data_2I65
# 
_entry.id   2I65 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2I65         
RCSB  RCSB039185   
WWPDB D_1000039185 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2I66 'Structural Basis for the Mechanistic Understanding Human CD38 Controlled Multiple Catalysis' unspecified 
PDB 2I67 'Structural Basis for the Mechanistic Understanding Human CD38 Controlled Multiple Catalysis' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2I65 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, Q.'         1 
'Kriksunov, I.A.' 2 
'Graeff, R.'      3 
'Munshi, C.'      4 
'Lee, H.C.'       5 
'Hao, Q.'         6 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the mechanistic understanding of human CD38-controlled multiple catalysis.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                32861 
_citation.page_last                 32869 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16951430 
_citation.pdbx_database_id_DOI      10.1074/jbc.M606365200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, Q.'         1 
primary 'Kriksunov, I.A.' 2 
primary 'Graeff, R.'      3 
primary 'Munshi, C.'      4 
primary 'Lee, H.C.'       5 
primary 'Hao, Q.'         6 
# 
_cell.entry_id           2I65 
_cell.length_a           41.451 
_cell.length_b           50.715 
_cell.length_c           65.200 
_cell.angle_alpha        108.76 
_cell.angle_beta         92.01 
_cell.angle_gamma        96.38 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2I65 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADP-ribosyl cyclase 1'           30379.408 2   3.2.2.5 'Q49T, N100D, N164D, N209D, N219D,E226Q' ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425   2   ?       ?                                        ? ? 
3 water       nat water                             18.015    215 ?       ?                                        ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Cyclic ADP-ribose hydrolase 1, cADPr hydrolase 1, Lymphocyte differentiation antigen CD38, T10, Acute lymphoblastic leukemia cells antigen CD38
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KREAEARWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVP
CNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAE
AACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNI
YRPDKFLQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KREAEARWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVP
CNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAE
AACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNI
YRPDKFLQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   ARG n 
1 3   GLU n 
1 4   ALA n 
1 5   GLU n 
1 6   ALA n 
1 7   ARG n 
1 8   TRP n 
1 9   ARG n 
1 10  GLN n 
1 11  THR n 
1 12  TRP n 
1 13  SER n 
1 14  GLY n 
1 15  PRO n 
1 16  GLY n 
1 17  THR n 
1 18  THR n 
1 19  LYS n 
1 20  ARG n 
1 21  PHE n 
1 22  PRO n 
1 23  GLU n 
1 24  THR n 
1 25  VAL n 
1 26  LEU n 
1 27  ALA n 
1 28  ARG n 
1 29  CYS n 
1 30  VAL n 
1 31  LYS n 
1 32  TYR n 
1 33  THR n 
1 34  GLU n 
1 35  ILE n 
1 36  HIS n 
1 37  PRO n 
1 38  GLU n 
1 39  MET n 
1 40  ARG n 
1 41  HIS n 
1 42  VAL n 
1 43  ASP n 
1 44  CYS n 
1 45  GLN n 
1 46  SER n 
1 47  VAL n 
1 48  TRP n 
1 49  ASP n 
1 50  ALA n 
1 51  PHE n 
1 52  LYS n 
1 53  GLY n 
1 54  ALA n 
1 55  PHE n 
1 56  ILE n 
1 57  SER n 
1 58  LYS n 
1 59  HIS n 
1 60  PRO n 
1 61  CYS n 
1 62  ASP n 
1 63  ILE n 
1 64  THR n 
1 65  GLU n 
1 66  GLU n 
1 67  ASP n 
1 68  TYR n 
1 69  GLN n 
1 70  PRO n 
1 71  LEU n 
1 72  MET n 
1 73  LYS n 
1 74  LEU n 
1 75  GLY n 
1 76  THR n 
1 77  GLN n 
1 78  THR n 
1 79  VAL n 
1 80  PRO n 
1 81  CYS n 
1 82  ASN n 
1 83  LYS n 
1 84  ILE n 
1 85  LEU n 
1 86  LEU n 
1 87  TRP n 
1 88  SER n 
1 89  ARG n 
1 90  ILE n 
1 91  LYS n 
1 92  ASP n 
1 93  LEU n 
1 94  ALA n 
1 95  HIS n 
1 96  GLN n 
1 97  PHE n 
1 98  THR n 
1 99  GLN n 
1 100 VAL n 
1 101 GLN n 
1 102 ARG n 
1 103 ASP n 
1 104 MET n 
1 105 PHE n 
1 106 THR n 
1 107 LEU n 
1 108 GLU n 
1 109 ASP n 
1 110 THR n 
1 111 LEU n 
1 112 LEU n 
1 113 GLY n 
1 114 TYR n 
1 115 LEU n 
1 116 ALA n 
1 117 ASP n 
1 118 ASP n 
1 119 LEU n 
1 120 THR n 
1 121 TRP n 
1 122 CYS n 
1 123 GLY n 
1 124 GLU n 
1 125 PHE n 
1 126 ASP n 
1 127 THR n 
1 128 SER n 
1 129 LYS n 
1 130 ILE n 
1 131 ASN n 
1 132 TYR n 
1 133 GLN n 
1 134 SER n 
1 135 CYS n 
1 136 PRO n 
1 137 ASP n 
1 138 TRP n 
1 139 ARG n 
1 140 LYS n 
1 141 ASP n 
1 142 CYS n 
1 143 SER n 
1 144 ASN n 
1 145 ASN n 
1 146 PRO n 
1 147 VAL n 
1 148 SER n 
1 149 VAL n 
1 150 PHE n 
1 151 TRP n 
1 152 LYS n 
1 153 THR n 
1 154 VAL n 
1 155 SER n 
1 156 ARG n 
1 157 ARG n 
1 158 PHE n 
1 159 ALA n 
1 160 GLU n 
1 161 ALA n 
1 162 ALA n 
1 163 CYS n 
1 164 ASP n 
1 165 VAL n 
1 166 VAL n 
1 167 HIS n 
1 168 VAL n 
1 169 MET n 
1 170 LEU n 
1 171 ASP n 
1 172 GLY n 
1 173 SER n 
1 174 ARG n 
1 175 SER n 
1 176 LYS n 
1 177 ILE n 
1 178 PHE n 
1 179 ASP n 
1 180 LYS n 
1 181 ASP n 
1 182 SER n 
1 183 THR n 
1 184 PHE n 
1 185 GLY n 
1 186 SER n 
1 187 VAL n 
1 188 GLN n 
1 189 VAL n 
1 190 HIS n 
1 191 ASN n 
1 192 LEU n 
1 193 GLN n 
1 194 PRO n 
1 195 GLU n 
1 196 LYS n 
1 197 VAL n 
1 198 GLN n 
1 199 THR n 
1 200 LEU n 
1 201 GLU n 
1 202 ALA n 
1 203 TRP n 
1 204 VAL n 
1 205 ILE n 
1 206 HIS n 
1 207 GLY n 
1 208 GLY n 
1 209 ARG n 
1 210 GLU n 
1 211 ASP n 
1 212 SER n 
1 213 ARG n 
1 214 ASP n 
1 215 LEU n 
1 216 CYS n 
1 217 GLN n 
1 218 ASP n 
1 219 PRO n 
1 220 THR n 
1 221 ILE n 
1 222 LYS n 
1 223 GLU n 
1 224 LEU n 
1 225 GLU n 
1 226 SER n 
1 227 ILE n 
1 228 ILE n 
1 229 SER n 
1 230 LYS n 
1 231 ARG n 
1 232 ASN n 
1 233 ILE n 
1 234 GLN n 
1 235 PHE n 
1 236 SER n 
1 237 CYS n 
1 238 LYS n 
1 239 ASN n 
1 240 ILE n 
1 241 TYR n 
1 242 ARG n 
1 243 PRO n 
1 244 ASP n 
1 245 LYS n 
1 246 PHE n 
1 247 LEU n 
1 248 GLN n 
1 249 CYS n 
1 250 VAL n 
1 251 LYS n 
1 252 ASN n 
1 253 PRO n 
1 254 GLU n 
1 255 ASP n 
1 256 SER n 
1 257 SER n 
1 258 CYS n 
1 259 THR n 
1 260 SER n 
1 261 GLU n 
1 262 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CD38 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     Pichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               X-33 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPICZaA 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD38_HUMAN 
_struct_ref.pdbx_db_accession          P28907 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
;
_struct_ref.pdbx_align_begin           45 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2I65 A 7 ? 262 ? P28907 45 ? 300 ? 45 300 
2 1 2I65 B 7 ? 262 ? P28907 45 ? 300 ? 45 300 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2I65 LYS A 1   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 39  1  
1 2I65 ARG A 2   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 40  2  
1 2I65 GLU A 3   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 41  3  
1 2I65 ALA A 4   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 42  4  
1 2I65 GLU A 5   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 43  5  
1 2I65 ALA A 6   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 44  6  
1 2I65 THR A 11  ? UNP P28907 GLN 49  ENGINEERED         49  7  
1 2I65 ASP A 62  ? UNP P28907 ASN 100 ENGINEERED         100 8  
1 2I65 ASP A 126 ? UNP P28907 ASN 164 ENGINEERED         164 9  
1 2I65 ASP A 171 ? UNP P28907 ASN 209 ENGINEERED         209 10 
1 2I65 ASP A 181 ? UNP P28907 ASN 219 ENGINEERED         219 11 
1 2I65 GLN A 188 ? UNP P28907 GLU 226 ENGINEERED         226 12 
2 2I65 LYS B 1   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 39  13 
2 2I65 ARG B 2   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 40  14 
2 2I65 GLU B 3   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 41  15 
2 2I65 ALA B 4   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 42  16 
2 2I65 GLU B 5   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 43  17 
2 2I65 ALA B 6   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 44  18 
2 2I65 THR B 11  ? UNP P28907 GLN 49  ENGINEERED         49  19 
2 2I65 ASP B 62  ? UNP P28907 ASN 100 ENGINEERED         100 20 
2 2I65 ASP B 126 ? UNP P28907 ASN 164 ENGINEERED         164 21 
2 2I65 ASP B 171 ? UNP P28907 ASN 209 ENGINEERED         209 22 
2 2I65 ASP B 181 ? UNP P28907 ASN 219 ENGINEERED         219 23 
2 2I65 GLN B 188 ? UNP P28907 GLU 226 ENGINEERED         226 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2I65 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   41.87 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '100 mM MES, 10% PEG 4000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2006-02-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.976 
# 
_reflns.entry_id                     2I65 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            1.90 
_reflns.d_resolution_low             30.0 
_reflns.number_all                   39386 
_reflns.number_obs                   37732 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   83.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2I65 
_refine.ls_number_reflns_obs                     35626 
_refine.ls_number_reflns_all                     35626 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.19599 
_refine.ls_R_factor_all                          0.199 
_refine.ls_R_factor_R_work                       0.19427 
_refine.ls_R_factor_R_free                       0.22866 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1872 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.948 
_refine.correlation_coeff_Fo_to_Fc_free          0.926 
_refine.B_iso_mean                               32.138 
_refine.aniso_B[1][1]                            -1.54 
_refine.aniso_B[2][2]                            1.25 
_refine.aniso_B[3][3]                            1.28 
_refine.aniso_B[1][2]                            0.85 
_refine.aniso_B[1][3]                            0.92 
_refine.aniso_B[2][3]                            1.13 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1YH3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.185 
_refine.pdbx_overall_ESU_R_Free                  0.155 
_refine.overall_SU_ML                            0.117 
_refine.overall_SU_B                             7.923 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4064 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         88 
_refine_hist.number_atoms_solvent             215 
_refine_hist.number_atoms_total               4367 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.009  ? ? ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.246  ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.064  ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.753 ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   14.912 ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   16.161 ? ? ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.085  ? ? ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.212  ? ? ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.311  ? ? ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.158  ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.192  ? ? ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.148  ? ? ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.737  ? ? ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.214  ? ? ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.772  ? ? ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.886  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             2122 
_refine_ls_shell.R_factor_R_work                  0.244 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.277 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             119 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2I65 
_struct.title                     'Structural Basis for the Mechanistic Understanding Human CD38 Controlled Multiple Catalysis' 
_struct.pdbx_descriptor           'ADP-ribosyl cyclase 1 (E.C.3.2.2.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2I65 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'the catalytic pocket, reaction product, reaction intermediate, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'There are two biological units in the crystallographic asymmetric unit' ? 
2 ?                                                                        ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 20  ? HIS A 36  ? ARG A 58  HIS A 74  1 ? 17 
HELX_P HELX_P2  2  PRO A 37  ? ARG A 40  ? PRO A 75  ARG A 78  5 ? 4  
HELX_P HELX_P3  3  ASP A 43  ? ALA A 54  ? ASP A 81  ALA A 92  1 ? 12 
HELX_P HELX_P4  4  THR A 64  ? ASP A 67  ? THR A 102 ASP A 105 5 ? 4  
HELX_P HELX_P5  5  TYR A 68  ? GLY A 75  ? TYR A 106 GLY A 113 1 ? 8  
HELX_P HELX_P6  6  ILE A 90  ? GLN A 101 ? ILE A 128 GLN A 139 1 ? 12 
HELX_P HELX_P7  7  THR A 106 ? ASP A 109 ? THR A 144 ASP A 147 5 ? 4  
HELX_P HELX_P8  8  THR A 110 ? ASP A 117 ? THR A 148 ASP A 155 1 ? 8  
HELX_P HELX_P9  9  ASN A 145 ? ALA A 162 ? ASN A 183 ALA A 200 1 ? 18 
HELX_P HELX_P10 10 SER A 182 ? VAL A 187 ? SER A 220 VAL A 225 1 ? 6  
HELX_P HELX_P11 11 ASP A 214 ? GLN A 217 ? ASP A 252 GLN A 255 5 ? 4  
HELX_P HELX_P12 12 ASP A 218 ? ARG A 231 ? ASP A 256 ARG A 269 1 ? 14 
HELX_P HELX_P13 13 ARG A 242 ? ASN A 252 ? ARG A 280 ASN A 290 1 ? 11 
HELX_P HELX_P14 14 ARG B 20  ? HIS B 36  ? ARG B 58  HIS B 74  1 ? 17 
HELX_P HELX_P15 15 PRO B 37  ? ARG B 40  ? PRO B 75  ARG B 78  5 ? 4  
HELX_P HELX_P16 16 ASP B 43  ? ILE B 56  ? ASP B 81  ILE B 94  1 ? 14 
HELX_P HELX_P17 17 THR B 64  ? ASP B 67  ? THR B 102 ASP B 105 5 ? 4  
HELX_P HELX_P18 18 TYR B 68  ? GLY B 75  ? TYR B 106 GLY B 113 1 ? 8  
HELX_P HELX_P19 19 PRO B 80  ? LYS B 83  ? PRO B 118 LYS B 121 5 ? 4  
HELX_P HELX_P20 20 ILE B 90  ? GLN B 101 ? ILE B 128 GLN B 139 1 ? 12 
HELX_P HELX_P21 21 THR B 106 ? ASP B 109 ? THR B 144 ASP B 147 5 ? 4  
HELX_P HELX_P22 22 THR B 110 ? ASP B 117 ? THR B 148 ASP B 155 1 ? 8  
HELX_P HELX_P23 23 ASN B 145 ? ALA B 162 ? ASN B 183 ALA B 200 1 ? 18 
HELX_P HELX_P24 24 SER B 182 ? VAL B 187 ? SER B 220 VAL B 225 1 ? 6  
HELX_P HELX_P25 25 GLN B 188 ? LEU B 192 ? GLN B 226 LEU B 230 5 ? 5  
HELX_P HELX_P26 26 ASP B 214 ? GLN B 217 ? ASP B 252 GLN B 255 5 ? 4  
HELX_P HELX_P27 27 ASP B 218 ? ARG B 231 ? ASP B 256 ARG B 269 1 ? 14 
HELX_P HELX_P28 28 ARG B 242 ? ASN B 252 ? ARG B 280 ASN B 290 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 29  SG ? ? ? 1_555 A CYS 44  SG ? ? A CYS 67  A CYS 82  1_555 ? ? ? ? ? ? ? 2.062 ? 
disulf2  disulf ? ? A CYS 61  SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 99  A CYS 180 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3  disulf ? ? A CYS 81  SG ? ? ? 1_555 A CYS 163 SG ? ? A CYS 119 A CYS 201 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf4  disulf ? ? A CYS 122 SG ? ? ? 1_555 A CYS 135 SG ? ? A CYS 160 A CYS 173 1_555 ? ? ? ? ? ? ? 2.062 ? 
disulf5  disulf ? ? A CYS 216 SG ? ? ? 1_555 A CYS 237 SG ? ? A CYS 254 A CYS 275 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf6  disulf ? ? A CYS 249 SG ? ? ? 1_555 A CYS 258 SG ? ? A CYS 287 A CYS 296 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf7  disulf ? ? B CYS 29  SG ? ? ? 1_555 B CYS 44  SG ? ? B CYS 67  B CYS 82  1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf8  disulf ? ? B CYS 61  SG ? ? ? 1_555 B CYS 142 SG ? ? B CYS 99  B CYS 180 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf9  disulf ? ? B CYS 81  SG ? ? ? 1_555 B CYS 163 SG ? ? B CYS 119 B CYS 201 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf10 disulf ? ? B CYS 122 SG ? ? ? 1_555 B CYS 135 SG ? ? B CYS 160 B CYS 173 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf11 disulf ? ? B CYS 216 SG ? ? ? 1_555 B CYS 237 SG ? ? B CYS 254 B CYS 275 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf12 disulf ? ? B CYS 249 SG ? ? ? 1_555 B CYS 258 SG ? ? B CYS 287 B CYS 296 1_555 ? ? ? ? ? ? ? 2.187 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 2 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 14  ? PRO A 15  ? GLY A 52  PRO A 53  
A 2 SER A 134 ? CYS A 135 ? SER A 172 CYS A 173 
B 1 LEU A 85  ? SER A 88  ? LEU A 123 SER A 126 
B 2 ASP A 164 ? ASP A 171 ? ASP A 202 ASP A 209 
B 3 VAL A 197 ? ILE A 205 ? VAL A 235 ILE A 243 
B 4 GLN A 234 ? ILE A 240 ? GLN A 272 ILE A 278 
C 1 GLY B 14  ? PRO B 15  ? GLY B 52  PRO B 53  
C 2 SER B 134 ? CYS B 135 ? SER B 172 CYS B 173 
D 1 LEU B 85  ? SER B 88  ? LEU B 123 SER B 126 
D 2 ASP B 164 ? ASP B 171 ? ASP B 202 ASP B 209 
D 3 VAL B 197 ? ILE B 205 ? VAL B 235 ILE B 243 
D 4 GLN B 234 ? ILE B 240 ? GLN B 272 ILE B 278 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 14  ? N GLY A 52  O CYS A 135 ? O CYS A 173 
B 1 2 N LEU A 86  ? N LEU A 124 O HIS A 167 ? O HIS A 205 
B 2 3 N LEU A 170 ? N LEU A 208 O ILE A 205 ? O ILE A 243 
B 3 4 N VAL A 204 ? N VAL A 242 O LYS A 238 ? O LYS A 276 
C 1 2 N GLY B 14  ? N GLY B 52  O CYS B 135 ? O CYS B 173 
D 1 2 N LEU B 86  ? N LEU B 124 O HIS B 167 ? O HIS B 205 
D 2 3 N VAL B 168 ? N VAL B 206 O TRP B 203 ? O TRP B 241 
D 3 4 N ALA B 202 ? N ALA B 240 O LYS B 238 ? O LYS B 276 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE NAD A 301' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE NAD B 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 LEU A 86  ? LEU A 124 . ? 1_555 ? 
