11.549  1.00 0.00 ? 60  PRO A HB3  4  
ATOM 9762  H HG2  . PRO A 1 60  ? 13.108  -5.960  8.887   1.00 0.00 ? 60  PRO A HG2  4  
ATOM 9763  H HG3  . PRO A 1 60  ? 12.993  -6.695  10.523  1.00 0.00 ? 60  PRO A HG3  4  
ATOM 9764  H HD2  . PRO A 1 60  ? 10.821  -6.541  8.793   1.00 0.00 ? 60  PRO A HD2  4  
ATOM 9765  H HD3  . PRO A 1 60  ? 10.696  -6.505  10.562  1.00 0.00 ? 60  PRO A HD3  4  
ATOM 9766  N N    . LEU A 1 61  ? 11.585  -3.508  7.272   1.00 0.00 ? 61  LEU A N    4  
ATOM 9767  C CA   . LEU A 1 61  ? 11.709  -3.074  5.874   1.00 0.00 ? 61  LEU A CA   4  
ATOM 9768  C C    . LEU A 1 61  ? 13.115  -2.736  5.390   1.00 0.00 ? 61  LEU A C    4  
ATOM 9769  O O    . LEU A 1 61  ? 13.683  -3.495  4.606   1.00 0.00 ? 61  LEU A O    4  
ATOM 9770  C CB   . LEU A 1 61  ? 10.693  -1.974  5.531   1.00 0.00 ? 61  LEU A CB   4  
ATOM 9771  C CG   . LEU A 1 61  ? 9.595   -2.431  4.556   1.00 0.00 ? 61  LEU A CG   4  
ATOM 9772  C CD1  . LEU A 1 61  ? 8.788   -1.185  4.216   1.00 0.00 ? 61  LEU A CD1  4  
ATOM 9773  C CD2  . LEU A 1 61  ? 10.069  -2.985  3.209   1.00 0.00 ? 61  LEU A CD2  4  
ATOM 9774  H H    . LEU A 1 61  ? 10.697  -3.929  7.494   1.00 0.00 ? 61  LEU A H    4  
ATOM 9775  H HA   . LEU A 1 61  ? 11.442  -3.933  5.268   1.00 0.00 ? 61  LEU A HA   4  
ATOM 9776  H HB2  . LEU A 1 61  ? 10.202  -1.633  6.447   1.00 0.00 ? 61  LEU A HB2  4  
ATOM 9777  H HB3  . LEU A 1 61  ? 11.210  -1.114  5.092   1.00 0.00 ? 61  LEU A HB3  4  
ATOM 9778  H HG   . LEU A 1 61  ? 8.958   -3.170  5.045   1.00 0.00 ? 61  LEU A HG   4  
ATOM 9779  H HD11 . LEU A 1 61  ? 7.976   -1.451  3.548   1.00 0.00 ? 61  LEU A HD11 4  
ATOM 9780  H HD12 . LEU A 1 61  ? 8.381   -0.745  5.124   1.00 0.00 ? 61  LEU A HD12 4  
ATOM 9781  H HD13 . LEU A 1 61  ? 9.452   -0.464  3.730   1.00 0.00 ? 61  LEU A HD13 4  
ATOM 9782  H HD21 . LEU A 1 61  ? 10.783  -3.793  3.332   1.00 0.00 ? 61  LEU A HD21 4  
ATOM 9783  H HD22 . LEU A 1 61  ? 9.222   -3.395  2.666   1.00 0.00 ? 61  LEU A HD22 4  
ATOM 9784  H HD23 . LEU A 1 61  ? 10.526  -2.194  2.624   1.00 0.00 ? 61  LEU A HD23 4  
ATOM 9785  N N    . SER A 1 62  ? 13.658  -1.590  5.801   1.00 0.00 ? 62  SER A N    4  
ATOM 9786  C CA   . SER A 1 62  ? 15.066  -1.318  5.656   1.00 0.00 ? 62  SER A CA   4  
ATOM 9787  C C    . SER A 1 62  ? 15.525  -0.437  6.822   1.00 0.00 ? 62  SER A C    4  
ATOM 9788  O O    . SER A 1 62  ? 14.710  0.279   7.414   1.00 0.00 ? 62  SER A O    4  
ATOM 9789  C CB   . SER A 1 62  ? 15.308  -0.600  4.334   1.00 0.00 ? 62  SER A CB   4  
ATOM 9790  O OG   . SER A 1 62  ? 16.660  -0.781  4.022   1.00 0.00 ? 62  SER A OG   4  
ATOM 9791  H H    . SER A 1 62  ? 13.181  -1.061  6.523   1.00 0.00 ? 62  SER A H    4  
ATOM 9792  H HA   . SER A 1 62  ? 15.592  -2.292  5.648   1.00 0.00 ? 62  SER A HA   4  
ATOM 9793  H HB2  . SER A 1 62  ? 14.680  -1.011  3.553   1.00 0.00 ? 62  SER A HB2  4  
ATOM 9794  H HB3  . SER A 1 62  ? 15.120  0.477   4.382   1.00 0.00 ? 62  SER A HB3  4  
ATOM 9795  H HG   . SER A 1 62  ? 16.878  -1.734  3.977   1.00 0.00 ? 62  SER A HG   4  
ATOM 9796  N N    . ARG A 1 63  ? 16.833  -0.419  7.092   1.00 0.00 ? 63  ARG A N    4  
ATOM 9797  C CA   . ARG A 1 63  ? 17.499  0.324   8.167   1.00 0.00 ? 63  ARG A CA   4  
ATOM 9798  C C    . ARG A 1 63  ? 18.867  0.847   7.698   1.00 0.00 ? 63  ARG A C    4  
ATOM 9799  O O    . ARG A 1 63  ? 19.894  0.618   8.338   1.00 0.00 ? 63  ARG A O    4  
ATOM 9800  C CB   . ARG A 1 63  ? 17.598  -0.563  9.425   1.00 0.00 ? 63  ARG A CB   4  
ATOM 9801  C CG   . ARG A 1 63  ? 18.287  -1.921  9.211   1.00 0.00 ? 63  ARG A CG   4  
ATOM 9802  C CD   . ARG A 1 63  ? 19.073  -2.328  10.464  1.00 0.00 ? 63  ARG A CD   4  
ATOM 9803  N NE   . ARG A 1 63  ? 19.469  -3.744  10.405  1.00 0.00 ? 63  ARG A NE   4  
ATOM 9804  C CZ   . ARG A 1 63  ? 18.706  -4.773  10.788  1.00 0.00 ? 63  ARG A CZ   4  
ATOM 9805  N NH1  . ARG A 1 63  ? 17.554  -4.563  11.417  1.00 0.00 ? 63  ARG A NH1  4  
ATOM 9806  N NH2  . ARG A 1 63  ? 19.101  -6.017  10.534  1.00 0.00 ? 63  ARG A NH2  4  
ATOM 9807  H H    . ARG A 1 63  ? 17.433  -1.011  6.520   1.00 0.00 ? 63  ARG A H    4  
ATOM 9808  H HA   . ARG A 1 63  ? 16.896  1.198   8.428   1.00 0.00 ? 63  ARG A HA   4  
ATOM 9809  H HB2  . ARG A 1 63  ? 18.143  -0.015  10.193  1.00 0.00 ? 63  ARG A HB2  4  
ATOM 9810  H HB3  . ARG A 1 63  ? 16.593  -0.742  9.807   1.00 0.00 ? 63  ARG A HB3  4  
ATOM 9811  H HG2  . ARG A 1 63  ? 17.527  -2.669  8.979   1.00 0.00 ? 63  ARG A HG2  4  
ATOM 9812  H HG3  . ARG A 1 63  ? 18.986  -1.872  8.378   1.00 0.00 ? 63  ARG A HG3  4  
ATOM 9813  H HD2  . ARG A 1 63  ? 19.966  -1.706  10.534  1.00 0.00 ? 63  ARG A HD2  4  
ATOM 9814  H HD3  . ARG A 1 63  ? 18.467  -2.145  11.352  1.00 0.00 ? 63  ARG A HD3  4  
ATOM 9815  H HE   . ARG A 1 63  ? 20.379  -3.926  10.002  1.00 0.00 ? 63  ARG A HE   4  
ATOM 9816  H HH11 . ARG A 1 63  ? 17.188  -3.625  11.568  1.00 0.00 ? 63  ARG A HH11 4  
ATOM 9817  H HH12 . ARG A 1 63  ? 16.922  -5.336  11.588  1.00 0.00 ? 63  ARG A HH12 4  
ATOM 9818  H HH21 . ARG A 1 63  ? 19.904  -6.212  9.931   1.00 0.00 ? 63  ARG A HH21 4  
ATOM 9819  H HH22 . ARG A 1 63  ? 18.525  -6.828  10.752  1.00 0.00 ? 63  ARG A HH22 4  
ATOM 9820  N N    . VAL A 1 64  ? 18.879  1.564   6.565   1.00 0.00 ? 64  VAL A N    4  
ATOM 9821  C CA   . VAL A 1 64  ? 20.068  2.066   5.854   1.00 0.00 ? 64  VAL A CA   4  
ATOM 9822  C C    . VAL A 1 64  ? 20.933  0.908   5.306   1.00 0.00 ? 64  VAL A C    4  
ATOM 9823  O O    . VAL A 1 64  ? 20.813  -0.241  5.728   1.00 0.00 ? 64  VAL A O    4  
ATOM 9824  C CB   . VAL A 1 64  ? 20.803  3.114   6.745   1.00 0.00 ? 64  VAL A CB   4  
ATOM 9825  C CG1  . VAL A 1 64  ? 22.339  3.045   6.759   1.00 0.00 ? 64  VAL A CG1  4  
ATOM 9826  C CG2  . VAL A 1 64  ? 20.404  4.539   6.340   1.00 0.00 ? 64  VAL A CG2  4  
ATOM 9827  H H    . VAL A 1 64  ? 17.972  1.758   6.179   1.00 0.00 ? 64  VAL A H    4  
ATOM 9828  H HA   . VAL A 1 64  ? 19.710  2.602   4.976   1.00 0.00 ? 64  VAL A HA   4  
ATOM 9829  H HB   . VAL A 1 64  ? 20.486  3.002   7.780   1.00 0.00 ? 64  VAL A HB   4  
ATOM 9830  H HG11 . VAL A 1 64  ? 22.653  2.050   7.080   1.00 0.00 ? 64  VAL A HG11 4  
ATOM 9831  H HG12 . VAL A 1 64  ? 22.740  3.277   5.773   1.00 0.00 ? 64  VAL A HG12 4  
ATOM 9832  H HG13 . VAL A 1 64  ? 22.730  3.764   7.480   1.00 0.00 ? 64  VAL A HG13 4  
ATOM 9833  H HG21 . VAL A 1 64  ? 20.897  5.232   7.019   1.00 0.00 ? 64  VAL A HG21 4  
ATOM 9834  H HG22 . VAL A 1 64  ? 20.723  4.742   5.316   1.00 0.00 ? 64  VAL A HG22 4  
ATOM 9835  H HG23 . VAL A 1 64  ? 19.325  4.672   6.414   1.00 0.00 ? 64  VAL A HG23 4  
ATOM 9836  N N    . GLY A 1 65  ? 21.802  1.178   4.328   1.00 0.00 ? 65  GLY A N    4  
ATOM 9837  C CA   . GLY A 1 65  ? 22.799  0.236   3.864   1.00 0.00 ? 65  GLY A CA   4  
ATOM 9838  C C    . GLY A 1 65  ? 23.697  0.924   2.843   1.00 0.00 ? 65  GLY A C    4  
ATOM 9839  O O    . GLY A 1 65  ? 23.279  1.870   2.166   1.00 0.00 ? 65  GLY A O    4  
ATOM 9840  H H    . GLY A 1 65  ? 21.873  2.088   3.884   1.00 0.00 ? 65  GLY A H    4  
ATOM 9841  H HA2  . GLY A 1 65  ? 23.390  -0.106  4.715   1.00 0.00 ? 65  GLY A HA2  4  
ATOM 9842  H HA3  . GLY A 1 65  ? 22.313  -0.630  3.421   1.00 0.00 ? 65  GLY A HA3  4  
ATOM 9843  N N    . LEU A 1 66  ? 24.942  0.456   2.783   1.00 0.00 ? 66  LEU A N    4  
ATOM 9844  C CA   . LEU A 1 66  ? 25.971  0.933   1.852   1.00 0.00 ? 66  LEU A CA   4  
ATOM 9845  C C    . LEU A 1 66  ? 25.477  0.714   0.423   1.00 0.00 ? 66  LEU A C    4  
ATOM 9846  O O    . LEU A 1 66  ? 24.747  -0.249  0.193   1.00 0.00 ? 66  LEU A O    4  
ATOM 9847  C CB   . LEU A 1 66  ? 27.282  0.142   2.074   1.00 0.00 ? 66  LEU A CB   4  
ATOM 9848  C CG   . LEU A 1 66  ? 28.558  0.977   2.279   1.00 0.00 ? 66  LEU A CG   4  
ATOM 9849  C CD1  . LEU A 1 66  ? 28.804  1.983   1.149   1.00 0.00 ? 66  LEU A CD1  4  
ATOM 9850  C CD2  . LEU A 1 66  ? 28.538  1.678   3.642   1.00 0.00 ? 66  LEU A CD2  4  
ATOM 9851  H H    . LEU A 1 66  ? 25.102  -0.402  3.297   1.00 0.00 ? 66  LEU A H    4  
ATOM 9852  H HA   . LEU A 1 66  ? 26.131  2.000   2.012   1.00 0.00 ? 66  LEU A HA   4  
ATOM 9853  H HB2  . LEU A 1 66  ? 27.175  -0.524  2.931   1.00 0.00 ? 66  LEU A HB2  4  
ATOM 9854  H HB3  . LEU A 1 66  ? 27.453  -0.506  1.213   1.00 0.00 ? 66  LEU A HB3  4  
ATOM 9855  H HG   . LEU A 1 66  ? 29.396  0.279   2.288   1.00 0.00 ? 66  LEU A HG   4  
ATOM 9856  H HD11 . LEU A 1 66  ? 29.792  2.429   1.267   1.00 0.00 ? 66  LEU A HD11 4  
ATOM 9857  H HD12 . LEU A 1 66  ? 28.778  1.471   0.185   1.00 0.00 ? 66  LEU A HD12 4  
ATOM 9858  H HD13 . LEU A 1 66  ? 28.064  2.783   1.162   1.00 0.00 ? 66  LEU A HD13 4  
ATOM 9859  H HD21 . LEU A 1 66  ? 28.444  0.939   4.438   1.00 0.00 ? 66  LEU A HD21 4  
ATOM 9860  H HD22 . LEU A 1 66  ? 29.470  2.224   3.786   1.00 0.00 ? 66  LEU A HD22 4  
ATOM 9861  H HD23 . LEU A 1 66  ? 27.704  2.375   3.702   1.00 0.00 ? 66  LEU A HD23 4  
ATOM 9862  N N    . GLU A 1 67  ? 25.896  1.537   -0.543  1.00 0.00 ? 67  GLU A N    4  
ATOM 9863  C CA   . GLU A 1 67  ? 25.637  1.285   -1.965  1.00 0.00 ? 67  GLU A CA   4  
ATOM 9864  C C    . GLU A 1 67  ? 26.257  -0.066  -2.372  1.00 0.00 ? 67  GLU A C    4  
ATOM 9865  O O    . GLU A 1 67  ? 27.195  -0.533  -1.712  1.00 0.00 ? 67  GLU A O    4  
ATOM 9866  C CB   . GLU A 1 67  ? 26.211  2.426   -2.824  1.00 0.00 ? 67  GLU A CB   4  
ATOM 9867  C CG   . GLU A 1 67  ? 25.349  3.700   -2.844  1.00 0.00 ? 67  GLU A CG   4  
ATOM 9868  C CD   . GLU A 1 67  ? 24.200  3.657   -3.865  1.00 0.00 ? 67  GLU A CD   4  
ATOM 9869  O OE1  . GLU A 1 67  ? 23.436  2.666   -3.938  1.00 0.00 ? 67  GLU A OE1  4  
ATOM 9870  O OE2  . GLU A 1 67  ? 24.013  4.638   -4.626  1.00 0.00 ? 67  GLU A OE2  4  
ATOM 9871  H H    . GLU A 1 67  ? 26.539  2.280   -0.321  1.00 0.00 ? 67  GLU A H    4  
ATOM 9872  H HA   . GLU A 1 67  ? 24.561  1.247   -2.120  1.00 0.00 ? 67  GLU A HA   4  
ATOM 9873  H HB2  . GLU A 1 67  ? 27.198  2.670   -2.436  1.00 0.00 ? 67  GLU A HB2  4  
ATOM 9874  H HB3  . GLU A 1 67  ? 26.348  2.088   -3.850  1.00 0.00 ? 67  GLU A HB3  4  
ATOM 9875  H HG2  . GLU A 1 67  ? 24.945  3.880   -1.849  1.00 0.00 ? 67  GLU A HG2  4  
ATOM 9876  H HG3  . GLU A 1 67  ? 26.000  4.540   -3.095  1.00 0.00 ? 67  GLU A HG3  4  
ATOM 9877  N N    . PRO A 1 68  ? 25.767  -0.723  -3.438  1.00 0.00 ? 68  PRO A N    4  
ATOM 9878  C CA   . PRO A 1 68  ? 26.343  -1.970  -3.910  1.00 0.00 ? 68  PRO A CA   4  
ATOM 9879  C C    . PRO A 1 68  ? 27.734  -1.717  -4.502  1.00 0.00 ? 68  PRO A C    4  
ATOM 9880  O O    . PRO A 1 68  ? 27.892  -0.795  -5.311  1.00 0.00 ? 68  PRO A O    4  
ATOM 9881  C CB   . PRO A 1 68  ? 25.391  -2.545  -4.956  1.00 0.00 ? 68  PRO A CB   4  
ATOM 9882  C CG   . PRO A 1 68  ? 24.236  -1.551  -5.064  1.00 0.00 ? 68  PRO A CG   4  
ATOM 9883  C CD   . PRO A 1 68  ? 24.656  -0.314  -4.271  1.00 0.00 ? 68  PRO A CD   4  
ATOM 9884  H HA   . PRO A 1 68  ? 26.404  -2.668  -3.074  1.00 0.00 ? 68  PRO A HA   4  
ATOM 9885  H HB2  . PRO A 1 68  ? 25.876  -2.657  -5.924  1.00 0.00 ? 68  PRO A HB2  4  
ATOM 9886  H HB3  . PRO A 1 68  ? 25.044  -3.517  -4.611  1.00 0.00 ? 68  PRO A HB3  4  
ATOM 9887  H HG2  . PRO A 1 68  ? 24.046  -1.295  -6.106  1.00 0.00 ? 68  PRO A HG2  4  
ATOM 9888  H HG3  . PRO A 1 68  ? 23.344  -1.987  -4.613  1.00 0.00 ? 68  PRO A HG3  4  
ATOM 9889  H HD2  . PRO A 1 68  ? 24.999  0.479   -4.936  1.00 0.00 ? 68  PRO A HD2  4  
ATOM 9890  H HD3  . PRO A 1 68  ? 23.816  0.033   -3.673  1.00 0.00 ? 68  PRO A HD3  4  
ATOM 9891  N N    . PRO A 1 69  ? 28.739  -2.517  -4.123  1.00 0.00 ? 69  PRO A N    4  
ATOM 9892  C CA   . PRO A 1 69  ? 30.040  -2.537  -4.768  1.00 0.00 ? 69  PRO A CA   4  
ATOM 9893  C C    . PRO A 1 69  ? 29.931  -3.190  -6.155  1.00 0.00 ? 69  PRO A C    4  
ATOM 9894  O O    . PRO A 1 69  ? 29.051  -4.027  -6.367  1.00 0.00 ? 69  PRO A O    4  
ATOM 9895  C CB   . PRO A 1 69  ? 30.935  -3.343  -3.826  1.00 0.00 ? 69  PRO A CB   4  
ATOM 9896  C CG   . PRO A 1 69  ? 29.962  -4.282  -3.106  1.00 0.00 ? 69  PRO A CG   4  
ATOM 9897  C CD   . PRO A 1 69  ? 28.642  -3.534  -3.099  1.00 0.00 ? 69  PRO A CD   4  
ATOM 9898  H HA   . PRO A 1 69  ? 30.417  -1.518  -4.861  1.00 0.00 ? 69  PRO A HA   4  
ATOM 9899  H HB2  . PRO A 1 69  ? 31.703  -3.904  -4.359  1.00 0.00 ? 69  PRO A HB2  4  
ATOM 9900  H HB3  . PRO A 1 69  ? 31.397  -2.653  -3.121  1.00 0.00 ? 69  PRO A HB3  4  
ATOM 9901  H HG2  . PRO A 1 69  ? 29.828  -5.195  -3.681  1.00 0.00 ? 69  PRO A HG2  4  
ATOM 9902  H HG3  . PRO A 1 69  ? 30.277  -4.502  -2.089  1.00 0.00 ? 69  PRO A HG3  4  
ATOM 9903  H HD2  . PRO A 1 69  ? 27.821  -4.213  -3.325  1.00 0.00 ? 69  PRO A HD2  4  
ATOM 9904  H HD3  . PRO A 1 69  ? 28.463  -3.061  -2.137  1.00 0.00 ? 69  PRO A HD3  4  
ATOM 9905  N N    . PRO A 1 70  ? 30.841  -2.865  -7.087  1.00 0.00 ? 70  PRO A N    4  
ATOM 9906  C CA   . PRO A 1 70  ? 30.731  -3.271  -8.481  1.00 0.00 ? 70  PRO A CA   4  
ATOM 9907  C C    . PRO A 1 70  ? 30.818  -4.795  -8.586  1.00 0.00 ? 70  PRO A C    4  
ATOM 9908  O O    . PRO A 1 70  ? 31.859  -5.386  -8.297  1.00 0.00 ? 70  PRO A O    4  
ATOM 9909  C CB   . PRO A 1 70  ? 31.853  -2.536  -9.220  1.00 0.00 ? 70  PRO A CB   4  
ATOM 9910  C CG   . PRO A 1 70  ? 32.892  -2.253  -8.135  1.00 0.00 ? 70  PRO A CG   4  
ATOM 9911  C CD   . PRO A 1 70  ? 32.066  -2.115  -6.856  1.00 0.00 ? 70  PRO A CD   4  
ATOM 9912  H HA   . PRO A 1 70  ? 29.771  -2.940  -8.879  1.00 0.00 ? 70  PRO A HA   4  
ATOM 9913  H HB2  . PRO A 1 70  ? 32.268  -3.130  -10.036 1.00 0.00 ? 70  PRO A HB2  4  
ATOM 9914  H HB3  . PRO A 1 70  ? 31.471  -1.591  -9.605  1.00 0.00 ? 70  PRO A HB3  4  
ATOM 9915  H HG2  . PRO A 1 70  ? 33.561  -3.109  -8.042  1.00 0.00 ? 70  PRO A HG2  4  
ATOM 9916  H HG3  . PRO A 1 70  ? 33.463  -1.348  -8.348  1.00 0.00 ? 70  PRO A HG3  4  
ATOM 9917  H HD2  . PRO A 1 70  ? 32.626  -2.526  -6.017  1.00 0.00 ? 70  PRO A HD2  4  
ATOM 9918  H HD3  . PRO A 1 70  ? 31.823  -1.073  -6.653  1.00 0.00 ? 70  PRO A HD3  4  
ATOM 9919  N N    . GLY A 1 71  ? 29.706  -5.431  -8.954  1.00 0.00 ? 71  GLY A N    4  
ATOM 9920  C CA   . GLY A 1 71  ? 29.554  -6.877  -8.970  1.00 0.00 ? 71  GLY A CA   4  
ATOM 9921  C C    . GLY A 1 71  ? 28.280  -7.255  -8.230  1.00 0.00 ? 71  GLY A C    4  
ATOM 9922  O O    . GLY A 1 71  ? 27.364  -7.825  -8.826  1.00 0.00 ? 71  GLY A O    4  
ATOM 9923  H H    . GLY A 1 71  ? 28.871  -4.881  -9.109  1.00 0.00 ? 71  GLY A H    4  
ATOM 9924  H HA2  . GLY A 1 71  ? 29.496  -7.228  -9.998  1.00 0.00 ? 71  GLY A HA2  4  
ATOM 9925  H HA3  . GLY A 1 71  ? 30.404  -7.357  -8.484  1.00 0.00 ? 71  GLY A HA3  4  
ATOM 9926  N N    . LYS A 1 72  ? 28.187  -6.910  -6.945  1.00 0.00 ? 72  LYS A N    4  
ATOM 9927  C CA   . LYS A 1 72  ? 26.974  -7.122  -6.162  1.00 0.00 ? 72  LYS A CA   4  
ATOM 9928  C C    . LYS A 1 72  ? 25.911  -6.158  -6.670  1.00 0.00 ? 72  LYS A C    4  
ATOM 9929  O O    . LYS A 1 72  ? 26.188  -5.001  -6.970  1.00 0.00 ? 72  LYS A O    4  
ATOM 9930  C CB   . LYS A 1 72  ? 27.299  -6.872  -4.684  1.00 0.00 ? 72  LYS A CB   4  
ATOM 9931  C CG   . LYS A 1 72  ? 26.139  -6.812  -3.672  1.00 0.00 ? 72  LYS A CG   4  
ATOM 9932  C CD   . LYS A 1 72  ? 25.680  -8.172  -3.129  1.00 0.00 ? 72  LYS A CD   4  
ATOM 9933  C CE   . LYS A 1 72  ? 24.684  -8.875  -4.053  1.00 0.00 ? 72  LYS A CE   4  
ATOM 9934  N NZ   . LYS A 1 72  ? 24.352  -10.231 -3.580  1.00 0.00 ? 72  LYS A NZ   4  
ATOM 9935  H H    . LYS A 1 72  ? 28.861  -6.239  -6.592  1.00 0.00 ? 72  LYS A H    4  
ATOM 9936  H HA   . LYS A 1 72  ? 26.642  -8.151  -6.308  1.00 0.00 ? 72  LYS A HA   4  
ATOM 9937  H HB2  . LYS A 1 72  ? 27.987  -7.650  -4.369  1.00 0.00 ? 72  LYS A HB2  4  
ATOM 9938  H HB3  . LYS A 1 72  ? 27.817  -5.917  -4.630  1.00 0.00 ? 72  LYS A HB3  4  
ATOM 9939  H HG2  . LYS A 1 72  ? 26.497  -6.238  -2.817  1.00 0.00 ? 72  LYS A HG2  4  
ATOM 9940  H HG3  . LYS A 1 72  ? 25.289  -6.267  -4.079  1.00 0.00 ? 72  LYS A HG3  4  
ATOM 9941  H HD2  . LYS A 1 72  ? 26.547  -8.809  -2.947  1.00 0.00 ? 72  LYS A HD2  4  
ATOM 9942  H HD3  . LYS A 1 72  ? 25.191  -8.001  -2.169  1.00 0.00 ? 72  LYS A HD3  4  
ATOM 9943  H HE2  . LYS A 1 72  ? 23.768  -8.281  -4.088  1.00 0.00 ? 72  LYS A HE2  4  
ATOM 9944  H HE3  . LYS A 1 72  ? 25.098  -8.953  -5.056  1.00 0.00 ? 72  LYS A HE3  4  
ATOM 9945  H HZ1  . LYS A 1 72  ? 24.256  -10.264 -2.566  1.00 0.00 ? 72  LYS A HZ1  4  
ATOM 9946  H HZ2  . LYS A 1 72  ? 23.491  -10.563 -4.011  1.00 0.00 ? 72  LYS A HZ2  4  
ATOM 9947  H HZ3  . LYS A 1 72  ? 25.074  -10.895 -3.832  1.00 0.00 ? 72  LYS A HZ3  4  
ATOM 9948  N N    . ARG A 1 73  ? 24.674  -6.633  -6.708  1.00 0.00 ? 73  ARG A N    4  
ATOM 9949  C CA   . ARG A 1 73  ? 23.475  -5.824  -6.888  1.00 0.00 ? 73  ARG A CA   4  
ATOM 9950  C C    . ARG A 1 73  ? 22.365  -6.490  -6.107  1.00 0.00 ? 73  ARG A C    4  
ATOM 9951  O O    . ARG A 1 73  ? 22.370  -7.720  -5.987  1.00 0.00 ? 73  ARG A O    4  
ATOM 9952  C CB   . ARG A 1 73  ? 23.122  -5.725  -8.381  1.00 0.00 ? 73  ARG A CB   4  
ATOM 9953  C CG   . ARG A 1 73  ? 23.563  -4.377  -8.965  1.00 0.00 ? 73  ARG A CG   4  
ATOM 9954  C CD   . ARG A 1 73  ? 22.560  -3.294  -8.559  1.00 0.00 ? 73  ARG A CD   4  
ATOM 9955  N NE   . ARG A 1 73  ? 21.531  -3.146  -9.604  1.00 0.00 ? 73  ARG A NE   4  
ATOM 9956  C CZ   . ARG A 1 73  ? 20.330  -2.584  -9.476  1.00 0.00 ? 73  ARG A CZ   4  
ATOM 9957  N NH1  . ARG A 1 73  ? 19.994  -1.978  -8.343  1.00 0.00 ? 73  ARG A NH1  4  
ATOM 9958  N NH2  . ARG A 1 73  ? 19.473  -2.588  -10.488 1.00 0.00 ? 73  ARG A NH2  4  
ATOM 9959  H H    . ARG A 1 73  ? 24.534  -7.586  -6.410  1.00 0.00 ? 73  ARG A H    4  
ATOM 9960  H HA   . ARG A 1 73  ? 23.666  -4.836  -6.466  1.00 0.00 ? 73  ARG A HA   4  
ATOM 9961  H HB2  . ARG A 1 73  ? 23.611  -6.534  -8.913  1.00 0.00 ? 73  ARG A HB2  4  
ATOM 9962  H HB3  . ARG A 1 73  ? 22.047  -5.843  -8.527  1.00 0.00 ? 73  ARG A HB3  4  
ATOM 9963  H HG2  . ARG A 1 73  ? 24.552  -4.110  -8.601  1.00 0.00 ? 73  ARG A HG2  4  
ATOM 9964  H HG3  . ARG A 1 73  ? 23.618  -4.447  -10.052 1.00 0.00 ? 73  ARG A HG3  4  
ATOM 9965  H HD2  . ARG A 1 73  ? 22.115  -3.568  -7.590  1.00 0.00 ? 73  ARG A HD2  4  
ATOM 9966  H HD3  . ARG A 1 73  ? 23.090  -2.348  -8.452  1.00 0.00 ? 73  ARG A HD3  4  
ATOM 9967  H HE   . ARG A 1 73  ? 21.824  -3.432  -10.538 1.00 0.00 ? 73  ARG A HE   4  
ATOM 9968  H HH11 . ARG A 1 73  ? 20.636  -1.879  -7.558  1.00 0.00 ? 73  ARG A HH11 4  
ATOM 9969  H HH12 . ARG A 1 73  ? 19.064  -1.581  -8.226  1.00 0.00 ? 73  ARG A HH12 4  
ATOM 9970  H HH21 . ARG A 1 73  ? 19.686  -3.083  -11.358 1.00 0.00 ? 73  ARG A HH21 4  
ATOM 9971  H HH22 . ARG A 1 73  ? 18.543  -2.192  -10.415 1.00 0.00 ? 73  ARG A HH22 4  
ATOM 9972  N N    . GLU A 1 74  ? 21.457  -5.696  -5.544  1.00 0.00 ? 74  GLU A N    4  
ATOM 9973  C CA   . GLU A 1 74  ? 20.542  -6.178  -4.540  1.00 0.00 ? 74  GLU A CA   4  
ATOM 9974  C C    . GLU A 1 74  ? 19.312  -5.278  -4.383  1.00 0.00 ? 74  GLU A C    4  
ATOM 9975  O O    . GLU A 1 74  ? 19.122  -4.314  -5.134  1.00 0.00 ? 74  GLU A O    4  
ATOM 9976  C CB   . GLU A 1 74  ? 21.327  -6.310  -3.228  1.00 0.00 ? 74  GLU A CB   4  
ATOM 9977  C CG   . GLU A 1 74  ? 21.802  -4.963  -2.665  1.00 0.00 ? 74  GLU A CG   4  
ATOM 9978  C CD   . GLU A 1 74  ? 23.083  -5.139  -1.857  1.00 0.00 ? 74  GLU A CD   4  
ATOM 9979  O OE1  . GLU A 1 74  ? 23.026  -5.691  -0.738  1.00 0.00 ? 74  GLU A OE1  4  
ATOM 9980  O OE2  . GLU A 1 74  ? 24.142  -4.677  -2.331  1.00 0.00 ? 74  GLU A OE2  4  
ATOM 9981  H H    . GLU A 1 74  ? 21.481  -4.694  -5.586  1.00 0.00 ? 74  GLU A H    4  
ATOM 9982  H HA   . GLU A 1 74  ? 20.214  -7.150  -4.880  1.00 0.00 ? 74  GLU A HA   4  
ATOM 9983  H HB2  . GLU A 1 74  ? 20.693  -6.791  -2.500  1.00 0.00 ? 74  GLU A HB2  4  
ATOM 9984  H HB3  . GLU A 1 74  ? 22.187  -6.959  -3.392  1.00 0.00 ? 74  GLU A HB3  4  
ATOM 9985  H HG2  . GLU A 1 74  ? 21.997  -4.256  -3.474  1.00 0.00 ? 74  GLU A HG2  4  
ATOM 9986  H HG3  . GLU A 1 74  ? 21.020  -4.535  -2.038  1.00 0.00 ? 74  GLU A HG3  4  
ATOM 9987  N N    . CYS A 1 75  ? 18.469  -5.609  -3.405  1.00 0.00 ? 75  CYS A N    4  
ATOM 9988  C CA   . CYS A 1 75  ? 17.328  -4.837  -2.941  1.00 0.00 ? 75  CYS A CA   4  
ATOM 9989  C C    . CYS A 1 75  ? 17.775  -3.471  -2.416  1.00 0.00 ? 75  CYS A C    4  
ATOM 9990  O O    . CYS A 1 75  ? 18.255  -3.378  -1.293  1.00 0.00 ? 75  CYS A O    4  
ATOM 9991  C CB   . CYS A 1 75  ? 16.660  -5.608  -1.799  1.00 0.00 ? 75  CYS A CB   4  
ATOM 9992  S SG   . CYS A 1 75  ? 16.004  -7.205  -2.368  1.00 0.00 ? 75  CYS A SG   4  
ATOM 9993  H H    . CYS A 1 75  ? 18.719  -6.401  -2.826  1.00 0.00 ? 75  CYS A H    4  
ATOM 9994  H HA   . CYS A 1 75  ? 16.619  -4.700  -3.756  1.00 0.00 ? 75  CYS A HA   4  
ATOM 9995  H HB2  . CYS A 1 75  ? 17.404  -5.790  -1.019  1.00 0.00 ? 75  CYS A HB2  4  
ATOM 9996  H HB3  . CYS A 1 75  ? 15.874  -4.975  -1.366  1.00 0.00 ? 75  CYS A HB3  4  
ATOM 9997  H HG   . CYS A 1 75  ? 16.477  -7.934  -1.341  1.00 0.00 ? 75  CYS A HG   4  
ATOM 9998  N N    . ARG A 1 76  ? 17.617  -2.393  -3.183  1.00 0.00 ? 76  ARG A N    4  
ATOM 9999  C CA   . ARG A 1 76  ? 18.141  -1.086  -2.805  1.00 0.00 ? 76  ARG A CA   4  
ATOM 10000 C C    . ARG A 1 76  ? 17.119  -0.063  -3.238  1.00 0.00 ? 76  ARG A C    4  
ATOM 10001 O O    . ARG A 1 76  ? 16.809  0.012   -4.419  1.00 0.00 ? 76  ARG A O    4  
ATOM 10002 C CB   . ARG A 1 76  ? 19.492  -0.886  -3.494  1.00 0.00 ? 76  ARG A CB   4  
ATOM 10003 C CG   . ARG A 1 76  ? 20.238  0.395   -3.105  1.00 0.00 ? 76  ARG A CG   4  
ATOM 10004 C CD   . ARG A 1 76  ? 19.609  1.667   -3.672  1.00 0.00 ? 76  ARG A CD   4  
ATOM 10005 N NE   . ARG A 1 76  ? 20.582  2.750   -3.832  1.00 0.00 ? 76  ARG A NE   4  
ATOM 10006 C CZ   . ARG A 1 76  ? 20.311  3.913   -4.427  1.00 0.00 ? 76  ARG A CZ   4  
ATOM 10007 N NH1  . ARG A 1 76  ? 19.098  4.195   -4.886  1.00 0.00 ? 76  ARG A NH1  4  
ATOM 10008 N NH2  . ARG A 1 76  ? 21.263  4.812   -4.558  1.00 0.00 ? 76  ARG A NH2  4  
ATOM 10009 H H    . ARG A 1 76  ? 17.170  -2.438  -4.090  1.00 0.00 ? 76  ARG A H    4  
ATOM 10010 H HA   . ARG A 1 76  ? 18.289  -1.033  -1.725  1.00 0.00 ? 76  ARG A HA   4  
ATOM 10011 H HB2  . ARG A 1 76  ? 20.136  -1.733  -3.249  1.00 0.00 ? 76  ARG A HB2  4  
ATOM 10012 H HB3  . ARG A 1 76  ? 19.318  -0.888  -4.564  1.00 0.00 ? 76  ARG A HB3  4  
ATOM 10013 H HG2  . ARG A 1 76  ? 20.255  0.471   -2.019  1.00 0.00 ? 76  ARG A HG2  4  
ATOM 10014 H HG3  . ARG A 1 76  ? 21.258  0.312   -3.484  1.00 0.00 ? 76  ARG A HG3  4  
ATOM 10015 H HD2  . ARG A 1 76  ? 19.165  1.455   -4.645  1.00 0.00 ? 76  ARG A HD2  4  
ATOM 10016 H HD3  . ARG A 1 76  ? 18.832  2.008   -2.993  1.00 0.00 ? 76  ARG A HD3  4  
ATOM 10017 H HE   . ARG A 1 76  ? 21.549  2.565   -3.547  1.00 0.00 ? 76  ARG A HE   4  
ATOM 10018 H HH11 . ARG A 1 76  ? 18.313  3.563   -4.764  1.00 0.00 ? 76  ARG A HH11 4  
ATOM 10019 H HH12 . ARG A 1 76  ? 18.888  5.073   -5.371  1.00 0.00 ? 76  ARG A HH12 4  
ATOM 10020 H HH21 . ARG A 1 76  ? 22.228  4.579   -4.299  1.00 0.00 ? 76  ARG A HH21 4  
ATOM 10021 H HH22 . ARG A 1 76  ? 21.106  5.669   -5.077  1.00 0.00 ? 76  ARG A HH22 4  
ATOM 10022 N N    . VAL A 1 77  ? 16.586  0.694   -2.289  1.00 0.00 ? 77  VAL A N    4  
ATOM 10023 C CA   . VAL A 1 77  ? 15.574  1.709   -2.570  1.00 0.00 ? 77  VAL A CA   4  
ATOM 10024 C C    . VAL A 1 77  ? 16.306  3.012   -2.895  1.00 0.00 ? 77  VAL A C    4  
ATOM 10025 O O    . VAL A 1 77  ? 16.650  3.211   -4.060  1.00 0.00 ? 77  VAL A O    4  
ATOM 10026 C CB   . VAL A 1 77  ? 14.513  1.717   -1.448  1.00 0.00 ? 77  VAL A CB   4  
ATOM 10027 C CG1  . VAL A 1 77  ? 13.524  2.891   -1.497  1.00 0.00 ? 77  VAL A CG1  4  
ATOM 10028 C CG2  . VAL A 1 77  ? 13.703  0.416   -1.575  1.00 0.00 ? 77  VAL A CG2  4  
ATOM 10029 H H    . VAL A 1 77  ? 16.937  0.557   -1.345  1.00 0.00 ? 77  VAL A H    4  
ATOM 10030 H HA   . VAL A 1 77  ? 15.046  1.436   -3.487  1.00 0.00 ? 77  VAL A HA   4  
ATOM 10031 H HB   . VAL A 1 77  ? 15.016  1.736   -0.482  1.00 0.00 ? 77  VAL A HB   4  
ATOM 10032 H HG11 . VAL A 1 77  ? 12.775  2.775   -0.714  1.00 0.00 ? 77  VAL A HG11 4  
ATOM 10033 H HG12 . VAL A 1 77  ? 14.027  3.844   -1.345  1.00 0.00 ? 77  VAL A HG12 4  
ATOM 10034 H HG13 . VAL A 1 77  ? 13.011  2.909   -2.456  1.00 0.00 ? 77  VAL A HG13 4  
ATOM 10035 H HG21 . VAL A 1 77  ? 13.131  0.437   -2.506  1.00 0.00 ? 77  VAL A HG21 4  
ATOM 10036 H HG22 . VAL A 1 77  ? 14.360  -0.456  -1.601  1.00 0.00 ? 77  VAL A HG22 4  
ATOM 10037 H HG23 . VAL A 1 77  ? 13.015  0.317   -0.735  1.00 0.00 ? 77  VAL A HG23 4  
ATOM 10038 N N    . GLY A 1 78  ? 16.620  3.861   -1.910  1.00 0.00 ? 78  GLY A N    4  
ATOM 10039 C CA   . GLY A 1 78  ? 17.254  5.165   -2.136  1.00 0.00 ? 78  GLY A CA   4  
ATOM 10040 C C    . GLY A 1 78  ? 18.564  5.306   -1.364  1.00 0.00 ? 78  GLY A C    4  
ATOM 10041 O O    . GLY A 1 78  ? 19.581  5.739   -1.912  1.00 0.00 ? 78  GLY A O    4  
ATOM 10042 H H    . GLY A 1 78  ? 16.324  3.602   -0.984  1.00 0.00 ? 78  GLY A H    4  
ATOM 10043 H HA2  . GLY A 1 78  ? 17.445  5.321   -3.199  1.00 0.00 ? 78  GLY A HA2  4  
ATOM 10044 H HA3  . GLY A 1 78  ? 16.570  5.945   -1.801  1.00 0.00 ? 78  GLY A HA3  4  
ATOM 10045 N N    . GLN A 1 79  ? 18.531  4.955   -0.078  1.00 0.00 ? 79  GLN A N    4  
ATOM 10046 C CA   . GLN A 1 79  ? 19.700  4.852   0.796   1.00 0.00 ? 79  GLN A CA   4  
ATOM 10047 C C    . GLN A 1 79  ? 19.550  3.701   1.800   1.00 0.00 ? 79  GLN A C    4  
ATOM 10048 O O    . GLN A 1 79  ? 20.380  3.534   2.695   1.00 0.00 ? 79  GLN A O    4  
ATOM 10049 C CB   . GLN A 1 79  ? 19.951  6.204   1.480   1.00 0.00 ? 79  GLN A CB   4  
ATOM 10050 C CG   . GLN A 1 79  ? 18.874  6.566   2.507   1.00 0.00 ? 79  GLN A CG   4  
ATOM 10051 C CD   . GLN A 1 79  ? 18.855  8.059   2.804   1.00 0.00 ? 79  GLN A CD   4  
ATOM 10052 O OE1  . GLN A 1 79  ? 18.394  8.849   1.981   1.00 0.00 ? 79  GLN A OE1  4  
ATOM 10053 N NE2  . GLN A 1 79  ? 19.327  8.476   3.963   1.00 0.00 ? 79  GLN A NE2  4  
ATOM 10054 H H    . GLN A 1 79  ? 17.657  4.648   0.312   1.00 0.00 ? 79  GLN A H    4  
ATOM 10055 H HA   . GLN A 1 79  ? 20.572  4.610   0.188   1.00 0.00 ? 79  GLN A HA   4  
ATOM 10056 H HB2  . GLN A 1 79  ? 20.915  6.170   1.985   1.00 0.00 ? 79  GLN A HB2  4  
ATOM 10057 H HB3  . GLN A 1 79  ? 19.992  6.979   0.715   1.00 0.00 ? 79  GLN A HB3  4  
ATOM 10058 H HG2  . GLN A 1 79  ? 17.894  6.298   2.116   1.00 0.00 ? 79  GLN A HG2  4  
ATOM 10059 H HG3  . GLN A 1 79  ? 19.052  6.000   3.423   1.00 0.00 ? 79  GLN A HG3  4  
ATOM 10060 H HE21 . GLN A 1 79  ? 19.839  7.855   4.582   1.00 0.00 ? 79  GLN A HE21 4  
ATOM 10061 H HE22 . GLN A 1 79  ? 19.317  9.458   4.211   1.00 0.00 ? 79  GLN A HE22 4  
ATOM 10062 N N    . TYR A 1 80  ? 18.469  2.922   1.702   1.00 0.00 ? 80  TYR A N    4  
ATOM 10063 C CA   . TYR A 1 80  ? 18.229  1.774   2.516   1.00 0.00 ? 80  TYR A CA   4  
ATOM 10064 C C    . TYR A 1 80  ? 18.180  0.546   1.613   1.00 0.00 ? 80  TYR A C    4  
ATOM 10065 O O    . TYR A 1 80  ? 17.626  0.594   0.504   1.00 0.00 ? 80  TYR A O    4  
ATOM 10066 C CB   . TYR A 1 80  ? 16.932  2.017   3.278   1.00 0.00 ? 80  TYR A CB   4  
ATOM 10067 C CG   . TYR A 1 80  ? 16.476  3.451   3.441   1.00 0.00 ? 80  TYR A CG   4  
ATOM 10068 C CD1  . TYR A 1 80  ? 16.994  4.237   4.477   1.00 0.00 ? 80  TYR A CD1  4  
ATOM 10069 C CD2  . TYR A 1 80  ? 15.574  4.007   2.521   1.00 0.00 ? 80  TYR A CD2  4  
ATOM 10070 C CE1  . TYR A 1 80  ? 16.572  5.563   4.652   1.00 0.00 ? 80  TYR A CE1  4  
ATOM 10071 C CE2  . TYR A 1 80  ? 15.165  5.339   2.658   1.00 0.00 ? 80  TYR A CE2  4  
ATOM 10072 C CZ   . TYR A 1 80  ? 15.635  6.116   3.742   1.00 0.00 ? 80  TYR A CZ   4  
ATOM 10073 O OH   . TYR A 1 80  ? 15.174  7.383   3.911   1.00 0.00 ? 80  TYR A OH   4  
ATOM 10074 H H    . TYR A 1 80  ? 17.634  3.092   1.170   1.00 0.00 ? 80  TYR A H    4  
ATOM 10075 H HA   . TYR A 1 80  ? 19.038  1.649   3.227   1.00 0.00 ? 80  TYR A HA   4  
ATOM 10076 H HB2  . TYR A 1 80  ? 16.134  1.486   2.761   1.00 0.00 ? 80  TYR A HB2  4  
ATOM 10077 H HB3  . TYR A 1 80  ? 17.089  1.592   4.265   1.00 0.00 ? 80  TYR A HB3  4  
ATOM 10078 H HD1  . TYR A 1 80  ? 17.714  3.808   5.153   1.00 0.00 ? 80  TYR A HD1  4  
ATOM 10079 H HD2  . TYR A 1 80  ? 15.176  3.400   1.721   1.00 0.00 ? 80  TYR A HD2  4  
ATOM 10080 H HE1  . TYR A 1 80  ? 16.989  6.119   5.486   1.00 0.00 ? 80  TYR A HE1  4  
ATOM 10081 H HE2  . TYR A 1 80  ? 14.469  5.731   1.935   1.00 0.00 ? 80  TYR A HE2  4  
ATOM 10082 H HH   . TYR A 1 80  ? 14.691  7.728   3.131   1.00 0.00 ? 80  TYR A HH   4  
ATOM 10083 N N    . VAL A 1 81  ? 18.788  -0.530  2.100   1.00 0.00 ? 81  VAL A N    4  
ATOM 10084 C CA   . VAL A 1 81  ? 18.823  -1.844  1.491   1.00 0.00 ? 81  VAL A CA   4  
ATOM 10085 C C    . VAL A 1 81  ? 17.590  -2.579  2.007   1.00 0.00 ? 81  VAL A C    4  
ATOM 10086 O O    . VAL A 1 81  ? 17.575  -3.136  3.109   1.00 0.00 ? 81  VAL A O    4  
ATOM 10087 C CB   . VAL A 1 81  ? 20.160  -2.515  1.840   1.00 0.00 ? 81  VAL A CB   4  
ATOM 10088 C CG1  . VAL A 1 81  ? 20.246  -3.934  1.289   1.00 0.00 ? 81  VAL A CG1  4  
ATOM 10089 C CG2  . VAL A 1 81  ? 21.298  -1.698  1.216   1.00 0.00 ? 81  VAL A CG2  4  
ATOM 10090 H H    . VAL A 1 81  ? 19.122  -0.501  3.053   1.00 0.00 ? 81  VAL A H    4  
ATOM 10091 H HA   . VAL A 1 81  ? 18.756  -1.744  0.410   1.00 0.00 ? 81  VAL A HA   4  
ATOM 10092 H HB   . VAL A 1 81  ? 20.293  -2.540  2.925   1.00 0.00 ? 81  VAL A HB   4  
ATOM 10093 H HG11 . VAL A 1 81  ? 20.140  -3.917  0.207   1.00 0.00 ? 81  VAL A HG11 4  
ATOM 10094 H HG12 . VAL A 1 81  ? 21.211  -4.365  1.545   1.00 0.00 ? 81  VAL A HG12 4  
ATOM 10095 H HG13 . VAL A 1 81  ? 19.450  -4.552  1.706   1.00 0.00 ? 81  VAL A HG13 4  
ATOM 10096 H HG21 . VAL A 1 81  ? 22.261  -2.112  1.511   1.00 0.00 ? 81  VAL A HG21 4  
ATOM 10097 H HG22 . VAL A 1 81  ? 21.213  -1.737  0.131   1.00 0.00 ? 81  VAL A HG22 4  
ATOM 10098 H HG23 . VAL A 1 81  ? 21.239  -0.656  1.534   1.00 0.00 ? 81  VAL A HG23 4  
ATOM 10099 N N    . VAL A 1 82  ? 16.483  -2.411  1.294   1.00 0.00 ? 82  VAL A N    4  
ATOM 10100 C CA   . VAL A 1 82  ? 15.199  -3.006  1.635   1.00 0.00 ? 82  VAL A CA   4  
ATOM 10101 C C    . VAL A 1 82  ? 15.332  -4.525  1.544   1.00 0.00 ? 82  VAL A C    4  
ATOM 10102 O O    . VAL A 1 82  ? 16.342  -5.036  1.056   1.00 0.00 ? 82  VAL A O    4  
ATOM 10103 C CB   . VAL A 1 82  ? 14.140  -2.402  0.701   1.00 0.00 ? 82  VAL A CB   4  
ATOM 10104 C CG1  . VAL A 1 82  ? 14.073  -3.076  -0.672  1.00 0.00 ? 82  VAL A CG1  4  
ATOM 10105 C CG2  . VAL A 1 82  ? 12.774  -2.377  1.386   1.00 0.00 ? 82  VAL A CG2  4  
ATOM 10106 H H    . VAL A 1 82  ? 16.582  -1.987  0.390   1.00 0.00 ? 82  VAL A H    4  
ATOM 10107 H HA   . VAL A 1 82  ? 14.922  -2.755  2.659   1.00 0.00 ? 82  VAL A HA   4  
ATOM 10108 H HB   . VAL A 1 82  ? 14.422  -1.369  0.518   1.00 0.00 ? 82  VAL A HB   4  
ATOM 10109 H HG11 . VAL A 1 82  ? 13.307  -2.600  -1.283  1.00 0.00 ? 82  VAL A HG11 4  
ATOM 10110 H HG12 . VAL A 1 82  ? 15.032  -2.968  -1.174  1.00 0.00 ? 82  VAL A HG12 4  
ATOM 10111 H HG13 . VAL A 1 82  ? 13.839  -4.136  -0.566  1.00 0.00 ? 82  VAL A HG13 4  
ATOM 10112 H HG21 . VAL A 1 82  ? 12.450  -3.382  1.658   1.00 0.00 ? 82  VAL A HG21 4  
ATOM 10113 H HG22 . VAL A 1 82  ? 12.838  -1.789  2.303   1.00 0.00 ? 82  VAL A HG22 4  
ATOM 10114 H HG23 . VAL A 1 82  ? 12.040  -1.917  0.725   1.00 0.00 ? 82  VAL A HG23 4  
ATOM 10115 N N    . ASP A 1 83  ? 14.297  -5.270  1.919   1.00 0.00 ? 83  ASP A N    4  
ATOM 10116 C CA   . ASP A 1 83  ? 14.315  -6.691  1.628   1.00 0.00 ? 83  ASP A CA   4  
ATOM 10117 C C    . ASP A 1 83  ? 12.906  -7.194  1.371   1.00 0.00 ? 83  ASP A C    4  
ATOM 10118 O O    . ASP A 1 83  ? 11.990  -6.876  2.123   1.00 0.00 ? 83  ASP A O    4  
ATOM 10119 C CB   . ASP A 1 83  ? 15.031  -7.420  2.776   1.00 0.00 ? 83  ASP A CB   4  
ATOM 10120 C CG   . ASP A 1 83  ? 15.997  -8.472  2.204   1.00 0.00 ? 83  ASP A CG   4  
ATOM 10121 O OD1  . ASP A 1 83  ? 15.726  -9.004  1.097   1.00 0.00 ? 83  ASP A OD1  4  
ATOM 10122 O OD2  . ASP A 1 83  ? 17.035  -8.781  2.827   1.00 0.00 ? 83  ASP A OD2  4  
ATOM 10123 H H    . ASP A 1 83  ? 13.518  -4.875  2.432   1.00 0.00 ? 83  ASP A H    4  
ATOM 10124 H HA   . ASP A 1 83  ? 14.887  -6.834  0.708   1.00 0.00 ? 83  ASP A HA   4  
ATOM 10125 H HB2  . ASP A 1 83  ? 15.560  -6.661  3.383   1.00 0.00 ? 83  ASP A HB2  4  
ATOM 10126 H HB3  . ASP A 1 83  ? 14.303  -7.915  3.417   1.00 0.00 ? 83  ASP A HB3  4  
ATOM 10127 N N    . LEU A 1 84  ? 12.694  -7.971  0.311   1.00 0.00 ? 84  LEU A N    4  
ATOM 10128 C CA   . LEU A 1 84  ? 11.398  -8.584  0.006   1.00 0.00 ? 84  LEU A CA   4  
ATOM 10129 C C    . LEU A 1 84  ? 10.973  -9.488  1.164   1.00 0.00 ? 84  LEU A C    4  
ATOM 10130 O O    . LEU A 1 84  ? 9.801   -9.549  1.526   1.00 0.00 ? 84  LEU A O    4  
ATOM 10131 C CB   . LEU A 1 84  ? 11.502  -9.401  -1.291  1.00 0.00 ? 84  LEU A CB   4  
ATOM 10132 C CG   . LEU A 1 84  ? 11.307  -8.626  -2.615  1.00 0.00 ? 84  LEU A CG   4  
ATOM 10133 C CD1  . LEU A 1 84  ? 9.848   -8.234  -2.850  1.00 0.00 ? 84  LEU A CD1  4  
ATOM 10134 C CD2  . LEU A 1 84  ? 12.124  -7.337  -2.724  1.00 0.00 ? 84  LEU A CD2  4  
ATOM 10135 H H    . LEU A 1 84  ? 13.495  -8.252  -0.235  1.00 0.00 ? 84  LEU A H    4  
ATOM 10136 H HA   . LEU A 1 84  ? 10.647  -7.806  -0.106  1.00 0.00 ? 84  LEU A HA   4  
ATOM 10137 H HB2  . LEU A 1 84  ? 12.471  -9.900  -1.290  1.00 0.00 ? 84  LEU A HB2  4  
ATOM 10138 H HB3  . LEU A 1 84  ? 10.762  -10.202 -1.252  1.00 0.00 ? 84  LEU A HB3  4  
ATOM 10139 H HG   . LEU A 1 84  ? 11.610  -9.282  -3.431  1.00 0.00 ? 84  LEU A HG   4  
ATOM 10140 H HD11 . LEU A 1 84  ? 9.479   -7.607  -2.038  1.00 0.00 ? 84  LEU A HD11 4  
ATOM 10141 H HD12 . LEU A 1 84  ? 9.784   -7.685  -3.791  1.00 0.00 ? 84  LEU A HD12 4  
ATOM 10142 H HD13 . LEU A 1 84  ? 9.243   -9.137  -2.911  1.00 0.00 ? 84  LEU A HD13 4  
ATOM 10143 H HD21 . LEU A 1 84  ? 13.179  -7.581  -2.631  1.00 0.00 ? 84  LEU A HD21 4  
ATOM 10144 H HD22 . LEU A 1 84  ? 11.932  -6.861  -3.690  1.00 0.00 ? 84  LEU A HD22 4  
ATOM 10145 H HD23 . LEU A 1 84  ? 11.828  -6.648  -1.933  1.00 0.00 ? 84  LEU A HD23 4  
ATOM 10146 N N    . THR A 1 85  ? 11.941  -10.139 1.785   1.00 0.00 ? 85  THR A N    4  
ATOM 10147 C CA   . THR A 1 85  ? 11.792  -10.927 2.984   1.00 0.00 ? 85  THR A CA   4  
ATOM 10148 C C    . THR A 1 85  ? 11.162  -10.102 4.104   1.00 0.00 ? 85  THR A C    4  
ATOM 10149 O O    . THR A 1 85  ? 10.287  -10.618 4.790   1.00 0.00 ? 85  THR A O    4  
ATOM 10150 C CB   . THR A 1 85  ? 13.175  -11.438 3.384   1.00 0.00 ? 85  THR A CB   4  
ATOM 10151 O OG1  . THR A 1 85  ? 13.662  -12.354 2.429   1.00 0.00 ? 85  THR A OG1  4  
ATOM 10152 C CG2  . THR A 1 85  ? 13.135  -12.139 4.749   1.00 0.00 ? 85  THR A CG2  4  
ATOM 10153 H H    . THR A 1 85  ? 12.852  -10.093 1.351   1.00 0.00 ? 85  THR A H    4  
ATOM 10154 H HA   . THR A 1 85  ? 11.148  -11.781 2.772   1.00 0.00 ? 85  THR A HA   4  
ATOM 10155 H HB   . THR A 1 85  ? 13.851  -10.584 3.391   1.00 0.00 ? 85  THR A HB   4  
ATOM 10156 H HG1  . THR A 1 85  ? 13.763  -11.887 1.569   1.00 0.00 ? 85  THR A HG1  4  
ATOM 10157 H HG21 . THR A 1 85  ? 12.392  -12.931 4.713   1.00 0.00 ? 85  THR A HG21 4  
ATOM 10158 H HG22 . THR A 1 85  ? 14.106  -12.568 4.988   1.00 0.00 ? 85  THR A HG22 4  
ATOM 10159 H HG23 . THR A 1 85  ? 12.848  -11.440 5.539   1.00 0.00 ? 85  THR A HG23 4  
ATOM 10160 N N    . SER A 1 86  ? 11.571  -8.846  4.334   1.00 0.00 ? 86  SER A N    4  
ATOM 10161 C CA   . SER A 1 86  ? 11.110  -8.095  5.494   1.00 0.00 ? 86  SER A CA   4  
ATOM 10162 C C    . SER A 1 86  ? 9.590   -7.867  5.424   1.00 0.00 ? 86  SER A C    4  
ATOM 10163 O O    . SER A 1 86  ? 8.920   -7.813  6.458   1.00 0.00 ? 86  SER A O    4  
ATOM 10164 C CB   . SER A 1 86  ? 11.909  -6.796  5.555   1.00 0.00 ? 86  SER A CB   4  
ATOM 10165 O OG   . SER A 1 86  ? 11.543  -5.984  4.465   1.00 0.00 ? 86  SER A OG   4  
ATOM 10166 H H    . SER A 1 86  ? 12.193  -8.336  3.721   1.00 0.00 ? 86  SER A H    4  
ATOM 10167 H HA   . SER A 1 86  ? 11.339  -8.671  6.389   1.00 0.00 ? 86  SER A HA   4  
ATOM 10168 H HB2  . SER A 1 86  ? 11.689  -6.273  6.484   1.00 0.00 ? 86  SER A HB2  4  
ATOM 10169 H HB3  . SER A 1 86  ? 12.980  -7.009  5.517   1.00 0.00 ? 86  SER A HB3  4  
ATOM 10170 H HG   . SER A 1 86  ? 11.818  -6.373  3.609   1.00 0.00 ? 86  SER A HG   4  
ATOM 10171 N N    . PHE A 1 87  ? 9.055   -7.790  4.198   1.00 0.00 ? 87  PHE A N    4  
ATOM 10172 C CA   . PHE A 1 87  ? 7.636   -7.828  3.911   1.00 0.00 ? 87  PHE A CA   4  
ATOM 10173 C C    . PHE A 1 87  ? 7.074   -9.215  4.187   1.00 0.00 ? 87  PHE A C    4  
ATOM 10174 O O    . PHE A 1 87  ? 6.097   -9.315  4.922   1.00 0.00 ? 87  PHE A O    4  
ATOM 10175 C CB   . PHE A 1 87  ? 7.372   -7.445  2.445   1.00 0.00 ? 87  PHE A CB   4  
ATOM 10176 C CG   . PHE A 1 87  ? 7.231   -5.969  2.139   1.00 0.00 ? 87  PHE A CG   4  
ATOM 10177 C CD1  . PHE A 1 87  ? 6.505   -5.118  2.990   1.00 0.00 ? 87  PHE A CD1  4  
ATOM 10178 C CD2  . PHE A 1 87  ? 7.755   -5.462  0.940   1.00 0.00 ? 87  PHE A CD2  4  
ATOM 10179 C CE1  . PHE A 1 87  ? 6.292   -3.774  2.653   1.00 0.00 ? 87  PHE A CE1  4  
ATOM 10180 C CE2  . PHE A 1 87  ? 7.528   -4.120  0.591   1.00 0.00 ? 87  PHE A CE2  4  
ATOM 10181 C CZ   . PHE A 1 87  ? 6.777   -3.278  1.432   1.00 0.00 ? 87  PHE A CZ   4  
ATOM 10182 H H    . PHE A 1 87  ? 9.689   -7.816  3.413   1.00 0.00 ? 87  PHE A H    4  
ATOM 10183 H HA   . PHE A 1 87  ? 7.133   -7.138  4.583   1.00 0.00 ? 87  PHE A HA   4  
ATOM 10184 H HB2  . PHE A 1 87  ? 8.176   -7.846  1.830   1.00 0.00 ? 87  PHE A HB2  4  
ATOM 10185 H HB3  . PHE A 1 87  ? 6.450   -7.927  2.113   1.00 0.00 ? 87  PHE A HB3  4  
ATOM 10186 H HD1  . PHE A 1 87  ? 6.085   -5.489  3.905   1.00 0.00 ? 87  PHE A HD1  4  
ATOM 10187 H HD2  . PHE A 1 87  ? 8.311   -6.113  0.279   1.00 0.00 ? 87  PHE A HD2  4  
ATOM 10188 H HE1  . PHE A 1 87  ? 5.744   -3.144  3.339   1.00 0.00 ? 87  PHE A HE1  4  
ATOM 10189 H HE2  . PHE A 1 87  ? 7.940   -3.742  -0.331  1.00 0.00 ? 87  PHE A HE2  4  
ATOM 10190 H HZ   . PHE A 1 87  ? 6.574   -2.254  1.148   1.00 0.00 ? 87  PHE A HZ   4  
ATOM 10191 N N    . GLU A 1 88  ? 7.658   -10.273 3.616   1.00 0.00 ? 88  GLU A N    4  
ATOM 10192 C CA   . GLU A 1 88  ? 7.174   -11.652 3.746   1.00 0.00 ? 88  GLU A CA   4  
ATOM 10193 C C    . GLU A 1 88  ? 6.858   -12.019 5.200   1.00 0.00 ? 88  GLU A C    4  
ATOM 10194 O O    . GLU A 1 88  ? 5.890   -12.738 5.456   1.00 0.00 ? 88  GLU A O    4  
ATOM 10195 C CB   . GLU A 1 88  ? 8.186   -12.635 3.130   1.00 0.00 ? 88  GLU A CB   4  
ATOM 10196 C CG   . GLU A 1 88  ? 7.674   -14.080 3.234   1.00 0.00 ? 88  GLU A CG   4  
ATOM 10197 C CD   . GLU A 1 88  ? 8.559   -15.108 2.533   1.00 0.00 ? 88  GLU A CD   4  
ATOM 10198 O OE1  . GLU A 1 88  ? 9.799   -15.040 2.673   1.00 0.00 ? 88  GLU A OE1  4  
ATOM 10199 O OE2  . GLU A 1 88  ? 7.975   -16.009 1.890   1.00 0.00 ? 88  GLU A OE2  4  
ATOM 10200 H H    . GLU A 1 88  ? 8.512   -10.128 3.089   1.00 0.00 ? 88  GLU A H    4  
ATOM 10201 H HA   . GLU A 1 88  ? 6.247   -11.742 3.186   1.00 0.00 ? 88  GLU A HA   4  
ATOM 10202 H HB2  . GLU A 1 88  ? 8.341   -12.374 2.081   1.00 0.00 ? 88  GLU A HB2  4  
ATOM 10203 H HB3  . GLU A 1 88  ? 9.136   -12.564 3.657   1.00 0.00 ? 88  GLU A HB3  4  