2  AC1 19 TRP A 87  ? TRP A 125 . ? 1_555 ? 
3  AC1 19 SER A 88  ? SER A 126 . ? 1_555 ? 
4  AC1 19 ARG A 89  ? ARG A 127 . ? 1_555 ? 
5  AC1 19 LEU A 107 ? LEU A 145 . ? 1_555 ? 
6  AC1 19 GLU A 108 ? GLU A 146 . ? 1_555 ? 
7  AC1 19 ASP A 117 ? ASP A 155 . ? 1_555 ? 
8  AC1 19 TRP A 138 ? TRP A 176 . ? 1_555 ? 
9  AC1 19 SER A 148 ? SER A 186 . ? 1_555 ? 
10 AC1 19 TRP A 151 ? TRP A 189 . ? 1_555 ? 
11 AC1 19 SER A 155 ? SER A 193 . ? 1_555 ? 
12 AC1 19 SER A 182 ? SER A 220 . ? 1_555 ? 
13 AC1 19 THR A 183 ? THR A 221 . ? 1_555 ? 
14 AC1 19 PHE A 184 ? PHE A 222 . ? 1_555 ? 
15 AC1 19 GLN A 188 ? GLN A 226 . ? 1_555 ? 
16 AC1 19 HOH E .   ? HOH A 303 . ? 1_555 ? 
17 AC1 19 HOH E .   ? HOH A 338 . ? 1_555 ? 
18 AC1 19 HOH E .   ? HOH A 346 . ? 1_555 ? 
19 AC1 19 HOH E .   ? HOH A 350 . ? 1_555 ? 
20 AC2 17 LEU B 86  ? LEU B 124 . ? 1_555 ? 
21 AC2 17 TRP B 87  ? TRP B 125 . ? 1_555 ? 
22 AC2 17 SER B 88  ? SER B 126 . ? 1_555 ? 
23 AC2 17 ARG B 89  ? ARG B 127 . ? 1_555 ? 
24 AC2 17 LYS B 91  ? LYS B 129 . ? 1_555 ? 
25 AC2 17 LEU B 107 ? LEU B 145 . ? 1_555 ? 
26 AC2 17 GLU B 108 ? GLU B 146 . ? 1_555 ? 
27 AC2 17 ASP B 117 ? ASP B 155 . ? 1_555 ? 
28 AC2 17 TRP B 151 ? TRP B 189 . ? 1_555 ? 
29 AC2 17 SER B 155 ? SER B 193 . ? 1_555 ? 
30 AC2 17 SER B 182 ? SER B 220 . ? 1_555 ? 
31 AC2 17 THR B 183 ? THR B 221 . ? 1_555 ? 
32 AC2 17 PHE B 184 ? PHE B 222 . ? 1_555 ? 
33 AC2 17 GLN B 188 ? GLN B 226 . ? 1_555 ? 
34 AC2 17 HOH F .   ? HOH B 309 . ? 1_555 ? 
35 AC2 17 HOH F .   ? HOH B 310 . ? 1_555 ? 
36 AC2 17 HOH F .   ? HOH B 357 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2I65 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2I65 
_atom_sites.fract_transf_matrix[1][1]   0.024125 
_atom_sites.fract_transf_matrix[1][2]   0.002696 
_atom_sites.fract_transf_matrix[1][3]   0.001830 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019841 
_atom_sites.fract_transf_matrix[2][3]   0.006882 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016244 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 10  ? 21.683  -16.312 10.427  1.00 42.15 ? 48  GLN A N   1 
ATOM   2    C CA  . GLN A 1 10  ? 20.966  -15.252 9.646   1.00 42.23 ? 48  GLN A CA  1 
ATOM   3    C C   . GLN A 1 10  ? 21.789  -14.865 8.418   1.00 40.60 ? 48  GLN A C   1 
ATOM   4    O O   . GLN A 1 10  ? 22.936  -14.444 8.545   1.00 40.69 ? 48  GLN A O   1 
ATOM   5    C CB  . GLN A 1 10  ? 20.751  -13.988 10.508  1.00 42.64 ? 48  GLN A CB  1 
ATOM   6    C CG  . GLN A 1 10  ? 20.156  -14.225 11.914  1.00 44.63 ? 48  GLN A CG  1 
ATOM   7    C CD  . GLN A 1 10  ? 20.638  -13.204 12.957  1.00 44.49 ? 48  GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 10  ? 21.844  -12.979 13.119  1.00 47.56 ? 48  GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 10  ? 19.693  -12.601 13.680  1.00 47.24 ? 48  GLN A NE2 1 
ATOM   10   N N   . THR A 1 11  ? 21.217  -15.029 7.233   1.00 38.78 ? 49  THR A N   1 
ATOM   11   C CA  . THR A 1 11  ? 21.790  -14.417 6.044   1.00 37.08 ? 49  THR A CA  1 
ATOM   12   C C   . THR A 1 11  ? 21.425  -12.938 6.091   1.00 35.55 ? 49  THR A C   1 
ATOM   13   O O   . THR A 1 11  ? 22.284  -12.070 5.959   1.00 35.41 ? 49  THR A O   1 
ATOM   14   C CB  . THR A 1 11  ? 21.225  -15.042 4.748   1.00 37.22 ? 49  THR A CB  1 
ATOM   15   O OG1 . THR A 1 11  ? 21.535  -16.439 4.719   1.00 38.32 ? 49  THR A OG1 1 
ATOM   16   C CG2 . THR A 1 11  ? 21.822  -14.373 3.520   1.00 37.26 ? 49  THR A CG2 1 
ATOM   17   N N   . TRP A 1 12  ? 20.141  -12.675 6.314   1.00 33.48 ? 50  TRP A N   1 
ATOM   18   C CA  . TRP A 1 12  ? 19.594  -11.332 6.252   1.00 31.92 ? 50  TRP A CA  1 
ATOM   19   C C   . TRP A 1 12  ? 19.190  -10.845 7.632   1.00 32.04 ? 50  TRP A C   1 
ATOM   20   O O   . TRP A 1 12  ? 19.060  -11.640 8.563   1.00 31.61 ? 50  TRP A O   1 
ATOM   21   C CB  . TRP A 1 12  ? 18.382  -11.311 5.324   1.00 30.59 ? 50  TRP A CB  1 
ATOM   22   C CG  . TRP A 1 12  ? 18.641  -11.933 3.976   1.00 29.29 ? 50  TRP A CG  1 
ATOM   23   C CD1 . TRP A 1 12  ? 18.060  -13.066 3.463   1.00 28.10 ? 50  TRP A CD1 1 
ATOM   24   C CD2 . TRP A 1 12  ? 19.562  -11.469 2.978   1.00 28.42 ? 50  TRP A CD2 1 
ATOM   25   N NE1 . TRP A 1 12  ? 18.552  -13.323 2.201   1.00 27.08 ? 50  TRP A NE1 1 
ATOM   26   C CE2 . TRP A 1 12  ? 19.479  -12.362 1.882   1.00 28.02 ? 50  TRP A CE2 1 
ATOM   27   C CE3 . TRP A 1 12  ? 20.444  -10.378 2.899   1.00 29.32 ? 50  TRP A CE3 1 
ATOM   28   C CZ2 . TRP A 1 12  ? 20.250  -12.202 0.728   1.00 28.47 ? 50  TRP A CZ2 1 
ATOM   29   C CZ3 . TRP A 1 12  ? 21.209  -10.223 1.747   1.00 28.55 ? 50  TRP A CZ3 1 
ATOM   30   C CH2 . TRP A 1 12  ? 21.106  -11.132 0.680   1.00 28.13 ? 50  TRP A CH2 1 
ATOM   31   N N   . SER A 1 13  ? 18.969  -9.537  7.737   1.00 32.48 ? 51  SER A N   1 
ATOM   32   C CA  . SER A 1 13  ? 18.656  -8.864  9.001   1.00 33.18 ? 51  SER A CA  1 
ATOM   33   C C   . SER A 1 13  ? 17.171  -8.832  9.337   1.00 32.61 ? 51  SER A C   1 
ATOM   34   O O   . SER A 1 13  ? 16.804  -8.695  10.510  1.00 33.07 ? 51  SER A O   1 
ATOM   35   C CB  . SER A 1 13  ? 19.184  -7.429  8.965   1.00 33.21 ? 51  SER A CB  1 
ATOM   36   O OG  . SER A 1 13  ? 20.594  -7.434  8.983   1.00 36.30 ? 51  SER A OG  1 
ATOM   37   N N   . GLY A 1 14  ? 16.327  -8.966  8.315   1.00 31.88 ? 52  GLY A N   1 
ATOM   38   C CA  . GLY A 1 14  ? 14.885  -8.806  8.460   1.00 31.10 ? 52  GLY A CA  1 
ATOM   39   C C   . GLY A 1 14  ? 14.166  -10.100 8.794   1.00 30.59 ? 52  GLY A C   1 
ATOM   40   O O   . GLY A 1 14  ? 14.744  -11.192 8.690   1.00 30.84 ? 52  GLY A O   1 
ATOM   41   N N   . PRO A 1 15  ? 12.890  -9.998  9.200   1.00 30.08 ? 53  PRO A N   1 
ATOM   42   C CA  . PRO A 1 15  ? 12.189  -11.229 9.545   1.00 29.67 ? 53  PRO A CA  1 
ATOM   43   C C   . PRO A 1 15  ? 12.119  -12.160 8.344   1.00 28.82 ? 53  PRO A C   1 
ATOM   44   O O   . PRO A 1 15  ? 12.152  -11.703 7.200   1.00 28.97 ? 53  PRO A O   1 
ATOM   45   C CB  . PRO A 1 15  ? 10.795  -10.748 9.949   1.00 29.75 ? 53  PRO A CB  1 
ATOM   46   C CG  . PRO A 1 15  ? 10.670  -9.368  9.397   1.00 30.73 ? 53  PRO A CG  1 
ATOM   47   C CD  . PRO A 1 15  ? 12.043  -8.804  9.362   1.00 30.22 ? 53  PRO A CD  1 
ATOM   48   N N   . GLY A 1 16  ? 12.065  -13.455 8.610   1.00 28.19 ? 54  GLY A N   1 
ATOM   49   C CA  . GLY A 1 16  ? 11.927  -14.454 7.565   1.00 27.84 ? 54  GLY A CA  1 
ATOM   50   C C   . GLY A 1 16  ? 10.522  -14.401 7.020   1.00 27.59 ? 54  GLY A C   1 
ATOM   51   O O   . GLY A 1 16  ? 9.719   -13.564 7.448   1.00 27.20 ? 54  GLY A O   1 
ATOM   52   N N   . THR A 1 17  ? 10.229  -15.282 6.071   1.00 27.02 ? 55  THR A N   1 
ATOM   53   C CA  . THR A 1 17  ? 8.887   -15.369 5.508   1.00 26.89 ? 55  THR A CA  1 
ATOM   54   C C   . THR A 1 17  ? 7.919   -15.736 6.629   1.00 27.26 ? 55  THR A C   1 
ATOM   55   O O   . THR A 1 17  ? 8.213   -16.618 7.433   1.00 27.25 ? 55  THR A O   1 
ATOM   56   C CB  . THR A 1 17  ? 8.827   -16.408 4.366   1.00 26.56 ? 55  THR A CB  1 
ATOM   57   O OG1 . THR A 1 17  ? 9.768   -16.043 3.350   1.00 26.15 ? 55  THR A OG1 1 
ATOM   58   C CG2 . THR A 1 17  ? 7.441   -16.479 3.735   1.00 26.75 ? 55  THR A CG2 1 
ATOM   59   N N   . THR A 1 18  ? 6.786   -15.039 6.683   1.00 27.17 ? 56  THR A N   1 
ATOM   60   C CA  . THR A 1 18  ? 5.743   -15.286 7.667   1.00 27.14 ? 56  THR A CA  1 
ATOM   61   C C   . THR A 1 18  ? 5.394   -16.762 7.698   1.00 27.52 ? 56  THR A C   1 
ATOM   62   O O   . THR A 1 18  ? 5.247   -17.385 6.643   1.00 27.40 ? 56  THR A O   1 
ATOM   63   C CB  . THR A 1 18  ? 4.481   -14.472 7.326   1.00 27.11 ? 56  THR A CB  1 
ATOM   64   O OG1 . THR A 1 18  ? 4.861   -13.104 7.160   1.00 25.57 ? 56  THR A OG1 1 
ATOM   65   C CG2 . THR A 1 18  ? 3.456   -14.574 8.447   1.00 27.43 ? 56  THR A CG2 1 
ATOM   66   N N   . LYS A 1 19  ? 5.265   -17.332 8.898   1.00 27.31 ? 57  LYS A N   1 
ATOM   67   C CA  . LYS A 1 19  ? 4.877   -18.733 8.999   1.00 27.75 ? 57  LYS A CA  1 
ATOM   68   C C   . LYS A 1 19  ? 3.571   -18.981 8.245   1.00 27.36 ? 57  LYS A C   1 
ATOM   69   O O   . LYS A 1 19  ? 2.684   -18.118 8.210   1.00 26.50 ? 57  LYS A O   1 
ATOM   70   C CB  . LYS A 1 19  ? 4.776   -19.204 10.460  1.00 28.26 ? 57  LYS A CB  1 
ATOM   71   C CG  . LYS A 1 19  ? 3.686   -18.536 11.309  1.00 28.79 ? 57  LYS A CG  1 
ATOM   72   C CD  . LYS A 1 19  ? 3.585   -19.231 12.673  1.00 28.77 ? 57  LYS A CD  1 
ATOM   73   C CE  . LYS A 1 19  ? 2.483   -18.625 13.533  1.00 30.52 ? 57  LYS A CE  1 
ATOM   74   N NZ  . LYS A 1 19  ? 2.499   -19.253 14.897  1.00 31.95 ? 57  LYS A NZ  1 
ATOM   75   N N   . ARG A 1 20  ? 3.482   -20.147 7.617   1.00 27.11 ? 58  ARG A N   1 
ATOM   76   C CA  . ARG A 1 20  ? 2.328   -20.524 6.803   1.00 27.93 ? 58  ARG A CA  1 
ATOM   77   C C   . ARG A 1 20  ? 2.014   -19.557 5.661   1.00 27.63 ? 58  ARG A C   1 
ATOM   78   O O   . ARG A 1 20  ? 0.860   -19.436 5.244   1.00 27.35 ? 58  ARG A O   1 
ATOM   79   C CB  . ARG A 1 20  ? 1.084   -20.723 7.677   1.00 27.71 ? 58  ARG A CB  1 
ATOM   80   C CG  . ARG A 1 20  ? 1.175   -21.876 8.624   1.00 30.60 ? 58  ARG A CG  1 
ATOM   81   C CD  . ARG A 1 20  ? -0.062  -21.941 9.518   1.00 35.97 ? 58  ARG A CD  1 
ATOM   82   N NE  . ARG A 1 20  ? 0.123   -22.857 10.642  1.00 40.64 ? 58  ARG A NE  1 
ATOM   83   C CZ  . ARG A 1 20  ? 0.866   -22.594 11.719  1.00 43.33 ? 58  ARG A CZ  1 
ATOM   84   N NH1 . ARG A 1 20  ? 1.511   -21.435 11.828  1.00 44.90 ? 58  ARG A NH1 1 
ATOM   85   N NH2 . ARG A 1 20  ? 0.973   -23.492 12.688  1.00 42.98 ? 58  ARG A NH2 1 
ATOM   86   N N   . PHE A 1 21  ? 3.040   -18.894 5.140   1.00 27.80 ? 59  PHE A N   1 
ATOM   87   C CA  . PHE A 1 21  ? 2.857   -17.903 4.080   1.00 27.29 ? 59  PHE A CA  1 
ATOM   88   C C   . PHE A 1 21  ? 2.006   -18.416 2.921   1.00 27.73 ? 59  PHE A C   1 
ATOM   89   O O   . PHE A 1 21  ? 1.036   -17.755 2.557   1.00 27.96 ? 59  PHE A O   1 
ATOM   90   C CB  . PHE A 1 21  ? 4.208   -17.352 3.582   1.00 26.98 ? 59  PHE A CB  1 
ATOM   91   C CG  . PHE A 1 21  ? 4.082   -16.337 2.478   1.00 25.25 ? 59  PHE A CG  1 
ATOM   92   C CD1 . PHE A 1 21  ? 3.585   -15.060 2.738   1.00 22.81 ? 59  PHE A CD1 1 
ATOM   93   C CD2 . PHE A 1 21  ? 4.469   -16.660 1.172   1.00 24.33 ? 59  PHE A CD2 1 
ATOM   94   C CE1 . PHE A 1 21  ? 3.462   -14.108 1.715   1.00 24.03 ? 59  PHE A CE1 1 
ATOM   95   C CE2 . PHE A 1 21  ? 4.367   -15.714 0.145   1.00 23.68 ? 59  PHE A CE2 1 
ATOM   96   C CZ  . PHE A 1 21  ? 3.852   -14.432 0.414   1.00 23.84 ? 59  PHE A CZ  1 
ATOM   97   N N   . PRO A 1 22  ? 2.349   -19.589 2.343   1.00 28.06 ? 60  PRO A N   1 
ATOM   98   C CA  . PRO A 1 22  ? 1.569   -20.118 1.210   1.00 28.07 ? 60  PRO A CA  1 
ATOM   99   C C   . PRO A 1 22  ? 0.092   -20.340 1.523   1.00 28.72 ? 60  PRO A C   1 
ATOM   100  O O   . PRO A 1 22  ? -0.779  -19.907 0.764   1.00 28.46 ? 60  PRO A O   1 
ATOM   101  C CB  . PRO A 1 22  ? 2.251   -21.455 0.922   1.00 28.34 ? 60  PRO A CB  1 
ATOM   102  C CG  . PRO A 1 22  ? 3.637   -21.276 1.421   1.00 27.92 ? 60  PRO A CG  1 
ATOM   103  C CD  . PRO A 1 22  ? 3.479   -20.483 2.664   1.00 27.79 ? 60  PRO A CD  1 
ATOM   104  N N   . GLU A 1 23  ? -0.178  -21.032 2.625   1.00 28.87 ? 61  GLU A N   1 
ATOM   105  C CA  . GLU A 1 23  ? -1.541  -21.306 3.058   1.00 29.05 ? 61  GLU A CA  1 
ATOM   106  C C   . GLU A 1 23  ? -2.280  -19.991 3.254   1.00 28.71 ? 61  GLU A C   1 
ATOM   107  O O   . GLU A 1 23  ? -3.444  -19.852 2.851   1.00 28.12 ? 61  GLU A O   1 
ATOM   108  C CB  . GLU A 1 23  ? -1.517  -22.100 4.362   1.00 29.32 ? 61  GLU A CB  1 
ATOM   109  C CG  . GLU A 1 23  ? -0.882  -23.482 4.237   1.00 31.64 ? 61  GLU A CG  1 
ATOM   110  C CD  . GLU A 1 23  ? 0.559   -23.580 4.756   1.00 33.65 ? 61  GLU A CD  1 
ATOM   111  O OE1 . GLU A 1 23  ? 1.464   -22.835 4.289   1.00 32.17 ? 61  GLU A OE1 1 
ATOM   112  O OE2 . GLU A 1 23  ? 0.784   -24.452 5.622   1.00 34.52 ? 61  GLU A OE2 1 
ATOM   113  N N   . THR A 1 24  ? -1.586  -19.027 3.858   1.00 28.23 ? 62  THR A N   1 
ATOM   114  C CA  . THR A 1 24  ? -2.159  -17.723 4.169   1.00 28.35 ? 62  THR A CA  1 
ATOM   115  C C   . THR A 1 24  ? -2.545  -16.958 2.915   1.00 28.25 ? 62  THR A C   1 
ATOM   116  O O   . THR A 1 24  ? -3.665  -16.460 2.817   1.00 28.23 ? 62  THR A O   1 
ATOM   117  C CB  . THR A 1 24  ? -1.219  -16.877 5.040   1.00 28.45 ? 62  THR A CB  1 
ATOM   118  O OG1 . THR A 1 24  ? -1.058  -17.521 6.309   1.00 29.38 ? 62  THR A OG1 1 
ATOM   119  C CG2 . THR A 1 24  ? -1.790  -15.478 5.270   1.00 28.95 ? 62  THR A CG2 1 
ATOM   120  N N   . VAL A 1 25  ? -1.640  -16.862 1.952   1.00 27.85 ? 63  VAL A N   1 
ATOM   121  C CA  . VAL A 1 25  ? -1.975  -16.143 0.721   1.00 27.83 ? 63  VAL A CA  1 
ATOM   122  C C   . VAL A 1 25  ? -3.171  -16.817 0.040   1.00 27.98 ? 63  VAL A C   1 
ATOM   123  O O   . VAL A 1 25  ? -4.103  -16.152 -0.424  1.00 27.29 ? 63  VAL A O   1 
ATOM   124  C CB  . VAL A 1 25  ? -0.794  -16.098 -0.258  1.00 27.90 ? 63  VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 25  ? -1.264  -15.579 -1.618  1.00 27.11 ? 63  VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 25  ? 0.325   -15.219 0.294   1.00 27.32 ? 63  VAL A CG2 1 
ATOM   127  N N   . LEU A 1 26  ? -3.126  -18.144 -0.006  1.00 28.16 ? 64  LEU A N   1 
ATOM   128  C CA  . LEU A 1 26  ? -4.155  -18.934 -0.656  1.00 28.74 ? 64  LEU A CA  1 
ATOM   129  C C   . LEU A 1 26  ? -5.504  -18.723 0.026   1.00 28.52 ? 64  LEU A C   1 
ATOM   130  O O   . LEU A 1 26  ? -6.507  -18.452 -0.635  1.00 28.87 ? 64  LEU A O   1 
ATOM   131  C CB  . LEU A 1 26  ? -3.748  -20.409 -0.622  1.00 28.70 ? 64  LEU A CB  1 
ATOM   132  C CG  . LEU A 1 26  ? -4.089  -21.297 -1.814  1.00 29.67 ? 64  LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 26  ? -3.335  -20.848 -3.029  1.00 28.29 ? 64  LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 26  ? -3.734  -22.767 -1.482  1.00 29.86 ? 64  LEU A CD2 1 
ATOM   135  N N   . ALA A 1 27  ? -5.518  -18.828 1.351   1.00 28.53 ? 65  ALA A N   1 
ATOM   136  C CA  . ALA A 1 27  ? -6.736  -18.655 2.134   1.00 28.59 ? 65  ALA A CA  1 
ATOM   137  C C   . ALA A 1 27  ? -7.262  -17.223 2.046   1.00 28.70 ? 65  ALA A C   1 
ATOM   138  O O   . ALA A 1 27  ? -8.476  -17.010 2.032   1.00 28.23 ? 65  ALA A O   1 
ATOM   139  C CB  . ALA A 1 27  ? -6.500  -19.050 3.584   1.00 28.95 ? 65  ALA A CB  1 
ATOM   140  N N   . ARG A 1 28  ? -6.351  -16.251 1.995   1.00 27.64 ? 66  ARG A N   1 
ATOM   141  C CA  . ARG A 1 28  ? -6.738  -14.844 1.825   1.00 28.08 ? 66  ARG A CA  1 
ATOM   142  C C   . ARG A 1 28  ? -7.346  -14.618 0.460   1.00 28.24 ? 66  ARG A C   1 
ATOM   143  O O   . ARG A 1 28  ? -8.343  -13.900 0.327   1.00 28.53 ? 66  ARG A O   1 
ATOM   144  C CB  . ARG A 1 28  ? -5.545  -13.913 2.007   1.00 26.93 ? 66  ARG A CB  1 
ATOM   145  C CG  . ARG A 1 28  ? -5.202  -13.708 3.448   1.00 27.88 ? 66  ARG A CG  1 
ATOM   146  C CD  . ARG A 1 28  ? -4.082  -12.732 3.577   1.00 27.90 ? 66  ARG A CD  1 
ATOM   147  N NE  . ARG A 1 28  ? -3.740  -12.482 4.967   1.00 29.32 ? 66  ARG A NE  1 
ATOM   148  C CZ  . ARG A 1 28  ? -2.854  -11.570 5.349   1.00 30.01 ? 66  ARG A CZ  1 
ATOM   149  N NH1 . ARG A 1 28  ? -2.240  -10.831 4.433   1.00 28.62 ? 66  ARG A NH1 1 
ATOM   150  N NH2 . ARG A 1 28  ? -2.575  -11.405 6.639   1.00 27.95 ? 66  ARG A NH2 1 
ATOM   151  N N   . CYS A 1 29  ? -6.753  -15.250 -0.548  1.00 28.55 ? 67  CYS A N   1 
ATOM   152  C CA  . CYS A 1 29  ? -7.265  -15.164 -1.899  1.00 28.68 ? 67  CYS A CA  1 
ATOM   153  C C   . CYS A 1 29  ? -8.669  -15.747 -1.965  1.00 28.63 ? 67  CYS A C   1 
ATOM   154  O O   . CYS A 1 29  ? -9.593  -15.106 -2.480  1.00 28.53 ? 67  CYS A O   1 
ATOM   155  C CB  . CYS A 1 29  ? -6.331  -15.882 -2.869  1.00 28.76 ? 67  CYS A CB  1 
ATOM   156  S SG  . CYS A 1 29  ? -6.814  -15.716 -4.595  1.00 30.75 ? 67  CYS A SG  1 
ATOM   157  N N   . VAL A 1 30  ? -8.826  -16.960 -1.437  1.00 28.15 ? 68  VAL A N   1 
ATOM   158  C CA  . VAL A 1 30  ? -10.133 -17.608 -1.392  1.00 28.13 ? 68  VAL A CA  1 
ATOM   159  C C   . VAL A 1 30  ? -11.161 -16.718 -0.686  1.00 28.61 ? 68  VAL A C   1 
ATOM   160  O O   . VAL A 1 30  ? -12.244 -16.473 -1.227  1.00 28.59 ? 68  VAL A O   1 
ATOM   161  C CB  . VAL A 1 30  ? -10.058 -19.015 -0.746  1.00 27.93 ? 68  VAL A CB  1 
ATOM   162  C CG1 . VAL A 1 30  ? -11.455 -19.583 -0.519  1.00 26.96 ? 68  VAL A CG1 1 
ATOM   163  C CG2 . VAL A 1 30  ? -9.251  -19.943 -1.629  1.00 27.67 ? 68  VAL A CG2 1 
ATOM   164  N N   . LYS A 1 31  ? -10.820 -16.222 0.502   1.00 28.93 ? 69  LYS A N   1 
ATOM   165  C CA  . LYS A 1 31  ? -11.717 -15.344 1.242   1.00 29.78 ? 69  LYS A CA  1 
ATOM   166  C C   . LYS A 1 31  ? -12.079 -14.107 0.420   1.00 29.57 ? 69  LYS A C   1 
ATOM   167  O O   . LYS A 1 31  ? -13.254 -13.774 0.280   1.00 29.82 ? 69  LYS A O   1 
ATOM   168  C CB  . LYS A 1 31  ? -11.098 -14.915 2.568   1.00 30.47 ? 69  LYS A CB  1 
ATOM   169  C CG  . LYS A 1 31  ? -12.009 -14.011 3.404   1.00 33.69 ? 69  LYS A CG  1 
ATOM   170  C CD  . LYS A 1 31  ? -11.481 -13.837 4.828   1.00 38.48 ? 69  LYS A CD  1 
ATOM   171  C CE  . LYS A 1 31  ? -11.581 -15.151 5.620   1.00 40.88 ? 69  LYS A CE  1 
ATOM   172  N NZ  . LYS A 1 31  ? -10.540 -15.257 6.683   1.00 43.34 ? 69  LYS A NZ  1 
ATOM   173  N N   . TYR A 1 32  ? -11.067 -13.443 -0.126  1.00 29.14 ? 70  TYR A N   1 
ATOM   174  C CA  . TYR A 1 32  ? -11.276 -12.227 -0.903  1.00 29.12 ? 70  TYR A CA  1 
ATOM   175  C C   . TYR A 1 32  ? -12.193 -12.476 -2.099  1.00 29.27 ? 70  TYR A C   1 
ATOM   176  O O   . TYR A 1 32  ? -13.141 -11.717 -2.330  1.00 29.21 ? 70  TYR A O   1 
ATOM   177  C CB  . TYR A 1 32  ? -9.943  -11.634 -1.374  1.00 28.75 ? 70  TYR A CB  1 
ATOM   178  C CG  . TYR A 1 32  ? -10.098 -10.234 -1.911  1.00 28.12 ? 70  TYR A CG  1 
ATOM   179  C CD1 . TYR A 1 32  ? -9.904  -9.120  -1.083  1.00 27.65 ? 70  TYR A CD1 1 
ATOM   180  C CD2 . TYR A 1 32  ? -10.479 -10.021 -3.237  1.00 27.96 ? 70  TYR A CD2 1 
ATOM   181  C CE1 . TYR A 1 32  ? -10.077 -7.824  -1.582  1.00 27.83 ? 70  TYR A CE1 1 
ATOM   182  C CE2 . TYR A 1 32  ? -10.660 -8.749  -3.737  1.00 26.43 ? 70  TYR A CE2 1 
ATOM   183  C CZ  . TYR A 1 32  ? -10.455 -7.655  -2.908  1.00 27.32 ? 70  TYR A CZ  1 
ATOM   184  O OH  . TYR A 1 32  ? -10.637 -6.394  -3.418  1.00 26.81 ? 70  TYR A OH  1 
ATOM   185  N N   . THR A 1 33  ? -11.913 -13.535 -2.856  1.00 29.12 ? 71  THR A N   1 
ATOM   186  C CA  . THR A 1 33  ? -12.657 -13.795 -4.080  1.00 29.89 ? 71  THR A CA  1 
ATOM   187  C C   . THR A 1 33  ? -14.071 -14.301 -3.793  1.00 29.94 ? 71  THR A C   1 
ATOM   188  O O   . THR A 1 33  ? -14.932 -14.230 -4.657  1.00 29.81 ? 71  THR A O   1 
ATOM   189  C CB  . THR A 1 33  ? -11.925 -14.754 -5.009  1.00 30.18 ? 71  THR A CB  1 
ATOM   190  O OG1 . THR A 1 33  ? -11.713 -15.999 -4.334  1.00 30.75 ? 71  THR A OG1 1 
ATOM   191  C CG2 . THR A 1 33  ? -10.578 -14.171 -5.426  1.00 30.07 ? 71  THR A CG2 1 
ATOM   192  N N   . GLU A 1 34  ? -14.300 -14.814 -2.583  1.00 30.43 ? 72  GLU A N   1 