ATOM 10204 H HG2  . GLU A 1 88  ? 7.616   -14.371 4.284   1.00 0.00 ? 88  GLU A HG2  4  
ATOM 10205 H HG3  . GLU A 1 88  ? 6.670   -14.120 2.805   1.00 0.00 ? 88  GLU A HG3  4  
ATOM 10206 N N    . GLN A 1 89  ? 7.634   -11.493 6.148   1.00 0.00 ? 89  GLN A N    4  
ATOM 10207 C CA   . GLN A 1 89  ? 7.480   -11.784 7.563   1.00 0.00 ? 89  GLN A CA   4  
ATOM 10208 C C    . GLN A 1 89  ? 6.102   -11.431 8.119   1.00 0.00 ? 89  GLN A C    4  
ATOM 10209 O O    . GLN A 1 89  ? 5.678   -12.061 9.090   1.00 0.00 ? 89  GLN A O    4  
ATOM 10210 C CB   . GLN A 1 89  ? 8.527   -11.025 8.385   1.00 0.00 ? 89  GLN A CB   4  
ATOM 10211 C CG   . GLN A 1 89  ? 9.936   -11.029 7.818   1.00 0.00 ? 89  GLN A CG   4  
ATOM 10212 C CD   . GLN A 1 89  ? 11.000  -10.671 8.832   1.00 0.00 ? 89  GLN A CD   4  
ATOM 10213 O OE1  . GLN A 1 89  ? 11.885  -11.466 9.135   1.00 0.00 ? 89  GLN A OE1  4  
ATOM 10214 N NE2  . GLN A 1 89  ? 10.976  -9.456  9.339   1.00 0.00 ? 89  GLN A NE2  4  
ATOM 10215 H H    . GLN A 1 89  ? 8.429   -10.951 5.830   1.00 0.00 ? 89  GLN A H    4  
ATOM 10216 H HA   . GLN A 1 89  ? 7.613   -12.852 7.683   1.00 0.00 ? 89  GLN A HA   4  
ATOM 10217 H HB2  . GLN A 1 89  ? 8.265   -9.984  8.369   1.00 0.00 ? 89  GLN A HB2  4  
ATOM 10218 H HB3  . GLN A 1 89  ? 8.495   -11.361 9.418   1.00 0.00 ? 89  GLN A HB3  4  
ATOM 10219 H HG2  . GLN A 1 89  ? 10.177  -11.981 7.363   1.00 0.00 ? 89  GLN A HG2  4  
ATOM 10220 H HG3  . GLN A 1 89  ? 9.925   -10.247 7.068   1.00 0.00 ? 89  GLN A HG3  4  
ATOM 10221 H HE21 . GLN A 1 89  ? 10.260  -8.797  9.085   1.00 0.00 ? 89  GLN A HE21 4  
ATOM 10222 H HE22 . GLN A 1 89  ? 11.733  -9.219  9.976   1.00 0.00 ? 89  GLN A HE22 4  
ATOM 10223 N N    . LEU A 1 90  ? 5.438   -10.392 7.600   1.00 0.00 ? 90  LEU A N    4  
ATOM 10224 C CA   . LEU A 1 90  ? 4.204   -9.883  8.194   1.00 0.00 ? 90  LEU A CA   4  
ATOM 10225 C C    . LEU A 1 90  ? 3.199   -9.373  7.161   1.00 0.00 ? 90  LEU A C    4  
ATOM 10226 O O    . LEU A 1 90  ? 2.000   -9.587  7.313   1.00 0.00 ? 90  LEU A O    4  
ATOM 10227 C CB   . LEU A 1 90  ? 4.549   -8.799  9.230   1.00 0.00 ? 90  LEU A CB   4  
ATOM 10228 C CG   . LEU A 1 90  ? 5.319   -7.569  8.691   1.00 0.00 ? 90  LEU A CG   4  
ATOM 10229 C CD1  . LEU A 1 90  ? 4.646   -6.277  9.168   1.00 0.00 ? 90  LEU A CD1  4  
ATOM 10230 C CD2  . LEU A 1 90  ? 6.747   -7.455  9.153   1.00 0.00 ? 90  LEU A CD2  4  
ATOM 10231 H H    . LEU A 1 90  ? 5.862   -9.870  6.836   1.00 0.00 ? 90  LEU A H    4  
ATOM 10232 H HA   . LEU A 1 90  ? 3.707   -10.694 8.728   1.00 0.00 ? 90  LEU A HA   4  
ATOM 10233 H HB2  . LEU A 1 90  ? 3.607   -8.477  9.665   1.00 0.00 ? 90  LEU A HB2  4  
ATOM 10234 H HB3  . LEU A 1 90  ? 5.116   -9.254  10.039  1.00 0.00 ? 90  LEU A HB3  4  
ATOM 10235 H HG   . LEU A 1 90  ? 5.455   -7.624  7.615   1.00 0.00 ? 90  LEU A HG   4  
ATOM 10236 H HD11 . LEU A 1 90  ? 5.273   -5.413  8.994   1.00 0.00 ? 90  LEU A HD11 4  
ATOM 10237 H HD12 . LEU A 1 90  ? 3.707   -6.136  8.640   1.00 0.00 ? 90  LEU A HD12 4  
ATOM 10238 H HD13 . LEU A 1 90  ? 4.492   -6.326  10.247  1.00 0.00 ? 90  LEU A HD13 4  
ATOM 10239 H HD21 . LEU A 1 90  ? 7.291   -8.336  8.879   1.00 0.00 ? 90  LEU A HD21 4  
ATOM 10240 H HD22 . LEU A 1 90  ? 7.198   -6.616  8.609   1.00 0.00 ? 90  LEU A HD22 4  
ATOM 10241 H HD23 . LEU A 1 90  ? 6.788   -7.325  10.229  1.00 0.00 ? 90  LEU A HD23 4  
ATOM 10242 N N    . ALA A 1 91  ? 3.673   -8.755  6.084   1.00 0.00 ? 91  ALA A N    4  
ATOM 10243 C CA   . ALA A 1 91  ? 2.906   -8.141  4.999   1.00 0.00 ? 91  ALA A CA   4  
ATOM 10244 C C    . ALA A 1 91  ? 2.510   -9.175  3.937   1.00 0.00 ? 91  ALA A C    4  
ATOM 10245 O O    . ALA A 1 91  ? 2.426   -8.857  2.753   1.00 0.00 ? 91  ALA A O    4  
ATOM 10246 C CB   . ALA A 1 91  ? 3.761   -7.020  4.404   1.00 0.00 ? 91  ALA A CB   4  
ATOM 10247 H H    . ALA A 1 91  ? 4.676   -8.826  5.935   1.00 0.00 ? 91  ALA A H    4  
ATOM 10248 H HA   . ALA A 1 91  ? 1.982   -7.703  5.391   1.00 0.00 ? 91  ALA A HA   4  
ATOM 10249 H HB1  . ALA A 1 91  ? 3.206   -6.491  3.634   1.00 0.00 ? 91  ALA A HB1  4  
ATOM 10250 H HB2  . ALA A 1 91  ? 4.030   -6.321  5.190   1.00 0.00 ? 91  ALA A HB2  4  
ATOM 10251 H HB3  . ALA A 1 91  ? 4.654   -7.435  3.945   1.00 0.00 ? 91  ALA A HB3  4  
ATOM 10252 N N    . LEU A 1 92  ? 2.295   -10.419 4.366   1.00 0.00 ? 92  LEU A N    4  
ATOM 10253 C CA   . LEU A 1 92  ? 1.881   -11.561 3.559   1.00 0.00 ? 92  LEU A CA   4  
ATOM 10254 C C    . LEU A 1 92  ? 0.607   -12.149 4.171   1.00 0.00 ? 92  LEU A C    4  
ATOM 10255 O O    . LEU A 1 92  ? -0.429  -12.050 3.517   1.00 0.00 ? 92  LEU A O    4  
ATOM 10256 C CB   . LEU A 1 92  ? 3.028   -12.583 3.397   1.00 0.00 ? 92  LEU A CB   4  
ATOM 10257 C CG   . LEU A 1 92  ? 3.691   -12.630 2.006   1.00 0.00 ? 92  LEU A CG   4  
ATOM 10258 C CD1  . LEU A 1 92  ? 2.794   -13.335 0.984   1.00 0.00 ? 92  LEU A CD1  4  
ATOM 10259 C CD2  . LEU A 1 92  ? 4.107   -11.254 1.464   1.00 0.00 ? 92  LEU A CD2  4  
ATOM 10260 H H    . LEU A 1 92  ? 2.346   -10.556 5.366   1.00 0.00 ? 92  LEU A H    4  
ATOM 10261 H HA   . LEU A 1 92  ? 1.612   -11.202 2.568   1.00 0.00 ? 92  LEU A HA   4  
ATOM 10262 H HB2  . LEU A 1 92  ? 3.797   -12.367 4.135   1.00 0.00 ? 92  LEU A HB2  4  
ATOM 10263 H HB3  . LEU A 1 92  ? 2.654   -13.584 3.620   1.00 0.00 ? 92  LEU A HB3  4  
ATOM 10264 H HG   . LEU A 1 92  ? 4.598   -13.226 2.107   1.00 0.00 ? 92  LEU A HG   4  
ATOM 10265 H HD11 . LEU A 1 92  ? 1.833   -12.829 0.895   1.00 0.00 ? 92  LEU A HD11 4  
ATOM 10266 H HD12 . LEU A 1 92  ? 3.284   -13.363 0.012   1.00 0.00 ? 92  LEU A HD12 4  
ATOM 10267 H HD13 . LEU A 1 92  ? 2.633   -14.363 1.303   1.00 0.00 ? 92  LEU A HD13 4  
ATOM 10268 H HD21 . LEU A 1 92  ? 4.570   -10.663 2.254   1.00 0.00 ? 92  LEU A HD21 4  
ATOM 10269 H HD22 . LEU A 1 92  ? 4.820   -11.380 0.652   1.00 0.00 ? 92  LEU A HD22 4  
ATOM 10270 H HD23 . LEU A 1 92  ? 3.238   -10.714 1.088   1.00 0.00 ? 92  LEU A HD23 4  
ATOM 10271 N N    . PRO A 1 93  ? 0.602   -12.679 5.415   1.00 0.00 ? 93  PRO A N    4  
ATOM 10272 C CA   . PRO A 1 93  ? -0.618  -13.229 6.008   1.00 0.00 ? 93  PRO A CA   4  
ATOM 10273 C C    . PRO A 1 93  ? -1.736  -12.190 6.165   1.00 0.00 ? 93  PRO A C    4  
ATOM 10274 O O    . PRO A 1 93  ? -2.906  -12.552 6.093   1.00 0.00 ? 93  PRO A O    4  
ATOM 10275 C CB   . PRO A 1 93  ? -0.205  -13.839 7.352   1.00 0.00 ? 93  PRO A CB   4  
ATOM 10276 C CG   . PRO A 1 93  ? 1.108   -13.135 7.689   1.00 0.00 ? 93  PRO A CG   4  
ATOM 10277 C CD   . PRO A 1 93  ? 1.729   -12.894 6.316   1.00 0.00 ? 93  PRO A CD   4  
ATOM 10278 H HA   . PRO A 1 93  ? -0.997  -14.026 5.366   1.00 0.00 ? 93  PRO A HA   4  
ATOM 10279 H HB2  . PRO A 1 93  ? -0.958  -13.675 8.124   1.00 0.00 ? 93  PRO A HB2  4  
ATOM 10280 H HB3  . PRO A 1 93  ? -0.020  -14.907 7.223   1.00 0.00 ? 93  PRO A HB3  4  
ATOM 10281 H HG2  . PRO A 1 93  ? 0.899   -12.178 8.170   1.00 0.00 ? 93  PRO A HG2  4  
ATOM 10282 H HG3  . PRO A 1 93  ? 1.751   -13.750 8.319   1.00 0.00 ? 93  PRO A HG3  4  
ATOM 10283 H HD2  . PRO A 1 93  ? 2.406   -12.044 6.359   1.00 0.00 ? 93  PRO A HD2  4  
ATOM 10284 H HD3  . PRO A 1 93  ? 2.272   -13.788 6.005   1.00 0.00 ? 93  PRO A HD3  4  
ATOM 10285 N N    . VAL A 1 94  ? -1.414  -10.900 6.303   1.00 0.00 ? 94  VAL A N    4  
ATOM 10286 C CA   . VAL A 1 94  ? -2.415  -9.834  6.326   1.00 0.00 ? 94  VAL A CA   4  
ATOM 10287 C C    . VAL A 1 94  ? -3.273  -9.781  5.060   1.00 0.00 ? 94  VAL A C    4  
ATOM 10288 O O    . VAL A 1 94  ? -4.406  -9.308  5.137   1.00 0.00 ? 94  VAL A O    4  
ATOM 10289 C CB   . VAL A 1 94  ? -1.755  -8.465  6.567   1.00 0.00 ? 94  VAL A CB   4  
ATOM 10290 C CG1  . VAL A 1 94  ? -1.327  -8.317  8.022   1.00 0.00 ? 94  VAL A CG1  4  
ATOM 10291 C CG2  . VAL A 1 94  ? -0.583  -8.165  5.632   1.00 0.00 ? 94  VAL A CG2  4  
ATOM 10292 H H    . VAL A 1 94  ? -0.444  -10.635 6.389   1.00 0.00 ? 94  VAL A H    4  
ATOM 10293 H HA   . VAL A 1 94  ? -3.100  -10.037 7.151   1.00 0.00 ? 94  VAL A HA   4  
ATOM 10294 H HB   . VAL A 1 94  ? -2.481  -7.684  6.383   1.00 0.00 ? 94  VAL A HB   4  
ATOM 10295 H HG11 . VAL A 1 94  ? -2.186  -8.494  8.669   1.00 0.00 ? 94  VAL A HG11 4  
ATOM 10296 H HG12 . VAL A 1 94  ? -0.532  -9.023  8.261   1.00 0.00 ? 94  VAL A HG12 4  
ATOM 10297 H HG13 . VAL A 1 94  ? -0.993  -7.295  8.177   1.00 0.00 ? 94  VAL A HG13 4  
ATOM 10298 H HG21 . VAL A 1 94  ? -0.129  -7.221  5.932   1.00 0.00 ? 94  VAL A HG21 4  
ATOM 10299 H HG22 . VAL A 1 94  ? 0.161   -8.952  5.686   1.00 0.00 ? 94  VAL A HG22 4  
ATOM 10300 H HG23 . VAL A 1 94  ? -0.941  -8.076  4.608   1.00 0.00 ? 94  VAL A HG23 4  
ATOM 10301 N N    . LEU A 1 95  ? -2.772  -10.247 3.907   1.00 0.00 ? 95  LEU A N    4  
ATOM 10302 C CA   . LEU A 1 95  ? -3.575  -10.271 2.689   1.00 0.00 ? 95  LEU A CA   4  
ATOM 10303 C C    . LEU A 1 95  ? -4.641  -11.369 2.745   1.00 0.00 ? 95  LEU A C    4  
ATOM 10304 O O    . LEU A 1 95  ? -5.639  -11.259 2.039   1.00 0.00 ? 95  LEU A O    4  
ATOM 10305 C CB   . LEU A 1 95  ? -2.720  -10.436 1.417   1.00 0.00 ? 95  LEU A CB   4  
ATOM 10306 C CG   . LEU A 1 95  ? -1.854  -9.245  0.954   1.00 0.00 ? 95  LEU A CG   4  
ATOM 10307 C CD1  . LEU A 1 95  ? -2.425  -7.863  1.262   1.00 0.00 ? 95  LEU A CD1  4  
ATOM 10308 C CD2  . LEU A 1 95  ? -0.425  -9.264  1.473   1.00 0.00 ? 95  LEU A CD2  4  
ATOM 10309 H H    . LEU A 1 95  ? -1.857  -10.681 3.901   1.00 0.00 ? 95  LEU A H    4  
ATOM 10310 H HA   . LEU A 1 95  ? -4.115  -9.327  2.616   1.00 0.00 ? 95  LEU A HA   4  
ATOM 10311 H HB2  . LEU A 1 95  ? -2.107  -11.333 1.501   1.00 0.00 ? 95  LEU A HB2  4  
ATOM 10312 H HB3  . LEU A 1 95  ? -3.415  -10.628 0.599   1.00 0.00 ? 95  LEU A HB3  4  
ATOM 10313 H HG   . LEU A 1 95  ? -1.779  -9.322  -0.129  1.00 0.00 ? 95  LEU A HG   4  
ATOM 10314 H HD11 . LEU A 1 95  ? -3.445  -7.814  0.899   1.00 0.00 ? 95  LEU A HD11 4  
ATOM 10315 H HD12 . LEU A 1 95  ? -2.413  -7.662  2.337   1.00 0.00 ? 95  LEU A HD12 4  
ATOM 10316 H HD13 . LEU A 1 95  ? -1.827  -7.102  0.763   1.00 0.00 ? 95  LEU A HD13 4  
ATOM 10317 H HD21 . LEU A 1 95  ? -0.381  -8.921  2.504   1.00 0.00 ? 95  LEU A HD21 4  
ATOM 10318 H HD22 . LEU A 1 95  ? -0.030  -10.273 1.427   1.00 0.00 ? 95  LEU A HD22 4  
ATOM 10319 H HD23 . LEU A 1 95  ? 0.174   -8.616  0.830   1.00 0.00 ? 95  LEU A HD23 4  
ATOM 10320 N N    . ARG A 1 96  ? -4.473  -12.432 3.538   1.00 0.00 ? 96  ARG A N    4  
ATOM 10321 C CA   . ARG A 1 96  ? -5.520  -13.416 3.800   1.00 0.00 ? 96  ARG A CA   4  
ATOM 10322 C C    . ARG A 1 96  ? -5.100  -14.245 4.983   1.00 0.00 ? 96  ARG A C    4  
ATOM 10323 O O    . ARG A 1 96  ? -4.133  -15.007 4.916   1.00 0.00 ? 96  ARG A O    4  
ATOM 10324 C CB   . ARG A 1 96  ? -5.791  -14.324 2.585   1.00 0.00 ? 96  ARG A CB   4  
ATOM 10325 C CG   . ARG A 1 96  ? -6.911  -15.356 2.838   1.00 0.00 ? 96  ARG A CG   4  
ATOM 10326 C CD   . ARG A 1 96  ? -6.425  -16.770 3.182   1.00 0.00 ? 96  ARG A CD   4  
ATOM 10327 N NE   . ARG A 1 96  ? -5.780  -17.409 2.023   1.00 0.00 ? 96  ARG A NE   4  
ATOM 10328 C CZ   . ARG A 1 96  ? -4.975  -18.474 2.039   1.00 0.00 ? 96  ARG A CZ   4  
ATOM 10329 N NH1  . ARG A 1 96  ? -4.638  -19.053 3.190   1.00 0.00 ? 96  ARG A NH1  4  
ATOM 10330 N NH2  . ARG A 1 96  ? -4.519  -18.957 0.890   1.00 0.00 ? 96  ARG A NH2  4  
ATOM 10331 H H    . ARG A 1 96  ? -3.661  -12.475 4.146   1.00 0.00 ? 96  ARG A H    4  
ATOM 10332 H HA   . ARG A 1 96  ? -6.432  -12.882 4.080   1.00 0.00 ? 96  ARG A HA   4  
ATOM 10333 H HB2  . ARG A 1 96  ? -6.108  -13.701 1.749   1.00 0.00 ? 96  ARG A HB2  4  
ATOM 10334 H HB3  . ARG A 1 96  ? -4.868  -14.830 2.297   1.00 0.00 ? 96  ARG A HB3  4  
ATOM 10335 H HG2  . ARG A 1 96  ? -7.562  -15.004 3.637   1.00 0.00 ? 96  ARG A HG2  4  
ATOM 10336 H HG3  . ARG A 1 96  ? -7.517  -15.426 1.937   1.00 0.00 ? 96  ARG A HG3  4  
ATOM 10337 H HD2  . ARG A 1 96  ? -5.730  -16.726 4.018   1.00 0.00 ? 96  ARG A HD2  4  
ATOM 10338 H HD3  . ARG A 1 96  ? -7.287  -17.368 3.482   1.00 0.00 ? 96  ARG A HD3  4  
ATOM 10339 H HE   . ARG A 1 96  ? -5.929  -16.925 1.136   1.00 0.00 ? 96  ARG A HE   4  
ATOM 10340 H HH11 . ARG A 1 96  ? -5.044  -18.715 4.047   1.00 0.00 ? 96  ARG A HH11 4  
ATOM 10341 H HH12 . ARG A 1 96  ? -3.905  -19.749 3.280   1.00 0.00 ? 96  ARG A HH12 4  
ATOM 10342 H HH21 . ARG A 1 96  ? -4.859  -18.564 0.009   1.00 0.00 ? 96  ARG A HH21 4  
ATOM 10343 H HH22 . ARG A 1 96  ? -3.889  -19.752 0.810   1.00 0.00 ? 96  ARG A HH22 4  
ATOM 10344 N N    . ASN A 1 97  ? -5.887  -14.138 6.038   1.00 0.00 ? 97  ASN A N    4  
ATOM 10345 C CA   . ASN A 1 97  ? -5.787  -14.970 7.210   1.00 0.00 ? 97  ASN A CA   4  
ATOM 10346 C C    . ASN A 1 97  ? -6.960  -15.951 7.181   1.00 0.00 ? 97  ASN A C    4  
ATOM 10347 O O    . ASN A 1 97  ? -7.968  -15.705 6.509   1.00 0.00 ? 97  ASN A O    4  
ATOM 10348 C CB   . ASN A 1 97  ? -5.778  -14.026 8.410   1.00 0.00 ? 97  ASN A CB   4  
ATOM 10349 C CG   . ASN A 1 97  ? -5.270  -14.680 9.687   1.00 0.00 ? 97  ASN A CG   4  
ATOM 10350 O OD1  . ASN A 1 97  ? -5.190  -15.902 9.800   1.00 0.00 ? 97  ASN A OD1  4  
ATOM 10351 N ND2  . ASN A 1 97  ? -4.820  -13.880 10.632  1.00 0.00 ? 97  ASN A ND2  4  
ATOM 10352 H H    . ASN A 1 97  ? -6.700  -13.544 5.991   1.00 0.00 ? 97  ASN A H    4  
ATOM 10353 H HA   . ASN A 1 97  ? -4.856  -15.534 7.193   1.00 0.00 ? 97  ASN A HA   4  
ATOM 10354 H HB2  . ASN A 1 97  ? -5.113  -13.189 8.186   1.00 0.00 ? 97  ASN A HB2  4  
ATOM 10355 H HB3  . ASN A 1 97  ? -6.781  -13.624 8.530   1.00 0.00 ? 97  ASN A HB3  4  
ATOM 10356 H HD21 . ASN A 1 97  ? -4.756  -12.872 10.465  1.00 0.00 ? 97  ASN A HD21 4  
ATOM 10357 H HD22 . ASN A 1 97  ? -4.442  -14.268 11.491  1.00 0.00 ? 97  ASN A HD22 4  
ATOM 10358 N N    . ALA A 1 98  ? -6.822  -17.084 7.861   1.00 0.00 ? 98  ALA A N    4  
ATOM 10359 C CA   . ALA A 1 98  ? -7.759  -18.189 7.811   1.00 0.00 ? 98  ALA A CA   4  
ATOM 10360 C C    . ALA A 1 98  ? -8.281  -18.404 9.216   1.00 0.00 ? 98  ALA A C    4  
ATOM 10361 O O    . ALA A 1 98  ? -7.662  -19.105 10.018  1.00 0.00 ? 98  ALA A O    4  
ATOM 10362 C CB   . ALA A 1 98  ? -7.098  -19.426 7.198   1.00 0.00 ? 98  ALA A CB   4  
ATOM 10363 H H    . ALA A 1 98  ? -6.072  -17.141 8.542   1.00 0.00 ? 98  ALA A H    4  
ATOM 10364 H HA   . ALA A 1 98  ? -8.604  -17.909 7.191   1.00 0.00 ? 98  ALA A HA   4  
ATOM 10365 H HB1  . ALA A 1 98  ? -7.803  -20.258 7.213   1.00 0.00 ? 98  ALA A HB1  4  
ATOM 10366 H HB2  . ALA A 1 98  ? -6.812  -19.220 6.167   1.00 0.00 ? 98  ALA A HB2  4  
ATOM 10367 H HB3  . ALA A 1 98  ? -6.211  -19.697 7.771   1.00 0.00 ? 98  ALA A HB3  4  
ATOM 10368 N N    . ASP A 1 99  ? -9.392  -17.739 9.507   1.00 0.00 ? 99  ASP A N    4  
ATOM 10369 C CA   . ASP A 1 99  ? -9.987  -17.642 10.822  1.00 0.00 ? 99  ASP A CA   4  
ATOM 10370 C C    . ASP A 1 99  ? -11.450 -17.263 10.644  1.00 0.00 ? 99  ASP A C    4  
ATOM 10371 O O    . ASP A 1 99  ? -11.768 -16.226 10.039  1.00 0.00 ? 99  ASP A O    4  
ATOM 10372 C CB   . ASP A 1 99  ? -9.265  -16.563 11.621  1.00 0.00 ? 99  ASP A CB   4  
ATOM 10373 C CG   . ASP A 1 99  ? -9.798  -16.451 13.048  1.00 0.00 ? 99  ASP A CG   4  
ATOM 10374 O OD1  . ASP A 1 99  ? -10.449 -17.401 13.546  1.00 0.00 ? 99  ASP A OD1  4  
ATOM 10375 O OD2  . ASP A 1 99  ? -9.584  -15.392 13.677  1.00 0.00 ? 99  ASP A OD2  4  
ATOM 10376 H H    . ASP A 1 99  ? -9.895  -17.260 8.770   1.00 0.00 ? 99  ASP A H    4  
ATOM 10377 H HA   . ASP A 1 99  ? -9.894  -18.595 11.346  1.00 0.00 ? 99  ASP A HA   4  
ATOM 10378 H HB2  . ASP A 1 99  ? -8.200  -16.793 11.624  1.00 0.00 ? 99  ASP A HB2  4  
ATOM 10379 H HB3  . ASP A 1 99  ? -9.403  -15.608 11.122  1.00 0.00 ? 99  ASP A HB3  4  
ATOM 10380 N N    . CYS A 1 100 ? -12.353 -18.115 11.123  1.00 0.00 ? 100 CYS A N    4  
ATOM 10381 C CA   . CYS A 1 100 ? -13.786 -17.983 10.904  1.00 0.00 ? 100 CYS A CA   4  
ATOM 10382 C C    . CYS A 1 100 ? -14.402 -17.037 11.946  1.00 0.00 ? 100 CYS A C    4  
ATOM 10383 O O    . CYS A 1 100 ? -15.314 -17.403 12.694  1.00 0.00 ? 100 CYS A O    4  
ATOM 10384 C CB   . CYS A 1 100 ? -14.440 -19.370 10.797  1.00 0.00 ? 100 CYS A CB   4  
ATOM 10385 S SG   . CYS A 1 100 ? -15.524 -19.380 9.338   1.00 0.00 ? 100 CYS A SG   4  
ATOM 10386 H H    . CYS A 1 100 ? -12.020 -18.887 11.684  1.00 0.00 ? 100 CYS A H    4  
ATOM 10387 H HA   . CYS A 1 100 ? -13.914 -17.511 9.934   1.00 0.00 ? 100 CYS A HA   4  
ATOM 10388 H HB2  . CYS A 1 100 ? -13.673 -20.131 10.652  1.00 0.00 ? 100 CYS A HB2  4  
ATOM 10389 H HB3  . CYS A 1 100 ? -15.003 -19.613 11.700  1.00 0.00 ? 100 CYS A HB3  4  
ATOM 10390 H HG   . CYS A 1 100 ? -16.499 -18.615 9.854   1.00 0.00 ? 100 CYS A HG   4  
ATOM 10391 N N    . SER A 1 101 ? -13.889 -15.804 11.963  1.00 0.00 ? 101 SER A N    4  
ATOM 10392 C CA   . SER A 1 101 ? -14.316 -14.697 12.803  1.00 0.00 ? 101 SER A CA   4  
ATOM 10393 C C    . SER A 1 101 ? -15.839 -14.567 12.749  1.00 0.00 ? 101 SER A C    4  
ATOM 10394 O O    . SER A 1 101 ? -16.416 -14.453 11.664  1.00 0.00 ? 101 SER A O    4  
ATOM 10395 C CB   . SER A 1 101 ? -13.607 -13.425 12.316  1.00 0.00 ? 101 SER A CB   4  
ATOM 10396 O OG   . SER A 1 101 ? -13.542 -12.452 13.341  1.00 0.00 ? 101 SER A OG   4  
ATOM 10397 H H    . SER A 1 101 ? -13.100 -15.638 11.352  1.00 0.00 ? 101 SER A H    4  
ATOM 10398 H HA   . SER A 1 101 ? -14.006 -14.908 13.827  1.00 0.00 ? 101 SER A HA   4  
ATOM 10399 H HB2  . SER A 1 101 ? -12.583 -13.666 12.022  1.00 0.00 ? 101 SER A HB2  4  
ATOM 10400 H HB3  . SER A 1 101 ? -14.132 -13.022 11.447  1.00 0.00 ? 101 SER A HB3  4  
ATOM 10401 H HG   . SER A 1 101 ? -12.786 -12.712 13.907  1.00 0.00 ? 101 SER A HG   4  
ATOM 10402 N N    . SER A 1 102 ? -16.483 -14.652 13.912  1.00 0.00 ? 102 SER A N    4  
ATOM 10403 C CA   . SER A 1 102 ? -17.928 -14.618 14.061  1.00 0.00 ? 102 SER A CA   4  
ATOM 10404 C C    . SER A 1 102 ? -18.493 -13.369 13.385  1.00 0.00 ? 102 SER A C    4  
ATOM 10405 O O    . SER A 1 102 ? -17.989 -12.267 13.601  1.00 0.00 ? 102 SER A O    4  
ATOM 10406 C CB   . SER A 1 102 ? -18.247 -14.678 15.553  1.00 0.00 ? 102 SER A CB   4  
ATOM 10407 O OG   . SER A 1 102 ? -17.630 -15.830 16.099  1.00 0.00 ? 102 SER A OG   4  
ATOM 10408 H H    . SER A 1 102 ? -15.957 -14.755 14.767  1.00 0.00 ? 102 SER A H    4  
ATOM 10409 H HA   . SER A 1 102 ? -18.347 -15.499 13.577  1.00 0.00 ? 102 SER A HA   4  
ATOM 10410 H HB2  . SER A 1 102 ? -17.850 -13.791 16.046  1.00 0.00 ? 102 SER A HB2  4  
ATOM 10411 H HB3  . SER A 1 102 ? -19.324 -14.723 15.708  1.00 0.00 ? 102 SER A HB3  4  
ATOM 10412 H HG   . SER A 1 102 ? -17.656 -15.735 17.077  1.00 0.00 ? 102 SER A HG   4  
ATOM 10413 N N    . GLY A 1 103 ? -19.514 -13.552 12.554  1.00 0.00 ? 103 GLY A N    4  
ATOM 10414 C CA   . GLY A 1 103 ? -19.983 -12.572 11.592  1.00 0.00 ? 103 GLY A CA   4  
ATOM 10415 C C    . GLY A 1 103 ? -19.118 -12.610 10.328  1.00 0.00 ? 103 GLY A C    4  
ATOM 10416 O O    . GLY A 1 103 ? -18.279 -11.726 10.157  1.00 0.00 ? 103 GLY A O    4  
ATOM 10417 H H    . GLY A 1 103 ? -19.941 -14.468 12.536  1.00 0.00 ? 103 GLY A H    4  
ATOM 10418 H HA2  . GLY A 1 103 ? -21.021 -12.786 11.331  1.00 0.00 ? 103 GLY A HA2  4  
ATOM 10419 H HA3  . GLY A 1 103 ? -19.933 -11.574 12.029  1.00 0.00 ? 103 GLY A HA3  4  
ATOM 10420 N N    . PRO A 1 104 ? -19.313 -13.592 9.428   1.00 0.00 ? 104 PRO A N    4  
ATOM 10421 C CA   . PRO A 1 104 ? -18.885 -13.529 8.027   1.00 0.00 ? 104 PRO A CA   4  
ATOM 10422 C C    . PRO A 1 104 ? -19.384 -12.280 7.264   1.00 0.00 ? 104 PRO A C    4  
ATOM 10423 O O    . PRO A 1 104 ? -19.972 -11.351 7.833   1.00 0.00 ? 104 PRO A O    4  
ATOM 10424 C CB   . PRO A 1 104 ? -19.427 -14.808 7.372   1.00 0.00 ? 104 PRO A CB   4  
ATOM 10425 C CG   . PRO A 1 104 ? -19.657 -15.774 8.526   1.00 0.00 ? 104 PRO A CG   4  