ATOM   193  C CA  . GLU A 1 34  ? -15.655 -15.194 -2.143  1.00 31.17 ? 72  GLU A CA  1 
ATOM   194  C C   . GLU A 1 34  ? -16.474 -13.954 -1.781  1.00 30.81 ? 72  GLU A C   1 
ATOM   195  O O   . GLU A 1 34  ? -17.678 -13.915 -2.023  1.00 30.81 ? 72  GLU A O   1 
ATOM   196  C CB  . GLU A 1 34  ? -15.610 -16.138 -0.937  1.00 30.88 ? 72  GLU A CB  1 
ATOM   197  C CG  . GLU A 1 34  ? -15.210 -17.567 -1.259  1.00 31.98 ? 72  GLU A CG  1 
ATOM   198  C CD  . GLU A 1 34  ? -15.004 -18.435 -0.018  1.00 33.27 ? 72  GLU A CD  1 
ATOM   199  O OE1 . GLU A 1 34  ? -14.894 -17.889 1.104   1.00 36.49 ? 72  GLU A OE1 1 
ATOM   200  O OE2 . GLU A 1 34  ? -14.930 -19.672 -0.168  1.00 34.62 ? 72  GLU A OE2 1 
ATOM   201  N N   . ILE A 1 35  ? -15.813 -12.955 -1.194  1.00 30.74 ? 73  ILE A N   1 
ATOM   202  C CA  . ILE A 1 35  ? -16.471 -11.750 -0.690  1.00 31.22 ? 73  ILE A CA  1 
ATOM   203  C C   . ILE A 1 35  ? -16.704 -10.736 -1.814  1.00 31.79 ? 73  ILE A C   1 
ATOM   204  O O   . ILE A 1 35  ? -17.778 -10.122 -1.904  1.00 31.78 ? 73  ILE A O   1 
ATOM   205  C CB  . ILE A 1 35  ? -15.639 -11.079 0.461   1.00 31.46 ? 73  ILE A CB  1 
ATOM   206  C CG1 . ILE A 1 35  ? -15.408 -12.037 1.645   1.00 31.76 ? 73  ILE A CG1 1 
ATOM   207  C CG2 . ILE A 1 35  ? -16.238 -9.732  0.914   1.00 31.31 ? 73  ILE A CG2 1 
ATOM   208  C CD1 . ILE A 1 35  ? -16.606 -12.826 2.103   1.00 32.03 ? 73  ILE A CD1 1 
ATOM   209  N N   . HIS A 1 36  ? -15.692 -10.565 -2.662  1.00 31.96 ? 74  HIS A N   1 
ATOM   210  C CA  . HIS A 1 36  ? -15.715 -9.554  -3.713  1.00 31.99 ? 74  HIS A CA  1 
ATOM   211  C C   . HIS A 1 36  ? -16.118 -10.157 -5.041  1.00 32.02 ? 74  HIS A C   1 
ATOM   212  O O   . HIS A 1 36  ? -15.324 -10.866 -5.665  1.00 31.46 ? 74  HIS A O   1 
ATOM   213  C CB  . HIS A 1 36  ? -14.346 -8.892  -3.816  1.00 31.99 ? 74  HIS A CB  1 
ATOM   214  C CG  . HIS A 1 36  ? -13.990 -8.097  -2.606  1.00 32.49 ? 74  HIS A CG  1 
ATOM   215  N ND1 . HIS A 1 36  ? -13.523 -8.679  -1.447  1.00 33.25 ? 74  HIS A ND1 1 
ATOM   216  C CD2 . HIS A 1 36  ? -14.070 -6.769  -2.359  1.00 33.49 ? 74  HIS A CD2 1 
ATOM   217  C CE1 . HIS A 1 36  ? -13.311 -7.738  -0.544  1.00 34.78 ? 74  HIS A CE1 1 
ATOM   218  N NE2 . HIS A 1 36  ? -13.631 -6.570  -1.074  1.00 33.76 ? 74  HIS A NE2 1 
ATOM   219  N N   . PRO A 1 37  ? -17.364 -9.888  -5.477  1.00 32.27 ? 75  PRO A N   1 
ATOM   220  C CA  . PRO A 1 37  ? -17.875 -10.555 -6.660  1.00 33.14 ? 75  PRO A CA  1 
ATOM   221  C C   . PRO A 1 37  ? -17.080 -10.257 -7.937  1.00 33.80 ? 75  PRO A C   1 
ATOM   222  O O   . PRO A 1 37  ? -16.990 -11.118 -8.809  1.00 34.34 ? 75  PRO A O   1 
ATOM   223  C CB  . PRO A 1 37  ? -19.319 -10.024 -6.772  1.00 32.80 ? 75  PRO A CB  1 
ATOM   224  C CG  . PRO A 1 37  ? -19.322 -8.763  -6.019  1.00 32.09 ? 75  PRO A CG  1 
ATOM   225  C CD  . PRO A 1 37  ? -18.368 -8.976  -4.896  1.00 32.43 ? 75  PRO A CD  1 
ATOM   226  N N   . GLU A 1 38  ? -16.511 -9.058  -8.043  1.00 34.70 ? 76  GLU A N   1 
ATOM   227  C CA  . GLU A 1 38  ? -15.748 -8.680  -9.241  1.00 35.78 ? 76  GLU A CA  1 
ATOM   228  C C   . GLU A 1 38  ? -14.528 -9.585  -9.438  1.00 36.16 ? 76  GLU A C   1 
ATOM   229  O O   . GLU A 1 38  ? -14.018 -9.725  -10.552 1.00 36.26 ? 76  GLU A O   1 
ATOM   230  C CB  . GLU A 1 38  ? -15.346 -7.191  -9.206  1.00 35.96 ? 76  GLU A CB  1 
ATOM   231  C CG  . GLU A 1 38  ? -14.358 -6.778  -8.115  1.00 37.50 ? 76  GLU A CG  1 
ATOM   232  C CD  . GLU A 1 38  ? -14.999 -6.546  -6.751  1.00 40.08 ? 76  GLU A CD  1 
ATOM   233  O OE1 . GLU A 1 38  ? -16.078 -7.115  -6.474  1.00 42.35 ? 76  GLU A OE1 1 
ATOM   234  O OE2 . GLU A 1 38  ? -14.417 -5.791  -5.945  1.00 42.40 ? 76  GLU A OE2 1 
ATOM   235  N N   . MET A 1 39  ? -14.073 -10.211 -8.353  1.00 36.70 ? 77  MET A N   1 
ATOM   236  C CA  . MET A 1 39  ? -12.884 -11.065 -8.411  1.00 36.83 ? 77  MET A CA  1 
ATOM   237  C C   . MET A 1 39  ? -13.226 -12.564 -8.382  1.00 37.42 ? 77  MET A C   1 
ATOM   238  O O   . MET A 1 39  ? -12.383 -13.395 -8.034  1.00 37.39 ? 77  MET A O   1 
ATOM   239  C CB  . MET A 1 39  ? -11.884 -10.677 -7.314  1.00 36.46 ? 77  MET A CB  1 
ATOM   240  C CG  . MET A 1 39  ? -11.366 -9.241  -7.416  1.00 36.00 ? 77  MET A CG  1 
ATOM   241  S SD  . MET A 1 39  ? -10.671 -8.803  -9.043  1.00 34.74 ? 77  MET A SD  1 
ATOM   242  C CE  . MET A 1 39  ? -9.004  -9.422  -8.855  1.00 32.54 ? 77  MET A CE  1 
ATOM   243  N N   . ARG A 1 40  ? -14.452 -12.902 -8.791  1.00 37.87 ? 78  ARG A N   1 
ATOM   244  C CA  . ARG A 1 40  ? -14.927 -14.294 -8.830  1.00 38.44 ? 78  ARG A CA  1 
ATOM   245  C C   . ARG A 1 40  ? -14.260 -15.144 -9.907  1.00 38.00 ? 78  ARG A C   1 
ATOM   246  O O   . ARG A 1 40  ? -14.231 -16.376 -9.811  1.00 38.03 ? 78  ARG A O   1 
ATOM   247  C CB  . ARG A 1 40  ? -16.442 -14.338 -9.057  1.00 38.80 ? 78  ARG A CB  1 
ATOM   248  C CG  . ARG A 1 40  ? -17.288 -14.166 -7.809  1.00 39.84 ? 78  ARG A CG  1 
ATOM   249  C CD  . ARG A 1 40  ? -18.777 -14.252 -8.168  1.00 40.08 ? 78  ARG A CD  1 
ATOM   250  N NE  . ARG A 1 40  ? -19.131 -13.249 -9.173  1.00 44.41 ? 78  ARG A NE  1 
ATOM   251  C CZ  . ARG A 1 40  ? -20.353 -13.033 -9.648  1.00 45.45 ? 78  ARG A CZ  1 
ATOM   252  N NH1 . ARG A 1 40  ? -21.383 -13.750 -9.220  1.00 47.14 ? 78  ARG A NH1 1 
ATOM   253  N NH2 . ARG A 1 40  ? -20.545 -12.087 -10.557 1.00 45.65 ? 78  ARG A NH2 1 
ATOM   254  N N   . HIS A 1 41  ? -13.754 -14.489 -10.946 1.00 37.61 ? 79  HIS A N   1 
ATOM   255  C CA  . HIS A 1 41  ? -13.120 -15.180 -12.068 1.00 37.21 ? 79  HIS A CA  1 
ATOM   256  C C   . HIS A 1 41  ? -11.732 -15.669 -11.665 1.00 36.46 ? 79  HIS A C   1 
ATOM   257  O O   . HIS A 1 41  ? -11.107 -16.428 -12.406 1.00 36.51 ? 79  HIS A O   1 
ATOM   258  C CB  . HIS A 1 41  ? -12.975 -14.219 -13.248 1.00 37.47 ? 79  HIS A CB  1 
ATOM   259  C CG  . HIS A 1 41  ? -12.090 -13.052 -12.948 1.00 37.61 ? 79  HIS A CG  1 
ATOM   260  N ND1 . HIS A 1 41  ? -12.554 -11.908 -12.337 1.00 37.51 ? 79  HIS A ND1 1 
ATOM   261  C CD2 . HIS A 1 41  ? -10.760 -12.872 -13.127 1.00 37.83 ? 79  HIS A CD2 1 
ATOM   262  C CE1 . HIS A 1 41  ? -11.550 -11.064 -12.172 1.00 38.77 ? 79  HIS A CE1 1 
ATOM   263  N NE2 . HIS A 1 41  ? -10.452 -11.623 -12.647 1.00 38.15 ? 79  HIS A NE2 1 
ATOM   264  N N   . VAL A 1 42  ? -11.259 -15.216 -10.500 1.00 35.18 ? 80  VAL A N   1 
ATOM   265  C CA  . VAL A 1 42  ? -9.886  -15.456 -10.061 1.00 34.03 ? 80  VAL A CA  1 
ATOM   266  C C   . VAL A 1 42  ? -9.648  -16.891 -9.592  1.00 33.32 ? 80  VAL A C   1 
ATOM   267  O O   . VAL A 1 42  ? -10.348 -17.409 -8.720  1.00 33.27 ? 80  VAL A O   1 
ATOM   268  C CB  . VAL A 1 42  ? -9.418  -14.421 -8.989  1.00 34.22 ? 80  VAL A CB  1 
ATOM   269  C CG1 . VAL A 1 42  ? -8.150  -14.876 -8.294  1.00 33.83 ? 80  VAL A CG1 1 
ATOM   270  C CG2 . VAL A 1 42  ? -9.182  -13.066 -9.629  1.00 33.45 ? 80  VAL A CG2 1 
ATOM   271  N N   . ASP A 1 43  ? -8.655  -17.521 -10.205 1.00 32.62 ? 81  ASP A N   1 
ATOM   272  C CA  . ASP A 1 43  ? -8.183  -18.822 -9.775  1.00 32.00 ? 81  ASP A CA  1 
ATOM   273  C C   . ASP A 1 43  ? -7.051  -18.574 -8.785  1.00 31.21 ? 81  ASP A C   1 
ATOM   274  O O   . ASP A 1 43  ? -5.964  -18.123 -9.161  1.00 30.62 ? 81  ASP A O   1 
ATOM   275  C CB  . ASP A 1 43  ? -7.698  -19.619 -10.978 1.00 32.33 ? 81  ASP A CB  1 
ATOM   276  C CG  . ASP A 1 43  ? -7.336  -21.048 -10.631 1.00 33.49 ? 81  ASP A CG  1 
ATOM   277  O OD1 . ASP A 1 43  ? -8.169  -21.935 -10.866 1.00 36.32 ? 81  ASP A OD1 1 
ATOM   278  O OD2 . ASP A 1 43  ? -6.226  -21.288 -10.130 1.00 34.26 ? 81  ASP A OD2 1 
ATOM   279  N N   . CYS A 1 44  ? -7.320  -18.875 -7.520  1.00 30.27 ? 82  CYS A N   1 
ATOM   280  C CA  . CYS A 1 44  ? -6.393  -18.565 -6.442  1.00 30.09 ? 82  CYS A CA  1 
ATOM   281  C C   . CYS A 1 44  ? -5.108  -19.381 -6.473  1.00 29.36 ? 82  CYS A C   1 
ATOM   282  O O   . CYS A 1 44  ? -4.059  -18.899 -6.036  1.00 28.90 ? 82  CYS A O   1 
ATOM   283  C CB  . CYS A 1 44  ? -7.089  -18.678 -5.095  1.00 30.38 ? 82  CYS A CB  1 
ATOM   284  S SG  . CYS A 1 44  ? -8.152  -17.271 -4.805  1.00 32.16 ? 82  CYS A SG  1 
ATOM   285  N N   . GLN A 1 45  ? -5.192  -20.599 -7.004  1.00 28.46 ? 83  GLN A N   1 
ATOM   286  C CA  . GLN A 1 45  ? -4.011  -21.429 -7.212  1.00 28.64 ? 83  GLN A CA  1 
ATOM   287  C C   . GLN A 1 45  ? -3.114  -20.782 -8.258  1.00 28.28 ? 83  GLN A C   1 
ATOM   288  O O   . GLN A 1 45  ? -1.897  -20.752 -8.104  1.00 28.07 ? 83  GLN A O   1 
ATOM   289  C CB  . GLN A 1 45  ? -4.409  -22.854 -7.636  1.00 28.46 ? 83  GLN A CB  1 
ATOM   290  C CG  . GLN A 1 45  ? -3.239  -23.823 -7.760  1.00 29.61 ? 83  GLN A CG  1 
ATOM   291  C CD  . GLN A 1 45  ? -2.513  -24.066 -6.439  1.00 29.68 ? 83  GLN A CD  1 
ATOM   292  O OE1 . GLN A 1 45  ? -1.280  -24.084 -6.390  1.00 32.02 ? 83  GLN A OE1 1 
ATOM   293  N NE2 . GLN A 1 45  ? -3.273  -24.239 -5.365  1.00 28.71 ? 83  GLN A NE2 1 
ATOM   294  N N   . SER A 1 46  ? -3.730  -20.260 -9.316  1.00 28.03 ? 84  SER A N   1 
ATOM   295  C CA  . SER A 1 46  ? -3.007  -19.522 -10.349 1.00 27.81 ? 84  SER A CA  1 
ATOM   296  C C   . SER A 1 46  ? -2.358  -18.275 -9.771  1.00 27.06 ? 84  SER A C   1 
ATOM   297  O O   . SER A 1 46  ? -1.192  -17.975 -10.058 1.00 26.58 ? 84  SER A O   1 
ATOM   298  C CB  . SER A 1 46  ? -3.945  -19.132 -11.496 1.00 28.11 ? 84  SER A CB  1 
ATOM   299  O OG  . SER A 1 46  ? -4.315  -20.272 -12.244 1.00 29.25 ? 84  SER A OG  1 
ATOM   300  N N   . VAL A 1 47  ? -3.120  -17.543 -8.958  1.00 26.70 ? 85  VAL A N   1 
ATOM   301  C CA  . VAL A 1 47  ? -2.599  -16.364 -8.262  1.00 26.10 ? 85  VAL A CA  1 
ATOM   302  C C   . VAL A 1 47  ? -1.367  -16.752 -7.430  1.00 25.88 ? 85  VAL A C   1 
ATOM   303  O O   . VAL A 1 47  ? -0.296  -16.122 -7.532  1.00 25.06 ? 85  VAL A O   1 
ATOM   304  C CB  . VAL A 1 47  ? -3.690  -15.709 -7.376  1.00 26.02 ? 85  VAL A CB  1 
ATOM   305  C CG1 . VAL A 1 47  ? -3.098  -14.652 -6.454  1.00 25.76 ? 85  VAL A CG1 1 
ATOM   306  C CG2 . VAL A 1 47  ? -4.769  -15.087 -8.248  1.00 26.02 ? 85  VAL A CG2 1 
ATOM   307  N N   . TRP A 1 48  ? -1.519  -17.800 -6.625  1.00 25.58 ? 86  TRP A N   1 
ATOM   308  C CA  . TRP A 1 48  ? -0.427  -18.244 -5.785  1.00 26.08 ? 86  TRP A CA  1 
ATOM   309  C C   . TRP A 1 48  ? 0.791   -18.602 -6.628  1.00 25.67 ? 86  TRP A C   1 
ATOM   310  O O   . TRP A 1 48  ? 1.906   -18.221 -6.286  1.00 24.83 ? 86  TRP A O   1 
ATOM   311  C CB  . TRP A 1 48  ? -0.832  -19.421 -4.901  1.00 26.62 ? 86  TRP A CB  1 
ATOM   312  C CG  . TRP A 1 48  ? 0.336   -20.036 -4.186  1.00 26.94 ? 86  TRP A CG  1 
ATOM   313  C CD1 . TRP A 1 48  ? 0.727   -21.346 -4.237  1.00 27.62 ? 86  TRP A CD1 1 
ATOM   314  C CD2 . TRP A 1 48  ? 1.277   -19.368 -3.323  1.00 26.93 ? 86  TRP A CD2 1 
ATOM   315  N NE1 . TRP A 1 48  ? 1.848   -21.534 -3.459  1.00 26.59 ? 86  TRP A NE1 1 
ATOM   316  C CE2 . TRP A 1 48  ? 2.203   -20.337 -2.890  1.00 26.79 ? 86  TRP A CE2 1 
ATOM   317  C CE3 . TRP A 1 48  ? 1.428   -18.039 -2.880  1.00 26.94 ? 86  TRP A CE3 1 
ATOM   318  C CZ2 . TRP A 1 48  ? 3.273   -20.028 -2.039  1.00 26.80 ? 86  TRP A CZ2 1 
ATOM   319  C CZ3 . TRP A 1 48  ? 2.496   -17.733 -2.030  1.00 26.82 ? 86  TRP A CZ3 1 
ATOM   320  C CH2 . TRP A 1 48  ? 3.399   -18.729 -1.619  1.00 26.84 ? 86  TRP A CH2 1 
ATOM   321  N N   . ASP A 1 49  ? 0.568   -19.314 -7.732  1.00 25.93 ? 87  ASP A N   1 
ATOM   322  C CA  . ASP A 1 49  ? 1.676   -19.733 -8.585  1.00 25.86 ? 87  ASP A CA  1 
ATOM   323  C C   . ASP A 1 49  ? 2.405   -18.537 -9.193  1.00 25.49 ? 87  ASP A C   1 
ATOM   324  O O   . ASP A 1 49  ? 3.632   -18.539 -9.245  1.00 24.85 ? 87  ASP A O   1 
ATOM   325  C CB  . ASP A 1 49  ? 1.208   -20.717 -9.667  1.00 26.72 ? 87  ASP A CB  1 
ATOM   326  C CG  . ASP A 1 49  ? 0.908   -22.101 -9.104  1.00 27.83 ? 87  ASP A CG  1 
ATOM   327  O OD1 . ASP A 1 49  ? 1.482   -22.463 -8.060  1.00 30.87 ? 87  ASP A OD1 1 
ATOM   328  O OD2 . ASP A 1 49  ? 0.095   -22.832 -9.694  1.00 31.28 ? 87  ASP A OD2 1 
ATOM   329  N N   . ALA A 1 50  ? 1.649   -17.535 -9.660  1.00 24.36 ? 88  ALA A N   1 
ATOM   330  C CA  . ALA A 1 50  ? 2.223   -16.266 -10.128 1.00 24.80 ? 88  ALA A CA  1 
ATOM   331  C C   . ALA A 1 50  ? 2.988   -15.519 -9.029  1.00 24.72 ? 88  ALA A C   1 
ATOM   332  O O   . ALA A 1 50  ? 4.051   -14.937 -9.289  1.00 24.81 ? 88  ALA A O   1 
ATOM   333  C CB  . ALA A 1 50  ? 1.134   -15.363 -10.709 1.00 24.16 ? 88  ALA A CB  1 
ATOM   334  N N   . PHE A 1 51  ? 2.446   -15.536 -7.809  1.00 24.87 ? 89  PHE A N   1 
ATOM   335  C CA  . PHE A 1 51  ? 3.073   -14.863 -6.661  1.00 24.85 ? 89  PHE A CA  1 
ATOM   336  C C   . PHE A 1 51  ? 4.433   -15.502 -6.366  1.00 25.33 ? 89  PHE A C   1 
ATOM   337  O O   . PHE A 1 51  ? 5.453   -14.805 -6.324  1.00 24.39 ? 89  PHE A O   1 
ATOM   338  C CB  . PHE A 1 51  ? 2.161   -14.954 -5.433  1.00 25.33 ? 89  PHE A CB  1 
ATOM   339  C CG  . PHE A 1 51  ? 2.418   -13.893 -4.386  1.00 25.58 ? 89  PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 51  ? 3.708   -13.451 -4.094  1.00 28.85 ? 89  PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 51  ? 1.361   -13.350 -3.678  1.00 28.20 ? 89  PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 51  ? 3.930   -12.474 -3.124  1.00 28.31 ? 89  PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 51  ? 1.572   -12.375 -2.698  1.00 29.23 ? 89  PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 51  ? 2.861   -11.937 -2.426  1.00 27.32 ? 89  PHE A CZ  1 
ATOM   345  N N   . LYS A 1 52  ? 4.434   -16.824 -6.166  1.00 26.02 ? 90  LYS A N   1 
ATOM   346  C CA  . LYS A 1 52  ? 5.662   -17.632 -5.999  1.00 27.04 ? 90  LYS A CA  1 
ATOM   347  C C   . LYS A 1 52  ? 6.684   -17.375 -7.078  1.00 27.01 ? 90  LYS A C   1 
ATOM   348  O O   . LYS A 1 52  ? 7.859   -17.174 -6.786  1.00 28.09 ? 90  LYS A O   1 
ATOM   349  C CB  . LYS A 1 52  ? 5.348   -19.125 -6.106  1.00 27.64 ? 90  LYS A CB  1 
ATOM   350  C CG  . LYS A 1 52  ? 5.026   -19.793 -4.828  1.00 30.63 ? 90  LYS A CG  1 
ATOM   351  C CD  . LYS A 1 52  ? 5.206   -21.301 -4.953  1.00 30.95 ? 90  LYS A CD  1 
ATOM   352  C CE  . LYS A 1 52  ? 4.263   -21.912 -5.983  1.00 33.32 ? 90  LYS A CE  1 
ATOM   353  N NZ  . LYS A 1 52  ? 4.526   -23.381 -6.117  1.00 33.32 ? 90  LYS A NZ  1 
ATOM   354  N N   . GLY A 1 53  ? 6.227   -17.428 -8.329  1.00 26.88 ? 91  GLY A N   1 
ATOM   355  C CA  . GLY A 1 53  ? 7.083   -17.252 -9.494  1.00 26.57 ? 91  GLY A CA  1 
ATOM   356  C C   . GLY A 1 53  ? 7.845   -15.944 -9.499  1.00 26.32 ? 91  GLY A C   1 
ATOM   357  O O   . GLY A 1 53  ? 8.945   -15.860 -10.051 1.00 27.01 ? 91  GLY A O   1 
ATOM   358  N N   . ALA A 1 54  ? 7.288   -14.929 -8.847  1.00 25.35 ? 92  ALA A N   1 
ATOM   359  C CA  . ALA A 1 54  ? 7.961   -13.645 -8.748  1.00 24.92 ? 92  ALA A CA  1 
ATOM   360  C C   . ALA A 1 54  ? 9.251   -13.656 -7.916  1.00 24.80 ? 92  ALA A C   1 
ATOM   361  O O   . ALA A 1 54  ? 10.133  -12.825 -8.141  1.00 24.19 ? 92  ALA A O   1 
ATOM   362  C CB  . ALA A 1 54  ? 6.995   -12.601 -8.218  1.00 25.27 ? 92  ALA A CB  1 
ATOM   363  N N   . PHE A 1 55  ? 9.358   -14.575 -6.956  1.00 24.94 ? 93  PHE A N   1 
ATOM   364  C CA  . PHE A 1 55  ? 10.473  -14.530 -5.998  1.00 25.01 ? 93  PHE A CA  1 
ATOM   365  C C   . PHE A 1 55  ? 11.178  -15.862 -5.733  1.00 25.40 ? 93  PHE A C   1 
ATOM   366  O O   . PHE A 1 55  ? 12.333  -15.869 -5.317  1.00 24.37 ? 93  PHE A O   1 
ATOM   367  C CB  . PHE A 1 55  ? 10.044  -13.852 -4.665  1.00 25.34 ? 93  PHE A CB  1 
ATOM   368  C CG  . PHE A 1 55  ? 9.093   -14.670 -3.848  1.00 24.36 ? 93  PHE A CG  1 
ATOM   369  C CD1 . PHE A 1 55  ? 9.572   -15.553 -2.875  1.00 27.31 ? 93  PHE A CD1 1 
ATOM   370  C CD2 . PHE A 1 55  ? 7.725   -14.584 -4.057  1.00 25.77 ? 93  PHE A CD2 1 
ATOM   371  C CE1 . PHE A 1 55  ? 8.695   -16.332 -2.122  1.00 27.00 ? 93  PHE A CE1 1 
ATOM   372  C CE2 . PHE A 1 55  ? 6.834   -15.356 -3.313  1.00 25.71 ? 93  PHE A CE2 1 
ATOM   373  C CZ  . PHE A 1 55  ? 7.322   -16.230 -2.342  1.00 26.82 ? 93  PHE A CZ  1 
ATOM   374  N N   . ILE A 1 56  ? 10.497  -16.984 -5.958  1.00 26.47 ? 94  ILE A N   1 
ATOM   375  C CA  . ILE A 1 56  ? 11.118  -18.303 -5.756  1.00 26.87 ? 94  ILE A CA  1 
ATOM   376  C C   . ILE A 1 56  ? 12.293  -18.489 -6.713  1.00 26.96 ? 94  ILE A C   1 
ATOM   377  O O   . ILE A 1 56  ? 12.192  -18.143 -7.892  1.00 26.98 ? 94  ILE A O   1 
ATOM   378  C CB  . ILE A 1 56  ? 10.096  -19.472 -5.956  1.00 27.12 ? 94  ILE A CB  1 
ATOM   379  C CG1 . ILE A 1 56  ? 9.101   -19.551 -4.794  1.00 29.04 ? 94  ILE A CG1 1 
ATOM   380  C CG2 . ILE A 1 56  ? 10.809  -20.814 -6.164  1.00 27.50 ? 94  ILE A CG2 1 
ATOM   381  C CD1 . ILE A 1 56  ? 9.739   -19.676 -3.419  1.00 29.97 ? 94  ILE A CD1 1 
ATOM   382  N N   . SER A 1 57  ? 13.400  -19.037 -6.205  1.00 27.07 ? 95  SER A N   1 
ATOM   383  C CA  . SER A 1 57  ? 14.605  -19.290 -7.024  1.00 27.60 ? 95  SER A CA  1 
ATOM   384  C C   . SER A 1 57  ? 15.315  -18.028 -7.514  1.00 27.58 ? 95  SER A C   1 
ATOM   385  O O   . SER A 1 57  ? 16.206  -18.102 -8.363  1.00 28.40 ? 95  SER A O   1 
ATOM   386  C CB  . SER A 1 57  ? 14.277  -20.173 -8.236  1.00 27.69 ? 95  SER A CB  1 
ATOM   387  O OG  . SER A 1 57  ? 13.927  -21.472 -7.815  1.00 29.04 ? 95  SER A OG  1 
ATOM   388  N N   . LYS A 1 58  ? 14.914  -16.877 -6.999  1.00 26.93 ? 96  LYS A N   1 
ATOM   389  C CA  . LYS A 1 58  ? 15.541  -15.625 -7.391  1.00 26.78 ? 96  LYS A CA  1 
ATOM   390  C C   . LYS A 1 58  ? 16.265  -15.030 -6.202  1.00 26.20 ? 96  LYS A C   1 
ATOM   391  O O   . LYS A 1 58  ? 15.871  -15.231 -5.048  1.00 25.93 ? 96  LYS A O   1 
ATOM   392  C CB  . LYS A 1 58  ? 14.498  -14.648 -7.949  1.00 26.66 ? 96  LYS A CB  1 
ATOM   393  C CG  . LYS A 1 58  ? 13.910  -15.131 -9.269  1.00 27.76 ? 96  LYS A CG  1 
ATOM   394  C CD  . LYS A 1 58  ? 12.724  -14.323 -9.744  1.00 29.28 ? 96  LYS A CD  1 
ATOM   395  C CE  . LYS A 1 58  ? 12.143  -14.967 -11.003 1.00 30.16 ? 96  LYS A CE  1 
ATOM   396  N NZ  . LYS A 1 58  ? 10.854  -14.353 -11.423 1.00 32.25 ? 96  LYS A NZ  1 
ATOM   397  N N   . HIS A 1 59  ? 17.345  -14.318 -6.483  1.00 26.00 ? 97  HIS A N   1 
ATOM   398  C CA  . HIS A 1 59  ? 18.103  -13.693 -5.419  1.00 25.42 ? 97  HIS A CA  1 
ATOM   399  C C   . HIS A 1 59  ? 17.238  -12.613 -4.782  1.00 24.97 ? 97  HIS A C   1 
ATOM   400  O O   . HIS A 1 59  ? 16.727  -11.757 -5.491  1.00 25.19 ? 97  HIS A O   1 
ATOM   401  C CB  . HIS A 1 59  ? 19.390  -13.095 -5.954  1.00 25.04 ? 97  HIS A CB  1 
ATOM   402  C CG  . HIS A 1 59  ? 20.364  -12.769 -4.876  1.00 24.74 ? 97  HIS A CG  1 
ATOM   403  N ND1 . HIS A 1 59  ? 20.182  -11.717 -4.007  1.00 23.17 ? 97  HIS A ND1 1 
ATOM   404  C CD2 . HIS A 1 59  ? 21.504  -13.387 -4.490  1.00 24.96 ? 97  HIS A CD2 1 
ATOM   405  C CE1 . HIS A 1 59  ? 21.180  -11.687 -3.144  1.00 23.16 ? 97  HIS A CE1 1 
ATOM   406  N NE2 . HIS A 1 59  ? 21.997  -12.687 -3.417  1.00 22.58 ? 97  HIS A NE2 1 
ATOM   407  N N   . PRO A 1 60  ? 17.060  -12.647 -3.443  1.00 24.68 ? 98  PRO A N   1 
ATOM   408  C CA  . PRO A 1 60  ? 16.100  -11.714 -2.845  1.00 24.44 ? 98  PRO A CA  1 
ATOM   409  C C   . PRO A 1 60  ? 16.555  -10.252 -2.788  1.00 24.83 ? 98  PRO A C   1 
ATOM   410  O O   . PRO A 1 60  ? 15.885  -9.439  -2.152  1.00 23.81 ? 98  PRO A O   1 
ATOM   411  C CB  . PRO A 1 60  ? 15.884  -12.288 -1.434  1.00 24.76 ? 98  PRO A CB  1 
ATOM   412  C CG  . PRO A 1 60  ? 17.137  -12.998 -1.120  1.00 23.65 ? 98  PRO A CG  1 
ATOM   413  C CD  . PRO A 1 60  ? 17.685  -13.520 -2.429  1.00 25.35 ? 98  PRO A CD  1 
ATOM   414  N N   . CYS A 1 61  ? 17.678  -9.933  -3.427  1.00 24.93 ? 99  CYS A N   1 
ATOM   415  C CA  . CYS A 1 61  ? 18.131  -8.545  -3.569  1.00 26.25 ? 99  CYS A CA  1 
ATOM   416  C C   . CYS A 1 61  ? 18.159  -8.143  -5.041  1.00 26.25 ? 99  CYS A C   1 
ATOM   417  O O   . CYS A 1 61  ? 18.613  -7.059  -5.393  1.00 26.73 ? 99  CYS A O   1 
ATOM   418  C CB  . CYS A 1 61  ? 19.511  -8.357  -2.941  1.00 26.14 ? 99  CYS A CB  1 
ATOM   419  S SG  . CYS A 1 61  ? 19.462  -8.423  -1.163  1.00 28.05 ? 99  CYS A SG  1 
ATOM   420  N N   . ASP A 1 62  ? 17.658  -9.026  -5.891  1.00 26.68 ? 100 ASP A N   1 
ATOM   421  C CA  . ASP A 1 62  ? 17.624  -8.784  -7.325  1.00 27.54 ? 100 ASP A CA  1 
ATOM   422  C C   . ASP A 1 62  ? 16.224  -9.013  -7.903  1.00 27.15 ? 100 ASP A C   1 
ATOM   423  O O   . ASP A 1 62  ? 16.071  -9.559  -9.003  1.00 27.69 ? 100 ASP A O   1 
ATOM   424  C CB  . ASP A 1 62  ? 18.632  -9.678  -8.034  1.00 28.35 ? 100 ASP A CB  1 
ATOM   425  C CG  . ASP A 1 62  ? 18.963  -9.187  -9.432  1.00 30.56 ? 100 ASP A CG  1 
ATOM   426  O OD1 . ASP A 1 62  ? 19.466  -10.005 -10.222 1.00 33.01 ? 100 ASP A OD1 1 
ATOM   427  O OD2 . ASP A 1 62  ? 18.708  -7.995  -9.739  1.00 32.78 ? 100 ASP A OD2 1 
ATOM   428  N N   . ILE A 1 63  ? 15.208  -8.609  -7.148  1.00 26.34 ? 101 ILE A N   1 
ATOM   429  C CA  . ILE A 1 63  ? 13.836  -8.682  -7.613  1.00 25.92 ? 101 ILE A CA  1 
ATOM   430  C C   . ILE A 1 63  ? 13.528  -7.424  -8.412  1.00 26.57 ? 101 ILE A C   1 
ATOM   431  O O   . ILE A 1 63  ? 13.968  -6.331  -8.048  1.00 25.83 ? 101 ILE A O   1 
ATOM   432  C CB  . ILE A 1 63  ? 12.847  -8.829  -6.452  1.00 25.97 ? 101 ILE A CB  1 
ATOM   433  C CG1 . ILE A 1 63  ? 13.275  -9.989  -5.539  1.00 25.48 ? 101 ILE A CG1 1 
ATOM   434  C CG2 . ILE A 1 63  ? 11.396  -8.993  -6.962  1.00 24.36 ? 101 ILE A CG2 1 
ATOM   435  C CD1 . ILE A 1 63  ? 13.342  -11.371 -6.210  1.00 23.91 ? 101 ILE A CD1 1 
ATOM   436  N N   . THR A 1 64  ? 12.781  -7.597  -9.505  1.00 26.84 ? 102 THR A N   1 
ATOM   437  C CA  . THR A 1 64  ? 12.360  -6.469  -10.350 1.00 27.75 ? 102 THR A CA  1 
ATOM   438  C C   . THR A 1 64  ? 10.839  -6.438  -10.421 1.00 28.07 ? 102 THR A C   1 
ATOM   439  O O   . THR A 1 64  ? 10.168  -7.410  -10.079 1.00 27.93 ? 102 THR A O   1 
ATOM   440  C CB  . THR A 1 64  ? 12.893  -6.601  -11.779 1.00 27.46 ? 102 THR A CB  1 
ATOM   441  O OG1 . THR A 1 64  ? 12.294  -7.751  -12.386 1.00 28.50 ? 102 THR A OG1 1 
ATOM   442  C CG2 . THR A 1 64  ? 14.414  -6.756  -11.800 1.00 28.01 ? 102 THR A CG2 1 
ATOM   443  N N   . GLU A 1 65  ? 10.288  -5.314  -10.863 1.00 28.74 ? 103 GLU A N   1 
ATOM   444  C CA  . GLU A 1 65  ? 8.859   -5.230  -11.085 1.00 30.11 ? 103 GLU A CA  1 
ATOM   445  C C   . GLU A 1 65  ? 8.376   -6.247  -12.116 1.00 29.89 ? 103 GLU A C   1 
ATOM   446  O O   . GLU A 1 65  ? 7.292   -6.804  -11.966 1.00 30.56 ? 103 GLU A O   1 
ATOM   447  C CB  . GLU A 1 65  ? 8.458   -3.802  -11.449 1.00 30.40 ? 103 GLU A CB  1 
ATOM   448  C CG  . GLU A 1 65  ? 8.941   -2.797  -10.391 1.00 34.63 ? 103 GLU A CG  1 
ATOM   449  C CD  . GLU A 1 65  ? 8.206   -1.465  -10.418 1.00 40.01 ? 103 GLU A CD  1 
ATOM   450  O OE1 . GLU A 1 65  ? 7.594   -1.134  -11.467 1.00 40.93 ? 103 GLU A OE1 1 
ATOM   451  O OE2 . GLU A 1 65  ? 8.257   -0.754  -9.381  1.00 41.79 ? 103 GLU A OE2 1 
ATOM   452  N N   . GLU A 1 66  ? 9.190   -6.503  -13.138 1.00 29.99 ? 104 GLU A N   1 
ATOM   453  C CA  . GLU A 1 66  ? 8.878   -7.486  -14.175 1.00 30.40 ? 104 GLU A CA  1 
ATOM   454  C C   . GLU A 1 66  ? 8.566   -8.853  -13.557 1.00 29.84 ? 104 GLU A C   1 
ATOM   455  O O   . GLU A 1 66  ? 7.674   -9.572  -14.024 1.00 29.41 ? 104 GLU A O   1 
ATOM   456  C CB  . GLU A 1 66  ? 10.051  -7.613  -15.160 1.00 31.54 ? 104 GLU A CB  1 
ATOM   457  C CG  . GLU A 1 66  ? 10.174  -6.452  -16.172 1.00 35.47 ? 104 GLU A CG  1 
ATOM   458  C CD  . GLU A 1 66  ? 10.442  -5.071  -15.535 1.00 39.87 ? 104 GLU A CD  1 
ATOM   459  O OE1 . GLU A 1 66  ? 11.239  -4.975  -14.560 1.00 39.13 ? 104 GLU A OE1 1 
ATOM   460  O OE2 . GLU A 1 66  ? 9.850   -4.077  -16.033 1.00 41.71 ? 104 GLU A OE2 1 
ATOM   461  N N   . ASP A 1 67  ? 9.295   -9.198  -12.491 1.00 29.13 ? 105 ASP A N   1 
ATOM   462  C CA  . ASP A 1 67  ? 9.072   -10.455 -11.763 1.00 28.46 ? 105 ASP A CA  1 
ATOM   463  C C   . ASP A 1 67  ? 7.626   -10.615 -11.299 1.00 27.82 ? 105 ASP A C   1 
ATOM   464  O O   . ASP A 1 67  ? 7.096   -11.736 -11.279 1.00 27.98 ? 105 ASP A O   1 
ATOM   465  C CB  . ASP A 1 67  ? 10.020  -10.558 -10.564 1.00 28.32 ? 105 ASP A CB  1 
ATOM   466  C CG  . ASP A 1 67  ? 11.445  -10.831 -10.986 1.00 29.75 ? 105 ASP A CG  1 
ATOM   467  O OD1 . ASP A 1 67  ? 11.626  -11.646 -11.909 1.00 29.51 ? 105 ASP A OD1 1 
ATOM   468  O OD2 . ASP A 1 67  ? 12.376  -10.232 -10.411 1.00 31.14 ? 105 ASP A OD2 1 
ATOM   469  N N   . TYR A 1 68  ? 7.007   -9.495  -10.930 1.00 27.37 ? 106 TYR A N   1 
ATOM   470  C CA  . TYR A 1 68  ? 5.619   -9.473  -10.442 1.00 27.14 ? 106 TYR A CA  1 
ATOM   471  C C   . TYR A 1 68  ? 4.549   -9.260  -11.513 1.00 28.10 ? 106 TYR A C   1 
ATOM   472  O O   . TYR A 1 68  ? 3.346   -9.263  -11.217 1.00 27.82 ? 106 TYR A O   1 
ATOM   473  C CB  . TYR A 1 68  ? 5.462   -8.423  -9.353  1.00 26.84 ? 106 TYR A CB  1 
ATOM   474  C CG  . TYR A 1 68  ? 6.018   -8.855  -8.024  1.00 25.45 ? 106 TYR A CG  1 
ATOM   475  C CD1 . TYR A 1 68  ? 7.214   -8.324  -7.544  1.00 25.06 ? 106 TYR A CD1 1 
ATOM   476  C CD2 . TYR A 1 68  ? 5.352   -9.807  -7.251  1.00 24.83 ? 106 TYR A CD2 1 
ATOM   477  C CE1 . TYR A 1 68  ? 7.735   -8.727  -6.298  1.00 25.09 ? 106 TYR A CE1 1 
ATOM   478  C CE2 . TYR A 1 68  ? 5.849   -10.208 -6.008  1.00 27.25 ? 106 TYR A CE2 1 
ATOM   479  C CZ  . TYR A 1 68  ? 7.042   -9.666  -5.548  1.00 24.90 ? 106 TYR A CZ  1 
ATOM   480  O OH  . TYR A 1 68  ? 7.508   -10.075 -4.334  1.00 25.42 ? 106 TYR A OH  1 
ATOM   481  N N   . GLN A 1 69  ? 4.967   -9.106  -12.764 1.00 29.09 ? 107 GLN A N   1 
ATOM   482  C CA  . GLN A 1 69  ? 4.001   -8.883  -13.833 1.00 30.11 ? 107 GLN A CA  1 
ATOM   483  C C   . GLN A 1 69  ? 2.937   -9.976  -13.992 1.00 29.39 ? 107 GLN A C   1 
ATOM   484  O O   . GLN A 1 69  ? 1.768   -9.642  -14.195 1.00 29.45 ? 107 GLN A O   1 
ATOM   485  C CB  . GLN A 1 69  ? 4.678   -8.532  -15.172 1.00 31.13 ? 107 GLN A CB  1 
ATOM   486  C CG  . GLN A 1 69  ? 5.318   -7.124  -15.190 1.00 35.72 ? 107 GLN A CG  1 
ATOM   487  C CD  . GLN A 1 69  ? 4.486   -6.042  -14.474 1.00 41.44 ? 107 GLN A CD  1 
ATOM   488  O OE1 . GLN A 1 69  ? 3.421   -5.625  -14.957 1.00 45.09 ? 107 GLN A OE1 1 
ATOM   489  N NE2 . GLN A 1 69  ? 4.978   -5.582  -13.317 1.00 44.09 ? 107 GLN A NE2 1 
ATOM   490  N N   . PRO A 1 70  ? 3.323   -11.267 -13.931 1.00 28.64 ? 108 PRO A N   1 
ATOM   491  C CA  . PRO A 1 70  ? 2.276   -12.299 -13.959 1.00 28.19 ? 108 PRO A CA  1 
ATOM   492  C C   . PRO A 1 70  ? 1.247   -12.181 -12.827 1.00 27.58 ? 108 PRO A C   1 
ATOM   493  O O   . PRO A 1 70  ? 0.050   -12.352 -13.065 1.00 27.05 ? 108 PRO A O   1 
ATOM   494  C CB  . PRO A 1 70  ? 3.073   -13.605 -13.844 1.00 28.38 ? 108 PRO A CB  1 
ATOM   495  C CG  . PRO A 1 70  ? 4.395   -13.272 -14.413 1.00 28.84 ? 108 PRO A CG  1 
ATOM   496  C CD  . PRO A 1 70  ? 4.668   -11.879 -13.915 1.00 28.57 ? 108 PRO A CD  1 
ATOM   497  N N   . LEU A 1 71  ? 1.712   -11.868 -11.617 1.00 27.37 ? 109 LEU A N   1 
ATOM   498  C CA  . LEU A 1 71  ? 0.819   -11.623 -10.493 1.00 26.81 ? 109 LEU A CA  1 
ATOM   499  C C   . LEU A 1 71  ? -0.046  -10.390 -10.728 1.00 27.37 ? 109 LEU A C   1 
ATOM   500  O O   . LEU A 1 71  ? -1.252  -10.447 -10.509 1.00 27.05 ? 109 LEU A O   1 
ATOM   501  C CB  . LEU A 1 71  ? 1.593   -11.482 -9.186  1.00 26.21 ? 109 LEU A CB  1 
ATOM   502  C CG  . LEU A 1 71  ? 0.741   -11.202 -7.950  1.00 25.50 ? 109 LEU A CG  1 
ATOM   503  C CD1 . LEU A 1 71  ? -0.293  -12.308 -7.696  1.00 24.73 ? 109 LEU A CD1 1 
ATOM   504  C CD2 . LEU A 1 71  ? 1.630   -10.976 -6.733  1.00 24.77 ? 109 LEU A CD2 1 
ATOM   505  N N   . MET A 1 72  ? 0.561   -9.291  -11.175 1.00 27.92 ? 110 MET A N   1 
ATOM   506  C CA  . MET A 1 72  ? -0.205  -8.081  -11.521 1.00 29.70 ? 110 MET A CA  1 
ATOM   507  C C   . MET A 1 72  ? -1.291  -8.383  -12.553 1.00 30.02 ? 110 MET A C   1 
ATOM   508  O O   . MET A 1 72  ? -2.410  -7.882  -12.434 1.00 30.04 ? 110 MET A O   1 
ATOM   509  C CB  . MET A 1 72  ? 0.703   -6.972  -12.068 1.00 29.99 ? 110 MET A CB  1 
ATOM   510  C CG  . MET A 1 72  ? 1.777   -6.468  -11.125 1.00 32.74 ? 110 MET A CG  1 
ATOM   511  S SD  . MET A 1 72  ? 1.194   -5.926  -9.516  1.00 38.47 ? 110 MET A SD  1 
ATOM   512  C CE  . MET A 1 72  ? 1.567   -7.370  -8.510  1.00 35.03 ? 110 MET A CE  1 
ATOM   513  N N   . LYS A 1 73  ? -0.954  -9.201  -13.555 1.00 30.30 ? 111 LYS A N   1 
ATOM   514  C CA  . LYS A 1 73  ? -1.917  -9.598  -14.588 1.00 31.31 ? 111 LYS A CA  1 
ATOM   515  C C   . LYS A 1 73  ? -3.114  -10.334 -13.990 1.00 30.77 ? 111 LYS A C   1 
ATOM   516  O O   . LYS A 1 73  ? -4.269  -9.941  -14.196 1.00 30.89 ? 111 LYS A O   1 
ATOM   517  C CB  . LYS A 1 73  ? -1.253  -10.463 -15.657 1.00 31.82 ? 111 LYS A CB  1 
ATOM   518  C CG  . LYS A 1 73  ? -0.501  -9.667  -16.712 1.00 35.47 ? 111 LYS A CG  1 
ATOM   519  C CD  . LYS A 1 73  ? -0.025  -10.553 -17.862 1.00 40.64 ? 111 LYS A CD  1 
ATOM   520  C CE  . LYS A 1 73  ? 1.005   -9.836  -18.755 1.00 43.58 ? 111 LYS A CE  1 
ATOM   521  N NZ  . LYS A 1 73  ? 2.210   -9.343  -17.995 1.00 45.11 ? 111 LYS A NZ  1 
ATOM   522  N N   . LEU A 1 74  ? -2.832  -11.380 -13.225 1.00 30.03 ? 112 LEU A N   1 
ATOM   523  C CA  . LEU A 1 74  ? -3.879  -12.188 -12.606 1.00 29.84 ? 112 LEU A CA  1 
ATOM   524  C C   . LEU A 1 74  ? -4.681  -11.396 -11.566 1.00 30.04 ? 112 LEU A C   1 
ATOM   525  O O   . LEU A 1 74  ? -5.876  -11.610 -11.399 1.00 29.02 ? 112 LEU A O   1 
ATOM   526  C CB  . LEU A 1 74  ? -3.263  -13.431 -11.959 1.00 29.47 ? 112 LEU A CB  1 
ATOM   527  C CG  . LEU A 1 74  ? -2.695  -14.490 -12.899 1.00 30.10 ? 112 LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 74  ? -2.310  -15.713 -12.098 1.00 30.12 ? 112 LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 74  ? -3.679  -14.875 -13.995 1.00 30.35 ? 112 LEU A CD2 1 
ATOM   530  N N   . GLY A 1 75  ? -4.001  -10.478 -10.881 1.00 30.14 ? 113 GLY A N   1 
ATOM   531  C CA  . GLY A 1 75  ? -4.616  -9.669  -9.839  1.00 30.86 ? 113 GLY A CA  1 
ATOM   532  C C   . GLY A 1 75  ? -5.250  -8.394  -10.362 1.00 31.17 ? 113 GLY A C   1 
ATOM   533  O O   . GLY A 1 75  ? -5.640  -7.537  -9.575  1.00 30.95 ? 113 GLY A O   1 
ATOM   534  N N   . THR A 1 76  ? -5.349  -8.269  -11.691 1.00 31.85 ? 114 THR A N   1 
ATOM   535  C CA  . THR A 1 76  ? -5.996  -7.116  -12.332 1.00 32.66 ? 114 THR A CA  1 
ATOM   536  C C   . THR A 1 76  ? -7.362  -6.852  -11.703 1.00 32.59 ? 114 THR A C   1 
ATOM   537  O O   . THR A 1 76  ? -8.233  -7.728  -11.653 1.00 32.95 ? 114 THR A O   1 
ATOM   538  C CB  . THR A 1 76  ? -6.151  -7.305  -13.880 1.00 32.74 ? 114 THR A CB  1 
ATOM   539  O OG1 . THR A 1 76  ? -4.860  -7.488  -14.466 1.00 33.09 ? 114 THR A OG1 1 
ATOM   540  C CG2 . THR A 1 76  ? -6.806  -6.085  -14.525 1.00 33.06 ? 114 THR A CG2 1 
ATOM   541  N N   . GLN A 1 77  ? -7.534  -5.638  -11.205 1.00 32.94 ? 115 GLN A N   1 
ATOM   542  C CA  . GLN A 1 77  ? -8.763  -5.271  -10.538 1.00 32.88 ? 115 GLN A CA  1 
ATOM   543  C C   . GLN A 1 77  ? -9.049  -3.801  -10.775 1.00 33.21 ? 115 GLN A C   1 
ATOM   544  O O   . GLN A 1 77  ? -8.183  -2.970  -10.565 1.00 32.92 ? 115 GLN A O   1 
ATOM   545  C CB  . GLN A 1 77  ? -8.622  -5.539  -9.043  1.00 32.96 ? 115 GLN A CB  1 
ATOM   546  C CG  . GLN A 1 77  ? -9.852  -5.245  -8.245  1.00 32.27 ? 115 GLN A CG  1 
ATOM   547  C CD  . GLN A 1 77  ? -9.746  -5.726  -6.822  1.00 32.47 ? 115 GLN A CD  1 
ATOM   548  O OE1 . GLN A 1 77  ? -10.715 -5.652  -6.066  1.00 33.22 ? 115 GLN A OE1 1 
ATOM   549  N NE2 . GLN A 1 77  ? -8.581  -6.242  -6.450  1.00 28.90 ? 115 GLN A NE2 1 
ATOM   550  N N   . THR A 1 78  ? -10.262 -3.498  -11.226 1.00 33.84 ? 116 THR A N   1 
ATOM   551  C CA  . THR A 1 78  ? -10.694 -2.111  -11.396 1.00 35.60 ? 116 THR A CA  1 
ATOM   552  C C   . THR A 1 78  ? -11.300 -1.650  -10.076 1.00 35.18 ? 116 THR A C   1 
ATOM   553  O O   . THR A 1 78  ? -12.263 -2.238  -9.592  1.00 36.05 ? 116 THR A O   1 
ATOM   554  C CB  . THR A 1 78  ? -11.733 -1.959  -12.515 1.00 35.58 ? 116 THR A CB  1 
ATOM   555  O OG1 . THR A 1 78  ? -11.216 -2.520  -13.726 1.00 39.14 ? 116 THR A OG1 1 
ATOM   556  C CG2 . THR A 1 78  ? -12.069 -0.474  -12.753 1.00 37.50 ? 116 THR A CG2 1 
ATOM   557  N N   . VAL A 1 79  ? -10.705 -0.631  -9.473  1.00 34.69 ? 117 VAL A N   1 
ATOM   558  C CA  . VAL A 1 79  ? -11.275 -0.047  -8.272  1.00 34.37 ? 117 VAL A CA  1 
ATOM   559  C C   . VAL A 1 79  ? -11.856 1.315   -8.675  1.00 32.99 ? 117 VAL A C   1 
ATOM   560  O O   . VAL A 1 79  ? -11.325 1.967   -9.586  1.00 32.43 ? 117 VAL A O   1 
ATOM   561  C CB  . VAL A 1 79  ? -10.234 0.086   -7.114  1.00 34.61 ? 117 VAL A CB  1 
ATOM   562  C CG1 . VAL A 1 79  ? -9.560  -1.270  -6.821  1.00 35.69 ? 117 VAL A CG1 1 
ATOM   563  C CG2 . VAL A 1 79  ? -9.190  1.119   -7.441  1.00 36.93 ? 117 VAL A CG2 1 
ATOM   564  N N   . PRO A 1 80  ? -12.952 1.740   -8.028  1.00 32.20 ? 118 PRO A N   1 
ATOM   565  C CA  . PRO A 1 80  ? -13.480 3.061   -8.365  1.00 30.77 ? 118 PRO A CA  1 
ATOM   566  C C   . PRO A 1 80  ? -12.404 4.111   -8.131  1.00 29.49 ? 118 PRO A C   1 
ATOM   567  O O   . PRO A 1 80  ? -11.948 4.272   -7.004  1.00 28.61 ? 118 PRO A O   1 
ATOM   568  C CB  . PRO A 1 80  ? -14.628 3.230   -7.381  1.00 30.93 ? 118 PRO A CB  1 
ATOM   569  C CG  . PRO A 1 80  ? -15.045 1.840   -7.066  1.00 32.72 ? 118 PRO A CG  1 
ATOM   570  C CD  . PRO A 1 80  ? -13.785 1.065   -7.016  1.00 32.27 ? 118 PRO A CD  1 
ATOM   571  N N   . CYS A 1 81  ? -11.994 4.804   -9.191  1.00 28.70 ? 119 CYS A N   1 
ATOM   572  C CA  . CYS A 1 81  ? -10.784 5.638   -9.137  1.00 27.99 ? 119 CYS A CA  1 
ATOM   573  C C   . CYS A 1 81  ? -10.938 6.821   -8.187  1.00 27.10 ? 119 CYS A C   1 
ATOM   574  O O   . CYS A 1 81  ? -9.952  7.344   -7.666  1.00 26.90 ? 119 CYS A O   1 
ATOM   575  C CB  . CYS A 1 81  ? -10.355 6.101   -10.549 1.00 28.18 ? 119 CYS A CB  1 
ATOM   576  S SG  . CYS A 1 81  ? -11.506 7.157   -11.403 1.00 30.84 ? 119 CYS A SG  1 
ATOM   577  N N   . ASN A 1 82  ? -12.183 7.235   -7.959  1.00 25.64 ? 120 ASN A N   1 
ATOM   578  C CA  . ASN A 1 82  ? -12.460 8.385   -7.100  1.00 24.99 ? 120 ASN A CA  1 
ATOM   579  C C   . ASN A 1 82  ? -12.617 8.047   -5.613  1.00 24.13 ? 120 ASN A C   1 
ATOM   580  O O   . ASN A 1 82  ? -12.892 8.931   -4.797  1.00 24.04 ? 120 ASN A O   1 
ATOM   581  C CB  . ASN A 1 82  ? -13.692 9.149   -7.610  1.00 24.57 ? 120 ASN A CB  1 
ATOM   582  C CG  . ASN A 1 82  ? -14.968 8.300   -7.628  1.00 25.06 ? 120 ASN A CG  1 
ATOM   583  O OD1 . ASN A 1 82  ? -14.961 7.106   -7.989  1.00 22.96 ? 120 ASN A OD1 1 
ATOM   584  N ND2 . ASN A 1 82  ? -16.078 8.926   -7.260  1.00 22.65 ? 120 ASN A ND2 1 
ATOM   585  N N   . LYS A 1 83  ? -12.424 6.773   -5.257  1.00 24.66 ? 121 LYS A N   1 
ATOM   586  C CA  . LYS A 1 83  ? -12.715 6.316   -3.898  1.00 25.00 ? 121 LYS A CA  1 
ATOM   587  C C   . LYS A 1 83  ? -11.500 5.677   -3.253  1.00 25.77 ? 121 LYS A C   1 
ATOM   588  O O   . LYS A 1 83  ? -11.603 4.715   -2.487  1.00 26.31 ? 121 LYS A O   1 
ATOM   589  C CB  . LYS A 1 83  ? -13.911 5.362   -3.932  1.00 25.31 ? 121 LYS A CB  1 
ATOM   590  C CG  . LYS A 1 83  ? -15.183 6.100   -4.346  1.00 26.32 ? 121 LYS A CG  1 
ATOM   591  C CD  . LYS A 1 83  ? -16.369 5.185   -4.430  1.00 27.76 ? 121 LYS A CD  1 
ATOM   592  C CE  . LYS A 1 83  ? -17.568 5.913   -4.994  1.00 28.40 ? 121 LYS A CE  1 
ATOM   593  N NZ  . LYS A 1 83  ? -17.984 7.104   -4.170  1.00 25.59 ? 121 LYS A NZ  1 
ATOM   594  N N   . ILE A 1 84  ? -10.339 6.223   -3.579  1.00 25.50 ? 122 ILE A N   1 
ATOM   595  C CA  . ILE A 1 84  ? -9.106  5.654   -3.124  1.00 25.45 ? 122 ILE A CA  1 
ATOM   596  C C   . ILE A 1 84  ? -8.637  6.380   -1.888  1.00 25.49 ? 122 ILE A C   1 
ATOM   597  O O   . ILE A 1 84  ? -8.661  7.610   -1.840  1.00 26.19 ? 122 ILE A O   1 
ATOM   598  C CB  . ILE A 1 84  ? -8.071  5.641   -4.265  1.00 25.34 ? 122 ILE A CB  1 
ATOM   599  C CG1 . ILE A 1 84  ? -8.371  4.430   -5.165  1.00 25.50 ? 122 ILE A CG1 1 
ATOM   600  C CG2 . ILE A 1 84  ? -6.636  5.568   -3.730  1.00 26.05 ? 122 ILE A CG2 1 
ATOM   601  C CD1 . ILE A 1 84  ? -7.618  4.445   -6.463  1.00 27.57 ? 122 ILE A CD1 1 
ATOM   602  N N   . LEU A 1 85  ? -8.264  5.593   -0.876  1.00 24.75 ? 123 LEU A N   1 
ATOM   603  C CA  . LEU A 1 85  ? -7.639  6.118   0.328   1.00 23.90 ? 123 LEU A CA  1 
ATOM   604  C C   . LEU A 1 85  ? -6.192  5.633   0.413   1.00 23.59 ? 123 LEU A C   1 
ATOM   605  O O   . LEU A 1 85  ? -5.919  4.442   0.560   1.00 23.14 ? 123 LEU A O   1 
ATOM   606  C CB  . LEU A 1 85  ? -8.429  5.717   1.582   1.00 23.57 ? 123 LEU A CB  1 
ATOM   607  C CG  . LEU A 1 85  ? -7.824  6.154   2.931   1.00 23.73 ? 123 LEU A CG  1 
ATOM   608  C CD1 . LEU A 1 85  ? -7.835  7.686   3.092   1.00 24.07 ? 123 LEU A CD1 1 
ATOM   609  C CD2 . LEU A 1 85  ? -8.560  5.498   4.101   1.00 24.99 ? 123 LEU A CD2 1 
ATOM   610  N N   . LEU A 1 86  ? -5.270  6.567   0.282   1.00 23.38 ? 124 LEU A N   1 
ATOM   611  C CA  . LEU A 1 86  ? -3.865  6.276   0.520   1.00 24.23 ? 124 LEU A CA  1 
ATOM   612  C C   . LEU A 1 86  ? -3.622  6.485   2.014   1.00 25.33 ? 124 LEU A C   1 
ATOM   613  O O   . LEU A 1 86  ? -4.452  7.076   2.717   1.00 25.05 ? 124 LEU A O   1 
ATOM   614  C CB  . LEU A 1 86  ? -3.008  7.237   -0.288  1.00 23.86 ? 124 LEU A CB  1 
ATOM   615  C CG  . LEU A 1 86  ? -3.352  7.203   -1.781  1.00 25.63 ? 124 LEU A CG  1 
ATOM   616  C CD1 . LEU A 1 86  ? -2.452  8.152   -2.519  1.00 23.48 ? 124 LEU A CD1 1 
ATOM   617  C CD2 . LEU A 1 86  ? -3.216  5.784   -2.314  1.00 24.42 ? 124 LEU A CD2 1 
ATOM   618  N N   . TRP A 1 87  ? -2.493  5.994   2.518   1.00 26.33 ? 125 TRP A N   1 
ATOM   619  C CA  . TRP A 1 87  ? -2.199  6.238   3.908   1.00 26.66 ? 125 TRP A CA  1 
ATOM   620  C C   . TRP A 1 87  ? -0.694  6.189   4.115   1.00 27.24 ? 125 TRP A C   1 
ATOM   621  O O   . TRP A 1 87  ? 0.040   5.739   3.247   1.00 25.94 ? 125 TRP A O   1 
ATOM   622  C CB  . TRP A 1 87  ? -2.957  5.256   4.820   1.00 26.89 ? 125 TRP A CB  1 