ATOM 10426 C CD   . PRO A 1 104 ? -19.983 -14.854 9.699   1.00 0.00 ? 104 PRO A CD   4  
ATOM 10427 H HA   . PRO A 1 104 ? -17.795 -13.553 8.007   1.00 0.00 ? 104 PRO A HA   4  
ATOM 10428 H HB2  . PRO A 1 104 ? -20.387 -14.603 6.902   1.00 0.00 ? 104 PRO A HB2  4  
ATOM 10429 H HB3  . PRO A 1 104 ? -18.729 -15.215 6.639   1.00 0.00 ? 104 PRO A HB3  4  
ATOM 10430 H HG2  . PRO A 1 104 ? -20.472 -16.465 8.318   1.00 0.00 ? 104 PRO A HG2  4  
ATOM 10431 H HG3  . PRO A 1 104 ? -18.740 -16.325 8.728   1.00 0.00 ? 104 PRO A HG3  4  
ATOM 10432 H HD2  . PRO A 1 104 ? -21.056 -14.690 9.766   1.00 0.00 ? 104 PRO A HD2  4  
ATOM 10433 H HD3  . PRO A 1 104 ? -19.615 -15.306 10.619  1.00 0.00 ? 104 PRO A HD3  4  
ATOM 10434 N N    . GLY A 1 105 ? -19.157 -12.242 5.947   1.00 0.00 ? 105 GLY A N    4  
ATOM 10435 C CA   . GLY A 1 105 ? -19.514 -11.185 5.041   1.00 0.00 ? 105 GLY A CA   4  
ATOM 10436 C C    . GLY A 1 105 ? -18.187 -10.861 4.396   1.00 0.00 ? 105 GLY A C    4  
ATOM 10437 O O    . GLY A 1 105 ? -17.659 -11.722 3.680   1.00 0.00 ? 105 GLY A O    4  
ATOM 10438 H H    . GLY A 1 105 ? -18.502 -12.852 5.471   1.00 0.00 ? 105 GLY A H    4  
ATOM 10439 H HA2  . GLY A 1 105 ? -20.204 -11.565 4.288   1.00 0.00 ? 105 GLY A HA2  4  
ATOM 10440 H HA3  . GLY A 1 105 ? -19.959 -10.327 5.538   1.00 0.00 ? 105 GLY A HA3  4  
ATOM 10441 N N    . GLN A 1 106 ? -17.620 -9.682  4.657   1.00 0.00 ? 106 GLN A N    4  
ATOM 10442 C CA   . GLN A 1 106 ? -16.365 -9.299  4.037   1.00 0.00 ? 106 GLN A CA   4  
ATOM 10443 C C    . GLN A 1 106 ? -15.496 -8.441  4.946   1.00 0.00 ? 106 GLN A C    4  
ATOM 10444 O O    . GLN A 1 106 ? -15.972 -7.666  5.779   1.00 0.00 ? 106 GLN A O    4  
ATOM 10445 C CB   . GLN A 1 106 ? -16.621 -8.539  2.721   1.00 0.00 ? 106 GLN A CB   4  
ATOM 10446 C CG   . GLN A 1 106 ? -17.849 -8.981  1.896   1.00 0.00 ? 106 GLN A CG   4  
ATOM 10447 C CD   . GLN A 1 106 ? -17.788 -8.472  0.451   1.00 0.00 ? 106 GLN A CD   4  
ATOM 10448 O OE1  . GLN A 1 106 ? -18.289 -9.102  -0.477  1.00 0.00 ? 106 GLN A OE1  4  
ATOM 10449 N NE2  . GLN A 1 106 ? -17.175 -7.328  0.196   1.00 0.00 ? 106 GLN A NE2  4  
ATOM 10450 H H    . GLN A 1 106 ? -17.998 -9.082  5.386   1.00 0.00 ? 106 GLN A H    4  
ATOM 10451 H HA   . GLN A 1 106 ? -15.787 -10.207 3.835   1.00 0.00 ? 106 GLN A HA   4  
ATOM 10452 H HB2  . GLN A 1 106 ? -16.744 -7.482  2.948   1.00 0.00 ? 106 GLN A HB2  4  
ATOM 10453 H HB3  . GLN A 1 106 ? -15.723 -8.626  2.110   1.00 0.00 ? 106 GLN A HB3  4  
ATOM 10454 H HG2  . GLN A 1 106 ? -17.930 -10.076 1.917   1.00 0.00 ? 106 GLN A HG2  4  
ATOM 10455 H HG3  . GLN A 1 106 ? -18.752 -8.584  2.362   1.00 0.00 ? 106 GLN A HG3  4  
ATOM 10456 H HE21 . GLN A 1 106 ? -16.813 -6.782  0.963   1.00 0.00 ? 106 GLN A HE21 4  
ATOM 10457 H HE22 . GLN A 1 106 ? -16.947 -7.076  -0.761  1.00 0.00 ? 106 GLN A HE22 4  
ATOM 10458 N N    . ARG A 1 107 ? -14.201 -8.551  4.675   1.00 0.00 ? 107 ARG A N    4  
ATOM 10459 C CA   . ARG A 1 107 ? -13.090 -7.820  5.251   1.00 0.00 ? 107 ARG A CA   4  
ATOM 10460 C C    . ARG A 1 107 ? -12.778 -6.576  4.431   1.00 0.00 ? 107 ARG A C    4  
ATOM 10461 O O    . ARG A 1 107 ? -13.283 -6.418  3.321   1.00 0.00 ? 107 ARG A O    4  
ATOM 10462 C CB   . ARG A 1 107 ? -11.898 -8.786  5.286   1.00 0.00 ? 107 ARG A CB   4  
ATOM 10463 C CG   . ARG A 1 107 ? -12.026 -9.851  6.388   1.00 0.00 ? 107 ARG A CG   4  
ATOM 10464 C CD   . ARG A 1 107 ? -11.069 -11.005 6.073   1.00 0.00 ? 107 ARG A CD   4  
ATOM 10465 N NE   . ARG A 1 107 ? -10.686 -11.788 7.267   1.00 0.00 ? 107 ARG A NE   4  
ATOM 10466 C CZ   . ARG A 1 107 ? -11.335 -12.838 7.785   1.00 0.00 ? 107 ARG A CZ   4  
ATOM 10467 N NH1  . ARG A 1 107 ? -12.501 -13.212 7.272   1.00 0.00 ? 107 ARG A NH1  4  
ATOM 10468 N NH2  . ARG A 1 107 ? -10.830 -13.516 8.815   1.00 0.00 ? 107 ARG A NH2  4  
ATOM 10469 H H    . ARG A 1 107 ? -13.945 -9.198  3.940   1.00 0.00 ? 107 ARG A H    4  
ATOM 10470 H HA   . ARG A 1 107 ? -13.333 -7.505  6.252   1.00 0.00 ? 107 ARG A HA   4  
ATOM 10471 H HB2  . ARG A 1 107 ? -11.805 -9.281  4.320   1.00 0.00 ? 107 ARG A HB2  4  
ATOM 10472 H HB3  . ARG A 1 107 ? -10.981 -8.228  5.434   1.00 0.00 ? 107 ARG A HB3  4  
ATOM 10473 H HG2  . ARG A 1 107 ? -11.792 -9.405  7.351   1.00 0.00 ? 107 ARG A HG2  4  
ATOM 10474 H HG3  . ARG A 1 107 ? -13.044 -10.234 6.435   1.00 0.00 ? 107 ARG A HG3  4  
ATOM 10475 H HD2  . ARG A 1 107 ? -11.552 -11.636 5.321   1.00 0.00 ? 107 ARG A HD2  4  
ATOM 10476 H HD3  . ARG A 1 107 ? -10.155 -10.597 5.640   1.00 0.00 ? 107 ARG A HD3  4  
ATOM 10477 H HE   . ARG A 1 107 ? -9.776  -11.532 7.659   1.00 0.00 ? 107 ARG A HE   4  
ATOM 10478 H HH11 . ARG A 1 107 ? -12.900 -12.743 6.458   1.00 0.00 ? 107 ARG A HH11 4  
ATOM 10479 H HH12 . ARG A 1 107 ? -13.012 -14.014 7.636   1.00 0.00 ? 107 ARG A HH12 4  
ATOM 10480 H HH21 . ARG A 1 107 ? -9.971  -13.219 9.292   1.00 0.00 ? 107 ARG A HH21 4  
ATOM 10481 H HH22 . ARG A 1 107 ? -11.258 -14.358 9.186   1.00 0.00 ? 107 ARG A HH22 4  
ATOM 10482 N N    . VAL A 1 108 ? -11.874 -5.733  4.922   1.00 0.00 ? 108 VAL A N    4  
ATOM 10483 C CA   . VAL A 1 108 ? -11.203 -4.697  4.158   1.00 0.00 ? 108 VAL A CA   4  
ATOM 10484 C C    . VAL A 1 108 ? -9.714  -5.015  4.243   1.00 0.00 ? 108 VAL A C    4  
ATOM 10485 O O    . VAL A 1 108 ? -9.226  -5.368  5.320   1.00 0.00 ? 108 VAL A O    4  
ATOM 10486 C CB   . VAL A 1 108 ? -11.567 -3.315  4.728   1.00 0.00 ? 108 VAL A CB   4  
ATOM 10487 C CG1  . VAL A 1 108 ? -10.735 -2.212  4.073   1.00 0.00 ? 108 VAL A CG1  4  
ATOM 10488 C CG2  . VAL A 1 108 ? -13.052 -3.010  4.500   1.00 0.00 ? 108 VAL A CG2  4  
ATOM 10489 H H    . VAL A 1 108 ? -11.490 -5.857  5.850   1.00 0.00 ? 108 VAL A H    4  
ATOM 10490 H HA   . VAL A 1 108 ? -11.513 -4.737  3.116   1.00 0.00 ? 108 VAL A HA   4  
ATOM 10491 H HB   . VAL A 1 108 ? -11.374 -3.299  5.800   1.00 0.00 ? 108 VAL A HB   4  
ATOM 10492 H HG11 . VAL A 1 108 ? -10.804 -2.297  2.989   1.00 0.00 ? 108 VAL A HG11 4  
ATOM 10493 H HG12 . VAL A 1 108 ? -11.068 -1.230  4.408   1.00 0.00 ? 108 VAL A HG12 4  
ATOM 10494 H HG13 . VAL A 1 108 ? -9.692  -2.330  4.362   1.00 0.00 ? 108 VAL A HG13 4  
ATOM 10495 H HG21 . VAL A 1 108 ? -13.299 -2.039  4.927   1.00 0.00 ? 108 VAL A HG21 4  
ATOM 10496 H HG22 . VAL A 1 108 ? -13.268 -2.991  3.434   1.00 0.00 ? 108 VAL A HG22 4  
ATOM 10497 H HG23 . VAL A 1 108 ? -13.674 -3.763  4.984   1.00 0.00 ? 108 VAL A HG23 4  
ATOM 10498 N N    . CYS A 1 109 ? -9.008  -4.930  3.117   1.00 0.00 ? 109 CYS A N    4  
ATOM 10499 C CA   . CYS A 1 109 ? -7.558  -4.946  3.067   1.00 0.00 ? 109 CYS A CA   4  
ATOM 10500 C C    . CYS A 1 109 ? -7.091  -3.497  2.953   1.00 0.00 ? 109 CYS A C    4  
ATOM 10501 O O    . CYS A 1 109 ? -7.797  -2.666  2.384   1.00 0.00 ? 109 CYS A O    4  
ATOM 10502 C CB   . CYS A 1 109 ? -7.074  -5.740  1.851   1.00 0.00 ? 109 CYS A CB   4  
ATOM 10503 S SG   . CYS A 1 109 ? -5.319  -6.141  2.014   1.00 0.00 ? 109 CYS A SG   4  
ATOM 10504 H H    . CYS A 1 109 ? -9.444  -4.479  2.317   1.00 0.00 ? 109 CYS A H    4  
ATOM 10505 H HA   . CYS A 1 109 ? -7.184  -5.408  3.976   1.00 0.00 ? 109 CYS A HA   4  
ATOM 10506 H HB2  . CYS A 1 109 ? -7.619  -6.674  1.778   1.00 0.00 ? 109 CYS A HB2  4  
ATOM 10507 H HB3  . CYS A 1 109 ? -7.228  -5.149  0.953   1.00 0.00 ? 109 CYS A HB3  4  
ATOM 10508 H HG   . CYS A 1 109 ? -5.523  -7.148  2.881   1.00 0.00 ? 109 CYS A HG   4  
ATOM 10509 N N    . VAL A 1 110 ? -5.884  -3.216  3.422   1.00 0.00 ? 110 VAL A N    4  
ATOM 10510 C CA   . VAL A 1 110 ? -5.215  -1.937  3.286   1.00 0.00 ? 110 VAL A CA   4  
ATOM 10511 C C    . VAL A 1 110 ? -3.791  -2.244  2.857   1.00 0.00 ? 110 VAL A C    4  
ATOM 10512 O O    . VAL A 1 110 ? -3.126  -3.078  3.478   1.00 0.00 ? 110 VAL A O    4  
ATOM 10513 C CB   . VAL A 1 110 ? -5.252  -1.182  4.623   1.00 0.00 ? 110 VAL A CB   4  
ATOM 10514 C CG1  . VAL A 1 110 ? -4.426  0.111   4.547   1.00 0.00 ? 110 VAL A CG1  4  
ATOM 10515 C CG2  . VAL A 1 110 ? -6.692  -0.823  5.011   1.00 0.00 ? 110 VAL A CG2  4  
ATOM 10516 H H    . VAL A 1 110 ? -5.349  -3.949  3.864   1.00 0.00 ? 110 VAL A H    4  
ATOM 10517 H HA   . VAL A 1 110 ? -5.708  -1.336  2.521   1.00 0.00 ? 110 VAL A HA   4  
ATOM 10518 H HB   . VAL A 1 110 ? -4.831  -1.833  5.394   1.00 0.00 ? 110 VAL A HB   4  
ATOM 10519 H HG11 . VAL A 1 110 ? -4.767  0.725   3.712   1.00 0.00 ? 110 VAL A HG11 4  
ATOM 10520 H HG12 . VAL A 1 110 ? -4.516  0.678   5.470   1.00 0.00 ? 110 VAL A HG12 4  
ATOM 10521 H HG13 . VAL A 1 110 ? -3.372  -0.128  4.396   1.00 0.00 ? 110 VAL A HG13 4  
ATOM 10522 H HG21 . VAL A 1 110 ? -6.709  -0.254  5.938   1.00 0.00 ? 110 VAL A HG21 4  
ATOM 10523 H HG22 . VAL A 1 110 ? -7.162  -0.237  4.221   1.00 0.00 ? 110 VAL A HG22 4  
ATOM 10524 H HG23 . VAL A 1 110 ? -7.270  -1.732  5.159   1.00 0.00 ? 110 VAL A HG23 4  
ATOM 10525 N N    . ILE A 1 111 ? -3.312  -1.583  1.806   1.00 0.00 ? 111 ILE A N    4  
ATOM 10526 C CA   . ILE A 1 111 ? -1.963  -1.742  1.338   1.00 0.00 ? 111 ILE A CA   4  
ATOM 10527 C C    . ILE A 1 111 ? -1.535  -0.311  1.031   1.00 0.00 ? 111 ILE A C    4  
ATOM 10528 O O    . ILE A 1 111 ? -1.823  0.174   -0.067  1.00 0.00 ? 111 ILE A O    4  
ATOM 10529 C CB   . ILE A 1 111 ? -1.948  -2.703  0.112   1.00 0.00 ? 111 ILE A CB   4  
ATOM 10530 C CG1  . ILE A 1 111 ? -3.058  -3.782  0.135   1.00 0.00 ? 111 ILE A CG1  4  
ATOM 10531 C CG2  . ILE A 1 111 ? -0.584  -3.393  0.037   1.00 0.00 ? 111 ILE A CG2  4  
ATOM 10532 C CD1  . ILE A 1 111 ? -3.054  -4.709  -1.079  1.00 0.00 ? 111 ILE A CD1  4  
ATOM 10533 H H    . ILE A 1 111 ? -3.895  -1.043  1.171   1.00 0.00 ? 111 ILE A H    4  
ATOM 10534 H HA   . ILE A 1 111 ? -1.333  -2.149  2.134   1.00 0.00 ? 111 ILE A HA   4  
ATOM 10535 H HB   . ILE A 1 111 ? -2.091  -2.129  -0.803  1.00 0.00 ? 111 ILE A HB   4  
ATOM 10536 H HG12 . ILE A 1 111 ? -2.971  -4.379  1.043   1.00 0.00 ? 111 ILE A HG12 4  
ATOM 10537 H HG13 . ILE A 1 111 ? -4.033  -3.294  0.147   1.00 0.00 ? 111 ILE A HG13 4  
ATOM 10538 H HG21 . ILE A 1 111 ? -0.431  -3.781  -0.965  1.00 0.00 ? 111 ILE A HG21 4  
ATOM 10539 H HG22 . ILE A 1 111 ? 0.210   -2.687  0.265   1.00 0.00 ? 111 ILE A HG22 4  
ATOM 10540 H HG23 . ILE A 1 111 ? -0.550  -4.205  0.759   1.00 0.00 ? 111 ILE A HG23 4  
ATOM 10541 H HD11 . ILE A 1 111 ? -3.946  -5.329  -1.031  1.00 0.00 ? 111 ILE A HD11 4  
ATOM 10542 H HD12 . ILE A 1 111 ? -3.073  -4.117  -1.996  1.00 0.00 ? 111 ILE A HD12 4  
ATOM 10543 H HD13 . ILE A 1 111 ? -2.176  -5.355  -1.072  1.00 0.00 ? 111 ILE A HD13 4  
ATOM 10544 N N    . ASP A 1 112 ? -0.869  0.389   1.955   1.00 0.00 ? 112 ASP A N    4  
ATOM 10545 C CA   . ASP A 1 112 ? -0.439  1.772   1.708   1.00 0.00 ? 112 ASP A CA   4  
ATOM 10546 C C    . ASP A 1 112 ? 1.080   1.926   1.700   1.00 0.00 ? 112 ASP A C    4  
ATOM 10547 O O    . ASP A 1 112 ? 1.724   2.303   2.679   1.00 0.00 ? 112 ASP A O    4  
ATOM 10548 C CB   . ASP A 1 112 ? -1.159  2.802   2.569   1.00 0.00 ? 112 ASP A CB   4  
ATOM 10549 C CG   . ASP A 1 112 ? -1.229  4.107   1.784   1.00 0.00 ? 112 ASP A CG   4  
ATOM 10550 O OD1  . ASP A 1 112 ? -2.064  4.167   0.859   1.00 0.00 ? 112 ASP A OD1  4  
ATOM 10551 O OD2  . ASP A 1 112 ? -0.451  5.062   2.023   1.00 0.00 ? 112 ASP A OD2  4  
ATOM 10552 H H    . ASP A 1 112 ? -0.670  -0.041  2.852   1.00 0.00 ? 112 ASP A H    4  
ATOM 10553 H HA   . ASP A 1 112 ? -0.761  2.039   0.703   1.00 0.00 ? 112 ASP A HA   4  
ATOM 10554 H HB2  . ASP A 1 112 ? -2.167  2.454   2.791   1.00 0.00 ? 112 ASP A HB2  4  
ATOM 10555 H HB3  . ASP A 1 112 ? -0.642  2.946   3.501   1.00 0.00 ? 112 ASP A HB3  4  
ATOM 10556 N N    . GLU A 1 113 ? 1.642   1.570   0.552   1.00 0.00 ? 113 GLU A N    4  
ATOM 10557 C CA   . GLU A 1 113 ? 2.972   1.826   0.046   1.00 0.00 ? 113 GLU A CA   4  
ATOM 10558 C C    . GLU A 1 113 ? 2.854   1.671   -1.478  1.00 0.00 ? 113 GLU A C    4  
ATOM 10559 O O    . GLU A 1 113 ? 2.623   2.645   -2.197  1.00 0.00 ? 113 GLU A O    4  
ATOM 10560 C CB   . GLU A 1 113 ? 3.980   0.847   0.689   1.00 0.00 ? 113 GLU A CB   4  
ATOM 10561 C CG   . GLU A 1 113 ? 5.366   0.834   0.021   1.00 0.00 ? 113 GLU A CG   4  
ATOM 10562 C CD   . GLU A 1 113 ? 5.911   2.240   -0.223  1.00 0.00 ? 113 GLU A CD   4  
ATOM 10563 O OE1  . GLU A 1 113 ? 6.620   2.755   0.662   1.00 0.00 ? 113 GLU A OE1  4  
ATOM 10564 O OE2  . GLU A 1 113 ? 5.696   2.812   -1.316  1.00 0.00 ? 113 GLU A OE2  4  
ATOM 10565 H H    . GLU A 1 113 ? 1.038   1.118   -0.122  1.00 0.00 ? 113 GLU A H    4  
ATOM 10566 H HA   . GLU A 1 113 ? 3.256   2.850   0.285   1.00 0.00 ? 113 GLU A HA   4  
ATOM 10567 H HB2  . GLU A 1 113 ? 4.095   1.116   1.737   1.00 0.00 ? 113 GLU A HB2  4  
ATOM 10568 H HB3  . GLU A 1 113 ? 3.575   -0.167  0.654   1.00 0.00 ? 113 GLU A HB3  4  
ATOM 10569 H HG2  . GLU A 1 113 ? 6.050   0.274   0.661   1.00 0.00 ? 113 GLU A HG2  4  
ATOM 10570 H HG3  . GLU A 1 113 ? 5.322   0.308   -0.933  1.00 0.00 ? 113 GLU A HG3  4  
ATOM 10571 N N    . ILE A 1 114 ? 2.957   0.419   -1.940  1.00 0.00 ? 114 ILE A N    4  
ATOM 10572 C CA   . ILE A 1 114 ? 3.002   -0.117  -3.296  1.00 0.00 ? 114 ILE A CA   4  
ATOM 10573 C C    . ILE A 1 114 ? 4.077   0.525   -4.202  1.00 0.00 ? 114 ILE A C    4  
ATOM 10574 O O    . ILE A 1 114 ? 4.522   -0.145  -5.134  1.00 0.00 ? 114 ILE A O    4  
ATOM 10575 C CB   . ILE A 1 114 ? 1.562   -0.292  -3.858  1.00 0.00 ? 114 ILE A CB   4  
ATOM 10576 C CG1  . ILE A 1 114 ? 1.019   -1.724  -3.596  1.00 0.00 ? 114 ILE A CG1  4  
ATOM 10577 C CG2  . ILE A 1 114 ? 1.422   0.007   -5.346  1.00 0.00 ? 114 ILE A CG2  4  
ATOM 10578 C CD1  . ILE A 1 114 ? -0.516  -1.881  -3.550  1.00 0.00 ? 114 ILE A CD1  4  
ATOM 10579 H H    . ILE A 1 114 ? 3.015   -0.274  -1.208  1.00 0.00 ? 114 ILE A H    4  
ATOM 10580 H HA   . ILE A 1 114 ? 3.364   -1.133  -3.163  1.00 0.00 ? 114 ILE A HA   4  
ATOM 10581 H HB   . ILE A 1 114 ? 0.917   0.414   -3.346  1.00 0.00 ? 114 ILE A HB   4  
ATOM 10582 H HG12 . ILE A 1 114 ? 1.404   -2.385  -4.366  1.00 0.00 ? 114 ILE A HG12 4  
ATOM 10583 H HG13 . ILE A 1 114 ? 1.415   -2.093  -2.653  1.00 0.00 ? 114 ILE A HG13 4  
ATOM 10584 H HG21 . ILE A 1 114 ? 1.663   1.051   -5.532  1.00 0.00 ? 114 ILE A HG21 4  
ATOM 10585 H HG22 . ILE A 1 114 ? 2.077   -0.632  -5.933  1.00 0.00 ? 114 ILE A HG22 4  
ATOM 10586 H HG23 . ILE A 1 114 ? 0.396   -0.179  -5.638  1.00 0.00 ? 114 ILE A HG23 4  
ATOM 10587 H HD11 . ILE A 1 114 ? -0.771  -2.916  -3.315  1.00 0.00 ? 114 ILE A HD11 4  
ATOM 10588 H HD12 . ILE A 1 114 ? -0.981  -1.250  -2.784  1.00 0.00 ? 114 ILE A HD12 4  
ATOM 10589 H HD13 . ILE A 1 114 ? -0.944  -1.646  -4.522  1.00 0.00 ? 114 ILE A HD13 4  
ATOM 10590 N N    . GLY A 1 115 ? 4.636   1.691   -3.882  1.00 0.00 ? 115 GLY A N    4  
ATOM 10591 C CA   . GLY A 1 115 ? 5.694   2.317   -4.654  1.00 0.00 ? 115 GLY A CA   4  
ATOM 10592 C C    . GLY A 1 115 ? 7.092   1.770   -4.336  1.00 0.00 ? 115 GLY A C    4  
ATOM 10593 O O    . GLY A 1 115 ? 7.864   1.508   -5.243  1.00 0.00 ? 115 GLY A O    4  
ATOM 10594 H H    . GLY A 1 115 ? 4.260   2.198   -3.089  1.00 0.00 ? 115 GLY A H    4  
ATOM 10595 H HA2  . GLY A 1 115 ? 5.482   2.161   -5.711  1.00 0.00 ? 115 GLY A HA2  4  
ATOM 10596 H HA3  . GLY A 1 115 ? 5.676   3.389   -4.474  1.00 0.00 ? 115 GLY A HA3  4  
ATOM 10597 N N    . LYS A 1 116 ? 7.510   1.596   -3.080  1.00 0.00 ? 116 LYS A N    4  
ATOM 10598 C CA   . LYS A 1 116 ? 8.952   1.372   -2.831  1.00 0.00 ? 116 LYS A CA   4  
ATOM 10599 C C    . LYS A 1 116 ? 9.449   -0.004  -3.289  1.00 0.00 ? 116 LYS A C    4  
ATOM 10600 O O    . LYS A 1 116 ? 10.642  -0.142  -3.564  1.00 0.00 ? 116 LYS A O    4  
ATOM 10601 C CB   . LYS A 1 116 ? 9.351   1.738   -1.393  1.00 0.00 ? 116 LYS A CB   4  
ATOM 10602 C CG   . LYS A 1 116 ? 9.263   3.265   -1.260  1.00 0.00 ? 116 LYS A CG   4  
ATOM 10603 C CD   . LYS A 1 116 ? 9.542   3.848   0.131   1.00 0.00 ? 116 LYS A CD   4  
ATOM 10604 C CE   . LYS A 1 116 ? 8.923   5.250   0.280   1.00 0.00 ? 116 LYS A CE   4  
ATOM 10605 N NZ   . LYS A 1 116 ? 7.448   5.244   0.165   1.00 0.00 ? 116 LYS A NZ   4  
ATOM 10606 H H    . LYS A 1 116 ? 6.878   1.841   -2.322  1.00 0.00 ? 116 LYS A H    4  
ATOM 10607 H HA   . LYS A 1 116 ? 9.491   2.071   -3.475  1.00 0.00 ? 116 LYS A HA   4  
ATOM 10608 H HB2  . LYS A 1 116 ? 8.686   1.253   -0.683  1.00 0.00 ? 116 LYS A HB2  4  
ATOM 10609 H HB3  . LYS A 1 116 ? 10.377  1.425   -1.200  1.00 0.00 ? 116 LYS A HB3  4  
ATOM 10610 H HG2  . LYS A 1 116 ? 9.953   3.720   -1.963  1.00 0.00 ? 116 LYS A HG2  4  
ATOM 10611 H HG3  . LYS A 1 116 ? 8.265   3.553   -1.560  1.00 0.00 ? 116 LYS A HG3  4  
ATOM 10612 H HD2  . LYS A 1 116 ? 9.133   3.201   0.901   1.00 0.00 ? 116 LYS A HD2  4  
ATOM 10613 H HD3  . LYS A 1 116 ? 10.621  3.913   0.281   1.00 0.00 ? 116 LYS A HD3  4  
ATOM 10614 H HE2  . LYS A 1 116 ? 9.186   5.635   1.262   1.00 0.00 ? 116 LYS A HE2  4  
ATOM 10615 H HE3  . LYS A 1 116 ? 9.340   5.912   -0.479  1.00 0.00 ? 116 LYS A HE3  4  
ATOM 10616 H HZ1  . LYS A 1 116 ? 7.010   6.110   0.457   1.00 0.00 ? 116 LYS A HZ1  4  
ATOM 10617 H HZ2  . LYS A 1 116 ? 7.164   5.085   -0.795  1.00 0.00 ? 116 LYS A HZ2  4  
ATOM 10618 H HZ3  . LYS A 1 116 ? 7.049   4.454   0.675   1.00 0.00 ? 116 LYS A HZ3  4  
ATOM 10619 N N    . MET A 1 117 ? 8.561   -0.972  -3.515  1.00 0.00 ? 117 MET A N    4  
ATOM 10620 C CA   . MET A 1 117 ? 8.834   -2.229  -4.208  1.00 0.00 ? 117 MET A CA   4  
ATOM 10621 C C    . MET A 1 117 ? 8.204   -2.230  -5.612  1.00 0.00 ? 117 MET A C    4  
ATOM 10622 O O    . MET A 1 117 ? 8.008   -3.309  -6.159  1.00 0.00 ? 117 MET A O    4  
ATOM 10623 C CB   . MET A 1 117 ? 8.350   -3.427  -3.351  1.00 0.00 ? 117 MET A CB   4  
ATOM 10624 C CG   . MET A 1 117 ? 9.409   -4.511  -3.142  1.00 0.00 ? 117 MET A CG   4  
ATOM 10625 S SD   . MET A 1 117 ? 10.951  -3.986  -2.336  1.00 0.00 ? 117 MET A SD   4  
ATOM 10626 C CE   . MET A 1 117 ? 10.701  -4.492  -0.616  1.00 0.00 ? 117 MET A CE   4  
ATOM 10627 H H    . MET A 1 117 ? 7.589   -0.807  -3.277  1.00 0.00 ? 117 MET A H    4  
ATOM 10628 H HA   . MET A 1 117 ? 9.912   -2.321  -4.343  1.00 0.00 ? 117 MET A HA   4  
ATOM 10629 H HB2  . MET A 1 117 ? 8.031   -3.068  -2.376  1.00 0.00 ? 117 MET A HB2  4  
ATOM 10630 H HB3  . MET A 1 117 ? 7.498   -3.916  -3.831  1.00 0.00 ? 117 MET A HB3  4  
ATOM 10631 H HG2  . MET A 1 117 ? 8.965   -5.317  -2.558  1.00 0.00 ? 117 MET A HG2  4  
ATOM 10632 H HG3  . MET A 1 117 ? 9.656   -4.922  -4.120  1.00 0.00 ? 117 MET A HG3  4  
ATOM 10633 H HE1  . MET A 1 117 ? 10.110  -3.740  -0.095  1.00 0.00 ? 117 MET A HE1  4  
ATOM 10634 H HE2  . MET A 1 117 ? 10.207  -5.462  -0.588  1.00 0.00 ? 117 MET A HE2  4  
ATOM 10635 H HE3  . MET A 1 117 ? 11.667  -4.584  -0.124  1.00 0.00 ? 117 MET A HE3  4  
ATOM 10636 N N    . GLU A 1 118 ? 7.887   -1.078  -6.221  1.00 0.00 ? 118 GLU A N    4  
ATOM 10637 C CA   . GLU A 1 118 ? 7.169   -0.948  -7.506  1.00 0.00 ? 118 GLU A CA   4  
ATOM 10638 C C    . GLU A 1 118 ? 7.797   -1.717  -8.667  1.00 0.00 ? 118 GLU A C    4  
ATOM 10639 O O    . GLU A 1 118 ? 7.120   -1.961  -9.666  1.00 0.00 ? 118 GLU A O    4  
ATOM 10640 C CB   . GLU A 1 118 ? 7.024   0.524   -7.940  1.00 0.00 ? 118 GLU A CB   4  
ATOM 10641 C CG   . GLU A 1 118 ? 8.349   1.271   -8.192  1.00 0.00 ? 118 GLU A CG   4  
ATOM 10642 C CD   . GLU A 1 118 ? 8.190   2.795   -8.295  1.00 0.00 ? 118 GLU A CD   4  
ATOM 10643 O OE1  . GLU A 1 118 ? 8.099   3.495   -7.256  1.00 0.00 ? 118 GLU A OE1  4  
ATOM 10644 O OE2  . GLU A 1 118 ? 8.287   3.326   -9.422  1.00 0.00 ? 118 GLU A OE2  4  
ATOM 10645 H H    . GLU A 1 118 ? 8.094   -0.194  -5.766  1.00 0.00 ? 118 GLU A H    4  
ATOM 10646 H HA   . GLU A 1 118 ? 6.161   -1.330  -7.363  1.00 0.00 ? 118 GLU A HA   4  