ATOM   623  C CG  . TRP A 1 87  ? -2.712  3.830   4.512   1.00 26.51 ? 125 TRP A CG  1 
ATOM   624  C CD1 . TRP A 1 87  ? -3.464  3.032   3.727   1.00 27.23 ? 125 TRP A CD1 1 
ATOM   625  C CD2 . TRP A 1 87  ? -1.630  3.026   4.990   1.00 28.93 ? 125 TRP A CD2 1 
ATOM   626  N NE1 . TRP A 1 87  ? -2.928  1.764   3.673   1.00 27.76 ? 125 TRP A NE1 1 
ATOM   627  C CE2 . TRP A 1 87  ? -1.794  1.737   4.437   1.00 27.54 ? 125 TRP A CE2 1 
ATOM   628  C CE3 . TRP A 1 87  ? -0.537  3.270   5.837   1.00 27.64 ? 125 TRP A CE3 1 
ATOM   629  C CZ2 . TRP A 1 87  ? -0.912  0.690   4.702   1.00 28.16 ? 125 TRP A CZ2 1 
ATOM   630  C CZ3 . TRP A 1 87  ? 0.351   2.227   6.092   1.00 28.36 ? 125 TRP A CZ3 1 
ATOM   631  C CH2 . TRP A 1 87  ? 0.153   0.953   5.522   1.00 27.49 ? 125 TRP A CH2 1 
ATOM   632  N N   . SER A 1 88  ? -0.237  6.666   5.261   1.00 27.05 ? 126 SER A N   1 
ATOM   633  C CA  . SER A 1 88  ? 1.162   6.565   5.581   1.00 28.12 ? 126 SER A CA  1 
ATOM   634  C C   . SER A 1 88  ? 1.246   6.483   7.109   1.00 28.74 ? 126 SER A C   1 
ATOM   635  O O   . SER A 1 88  ? 0.745   7.372   7.800   1.00 27.92 ? 126 SER A O   1 
ATOM   636  C CB  . SER A 1 88  ? 1.905   7.796   5.037   1.00 28.94 ? 126 SER A CB  1 
ATOM   637  O OG  . SER A 1 88  ? 3.315   7.596   5.017   1.00 30.19 ? 126 SER A OG  1 
ATOM   638  N N   . ARG A 1 89  ? 1.824   5.398   7.636   1.00 29.35 ? 127 ARG A N   1 
ATOM   639  C CA  . ARG A 1 89  ? 2.072   5.275   9.089   1.00 31.04 ? 127 ARG A CA  1 
ATOM   640  C C   . ARG A 1 89  ? 0.820   5.214   9.969   1.00 31.72 ? 127 ARG A C   1 
ATOM   641  O O   . ARG A 1 89  ? 0.897   5.389   11.199  1.00 32.57 ? 127 ARG A O   1 
ATOM   642  C CB  . ARG A 1 89  ? 2.995   6.406   9.576   1.00 31.21 ? 127 ARG A CB  1 
ATOM   643  C CG  . ARG A 1 89  ? 4.479   6.225   9.219   1.00 33.80 ? 127 ARG A CG  1 
ATOM   644  C CD  . ARG A 1 89  ? 4.767   6.571   7.774   1.00 36.69 ? 127 ARG A CD  1 
ATOM   645  N NE  . ARG A 1 89  ? 6.094   6.139   7.320   1.00 39.56 ? 127 ARG A NE  1 
ATOM   646  C CZ  . ARG A 1 89  ? 7.196   6.882   7.385   1.00 39.50 ? 127 ARG A CZ  1 
ATOM   647  N NH1 . ARG A 1 89  ? 7.157   8.103   7.916   1.00 39.23 ? 127 ARG A NH1 1 
ATOM   648  N NH2 . ARG A 1 89  ? 8.346   6.401   6.919   1.00 40.28 ? 127 ARG A NH2 1 
ATOM   649  N N   . ILE A 1 90  ? -0.329  4.960   9.356   1.00 31.94 ? 128 ILE A N   1 
ATOM   650  C CA  . ILE A 1 90  ? -1.584  4.896   10.091  1.00 32.51 ? 128 ILE A CA  1 
ATOM   651  C C   . ILE A 1 90  ? -2.461  3.777   9.494   1.00 32.73 ? 128 ILE A C   1 
ATOM   652  O O   . ILE A 1 90  ? -3.657  3.957   9.237   1.00 32.64 ? 128 ILE A O   1 
ATOM   653  C CB  . ILE A 1 90  ? -2.287  6.298   10.120  1.00 32.88 ? 128 ILE A CB  1 
ATOM   654  C CG1 . ILE A 1 90  ? -3.448  6.319   11.120  1.00 33.08 ? 128 ILE A CG1 1 
ATOM   655  C CG2 . ILE A 1 90  ? -2.685  6.747   8.698   1.00 33.05 ? 128 ILE A CG2 1 
ATOM   656  C CD1 . ILE A 1 90  ? -3.045  6.746   12.525  1.00 35.00 ? 128 ILE A CD1 1 
ATOM   657  N N   . LYS A 1 91  ? -1.834  2.620   9.280   1.00 32.62 ? 129 LYS A N   1 
ATOM   658  C CA  . LYS A 1 91  ? -2.456  1.487   8.588   1.00 33.16 ? 129 LYS A CA  1 
ATOM   659  C C   . LYS A 1 91  ? -3.747  1.066   9.257   1.00 32.19 ? 129 LYS A C   1 
ATOM   660  O O   . LYS A 1 91  ? -4.753  0.836   8.585   1.00 31.99 ? 129 LYS A O   1 
ATOM   661  C CB  . LYS A 1 91  ? -1.508  0.273   8.577   1.00 33.24 ? 129 LYS A CB  1 
ATOM   662  C CG  . LYS A 1 91  ? -2.147  -1.001  8.026   1.00 35.30 ? 129 LYS A CG  1 
ATOM   663  C CD  . LYS A 1 91  ? -1.365  -2.280  8.379   1.00 34.75 ? 129 LYS A CD  1 
ATOM   664  C CE  . LYS A 1 91  ? -0.186  -2.422  7.472   1.00 38.51 ? 129 LYS A CE  1 
ATOM   665  N NZ  . LYS A 1 91  ? 0.198   -3.843  7.311   1.00 39.11 ? 129 LYS A NZ  1 
ATOM   666  N N   . ASP A 1 92  ? -3.704  0.952   10.582  1.00 31.38 ? 130 ASP A N   1 
ATOM   667  C CA  . ASP A 1 92  ? -4.826  0.413   11.334  1.00 31.50 ? 130 ASP A CA  1 
ATOM   668  C C   . ASP A 1 92  ? -6.075  1.263   11.216  1.00 30.08 ? 130 ASP A C   1 
ATOM   669  O O   . ASP A 1 92  ? -7.131  0.730   10.915  1.00 29.01 ? 130 ASP A O   1 
ATOM   670  C CB  . ASP A 1 92  ? -4.465  0.193   12.804  1.00 32.37 ? 130 ASP A CB  1 
ATOM   671  C CG  . ASP A 1 92  ? -3.873  -1.183  13.055  1.00 36.07 ? 130 ASP A CG  1 
ATOM   672  O OD1 . ASP A 1 92  ? -3.061  -1.650  12.225  1.00 41.45 ? 130 ASP A OD1 1 
ATOM   673  O OD2 . ASP A 1 92  ? -4.231  -1.804  14.078  1.00 41.43 ? 130 ASP A OD2 1 
ATOM   674  N N   . LEU A 1 93  ? -5.960  2.575   11.442  1.00 29.32 ? 131 LEU A N   1 
ATOM   675  C CA  . LEU A 1 93  ? -7.144  3.440   11.316  1.00 29.29 ? 131 LEU A CA  1 
ATOM   676  C C   . LEU A 1 93  ? -7.661  3.426   9.873   1.00 28.51 ? 131 LEU A C   1 
ATOM   677  O O   . LEU A 1 93  ? -8.872  3.343   9.640   1.00 28.66 ? 131 LEU A O   1 
ATOM   678  C CB  . LEU A 1 93  ? -6.873  4.877   11.771  1.00 29.57 ? 131 LEU A CB  1 
ATOM   679  C CG  . LEU A 1 93  ? -8.077  5.766   12.149  1.00 31.35 ? 131 LEU A CG  1 
ATOM   680  C CD1 . LEU A 1 93  ? -7.618  7.181   12.446  1.00 30.54 ? 131 LEU A CD1 1 
ATOM   681  C CD2 . LEU A 1 93  ? -9.176  5.836   11.112  1.00 35.22 ? 131 LEU A CD2 1 
ATOM   682  N N   . ALA A 1 94  ? -6.745  3.506   8.916   1.00 28.10 ? 132 ALA A N   1 
ATOM   683  C CA  . ALA A 1 94  ? -7.120  3.482   7.500   1.00 27.83 ? 132 ALA A CA  1 
ATOM   684  C C   . ALA A 1 94  ? -7.982  2.260   7.161   1.00 27.86 ? 132 ALA A C   1 
ATOM   685  O O   . ALA A 1 94  ? -9.008  2.376   6.487   1.00 27.71 ? 132 ALA A O   1 
ATOM   686  C CB  . ALA A 1 94  ? -5.889  3.541   6.623   1.00 27.94 ? 132 ALA A CB  1 
ATOM   687  N N   . HIS A 1 95  ? -7.574  1.092   7.646   1.00 27.80 ? 133 HIS A N   1 
ATOM   688  C CA  . HIS A 1 95  ? -8.327  -0.130  7.394   1.00 27.96 ? 133 HIS A CA  1 
ATOM   689  C C   . HIS A 1 95  ? -9.621  -0.232  8.179   1.00 27.91 ? 133 HIS A C   1 
ATOM   690  O O   . HIS A 1 95  ? -10.631 -0.680  7.639   1.00 27.91 ? 133 HIS A O   1 
ATOM   691  C CB  . HIS A 1 95  ? -7.446  -1.352  7.616   1.00 28.17 ? 133 HIS A CB  1 
ATOM   692  C CG  . HIS A 1 95  ? -6.321  -1.447  6.638   1.00 28.52 ? 133 HIS A CG  1 
ATOM   693  N ND1 . HIS A 1 95  ? -5.185  -2.188  6.874   1.00 30.67 ? 133 HIS A ND1 1 
ATOM   694  C CD2 . HIS A 1 95  ? -6.169  -0.903  5.406   1.00 28.59 ? 133 HIS A CD2 1 
ATOM   695  C CE1 . HIS A 1 95  ? -4.377  -2.087  5.831   1.00 31.56 ? 133 HIS A CE1 1 
ATOM   696  N NE2 . HIS A 1 95  ? -4.947  -1.303  4.934   1.00 29.94 ? 133 HIS A NE2 1 
ATOM   697  N N   . GLN A 1 96  ? -9.594  0.178   9.449   1.00 27.49 ? 134 GLN A N   1 
ATOM   698  C CA  . GLN A 1 96  ? -10.814 0.246   10.252  1.00 27.86 ? 134 GLN A CA  1 
ATOM   699  C C   . GLN A 1 96  ? -11.827 1.124   9.539   1.00 27.35 ? 134 GLN A C   1 
ATOM   700  O O   . GLN A 1 96  ? -13.013 0.816   9.481   1.00 26.98 ? 134 GLN A O   1 
ATOM   701  C CB  . GLN A 1 96  ? -10.506 0.829   11.629  1.00 27.94 ? 134 GLN A CB  1 
ATOM   702  C CG  . GLN A 1 96  ? -9.868  -0.167  12.583  1.00 30.63 ? 134 GLN A CG  1 
ATOM   703  C CD  . GLN A 1 96  ? -9.117  0.498   13.742  1.00 33.89 ? 134 GLN A CD  1 
ATOM   704  O OE1 . GLN A 1 96  ? -8.287  -0.136  14.385  1.00 35.96 ? 134 GLN A OE1 1 
ATOM   705  N NE2 . GLN A 1 96  ? -9.396  1.773   13.996  1.00 34.07 ? 134 GLN A NE2 1 
ATOM   706  N N   . PHE A 1 97  ? -11.333 2.218   8.980   1.00 27.30 ? 135 PHE A N   1 
ATOM   707  C CA  . PHE A 1 97  ? -12.182 3.140   8.248   1.00 27.74 ? 135 PHE A CA  1 
ATOM   708  C C   . PHE A 1 97  ? -12.826 2.475   7.007   1.00 27.94 ? 135 PHE A C   1 
ATOM   709  O O   . PHE A 1 97  ? -14.041 2.543   6.831   1.00 28.55 ? 135 PHE A O   1 
ATOM   710  C CB  . PHE A 1 97  ? -11.402 4.413   7.879   1.00 27.18 ? 135 PHE A CB  1 
ATOM   711  C CG  . PHE A 1 97  ? -12.158 5.327   6.968   1.00 28.30 ? 135 PHE A CG  1 
ATOM   712  C CD1 . PHE A 1 97  ? -11.913 5.315   5.599   1.00 27.56 ? 135 PHE A CD1 1 
ATOM   713  C CD2 . PHE A 1 97  ? -13.137 6.174   7.468   1.00 28.36 ? 135 PHE A CD2 1 
ATOM   714  C CE1 . PHE A 1 97  ? -12.638 6.146   4.737   1.00 29.22 ? 135 PHE A CE1 1 
ATOM   715  C CE2 . PHE A 1 97  ? -13.858 7.003   6.619   1.00 29.51 ? 135 PHE A CE2 1 
ATOM   716  C CZ  . PHE A 1 97  ? -13.604 6.985   5.245   1.00 28.11 ? 135 PHE A CZ  1 
ATOM   717  N N   . THR A 1 98  ? -12.032 1.818   6.165   1.00 28.29 ? 136 THR A N   1 
ATOM   718  C CA  . THR A 1 98  ? -12.611 1.175   4.963   1.00 29.02 ? 136 THR A CA  1 
ATOM   719  C C   . THR A 1 98  ? -13.435 -0.080  5.286   1.00 29.89 ? 136 THR A C   1 
ATOM   720  O O   . THR A 1 98  ? -14.314 -0.465  4.508   1.00 30.21 ? 136 THR A O   1 
ATOM   721  C CB  . THR A 1 98  ? -11.560 0.877   3.868   1.00 28.72 ? 136 THR A CB  1 
ATOM   722  O OG1 . THR A 1 98  ? -10.537 0.026   4.400   1.00 27.02 ? 136 THR A OG1 1 
ATOM   723  C CG2 . THR A 1 98  ? -10.917 2.200   3.368   1.00 28.24 ? 136 THR A CG2 1 
ATOM   724  N N   . GLN A 1 99  ? -13.180 -0.708  6.435   1.00 30.88 ? 137 GLN A N   1 
ATOM   725  C CA  . GLN A 1 99  ? -14.006 -1.853  6.842   1.00 32.19 ? 137 GLN A CA  1 
ATOM   726  C C   . GLN A 1 99  ? -15.441 -1.415  7.107   1.00 32.68 ? 137 GLN A C   1 
ATOM   727  O O   . GLN A 1 99  ? -16.379 -2.201  7.003   1.00 32.79 ? 137 GLN A O   1 
ATOM   728  C CB  . GLN A 1 99  ? -13.419 -2.576  8.066   1.00 32.63 ? 137 GLN A CB  1 
ATOM   729  C CG  . GLN A 1 99  ? -12.295 -3.551  7.731   1.00 35.03 ? 137 GLN A CG  1 
ATOM   730  C CD  . GLN A 1 99  ? -12.704 -4.618  6.706   1.00 39.24 ? 137 GLN A CD  1 
ATOM   731  O OE1 . GLN A 1 99  ? -13.745 -5.269  6.842   1.00 42.47 ? 137 GLN A OE1 1 
ATOM   732  N NE2 . GLN A 1 99  ? -11.880 -4.803  5.686   1.00 41.15 ? 137 GLN A NE2 1 
ATOM   733  N N   . VAL A 1 100 ? -15.592 -0.140  7.432   1.00 33.35 ? 138 VAL A N   1 
ATOM   734  C CA  . VAL A 1 100 ? -16.874 0.432   7.777   1.00 34.30 ? 138 VAL A CA  1 
ATOM   735  C C   . VAL A 1 100 ? -17.401 1.285   6.627   1.00 34.37 ? 138 VAL A C   1 
ATOM   736  O O   . VAL A 1 100 ? -18.575 1.191   6.277   1.00 34.46 ? 138 VAL A O   1 
ATOM   737  C CB  . VAL A 1 100 ? -16.777 1.227   9.104   1.00 34.29 ? 138 VAL A CB  1 
ATOM   738  C CG1 . VAL A 1 100 ? -18.037 2.033   9.348   1.00 34.86 ? 138 VAL A CG1 1 
ATOM   739  C CG2 . VAL A 1 100 ? -16.537 0.259   10.262  1.00 35.00 ? 138 VAL A CG2 1 
ATOM   740  N N   . GLN A 1 101 ? -16.524 2.097   6.041   1.00 34.65 ? 139 GLN A N   1 
ATOM   741  C CA  . GLN A 1 101 ? -16.841 2.886   4.849   1.00 35.03 ? 139 GLN A CA  1 
ATOM   742  C C   . GLN A 1 101 ? -16.465 2.069   3.611   1.00 35.18 ? 139 GLN A C   1 
ATOM   743  O O   . GLN A 1 101 ? -15.421 2.301   2.977   1.00 35.13 ? 139 GLN A O   1 
ATOM   744  C CB  . GLN A 1 101 ? -16.086 4.224   4.875   1.00 35.16 ? 139 GLN A CB  1 
ATOM   745  C CG  . GLN A 1 101 ? -16.581 5.258   3.875   1.00 35.75 ? 139 GLN A CG  1 
ATOM   746  C CD  . GLN A 1 101 ? -17.986 5.717   4.178   1.00 37.82 ? 139 GLN A CD  1 
ATOM   747  O OE1 . GLN A 1 101 ? -18.318 6.021   5.327   1.00 39.83 ? 139 GLN A OE1 1 
ATOM   748  N NE2 . GLN A 1 101 ? -18.833 5.751   3.154   1.00 37.16 ? 139 GLN A NE2 1 
ATOM   749  N N   . ARG A 1 102 ? -17.324 1.114   3.271   1.00 35.29 ? 140 ARG A N   1 
ATOM   750  C CA  . ARG A 1 102 ? -17.011 0.085   2.279   1.00 36.04 ? 140 ARG A CA  1 
ATOM   751  C C   . ARG A 1 102 ? -16.992 0.616   0.850   1.00 36.02 ? 140 ARG A C   1 
ATOM   752  O O   . ARG A 1 102 ? -16.599 -0.096  -0.075  1.00 35.69 ? 140 ARG A O   1 
ATOM   753  C CB  . ARG A 1 102 ? -17.997 -1.066  2.395   1.00 36.59 ? 140 ARG A CB  1 
ATOM   754  C CG  . ARG A 1 102 ? -17.842 -1.871  3.665   1.00 38.73 ? 140 ARG A CG  1 
ATOM   755  C CD  . ARG A 1 102 ? -17.061 -3.113  3.373   1.00 42.07 ? 140 ARG A CD  1 
ATOM   756  N NE  . ARG A 1 102 ? -16.953 -3.968  4.541   1.00 43.12 ? 140 ARG A NE  1 
ATOM   757  C CZ  . ARG A 1 102 ? -16.126 -4.999  4.625   1.00 45.05 ? 140 ARG A CZ  1 
ATOM   758  N NH1 . ARG A 1 102 ? -15.342 -5.313  3.599   1.00 44.81 ? 140 ARG A NH1 1 
ATOM   759  N NH2 . ARG A 1 102 ? -16.086 -5.722  5.736   1.00 46.59 ? 140 ARG A NH2 1 
ATOM   760  N N   . ASP A 1 103 ? -17.444 1.861   0.729   1.00 35.99 ? 141 ASP A N   1 
ATOM   761  C CA  . ASP A 1 103 ? -17.360 2.759   -0.422  1.00 37.06 ? 141 ASP A CA  1 
ATOM   762  C C   . ASP A 1 103 ? -15.898 3.008   -0.864  1.00 36.79 ? 141 ASP A C   1 
ATOM   763  O O   . ASP A 1 103 ? -15.598 3.114   -2.060  1.00 37.03 ? 141 ASP A O   1 
ATOM   764  C CB  . ASP A 1 103 ? -17.995 4.099   0.044   1.00 37.81 ? 141 ASP A CB  1 
ATOM   765  C CG  . ASP A 1 103 ? -18.161 5.121   -1.069  1.00 40.99 ? 141 ASP A CG  1 
ATOM   766  O OD1 . ASP A 1 103 ? -17.334 6.067   -1.168  1.00 44.17 ? 141 ASP A OD1 1 
ATOM   767  O OD2 . ASP A 1 103 ? -19.147 5.009   -1.827  1.00 46.60 ? 141 ASP A OD2 1 
ATOM   768  N N   . MET A 1 104 ? -14.995 3.088   0.110   1.00 35.47 ? 142 MET A N   1 
ATOM   769  C CA  . MET A 1 104 ? -13.621 3.493   -0.145  1.00 35.34 ? 142 MET A CA  1 
ATOM   770  C C   . MET A 1 104 ? -12.622 2.333   0.004   1.00 33.20 ? 142 MET A C   1 
ATOM   771  O O   . MET A 1 104 ? -12.897 1.349   0.688   1.00 32.74 ? 142 MET A O   1 
ATOM   772  C CB  . MET A 1 104 ? -13.259 4.692   0.721   1.00 35.04 ? 142 MET A CB  1 
ATOM   773  C CG  . MET A 1 104 ? -13.876 6.056   0.243   1.00 35.50 ? 142 MET A CG  1 
ATOM   774  S SD  . MET A 1 104 ? -13.288 7.350   1.358   1.00 42.03 ? 142 MET A SD  1 
ATOM   775  C CE  . MET A 1 104 ? -14.056 8.883   0.739   1.00 38.69 ? 142 MET A CE  1 
ATOM   776  N N   . PHE A 1 105 ? -11.483 2.468   -0.671  1.00 31.55 ? 143 PHE A N   1 
ATOM   777  C CA  . PHE A 1 105 ? -10.522 1.390   -0.859  1.00 30.47 ? 143 PHE A CA  1 
ATOM   778  C C   . PHE A 1 105 ? -9.137  1.866   -0.520  1.00 28.63 ? 143 PHE A C   1 
ATOM   779  O O   . PHE A 1 105 ? -8.656  2.855   -1.085  1.00 27.92 ? 143 PHE A O   1 
ATOM   780  C CB  . PHE A 1 105 ? -10.479 0.965   -2.334  1.00 31.34 ? 143 PHE A CB  1 
ATOM   781  C CG  . PHE A 1 105 ? -11.644 0.135   -2.763  1.00 33.94 ? 143 PHE A CG  1 
ATOM   782  C CD1 . PHE A 1 105 ? -11.463 -1.209  -3.095  1.00 38.21 ? 143 PHE A CD1 1 
ATOM   783  C CD2 . PHE A 1 105 ? -12.918 0.685   -2.843  1.00 37.25 ? 143 PHE A CD2 1 
ATOM   784  C CE1 . PHE A 1 105 ? -12.537 -1.992  -3.496  1.00 38.37 ? 143 PHE A CE1 1 
ATOM   785  C CE2 . PHE A 1 105 ? -14.004 -0.097  -3.236  1.00 37.81 ? 143 PHE A CE2 1 
ATOM   786  C CZ  . PHE A 1 105 ? -13.807 -1.433  -3.563  1.00 36.91 ? 143 PHE A CZ  1 
ATOM   787  N N   . THR A 1 106 ? -8.482  1.155   0.384   1.00 27.33 ? 144 THR A N   1 
ATOM   788  C CA  . THR A 1 106 ? -7.051  1.279   0.487   1.00 25.87 ? 144 THR A CA  1 
ATOM   789  C C   . THR A 1 106 ? -6.497  0.209   -0.433  1.00 25.30 ? 144 THR A C   1 
ATOM   790  O O   . THR A 1 106 ? -7.226  -0.663  -0.933  1.00 24.44 ? 144 THR A O   1 
ATOM   791  C CB  . THR A 1 106 ? -6.524  0.982   1.886   1.00 26.30 ? 144 THR A CB  1 
ATOM   792  O OG1 . THR A 1 106 ? -6.833  -0.381  2.222   1.00 27.07 ? 144 THR A OG1 1 
ATOM   793  C CG2 . THR A 1 106 ? -7.109  1.958   2.930   1.00 24.47 ? 144 THR A CG2 1 
ATOM   794  N N   . LEU A 1 107 ? -5.188  0.248   -0.606  1.00 24.60 ? 145 LEU A N   1 
ATOM   795  C CA  . LEU A 1 107 ? -4.508  -0.757  -1.405  1.00 25.14 ? 145 LEU A CA  1 
ATOM   796  C C   . LEU A 1 107 ? -4.754  -2.154  -0.848  1.00 24.55 ? 145 LEU A C   1 
ATOM   797  O O   . LEU A 1 107 ? -4.866  -3.123  -1.592  1.00 24.21 ? 145 LEU A O   1 
ATOM   798  C CB  . LEU A 1 107 ? -3.014  -0.464  -1.409  1.00 24.74 ? 145 LEU A CB  1 
ATOM   799  C CG  . LEU A 1 107 ? -2.105  -1.489  -2.075  1.00 25.52 ? 145 LEU A CG  1 
ATOM   800  C CD1 . LEU A 1 107 ? -2.519  -1.712  -3.537  1.00 25.26 ? 145 LEU A CD1 1 
ATOM   801  C CD2 . LEU A 1 107 ? -0.685  -0.972  -1.969  1.00 24.71 ? 145 LEU A CD2 1 
ATOM   802  N N   . GLU A 1 108 ? -4.848  -2.250  0.470   1.00 24.57 ? 146 GLU A N   1 
ATOM   803  C CA  . GLU A 1 108 ? -5.010  -3.549  1.118   1.00 24.90 ? 146 GLU A CA  1 
ATOM   804  C C   . GLU A 1 108 ? -6.465  -4.020  1.045   1.00 25.30 ? 146 GLU A C   1 
ATOM   805  O O   . GLU A 1 108 ? -6.820  -5.084  1.542   1.00 25.83 ? 146 GLU A O   1 
ATOM   806  C CB  . GLU A 1 108 ? -4.469  -3.495  2.564   1.00 24.96 ? 146 GLU A CB  1 
ATOM   807  C CG  . GLU A 1 108 ? -2.983  -3.090  2.631   1.00 24.55 ? 146 GLU A CG  1 
ATOM   808  C CD  . GLU A 1 108 ? -2.744  -1.607  2.381   1.00 26.97 ? 146 GLU A CD  1 
ATOM   809  O OE1 . GLU A 1 108 ? -3.631  -0.791  2.698   1.00 25.08 ? 146 GLU A OE1 1 
ATOM   810  O OE2 . GLU A 1 108 ? -1.657  -1.245  1.890   1.00 28.84 ? 146 GLU A OE2 1 
ATOM   811  N N   . ASP A 1 109 ? -7.317  -3.217  0.415   1.00 25.36 ? 147 ASP A N   1 
ATOM   812  C CA  . ASP A 1 109 ? -8.681  -3.642  0.120   1.00 25.67 ? 147 ASP A CA  1 
ATOM   813  C C   . ASP A 1 109 ? -8.835  -4.161  -1.311  1.00 25.48 ? 147 ASP A C   1 
ATOM   814  O O   . ASP A 1 109 ? -9.935  -4.565  -1.707  1.00 25.12 ? 147 ASP A O   1 
ATOM   815  C CB  . ASP A 1 109 ? -9.681  -2.504  0.370   1.00 25.97 ? 147 ASP A CB  1 
ATOM   816  C CG  . ASP A 1 109 ? -9.734  -2.093  1.835   1.00 27.48 ? 147 ASP A CG  1 
ATOM   817  O OD1 . ASP A 1 109 ? -9.446  -0.913  2.131   1.00 26.87 ? 147 ASP A OD1 1 
ATOM   818  O OD2 . ASP A 1 109 ? -10.037 -2.960  2.683   1.00 26.52 ? 147 ASP A OD2 1 
ATOM   819  N N   . THR A 1 110 ? -7.747  -4.115  -2.083  1.00 25.18 ? 148 THR A N   1 
ATOM   820  C CA  . THR A 1 110 ? -7.702  -4.805  -3.388  1.00 25.46 ? 148 THR A CA  1 
ATOM   821  C C   . THR A 1 110 ? -7.161  -6.204  -3.146  1.00 25.68 ? 148 THR A C   1 
ATOM   822  O O   . THR A 1 110 ? -6.551  -6.450  -2.120  1.00 25.21 ? 148 THR A O   1 
ATOM   823  C CB  . THR A 1 110 ? -6.783  -4.091  -4.394  1.00 24.68 ? 148 THR A CB  1 
ATOM   824  O OG1 . THR A 1 110 ? -5.416  -4.216  -3.975  1.00 24.85 ? 148 THR A OG1 1 
ATOM   825  C CG2 . THR A 1 110 ? -7.148  -2.603  -4.506  1.00 26.07 ? 148 THR A CG2 1 
ATOM   826  N N   . LEU A 1 111 ? -7.365  -7.109  -4.095  1.00 25.25 ? 149 LEU A N   1 
ATOM   827  C CA  . LEU A 1 111 ? -6.938  -8.491  -3.923  1.00 25.61 ? 149 LEU A CA  1 
ATOM   828  C C   . LEU A 1 111 ? -5.463  -8.553  -3.549  1.00 25.79 ? 149 LEU A C   1 
ATOM   829  O O   . LEU A 1 111 ? -5.104  -9.147  -2.531  1.00 26.82 ? 149 LEU A O   1 
ATOM   830  C CB  . LEU A 1 111 ? -7.211  -9.311  -5.191  1.00 25.16 ? 149 LEU A CB  1 
ATOM   831  C CG  . LEU A 1 111 ? -6.717  -10.773 -5.198  1.00 24.75 ? 149 LEU A CG  1 
ATOM   832  C CD1 . LEU A 1 111 ? -7.338  -11.570 -4.056  1.00 23.83 ? 149 LEU A CD1 1 
ATOM   833  C CD2 . LEU A 1 111 ? -7.027  -11.443 -6.523  1.00 25.23 ? 149 LEU A CD2 1 
ATOM   834  N N   . LEU A 1 112 ? -4.623  -7.903  -4.344  1.00 26.38 ? 150 LEU A N   1 
ATOM   835  C CA  . LEU A 1 112 ? -3.175  -8.032  -4.187  1.00 25.80 ? 150 LEU A CA  1 
ATOM   836  C C   . LEU A 1 112 ? -2.679  -7.443  -2.893  1.00 25.72 ? 150 LEU A C   1 
ATOM   837  O O   . LEU A 1 112 ? -1.834  -8.044  -2.236  1.00 25.43 ? 150 LEU A O   1 
ATOM   838  C CB  . LEU A 1 112 ? -2.442  -7.407  -5.367  1.00 26.71 ? 150 LEU A CB  1 