ATOM 10647 H HB2  . GLU A 1 118 ? 6.453   0.540   -8.863  1.00 0.00 ? 118 GLU A HB2  4  
ATOM 10648 H HB3  . GLU A 1 118 ? 6.427   1.053   -7.209  1.00 0.00 ? 118 GLU A HB3  4  
ATOM 10649 H HG2  . GLU A 1 118 ? 9.068   1.046   -7.405  1.00 0.00 ? 118 GLU A HG2  4  
ATOM 10650 H HG3  . GLU A 1 118 ? 8.783   0.899   -9.116  1.00 0.00 ? 118 GLU A HG3  4  
ATOM 10651 N N    . LEU A 1 119 ? 9.081   -2.044  -8.533  1.00 0.00 ? 119 LEU A N    4  
ATOM 10652 C CA   . LEU A 1 119 ? 9.922   -2.649  -9.547  1.00 0.00 ? 119 LEU A CA   4  
ATOM 10653 C C    . LEU A 1 119 ? 10.585  -3.922  -9.011  1.00 0.00 ? 119 LEU A C    4  
ATOM 10654 O O    . LEU A 1 119 ? 10.827  -4.862  -9.753  1.00 0.00 ? 119 LEU A O    4  
ATOM 10655 C CB   . LEU A 1 119 ? 10.931  -1.556  -9.955  1.00 0.00 ? 119 LEU A CB   4  
ATOM 10656 C CG   . LEU A 1 119 ? 11.726  -1.783  -11.248 1.00 0.00 ? 119 LEU A CG   4  
ATOM 10657 C CD1  . LEU A 1 119 ? 12.960  -2.669  -11.048 1.00 0.00 ? 119 LEU A CD1  4  
ATOM 10658 C CD2  . LEU A 1 119 ? 10.843  -2.272  -12.401 1.00 0.00 ? 119 LEU A CD2  4  
ATOM 10659 H H    . LEU A 1 119 ? 9.522   -1.700  -7.698  1.00 0.00 ? 119 LEU A H    4  
ATOM 10660 H HA   . LEU A 1 119 ? 9.297   -2.919  -10.399 1.00 0.00 ? 119 LEU A HA   4  
ATOM 10661 H HB2  . LEU A 1 119 ? 10.367  -0.634  -10.117 1.00 0.00 ? 119 LEU A HB2  4  
ATOM 10662 H HB3  . LEU A 1 119 ? 11.626  -1.364  -9.131  1.00 0.00 ? 119 LEU A HB3  4  
ATOM 10663 H HG   . LEU A 1 119 ? 12.103  -0.803  -11.530 1.00 0.00 ? 119 LEU A HG   4  
ATOM 10664 H HD11 . LEU A 1 119 ? 12.669  -3.706  -10.898 1.00 0.00 ? 119 LEU A HD11 4  
ATOM 10665 H HD12 . LEU A 1 119 ? 13.588  -2.624  -11.935 1.00 0.00 ? 119 LEU A HD12 4  
ATOM 10666 H HD13 . LEU A 1 119 ? 13.536  -2.322  -10.195 1.00 0.00 ? 119 LEU A HD13 4  
ATOM 10667 H HD21 . LEU A 1 119 ? 11.368  -2.184  -13.348 1.00 0.00 ? 119 LEU A HD21 4  
ATOM 10668 H HD22 . LEU A 1 119 ? 10.566  -3.317  -12.255 1.00 0.00 ? 119 LEU A HD22 4  
ATOM 10669 H HD23 . LEU A 1 119 ? 9.937   -1.666  -12.462 1.00 0.00 ? 119 LEU A HD23 4  
ATOM 10670 N N    . PHE A 1 120 ? 10.872  -3.978  -7.706  1.00 0.00 ? 120 PHE A N    4  
ATOM 10671 C CA   . PHE A 1 120 ? 11.591  -5.091  -7.079  1.00 0.00 ? 120 PHE A CA   4  
ATOM 10672 C C    . PHE A 1 120 ? 10.666  -6.213  -6.602  1.00 0.00 ? 120 PHE A C    4  
ATOM 10673 O O    . PHE A 1 120 ? 11.132  -7.205  -6.041  1.00 0.00 ? 120 PHE A O    4  
ATOM 10674 C CB   . PHE A 1 120 ? 12.343  -4.581  -5.850  1.00 0.00 ? 120 PHE A CB   4  
ATOM 10675 C CG   . PHE A 1 120 ? 13.131  -3.290  -5.976  1.00 0.00 ? 120 PHE A CG   4  
ATOM 10676 C CD1  . PHE A 1 120 ? 13.641  -2.834  -7.209  1.00 0.00 ? 120 PHE A CD1  4  
ATOM 10677 C CD2  . PHE A 1 120 ? 13.312  -2.507  -4.821  1.00 0.00 ? 120 PHE A CD2  4  
ATOM 10678 C CE1  . PHE A 1 120 ? 14.264  -1.575  -7.286  1.00 0.00 ? 120 PHE A CE1  4  
ATOM 10679 C CE2  . PHE A 1 120 ? 13.998  -1.293  -4.890  1.00 0.00 ? 120 PHE A CE2  4  
ATOM 10680 C CZ   . PHE A 1 120 ? 14.449  -0.812  -6.122  1.00 0.00 ? 120 PHE A CZ   4  
ATOM 10681 H H    . PHE A 1 120 ? 10.614  -3.199  -7.127  1.00 0.00 ? 120 PHE A H    4  
ATOM 10682 H HA   . PHE A 1 120 ? 12.302  -5.508  -7.793  1.00 0.00 ? 120 PHE A HA   4  
ATOM 10683 H HB2  . PHE A 1 120 ? 11.603  -4.418  -5.072  1.00 0.00 ? 120 PHE A HB2  4  
ATOM 10684 H HB3  . PHE A 1 120 ? 12.987  -5.385  -5.495  1.00 0.00 ? 120 PHE A HB3  4  
ATOM 10685 H HD1  . PHE A 1 120 ? 13.526  -3.426  -8.107  1.00 0.00 ? 120 PHE A HD1  4  
ATOM 10686 H HD2  . PHE A 1 120 ? 12.940  -2.834  -3.863  1.00 0.00 ? 120 PHE A HD2  4  
ATOM 10687 H HE1  . PHE A 1 120 ? 14.609  -1.197  -8.237  1.00 0.00 ? 120 PHE A HE1  4  
ATOM 10688 H HE2  . PHE A 1 120 ? 14.172  -0.715  -4.001  1.00 0.00 ? 120 PHE A HE2  4  
ATOM 10689 H HZ   . PHE A 1 120 ? 14.933  0.152   -6.133  1.00 0.00 ? 120 PHE A HZ   4  
ATOM 10690 N N    . SER A 1 121 ? 9.365   -6.000  -6.733  1.00 0.00 ? 121 SER A N    4  
ATOM 10691 C CA   . SER A 1 121 ? 8.252   -6.816  -6.284  1.00 0.00 ? 121 SER A CA   4  
ATOM 10692 C C    . SER A 1 121 ? 8.511   -8.291  -6.602  1.00 0.00 ? 121 SER A C    4  
ATOM 10693 O O    . SER A 1 121 ? 9.029   -8.609  -7.677  1.00 0.00 ? 121 SER A O    4  
ATOM 10694 C CB   . SER A 1 121 ? 6.971   -6.297  -6.971  1.00 0.00 ? 121 SER A CB   4  
ATOM 10695 O OG   . SER A 1 121 ? 7.181   -5.153  -7.787  1.00 0.00 ? 121 SER A OG   4  
ATOM 10696 H H    . SER A 1 121 ? 9.102   -5.180  -7.254  1.00 0.00 ? 121 SER A H    4  
ATOM 10697 H HA   . SER A 1 121 ? 8.138   -6.688  -5.205  1.00 0.00 ? 121 SER A HA   4  
ATOM 10698 H HB2  . SER A 1 121 ? 6.545   -7.076  -7.595  1.00 0.00 ? 121 SER A HB2  4  
ATOM 10699 H HB3  . SER A 1 121 ? 6.241   -6.045  -6.206  1.00 0.00 ? 121 SER A HB3  4  
ATOM 10700 H HG   . SER A 1 121 ? 7.385   -4.392  -7.210  1.00 0.00 ? 121 SER A HG   4  
ATOM 10701 N N    . GLN A 1 122 ? 8.164   -9.199  -5.680  1.00 0.00 ? 122 GLN A N    4  
ATOM 10702 C CA   . GLN A 1 122 ? 8.348   -10.628 -5.929  1.00 0.00 ? 122 GLN A CA   4  
ATOM 10703 C C    . GLN A 1 122 ? 7.229   -11.480 -5.309  1.00 0.00 ? 122 GLN A C    4  
ATOM 10704 O O    . GLN A 1 122 ? 6.744   -12.407 -5.952  1.00 0.00 ? 122 GLN A O    4  
ATOM 10705 C CB   . GLN A 1 122 ? 9.798   -11.036 -5.563  1.00 0.00 ? 122 GLN A CB   4  
ATOM 10706 C CG   . GLN A 1 122 ? 9.984   -11.905 -4.313  1.00 0.00 ? 122 GLN A CG   4  
ATOM 10707 C CD   . GLN A 1 122 ? 9.686   -13.403 -4.472  1.00 0.00 ? 122 GLN A CD   4  
ATOM 10708 O OE1  . GLN A 1 122 ? 9.682   -14.132 -3.489  1.00 0.00 ? 122 GLN A OE1  4  
ATOM 10709 N NE2  . GLN A 1 122 ? 9.402   -13.908 -5.662  1.00 0.00 ? 122 GLN A NE2  4  
ATOM 10710 H H    . GLN A 1 122 ? 7.782   -8.904  -4.795  1.00 0.00 ? 122 GLN A H    4  
ATOM 10711 H HA   . GLN A 1 122 ? 8.249   -10.760 -7.004  1.00 0.00 ? 122 GLN A HA   4  
ATOM 10712 H HB2  . GLN A 1 122 ? 10.262  -11.535 -6.411  1.00 0.00 ? 122 GLN A HB2  4  
ATOM 10713 H HB3  . GLN A 1 122 ? 10.390  -10.131 -5.415  1.00 0.00 ? 122 GLN A HB3  4  
ATOM 10714 H HG2  . GLN A 1 122 ? 11.020  -11.812 -3.997  1.00 0.00 ? 122 GLN A HG2  4  
ATOM 10715 H HG3  . GLN A 1 122 ? 9.355   -11.497 -3.525  1.00 0.00 ? 122 GLN A HG3  4  
ATOM 10716 H HE21 . GLN A 1 122 ? 9.384   -13.347 -6.510  1.00 0.00 ? 122 GLN A HE21 4  
ATOM 10717 H HE22 . GLN A 1 122 ? 9.209   -14.892 -5.743  1.00 0.00 ? 122 GLN A HE22 4  
ATOM 10718 N N    . LEU A 1 123 ? 6.764   -11.158 -4.097  1.00 0.00 ? 123 LEU A N    4  
ATOM 10719 C CA   . LEU A 1 123 ? 5.541   -11.748 -3.543  1.00 0.00 ? 123 LEU A CA   4  
ATOM 10720 C C    . LEU A 1 123 ? 4.377   -10.795 -3.682  1.00 0.00 ? 123 LEU A C    4  
ATOM 10721 O O    . LEU A 1 123 ? 3.254   -11.271 -3.722  1.00 0.00 ? 123 LEU A O    4  
ATOM 10722 C CB   . LEU A 1 123 ? 5.724   -12.145 -2.074  1.00 0.00 ? 123 LEU A CB   4  
ATOM 10723 C CG   . LEU A 1 123 ? 6.524   -13.443 -1.904  1.00 0.00 ? 123 LEU A CG   4  
ATOM 10724 C CD1  . LEU A 1 123 ? 6.917   -13.630 -0.438  1.00 0.00 ? 123 LEU A CD1  4  
ATOM 10725 C CD2  . LEU A 1 123 ? 5.714   -14.652 -2.379  1.00 0.00 ? 123 LEU A CD2  4  
ATOM 10726 H H    . LEU A 1 123 ? 7.193   -10.412 -3.565  1.00 0.00 ? 123 LEU A H    4  
ATOM 10727 H HA   . LEU A 1 123 ? 5.233   -12.627 -4.107  1.00 0.00 ? 123 LEU A HA   4  
ATOM 10728 H HB2  . LEU A 1 123 ? 6.215   -11.330 -1.552  1.00 0.00 ? 123 LEU A HB2  4  
ATOM 10729 H HB3  . LEU A 1 123 ? 4.744   -12.281 -1.618  1.00 0.00 ? 123 LEU A HB3  4  
ATOM 10730 H HG   . LEU A 1 123 ? 7.435   -13.375 -2.491  1.00 0.00 ? 123 LEU A HG   4  
ATOM 10731 H HD11 . LEU A 1 123 ? 7.547   -12.805 -0.113  1.00 0.00 ? 123 LEU A HD11 4  
ATOM 10732 H HD12 . LEU A 1 123 ? 6.030   -13.701 0.190   1.00 0.00 ? 123 LEU A HD12 4  
ATOM 10733 H HD13 . LEU A 1 123 ? 7.492   -14.552 -0.331  1.00 0.00 ? 123 LEU A HD13 4  
ATOM 10734 H HD21 . LEU A 1 123 ? 6.263   -15.556 -2.136  1.00 0.00 ? 123 LEU A HD21 4  
ATOM 10735 H HD22 . LEU A 1 123 ? 4.746   -14.683 -1.877  1.00 0.00 ? 123 LEU A HD22 4  
ATOM 10736 H HD23 . LEU A 1 123 ? 5.567   -14.628 -3.456  1.00 0.00 ? 123 LEU A HD23 4  
ATOM 10737 N N    . PHE A 1 124 ? 4.639   -9.496  -3.822  1.00 0.00 ? 124 PHE A N    4  
ATOM 10738 C CA   . PHE A 1 124 ? 3.660   -8.441  -4.008  1.00 0.00 ? 124 PHE A CA   4  
ATOM 10739 C C    . PHE A 1 124 ? 2.626   -8.852  -5.034  1.00 0.00 ? 124 PHE A C    4  
ATOM 10740 O O    . PHE A 1 124 ? 1.491   -9.088  -4.646  1.00 0.00 ? 124 PHE A O    4  
ATOM 10741 C CB   . PHE A 1 124 ? 4.377   -7.116  -4.304  1.00 0.00 ? 124 PHE A CB   4  
ATOM 10742 C CG   . PHE A 1 124 ? 4.125   -6.037  -3.271  1.00 0.00 ? 124 PHE A CG   4  
ATOM 10743 C CD1  . PHE A 1 124 ? 2.806   -5.684  -2.939  1.00 0.00 ? 124 PHE A CD1  4  
ATOM 10744 C CD2  . PHE A 1 124 ? 5.197   -5.355  -2.667  1.00 0.00 ? 124 PHE A CD2  4  
ATOM 10745 C CE1  . PHE A 1 124 ? 2.556   -4.629  -2.050  1.00 0.00 ? 124 PHE A CE1  4  
ATOM 10746 C CE2  . PHE A 1 124 ? 4.945   -4.293  -1.780  1.00 0.00 ? 124 PHE A CE2  4  
ATOM 10747 C CZ   . PHE A 1 124 ? 3.626   -3.919  -1.482  1.00 0.00 ? 124 PHE A CZ   4  
ATOM 10748 H H    . PHE A 1 124 ? 5.581   -9.198  -3.611  1.00 0.00 ? 124 PHE A H    4  
ATOM 10749 H HA   . PHE A 1 124 ? 3.092   -8.340  -3.095  1.00 0.00 ? 124 PHE A HA   4  
ATOM 10750 H HB2  . PHE A 1 124 ? 5.452   -7.285  -4.379  1.00 0.00 ? 124 PHE A HB2  4  
ATOM 10751 H HB3  . PHE A 1 124 ? 4.056   -6.739  -5.272  1.00 0.00 ? 124 PHE A HB3  4  
ATOM 10752 H HD1  . PHE A 1 124 ? 1.981   -6.225  -3.375  1.00 0.00 ? 124 PHE A HD1  4  
ATOM 10753 H HD2  . PHE A 1 124 ? 6.215   -5.639  -2.890  1.00 0.00 ? 124 PHE A HD2  4  
ATOM 10754 H HE1  . PHE A 1 124 ? 1.538   -4.362  -1.813  1.00 0.00 ? 124 PHE A HE1  4  
ATOM 10755 H HE2  . PHE A 1 124 ? 5.762   -3.750  -1.331  1.00 0.00 ? 124 PHE A HE2  4  
ATOM 10756 H HZ   . PHE A 1 124 ? 3.434   -3.096  -0.808  1.00 0.00 ? 124 PHE A HZ   4  
ATOM 10757 N N    . ILE A 1 125 ? 3.048   -9.062  -6.277  1.00 0.00 ? 125 ILE A N    4  
ATOM 10758 C CA   . ILE A 1 125 ? 2.287   -9.633  -7.363  1.00 0.00 ? 125 ILE A CA   4  
ATOM 10759 C C    . ILE A 1 125 ? 1.280   -10.685 -6.901  1.00 0.00 ? 125 ILE A C    4  
ATOM 10760 O O    . ILE A 1 125 ? 0.083   -10.554 -7.143  1.00 0.00 ? 125 ILE A O    4  
ATOM 10761 C CB   . ILE A 1 125 ? 3.259   -10.224 -8.413  1.00 0.00 ? 125 ILE A CB   4  
ATOM 10762 C CG1  . ILE A 1 125 ? 4.477   -9.338  -8.747  1.00 0.00 ? 125 ILE A CG1  4  
ATOM 10763 C CG2  . ILE A 1 125 ? 2.519   -10.562 -9.701  1.00 0.00 ? 125 ILE A CG2  4  
ATOM 10764 C CD1  . ILE A 1 125 ? 5.681   -9.705  -7.879  1.00 0.00 ? 125 ILE A CD1  4  
ATOM 10765 H H    . ILE A 1 125 ? 3.943   -8.714  -6.575  1.00 0.00 ? 125 ILE A H    4  
ATOM 10766 H HA   . ILE A 1 125 ? 1.741   -8.800  -7.773  1.00 0.00 ? 125 ILE A HA   4  
ATOM 10767 H HB   . ILE A 1 125 ? 3.640   -11.173 -8.038  1.00 0.00 ? 125 ILE A HB   4  
ATOM 10768 H HG12 . ILE A 1 125 ? 4.783   -9.504  -9.780  1.00 0.00 ? 125 ILE A HG12 4  
ATOM 10769 H HG13 . ILE A 1 125 ? 4.231   -8.281  -8.639  1.00 0.00 ? 125 ILE A HG13 4  
ATOM 10770 H HG21 . ILE A 1 125 ? 3.237   -10.955 -10.417 1.00 0.00 ? 125 ILE A HG21 4  
ATOM 10771 H HG22 . ILE A 1 125 ? 1.777   -11.334 -9.500  1.00 0.00 ? 125 ILE A HG22 4  
ATOM 10772 H HG23 . ILE A 1 125 ? 2.050   -9.670  -10.107 1.00 0.00 ? 125 ILE A HG23 4  
ATOM 10773 H HD11 . ILE A 1 125 ? 6.556   -9.196  -8.270  1.00 0.00 ? 125 ILE A HD11 4  
ATOM 10774 H HD12 . ILE A 1 125 ? 5.526   -9.420  -6.837  1.00 0.00 ? 125 ILE A HD12 4  
ATOM 10775 H HD13 . ILE A 1 125 ? 5.855   -10.778 -7.940  1.00 0.00 ? 125 ILE A HD13 4  
ATOM 10776 N N    . GLN A 1 126 ? 1.781   -11.735 -6.258  1.00 0.00 ? 126 GLN A N    4  
ATOM 10777 C CA   . GLN A 1 126 ? 1.027   -12.915 -5.890  1.00 0.00 ? 126 GLN A CA   4  
ATOM 10778 C C    . GLN A 1 126 ? 0.034   -12.525 -4.805  1.00 0.00 ? 126 GLN A C    4  
ATOM 10779 O O    . GLN A 1 126 ? -1.166  -12.738 -4.935  1.00 0.00 ? 126 GLN A O    4  
ATOM 10780 C CB   . GLN A 1 126 ? 1.973   -13.991 -5.332  1.00 0.00 ? 126 GLN A CB   4  
ATOM 10781 C CG   . GLN A 1 126 ? 3.221   -14.257 -6.201  1.00 0.00 ? 126 GLN A CG   4  
ATOM 10782 C CD   . GLN A 1 126 ? 3.050   -15.387 -7.208  1.00 0.00 ? 126 GLN A CD   4  
ATOM 10783 O OE1  . GLN A 1 126 ? 2.064   -15.470 -7.933  1.00 0.00 ? 126 GLN A OE1  4  
ATOM 10784 N NE2  . GLN A 1 126 ? 4.032   -16.263 -7.297  1.00 0.00 ? 126 GLN A NE2  4  
ATOM 10785 H H    . GLN A 1 126 ? 2.753   -11.705 -5.989  1.00 0.00 ? 126 GLN A H    4  
ATOM 10786 H HA   . GLN A 1 126 ? 0.505   -13.283 -6.777  1.00 0.00 ? 126 GLN A HA   4  
ATOM 10787 H HB2  . GLN A 1 126 ? 2.299   -13.677 -4.336  1.00 0.00 ? 126 GLN A HB2  4  
ATOM 10788 H HB3  . GLN A 1 126 ? 1.405   -14.912 -5.184  1.00 0.00 ? 126 GLN A HB3  4  
ATOM 10789 H HG2  . GLN A 1 126 ? 3.552   -13.373 -6.743  1.00 0.00 ? 126 GLN A HG2  4  
ATOM 10790 H HG3  . GLN A 1 126 ? 4.032   -14.503 -5.528  1.00 0.00 ? 126 GLN A HG3  4  
ATOM 10791 H HE21 . GLN A 1 126 ? 4.864   -16.104 -6.738  1.00 0.00 ? 126 GLN A HE21 4  
ATOM 10792 H HE22 . GLN A 1 126 ? 4.010   -17.032 -7.945  1.00 0.00 ? 126 GLN A HE22 4  
ATOM 10793 N N    . ALA A 1 127 ? 0.548   -11.946 -3.722  1.00 0.00 ? 127 ALA A N    4  
ATOM 10794 C CA   . ALA A 1 127 ? -0.219  -11.661 -2.532  1.00 0.00 ? 127 ALA A CA   4  
ATOM 10795 C C    . ALA A 1 127 ? -1.350  -10.672 -2.827  1.00 0.00 ? 127 ALA A C    4  
ATOM 10796 O O    . ALA A 1 127 ? -2.434  -10.743 -2.245  1.00 0.00 ? 127 ALA A O    4  
ATOM 10797 C CB   . ALA A 1 127 ? 0.733   -11.106 -1.473  1.00 0.00 ? 127 ALA A CB   4  
ATOM 10798 H H    . ALA A 1 127 ? 1.551   -11.774 -3.712  1.00 0.00 ? 127 ALA A H    4  
ATOM 10799 H HA   . ALA A 1 127 ? -0.640  -12.609 -2.207  1.00 0.00 ? 127 ALA A HA   4  
ATOM 10800 H HB1  . ALA A 1 127 ? 1.078   -10.106 -1.755  1.00 0.00 ? 127 ALA A HB1  4  
ATOM 10801 H HB2  . ALA A 1 127 ? 0.198   -11.060 -0.533  1.00 0.00 ? 127 ALA A HB2  4  
ATOM 10802 H HB3  . ALA A 1 127 ? 1.591   -11.768 -1.356  1.00 0.00 ? 127 ALA A HB3  4  
ATOM 10803 N N    . VAL A 1 128 ? -1.087  -9.743  -3.739  1.00 0.00 ? 128 VAL A N    4  
ATOM 10804 C CA   . VAL A 1 128 ? -2.057  -8.838  -4.303  1.00 0.00 ? 128 VAL A CA   4  
ATOM 10805 C C    . VAL A 1 128 ? -3.050  -9.671  -5.120  1.00 0.00 ? 128 VAL A C    4  
ATOM 10806 O O    . VAL A 1 128 ? -4.234  -9.705  -4.790  1.00 0.00 ? 128 VAL A O    4  
ATOM 10807 C CB   . VAL A 1 128 ? -1.309  -7.770  -5.130  1.00 0.00 ? 128 VAL A CB   4  
ATOM 10808 C CG1  . VAL A 1 128 ? -2.180  -6.990  -6.116  1.00 0.00 ? 128 VAL A CG1  4  
ATOM 10809 C CG2  . VAL A 1 128 ? -0.583  -6.784  -4.202  1.00 0.00 ? 128 VAL A CG2  4  
ATOM 10810 H H    . VAL A 1 128 ? -0.152  -9.704  -4.134  1.00 0.00 ? 128 VAL A H    4  
ATOM 10811 H HA   . VAL A 1 128 ? -2.562  -8.362  -3.462  1.00 0.00 ? 128 VAL A HA   4  
ATOM 10812 H HB   . VAL A 1 128 ? -0.562  -8.277  -5.735  1.00 0.00 ? 128 VAL A HB   4  
ATOM 10813 H HG11 . VAL A 1 128 ? -3.148  -6.773  -5.679  1.00 0.00 ? 128 VAL A HG11 4  
ATOM 10814 H HG12 . VAL A 1 128 ? -1.706  -6.048  -6.374  1.00 0.00 ? 128 VAL A HG12 4  
ATOM 10815 H HG13 . VAL A 1 128 ? -2.313  -7.578  -7.021  1.00 0.00 ? 128 VAL A HG13 4  
ATOM 10816 H HG21 . VAL A 1 128 ? 0.101   -6.173  -4.793  1.00 0.00 ? 128 VAL A HG21 4  
ATOM 10817 H HG22 . VAL A 1 128 ? -1.303  -6.144  -3.694  1.00 0.00 ? 128 VAL A HG22 4  
ATOM 10818 H HG23 . VAL A 1 128 ? 0.003   -7.324  -3.462  1.00 0.00 ? 128 VAL A HG23 4  
ATOM 10819 N N    . ARG A 1 129 ? -2.596  -10.371 -6.172  1.00 0.00 ? 129 ARG A N    4  
ATOM 10820 C CA   . ARG A 1 129 ? -3.493  -11.042 -7.117  1.00 0.00 ? 129 ARG A CA   4  
ATOM 10821 C C    . ARG A 1 129 ? -4.410  -12.047 -6.432  1.00 0.00 ? 129 ARG A C    4  
ATOM 10822 O O    . ARG A 1 129 ? -5.574  -12.130 -6.817  1.00 0.00 ? 129 ARG A O    4  
ATOM 10823 C CB   . ARG A 1 129 ? -2.731  -11.629 -8.324  1.00 0.00 ? 129 ARG A CB   4  
ATOM 10824 C CG   . ARG A 1 129 ? -2.221  -13.069 -8.202  1.00 0.00 ? 129 ARG A CG   4  
ATOM 10825 C CD   . ARG A 1 129 ? -1.364  -13.398 -9.427  1.00 0.00 ? 129 ARG A CD   4  
ATOM 10826 N NE   . ARG A 1 129 ? -0.843  -14.769 -9.367  1.00 0.00 ? 129 ARG A NE   4  
ATOM 10827 C CZ   . ARG A 1 129 ? -0.182  -15.400 -10.337 1.00 0.00 ? 129 ARG A CZ   4  
ATOM 10828 N NH1  . ARG A 1 129 ? 0.055   -14.796 -11.497 1.00 0.00 ? 129 ARG A NH1  4  
ATOM 10829 N NH2  . ARG A 1 129 ? 0.218   -16.647 -10.139 1.00 0.00 ? 129 ARG A NH2  4  
ATOM 10830 H H    . ARG A 1 129 ? -1.601  -10.364 -6.386  1.00 0.00 ? 129 ARG A H    4  
ATOM 10831 H HA   . ARG A 1 129 ? -4.143  -10.267 -7.520  1.00 0.00 ? 129 ARG A HA   4  
ATOM 10832 H HB2  . ARG A 1 129 ? -3.399  -11.600 -9.185  1.00 0.00 ? 129 ARG A HB2  4  
ATOM 10833 H HB3  . ARG A 1 129 ? -1.879  -10.992 -8.550  1.00 0.00 ? 129 ARG A HB3  4  
ATOM 10834 H HG2  . ARG A 1 129 ? -1.614  -13.171 -7.311  1.00 0.00 ? 129 ARG A HG2  4  
ATOM 10835 H HG3  . ARG A 1 129 ? -3.064  -13.760 -8.148  1.00 0.00 ? 129 ARG A HG3  4  
ATOM 10836 H HD2  . ARG A 1 129 ? -1.977  -13.288 -10.323 1.00 0.00 ? 129 ARG A HD2  4  
ATOM 10837 H HD3  . ARG A 1 129 ? -0.526  -12.701 -9.483  1.00 0.00 ? 129 ARG A HD3  4  
ATOM 10838 H HE   . ARG A 1 129 ? -1.062  -15.319 -8.538  1.00 0.00 ? 129 ARG A HE   4  
ATOM 10839 H HH11 . ARG A 1 129 ? -0.258  -13.844 -11.633 1.00 0.00 ? 129 ARG A HH11 4  
ATOM 10840 H HH12 . ARG A 1 129 ? 0.625   -15.212 -12.215 1.00 0.00 ? 129 ARG A HH12 4  
ATOM 10841 H HH21 . ARG A 1 129 ? 0.049   -17.087 -9.234  1.00 0.00 ? 129 ARG A HH21 4  
ATOM 10842 H HH22 . ARG A 1 129 ? 0.668   -17.205 -10.846 1.00 0.00 ? 129 ARG A HH22 4  
ATOM 10843 N N    . GLN A 1 130 ? -3.946  -12.771 -5.409  1.00 0.00 ? 130 GLN A N    4  
ATOM 10844 C CA   . GLN A 1 130 ? -4.782  -13.680 -4.640  1.00 0.00 ? 130 GLN A CA   4  
ATOM 10845 C C    . GLN A 1 130 ? -5.998  -12.914 -4.109  1.00 0.00 ? 130 GLN A C    4  
ATOM 10846 O O    . GLN A 1 130 ? -7.137  -13.212 -4.480  1.00 0.00 ? 130 GLN A O    4  
ATOM 10847 C CB   . GLN A 1 130 ? -3.978  -14.330 -3.512  1.00 0.00 ? 130 GLN A CB   4  
ATOM 10848 C CG   . GLN A 1 130 ? -2.956  -15.359 -4.011  1.00 0.00 ? 130 GLN A CG   4  
ATOM 10849 C CD   . GLN A 1 130 ? -3.560  -16.564 -4.716  1.00 0.00 ? 130 GLN A CD   4  
ATOM 10850 O OE1  . GLN A 1 130 ? -2.951  -17.143 -5.612  1.00 0.00 ? 130 GLN A OE1  4  
ATOM 10851 N NE2  . GLN A 1 130 ? -4.755  -16.982 -4.348  1.00 0.00 ? 130 GLN A NE2  4  
ATOM 10852 H H    . GLN A 1 130 ? -2.982  -12.642 -5.110  1.00 0.00 ? 130 GLN A H    4  
ATOM 10853 H HA   . GLN A 1 130 ? -5.114  -14.485 -5.288  1.00 0.00 ? 130 GLN A HA   4  
ATOM 10854 H HB2  . GLN A 1 130 ? -3.446  -13.570 -2.959  1.00 0.00 ? 130 GLN A HB2  4  
ATOM 10855 H HB3  . GLN A 1 130 ? -4.660  -14.812 -2.813  1.00 0.00 ? 130 GLN A HB3  4  
ATOM 10856 H HG2  . GLN A 1 130 ? -2.246  -14.896 -4.691  1.00 0.00 ? 130 GLN A HG2  4  
ATOM 10857 H HG3  . GLN A 1 130 ? -2.412  -15.706 -3.149  1.00 0.00 ? 130 GLN A HG3  4  
ATOM 10858 H HE21 . GLN A 1 130 ? -5.286  -16.540 -3.601  1.00 0.00 ? 130 GLN A HE21 4  
ATOM 10859 H HE22 . GLN A 1 130 ? -5.214  -17.668 -4.917  1.00 0.00 ? 130 GLN A HE22 4  
ATOM 10860 N N    . THR A 1 131 ? -5.753  -11.904 -3.281  1.00 0.00 ? 131 THR A N    4  
ATOM 10861 C CA   . THR A 1 131 ? -6.781  -11.186 -2.547  1.00 0.00 ? 131 THR A CA   4  
ATOM 10862 C C    . THR A 1 131 ? -7.532  -10.156 -3.407  1.00 0.00 ? 131 THR A C    4  
ATOM 10863 O O    . THR A 1 131 ? -8.641  -9.764  -3.038  1.00 0.00 ? 131 THR A O    4  
ATOM 10864 C CB   . THR A 1 131 ? -6.118  -10.620 -1.285  1.00 0.00 ? 131 THR A CB   4  
ATOM 10865 O OG1  . THR A 1 131 ? -5.560  -11.715 -0.578  1.00 0.00 ? 131 THR A OG1  4  
ATOM 10866 C CG2  . THR A 1 131 ? -7.047  -9.850  -0.343  1.00 0.00 ? 131 THR A CG2  4  
ATOM 10867 H H    . THR A 1 131 ? -4.800  -11.691 -3.012  1.00 0.00 ? 131 THR A H    4  
ATOM 10868 H HA   . THR A 1 131 ? -7.512  -11.919 -2.227  1.00 0.00 ? 131 THR A HA   4  
ATOM 10869 H HB   . THR A 1 131 ? -5.311  -9.962  -1.592  1.00 0.00 ? 131 THR A HB   4  
ATOM 10870 H HG1  . THR A 1 131 ? -5.632  -11.517 0.377   1.00 0.00 ? 131 THR A HG1  4  
ATOM 10871 H HG21 . THR A 1 131 ? -7.510  -9.018  -0.865  1.00 0.00 ? 131 THR A HG21 4  
ATOM 10872 H HG22 . THR A 1 131 ? -7.823  -10.509 0.051   1.00 0.00 ? 131 THR A HG22 4  
ATOM 10873 H HG23 . THR A 1 131 ? -6.464  -9.431  0.477   1.00 0.00 ? 131 THR A HG23 4  
ATOM 10874 N N    . LEU A 1 132 ? -7.034  -9.801  -4.599  1.00 0.00 ? 132 LEU A N    4  
ATOM 10875 C CA   . LEU A 1 132 ? -7.806  -9.060  -5.604  1.00 0.00 ? 132 LEU A CA   4  
ATOM 10876 C C    . LEU A 1 132 ? -9.001  -9.892  -6.076  1.00 0.00 ? 132 LEU A C    4  
ATOM 10877 O O    . LEU A 1 132 ? -9.940  -9.348  -6.640  1.00 0.00 ? 132 LEU A O    4  
ATOM 10878 C CB   . LEU A 1 132 ? -6.930  -8.688  -6.820  1.00 0.00 ? 132 LEU A CB   4  
ATOM 10879 C CG   . LEU A 1 132 ? -6.202  -7.337  -6.695  1.00 0.00 ? 132 LEU A CG   4  
ATOM 10880 C CD1  . LEU A 1 132 ? -5.132  -7.218  -7.790  1.00 0.00 ? 132 LEU A CD1  4  
ATOM 10881 C CD2  . LEU A 1 132 ? -7.168  -6.152  -6.849  1.00 0.00 ? 132 LEU A CD2  4  
ATOM 10882 H H    . LEU A 1 132 ? -6.137  -10.184 -4.877  1.00 0.00 ? 132 LEU A H    4  
ATOM 10883 H HA   . LEU A 1 132 ? -8.203  -8.155  -5.147  1.00 0.00 ? 132 LEU A HA   4  
ATOM 10884 H HB2  . LEU A 1 132 ? -6.206  -9.484  -6.981  1.00 0.00 ? 132 LEU A HB2  4  
ATOM 10885 H HB3  . LEU A 1 132 ? -7.560  -8.641  -7.710  1.00 0.00 ? 132 LEU A HB3  4  
ATOM 10886 H HG   . LEU A 1 132 ? -5.713  -7.281  -5.724  1.00 0.00 ? 132 LEU A HG   4  
ATOM 10887 H HD11 . LEU A 1 132 ? -5.593  -7.253  -8.773  1.00 0.00 ? 132 LEU A HD11 4  
ATOM 10888 H HD12 . LEU A 1 132 ? -4.588  -6.280  -7.687  1.00 0.00 ? 132 LEU A HD12 4  
ATOM 10889 H HD13 . LEU A 1 132 ? -4.415  -8.032  -7.702  1.00 0.00 ? 132 LEU A HD13 4  
ATOM 10890 H HD21 . LEU A 1 132 ? -7.965  -6.207  -6.110  1.00 0.00 ? 132 LEU A HD21 4  
ATOM 10891 H HD22 . LEU A 1 132 ? -6.630  -5.214  -6.712  1.00 0.00 ? 132 LEU A HD22 4  
ATOM 10892 H HD23 . LEU A 1 132 ? -7.633  -6.164  -7.835  1.00 0.00 ? 132 LEU A HD23 4  
ATOM 10893 N N    . SER A 1 133 ? -8.975  -11.203 -5.841  1.00 0.00 ? 133 SER A N    4  
ATOM 10894 C CA   . SER A 1 133 ? -10.014 -12.139 -6.211  1.00 0.00 ? 133 SER A CA   4  
ATOM 10895 C C    . SER A 1 133 ? -10.331 -13.035 -5.006  1.00 0.00 ? 133 SER A C    4  
ATOM 10896 O O    . SER A 1 133 ? -10.649 -14.216 -5.161  1.00 0.00 ? 133 SER A O    4  
ATOM 10897 C CB   . SER A 1 133 ? -9.521  -12.884 -7.455  1.00 0.00 ? 133 SER A CB   4  
ATOM 10898 O OG   . SER A 1 133 ? -10.586 -13.460 -8.183  1.00 0.00 ? 133 SER A OG   4  
ATOM 10899 H H    . SER A 1 133 ? -8.164  -11.605 -5.389  1.00 0.00 ? 133 SER A H    4  
ATOM 10900 H HA   . SER A 1 133 ? -10.920 -11.585 -6.465  1.00 0.00 ? 133 SER A HA   4  
ATOM 10901 H HB2  . SER A 1 133 ? -9.041  -12.167 -8.121  1.00 0.00 ? 133 SER A HB2  4  
ATOM 10902 H HB3  . SER A 1 133 ? -8.769  -13.616 -7.158  1.00 0.00 ? 133 SER A HB3  4  
ATOM 10903 H HG   . SER A 1 133 ? -10.754 -14.381 -7.901  1.00 0.00 ? 133 SER A HG   4  
ATOM 10904 N N    . THR A 1 134 ? -10.215 -12.513 -3.784  1.00 0.00 ? 134 THR A N    4  
ATOM 10905 C CA   . THR A 1 134 ? -10.741 -13.174 -2.604  1.00 0.00 ? 134 THR A CA   4  
ATOM 10906 C C    . THR A 1 134 ? -12.245 -12.870 -2.540  1.00 0.00 ? 134 THR A C    4  
ATOM 10907 O O    . THR A 1 134 ? -12.651 -11.714 -2.711  1.00 0.00 ? 134 THR A O    4  
ATOM 10908 C CB   . THR A 1 134 ? -9.957  -12.702 -1.367  1.00 0.00 ? 134 THR A CB   4  
ATOM 10909 O OG1  . THR A 1 134 ? -8.884  -13.609 -1.166  1.00 0.00 ? 134 THR A OG1  4  
ATOM 10910 C CG2  . THR A 1 134 ? -10.764 -12.568 -0.077  1.00 0.00 ? 134 THR A CG2  4  
ATOM 10911 H H    . THR A 1 134 ? -10.000 -11.534 -3.680  1.00 0.00 ? 134 THR A H    4  
ATOM 10912 H HA   . THR A 1 134 ? -10.582 -14.246 -2.717  1.00 0.00 ? 134 THR A HA   4  
ATOM 10913 H HB   . THR A 1 134 ? -9.547  -11.714 -1.570  1.00 0.00 ? 134 THR A HB   4  
ATOM 10914 H HG1  . THR A 1 134 ? -9.193  -14.298 -0.544  1.00 0.00 ? 134 THR A HG1  4  
ATOM 10915 H HG21 . THR A 1 134 ? -11.293 -13.489 0.164   1.00 0.00 ? 134 THR A HG21 4  
ATOM 10916 H HG22 . THR A 1 134 ? -10.085 -12.310 0.732   1.00 0.00 ? 134 THR A HG22 4  
ATOM 10917 H HG23 . THR A 1 134 ? -11.488 -11.759 -0.171  1.00 0.00 ? 134 THR A HG23 4  
ATOM 10918 N N    . PRO A 1 135 ? -13.084 -13.876 -2.270  1.00 0.00 ? 135 PRO A N    4  
ATOM 10919 C CA   . PRO A 1 135 ? -14.466 -13.691 -1.876  1.00 0.00 ? 135 PRO A CA   4  
ATOM 10920 C C    . PRO A 1 135 ? -14.482 -13.250 -0.408  1.00 0.00 ? 135 PRO A C    4  
ATOM 10921 O O    . PRO A 1 135 ? -14.185 -14.054 0.481   1.00 0.00 ? 135 PRO A O    4  
ATOM 10922 C CB   . PRO A 1 135 ? -15.127 -15.053 -2.108  1.00 0.00 ? 135 PRO A CB   4  
ATOM 10923 C CG   . PRO A 1 135 ? -13.991 -16.047 -1.888  1.00 0.00 ? 135 PRO A CG   4  
ATOM 10924 C CD   . PRO A 1 135 ? -12.735 -15.285 -2.291  1.00 0.00 ? 135 PRO A CD   4  
ATOM 10925 H HA   . PRO A 1 135 ? -14.953 -12.946 -2.503  1.00 0.00 ? 135 PRO A HA   4  
ATOM 10926 H HB2  . PRO A 1 135 ? -15.966 -15.232 -1.437  1.00 0.00 ? 135 PRO A HB2  4  
ATOM 10927 H HB3  . PRO A 1 135 ? -15.462 -15.127 -3.142  1.00 0.00 ? 135 PRO A HB3  4  
ATOM 10928 H HG2  . PRO A 1 135 ? -13.923 -16.298 -0.835  1.00 0.00 ? 135 PRO A HG2  4  
ATOM 10929 H HG3  . PRO A 1 135 ? -14.122 -16.948 -2.479  1.00 0.00 ? 135 PRO A HG3  4  
ATOM 10930 H HD2  . PRO A 1 135 ? -11.944 -15.501 -1.574  1.00 0.00 ? 135 PRO A HD2  4  
ATOM 10931 H HD3  . PRO A 1 135 ? -12.411 -15.545 -3.300  1.00 0.00 ? 135 PRO A HD3  4  
ATOM 10932 N N    . GLY A 1 136 ? -14.781 -11.977 -0.144  1.00 0.00 ? 136 GLY A N    4  
ATOM 10933 C CA   . GLY A 1 136 ? -14.956 -11.488 1.217   1.00 0.00 ? 136 GLY A CA   4  
ATOM 10934 C C    . GLY A 1 136 ? -13.776 -10.683 1.765   1.00 0.00 ? 136 GLY A C    4  
ATOM 10935 O O    . GLY A 1 136 ? -13.559 -10.730 2.973   1.00 0.00 ? 136 GLY A O    4  
ATOM 10936 H H    . GLY A 1 136 ? -15.029 -11.366 -0.909  1.00 0.00 ? 136 GLY A H    4  
ATOM 10937 H HA2  . GLY A 1 136 ? -15.838 -10.853 1.228   1.00 0.00 ? 136 GLY A HA2  4  
ATOM 10938 H HA3  . GLY A 1 136 ? -15.156 -12.324 1.892   1.00 0.00 ? 136 GLY A HA3  4  
ATOM 10939 N N    . THR A 1 137 ? -13.072 -9.905  0.942   1.00 0.00 ? 137 THR A N    4  
ATOM 10940 C CA   . THR A 1 137 ? -12.192 -8.804  1.360   1.00 0.00 ? 137 THR A CA   4  
ATOM 10941 C C    . THR A 1 137 ? -12.480 -7.628  0.403   1.00 0.00 ? 137 THR A C    4  
ATOM 10942 O O    . THR A 1 137 ? -13.225 -7.794  -0.573  1.00 0.00 ? 137 THR A O    4  
ATOM 10943 C CB   . THR A 1 137 ? -10.715 -9.271  1.362   1.00 0.00 ? 137 THR A CB   4  
ATOM 10944 O OG1  . THR A 1 137 ? -10.535 -10.338 2.269   1.00 0.00 ? 137 THR A OG1  4  
ATOM 10945 C CG2  . THR A 1 137 ? -9.697  -8.206  1.772   1.00 0.00 ? 137 THR A CG2  4  
ATOM 10946 H H    . THR A 1 137 ? -13.328 -9.867  -0.034  1.00 0.00 ? 137 THR A H    4  
ATOM 10947 H HA   . THR A 1 137 ? -12.460 -8.502  2.379   1.00 0.00 ? 137 THR A HA   4  
ATOM 10948 H HB   . THR A 1 137 ? -10.451 -9.624  0.368   1.00 0.00 ? 137 THR A HB   4  
ATOM 10949 H HG1  . THR A 1 137 ? -9.641  -10.270 2.626   1.00 0.00 ? 137 THR A HG1  4  
ATOM 10950 H HG21 . THR A 1 137 ? -9.593  -7.456  0.987   1.00 0.00 ? 137 THR A HG21 4  
ATOM 10951 H HG22 . THR A 1 137 ? -9.994  -7.736  2.708   1.00 0.00 ? 137 THR A HG22 4  
ATOM 10952 H HG23 . THR A 1 137 ? -8.716  -8.662  1.904   1.00 0.00 ? 137 THR A HG23 4  
ATOM 10953 N N    . ILE A 1 138 ? -11.944 -6.434  0.666   1.00 0.00 ? 138 ILE A N    4  
ATOM 10954 C CA   . ILE A 1 138 ? -12.141 -5.238  -0.141  1.00 0.00 ? 138 ILE A CA   4  
ATOM 10955 C C    . ILE A 1 138 ? -10.784 -4.535  -0.154  1.00 0.00 ? 138 ILE A C    4  
ATOM 10956 O O    . ILE A 1 138 ? -10.393 -3.981  0.871   1.00 0.00 ? 138 ILE A O    4  
ATOM 10957 C CB   . ILE A 1 138 ? -13.255 -4.347  0.472   1.00 0.00 ? 138 ILE A CB   4  
ATOM 10958 C CG1  . ILE A 1 138 ? -14.639 -5.037  0.502   1.00 0.00 ? 138 ILE A CG1  4  
ATOM 10959 C CG2  . ILE A 1 138 ? -13.352 -3.016  -0.293  1.00 0.00 ? 138 ILE A CG2  4  
ATOM 10960 C CD1  . ILE A 1 138 ? -15.654 -4.315  1.394   1.00 0.00 ? 138 ILE A CD1  4  
ATOM 10961 H H    . ILE A 1 138 ? -11.316 -6.330  1.455   1.00 0.00 ? 138 ILE A H    4  
ATOM 10962 H HA   . ILE A 1 138 ? -12.418 -5.518  -1.158  1.00 0.00 ? 138 ILE A HA   4  
ATOM 10963 H HB   . ILE A 1 138 ? -12.972 -4.121  1.497   1.00 0.00 ? 138 ILE A HB   4  
ATOM 10964 H HG12 . ILE A 1 138 ? -15.037 -5.099  -0.512  1.00 0.00 ? 138 ILE A HG12 4  
ATOM 10965 H HG13 . ILE A 1 138 ? -14.545 -6.044  0.908   1.00 0.00 ? 138 ILE A HG13 4  
ATOM 10966 H HG21 . ILE A 1 138 ? -14.083 -2.355  0.168   1.00 0.00 ? 138 ILE A HG21 4  
ATOM 10967 H HG22 . ILE A 1 138 ? -12.395 -2.497  -0.262  1.00 0.00 ? 138 ILE A HG22 4  
ATOM 10968 H HG23 . ILE A 1 138 ? -13.630 -3.202  -1.328  1.00 0.00 ? 138 ILE A HG23 4  
ATOM 10969 H HD11 . ILE A 1 138 ? -15.285 -4.274  2.417   1.00 0.00 ? 138 ILE A HD11 4  
ATOM 10970 H HD12 . ILE A 1 138 ? -15.857 -3.307  1.038   1.00 0.00 ? 138 ILE A HD12 4  
ATOM 10971 H HD13 . ILE A 1 138 ? -16.586 -4.869  1.387   1.00 0.00 ? 138 ILE A HD13 4  
ATOM 10972 N N    . ILE A 1 139 ? -10.045 -4.573  -1.266  1.00 0.00 ? 139 ILE A N    4  
ATOM 10973 C CA   . ILE A 1 139 ? -8.792  -3.831  -1.376  1.00 0.00 ? 139 ILE A CA   4  
ATOM 10974 C C    . ILE A 1 139 ? -9.053  -2.330  -1.247  1.00 0.00 ? 139 ILE A C    4  
ATOM 10975 O O    . ILE A 1 139 ? -9.943  -1.789  -1.915  1.00 0.00 ? 139 ILE A O    4  
ATOM 10976 C CB   . ILE A 1 139 ? -8.049  -4.127  -2.697  1.00 0.00 ? 139 ILE A CB   4  
ATOM 10977 C CG1  . ILE A 1 139 ? -7.849  -5.623  -2.994  1.00 0.00 ? 139 ILE A CG1  4  
ATOM 10978 C CG2  . ILE A 1 139 ? -6.678  -3.427  -2.710  1.00 0.00 ? 139 ILE A CG2  4  
ATOM 10979 C CD1  . ILE A 1 139 ? -7.027  -6.371  -1.944  1.00 0.00 ? 139 ILE A CD1  4  
ATOM 10980 H H    . ILE A 1 139 ? -10.316 -5.163  -2.033  1.00 0.00 ? 139 ILE A H    4  
ATOM 10981 H HA   . ILE A 1 139 ? -8.156  -4.134  -0.550  1.00 0.00 ? 139 ILE A HA   4  
ATOM 10982 H HB   . ILE A 1 139 ? -8.637  -3.721  -3.519  1.00 0.00 ? 139 ILE A HB   4  
ATOM 10983 H HG12 . ILE A 1 139 ? -8.819  -6.103  -3.096  1.00 0.00 ? 139 ILE A HG12 4  
ATOM 10984 H HG13 . ILE A 1 139 ? -7.333  -5.713  -3.947  1.00 0.00 ? 139 ILE A HG13 4  
ATOM 10985 H HG21 . ILE A 1 139 ? -6.807  -2.347  -2.802  1.00 0.00 ? 139 ILE A HG21 4  
ATOM 10986 H HG22 . ILE A 1 139 ? -6.137  -3.628  -1.783  1.00 0.00 ? 139 ILE A HG22 4  
ATOM 10987 H HG23 . ILE A 1 139 ? -6.087  -3.769  -3.557  1.00 0.00 ? 139 ILE A HG23 4  
ATOM 10988 H HD11 . ILE A 1 139 ? -7.581  -6.446  -1.011  1.00 0.00 ? 139 ILE A HD11 4  
ATOM 10989 H HD12 . ILE A 1 139 ? -6.811  -7.369  -2.317  1.00 0.00 ? 139 ILE A HD12 4  
ATOM 10990 H HD13 . ILE A 1 139 ? -6.083  -5.855  -1.773  1.00 0.00 ? 139 ILE A HD13 4  
ATOM 10991 N N    . LEU A 1 140 ? -8.200  -1.676  -0.466  1.00 0.00 ? 140 LEU A N    4  
ATOM 10992 C CA   . LEU A 1 140 ? -7.933  -0.248  -0.459  1.00 0.00 ? 140 LEU A CA   4  
ATOM 10993 C C    . LEU A 1 140 ? -6.405  -0.087  -0.458  1.00 0.00 ? 140 LEU A C    4  
ATOM 10994 O O    . LEU A 1 140 ? -5.709  -0.921  0.127   1.00 0.00 ? 140 LEU A O    4  
ATOM 10995 C CB   . LEU A 1 140 ? -8.582  0.368   0.791   1.00 0.00 ? 140 LEU A CB   4  
ATOM 10996 C CG   . LEU A 1 140 ? -8.476  1.898   0.857   1.00 0.00 ? 140 LEU A CG   4  
ATOM 10997 C CD1  . LEU A 1 140 ? -9.324  2.623   -0.167  1.00 0.00 ? 140 LEU A CD1  4  
ATOM 10998 C CD2  . LEU A 1 140 ? -8.811  2.392   2.267   1.00 0.00 ? 140 LEU A CD2  4  
ATOM 10999 H H    . LEU A 1 140 ? -7.514  -2.219  0.045   1.00 0.00 ? 140 LEU A H    4  
ATOM 11000 H HA   . LEU A 1 140 ? -8.363  0.203   -1.345  1.00 0.00 ? 140 LEU A HA   4  
ATOM 11001 H HB2  . LEU A 1 140 ? -9.632  0.089   0.826   1.00 0.00 ? 140 LEU A HB2  4  
ATOM 11002 H HB3  . LEU A 1 140 ? -8.097  -0.060  1.669   1.00 0.00 ? 140 LEU A HB3  4  
ATOM 11003 H HG   . LEU A 1 140 ? -7.475  2.189   0.601   1.00 0.00 ? 140 LEU A HG   4  
ATOM 11004 H HD11 . LEU A 1 140 ? -10.371 2.335   -0.061  1.00 0.00 ? 140 LEU A HD11 4  
ATOM 11005 H HD12 . LEU A 1 140 ? -9.212  3.694   -0.034  1.00 0.00 ? 140 LEU A HD12 4  
ATOM 11006 H HD13 . LEU A 1 140 ? -8.942  2.378   -1.155  1.00 0.00 ? 140 LEU A HD13 4  
ATOM 11007 H HD21 . LEU A 1 140 ? -9.812  2.057   2.541   1.00 0.00 ? 140 LEU A HD21 4  
ATOM 11008 H HD22 . LEU A 1 140 ? -8.077  1.990   2.966   1.00 0.00 ? 140 LEU A HD22 4  
ATOM 11009 H HD23 . LEU A 1 140 ? -8.774  3.480   2.308   1.00 0.00 ? 140 LEU A HD23 4  
ATOM 11010 N N    . GLY A 1 141 ? -5.862  0.975   -1.056  1.00 0.00 ? 141 GLY A N    4  
ATOM 11011 C CA   . GLY A 1 141 ? -4.426  1.230   -1.033  1.00 0.00 ? 141 GLY A CA   4  
ATOM 11012 C C    . GLY A 1 141 ? -4.038  2.422   -1.897  1.00 0.00 ? 141 GLY A C    4  
ATOM 11013 O O    . GLY A 1 141 ? -4.911  3.114   -2.425  1.00 0.00 ? 141 GLY A O    4  
ATOM 11014 H H    . GLY A 1 141 ? -6.426  1.627   -1.582  1.00 0.00 ? 141 GLY A H    4  
ATOM 11015 H HA2  . GLY A 1 141 ? -4.114  1.424   -0.007  1.00 0.00 ? 141 GLY A HA2  4  
ATOM 11016 H HA3  . GLY A 1 141 ? -3.911  0.342   -1.404  1.00 0.00 ? 141 GLY A HA3  4  
ATOM 11017 N N    . THR A 1 142 ? -2.741  2.656   -2.090  1.00 0.00 ? 142 THR A N    4  
ATOM 11018 C CA   . THR A 1 142 ? -2.265  3.680   -3.033  1.00 0.00 ? 142 THR A CA   4  
ATOM 11019 C C    . THR A 1 142 ? -1.418  3.060   -4.156  1.00 0.00 ? 142 THR A C    4  
ATOM 11020 O O    . THR A 1 142 ? -0.830  2.001   -3.968  1.00 0.00 ? 142 THR A O    4  
ATOM 11021 C CB   . THR A 1 142 ? -1.543  4.768   -2.222  1.00 0.00 ? 142 THR A CB   4  
ATOM 11022 O OG1  . THR A 1 142 ? -2.480  5.332   -1.331  1.00 0.00 ? 142 THR A OG1  4  
ATOM 11023 C CG2  . THR A 1 142 ? -1.015  5.949   -3.036  1.00 0.00 ? 142 THR A CG2  4  
ATOM 11024 H H    . THR A 1 142 ? -2.067  2.104   -1.562  1.00 0.00 ? 142 THR A H    4  
ATOM 11025 H HA   . THR A 1 142 ? -3.119  4.154   -3.516  1.00 0.00 ? 142 THR A HA   4  
ATOM 11026 H HB   . THR A 1 142 ? -0.718  4.330   -1.657  1.00 0.00 ? 142 THR A HB   4  
ATOM 11027 H HG1  . THR A 1 142 ? -2.452  4.773   -0.507  1.00 0.00 ? 142 THR A HG1  4  
ATOM 11028 H HG21 . THR A 1 142 ? -0.570  6.688   -2.369  1.00 0.00 ? 142 THR A HG21 4  
ATOM 11029 H HG22 . THR A 1 142 ? -0.250  5.613   -3.734  1.00 0.00 ? 142 THR A HG22 4  
ATOM 11030 H HG23 . THR A 1 142 ? -1.843  6.407   -3.570  1.00 0.00 ? 142 THR A HG23 4  
ATOM 11031 N N    . ILE A 1 143 ? -1.358  3.728   -5.315  1.00 0.00 ? 143 ILE A N    4  
ATOM 11032 C CA   . ILE A 1 143 ? -0.478  3.460   -6.448  1.00 0.00 ? 143 ILE A CA   4  
ATOM 11033 C C    . ILE A 1 143 ? 0.075   4.809   -6.960  1.00 0.00 ? 143 ILE A C    4  
ATOM 11034 O O    . ILE A 1 143 ? -0.719  5.707   -7.270  1.00 0.00 ? 143 ILE A O    4  
ATOM 11035 C CB   . ILE A 1 143 ? -1.211  2.699   -7.585  1.00 0.00 ? 143 ILE A CB   4  
ATOM 11036 C CG1  . ILE A 1 143 ? -2.609  3.245   -7.943  1.00 0.00 ? 143 ILE A CG1  4  
ATOM 11037 C CG2  . ILE A 1 143 ? -1.312  1.195   -7.287  1.00 0.00 ? 143 ILE A CG2  4  
ATOM 11038 C CD1  . ILE A 1 143 ? -3.114  2.754   -9.306  1.00 0.00 ? 143 ILE A CD1  4  
ATOM 11039 H H    . ILE A 1 143 ? -1.918  4.569   -5.417  1.00 0.00 ? 143 ILE A H    4  
ATOM 11040 H HA   . ILE A 1 143 ? 0.341   2.838   -6.094  1.00 0.00 ? 143 ILE A HA   4  
ATOM 11041 H HB   . ILE A 1 143 ? -0.587  2.817   -8.468  1.00 0.00 ? 143 ILE A HB   4  
ATOM 11042 H HG12 . ILE A 1 143 ? -3.318  2.962   -7.170  1.00 0.00 ? 143 ILE A HG12 4  
ATOM 11043 H HG13 . ILE A 1 143 ? -2.580  4.327   -7.981  1.00 0.00 ? 143 ILE A HG13 4  
ATOM 11044 H HG21 . ILE A 1 143 ? -1.695  1.022   -6.281  1.00 0.00 ? 143 ILE A HG21 4  
ATOM 11045 H HG22 . ILE A 1 143 ? -1.958  0.687   -8.000  1.00 0.00 ? 143 ILE A HG22 4  
ATOM 11046 H HG23 . ILE A 1 143 ? -0.327  0.754   -7.386  1.00 0.00 ? 143 ILE A HG23 4  
ATOM 11047 H HD11 . ILE A 1 143 ? -3.880  3.435   -9.667  1.00 0.00 ? 143 ILE A HD11 4  
ATOM 11048 H HD12 . ILE A 1 143 ? -2.301  2.735   -10.032 1.00 0.00 ? 143 ILE A HD12 4  
ATOM 11049 H HD13 . ILE A 1 143 ? -3.538  1.754   -9.219  1.00 0.00 ? 143 ILE A HD13 4  
ATOM 11050 N N    . PRO A 1 144 ? 1.401   5.009   -7.074  1.00 0.00 ? 144 PRO A N    4  
ATOM 11051 C CA   . PRO A 1 144 ? 1.943   6.222   -7.685  1.00 0.00 ? 144 PRO A CA   4  
ATOM 11052 C C    . PRO A 1 144 ? 1.505   6.328   -9.154  1.00 0.00 ? 144 PRO A C    4  
ATOM 11053 O O    . PRO A 1 144 ? 1.276   5.318   -9.825  1.00 0.00 ? 144 PRO A O    4  
ATOM 11054 C CB   . PRO A 1 144 ? 3.465   6.121   -7.527  1.00 0.00 ? 144 PRO A CB   4  
ATOM 11055 C CG   . PRO A 1 144 ? 3.721   4.619   -7.416  1.00 0.00 ? 144 PRO A CG   4  
ATOM 11056 C CD   . PRO A 1 144 ? 2.476   4.104   -6.692  1.00 0.00 ? 144 PRO A CD   4  
ATOM 11057 H HA   . PRO A 1 144 ? 1.583   7.095   -7.141  1.00 0.00 ? 144 PRO A HA   4  
ATOM 11058 H HB2  . PRO A 1 144 ? 4.001   6.560   -8.370  1.00 0.00 ? 144 PRO A HB2  4  
ATOM 11059 H HB3  . PRO A 1 144 ? 3.766   6.607   -6.599  1.00 0.00 ? 144 PRO A HB3  4  
ATOM 11060 H HG2  . PRO A 1 144 ? 3.767   4.188   -8.416  1.00 0.00 ? 144 PRO A HG2  4  
ATOM 11061 H HG3  . PRO A 1 144 ? 4.635   4.400   -6.862  1.00 0.00 ? 144 PRO A HG3  4  
ATOM 11062 H HD2  . PRO A 1 144 ? 2.266   3.079   -6.990  1.00 0.00 ? 144 PRO A HD2  4  
ATOM 11063 H HD3  . PRO A 1 144 ? 2.628   4.159   -5.613  1.00 0.00 ? 144 PRO A HD3  4  
ATOM 11064 N N    . VAL A 1 145 ? 1.365   7.555   -9.664  1.00 0.00 ? 145 VAL A N    4  
ATOM 11065 C CA   . VAL A 1 145 ? 1.022   7.810   -11.056 1.00 0.00 ? 145 VAL A CA   4  
ATOM 11066 C C    . VAL A 1 145 ? 2.308   7.686   -11.902 1.00 0.00 ? 145 VAL A C    4  
ATOM 11067 O O    . VAL A 1 145 ? 3.332   8.283   -11.544 1.00 0.00 ? 145 VAL A O    4  
ATOM 11068 C CB   . VAL A 1 145 ? 0.272   9.161   -11.139 1.00 0.00 ? 145 VAL A CB   4  
ATOM 11069 C CG1  . VAL A 1 145 ? 1.072   10.327  -11.716 1.00 0.00 ? 145 VAL A CG1  4  
ATOM 11070 C CG2  . VAL A 1 145 ? -1.051  9.014   -11.892 1.00 0.00 ? 145 VAL A CG2  4  
ATOM 11071 H H    . VAL A 1 145 ? 1.548   8.370   -9.102  1.00 0.00 ? 145 VAL A H    4  
ATOM 11072 H HA   . VAL A 1 145 ? 0.331   7.024   -11.361 1.00 0.00 ? 145 VAL A HA   4  
ATOM 11073 H HB   . VAL A 1 145 ? -0.007  9.450   -10.130 1.00 0.00 ? 145 VAL A HB   4  
ATOM 11074 H HG11 . VAL A 1 145 ? 1.969   10.486  -11.119 1.00 0.00 ? 145 VAL A HG11 4  
ATOM 11075 H HG12 . VAL A 1 145 ? 1.345   10.093  -12.742 1.00 0.00 ? 145 VAL A HG12 4  
ATOM 11076 H HG13 . VAL A 1 145 ? 0.476   11.236  -11.697 1.00 0.00 ? 145 VAL A HG13 4  
ATOM 11077 H HG21 . VAL A 1 145 ? -1.640  8.224   -11.432 1.00 0.00 ? 145 VAL A HG21 4  
ATOM 11078 H HG22 . VAL A 1 145 ? -1.612  9.945   -11.846 1.00 0.00 ? 145 VAL A HG22 4  
ATOM 11079 H HG23 . VAL A 1 145 ? -0.869  8.754   -12.931 1.00 0.00 ? 145 VAL A HG23 4  
ATOM 11080 N N    . PRO A 1 146 ? 2.282   6.914   -13.003 1.00 0.00 ? 146 PRO A N    4  
ATOM 11081 C CA   . PRO A 1 146 ? 3.479   6.478   -13.708 1.00 0.00 ? 146 PRO A CA   4  
ATOM 11082 C C    . PRO A 1 146 ? 4.125   7.652   -14.439 1.00 0.00 ? 146 PRO A C    4  
ATOM 11083 O O    . PRO A 1 146 ? 5.309   7.914   -14.228 1.00 0.00 ? 146 PRO A O    4  
ATOM 11084 C CB   . PRO A 1 146 ? 3.019   5.359   -14.650 1.00 0.00 ? 146 PRO A CB   4  
ATOM 11085 C CG   . PRO A 1 146 ? 1.532   5.634   -14.875 1.00 0.00 ? 146 PRO A CG   4  
ATOM 11086 C CD   . PRO A 1 146 ? 1.090   6.356   -13.612 1.00 0.00 ? 146 PRO A CD   4  
ATOM 11087 H HA   . PRO A 1 146 ? 4.200   6.071   -12.997 1.00 0.00 ? 146 PRO A HA   4  
ATOM 11088 H HB2  . PRO A 1 146 ? 3.571   5.361   -15.591 1.00 0.00 ? 146 PRO A HB2  4  
ATOM 11089 H HB3  . PRO A 1 146 ? 3.135   4.398   -14.148 1.00 0.00 ? 146 PRO A HB3  4  