ATOM   839  C CG  . LEU A 1 112 ? -2.779  -8.120  -6.677  1.00 28.37 ? 150 LEU A CG  1 
ATOM   840  C CD1 . LEU A 1 112 ? -2.134  -7.431  -7.841  1.00 30.73 ? 150 LEU A CD1 1 
ATOM   841  C CD2 . LEU A 1 112 ? -2.403  -9.597  -6.616  1.00 30.23 ? 150 LEU A CD2 1 
ATOM   842  N N   . GLY A 1 113 ? -3.179  -6.262  -2.532  1.00 24.73 ? 151 GLY A N   1 
ATOM   843  C CA  . GLY A 1 113 ? -2.808  -5.673  -1.255  1.00 25.06 ? 151 GLY A CA  1 
ATOM   844  C C   . GLY A 1 113 ? -3.304  -6.506  -0.081  1.00 24.69 ? 151 GLY A C   1 
ATOM   845  O O   . GLY A 1 113 ? -2.621  -6.631  0.935   1.00 26.02 ? 151 GLY A O   1 
ATOM   846  N N   . TYR A 1 114 ? -4.492  -7.082  -0.211  1.00 24.77 ? 152 TYR A N   1 
ATOM   847  C CA  . TYR A 1 114 ? -5.061  -7.898  0.847   1.00 25.06 ? 152 TYR A CA  1 
ATOM   848  C C   . TYR A 1 114 ? -4.265  -9.184  1.049   1.00 25.07 ? 152 TYR A C   1 
ATOM   849  O O   . TYR A 1 114 ? -4.103  -9.646  2.182   1.00 25.02 ? 152 TYR A O   1 
ATOM   850  C CB  . TYR A 1 114 ? -6.502  -8.250  0.509   1.00 26.23 ? 152 TYR A CB  1 
ATOM   851  C CG  . TYR A 1 114 ? -7.213  -9.092  1.545   1.00 28.39 ? 152 TYR A CG  1 
ATOM   852  C CD1 . TYR A 1 114 ? -7.374  -10.468 1.368   1.00 29.26 ? 152 TYR A CD1 1 
ATOM   853  C CD2 . TYR A 1 114 ? -7.770  -8.501  2.682   1.00 30.22 ? 152 TYR A CD2 1 
ATOM   854  C CE1 . TYR A 1 114 ? -8.060  -11.242 2.314   1.00 30.40 ? 152 TYR A CE1 1 
ATOM   855  C CE2 . TYR A 1 114 ? -8.459  -9.262  3.633   1.00 31.27 ? 152 TYR A CE2 1 
ATOM   856  C CZ  . TYR A 1 114 ? -8.591  -10.632 3.447   1.00 30.56 ? 152 TYR A CZ  1 
ATOM   857  O OH  . TYR A 1 114 ? -9.275  -11.384 4.383   1.00 31.54 ? 152 TYR A OH  1 
ATOM   858  N N   . LEU A 1 115 ? -3.778  -9.751  -0.053  1.00 24.47 ? 153 LEU A N   1 
ATOM   859  C CA  . LEU A 1 115 ? -3.025  -11.010 -0.019  1.00 25.76 ? 153 LEU A CA  1 
ATOM   860  C C   . LEU A 1 115 ? -1.758  -10.831 0.795   1.00 25.14 ? 153 LEU A C   1 
ATOM   861  O O   . LEU A 1 115 ? -1.384  -11.701 1.567   1.00 25.19 ? 153 LEU A O   1 
ATOM   862  C CB  . LEU A 1 115 ? -2.641  -11.454 -1.436  1.00 24.90 ? 153 LEU A CB  1 
ATOM   863  C CG  . LEU A 1 115 ? -3.754  -11.909 -2.356  1.00 27.34 ? 153 LEU A CG  1 
ATOM   864  C CD1 . LEU A 1 115 ? -3.177  -12.415 -3.691  1.00 27.40 ? 153 LEU A CD1 1 
ATOM   865  C CD2 . LEU A 1 115 ? -4.585  -12.970 -1.670  1.00 27.65 ? 153 LEU A CD2 1 
ATOM   866  N N   . ALA A 1 116 ? -1.132  -9.674  0.637   1.00 25.37 ? 154 ALA A N   1 
ATOM   867  C CA  . ALA A 1 116 ? 0.236   -9.463  1.105   1.00 25.30 ? 154 ALA A CA  1 
ATOM   868  C C   . ALA A 1 116 ? 0.349   -8.703  2.423   1.00 26.02 ? 154 ALA A C   1 
ATOM   869  O O   . ALA A 1 116 ? 1.410   -8.708  3.044   1.00 25.11 ? 154 ALA A O   1 
ATOM   870  C CB  . ALA A 1 116 ? 1.046   -8.753  0.027   1.00 24.95 ? 154 ALA A CB  1 
ATOM   871  N N   . ASP A 1 117 ? -0.725  -8.031  2.827   1.00 26.29 ? 155 ASP A N   1 
ATOM   872  C CA  . ASP A 1 117 ? -0.689  -7.158  4.006   1.00 27.49 ? 155 ASP A CA  1 
ATOM   873  C C   . ASP A 1 117 ? -0.167  -7.858  5.257   1.00 27.60 ? 155 ASP A C   1 
ATOM   874  O O   . ASP A 1 117 ? -0.644  -8.926  5.616   1.00 27.57 ? 155 ASP A O   1 
ATOM   875  C CB  . ASP A 1 117 ? -2.069  -6.578  4.293   1.00 28.09 ? 155 ASP A CB  1 
ATOM   876  C CG  . ASP A 1 117 ? -2.013  -5.363  5.209   1.00 30.33 ? 155 ASP A CG  1 
ATOM   877  O OD1 . ASP A 1 117 ? -3.025  -5.089  5.875   1.00 34.31 ? 155 ASP A OD1 1 
ATOM   878  O OD2 . ASP A 1 117 ? -0.968  -4.679  5.252   1.00 32.75 ? 155 ASP A OD2 1 
ATOM   879  N N   . ASP A 1 118 ? 0.812   -7.232  5.899   1.00 28.27 ? 156 ASP A N   1 
ATOM   880  C CA  . ASP A 1 118 ? 1.473   -7.736  7.114   1.00 29.02 ? 156 ASP A CA  1 
ATOM   881  C C   . ASP A 1 118 ? 2.289   -8.996  6.918   1.00 28.56 ? 156 ASP A C   1 
ATOM   882  O O   . ASP A 1 118 ? 2.733   -9.592  7.891   1.00 29.54 ? 156 ASP A O   1 
ATOM   883  C CB  . ASP A 1 118 ? 0.477   -7.952  8.256   1.00 29.85 ? 156 ASP A CB  1 
ATOM   884  C CG  . ASP A 1 118 ? -0.195  -6.675  8.667   1.00 33.33 ? 156 ASP A CG  1 
ATOM   885  O OD1 . ASP A 1 118 ? 0.513   -5.664  8.849   1.00 37.91 ? 156 ASP A OD1 1 
ATOM   886  O OD2 . ASP A 1 118 ? -1.431  -6.674  8.790   1.00 38.17 ? 156 ASP A OD2 1 
ATOM   887  N N   . LEU A 1 119 ? 2.479   -9.419  5.676   1.00 27.44 ? 157 LEU A N   1 
ATOM   888  C CA  . LEU A 1 119 ? 3.294   -10.600 5.442   1.00 26.99 ? 157 LEU A CA  1 
ATOM   889  C C   . LEU A 1 119 ? 4.687   -10.211 4.967   1.00 26.61 ? 157 LEU A C   1 
ATOM   890  O O   . LEU A 1 119 ? 4.886   -9.134  4.410   1.00 26.56 ? 157 LEU A O   1 
ATOM   891  C CB  . LEU A 1 119 ? 2.620   -11.555 4.447   1.00 26.73 ? 157 LEU A CB  1 
ATOM   892  C CG  . LEU A 1 119 ? 1.176   -11.950 4.786   1.00 27.34 ? 157 LEU A CG  1 
ATOM   893  C CD1 . LEU A 1 119 ? 0.643   -12.906 3.747   1.00 25.98 ? 157 LEU A CD1 1 
ATOM   894  C CD2 . LEU A 1 119 ? 1.039   -12.564 6.191   1.00 27.11 ? 157 LEU A CD2 1 
ATOM   895  N N   . THR A 1 120 ? 5.633   -11.113 5.214   1.00 26.26 ? 158 THR A N   1 
ATOM   896  C CA  . THR A 1 120 ? 6.994   -11.035 4.706   1.00 26.26 ? 158 THR A CA  1 
ATOM   897  C C   . THR A 1 120 ? 7.243   -12.320 3.938   1.00 25.23 ? 158 THR A C   1 
ATOM   898  O O   . THR A 1 120 ? 6.747   -13.381 4.325   1.00 25.00 ? 158 THR A O   1 
ATOM   899  C CB  . THR A 1 120 ? 7.992   -10.944 5.868   1.00 26.60 ? 158 THR A CB  1 
ATOM   900  O OG1 . THR A 1 120 ? 7.663   -9.794  6.644   1.00 28.33 ? 158 THR A OG1 1 
ATOM   901  C CG2 . THR A 1 120 ? 9.444   -10.826 5.361   1.00 27.21 ? 158 THR A CG2 1 
ATOM   902  N N   . TRP A 1 121 ? 7.989   -12.222 2.842   1.00 24.62 ? 159 TRP A N   1 
ATOM   903  C CA  . TRP A 1 121 ? 8.351   -13.406 2.058   1.00 24.24 ? 159 TRP A CA  1 
ATOM   904  C C   . TRP A 1 121 ? 9.631   -13.134 1.300   1.00 24.12 ? 159 TRP A C   1 
ATOM   905  O O   . TRP A 1 121 ? 9.926   -11.997 0.950   1.00 23.44 ? 159 TRP A O   1 
ATOM   906  C CB  . TRP A 1 121 ? 7.247   -13.799 1.067   1.00 23.37 ? 159 TRP A CB  1 
ATOM   907  C CG  . TRP A 1 121 ? 6.987   -12.721 0.039   1.00 23.31 ? 159 TRP A CG  1 
ATOM   908  C CD1 . TRP A 1 121 ? 7.526   -12.633 -1.226  1.00 23.31 ? 159 TRP A CD1 1 
ATOM   909  C CD2 . TRP A 1 121 ? 6.165   -11.565 0.207   1.00 22.54 ? 159 TRP A CD2 1 
ATOM   910  N NE1 . TRP A 1 121 ? 7.067   -11.497 -1.856  1.00 23.40 ? 159 TRP A NE1 1 
ATOM   911  C CE2 . TRP A 1 121 ? 6.231   -10.824 -1.002  1.00 24.02 ? 159 TRP A CE2 1 
ATOM   912  C CE3 . TRP A 1 121 ? 5.353   -11.090 1.251   1.00 21.90 ? 159 TRP A CE3 1 
ATOM   913  C CZ2 . TRP A 1 121 ? 5.531   -9.625  -1.186  1.00 21.69 ? 159 TRP A CZ2 1 
ATOM   914  C CZ3 . TRP A 1 121 ? 4.664   -9.887  1.065   1.00 23.15 ? 159 TRP A CZ3 1 
ATOM   915  C CH2 . TRP A 1 121 ? 4.761   -9.172  -0.147  1.00 22.86 ? 159 TRP A CH2 1 
ATOM   916  N N   . CYS A 1 122 ? 10.397  -14.188 1.069   1.00 24.15 ? 160 CYS A N   1 
ATOM   917  C CA  . CYS A 1 122 ? 11.539  -14.108 0.180   1.00 24.80 ? 160 CYS A CA  1 
ATOM   918  C C   . CYS A 1 122 ? 11.949  -15.522 -0.143  1.00 24.85 ? 160 CYS A C   1 
ATOM   919  O O   . CYS A 1 122 ? 11.535  -16.463 0.531   1.00 24.44 ? 160 CYS A O   1 
ATOM   920  C CB  . CYS A 1 122 ? 12.703  -13.341 0.819   1.00 25.12 ? 160 CYS A CB  1 
ATOM   921  S SG  . CYS A 1 122 ? 13.347  -14.105 2.314   1.00 26.97 ? 160 CYS A SG  1 
ATOM   922  N N   . GLY A 1 123 ? 12.730  -15.667 -1.204  1.00 25.52 ? 161 GLY A N   1 
ATOM   923  C CA  . GLY A 1 123 ? 13.253  -16.957 -1.582  1.00 26.43 ? 161 GLY A CA  1 
ATOM   924  C C   . GLY A 1 123 ? 14.757  -16.886 -1.487  1.00 27.87 ? 161 GLY A C   1 
ATOM   925  O O   . GLY A 1 123 ? 15.307  -15.992 -0.837  1.00 27.05 ? 161 GLY A O   1 
ATOM   926  N N   . GLU A 1 124 ? 15.417  -17.834 -2.143  1.00 29.52 ? 162 GLU A N   1 
ATOM   927  C CA  . GLU A 1 124 ? 16.873  -17.919 -2.167  1.00 31.95 ? 162 GLU A CA  1 
ATOM   928  C C   . GLU A 1 124 ? 17.277  -18.111 -3.604  1.00 32.74 ? 162 GLU A C   1 
ATOM   929  O O   . GLU A 1 124 ? 16.538  -18.724 -4.372  1.00 32.72 ? 162 GLU A O   1 
ATOM   930  C CB  . GLU A 1 124 ? 17.340  -19.129 -1.362  1.00 32.05 ? 162 GLU A CB  1 
ATOM   931  C CG  . GLU A 1 124 ? 16.649  -19.276 -0.028  1.00 35.78 ? 162 GLU A CG  1 
ATOM   932  C CD  . GLU A 1 124 ? 17.145  -20.455 0.780   1.00 39.78 ? 162 GLU A CD  1 
ATOM   933  O OE1 . GLU A 1 124 ? 18.377  -20.669 0.856   1.00 43.17 ? 162 GLU A OE1 1 
ATOM   934  O OE2 . GLU A 1 124 ? 16.293  -21.158 1.358   1.00 43.32 ? 162 GLU A OE2 1 
ATOM   935  N N   . PHE A 1 125 ? 18.441  -17.603 -3.984  1.00 34.05 ? 163 PHE A N   1 
ATOM   936  C CA  . PHE A 1 125 ? 18.893  -17.810 -5.351  1.00 36.02 ? 163 PHE A CA  1 
ATOM   937  C C   . PHE A 1 125 ? 19.159  -19.297 -5.638  1.00 36.88 ? 163 PHE A C   1 
ATOM   938  O O   . PHE A 1 125 ? 18.652  -19.850 -6.615  1.00 37.80 ? 163 PHE A O   1 
ATOM   939  C CB  . PHE A 1 125 ? 20.125  -16.960 -5.690  1.00 36.29 ? 163 PHE A CB  1 
ATOM   940  C CG  . PHE A 1 125 ? 20.676  -17.231 -7.069  1.00 38.02 ? 163 PHE A CG  1 
ATOM   941  C CD1 . PHE A 1 125 ? 19.999  -16.791 -8.201  1.00 38.86 ? 163 PHE A CD1 1 
ATOM   942  C CD2 . PHE A 1 125 ? 21.857  -17.948 -7.232  1.00 38.83 ? 163 PHE A CD2 1 
ATOM   943  C CE1 . PHE A 1 125 ? 20.496  -17.049 -9.474  1.00 39.63 ? 163 PHE A CE1 1 
ATOM   944  C CE2 . PHE A 1 125 ? 22.359  -18.211 -8.501  1.00 39.62 ? 163 PHE A CE2 1 
ATOM   945  C CZ  . PHE A 1 125 ? 21.673  -17.760 -9.624  1.00 38.69 ? 163 PHE A CZ  1 
ATOM   946  N N   . ASP A 1 126 ? 19.916  -19.947 -4.767  1.00 37.45 ? 164 ASP A N   1 
ATOM   947  C CA  . ASP A 1 126 ? 20.446  -21.275 -5.084  1.00 38.53 ? 164 ASP A CA  1 
ATOM   948  C C   . ASP A 1 126 ? 19.460  -22.444 -4.922  1.00 38.45 ? 164 ASP A C   1 
ATOM   949  O O   . ASP A 1 126 ? 19.856  -23.605 -5.040  1.00 38.51 ? 164 ASP A O   1 
ATOM   950  C CB  . ASP A 1 126 ? 21.751  -21.539 -4.315  1.00 38.92 ? 164 ASP A CB  1 
ATOM   951  C CG  . ASP A 1 126 ? 21.717  -21.032 -2.884  1.00 40.69 ? 164 ASP A CG  1 
ATOM   952  O OD1 . ASP A 1 126 ? 22.765  -20.527 -2.422  1.00 43.35 ? 164 ASP A OD1 1 
ATOM   953  O OD2 . ASP A 1 126 ? 20.658  -21.129 -2.224  1.00 42.42 ? 164 ASP A OD2 1 
ATOM   954  N N   . THR A 1 127 ? 18.184  -22.135 -4.689  1.00 38.45 ? 165 THR A N   1 
ATOM   955  C CA  . THR A 1 127 ? 17.180  -23.160 -4.406  1.00 38.30 ? 165 THR A CA  1 
ATOM   956  C C   . THR A 1 127 ? 15.789  -22.681 -4.763  1.00 37.57 ? 165 THR A C   1 
ATOM   957  O O   . THR A 1 127 ? 15.589  -21.508 -5.062  1.00 37.83 ? 165 THR A O   1 
ATOM   958  C CB  . THR A 1 127 ? 17.201  -23.594 -2.910  1.00 38.56 ? 165 THR A CB  1 
ATOM   959  O OG1 . THR A 1 127 ? 16.563  -24.873 -2.768  1.00 41.15 ? 165 THR A OG1 1 
ATOM   960  C CG2 . THR A 1 127 ? 16.482  -22.582 -2.027  1.00 37.87 ? 165 THR A CG2 1 
ATOM   961  N N   . SER A 1 128 ? 14.820  -23.585 -4.702  1.00 36.68 ? 166 SER A N   1 
ATOM   962  C CA  . SER A 1 128 ? 13.440  -23.226 -4.982  1.00 36.00 ? 166 SER A CA  1 
ATOM   963  C C   . SER A 1 128 ? 12.579  -23.177 -3.723  1.00 35.20 ? 166 SER A C   1 
ATOM   964  O O   . SER A 1 128 ? 11.355  -23.191 -3.808  1.00 35.57 ? 166 SER A O   1 
ATOM   965  C CB  . SER A 1 128 ? 12.838  -24.177 -6.024  1.00 36.16 ? 166 SER A CB  1 
ATOM   966  O OG  . SER A 1 128 ? 12.931  -25.527 -5.603  1.00 36.12 ? 166 SER A OG  1 
ATOM   967  N N   . LYS A 1 129 ? 13.219  -23.091 -2.560  1.00 33.81 ? 167 LYS A N   1 
ATOM   968  C CA  . LYS A 1 129 ? 12.498  -23.015 -1.288  1.00 32.55 ? 167 LYS A CA  1 
ATOM   969  C C   . LYS A 1 129 ? 12.183  -21.572 -0.858  1.00 31.25 ? 167 LYS A C   1 
ATOM   970  O O   . LYS A 1 129 ? 12.862  -20.620 -1.260  1.00 30.86 ? 167 LYS A O   1 
ATOM   971  C CB  . LYS A 1 129 ? 13.267  -23.745 -0.174  1.00 33.03 ? 167 LYS A CB  1 
ATOM   972  C CG  . LYS A 1 129 ? 13.330  -25.281 -0.346  1.00 33.39 ? 167 LYS A CG  1 
ATOM   973  C CD  . LYS A 1 129 ? 13.643  -26.025 0.959   1.00 33.85 ? 167 LYS A CD  1 
ATOM   974  C CE  . LYS A 1 129 ? 15.062  -25.763 1.456   1.00 35.36 ? 167 LYS A CE  1 
ATOM   975  N NZ  . LYS A 1 129 ? 16.074  -26.737 0.937   1.00 34.90 ? 167 LYS A NZ  1 
ATOM   976  N N   . ILE A 1 130 ? 11.138  -21.440 -0.045  1.00 29.79 ? 168 ILE A N   1 
ATOM   977  C CA  . ILE A 1 130 ? 10.782  -20.191 0.608   1.00 28.89 ? 168 ILE A CA  1 
ATOM   978  C C   . ILE A 1 130 ? 11.657  -20.051 1.850   1.00 28.07 ? 168 ILE A C   1 
ATOM   979  O O   . ILE A 1 130 ? 11.854  -21.022 2.589   1.00 27.55 ? 168 ILE A O   1 
ATOM   980  C CB  . ILE A 1 130 ? 9.279   -20.162 0.989   1.00 29.15 ? 168 ILE A CB  1 
ATOM   981  C CG1 . ILE A 1 130 ? 8.423   -20.036 -0.281  1.00 28.91 ? 168 ILE A CG1 1 
ATOM   982  C CG2 . ILE A 1 130 ? 9.008   -18.997 1.922   1.00 28.22 ? 168 ILE A CG2 1 
ATOM   983  C CD1 . ILE A 1 130 ? 6.915   -20.241 -0.097  1.00 28.89 ? 168 ILE A CD1 1 
ATOM   984  N N   . ASN A 1 131 ? 12.208  -18.861 2.059   1.00 26.93 ? 169 ASN A N   1 
ATOM   985  C CA  . ASN A 1 131 ? 13.119  -18.634 3.176   1.00 26.74 ? 169 ASN A CA  1 
ATOM   986  C C   . ASN A 1 131 ? 12.330  -18.141 4.398   1.00 26.84 ? 169 ASN A C   1 
ATOM   987  O O   . ASN A 1 131 ? 11.871  -16.991 4.449   1.00 26.58 ? 169 ASN A O   1 
ATOM   988  C CB  . ASN A 1 131 ? 14.249  -17.668 2.769   1.00 26.52 ? 169 ASN A CB  1 
ATOM   989  C CG  . ASN A 1 131 ? 15.325  -17.528 3.826   1.00 27.24 ? 169 ASN A CG  1 
ATOM   990  O OD1 . ASN A 1 131 ? 15.109  -17.821 5.005   1.00 27.63 ? 169 ASN A OD1 1 
ATOM   991  N ND2 . ASN A 1 131 ? 16.502  -17.067 3.412   1.00 27.09 ? 169 ASN A ND2 1 
ATOM   992  N N   . TYR A 1 132 ? 12.143  -19.036 5.363   1.00 27.11 ? 170 TYR A N   1 
ATOM   993  C CA  . TYR A 1 132 ? 11.417  -18.713 6.590   1.00 27.64 ? 170 TYR A CA  1 
ATOM   994  C C   . TYR A 1 132 ? 12.351  -18.252 7.687   1.00 27.87 ? 170 TYR A C   1 
ATOM   995  O O   . TYR A 1 132 ? 11.895  -17.849 8.757   1.00 27.79 ? 170 TYR A O   1 
ATOM   996  C CB  . TYR A 1 132 ? 10.617  -19.918 7.092   1.00 27.81 ? 170 TYR A CB  1 
ATOM   997  C CG  . TYR A 1 132 ? 9.494   -20.321 6.166   1.00 28.34 ? 170 TYR A CG  1 
ATOM   998  C CD1 . TYR A 1 132 ? 9.680   -21.335 5.231   1.00 28.17 ? 170 TYR A CD1 1 
ATOM   999  C CD2 . TYR A 1 132 ? 8.256   -19.685 6.211   1.00 28.36 ? 170 TYR A CD2 1 
ATOM   1000 C CE1 . TYR A 1 132 ? 8.660   -21.703 4.364   1.00 28.18 ? 170 TYR A CE1 1 
ATOM   1001 C CE2 . TYR A 1 132 ? 7.221   -20.062 5.344   1.00 28.09 ? 170 TYR A CE2 1 
ATOM   1002 C CZ  . TYR A 1 132 ? 7.448   -21.078 4.431   1.00 28.12 ? 170 TYR A CZ  1 
ATOM   1003 O OH  . TYR A 1 132 ? 6.467   -21.483 3.560   1.00 30.35 ? 170 TYR A OH  1 
ATOM   1004 N N   . GLN A 1 133 ? 13.655  -18.316 7.420   1.00 27.83 ? 171 GLN A N   1 
ATOM   1005 C CA  . GLN A 1 133 ? 14.668  -17.938 8.401   1.00 28.27 ? 171 GLN A CA  1 
ATOM   1006 C C   . GLN A 1 133 ? 14.871  -16.427 8.447   1.00 27.59 ? 171 GLN A C   1 
ATOM   1007 O O   . GLN A 1 133 ? 14.803  -15.829 9.515   1.00 27.65 ? 171 GLN A O   1 
ATOM   1008 C CB  . GLN A 1 133 ? 16.008  -18.624 8.109   1.00 28.70 ? 171 GLN A CB  1 
ATOM   1009 C CG  . GLN A 1 133 ? 15.908  -20.058 7.616   1.00 32.70 ? 171 GLN A CG  1 
ATOM   1010 C CD  . GLN A 1 133 ? 15.803  -21.074 8.740   1.00 37.23 ? 171 GLN A CD  1 
ATOM   1011 O OE1 . GLN A 1 133 ? 14.766  -21.197 9.395   1.00 39.88 ? 171 GLN A OE1 1 
ATOM   1012 N NE2 . GLN A 1 133 ? 16.880  -21.829 8.956   1.00 39.21 ? 171 GLN A NE2 1 
ATOM   1013 N N   . SER A 1 134 ? 15.137  -15.813 7.292   1.00 26.91 ? 172 SER A N   1 
ATOM   1014 C CA  . SER A 1 134 ? 15.370  -14.369 7.225   1.00 26.21 ? 172 SER A CA  1 
ATOM   1015 C C   . SER A 1 134 ? 15.152  -13.847 5.820   1.00 26.56 ? 172 SER A C   1 
ATOM   1016 O O   . SER A 1 134 ? 15.309  -14.576 4.845   1.00 26.15 ? 172 SER A O   1 
ATOM   1017 C CB  . SER A 1 134 ? 16.792  -14.003 7.689   1.00 26.18 ? 172 SER A CB  1 
ATOM   1018 O OG  . SER A 1 134 ? 17.779  -14.496 6.793   1.00 26.51 ? 172 SER A OG  1 
ATOM   1019 N N   . CYS A 1 135 ? 14.803  -12.570 5.731   1.00 26.51 ? 173 CYS A N   1 
ATOM   1020 C CA  . CYS A 1 135 ? 14.617  -11.911 4.450   1.00 26.63 ? 173 CYS A CA  1 
ATOM   1021 C C   . CYS A 1 135 ? 15.296  -10.557 4.530   1.00 27.38 ? 173 CYS A C   1 
ATOM   1022 O O   . CYS A 1 135 ? 15.460  -10.014 5.637   1.00 26.77 ? 173 CYS A O   1 
ATOM   1023 C CB  . CYS A 1 135 ? 13.133  -11.725 4.154   1.00 27.17 ? 173 CYS A CB  1 
ATOM   1024 S SG  . CYS A 1 135 ? 12.250  -13.239 3.830   1.00 27.75 ? 173 CYS A SG  1 
ATOM   1025 N N   . PRO A 1 136 ? 15.739  -10.029 3.372   1.00 27.93 ? 174 PRO A N   1 
ATOM   1026 C CA  . PRO A 1 136 ? 16.433  -8.748  3.367   1.00 29.03 ? 174 PRO A CA  1 
ATOM   1027 C C   . PRO A 1 136 ? 15.599  -7.657  4.004   1.00 30.50 ? 174 PRO A C   1 
ATOM   1028 O O   . PRO A 1 136 ? 14.403  -7.546  3.741   1.00 30.55 ? 174 PRO A O   1 
ATOM   1029 C CB  . PRO A 1 136 ? 16.614  -8.451  1.873   1.00 28.38 ? 174 PRO A CB  1 
ATOM   1030 C CG  . PRO A 1 136 ? 16.622  -9.767  1.232   1.00 27.78 ? 174 PRO A CG  1 
ATOM   1031 C CD  . PRO A 1 136 ? 15.643  -10.593 2.011   1.00 27.39 ? 174 PRO A CD  1 
ATOM   1032 N N   . ASP A 1 137 ? 16.234  -6.869  4.857   1.00 32.78 ? 175 ASP A N   1 
ATOM   1033 C CA  . ASP A 1 137 ? 15.603  -5.666  5.358   1.00 35.27 ? 175 ASP A CA  1 
ATOM   1034 C C   . ASP A 1 137 ? 15.857  -4.565  4.329   1.00 36.63 ? 175 ASP A C   1 
ATOM   1035 O O   . ASP A 1 137 ? 16.973  -4.436  3.850   1.00 36.17 ? 175 ASP A O   1 
ATOM   1036 C CB  . ASP A 1 137 ? 16.190  -5.290  6.717   1.00 35.65 ? 175 ASP A CB  1 
ATOM   1037 C CG  . ASP A 1 137 ? 15.600  -4.022  7.252   1.00 36.40 ? 175 ASP A CG  1 
ATOM   1038 O OD1 . ASP A 1 137 ? 16.305  -2.998  7.231   1.00 39.16 ? 175 ASP A OD1 1 
ATOM   1039 O OD2 . ASP A 1 137 ? 14.412  -4.037  7.636   1.00 38.66 ? 175 ASP A OD2 1 
ATOM   1040 N N   . TRP A 1 138 ? 14.825  -3.799  3.967   1.00 39.17 ? 176 TRP A N   1 
ATOM   1041 C CA  . TRP A 1 138 ? 14.962  -2.712  2.976   1.00 41.66 ? 176 TRP A CA  1 
ATOM   1042 C C   . TRP A 1 138 ? 16.174  -1.823  3.239   1.00 42.19 ? 176 TRP A C   1 
ATOM   1043 O O   . TRP A 1 138 ? 16.783  -1.282  2.307   1.00 42.34 ? 176 TRP A O   1 
ATOM   1044 C CB  . TRP A 1 138 ? 13.708  -1.836  2.966   1.00 43.82 ? 176 TRP A CB  1 
ATOM   1045 C CG  . TRP A 1 138 ? 13.712  -0.728  1.935   1.00 46.13 ? 176 TRP A CG  1 
ATOM   1046 C CD1 . TRP A 1 138 ? 13.319  -0.824  0.622   1.00 48.22 ? 176 TRP A CD1 1 
ATOM   1047 C CD2 . TRP A 1 138 ? 14.105  0.642   2.133   1.00 47.81 ? 176 TRP A CD2 1 
ATOM   1048 N NE1 . TRP A 1 138 ? 13.445  0.394   -0.004  1.00 48.84 ? 176 TRP A NE1 1 
ATOM   1049 C CE2 . TRP A 1 138 ? 13.934  1.309   0.894   1.00 48.90 ? 176 TRP A CE2 1 
ATOM   1050 C CE3 . TRP A 1 138 ? 14.590  1.369   3.234   1.00 48.96 ? 176 TRP A CE3 1 
ATOM   1051 C CZ2 . TRP A 1 138 ? 14.227  2.677   0.725   1.00 47.82 ? 176 TRP A CZ2 1 
ATOM   1052 C CZ3 . TRP A 1 138 ? 14.892  2.734   3.065   1.00 48.17 ? 176 TRP A CZ3 1 
ATOM   1053 C CH2 . TRP A 1 138 ? 14.705  3.369   1.816   1.00 47.44 ? 176 TRP A CH2 1 
ATOM   1054 N N   . ARG A 1 139 ? 16.519  -1.685  4.516   1.00 42.24 ? 177 ARG A N   1 