ATOM 11090 H HG2  . PRO A 1 146 ? 1.395   6.280   -15.744 1.00 0.00 ? 146 PRO A HG2  4  
ATOM 11091 H HG3  . PRO A 1 146 ? 0.964   4.714   -14.976 1.00 0.00 ? 146 PRO A HG3  4  
ATOM 11092 H HD2  . PRO A 1 146 ? 0.376   7.138   -13.860 1.00 0.00 ? 146 PRO A HD2  4  
ATOM 11093 H HD3  . PRO A 1 146 ? 0.641   5.649   -12.925 1.00 0.00 ? 146 PRO A HD3  4  
ATOM 11094 N N    . LYS A 1 147 ? 3.341   8.394   -15.240 1.00 0.00 ? 147 LYS A N    4  
ATOM 11095 C CA   . LYS A 1 147 ? 3.727   9.640   -15.910 1.00 0.00 ? 147 LYS A CA   4  
ATOM 11096 C C    . LYS A 1 147 ? 5.159   9.549   -16.458 1.00 0.00 ? 147 LYS A C    4  
ATOM 11097 O O    . LYS A 1 147 ? 6.046   10.328  -16.080 1.00 0.00 ? 147 LYS A O    4  
ATOM 11098 C CB   . LYS A 1 147 ? 3.438   10.776  -14.920 1.00 0.00 ? 147 LYS A CB   4  
ATOM 11099 C CG   . LYS A 1 147 ? 3.567   12.195  -15.472 1.00 0.00 ? 147 LYS A CG   4  
ATOM 11100 C CD   . LYS A 1 147 ? 3.047   13.165  -14.414 1.00 0.00 ? 147 LYS A CD   4  
ATOM 11101 C CE   . LYS A 1 147 ? 3.319   14.618  -14.805 1.00 0.00 ? 147 LYS A CE   4  
ATOM 11102 N NZ   . LYS A 1 147 ? 3.257   15.495  -13.624 1.00 0.00 ? 147 LYS A NZ   4  
ATOM 11103 H H    . LYS A 1 147 ? 2.365   8.134   -15.307 1.00 0.00 ? 147 LYS A H    4  
ATOM 11104 H HA   . LYS A 1 147 ? 3.059   9.770   -16.760 1.00 0.00 ? 147 LYS A HA   4  
ATOM 11105 H HB2  . LYS A 1 147 ? 2.412   10.658  -14.584 1.00 0.00 ? 147 LYS A HB2  4  
ATOM 11106 H HB3  . LYS A 1 147 ? 4.076   10.665  -14.047 1.00 0.00 ? 147 LYS A HB3  4  
ATOM 11107 H HG2  . LYS A 1 147 ? 4.615   12.415  -15.662 1.00 0.00 ? 147 LYS A HG2  4  
ATOM 11108 H HG3  . LYS A 1 147 ? 2.983   12.299  -16.386 1.00 0.00 ? 147 LYS A HG3  4  
ATOM 11109 H HD2  . LYS A 1 147 ? 1.974   13.021  -14.272 1.00 0.00 ? 147 LYS A HD2  4  
ATOM 11110 H HD3  . LYS A 1 147 ? 3.551   12.939  -13.477 1.00 0.00 ? 147 LYS A HD3  4  
ATOM 11111 H HE2  . LYS A 1 147 ? 4.313   14.699  -15.247 1.00 0.00 ? 147 LYS A HE2  4  
ATOM 11112 H HE3  . LYS A 1 147 ? 2.572   14.931  -15.535 1.00 0.00 ? 147 LYS A HE3  4  
ATOM 11113 H HZ1  . LYS A 1 147 ? 3.248   16.478  -13.882 1.00 0.00 ? 147 LYS A HZ1  4  
ATOM 11114 H HZ2  . LYS A 1 147 ? 2.414   15.307  -13.093 1.00 0.00 ? 147 LYS A HZ2  4  
ATOM 11115 H HZ3  . LYS A 1 147 ? 4.062   15.322  -13.027 1.00 0.00 ? 147 LYS A HZ3  4  
ATOM 11116 N N    . GLY A 1 148 ? 5.392   8.535   -17.286 1.00 0.00 ? 148 GLY A N    4  
ATOM 11117 C CA   . GLY A 1 148 ? 6.683   7.956   -17.614 1.00 0.00 ? 148 GLY A CA   4  
ATOM 11118 C C    . GLY A 1 148 ? 6.439   6.536   -18.116 1.00 0.00 ? 148 GLY A C    4  
ATOM 11119 O O    . GLY A 1 148 ? 5.376   6.244   -18.674 1.00 0.00 ? 148 GLY A O    4  
ATOM 11120 H H    . GLY A 1 148 ? 4.617   7.961   -17.598 1.00 0.00 ? 148 GLY A H    4  
ATOM 11121 H HA2  . GLY A 1 148 ? 7.164   8.539   -18.399 1.00 0.00 ? 148 GLY A HA2  4  
ATOM 11122 H HA3  . GLY A 1 148 ? 7.323   7.917   -16.731 1.00 0.00 ? 148 GLY A HA3  4  
ATOM 11123 N N    . LYS A 1 149 ? 7.428   5.655   -17.952 1.00 0.00 ? 149 LYS A N    4  
ATOM 11124 C CA   . LYS A 1 149 ? 7.263   4.232   -18.245 1.00 0.00 ? 149 LYS A CA   4  
ATOM 11125 C C    . LYS A 1 149 ? 6.219   3.615   -17.307 1.00 0.00 ? 149 LYS A C    4  
ATOM 11126 O O    . LYS A 1 149 ? 5.844   4.217   -16.299 1.00 0.00 ? 149 LYS A O    4  
ATOM 11127 C CB   . LYS A 1 149 ? 8.623   3.507   -18.130 1.00 0.00 ? 149 LYS A CB   4  
ATOM 11128 C CG   . LYS A 1 149 ? 9.204   2.991   -19.449 1.00 0.00 ? 149 LYS A CG   4  
ATOM 11129 C CD   . LYS A 1 149 ? 9.690   4.084   -20.382 1.00 0.00 ? 149 LYS A CD   4  
ATOM 11130 C CE   . LYS A 1 149 ? 8.594   4.804   -21.154 1.00 0.00 ? 149 LYS A CE   4  
ATOM 11131 N NZ   . LYS A 1 149 ? 7.858   3.911   -22.067 1.00 0.00 ? 149 LYS A NZ   4  
ATOM 11132 H H    . LYS A 1 149 ? 8.202   5.921   -17.353 1.00 0.00 ? 149 LYS A H    4  
ATOM 11133 H HA   . LYS A 1 149 ? 6.856   4.133   -19.248 1.00 0.00 ? 149 LYS A HA   4  
ATOM 11134 H HB2  . LYS A 1 149 ? 9.359   4.144   -17.640 1.00 0.00 ? 149 LYS A HB2  4  
ATOM 11135 H HB3  . LYS A 1 149 ? 8.510   2.632   -17.492 1.00 0.00 ? 149 LYS A HB3  4  
ATOM 11136 H HG2  . LYS A 1 149 ? 10.069  2.389   -19.199 1.00 0.00 ? 149 LYS A HG2  4  
ATOM 11137 H HG3  . LYS A 1 149 ? 8.502   2.352   -19.975 1.00 0.00 ? 149 LYS A HG3  4  
ATOM 11138 H HD2  . LYS A 1 149 ? 10.223  4.815   -19.781 1.00 0.00 ? 149 LYS A HD2  4  
ATOM 11139 H HD3  . LYS A 1 149 ? 10.360  3.614   -21.092 1.00 0.00 ? 149 LYS A HD3  4  
ATOM 11140 H HE2  . LYS A 1 149 ? 7.908   5.235   -20.434 1.00 0.00 ? 149 LYS A HE2  4  
ATOM 11141 H HE3  . LYS A 1 149 ? 9.040   5.616   -21.724 1.00 0.00 ? 149 LYS A HE3  4  
ATOM 11142 H HZ1  . LYS A 1 149 ? 7.129   4.425   -22.557 1.00 0.00 ? 149 LYS A HZ1  4  
ATOM 11143 H HZ2  . LYS A 1 149 ? 8.453   3.469   -22.758 1.00 0.00 ? 149 LYS A HZ2  4  
ATOM 11144 H HZ3  . LYS A 1 149 ? 7.382   3.164   -21.580 1.00 0.00 ? 149 LYS A HZ3  4  
ATOM 11145 N N    . PRO A 1 150 ? 5.756   2.395   -17.618 1.00 0.00 ? 150 PRO A N    4  
ATOM 11146 C CA   . PRO A 1 150 ? 4.976   1.621   -16.681 1.00 0.00 ? 150 PRO A CA   4  
ATOM 11147 C C    . PRO A 1 150 ? 5.890   1.124   -15.554 1.00 0.00 ? 150 PRO A C    4  
ATOM 11148 O O    . PRO A 1 150 ? 7.122   1.210   -15.617 1.00 0.00 ? 150 PRO A O    4  
ATOM 11149 C CB   . PRO A 1 150 ? 4.369   0.492   -17.511 1.00 0.00 ? 150 PRO A CB   4  
ATOM 11150 C CG   . PRO A 1 150 ? 5.395   0.255   -18.615 1.00 0.00 ? 150 PRO A CG   4  
ATOM 11151 C CD   . PRO A 1 150 ? 6.165   1.568   -18.743 1.00 0.00 ? 150 PRO A CD   4  
ATOM 11152 H HA   . PRO A 1 150 ? 4.180   2.235   -16.258 1.00 0.00 ? 150 PRO A HA   4  
ATOM 11153 H HB2  . PRO A 1 150 ? 4.196   -0.408  -16.923 1.00 0.00 ? 150 PRO A HB2  4  
ATOM 11154 H HB3  . PRO A 1 150 ? 3.435   0.836   -17.958 1.00 0.00 ? 150 PRO A HB3  4  
ATOM 11155 H HG2  . PRO A 1 150 ? 6.083   -0.539  -18.321 1.00 0.00 ? 150 PRO A HG2  4  
ATOM 11156 H HG3  . PRO A 1 150 ? 4.894   0.003   -19.543 1.00 0.00 ? 150 PRO A HG3  4  
ATOM 11157 H HD2  . PRO A 1 150 ? 7.230   1.342   -18.681 1.00 0.00 ? 150 PRO A HD2  4  
ATOM 11158 H HD3  . PRO A 1 150 ? 5.973   2.079   -19.688 1.00 0.00 ? 150 PRO A HD3  4  
ATOM 11159 N N    . LEU A 1 151 ? 5.257   0.603   -14.513 1.00 0.00 ? 151 LEU A N    4  
ATOM 11160 C CA   . LEU A 1 151 ? 5.866   -0.001  -13.334 1.00 0.00 ? 151 LEU A CA   4  
ATOM 11161 C C    . LEU A 1 151 ? 5.558   -1.504  -13.413 1.00 0.00 ? 151 LEU A C    4  
ATOM 11162 O O    . LEU A 1 151 ? 4.849   -1.919  -14.332 1.00 0.00 ? 151 LEU A O    4  
ATOM 11163 C CB   . LEU A 1 151 ? 5.261   0.682   -12.090 1.00 0.00 ? 151 LEU A CB   4  
ATOM 11164 C CG   . LEU A 1 151 ? 5.960   1.974   -11.605 1.00 0.00 ? 151 LEU A CG   4  
ATOM 11165 C CD1  . LEU A 1 151 ? 6.119   3.044   -12.689 1.00 0.00 ? 151 LEU A CD1  4  
ATOM 11166 C CD2  . LEU A 1 151 ? 5.146   2.618   -10.473 1.00 0.00 ? 151 LEU A CD2  4  
ATOM 11167 H H    . LEU A 1 151 ? 4.274   0.410   -14.621 1.00 0.00 ? 151 LEU A H    4  
ATOM 11168 H HA   . LEU A 1 151 ? 6.948   0.136   -13.343 1.00 0.00 ? 151 LEU A HA   4  
ATOM 11169 H HB2  . LEU A 1 151 ? 4.224   0.917   -12.319 1.00 0.00 ? 151 LEU A HB2  4  
ATOM 11170 H HB3  . LEU A 1 151 ? 5.269   -0.028  -11.265 1.00 0.00 ? 151 LEU A HB3  4  
ATOM 11171 H HG   . LEU A 1 151 ? 6.945   1.706   -11.227 1.00 0.00 ? 151 LEU A HG   4  
ATOM 11172 H HD11 . LEU A 1 151 ? 5.168   3.260   -13.172 1.00 0.00 ? 151 LEU A HD11 4  
ATOM 11173 H HD12 . LEU A 1 151 ? 6.520   3.960   -12.255 1.00 0.00 ? 151 LEU A HD12 4  
ATOM 11174 H HD13 . LEU A 1 151 ? 6.836   2.703   -13.428 1.00 0.00 ? 151 LEU A HD13 4  
ATOM 11175 H HD21 . LEU A 1 151 ? 5.693   3.479   -10.080 1.00 0.00 ? 151 LEU A HD21 4  
ATOM 11176 H HD22 . LEU A 1 151 ? 4.171   2.948   -10.834 1.00 0.00 ? 151 LEU A HD22 4  
ATOM 11177 H HD23 . LEU A 1 151 ? 5.013   1.907   -9.664  1.00 0.00 ? 151 LEU A HD23 4  
ATOM 11178 N N    . ALA A 1 152 ? 6.060   -2.313  -12.479 1.00 0.00 ? 152 ALA A N    4  
ATOM 11179 C CA   . ALA A 1 152 ? 5.787   -3.745  -12.421 1.00 0.00 ? 152 ALA A CA   4  
ATOM 11180 C C    . ALA A 1 152 ? 4.556   -3.949  -11.533 1.00 0.00 ? 152 ALA A C    4  
ATOM 11181 O O    . ALA A 1 152 ? 3.434   -4.022  -12.026 1.00 0.00 ? 152 ALA A O    4  
ATOM 11182 C CB   . ALA A 1 152 ? 7.042   -4.488  -11.929 1.00 0.00 ? 152 ALA A CB   4  
ATOM 11183 H H    . ALA A 1 152 ? 6.599   -1.931  -11.714 1.00 0.00 ? 152 ALA A H    4  
ATOM 11184 H HA   . ALA A 1 152 ? 5.545   -4.116  -13.420 1.00 0.00 ? 152 ALA A HA   4  
ATOM 11185 H HB1  . ALA A 1 152 ? 6.849   -5.559  -11.915 1.00 0.00 ? 152 ALA A HB1  4  
ATOM 11186 H HB2  . ALA A 1 152 ? 7.875   -4.293  -12.606 1.00 0.00 ? 152 ALA A HB2  4  
ATOM 11187 H HB3  . ALA A 1 152 ? 7.323   -4.177  -10.925 1.00 0.00 ? 152 ALA A HB3  4  
ATOM 11188 N N    . LEU A 1 153 ? 4.738   -3.904  -10.212 1.00 0.00 ? 153 LEU A N    4  
ATOM 11189 C CA   . LEU A 1 153 ? 3.685   -4.086  -9.214  1.00 0.00 ? 153 LEU A CA   4  
ATOM 11190 C C    . LEU A 1 153 ? 2.475   -3.190  -9.479  1.00 0.00 ? 153 LEU A C    4  
ATOM 11191 O O    . LEU A 1 153 ? 1.345   -3.663  -9.391  1.00 0.00 ? 153 LEU A O    4  
ATOM 11192 C CB   . LEU A 1 153 ? 4.304   -3.872  -7.830  1.00 0.00 ? 153 LEU A CB   4  
ATOM 11193 C CG   . LEU A 1 153 ? 3.410   -3.445  -6.658  1.00 0.00 ? 153 LEU A CG   4  
ATOM 11194 C CD1  . LEU A 1 153 ? 2.310   -4.456  -6.344  1.00 0.00 ? 153 LEU A CD1  4  
ATOM 11195 C CD2  . LEU A 1 153 ? 4.322   -3.318  -5.436  1.00 0.00 ? 153 LEU A CD2  4  
ATOM 11196 H H    . LEU A 1 153 ? 5.696   -3.808  -9.899  1.00 0.00 ? 153 LEU A H    4  
ATOM 11197 H HA   . LEU A 1 153 ? 3.353   -5.125  -9.268  1.00 0.00 ? 153 LEU A HA   4  
ATOM 11198 H HB2  . LEU A 1 153 ? 4.756   -4.820  -7.562  1.00 0.00 ? 153 LEU A HB2  4  
ATOM 11199 H HB3  . LEU A 1 153 ? 5.096   -3.133  -7.925  1.00 0.00 ? 153 LEU A HB3  4  
ATOM 11200 H HG   . LEU A 1 153 ? 2.966   -2.474  -6.866  1.00 0.00 ? 153 LEU A HG   4  
ATOM 11201 H HD11 . LEU A 1 153 ? 1.486   -4.322  -7.038  1.00 0.00 ? 153 LEU A HD11 4  
ATOM 11202 H HD12 . LEU A 1 153 ? 2.687   -5.471  -6.439  1.00 0.00 ? 153 LEU A HD12 4  
ATOM 11203 H HD13 . LEU A 1 153 ? 1.916   -4.313  -5.342  1.00 0.00 ? 153 LEU A HD13 4  
ATOM 11204 H HD21 . LEU A 1 153 ? 5.090   -2.575  -5.643  1.00 0.00 ? 153 LEU A HD21 4  
ATOM 11205 H HD22 . LEU A 1 153 ? 3.736   -3.007  -4.573  1.00 0.00 ? 153 LEU A HD22 4  
ATOM 11206 H HD23 . LEU A 1 153 ? 4.808   -4.268  -5.231  1.00 0.00 ? 153 LEU A HD23 4  
ATOM 11207 N N    . VAL A 1 154 ? 2.681   -1.915  -9.812  1.00 0.00 ? 154 VAL A N    4  
ATOM 11208 C CA   . VAL A 1 154 ? 1.559   -1.009  -10.039 1.00 0.00 ? 154 VAL A CA   4  
ATOM 11209 C C    . VAL A 1 154 ? 0.780   -1.394  -11.303 1.00 0.00 ? 154 VAL A C    4  
ATOM 11210 O O    . VAL A 1 154 ? -0.431  -1.185  -11.322 1.00 0.00 ? 154 VAL A O    4  
ATOM 11211 C CB   . VAL A 1 154 ? 2.045   0.452   -10.061 1.00 0.00 ? 154 VAL A CB   4  
ATOM 11212 C CG1  . VAL A 1 154 ? 0.952   1.455   -10.454 1.00 0.00 ? 154 VAL A CG1  4  
ATOM 11213 C CG2  . VAL A 1 154 ? 2.619   0.845   -8.695  1.00 0.00 ? 154 VAL A CG2  4  
ATOM 11214 H H    . VAL A 1 154 ? 3.630   -1.583  -9.886  1.00 0.00 ? 154 VAL A H    4  
ATOM 11215 H HA   . VAL A 1 154 ? 0.868   -1.118  -9.201  1.00 0.00 ? 154 VAL A HA   4  
ATOM 11216 H HB   . VAL A 1 154 ? 2.836   0.534   -10.792 1.00 0.00 ? 154 VAL A HB   4  
ATOM 11217 H HG11 . VAL A 1 154 ? 1.289   2.479   -10.286 1.00 0.00 ? 154 VAL A HG11 4  
ATOM 11218 H HG12 . VAL A 1 154 ? 0.700   1.346   -11.508 1.00 0.00 ? 154 VAL A HG12 4  
ATOM 11219 H HG13 . VAL A 1 154 ? 0.053   1.259   -9.874  1.00 0.00 ? 154 VAL A HG13 4  
ATOM 11220 H HG21 . VAL A 1 154 ? 3.469   0.216   -8.430  1.00 0.00 ? 154 VAL A HG21 4  
ATOM 11221 H HG22 . VAL A 1 154 ? 2.955   1.879   -8.724  1.00 0.00 ? 154 VAL A HG22 4  
ATOM 11222 H HG23 . VAL A 1 154 ? 1.854   0.749   -7.933  1.00 0.00 ? 154 VAL A HG23 4  
ATOM 11223 N N    . GLU A 1 155 ? 1.411   -1.964  -12.340 1.00 0.00 ? 155 GLU A N    4  
ATOM 11224 C CA   . GLU A 1 155 ? 0.673   -2.454  -13.504 1.00 0.00 ? 155 GLU A CA   4  
ATOM 11225 C C    . GLU A 1 155 ? -0.292  -3.564  -13.077 1.00 0.00 ? 155 GLU A C    4  
ATOM 11226 O O    . GLU A 1 155 ? -1.404  -3.614  -13.593 1.00 0.00 ? 155 GLU A O    4  
ATOM 11227 C CB   . GLU A 1 155 ? 1.622   -2.931  -14.625 1.00 0.00 ? 155 GLU A CB   4  
ATOM 11228 C CG   . GLU A 1 155 ? 1.936   -1.864  -15.690 1.00 0.00 ? 155 GLU A CG   4  
ATOM 11229 C CD   . GLU A 1 155 ? 0.736   -1.387  -16.522 1.00 0.00 ? 155 GLU A CD   4  
ATOM 11230 O OE1  . GLU A 1 155 ? -0.380  -1.938  -16.416 1.00 0.00 ? 155 GLU A OE1  4  
ATOM 11231 O OE2  . GLU A 1 155 ? 0.892   -0.412  -17.294 1.00 0.00 ? 155 GLU A OE2  4  
ATOM 11232 H H    . GLU A 1 155 ? 2.355   -2.323  -12.230 1.00 0.00 ? 155 GLU A H    4  
ATOM 11233 H HA   . GLU A 1 155 ? 0.056   -1.645  -13.892 1.00 0.00 ? 155 GLU A HA   4  
ATOM 11234 H HB2  . GLU A 1 155 ? 2.566   -3.257  -14.190 1.00 0.00 ? 155 GLU A HB2  4  
ATOM 11235 H HB3  . GLU A 1 155 ? 1.185   -3.791  -15.129 1.00 0.00 ? 155 GLU A HB3  4  
ATOM 11236 H HG2  . GLU A 1 155 ? 2.396   -1.006  -15.199 1.00 0.00 ? 155 GLU A HG2  4  
ATOM 11237 H HG3  . GLU A 1 155 ? 2.672   -2.280  -16.378 1.00 0.00 ? 155 GLU A HG3  4  
ATOM 11238 N N    . GLU A 1 156 ? 0.062   -4.394  -12.090 1.00 0.00 ? 156 GLU A N    4  
ATOM 11239 C CA   . GLU A 1 156 ? -0.796  -5.491  -11.646 1.00 0.00 ? 156 GLU A CA   4  
ATOM 11240 C C    . GLU A 1 156 ? -2.164  -4.975  -11.183 1.00 0.00 ? 156 GLU A C    4  
ATOM 11241 O O    . GLU A 1 156 ? -3.191  -5.560  -11.539 1.00 0.00 ? 156 GLU A O    4  
ATOM 11242 C CB   . GLU A 1 156 ? -0.136  -6.303  -10.520 1.00 0.00 ? 156 GLU A CB   4  
ATOM 11243 C CG   . GLU A 1 156 ? 1.319   -6.760  -10.745 1.00 0.00 ? 156 GLU A CG   4  
ATOM 11244 C CD   . GLU A 1 156 ? 1.566   -7.472  -12.083 1.00 0.00 ? 156 GLU A CD   4  
ATOM 11245 O OE1  . GLU A 1 156 ? 0.627   -8.076  -12.648 1.00 0.00 ? 156 GLU A OE1  4  
ATOM 11246 O OE2  . GLU A 1 156 ? 2.713   -7.454  -12.589 1.00 0.00 ? 156 GLU A OE2  4  
ATOM 11247 H H    . GLU A 1 156 ? 0.986   -4.299  -11.684 1.00 0.00 ? 156 GLU A H    4  
ATOM 11248 H HA   . GLU A 1 156 ? -0.966  -6.151  -12.495 1.00 0.00 ? 156 GLU A HA   4  
ATOM 11249 H HB2  . GLU A 1 156 ? -0.158  -5.692  -9.624  1.00 0.00 ? 156 GLU A HB2  4  
ATOM 11250 H HB3  . GLU A 1 156 ? -0.752  -7.176  -10.309 1.00 0.00 ? 156 GLU A HB3  4  
ATOM 11251 H HG2  . GLU A 1 156 ? 1.961   -5.884  -10.714 1.00 0.00 ? 156 GLU A HG2  4  
ATOM 11252 H HG3  . GLU A 1 156 ? 1.600   -7.414  -9.907  1.00 0.00 ? 156 GLU A HG3  4  
ATOM 11253 N N    . ILE A 1 157 ? -2.189  -3.882  -10.410 1.00 0.00 ? 157 ILE A N    4  
ATOM 11254 C CA   . ILE A 1 157 ? -3.429  -3.259  -9.951  1.00 0.00 ? 157 ILE A CA   4  
ATOM 11255 C C    . ILE A 1 157 ? -4.014  -2.379  -11.066 1.00 0.00 ? 157 ILE A C    4  
ATOM 11256 O O    . ILE A 1 157 ? -5.234  -2.352  -11.269 1.00 0.00 ? 157 ILE A O    4  
ATOM 11257 C CB   . ILE A 1 157 ? -3.223  -2.498  -8.613  1.00 0.00 ? 157 ILE A CB   4  
ATOM 11258 C CG1  . ILE A 1 157 ? -2.763  -3.425  -7.468  1.00 0.00 ? 157 ILE A CG1  4  
ATOM 11259 C CG2  . ILE A 1 157 ? -4.503  -1.758  -8.220  1.00 0.00 ? 157 ILE A CG2  4  
ATOM 11260 C CD1  . ILE A 1 157 ? -1.243  -3.433  -7.279  1.00 0.00 ? 157 ILE A CD1  4  
ATOM 11261 H H    . ILE A 1 157 ? -1.302  -3.436  -10.205 1.00 0.00 ? 157 ILE A H    4  
ATOM 11262 H HA   . ILE A 1 157 ? -4.150  -4.052  -9.759  1.00 0.00 ? 157 ILE A HA   4  
ATOM 11263 H HB   . ILE A 1 157 ? -2.480  -1.718  -8.686  1.00 0.00 ? 157 ILE A HB   4  
ATOM 11264 H HG12 . ILE A 1 157 ? -3.183  -3.078  -6.532  1.00 0.00 ? 157 ILE A HG12 4  
ATOM 11265 H HG13 . ILE A 1 157 ? -3.118  -4.441  -7.636  1.00 0.00 ? 157 ILE A HG13 4  
ATOM 11266 H HG21 . ILE A 1 157 ? -4.266  -1.107  -7.384  1.00 0.00 ? 157 ILE A HG21 4  
ATOM 11267 H HG22 . ILE A 1 157 ? -4.851  -1.100  -9.013  1.00 0.00 ? 157 ILE A HG22 4  
ATOM 11268 H HG23 . ILE A 1 157 ? -5.285  -2.467  -7.955  1.00 0.00 ? 157 ILE A HG23 4  
ATOM 11269 H HD11 . ILE A 1 157 ? -0.992  -3.919  -6.338  1.00 0.00 ? 157 ILE A HD11 4  
ATOM 11270 H HD12 . ILE A 1 157 ? -0.777  -3.979  -8.093  1.00 0.00 ? 157 ILE A HD12 4  
ATOM 11271 H HD13 . ILE A 1 157 ? -0.854  -2.414  -7.247  1.00 0.00 ? 157 ILE A HD13 4  
ATOM 11272 N N    . ARG A 1 158 ? -3.185  -1.648  -11.817 1.00 0.00 ? 158 ARG A N    4  
ATOM 11273 C CA   . ARG A 1 158 ? -3.694  -0.764  -12.862 1.00 0.00 ? 158 ARG A CA   4  
ATOM 11274 C C    . ARG A 1 158 ? -4.459  -1.569  -13.913 1.00 0.00 ? 158 ARG A C    4  
ATOM 11275 O O    . ARG A 1 158 ? -5.486  -1.086  -14.394 1.00 0.00 ? 158 ARG A O    4  
ATOM 11276 C CB   . ARG A 1 158 ? -2.556  0.086   -13.452 1.00 0.00 ? 158 ARG A CB   4  
ATOM 11277 C CG   . ARG A 1 158 ? -3.085  1.341   -14.170 1.00 0.00 ? 158 ARG A CG   4  
ATOM 11278 C CD   . ARG A 1 158 ? -2.061  2.487   -14.154 1.00 0.00 ? 158 ARG A CD   4  
ATOM 11279 N NE   . ARG A 1 158 ? -0.881  2.215   -14.994 1.00 0.00 ? 158 ARG A NE   4  
ATOM 11280 C CZ   . ARG A 1 158 ? -0.627  2.712   -16.210 1.00 0.00 ? 158 ARG A CZ   4  
ATOM 11281 N NH1  . ARG A 1 158 ? -1.500  3.502   -16.826 1.00 0.00 ? 158 ARG A NH1  4  
ATOM 11282 N NH2  . ARG A 1 158 ? 0.522   2.416   -16.804 1.00 0.00 ? 158 ARG A NH2  4  
ATOM 11283 H H    . ARG A 1 158 ? -2.183  -1.696  -11.654 1.00 0.00 ? 158 ARG A H    4  
ATOM 11284 H HA   . ARG A 1 158 ? -4.399  -0.093  -12.375 1.00 0.00 ? 158 ARG A HA   4  
ATOM 11285 H HB2  . ARG A 1 158 ? -1.922  0.417   -12.629 1.00 0.00 ? 158 ARG A HB2  4  
ATOM 11286 H HB3  . ARG A 1 158 ? -1.960  -0.513  -14.143 1.00 0.00 ? 158 ARG A HB3  4  
ATOM 11287 H HG2  . ARG A 1 158 ? -3.360  1.093   -15.197 1.00 0.00 ? 158 ARG A HG2  4  
ATOM 11288 H HG3  . ARG A 1 158 ? -3.977  1.704   -13.656 1.00 0.00 ? 158 ARG A HG3  4  
ATOM 11289 H HD2  . ARG A 1 158 ? -2.550  3.402   -14.486 1.00 0.00 ? 158 ARG A HD2  4  
ATOM 11290 H HD3  . ARG A 1 158 ? -1.731  2.660   -13.128 1.00 0.00 ? 158 ARG A HD3  4  
ATOM 11291 H HE   . ARG A 1 158 ? -0.138  1.675   -14.555 1.00 0.00 ? 158 ARG A HE   4  
ATOM 11292 H HH11 . ARG A 1 158 ? -2.449  3.601   -16.460 1.00 0.00 ? 158 ARG A HH11 4  
ATOM 11293 H HH12 . ARG A 1 158 ? -1.304  3.955   -17.718 1.00 0.00 ? 158 ARG A HH12 4  
ATOM 11294 H HH21 . ARG A 1 158 ? 1.083   1.653   -16.430 1.00 0.00 ? 158 ARG A HH21 4  
ATOM 11295 H HH22 . ARG A 1 158 ? 0.678   2.641   -17.781 1.00 0.00 ? 158 ARG A HH22 4  
ATOM 11296 N N    . ASN A 1 159 ? -4.058  -2.818  -14.171 1.00 0.00 ? 159 ASN A N    4  
ATOM 11297 C CA   . ASN A 1 159 ? -4.663  -3.718  -15.148 1.00 0.00 ? 159 ASN A CA   4  
ATOM 11298 C C    . ASN A 1 159 ? -6.009  -4.290  -14.699 1.00 0.00 ? 159 ASN A C    4  
ATOM 11299 O O    . ASN A 1 159 ? -6.495  -5.228  -15.326 1.00 0.00 ? 159 ASN A O    4  
ATOM 11300 C CB   . ASN A 1 159 ? -3.670  -4.851  -15.504 1.00 0.00 ? 159 ASN A CB   4  
ATOM 11301 C CG   . ASN A 1 159 ? -2.679  -4.381  -16.555 1.00 0.00 ? 159 ASN A CG   4  
ATOM 11302 O OD1  . ASN A 1 159 ? -3.072  -3.823  -17.576 1.00 0.00 ? 159 ASN A OD1  4  
ATOM 11303 N ND2  . ASN A 1 159 ? -1.385  -4.560  -16.370 1.00 0.00 ? 159 ASN A ND2  4  
ATOM 11304 H H    . ASN A 1 159 ? -3.227  -3.160  -13.694 1.00 0.00 ? 159 ASN A H    4  
ATOM 11305 H HA   . ASN A 1 159 ? -4.862  -3.140  -16.052 1.00 0.00 ? 159 ASN A HA   4  
ATOM 11306 H HB2  . ASN A 1 159 ? -3.159  -5.201  -14.610 1.00 0.00 ? 159 ASN A HB2  4  
ATOM 11307 H HB3  . ASN A 1 159 ? -4.199  -5.709  -15.916 1.00 0.00 ? 159 ASN A HB3  4  
ATOM 11308 H HD21 . ASN A 1 159 ? -1.059  -5.011  -15.516 1.00 0.00 ? 159 ASN A HD21 4  
ATOM 11309 H HD22 . ASN A 1 159 ? -0.813  -3.776  -16.689 1.00 0.00 ? 159 ASN A HD22 4  
ATOM 11310 N N    . ARG A 1 160 ? -6.607  -3.833  -13.595 1.00 0.00 ? 160 ARG A N    4  