ATOM   1055 C CA  . ARG A 1 139 ? 17.532  -0.740  4.943   1.00 42.55 ? 177 ARG A CA  1 
ATOM   1056 C C   . ARG A 1 139 ? 18.855  -1.429  5.243   1.00 42.26 ? 177 ARG A C   1 
ATOM   1057 O O   . ARG A 1 139 ? 19.881  -1.111  4.637   1.00 42.53 ? 177 ARG A O   1 
ATOM   1058 C CB  . ARG A 1 139 ? 17.044  0.013   6.176   1.00 42.79 ? 177 ARG A CB  1 
ATOM   1059 C CG  . ARG A 1 139 ? 17.229  1.503   6.057   1.00 45.58 ? 177 ARG A CG  1 
ATOM   1060 C CD  . ARG A 1 139 ? 17.369  2.155   7.415   1.00 48.19 ? 177 ARG A CD  1 
ATOM   1061 N NE  . ARG A 1 139 ? 18.157  3.379   7.309   1.00 50.79 ? 177 ARG A NE  1 
ATOM   1062 C CZ  . ARG A 1 139 ? 19.469  3.447   7.512   1.00 50.78 ? 177 ARG A CZ  1 
ATOM   1063 N NH1 . ARG A 1 139 ? 20.159  2.363   7.842   1.00 51.48 ? 177 ARG A NH1 1 
ATOM   1064 N NH2 . ARG A 1 139 ? 20.088  4.606   7.385   1.00 51.86 ? 177 ARG A NH2 1 
ATOM   1065 N N   . LYS A 1 140 ? 18.824  -2.384  6.170   1.00 41.54 ? 178 LYS A N   1 
ATOM   1066 C CA  . LYS A 1 140 ? 20.039  -3.044  6.634   1.00 41.00 ? 178 LYS A CA  1 
ATOM   1067 C C   . LYS A 1 140 ? 20.571  -4.045  5.606   1.00 39.76 ? 178 LYS A C   1 
ATOM   1068 O O   . LYS A 1 140 ? 21.691  -4.537  5.755   1.00 40.07 ? 178 LYS A O   1 
ATOM   1069 C CB  . LYS A 1 140 ? 19.801  -3.761  7.978   1.00 41.21 ? 178 LYS A CB  1 
ATOM   1070 C CG  . LYS A 1 140 ? 19.176  -2.909  9.094   1.00 42.12 ? 178 LYS A CG  1 
ATOM   1071 C CD  . LYS A 1 140 ? 19.027  -3.726  10.380  1.00 42.57 ? 178 LYS A CD  1 
ATOM   1072 C CE  . LYS A 1 140 ? 19.132  -2.844  11.628  1.00 44.69 ? 178 LYS A CE  1 
ATOM   1073 N NZ  . LYS A 1 140 ? 19.676  -3.589  12.806  1.00 45.52 ? 178 LYS A NZ  1 
ATOM   1074 N N   . ASP A 1 141 ? 19.770  -4.367  4.585   1.00 38.06 ? 179 ASP A N   1 
ATOM   1075 C CA  . ASP A 1 141 ? 20.208  -5.322  3.564   1.00 36.42 ? 179 ASP A CA  1 
ATOM   1076 C C   . ASP A 1 141 ? 20.191  -4.791  2.130   1.00 35.36 ? 179 ASP A C   1 
ATOM   1077 O O   . ASP A 1 141 ? 21.246  -4.529  1.581   1.00 35.14 ? 179 ASP A O   1 
ATOM   1078 C CB  . ASP A 1 141 ? 19.463  -6.656  3.686   1.00 36.14 ? 179 ASP A CB  1 
ATOM   1079 C CG  . ASP A 1 141 ? 19.671  -7.313  5.038   1.00 36.07 ? 179 ASP A CG  1 
ATOM   1080 O OD1 . ASP A 1 141 ? 20.829  -7.435  5.488   1.00 37.19 ? 179 ASP A OD1 1 
ATOM   1081 O OD2 . ASP A 1 141 ? 18.674  -7.710  5.659   1.00 35.90 ? 179 ASP A OD2 1 
ATOM   1082 N N   . CYS A 1 142 ? 19.013  -4.644  1.522   1.00 34.57 ? 180 CYS A N   1 
ATOM   1083 C CA  . CYS A 1 142 ? 18.917  -4.261  0.110   1.00 33.23 ? 180 CYS A CA  1 
ATOM   1084 C C   . CYS A 1 142 ? 17.497  -3.870  -0.244  1.00 33.58 ? 180 CYS A C   1 
ATOM   1085 O O   . CYS A 1 142 ? 16.533  -4.382  0.345   1.00 33.16 ? 180 CYS A O   1 
ATOM   1086 C CB  . CYS A 1 142 ? 19.366  -5.416  -0.792  1.00 33.09 ? 180 CYS A CB  1 
ATOM   1087 S SG  . CYS A 1 142 ? 18.251  -6.852  -0.721  1.00 31.47 ? 180 CYS A SG  1 
ATOM   1088 N N   . SER A 1 143 ? 17.363  -2.983  -1.223  1.00 33.11 ? 181 SER A N   1 
ATOM   1089 C CA  . SER A 1 143 ? 16.062  -2.403  -1.544  1.00 32.77 ? 181 SER A CA  1 
ATOM   1090 C C   . SER A 1 143 ? 15.243  -3.232  -2.527  1.00 32.13 ? 181 SER A C   1 
ATOM   1091 O O   . SER A 1 143 ? 14.012  -3.212  -2.474  1.00 31.86 ? 181 SER A O   1 
ATOM   1092 C CB  . SER A 1 143 ? 16.219  -0.975  -2.063  1.00 33.38 ? 181 SER A CB  1 
ATOM   1093 O OG  . SER A 1 143 ? 17.045  -0.940  -3.209  1.00 35.40 ? 181 SER A OG  1 
ATOM   1094 N N   . ASN A 1 144 ? 15.907  -3.942  -3.439  1.00 30.30 ? 182 ASN A N   1 
ATOM   1095 C CA  . ASN A 1 144 ? 15.169  -4.693  -4.447  1.00 28.82 ? 182 ASN A CA  1 
ATOM   1096 C C   . ASN A 1 144 ? 14.831  -6.101  -3.953  1.00 27.01 ? 182 ASN A C   1 
ATOM   1097 O O   . ASN A 1 144 ? 15.171  -7.106  -4.594  1.00 26.32 ? 182 ASN A O   1 
ATOM   1098 C CB  . ASN A 1 144 ? 15.949  -4.736  -5.760  1.00 29.60 ? 182 ASN A CB  1 
ATOM   1099 C CG  . ASN A 1 144 ? 16.569  -3.404  -6.101  1.00 31.99 ? 182 ASN A CG  1 
ATOM   1100 O OD1 . ASN A 1 144 ? 15.875  -2.394  -6.220  1.00 34.16 ? 182 ASN A OD1 1 
ATOM   1101 N ND2 . ASN A 1 144 ? 17.888  -3.385  -6.224  1.00 36.51 ? 182 ASN A ND2 1 
ATOM   1102 N N   . ASN A 1 145 ? 14.180  -6.164  -2.797  1.00 25.61 ? 183 ASN A N   1 
ATOM   1103 C CA  . ASN A 1 145 ? 13.801  -7.438  -2.196  1.00 24.06 ? 183 ASN A CA  1 
ATOM   1104 C C   . ASN A 1 145 ? 12.338  -7.763  -2.565  1.00 23.25 ? 183 ASN A C   1 
ATOM   1105 O O   . ASN A 1 145 ? 11.610  -6.879  -3.007  1.00 23.28 ? 183 ASN A O   1 
ATOM   1106 C CB  . ASN A 1 145 ? 14.027  -7.392  -0.684  1.00 23.69 ? 183 ASN A CB  1 
ATOM   1107 C CG  . ASN A 1 145 ? 13.194  -6.323  -0.011  1.00 24.96 ? 183 ASN A CG  1 
ATOM   1108 O OD1 . ASN A 1 145 ? 13.668  -5.213  0.292   1.00 29.36 ? 183 ASN A OD1 1 
ATOM   1109 N ND2 . ASN A 1 145 ? 11.949  -6.633  0.198   1.00 23.93 ? 183 ASN A ND2 1 
ATOM   1110 N N   . PRO A 1 146 ? 11.907  -9.033  -2.405  1.00 22.73 ? 184 PRO A N   1 
ATOM   1111 C CA  . PRO A 1 146 ? 10.561  -9.408  -2.827  1.00 22.57 ? 184 PRO A CA  1 
ATOM   1112 C C   . PRO A 1 146 ? 9.464   -8.549  -2.226  1.00 23.14 ? 184 PRO A C   1 
ATOM   1113 O O   . PRO A 1 146 ? 8.508   -8.187  -2.918  1.00 23.31 ? 184 PRO A O   1 
ATOM   1114 C CB  . PRO A 1 146 ? 10.439  -10.865 -2.353  1.00 22.47 ? 184 PRO A CB  1 
ATOM   1115 C CG  . PRO A 1 146 ? 11.822  -11.345 -2.322  1.00 21.71 ? 184 PRO A CG  1 
ATOM   1116 C CD  . PRO A 1 146 ? 12.661  -10.197 -1.896  1.00 22.43 ? 184 PRO A CD  1 
ATOM   1117 N N   . VAL A 1 147 ? 9.595   -8.196  -0.955  1.00 23.33 ? 185 VAL A N   1 
ATOM   1118 C CA  . VAL A 1 147 ? 8.546   -7.430  -0.309  1.00 23.82 ? 185 VAL A CA  1 
ATOM   1119 C C   . VAL A 1 147 ? 8.536   -5.972  -0.784  1.00 23.95 ? 185 VAL A C   1 
ATOM   1120 O O   . VAL A 1 147 ? 7.488   -5.447  -1.156  1.00 24.43 ? 185 VAL A O   1 
ATOM   1121 C CB  . VAL A 1 147 ? 8.659   -7.548  1.235   1.00 24.16 ? 185 VAL A CB  1 
ATOM   1122 C CG1 . VAL A 1 147 ? 7.734   -6.566  1.932   1.00 24.13 ? 185 VAL A CG1 1 
ATOM   1123 C CG2 . VAL A 1 147 ? 8.335   -8.957  1.666   1.00 22.90 ? 185 VAL A CG2 1 
ATOM   1124 N N   . SER A 1 148 ? 9.695   -5.320  -0.774  1.00 24.87 ? 186 SER A N   1 
ATOM   1125 C CA  . SER A 1 148 ? 9.780   -3.904  -1.135  1.00 25.72 ? 186 SER A CA  1 
ATOM   1126 C C   . SER A 1 148 ? 9.400   -3.693  -2.581  1.00 25.96 ? 186 SER A C   1 
ATOM   1127 O O   . SER A 1 148 ? 8.696   -2.727  -2.893  1.00 26.69 ? 186 SER A O   1 
ATOM   1128 C CB  . SER A 1 148 ? 11.179  -3.344  -0.866  1.00 26.11 ? 186 SER A CB  1 
ATOM   1129 O OG  . SER A 1 148 ? 11.518  -3.546  0.499   1.00 27.28 ? 186 SER A OG  1 
ATOM   1130 N N   . VAL A 1 149 ? 9.827   -4.612  -3.451  1.00 25.30 ? 187 VAL A N   1 
ATOM   1131 C CA  . VAL A 1 149 ? 9.501   -4.518  -4.875  1.00 25.27 ? 187 VAL A CA  1 
ATOM   1132 C C   . VAL A 1 149 ? 7.997   -4.717  -5.139  1.00 25.07 ? 187 VAL A C   1 
ATOM   1133 O O   . VAL A 1 149 ? 7.403   -3.984  -5.929  1.00 25.08 ? 187 VAL A O   1 
ATOM   1134 C CB  . VAL A 1 149 ? 10.410  -5.403  -5.772  1.00 25.75 ? 187 VAL A CB  1 
ATOM   1135 C CG1 . VAL A 1 149 ? 9.898   -5.412  -7.234  1.00 26.23 ? 187 VAL A CG1 1 
ATOM   1136 C CG2 . VAL A 1 149 ? 11.868  -4.894  -5.721  1.00 24.09 ? 187 VAL A CG2 1 
ATOM   1137 N N   . PHE A 1 150 ? 7.394   -5.678  -4.451  1.00 25.63 ? 188 PHE A N   1 
ATOM   1138 C CA  . PHE A 1 150 ? 5.952   -5.866  -4.549  1.00 25.70 ? 188 PHE A CA  1 
ATOM   1139 C C   . PHE A 1 150 ? 5.233   -4.603  -4.121  1.00 25.43 ? 188 PHE A C   1 
ATOM   1140 O O   . PHE A 1 150 ? 4.391   -4.127  -4.850  1.00 26.04 ? 188 PHE A O   1 
ATOM   1141 C CB  . PHE A 1 150 ? 5.482   -7.055  -3.697  1.00 25.77 ? 188 PHE A CB  1 
ATOM   1142 C CG  . PHE A 1 150 ? 3.978   -7.172  -3.594  1.00 25.22 ? 188 PHE A CG  1 
ATOM   1143 C CD1 . PHE A 1 150 ? 3.260   -7.898  -4.521  1.00 25.28 ? 188 PHE A CD1 1 
ATOM   1144 C CD2 . PHE A 1 150 ? 3.287   -6.555  -2.541  1.00 26.26 ? 188 PHE A CD2 1 
ATOM   1145 C CE1 . PHE A 1 150 ? 1.863   -8.001  -4.421  1.00 25.94 ? 188 PHE A CE1 1 
ATOM   1146 C CE2 . PHE A 1 150 ? 1.891   -6.627  -2.445  1.00 23.07 ? 188 PHE A CE2 1 
ATOM   1147 C CZ  . PHE A 1 150 ? 1.187   -7.355  -3.377  1.00 26.13 ? 188 PHE A CZ  1 
ATOM   1148 N N   . TRP A 1 151 ? 5.519   -4.100  -2.917  1.00 25.46 ? 189 TRP A N   1 
ATOM   1149 C CA  . TRP A 1 151 ? 4.798   -2.935  -2.405  1.00 25.88 ? 189 TRP A CA  1 
ATOM   1150 C C   . TRP A 1 151 ? 5.009   -1.689  -3.245  1.00 26.37 ? 189 TRP A C   1 
ATOM   1151 O O   . TRP A 1 151 ? 4.067   -0.959  -3.495  1.00 26.90 ? 189 TRP A O   1 
ATOM   1152 C CB  . TRP A 1 151 ? 5.116   -2.668  -0.923  1.00 26.14 ? 189 TRP A CB  1 
ATOM   1153 C CG  . TRP A 1 151 ? 4.429   -3.661  -0.051  1.00 25.28 ? 189 TRP A CG  1 
ATOM   1154 C CD1 . TRP A 1 151 ? 5.023   -4.601  0.736   1.00 25.34 ? 189 TRP A CD1 1 
ATOM   1155 C CD2 . TRP A 1 151 ? 3.007   -3.852  0.091   1.00 26.03 ? 189 TRP A CD2 1 
ATOM   1156 N NE1 . TRP A 1 151 ? 4.074   -5.348  1.383   1.00 26.11 ? 189 TRP A NE1 1 
ATOM   1157 C CE2 . TRP A 1 151 ? 2.825   -4.925  0.990   1.00 24.84 ? 189 TRP A CE2 1 
ATOM   1158 C CE3 . TRP A 1 151 ? 1.874   -3.201  -0.434  1.00 24.98 ? 189 TRP A CE3 1 
ATOM   1159 C CZ2 . TRP A 1 151 ? 1.561   -5.368  1.385   1.00 25.83 ? 189 TRP A CZ2 1 
ATOM   1160 C CZ3 . TRP A 1 151 ? 0.601   -3.661  -0.048  1.00 25.62 ? 189 TRP A CZ3 1 
ATOM   1161 C CH2 . TRP A 1 151 ? 0.467   -4.734  0.852   1.00 24.63 ? 189 TRP A CH2 1 
ATOM   1162 N N   . LYS A 1 152 ? 6.238   -1.449  -3.694  1.00 26.86 ? 190 LYS A N   1 
ATOM   1163 C CA  . LYS A 1 152 ? 6.475   -0.310  -4.585  1.00 28.50 ? 190 LYS A CA  1 
ATOM   1164 C C   . LYS A 1 152 ? 5.634   -0.426  -5.875  1.00 27.41 ? 190 LYS A C   1 
ATOM   1165 O O   . LYS A 1 152 ? 5.032   0.557   -6.317  1.00 27.01 ? 190 LYS A O   1 
ATOM   1166 C CB  . LYS A 1 152 ? 7.971   -0.144  -4.897  1.00 28.24 ? 190 LYS A CB  1 
ATOM   1167 C CG  . LYS A 1 152 ? 8.270   1.012   -5.861  1.00 31.80 ? 190 LYS A CG  1 
ATOM   1168 C CD  . LYS A 1 152 ? 9.747   1.122   -6.216  1.00 31.78 ? 190 LYS A CD  1 
ATOM   1169 C CE  . LYS A 1 152 ? 9.997   2.424   -7.012  1.00 36.40 ? 190 LYS A CE  1 
ATOM   1170 N NZ  . LYS A 1 152 ? 11.354  2.491   -7.623  1.00 39.40 ? 190 LYS A NZ  1 
ATOM   1171 N N   . THR A 1 153 ? 5.587   -1.623  -6.458  1.00 27.10 ? 191 THR A N   1 
ATOM   1172 C CA  . THR A 1 153 ? 4.884   -1.839  -7.730  1.00 27.45 ? 191 THR A CA  1 
ATOM   1173 C C   . THR A 1 153 ? 3.387   -1.645  -7.580  1.00 27.21 ? 191 THR A C   1 
ATOM   1174 O O   . THR A 1 153 ? 2.784   -0.856  -8.324  1.00 28.21 ? 191 THR A O   1 
ATOM   1175 C CB  . THR A 1 153 ? 5.148   -3.243  -8.292  1.00 27.26 ? 191 THR A CB  1 
ATOM   1176 O OG1 . THR A 1 153 ? 6.559   -3.465  -8.319  1.00 29.82 ? 191 THR A OG1 1 
ATOM   1177 C CG2 . THR A 1 153 ? 4.606   -3.372  -9.696  1.00 28.79 ? 191 THR A CG2 1 
ATOM   1178 N N   . VAL A 1 154 ? 2.782   -2.341  -6.618  1.00 26.74 ? 192 VAL A N   1 
ATOM   1179 C CA  . VAL A 1 154 ? 1.322   -2.226  -6.432  1.00 26.57 ? 192 VAL A CA  1 
ATOM   1180 C C   . VAL A 1 154 ? 0.925   -0.867  -5.869  1.00 26.77 ? 192 VAL A C   1 
ATOM   1181 O O   . VAL A 1 154 ? -0.142  -0.365  -6.190  1.00 26.99 ? 192 VAL A O   1 
ATOM   1182 C CB  . VAL A 1 154 ? 0.696   -3.357  -5.566  1.00 26.89 ? 192 VAL A CB  1 
ATOM   1183 C CG1 . VAL A 1 154 ? 0.897   -4.705  -6.222  1.00 26.71 ? 192 VAL A CG1 1 
ATOM   1184 C CG2 . VAL A 1 154 ? 1.245   -3.365  -4.135  1.00 25.17 ? 192 VAL A CG2 1 
ATOM   1185 N N   . SER A 1 155 ? 1.780   -0.275  -5.046  1.00 26.34 ? 193 SER A N   1 
ATOM   1186 C CA  . SER A 1 155 ? 1.520   1.068   -4.521  1.00 27.73 ? 193 SER A CA  1 
ATOM   1187 C C   . SER A 1 155 ? 1.552   2.110   -5.620  1.00 28.35 ? 193 SER A C   1 
ATOM   1188 O O   . SER A 1 155 ? 0.733   3.027   -5.596  1.00 29.20 ? 193 SER A O   1 
ATOM   1189 C CB  . SER A 1 155 ? 2.531   1.462   -3.455  1.00 26.91 ? 193 SER A CB  1 
ATOM   1190 O OG  . SER A 1 155 ? 2.337   0.667   -2.299  1.00 28.85 ? 193 SER A OG  1 
ATOM   1191 N N   . ARG A 1 156 ? 2.513   1.981   -6.542  1.00 29.07 ? 194 ARG A N   1 
ATOM   1192 C CA  . ARG A 1 156 ? 2.559   2.825   -7.728  1.00 29.61 ? 194 ARG A CA  1 
ATOM   1193 C C   . ARG A 1 156 ? 1.291   2.648   -8.552  1.00 29.28 ? 194 ARG A C   1 
ATOM   1194 O O   . ARG A 1 156 ? 0.628   3.627   -8.895  1.00 27.80 ? 194 ARG A O   1 
ATOM   1195 C CB  . ARG A 1 156 ? 3.786   2.562   -8.606  1.00 29.45 ? 194 ARG A CB  1 
ATOM   1196 C CG  . ARG A 1 156 ? 3.895   3.565   -9.767  1.00 30.93 ? 194 ARG A CG  1 
ATOM   1197 C CD  . ARG A 1 156 ? 5.001   3.272   -10.765 1.00 32.23 ? 194 ARG A CD  1 
ATOM   1198 N NE  . ARG A 1 156 ? 4.637   2.137   -11.600 1.00 39.93 ? 194 ARG A NE  1 
ATOM   1199 C CZ  . ARG A 1 156 ? 5.181   0.934   -11.477 1.00 41.45 ? 194 ARG A CZ  1 
ATOM   1200 N NH1 . ARG A 1 156 ? 6.133   0.736   -10.578 1.00 43.12 ? 194 ARG A NH1 1 
ATOM   1201 N NH2 . ARG A 1 156 ? 4.792   -0.060  -12.263 1.00 43.95 ? 194 ARG A NH2 1 
ATOM   1202 N N   . ARG A 1 157 ? 0.956   1.403   -8.869  1.00 29.26 ? 195 ARG A N   1 
ATOM   1203 C CA  . ARG A 1 157 ? -0.178  1.156   -9.750  1.00 30.47 ? 195 ARG A CA  1 
ATOM   1204 C C   . ARG A 1 157 ? -1.496  1.634   -9.127  1.00 28.43 ? 195 ARG A C   1 
ATOM   1205 O O   . ARG A 1 157 ? -2.369  2.122   -9.830  1.00 28.00 ? 195 ARG A O   1 
ATOM   1206 C CB  . ARG A 1 157 ? -0.214  -0.307  -10.237 1.00 30.62 ? 195 ARG A CB  1 
ATOM   1207 C CG  . ARG A 1 157 ? -0.978  -1.294  -9.362  1.00 34.04 ? 195 ARG A CG  1 
ATOM   1208 C CD  . ARG A 1 157 ? -1.087  -2.729  -10.021 1.00 35.65 ? 195 ARG A CD  1 
ATOM   1209 N NE  . ARG A 1 157 ? -2.171  -3.501  -9.394  1.00 42.22 ? 195 ARG A NE  1 
ATOM   1210 C CZ  . ARG A 1 157 ? -2.869  -4.484  -9.971  1.00 44.89 ? 195 ARG A CZ  1 
ATOM   1211 N NH1 . ARG A 1 157 ? -2.628  -4.879  -11.225 1.00 45.53 ? 195 ARG A NH1 1 
ATOM   1212 N NH2 . ARG A 1 157 ? -3.838  -5.075  -9.282  1.00 47.37 ? 195 ARG A NH2 1 
ATOM   1213 N N   . PHE A 1 158 ? -1.615  1.532   -7.800  1.00 27.91 ? 196 PHE A N   1 
ATOM   1214 C CA  . PHE A 1 158 ? -2.802  1.990   -7.095  1.00 27.30 ? 196 PHE A CA  1 
ATOM   1215 C C   . PHE A 1 158 ? -2.895  3.508   -7.210  1.00 27.18 ? 196 PHE A C   1 
ATOM   1216 O O   . PHE A 1 158 ? -3.968  4.061   -7.429  1.00 27.01 ? 196 PHE A O   1 
ATOM   1217 C CB  . PHE A 1 158 ? -2.707  1.589   -5.603  1.00 27.36 ? 196 PHE A CB  1 
ATOM   1218 C CG  . PHE A 1 158 ? -4.001  1.663   -4.857  1.00 27.44 ? 196 PHE A CG  1 
ATOM   1219 C CD1 . PHE A 1 158 ? -5.118  0.957   -5.301  1.00 27.91 ? 196 PHE A CD1 1 
ATOM   1220 C CD2 . PHE A 1 158 ? -4.094  2.392   -3.656  1.00 26.35 ? 196 PHE A CD2 1 
ATOM   1221 C CE1 . PHE A 1 158 ? -6.312  0.991   -4.584  1.00 27.73 ? 196 PHE A CE1 1 
ATOM   1222 C CE2 . PHE A 1 158 ? -5.280  2.426   -2.936  1.00 26.22 ? 196 PHE A CE2 1 
ATOM   1223 C CZ  . PHE A 1 158 ? -6.394  1.734   -3.400  1.00 27.78 ? 196 PHE A CZ  1 
ATOM   1224 N N   . ALA A 1 159 ? -1.755  4.180   -7.066  1.00 26.84 ? 197 ALA A N   1 
ATOM   1225 C CA  . ALA A 1 159 ? -1.711  5.622   -7.201  1.00 27.02 ? 197 ALA A CA  1 
ATOM   1226 C C   . ALA A 1 159 ? -2.051  6.053   -8.631  1.00 27.07 ? 197 ALA A C   1 
ATOM   1227 O O   . ALA A 1 159 ? -2.768  7.032   -8.838  1.00 26.36 ? 197 ALA A O   1 
ATOM   1228 C CB  . ALA A 1 159 ? -0.321  6.139   -6.780  1.00 26.90 ? 197 ALA A CB  1 
ATOM   1229 N N   . GLU A 1 160 ? -1.552  5.307   -9.614  1.00 26.66 ? 198 GLU A N   1 
ATOM   1230 C CA  . GLU A 1 160 ? -1.824  5.596   -11.032 1.00 28.36 ? 198 GLU A CA  1 
ATOM   1231 C C   . GLU A 1 160 ? -3.296  5.439   -11.367 1.00 27.41 ? 198 GLU A C   1 
ATOM   1232 O O   . GLU A 1 160 ? -3.806  6.092   -12.272 1.00 27.60 ? 198 GLU A O   1 
ATOM   1233 C CB  . GLU A 1 160 ? -1.013  4.661   -11.935 1.00 27.83 ? 198 GLU A CB  1 
ATOM   1234 C CG  . GLU A 1 160 ? 0.468   4.954   -11.966 1.00 29.97 ? 198 GLU A CG  1 
ATOM   1235 C CD  . GLU A 1 160 ? 1.254   3.862   -12.688 1.00 31.68 ? 198 GLU A CD  1 
ATOM   1236 O OE1 . GLU A 1 160 ? 0.673   2.795   -12.984 1.00 35.08 ? 198 GLU A OE1 1 
ATOM   1237 O OE2 . GLU A 1 160 ? 2.459   4.065   -12.939 1.00 35.93 ? 198 GLU A OE2 1 
ATOM   1238 N N   . ALA A 1 161 ? -3.964  4.576   -10.625 1.00 27.40 ? 199 ALA A N   1 
ATOM   1239 C CA  . ALA A 1 161 ? -5.376  4.282   -10.828 1.00 27.82 ? 199 ALA A CA  1 
ATOM   1240 C C   . ALA A 1 161 ? -6.289  5.398   -10.330 1.00 27.99 ? 199 ALA A C   1 
ATOM   1241 O O   . ALA A 1 161 ? -7.436  5.477   -10.758 1.00 28.46 ? 199 ALA A O   1 
ATOM   1242 C CB  . ALA A 1 161 ? -5.745  2.948   -10.137 1.00 28.21 ? 199 ALA A CB  1 
ATOM   1243 N N   . ALA A 1 162 ? -5.783  6.254   -9.432  1.00 27.97 ? 200 ALA A N   1 
ATOM   1244 C CA  . ALA A 1 162 ? -6.631  7.185   -8.709  1.00 27.89 ? 200 ALA A CA  1 
ATOM   1245 C C   . ALA A 1 162 ? -7.033  8.352   -9.572  1.00 27.79 ? 200 ALA A C   1 
ATOM   1246 O O   . ALA A 1 162 ? -6.324  8.735   -10.512 1.00 27.48 ? 200 ALA A O   1 
ATOM   1247 C CB  . ALA A 1 162 ? -5.930  7.685   -7.446  1.00 28.27 ? 200 ALA A CB  1 
ATOM   1248 N N   . CYS A 1 163 ? -8.176  8.932   -9.238  1.00 27.16 ? 201 CYS A N   1 
ATOM   1249 C CA  . CYS A 1 163 ? -8.693  10.045  -10.000 1.00 27.18 ? 201 CYS A CA  1 
ATOM   1250 C C   . CYS A 1 163 ? -9.499  10.926  -9.048  1.00 26.64 ? 201 CYS A C   1 
ATOM   1251 O O   . CYS A 1 163 ? -9.780  10.529  -7.913  1.00 26.31 ? 201 CYS A O   1 
ATOM   1252 C CB  . CYS A 1 163 ? -9.583  9.534   -11.143 1.00 28.00 ? 201 CYS A CB  1 
ATOM   1253 S SG  . CYS A 1 163 ? -11.221 8.981   -10.572 1.00 30.01 ? 201 CYS A SG  1 
ATOM   1254 N N   . ASP A 1 164 ? -9.865  12.112  -9.526  1.00 26.01 ? 202 ASP A N   1 
ATOM   1255 C CA  . ASP A 1 164 ? -10.754 13.018  -8.812  1.00 25.77 ? 202 ASP A CA  1 
ATOM   1256 C C   . ASP A 1 164 ? -10.157 13.416  -7.466  1.00 25.27 ? 202 ASP A C   1 
ATOM   1257 O O   . ASP A 1 164 ? -9.043  13.934  -7.414  1.00 25.32 ? 202 ASP A O   1 
ATOM   1258 C CB  . ASP A 1 164 ? -12.170 12.407  -8.696  1.00 25.80 ? 202 ASP A CB  1 
ATOM   1259 C CG  . ASP A 1 164 ? -12.763 12.043  -10.051 1.00 27.15 ? 202 ASP A CG  1 
ATOM   1260 O OD1 . ASP A 1 164 ? -12.185 12.470  -11.079 1.00 26.72 ? 202 ASP A OD1 1 
ATOM   1261 O OD2 . ASP A 1 164 ? -13.819 11.344  -10.097 1.00 27.51 ? 202 ASP A OD2 1 
ATOM   1262 N N   . VAL A 1 165 ? -10.878 13.180  -6.378  1.00 25.41 ? 203 VAL A N   1 
ATOM   1263 C CA  . VAL A 1 165 ? -10.342 13.501  -5.066  1.00 24.98 ? 203 VAL A CA  1 
ATOM   1264 C C   . VAL A 1 165 ? -9.755  12.215  -4.489  1.00 24.91 ? 203 VAL A C   1 
ATOM   1265 O O   . VAL A 1 165 ? -10.438 11.208  -4.371  1.00 24.37 ? 203 VAL A O   1 
ATOM   1266 C CB  . VAL A 1 165 ? -11.380 14.132  -4.119  1.00 24.71 ? 203 VAL A CB  1 
ATOM   1267 C CG1 . VAL A 1 165 ? -10.709 14.530  -2.773  1.00 24.56 ? 203 VAL A CG1 1 
ATOM   1268 C CG2 . VAL A 1 165 ? -11.991 15.374  -4.777  1.00 25.37 ? 203 VAL A CG2 1 
ATOM   1269 N N   . VAL A 1 166 ? -8.465  12.276  -4.176  1.00 25.01 ? 204 VAL A N   1 
ATOM   1270 C CA  . VAL A 1 166 ? -7.731  11.155  -3.620  1.00 25.19 ? 204 VAL A CA  1 