ATOM 11311 C CA   . ARG A 1 160 ? -7.924  -4.326  -13.163 1.00 0.00 ? 160 ARG A CA   4  
ATOM 11312 C C    . ARG A 1 160 ? -9.049  -3.395  -13.613 1.00 0.00 ? 160 ARG A C    4  
ATOM 11313 O O    . ARG A 1 160 ? -10.104 -3.875  -14.022 1.00 0.00 ? 160 ARG A O    4  
ATOM 11314 C CB   . ARG A 1 160 ? -7.924  -4.589  -11.646 1.00 0.00 ? 160 ARG A CB   4  
ATOM 11315 C CG   . ARG A 1 160 ? -6.671  -5.290  -11.090 1.00 0.00 ? 160 ARG A CG   4  
ATOM 11316 C CD   . ARG A 1 160 ? -6.436  -6.751  -11.487 1.00 0.00 ? 160 ARG A CD   4  
ATOM 11317 N NE   . ARG A 1 160 ? -6.531  -7.018  -12.933 1.00 0.00 ? 160 ARG A NE   4  
ATOM 11318 C CZ   . ARG A 1 160 ? -7.132  -8.041  -13.547 1.00 0.00 ? 160 ARG A CZ   4  
ATOM 11319 N NH1  . ARG A 1 160 ? -7.634  -9.062  -12.858 1.00 0.00 ? 160 ARG A NH1  4  
ATOM 11320 N NH2  . ARG A 1 160 ? -7.207  -8.035  -14.874 1.00 0.00 ? 160 ARG A NH2  4  
ATOM 11321 H H    . ARG A 1 160 ? -6.118  -3.161  -13.014 1.00 0.00 ? 160 ARG A H    4  
ATOM 11322 H HA   . ARG A 1 160 ? -8.151  -5.275  -13.654 1.00 0.00 ? 160 ARG A HA   4  
ATOM 11323 H HB2  . ARG A 1 160 ? -8.022  -3.633  -11.128 1.00 0.00 ? 160 ARG A HB2  4  
ATOM 11324 H HB3  . ARG A 1 160 ? -8.789  -5.206  -11.402 1.00 0.00 ? 160 ARG A HB3  4  
ATOM 11325 H HG2  . ARG A 1 160 ? -5.781  -4.737  -11.372 1.00 0.00 ? 160 ARG A HG2  4  
ATOM 11326 H HG3  . ARG A 1 160 ? -6.729  -5.253  -10.001 1.00 0.00 ? 160 ARG A HG3  4  
ATOM 11327 H HD2  . ARG A 1 160 ? -5.411  -6.951  -11.189 1.00 0.00 ? 160 ARG A HD2  4  
ATOM 11328 H HD3  . ARG A 1 160 ? -7.126  -7.385  -10.931 1.00 0.00 ? 160 ARG A HD3  4  
ATOM 11329 H HE   . ARG A 1 160 ? -6.159  -6.294  -13.534 1.00 0.00 ? 160 ARG A HE   4  
ATOM 11330 H HH11 . ARG A 1 160 ? -7.609  -9.058  -11.851 1.00 0.00 ? 160 ARG A HH11 4  
ATOM 11331 H HH12 . ARG A 1 160 ? -8.179  -9.809  -13.291 1.00 0.00 ? 160 ARG A HH12 4  
ATOM 11332 H HH21 . ARG A 1 160 ? -6.953  -7.205  -15.424 1.00 0.00 ? 160 ARG A HH21 4  
ATOM 11333 H HH22 . ARG A 1 160 ? -7.796  -8.701  -15.374 1.00 0.00 ? 160 ARG A HH22 4  
ATOM 11334 N N    . LYS A 1 161 ? -8.797  -2.077  -13.643 1.00 0.00 ? 161 LYS A N    4  
ATOM 11335 C CA   . LYS A 1 161 ? -9.631  -0.991  -14.200 1.00 0.00 ? 161 LYS A CA   4  
ATOM 11336 C C    . LYS A 1 161 ? -10.995 -0.797  -13.523 1.00 0.00 ? 161 LYS A C    4  
ATOM 11337 O O    . LYS A 1 161 ? -11.575 0.287   -13.615 1.00 0.00 ? 161 LYS A O    4  
ATOM 11338 C CB   . LYS A 1 161 ? -9.785  -1.156  -15.723 1.00 0.00 ? 161 LYS A CB   4  
ATOM 11339 C CG   . LYS A 1 161 ? -8.453  -1.228  -16.491 1.00 0.00 ? 161 LYS A CG   4  
ATOM 11340 C CD   . LYS A 1 161 ? -7.722  0.118   -16.557 1.00 0.00 ? 161 LYS A CD   4  
ATOM 11341 C CE   . LYS A 1 161 ? -6.330  -0.011  -17.182 1.00 0.00 ? 161 LYS A CE   4  
ATOM 11342 N NZ   . LYS A 1 161 ? -6.362  -0.243  -18.639 1.00 0.00 ? 161 LYS A NZ   4  
ATOM 11343 H H    . LYS A 1 161 ? -7.884  -1.806  -13.314 1.00 0.00 ? 161 LYS A H    4  
ATOM 11344 H HA   . LYS A 1 161 ? -9.088  -0.061  -14.044 1.00 0.00 ? 161 LYS A HA   4  
ATOM 11345 H HB2  . LYS A 1 161 ? -10.350 -2.066  -15.925 1.00 0.00 ? 161 LYS A HB2  4  
ATOM 11346 H HB3  . LYS A 1 161 ? -10.375 -0.327  -16.113 1.00 0.00 ? 161 LYS A HB3  4  
ATOM 11347 H HG2  . LYS A 1 161 ? -7.799  -1.977  -16.045 1.00 0.00 ? 161 LYS A HG2  4  
ATOM 11348 H HG3  . LYS A 1 161 ? -8.676  -1.538  -17.504 1.00 0.00 ? 161 LYS A HG3  4  
ATOM 11349 H HD2  . LYS A 1 161 ? -8.312  0.841   -17.120 1.00 0.00 ? 161 LYS A HD2  4  
ATOM 11350 H HD3  . LYS A 1 161 ? -7.587  0.505   -15.552 1.00 0.00 ? 161 LYS A HD3  4  
ATOM 11351 H HE2  . LYS A 1 161 ? -5.791  0.917   -16.993 1.00 0.00 ? 161 LYS A HE2  4  
ATOM 11352 H HE3  . LYS A 1 161 ? -5.787  -0.817  -16.691 1.00 0.00 ? 161 LYS A HE3  4  
ATOM 11353 H HZ1  . LYS A 1 161 ? -5.433  -0.205  -19.045 1.00 0.00 ? 161 LYS A HZ1  4  
ATOM 11354 H HZ2  . LYS A 1 161 ? -6.804  -1.119  -18.901 1.00 0.00 ? 161 LYS A HZ2  4  
ATOM 11355 H HZ3  . LYS A 1 161 ? -6.881  0.491   -19.110 1.00 0.00 ? 161 LYS A HZ3  4  
ATOM 11356 N N    . ASP A 1 162 ? -11.487 -1.802  -12.812 1.00 0.00 ? 162 ASP A N    4  
ATOM 11357 C CA   . ASP A 1 162 ? -12.616 -1.824  -11.891 1.00 0.00 ? 162 ASP A CA   4  
ATOM 11358 C C    . ASP A 1 162 ? -12.290 -1.099  -10.581 1.00 0.00 ? 162 ASP A C    4  
ATOM 11359 O O    . ASP A 1 162 ? -13.178 -0.507  -9.960  1.00 0.00 ? 162 ASP A O    4  
ATOM 11360 C CB   . ASP A 1 162 ? -12.976 -3.296  -11.607 1.00 0.00 ? 162 ASP A CB   4  
ATOM 11361 C CG   . ASP A 1 162 ? -11.881 -4.119  -10.906 1.00 0.00 ? 162 ASP A CG   4  
ATOM 11362 O OD1  . ASP A 1 162 ? -10.703 -3.706  -10.931 1.00 0.00 ? 162 ASP A OD1  4  
ATOM 11363 O OD2  . ASP A 1 162 ? -12.203 -5.194  -10.357 1.00 0.00 ? 162 ASP A OD2  4  
ATOM 11364 H H    . ASP A 1 162 ? -10.953 -2.665  -12.790 1.00 0.00 ? 162 ASP A H    4  
ATOM 11365 H HA   . ASP A 1 162 ? -13.468 -1.339  -12.364 1.00 0.00 ? 162 ASP A HA   4  
ATOM 11366 H HB2  . ASP A 1 162 ? -13.874 -3.320  -10.994 1.00 0.00 ? 162 ASP A HB2  4  
ATOM 11367 H HB3  . ASP A 1 162 ? -13.213 -3.777  -12.554 1.00 0.00 ? 162 ASP A HB3  4  
ATOM 11368 N N    . VAL A 1 163 ? -11.021 -1.120  -10.169 1.00 0.00 ? 163 VAL A N    4  
ATOM 11369 C CA   . VAL A 1 163 ? -10.463 -0.338  -9.089  1.00 0.00 ? 163 VAL A CA   4  
ATOM 11370 C C    . VAL A 1 163 ? -10.788 1.137   -9.367  1.00 0.00 ? 163 VAL A C    4  
ATOM 11371 O O    . VAL A 1 163 ? -10.496 1.683   -10.434 1.00 0.00 ? 163 VAL A O    4  
ATOM 11372 C CB   . VAL A 1 163 ? -8.951  -0.639  -8.931  1.00 0.00 ? 163 VAL A CB   4  
ATOM 11373 C CG1  . VAL A 1 163 ? -8.623  -2.085  -8.499  1.00 0.00 ? 163 VAL A CG1  4  
ATOM 11374 C CG2  . VAL A 1 163 ? -8.130  -0.356  -10.188 1.00 0.00 ? 163 VAL A CG2  4  
ATOM 11375 H H    . VAL A 1 163 ? -10.405 -1.781  -10.629 1.00 0.00 ? 163 VAL A H    4  
ATOM 11376 H HA   . VAL A 1 163 ? -10.965 -0.628  -8.167  1.00 0.00 ? 163 VAL A HA   4  
ATOM 11377 H HB   . VAL A 1 163 ? -8.583  0.029   -8.161  1.00 0.00 ? 163 VAL A HB   4  
ATOM 11378 H HG11 . VAL A 1 163 ? -7.582  -2.337  -8.714  1.00 0.00 ? 163 VAL A HG11 4  
ATOM 11379 H HG12 . VAL A 1 163 ? -8.761  -2.191  -7.427  1.00 0.00 ? 163 VAL A HG12 4  
ATOM 11380 H HG13 . VAL A 1 163 ? -9.246  -2.810  -9.024  1.00 0.00 ? 163 VAL A HG13 4  
ATOM 11381 H HG21 . VAL A 1 163 ? -8.324  0.659   -10.515 1.00 0.00 ? 163 VAL A HG21 4  
ATOM 11382 H HG22 . VAL A 1 163 ? -7.072  -0.447  -9.944  1.00 0.00 ? 163 VAL A HG22 4  
ATOM 11383 H HG23 . VAL A 1 163 ? -8.400  -1.056  -10.976 1.00 0.00 ? 163 VAL A HG23 4  
ATOM 11384 N N    . LYS A 1 164 ? -11.423 1.796   -8.402  1.00 0.00 ? 164 LYS A N    4  
ATOM 11385 C CA   . LYS A 1 164 ? -11.550 3.247   -8.431  1.00 0.00 ? 164 LYS A CA   4  
ATOM 11386 C C    . LYS A 1 164 ? -10.148 3.777   -8.216  1.00 0.00 ? 164 LYS A C    4  
ATOM 11387 O O    . LYS A 1 164 ? -9.627  3.565   -7.130  1.00 0.00 ? 164 LYS A O    4  
ATOM 11388 C CB   . LYS A 1 164 ? -12.483 3.749   -7.313  1.00 0.00 ? 164 LYS A CB   4  
ATOM 11389 C CG   . LYS A 1 164 ? -12.552 5.270   -7.183  1.00 0.00 ? 164 LYS A CG   4  
ATOM 11390 C CD   . LYS A 1 164 ? -13.029 6.033   -8.426  1.00 0.00 ? 164 LYS A CD   4  
ATOM 11391 C CE   . LYS A 1 164 ? -14.545 6.257   -8.489  1.00 0.00 ? 164 LYS A CE   4  
ATOM 11392 N NZ   . LYS A 1 164 ? -15.348 5.075   -8.872  1.00 0.00 ? 164 LYS A NZ   4  
ATOM 11393 H H    . LYS A 1 164 ? -11.609 1.285   -7.553  1.00 0.00 ? 164 LYS A H    4  
ATOM 11394 H HA   . LYS A 1 164 ? -11.923 3.549   -9.410  1.00 0.00 ? 164 LYS A HA   4  
ATOM 11395 H HB2  . LYS A 1 164 ? -13.491 3.403   -7.457  1.00 0.00 ? 164 LYS A HB2  4  
ATOM 11396 H HB3  . LYS A 1 164 ? -12.147 3.344   -6.360  1.00 0.00 ? 164 LYS A HB3  4  
ATOM 11397 H HG2  . LYS A 1 164 ? -13.235 5.483   -6.367  1.00 0.00 ? 164 LYS A HG2  4  
ATOM 11398 H HG3  . LYS A 1 164 ? -11.567 5.644   -6.905  1.00 0.00 ? 164 LYS A HG3  4  
ATOM 11399 H HD2  . LYS A 1 164 ? -12.576 7.024   -8.379  1.00 0.00 ? 164 LYS A HD2  4  
ATOM 11400 H HD3  . LYS A 1 164 ? -12.679 5.562   -9.340  1.00 0.00 ? 164 LYS A HD3  4  
ATOM 11401 H HE2  . LYS A 1 164 ? -14.890 6.628   -7.521  1.00 0.00 ? 164 LYS A HE2  4  
ATOM 11402 H HE3  . LYS A 1 164 ? -14.735 7.039   -9.225  1.00 0.00 ? 164 LYS A HE3  4  
ATOM 11403 H HZ1  . LYS A 1 164 ? -15.321 4.324   -8.189  1.00 0.00 ? 164 LYS A HZ1  4  
ATOM 11404 H HZ2  . LYS A 1 164 ? -16.319 5.369   -8.957  1.00 0.00 ? 164 LYS A HZ2  4  
ATOM 11405 H HZ3  . LYS A 1 164 ? -15.084 4.675   -9.767  1.00 0.00 ? 164 LYS A HZ3  4  
ATOM 11406 N N    . VAL A 1 165 ? -9.504  4.411   -9.187  1.00 0.00 ? 165 VAL A N    4  
ATOM 11407 C CA   . VAL A 1 165 ? -8.255  5.090   -8.992  1.00 0.00 ? 165 VAL A CA   4  
ATOM 11408 C C    . VAL A 1 165 ? -8.587  6.566   -8.805  1.00 0.00 ? 165 VAL A C    4  
ATOM 11409 O O    . VAL A 1 165 ? -8.826  7.296   -9.770  1.00 0.00 ? 165 VAL A O    4  
ATOM 11410 C CB   . VAL A 1 165 ? -7.306  4.757   -10.145 1.00 0.00 ? 165 VAL A CB   4  
ATOM 11411 C CG1  . VAL A 1 165 ? -6.687  3.371   -9.914  1.00 0.00 ? 165 VAL A CG1  4  
ATOM 11412 C CG2  . VAL A 1 165 ? -7.873  4.804   -11.567 1.00 0.00 ? 165 VAL A CG2  4  
ATOM 11413 H H    . VAL A 1 165 ? -9.843  4.566   -10.120 1.00 0.00 ? 165 VAL A H    4  
ATOM 11414 H HA   . VAL A 1 165 ? -7.779  4.741   -8.077  1.00 0.00 ? 165 VAL A HA   4  
ATOM 11415 H HB   . VAL A 1 165 ? -6.544  5.503   -10.102 1.00 0.00 ? 165 VAL A HB   4  
ATOM 11416 H HG11 . VAL A 1 165 ? -6.147  3.362   -8.968  1.00 0.00 ? 165 VAL A HG11 4  
ATOM 11417 H HG12 . VAL A 1 165 ? -7.472  2.617   -9.878  1.00 0.00 ? 165 VAL A HG12 4  
ATOM 11418 H HG13 . VAL A 1 165 ? -5.992  3.129   -10.719 1.00 0.00 ? 165 VAL A HG13 4  
ATOM 11419 H HG21 . VAL A 1 165 ? -8.229  5.808   -11.788 1.00 0.00 ? 165 VAL A HG21 4  
ATOM 11420 H HG22 . VAL A 1 165 ? -7.068  4.588   -12.271 1.00 0.00 ? 165 VAL A HG22 4  
ATOM 11421 H HG23 . VAL A 1 165 ? -8.681  4.081   -11.678 1.00 0.00 ? 165 VAL A HG23 4  
ATOM 11422 N N    . PHE A 1 166 ? -8.680  6.983   -7.544  1.00 0.00 ? 166 PHE A N    4  
ATOM 11423 C CA   . PHE A 1 166 ? -8.891  8.364   -7.160  1.00 0.00 ? 166 PHE A CA   4  
ATOM 11424 C C    . PHE A 1 166 ? -7.627  9.163   -7.484  1.00 0.00 ? 166 PHE A C    4  
ATOM 11425 O O    . PHE A 1 166 ? -6.655  9.121   -6.728  1.00 0.00 ? 166 PHE A O    4  
ATOM 11426 C CB   . PHE A 1 166 ? -9.259  8.460   -5.675  1.00 0.00 ? 166 PHE A CB   4  
ATOM 11427 C CG   . PHE A 1 166 ? -10.713 8.137   -5.371  1.00 0.00 ? 166 PHE A CG   4  
ATOM 11428 C CD1  . PHE A 1 166 ? -11.743 8.829   -6.040  1.00 0.00 ? 166 PHE A CD1  4  
ATOM 11429 C CD2  . PHE A 1 166 ? -11.052 7.167   -4.409  1.00 0.00 ? 166 PHE A CD2  4  
ATOM 11430 C CE1  . PHE A 1 166 ? -13.089 8.522   -5.786  1.00 0.00 ? 166 PHE A CE1  4  
ATOM 11431 C CE2  . PHE A 1 166 ? -12.396 6.830   -4.203  1.00 0.00 ? 166 PHE A CE2  4  
ATOM 11432 C CZ   . PHE A 1 166 ? -13.418 7.528   -4.859  1.00 0.00 ? 166 PHE A CZ   4  
ATOM 11433 H H    . PHE A 1 166 ? -8.506  6.312   -6.800  1.00 0.00 ? 166 PHE A H    4  
ATOM 11434 H HA   . PHE A 1 166 ? -9.728  8.741   -7.739  1.00 0.00 ? 166 PHE A HA   4  
ATOM 11435 H HB2  . PHE A 1 166 ? -8.607  7.801   -5.103  1.00 0.00 ? 166 PHE A HB2  4  
ATOM 11436 H HB3  . PHE A 1 166 ? -9.064  9.480   -5.351  1.00 0.00 ? 166 PHE A HB3  4  
ATOM 11437 H HD1  . PHE A 1 166 ? -11.512 9.632   -6.722  1.00 0.00 ? 166 PHE A HD1  4  
ATOM 11438 H HD2  . PHE A 1 166 ? -10.312 6.684   -3.786  1.00 0.00 ? 166 PHE A HD2  4  
ATOM 11439 H HE1  . PHE A 1 166 ? -13.885 9.054   -6.281  1.00 0.00 ? 166 PHE A HE1  4  
ATOM 11440 H HE2  . PHE A 1 166 ? -12.643 6.017   -3.546  1.00 0.00 ? 166 PHE A HE2  4  
ATOM 11441 H HZ   . PHE A 1 166 ? -14.452 7.292   -4.664  1.00 0.00 ? 166 PHE A HZ   4  
ATOM 11442 N N    . ASN A 1 167 ? -7.606  9.861   -8.622  1.00 0.00 ? 167 ASN A N    4  
ATOM 11443 C CA   . ASN A 1 167 ? -6.540  10.799  -8.969  1.00 0.00 ? 167 ASN A CA   4  
ATOM 11444 C C    . ASN A 1 167 ? -6.623  11.991  -8.020  1.00 0.00 ? 167 ASN A C    4  
ATOM 11445 O O    . ASN A 1 167 ? -7.454  12.874  -8.214  1.00 0.00 ? 167 ASN A O    4  
ATOM 11446 C CB   . ASN A 1 167 ? -6.632  11.231  -10.437 1.00 0.00 ? 167 ASN A CB   4  
ATOM 11447 C CG   . ASN A 1 167 ? -5.283  11.731  -10.932 1.00 0.00 ? 167 ASN A CG   4  
ATOM 11448 O OD1  . ASN A 1 167 ? -4.700  11.156  -11.850 1.00 0.00 ? 167 ASN A OD1  4  
ATOM 11449 N ND2  . ASN A 1 167 ? -4.698  12.750  -10.333 1.00 0.00 ? 167 ASN A ND2  4  
ATOM 11450 H H    . ASN A 1 167 ? -8.432  9.826   -9.204  1.00 0.00 ? 167 ASN A H    4  
ATOM 11451 H HA   . ASN A 1 167 ? -5.565  10.328  -8.849  1.00 0.00 ? 167 ASN A HA   4  
ATOM 11452 H HB2  . ASN A 1 167 ? -6.920  10.372  -11.042 1.00 0.00 ? 167 ASN A HB2  4  
ATOM 11453 H HB3  . ASN A 1 167 ? -7.385  12.010  -10.568 1.00 0.00 ? 167 ASN A HB3  4  
ATOM 11454 H HD21 . ASN A 1 167 ? -5.123  13.289  -9.580  1.00 0.00 ? 167 ASN A HD21 4  
ATOM 11455 H HD22 . ASN A 1 167 ? -3.795  13.025  -10.665 1.00 0.00 ? 167 ASN A HD22 4  
ATOM 11456 N N    . VAL A 1 168 ? -5.788  12.014  -6.985  1.00 0.00 ? 168 VAL A N    4  
ATOM 11457 C CA   . VAL A 1 168 ? -5.675  13.129  -6.054  1.00 0.00 ? 168 VAL A CA   4  
ATOM 11458 C C    . VAL A 1 168 ? -5.192  14.375  -6.814  1.00 0.00 ? 168 VAL A C    4  
ATOM 11459 O O    . VAL A 1 168 ? -4.626  14.268  -7.907  1.00 0.00 ? 168 VAL A O    4  
ATOM 11460 C CB   . VAL A 1 168 ? -4.742  12.693  -4.894  1.00 0.00 ? 168 VAL A CB   4  
ATOM 11461 C CG1  . VAL A 1 168 ? -3.300  13.169  -5.075  1.00 0.00 ? 168 VAL A CG1  4  
ATOM 11462 C CG2  . VAL A 1 168 ? -5.146  13.210  -3.513  1.00 0.00 ? 168 VAL A CG2  4  
ATOM 11463 H H    . VAL A 1 168 ? -5.159  11.229  -6.851  1.00 0.00 ? 168 VAL A H    4  
ATOM 11464 H HA   . VAL A 1 168 ? -6.671  13.330  -5.666  1.00 0.00 ? 168 VAL A HA   4  
ATOM 11465 H HB   . VAL A 1 168 ? -4.742  11.604  -4.829  1.00 0.00 ? 168 VAL A HB   4  
ATOM 11466 H HG11 . VAL A 1 168 ? -2.932  12.844  -6.046  1.00 0.00 ? 168 VAL A HG11 4  
ATOM 11467 H HG12 . VAL A 1 168 ? -3.257  14.267  -4.979  1.00 0.00 ? 168 VAL A HG12 4  
ATOM 11468 H HG13 . VAL A 1 168 ? -2.698  12.715  -4.294  1.00 0.00 ? 168 VAL A HG13 4  
ATOM 11469 H HG21 . VAL A 1 168 ? -5.013  14.286  -3.488  1.00 0.00 ? 168 VAL A HG21 4  
ATOM 11470 H HG22 . VAL A 1 168 ? -6.175  12.952  -3.282  1.00 0.00 ? 168 VAL A HG22 4  
ATOM 11471 H HG23 . VAL A 1 168 ? -4.503  12.748  -2.757  1.00 0.00 ? 168 VAL A HG23 4  
ATOM 11472 N N    . THR A 1 169 ? -5.307  15.547  -6.196  1.00 0.00 ? 169 THR A N    4  
ATOM 11473 C CA   . THR A 1 169 ? -4.676  16.771  -6.664  1.00 0.00 ? 169 THR A CA   4  
ATOM 11474 C C    . THR A 1 169 ? -4.125  17.510  -5.464  1.00 0.00 ? 169 THR A C    4  
ATOM 11475 O O    . THR A 1 169 ? -4.604  17.402  -4.337  1.00 0.00 ? 169 THR A O    4  
ATOM 11476 C CB   . THR A 1 169 ? -5.689  17.621  -7.454  1.00 0.00 ? 169 THR A CB   4  
ATOM 11477 O OG1  . THR A 1 169 ? -6.645  18.097  -6.544  1.00 0.00 ? 169 THR A OG1  4  
ATOM 11478 C CG2  . THR A 1 169 ? -6.387  16.879  -8.594  1.00 0.00 ? 169 THR A CG2  4  
ATOM 11479 H H    . THR A 1 169 ? -5.799  15.631  -5.318  1.00 0.00 ? 169 THR A H    4  
ATOM 11480 H HA   . THR A 1 169 ? -3.806  16.601  -7.297  1.00 0.00 ? 169 THR A HA   4  
ATOM 11481 H HB   . THR A 1 169 ? -5.170  18.481  -7.877  1.00 0.00 ? 169 THR A HB   4  
ATOM 11482 H HG1  . THR A 1 169 ? -7.522  18.138  -6.974  1.00 0.00 ? 169 THR A HG1  4  
ATOM 11483 H HG21 . THR A 1 169 ? -6.958  17.577  -9.205  1.00 0.00 ? 169 THR A HG21 4  
ATOM 11484 H HG22 . THR A 1 169 ? -5.652  16.386  -9.223  1.00 0.00 ? 169 THR A HG22 4  
ATOM 11485 H HG23 . THR A 1 169 ? -7.062  16.122  -8.206  1.00 0.00 ? 169 THR A HG23 4  
ATOM 11486 N N    . LYS A 1 170 ? -3.135  18.341  -5.751  1.00 0.00 ? 170 LYS A N    4  
ATOM 11487 C CA   . LYS A 1 170 ? -2.749  19.498  -4.950  1.00 0.00 ? 170 LYS A CA   4  
ATOM 11488 C C    . LYS A 1 170 ? -3.947  20.292  -4.440  1.00 0.00 ? 170 LYS A C    4  
ATOM 11489 O O    . LYS A 1 170 ? -3.847  20.854  -3.353  1.00 0.00 ? 170 LYS A O    4  
ATOM 11490 C CB   . LYS A 1 170 ? -1.882  20.426  -5.815  1.00 0.00 ? 170 LYS A CB   4  
ATOM 11491 C CG   . LYS A 1 170 ? -0.487  19.837  -6.047  1.00 0.00 ? 170 LYS A CG   4  
ATOM 11492 C CD   . LYS A 1 170 ? 0.397   20.051  -4.794  1.00 0.00 ? 170 LYS A CD   4  
ATOM 11493 C CE   . LYS A 1 170 ? 1.893   19.920  -5.110  1.00 0.00 ? 170 LYS A CE   4  
ATOM 11494 N NZ   . LYS A 1 170 ? 2.755   20.558  -4.095  1.00 0.00 ? 170 LYS A NZ   4  
ATOM 11495 H H    . LYS A 1 170 ? -2.726  18.188  -6.661  1.00 0.00 ? 170 LYS A H    4  
ATOM 11496 H HA   . LYS A 1 170 ? -2.188  19.171  -4.077  1.00 0.00 ? 170 LYS A HA   4  
ATOM 11497 H HB2  . LYS A 1 170 ? -2.371  20.577  -6.781  1.00 0.00 ? 170 LYS A HB2  4  
ATOM 11498 H HB3  . LYS A 1 170 ? -1.794  21.407  -5.338  1.00 0.00 ? 170 LYS A HB3  4  
ATOM 11499 H HG2  . LYS A 1 170 ? -0.605  18.774  -6.314  1.00 0.00 ? 170 LYS A HG2  4  
ATOM 11500 H HG3  . LYS A 1 170 ? -0.035  20.366  -6.889  1.00 0.00 ? 170 LYS A HG3  4  
ATOM 11501 H HD2  . LYS A 1 170 ? 0.222   21.057  -4.406  1.00 0.00 ? 170 LYS A HD2  4  
ATOM 11502 H HD3  . LYS A 1 170 ? 0.126   19.334  -4.017  1.00 0.00 ? 170 LYS A HD3  4  
ATOM 11503 H HE2  . LYS A 1 170 ? 2.153   18.866  -5.170  1.00 0.00 ? 170 LYS A HE2  4  
ATOM 11504 H HE3  . LYS A 1 170 ? 2.106   20.374  -6.080  1.00 0.00 ? 170 LYS A HE3  4  
ATOM 11505 H HZ1  . LYS A 1 170 ? 2.910   21.532  -4.325  1.00 0.00 ? 170 LYS A HZ1  4  
ATOM 11506 H HZ2  . LYS A 1 170 ? 2.358   20.496  -3.159  1.00 0.00 ? 170 LYS A HZ2  4  
ATOM 11507 H HZ3  . LYS A 1 170 ? 3.660   20.088  -4.083  1.00 0.00 ? 170 LYS A HZ3  4  
ATOM 11508 N N    . GLU A 1 171 ? -5.047  20.330  -5.187  1.00 0.00 ? 171 GLU A N    4  
ATOM 11509 C CA   . GLU A 1 171 ? -6.171  21.190  -4.841  1.00 0.00 ? 171 GLU A CA   4  
ATOM 11510 C C    . GLU A 1 171 ? -7.010  20.530  -3.751  1.00 0.00 ? 171 GLU A C    4  
ATOM 11511 O O    . GLU A 1 171 ? -7.232  21.124  -2.698  1.00 0.00 ? 171 GLU A O    4  
ATOM 11512 C CB   . GLU A 1 171 ? -7.043  21.488  -6.068  1.00 0.00 ? 171 GLU A CB   4  
ATOM 11513 C CG   . GLU A 1 171 ? -6.271  22.174  -7.203  1.00 0.00 ? 171 GLU A CG   4  
ATOM 11514 C CD   . GLU A 1 171 ? -7.134  22.450  -8.436  1.00 0.00 ? 171 GLU A CD   4  
ATOM 11515 O OE1  . GLU A 1 171 ? -8.358  22.182  -8.413  1.00 0.00 ? 171 GLU A OE1  4  
ATOM 11516 O OE2  . GLU A 1 171 ? -6.565  22.893  -9.454  1.00 0.00 ? 171 GLU A OE2  4  
ATOM 11517 H H    . GLU A 1 171 ? -5.127  19.719  -5.995  1.00 0.00 ? 171 GLU A H    4  
ATOM 11518 H HA   . GLU A 1 171 ? -5.791  22.144  -4.463  1.00 0.00 ? 171 GLU A HA   4  
ATOM 11519 H HB2  . GLU A 1 171 ? -7.474  20.564  -6.446  1.00 0.00 ? 171 GLU A HB2  4  
ATOM 11520 H HB3  . GLU A 1 171 ? -7.861  22.139  -5.758  1.00 0.00 ? 171 GLU A HB3  4  
ATOM 11521 H HG2  . GLU A 1 171 ? -5.863  23.116  -6.838  1.00 0.00 ? 171 GLU A HG2  4  
ATOM 11522 H HG3  . GLU A 1 171 ? -5.441  21.537  -7.514  1.00 0.00 ? 171 GLU A HG3  4  
ATOM 11523 N N    . ASN A 1 172 ? -7.489  19.304  -3.976  1.00 0.00 ? 172 ASN A N    4  
ATOM 11524 C CA   . ASN A 1 172 ? -8.606  18.717  -3.237  1.00 0.00 ? 172 ASN A CA   4  
ATOM 11525 C C    . ASN A 1 172 ? -8.158  17.443  -2.524  1.00 0.00 ? 172 ASN A C    4  
ATOM 11526 O O    . ASN A 1 172 ? -8.992  16.675  -2.047  1.00 0.00 ? 172 ASN A O    4  
ATOM 11527 C CB   . ASN A 1 172 ? -9.857  18.566  -4.130  1.00 0.00 ? 172 ASN A CB   4  
ATOM 11528 C CG   . ASN A 1 172 ? -9.610  17.783  -5.417  1.00 0.00 ? 172 ASN A CG   4  
ATOM 11529 O OD1  . ASN A 1 172 ? -9.307  18.369  -6.455  1.00 0.00 ? 172 ASN A OD1  4  
ATOM 11530 N ND2  . ASN A 1 172 ? -9.682  16.467  -5.379  1.00 0.00 ? 172 ASN A ND2  4  
ATOM 11531 H H    . ASN A 1 172 ? -7.144  18.762  -4.765  1.00 0.00 ? 172 ASN A H    4  
ATOM 11532 H HA   . ASN A 1 172