ATOM   1271 C C   . VAL A 1 166 ? -7.463  11.568  -2.179  1.00 25.26 ? 204 VAL A C   1 
ATOM   1272 O O   . VAL A 1 166 ? -7.030  12.687  -1.932  1.00 25.01 ? 204 VAL A O   1 
ATOM   1273 C CB  . VAL A 1 166 ? -6.386  10.974  -4.339  1.00 25.46 ? 204 VAL A CB  1 
ATOM   1274 C CG1 . VAL A 1 166 ? -5.610  9.837   -3.714  1.00 26.95 ? 204 VAL A CG1 1 
ATOM   1275 C CG2 . VAL A 1 166 ? -6.605  10.695  -5.831  1.00 27.75 ? 204 VAL A CG2 1 
ATOM   1276 N N   . HIS A 1 167 ? -7.770  10.687  -1.236  1.00 24.68 ? 205 HIS A N   1 
ATOM   1277 C CA  . HIS A 1 167 ? -7.591  11.006  0.179   1.00 24.58 ? 205 HIS A CA  1 
ATOM   1278 C C   . HIS A 1 167 ? -6.390  10.246  0.718   1.00 25.11 ? 205 HIS A C   1 
ATOM   1279 O O   . HIS A 1 167 ? -6.075  9.150   0.248   1.00 24.98 ? 205 HIS A O   1 
ATOM   1280 C CB  . HIS A 1 167 ? -8.843  10.647  0.967   1.00 24.28 ? 205 HIS A CB  1 
ATOM   1281 C CG  . HIS A 1 167 ? -10.039 11.459  0.578   1.00 24.88 ? 205 HIS A CG  1 
ATOM   1282 N ND1 . HIS A 1 167 ? -10.896 11.083  -0.434  1.00 26.90 ? 205 HIS A ND1 1 
ATOM   1283 C CD2 . HIS A 1 167 ? -10.494 12.650  1.035   1.00 25.72 ? 205 HIS A CD2 1 
ATOM   1284 C CE1 . HIS A 1 167 ? -11.846 11.993  -0.562  1.00 24.92 ? 205 HIS A CE1 1 
ATOM   1285 N NE2 . HIS A 1 167 ? -11.622 12.955  0.317   1.00 24.82 ? 205 HIS A NE2 1 
ATOM   1286 N N   . VAL A 1 168 ? -5.723  10.840  1.697   1.00 24.82 ? 206 VAL A N   1 
ATOM   1287 C CA  . VAL A 1 168 ? -4.593  10.180  2.318   1.00 25.08 ? 206 VAL A CA  1 
ATOM   1288 C C   . VAL A 1 168 ? -4.676  10.410  3.810   1.00 25.13 ? 206 VAL A C   1 
ATOM   1289 O O   . VAL A 1 168 ? -4.789  11.536  4.269   1.00 25.05 ? 206 VAL A O   1 
ATOM   1290 C CB  . VAL A 1 168 ? -3.212  10.612  1.734   1.00 24.95 ? 206 VAL A CB  1 
ATOM   1291 C CG1 . VAL A 1 168 ? -2.966  12.120  1.872   1.00 24.38 ? 206 VAL A CG1 1 
ATOM   1292 C CG2 . VAL A 1 168 ? -2.091  9.802   2.384   1.00 23.74 ? 206 VAL A CG2 1 
ATOM   1293 N N   . MET A 1 169 ? -4.643  9.315   4.552   1.00 25.36 ? 207 MET A N   1 
ATOM   1294 C CA  . MET A 1 169 ? -4.628  9.382   5.988   1.00 26.47 ? 207 MET A CA  1 
ATOM   1295 C C   . MET A 1 169 ? -3.177  9.458   6.472   1.00 25.69 ? 207 MET A C   1 
ATOM   1296 O O   . MET A 1 169 ? -2.351  8.632   6.092   1.00 25.46 ? 207 MET A O   1 
ATOM   1297 C CB  . MET A 1 169 ? -5.287  8.124   6.524   1.00 26.95 ? 207 MET A CB  1 
ATOM   1298 C CG  . MET A 1 169 ? -5.882  8.311   7.870   1.00 28.52 ? 207 MET A CG  1 
ATOM   1299 S SD  . MET A 1 169 ? -6.867  6.895   8.395   1.00 30.78 ? 207 MET A SD  1 
ATOM   1300 C CE  . MET A 1 169 ? -8.456  7.292   7.702   1.00 26.81 ? 207 MET A CE  1 
ATOM   1301 N N   . LEU A 1 170 ? -2.869  10.430  7.326   1.00 25.16 ? 208 LEU A N   1 
ATOM   1302 C CA  . LEU A 1 170 ? -1.514  10.596  7.815   1.00 25.04 ? 208 LEU A CA  1 
ATOM   1303 C C   . LEU A 1 170 ? -1.522  10.568  9.338   1.00 25.93 ? 208 LEU A C   1 
ATOM   1304 O O   . LEU A 1 170 ? -2.477  11.001  9.955   1.00 25.53 ? 208 LEU A O   1 
ATOM   1305 C CB  . LEU A 1 170 ? -0.911  11.914  7.315   1.00 24.76 ? 208 LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 170 ? -0.797  12.075  5.791   1.00 23.79 ? 208 LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 170 ? -0.358  13.486  5.445   1.00 25.50 ? 208 LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 170 ? 0.181   11.087  5.256   1.00 23.57 ? 208 LEU A CD2 1 
ATOM   1309 N N   . ASP A 1 171 ? -0.449  10.062  9.920   1.00 26.33 ? 209 ASP A N   1 
ATOM   1310 C CA  . ASP A 1 171 ? -0.316  9.998   11.367  1.00 27.68 ? 209 ASP A CA  1 
ATOM   1311 C C   . ASP A 1 171 ? 0.249   11.311  11.912  1.00 27.85 ? 209 ASP A C   1 
ATOM   1312 O O   . ASP A 1 171 ? 1.443   11.564  11.820  1.00 28.79 ? 209 ASP A O   1 
ATOM   1313 C CB  . ASP A 1 171 ? 0.588   8.827   11.722  1.00 27.61 ? 209 ASP A CB  1 
ATOM   1314 C CG  . ASP A 1 171 ? 0.741   8.629   13.209  1.00 29.24 ? 209 ASP A CG  1 
ATOM   1315 O OD1 . ASP A 1 171 ? 0.080   9.346   14.001  1.00 28.82 ? 209 ASP A OD1 1 
ATOM   1316 O OD2 . ASP A 1 171 ? 1.535   7.737   13.577  1.00 31.49 ? 209 ASP A OD2 1 
ATOM   1317 N N   . GLY A 1 172 ? -0.608  12.125  12.504  1.00 28.82 ? 210 GLY A N   1 
ATOM   1318 C CA  . GLY A 1 172 ? -0.196  13.416  13.049  1.00 30.24 ? 210 GLY A CA  1 
ATOM   1319 C C   . GLY A 1 172 ? 0.707   13.332  14.268  1.00 31.66 ? 210 GLY A C   1 
ATOM   1320 O O   . GLY A 1 172 ? 1.119   14.359  14.795  1.00 31.71 ? 210 GLY A O   1 
ATOM   1321 N N   . SER A 1 173 ? 1.031   12.117  14.703  1.00 32.60 ? 211 SER A N   1 
ATOM   1322 C CA  . SER A 1 173 ? 1.907   11.911  15.855  1.00 34.54 ? 211 SER A CA  1 
ATOM   1323 C C   . SER A 1 173 ? 3.365   11.550  15.503  1.00 35.58 ? 211 SER A C   1 
ATOM   1324 O O   . SER A 1 173 ? 4.151   11.239  16.396  1.00 36.16 ? 211 SER A O   1 
ATOM   1325 C CB  . SER A 1 173 ? 1.301   10.853  16.792  1.00 34.56 ? 211 SER A CB  1 
ATOM   1326 O OG  . SER A 1 173 ? 1.207   9.587   16.137  1.00 34.92 ? 211 SER A OG  1 
ATOM   1327 N N   . ARG A 1 174 ? 3.731   11.624  14.225  1.00 36.60 ? 212 ARG A N   1 
ATOM   1328 C CA  . ARG A 1 174 ? 5.044   11.144  13.747  1.00 37.75 ? 212 ARG A CA  1 
ATOM   1329 C C   . ARG A 1 174 ? 6.214   12.131  13.824  1.00 37.89 ? 212 ARG A C   1 
ATOM   1330 O O   . ARG A 1 174 ? 7.364   11.709  13.940  1.00 38.44 ? 212 ARG A O   1 
ATOM   1331 C CB  . ARG A 1 174 ? 4.947   10.645  12.297  1.00 37.68 ? 212 ARG A CB  1 
ATOM   1332 C CG  . ARG A 1 174 ? 4.190   9.336   12.093  1.00 40.46 ? 212 ARG A CG  1 
ATOM   1333 C CD  . ARG A 1 174 ? 4.887   8.143   12.749  1.00 43.70 ? 212 ARG A CD  1 
ATOM   1334 N NE  . ARG A 1 174 ? 4.014   6.972   12.764  1.00 45.90 ? 212 ARG A NE  1 
ATOM   1335 C CZ  . ARG A 1 174 ? 4.435   5.711   12.739  1.00 47.98 ? 212 ARG A CZ  1 
ATOM   1336 N NH1 . ARG A 1 174 ? 5.737   5.429   12.690  1.00 49.02 ? 212 ARG A NH1 1 
ATOM   1337 N NH2 . ARG A 1 174 ? 3.547   4.724   12.745  1.00 48.74 ? 212 ARG A NH2 1 
ATOM   1338 N N   . SER A 1 175 ? 5.940   13.428  13.715  1.00 37.91 ? 213 SER A N   1 
ATOM   1339 C CA  . SER A 1 175 ? 7.009   14.458  13.642  1.00 38.26 ? 213 SER A CA  1 
ATOM   1340 C C   . SER A 1 175 ? 7.602   14.622  12.235  1.00 37.36 ? 213 SER A C   1 
ATOM   1341 O O   . SER A 1 175 ? 8.261   15.623  11.952  1.00 38.48 ? 213 SER A O   1 
ATOM   1342 C CB  . SER A 1 175 ? 8.120   14.262  14.695  1.00 38.60 ? 213 SER A CB  1 
ATOM   1343 O OG  . SER A 1 175 ? 9.092   13.317  14.258  1.00 41.20 ? 213 SER A OG  1 
ATOM   1344 N N   . LYS A 1 176 ? 7.402   13.620  11.385  1.00 35.79 ? 214 LYS A N   1 
ATOM   1345 C CA  . LYS A 1 176 ? 7.322   13.823  9.950   1.00 34.33 ? 214 LYS A CA  1 
ATOM   1346 C C   . LYS A 1 176 ? 5.941   13.308  9.577   1.00 32.64 ? 214 LYS A C   1 
ATOM   1347 O O   . LYS A 1 176 ? 5.783   12.148  9.189   1.00 32.93 ? 214 LYS A O   1 
ATOM   1348 C CB  . LYS A 1 176 ? 8.423   13.075  9.197   1.00 34.57 ? 214 LYS A CB  1 
ATOM   1349 C CG  . LYS A 1 176 ? 9.775   13.774  9.238   1.00 36.23 ? 214 LYS A CG  1 
ATOM   1350 C CD  . LYS A 1 176 ? 10.833  12.988  8.473   1.00 39.90 ? 214 LYS A CD  1 
ATOM   1351 C CE  . LYS A 1 176 ? 12.203  13.658  8.619   1.00 42.17 ? 214 LYS A CE  1 
ATOM   1352 N NZ  . LYS A 1 176 ? 13.261  13.001  7.799   1.00 45.14 ? 214 LYS A NZ  1 
ATOM   1353 N N   . ILE A 1 177 ? 4.933   14.163  9.756   1.00 30.59 ? 215 ILE A N   1 
ATOM   1354 C CA  . ILE A 1 177 ? 3.547   13.793  9.468   1.00 28.75 ? 215 ILE A CA  1 
ATOM   1355 C C   . ILE A 1 177 ? 3.453   13.388  7.996   1.00 29.06 ? 215 ILE A C   1 
ATOM   1356 O O   . ILE A 1 177 ? 2.939   12.314  7.670   1.00 28.78 ? 215 ILE A O   1 
ATOM   1357 C CB  . ILE A 1 177 ? 2.564   14.936  9.805   1.00 28.99 ? 215 ILE A CB  1 
ATOM   1358 C CG1 . ILE A 1 177 ? 2.593   15.206  11.328  1.00 27.40 ? 215 ILE A CG1 1 
ATOM   1359 C CG2 . ILE A 1 177 ? 1.156   14.592  9.296   1.00 26.62 ? 215 ILE A CG2 1 
ATOM   1360 C CD1 . ILE A 1 177 ? 1.956   16.487  11.740  1.00 26.91 ? 215 ILE A CD1 1 
ATOM   1361 N N   . PHE A 1 178 ? 3.955   14.261  7.127   1.00 27.89 ? 216 PHE A N   1 
ATOM   1362 C CA  . PHE A 1 178 ? 4.268   13.864  5.776   1.00 28.37 ? 216 PHE A CA  1 
ATOM   1363 C C   . PHE A 1 178 ? 5.755   13.549  5.677   1.00 28.59 ? 216 PHE A C   1 
ATOM   1364 O O   . PHE A 1 178 ? 6.605   14.408  5.930   1.00 28.47 ? 216 PHE A O   1 
ATOM   1365 C CB  . PHE A 1 178 ? 3.926   14.942  4.764   1.00 27.20 ? 216 PHE A CB  1 
ATOM   1366 C CG  . PHE A 1 178 ? 4.466   14.638  3.395   1.00 27.65 ? 216 PHE A CG  1 
ATOM   1367 C CD1 . PHE A 1 178 ? 3.979   13.547  2.678   1.00 28.45 ? 216 PHE A CD1 1 
ATOM   1368 C CD2 . PHE A 1 178 ? 5.494   15.393  2.850   1.00 27.04 ? 216 PHE A CD2 1 
ATOM   1369 C CE1 . PHE A 1 178 ? 4.486   13.236  1.425   1.00 27.30 ? 216 PHE A CE1 1 
ATOM   1370 C CE2 . PHE A 1 178 ? 6.008   15.084  1.579   1.00 28.95 ? 216 PHE A CE2 1 
ATOM   1371 C CZ  . PHE A 1 178 ? 5.496   14.004  0.875   1.00 27.08 ? 216 PHE A CZ  1 
ATOM   1372 N N   . ASP A 1 179 ? 6.049   12.315  5.304   1.00 29.40 ? 217 ASP A N   1 
ATOM   1373 C CA  . ASP A 1 179 ? 7.413   11.876  5.137   1.00 30.12 ? 217 ASP A CA  1 
ATOM   1374 C C   . ASP A 1 179 ? 7.674   11.588  3.674   1.00 30.29 ? 217 ASP A C   1 
ATOM   1375 O O   . ASP A 1 179 ? 7.092   10.660  3.119   1.00 29.79 ? 217 ASP A O   1 
ATOM   1376 C CB  . ASP A 1 179 ? 7.628   10.611  5.929   1.00 30.46 ? 217 ASP A CB  1 
ATOM   1377 C CG  . ASP A 1 179 ? 9.077   10.210  5.990   1.00 32.45 ? 217 ASP A CG  1 
ATOM   1378 O OD1 . ASP A 1 179 ? 9.909   10.826  5.281   1.00 30.86 ? 217 ASP A OD1 1 
ATOM   1379 O OD2 . ASP A 1 179 ? 9.366   9.265   6.748   1.00 34.23 ? 217 ASP A OD2 1 
ATOM   1380 N N   . LYS A 1 180 ? 8.549   12.388  3.070   1.00 31.17 ? 218 LYS A N   1 
ATOM   1381 C CA  . LYS A 1 180 ? 8.970   12.216  1.676   1.00 32.62 ? 218 LYS A CA  1 
ATOM   1382 C C   . LYS A 1 180 ? 9.540   10.826  1.391   1.00 33.07 ? 218 LYS A C   1 
ATOM   1383 O O   . LYS A 1 180 ? 9.499   10.350  0.260   1.00 33.03 ? 218 LYS A O   1 
ATOM   1384 C CB  . LYS A 1 180 ? 10.020  13.260  1.306   1.00 33.24 ? 218 LYS A CB  1 
ATOM   1385 C CG  . LYS A 1 180 ? 9.460   14.601  0.886   1.00 36.67 ? 218 LYS A CG  1 
ATOM   1386 C CD  . LYS A 1 180 ? 10.527  15.706  0.921   1.00 41.50 ? 218 LYS A CD  1 
ATOM   1387 C CE  . LYS A 1 180 ? 11.338  15.791  -0.359  1.00 45.93 ? 218 LYS A CE  1 
ATOM   1388 N NZ  . LYS A 1 180 ? 12.485  14.811  -0.365  1.00 50.21 ? 218 LYS A NZ  1 
ATOM   1389 N N   . ASP A 1 181 ? 10.074  10.188  2.426   1.00 33.78 ? 219 ASP A N   1 
ATOM   1390 C CA  . ASP A 1 181 ? 10.774  8.915   2.276   1.00 34.45 ? 219 ASP A CA  1 
ATOM   1391 C C   . ASP A 1 181 ? 9.862   7.705   2.478   1.00 33.95 ? 219 ASP A C   1 
ATOM   1392 O O   . ASP A 1 181 ? 10.273  6.572   2.244   1.00 34.47 ? 219 ASP A O   1 
ATOM   1393 C CB  . ASP A 1 181 ? 12.000  8.864   3.212   1.00 35.21 ? 219 ASP A CB  1 
ATOM   1394 C CG  . ASP A 1 181 ? 13.027  9.953   2.893   1.00 37.07 ? 219 ASP A CG  1 
ATOM   1395 O OD1 . ASP A 1 181 ? 13.276  10.223  1.699   1.00 39.64 ? 219 ASP A OD1 1 
ATOM   1396 O OD2 . ASP A 1 181 ? 13.577  10.559  3.840   1.00 40.39 ? 219 ASP A OD2 1 
ATOM   1397 N N   . SER A 1 182 ? 8.615   7.940   2.882   1.00 33.08 ? 220 SER A N   1 
ATOM   1398 C CA  . SER A 1 182 ? 7.635   6.857   2.975   1.00 32.47 ? 220 SER A CA  1 
ATOM   1399 C C   . SER A 1 182 ? 7.180   6.412   1.581   1.00 32.21 ? 220 SER A C   1 
ATOM   1400 O O   . SER A 1 182 ? 7.402   7.118   0.602   1.00 32.57 ? 220 SER A O   1 
ATOM   1401 C CB  . SER A 1 182 ? 6.440   7.298   3.807   1.00 32.34 ? 220 SER A CB  1 
ATOM   1402 O OG  . SER A 1 182 ? 5.658   8.242   3.102   1.00 33.16 ? 220 SER A OG  1 
ATOM   1403 N N   . THR A 1 183 ? 6.547   5.254   1.488   1.00 32.28 ? 221 THR A N   1 
ATOM   1404 C CA  . THR A 1 183 ? 6.010   4.809   0.203   1.00 32.49 ? 221 THR A CA  1 
ATOM   1405 C C   . THR A 1 183 ? 4.997   5.816   -0.327  1.00 31.69 ? 221 THR A C   1 
ATOM   1406 O O   . THR A 1 183 ? 5.016   6.128   -1.501  1.00 31.22 ? 221 THR A O   1 
ATOM   1407 C CB  . THR A 1 183 ? 5.351   3.430   0.265   1.00 32.49 ? 221 THR A CB  1 
ATOM   1408 O OG1 . THR A 1 183 ? 6.258   2.495   0.863   1.00 33.01 ? 221 THR A OG1 1 
ATOM   1409 C CG2 . THR A 1 183 ? 4.992   2.969   -1.152  1.00 33.80 ? 221 THR A CG2 1 
ATOM   1410 N N   . PHE A 1 184 ? 4.117   6.319   0.534   1.00 30.74 ? 222 PHE A N   1 
ATOM   1411 C CA  . PHE A 1 184 ? 3.226   7.376   0.100   1.00 30.04 ? 222 PHE A CA  1 
ATOM   1412 C C   . PHE A 1 184 ? 4.021   8.532   -0.492  1.00 29.78 ? 222 PHE A C   1 
ATOM   1413 O O   . PHE A 1 184 ? 3.762   8.958   -1.618  1.00 29.81 ? 222 PHE A O   1 
ATOM   1414 C CB  . PHE A 1 184 ? 2.360   7.901   1.230   1.00 29.47 ? 222 PHE A CB  1 
ATOM   1415 C CG  . PHE A 1 184 ? 1.627   9.152   0.863   1.00 28.78 ? 222 PHE A CG  1 
ATOM   1416 C CD1 . PHE A 1 184 ? 0.632   9.118   -0.118  1.00 27.63 ? 222 PHE A CD1 1 
ATOM   1417 C CD2 . PHE A 1 184 ? 1.945   10.366  1.465   1.00 27.98 ? 222 PHE A CD2 1 
ATOM   1418 C CE1 . PHE A 1 184 ? -0.039  10.263  -0.490  1.00 28.59 ? 222 PHE A CE1 1 
ATOM   1419 C CE2 . PHE A 1 184 ? 1.276   11.533  1.096   1.00 26.43 ? 222 PHE A CE2 1 
ATOM   1420 C CZ  . PHE A 1 184 ? 0.271   11.475  0.122   1.00 27.28 ? 222 PHE A CZ  1 
ATOM   1421 N N   . GLY A 1 185 ? 4.999   9.022   0.269   1.00 29.84 ? 223 GLY A N   1 
ATOM   1422 C CA  . GLY A 1 185 ? 5.775   10.202  -0.109  1.00 29.93 ? 223 GLY A CA  1 
ATOM   1423 C C   . GLY A 1 185 ? 6.672   10.038  -1.322  1.00 30.85 ? 223 GLY A C   1 
ATOM   1424 O O   . GLY A 1 185 ? 6.844   10.974  -2.106  1.00 30.64 ? 223 GLY A O   1 
ATOM   1425 N N   . SER A 1 186 ? 7.246   8.853   -1.475  1.00 30.90 ? 224 SER A N   1 
ATOM   1426 C CA  . SER A 1 186 ? 8.277   8.641   -2.487  1.00 30.96 ? 224 SER A CA  1 
ATOM   1427 C C   . SER A 1 186 ? 7.742   8.061   -3.788  1.00 30.81 ? 224 SER A C   1 
ATOM   1428 O O   . SER A 1 186 ? 8.315   8.305   -4.854  1.00 31.99 ? 224 SER A O   1 
ATOM   1429 C CB  . SER A 1 186 ? 9.368   7.731   -1.938  1.00 30.90 ? 224 SER A CB  1 
ATOM   1430 O OG  . SER A 1 186 ? 8.809   6.463   -1.668  1.00 30.75 ? 224 SER A OG  1 
ATOM   1431 N N   . VAL A 1 187 ? 6.650   7.308   -3.699  1.00 30.32 ? 225 VAL A N   1 
ATOM   1432 C CA  . VAL A 1 187 ? 6.100   6.584   -4.838  1.00 29.94 ? 225 VAL A CA  1 
ATOM   1433 C C   . VAL A 1 187 ? 4.707   7.124   -5.198  1.00 29.04 ? 225 VAL A C   1 
ATOM   1434 O O   . VAL A 1 187 ? 4.465   7.518   -6.343  1.00 28.57 ? 225 VAL A O   1 
ATOM   1435 C CB  . VAL A 1 187 ? 6.048   5.035   -4.579  1.00 30.34 ? 225 VAL A CB  1 
ATOM   1436 C CG1 . VAL A 1 187 ? 5.229   4.307   -5.646  1.00 30.02 ? 225 VAL A CG1 1 
ATOM   1437 C CG2 . VAL A 1 187 ? 7.464   4.446   -4.512  1.00 32.11 ? 225 VAL A CG2 1 
ATOM   1438 N N   . GLN A 1 188 ? 3.804   7.147   -4.233  1.00 27.78 ? 226 GLN A N   1 
ATOM   1439 C CA  . GLN A 1 188 ? 2.412   7.435   -4.567  1.00 27.57 ? 226 GLN A CA  1 
ATOM   1440 C C   . GLN A 1 188 ? 2.181   8.900   -4.916  1.00 27.65 ? 226 GLN A C   1 
ATOM   1441 O O   . GLN A 1 188 ? 1.546   9.200   -5.925  1.00 28.06 ? 226 GLN A O   1 
ATOM   1442 C CB  . GLN A 1 188 ? 1.467   6.920   -3.483  1.00 27.20 ? 226 GLN A CB  1 
ATOM   1443 C CG  . GLN A 1 188 ? 1.647   5.439   -3.204  1.00 28.07 ? 226 GLN A CG  1 
ATOM   1444 C CD  . GLN A 1 188 ? 0.598   4.862   -2.289  1.00 29.49 ? 226 GLN A CD  1 
ATOM   1445 O OE1 . GLN A 1 188 ? 0.373   5.374   -1.207  1.00 27.32 ? 226 GLN A OE1 1 
ATOM   1446 N NE2 . GLN A 1 188 ? -0.039  3.766   -2.716  1.00 29.36 ? 226 GLN A NE2 1 
ATOM   1447 N N   . VAL A 1 189 ? 2.754   9.812   -4.133  1.00 27.50 ? 227 VAL A N   1 
ATOM   1448 C CA  . VAL A 1 189 ? 2.666   11.237  -4.454  1.00 27.93 ? 227 VAL A CA  1 
ATOM   1449 C C   . VAL A 1 189 ? 3.097   11.539  -5.900  1.00 27.65 ? 227 VAL A C   1 
ATOM   1450 O O   . VAL A 1 189 ? 2.524   12.424  -6.539  1.00 27.91 ? 227 VAL A O   1 
ATOM   1451 C CB  . VAL A 1 189 ? 3.497   12.094  -3.467  1.00 28.53 ? 227 VAL A CB  1 
ATOM   1452 C CG1 . VAL A 1 189 ? 3.771   13.473  -4.029  1.00 29.34 ? 227 VAL A CG1 1 
ATOM   1453 C CG2 . VAL A 1 189 ? 2.774   12.210  -2.113  1.00 28.06 ? 227 VAL A CG2 1 
ATOM   1454 N N   . HIS A 1 190 ? 4.098   10.805  -6.392  1.00 27.34 ? 228 HIS A N   1 
ATOM   1455 C CA  . HIS A 1 190 ? 4.724   11.068  -7.686  1.00 27.53 ? 228 HIS A CA  1 
ATOM   1456 C C   . HIS A 1 190 ? 4.116   10.272  -8.816  1.00 28.15 ? 228 HIS A C   1 
ATOM   1457 O O   . HIS A 1 190 ? 4.517   10.424  -9.978  1.00 27.53 ? 228 HIS A O   1 
ATOM   1458 C CB  . HIS A 1 190 ? 6.240   10.856  -7.576  1.00 27.45 ? 228 HIS A CB  1 
ATOM   1459 C CG  . HIS A 1 190 ? 6.863   11.800  -6.606  1.00 27.11 ? 228 HIS A CG  1 
ATOM   1460 N ND1 . HIS A 1 190 ? 7.058   13.126  -6.908  1.00 27.70 ? 228 HIS A ND1 1 
ATOM   1461 C CD2 . HIS A 1 190 ? 7.210   11.654  -5.307  1.00 28.99 ? 228 HIS A CD2 1 
ATOM   1462 C CE1 . HIS A 1 190 ? 7.547   13.751  -5.853  1.00 28.76 ? 228 HIS A CE1 1 
ATOM   1463 N NE2 . HIS A 1 190 ? 7.648   12.881  -4.867  1.00 28.45 ? 228 HIS A NE2 1 
ATOM   1464 N N   . ASN A 1 191 ? 3.125   9.450   -8.470  1.00 27.97 ? 229 ASN A N   1 
ATOM   1465 C CA  . ASN A 1 191 ? 2.387   8.656   -9.456  1.00 28.34 ? 229 ASN A CA  1 
ATOM   1466 C C   . ASN A 1 191 ? 0.896   8.922   -9.554  1.00 28.40 ? 229 ASN A C   1 
ATOM   1467 O O   . ASN A 1 191 ? 0.207   8.255   -10.326 1.00 28.64 ? 229 ASN A O   1 
ATOM   1468 C CB  . ASN A 1 191 ? 2.692   7.180   -9.274  1.00 27.92 ? 229 ASN A CB  1 
ATOM   1469 C CG  . ASN A 1 191 ? 4.071   6.862   -9.743  1.00 29.56 ? 229 ASN A CG  1 
ATOM   1470 O OD1 . ASN A 1 191 ? 4.322   6.768   -10.956 1.00 29.50 ? 229 ASN A OD1 1 
ATOM   1471 N ND2 . ASN A 1 191 ? 5.004   6.775   -8.804  1.00 29.08 ? 229 ASN A ND2 1 
ATOM   1472 N N   . LEU A 1 192 ? 0.417   9.903   -8.792  1.00 28.61 ? 230 LEU A N   1 
ATOM   1473 C CA  . LEU A 1 192 ? -0.911  10.475  -8.997  1.00 28.87 ? 230 LEU A CA  1 
ATOM   1474 C C   . LEU A 1 192 ? -0.904  11.188  -10.334 1.00 29.28 ? 230 LEU A C   1 
ATOM   1475 O O   . LEU A 1 192 ? -0.041  12.040  -10.599 1.00 29.88 ? 230 LEU A O   1 
ATOM   1476 C CB  . LEU A 1 192 ? -1.260  11.459  -7.863  1.00 29.14 ? 230 LEU A CB  1 
ATOM   1477 C CG  . LEU A 1 192 ? -1.400  10.801  -6.485  1.00 29.40 ? 230 LEU A CG  1 
ATOM   1478 C CD1 . LEU A 1 192 ? -1.529  11.852  -5.358  1.00 30.08 ? 230 LEU A CD1 1 
ATOM   1479 C CD2 . LEU A 1 192 ? -2.573  9.811   -6.472  1.00 31.45 ? 230 LEU A CD2 1 
ATOM   1480 N N   . GLN A 1 193 ? -1.844  10.840  -11.196 1.00 28.98 ? 231 GLN A N   1 
ATOM   1481 C CA  . GLN A 1 193 ? -1.828  11.369  -12.561 1.00 29.16 ? 231 GLN A CA  1 
ATOM   1482 C C   . GLN A 1 193 ? -2.453  12.752  -12.583 1.00 28.24 ? 231 GLN A C   1 
ATOM   1483 O O   . GLN A 1 193 ? -3.623  12.887  -12.270 1.00 28.50 ? 231 GLN A O   1 
ATOM   1484 C CB  . GLN A 1 193 ? -2.573  10.429  -13.509 1.00 29.48 ? 231 GLN A CB  1 
ATOM   1485 C CG  . GLN A 1 193 ? -2.085  8.977   -13.454 1.00 33.05 ? 231 GLN A CG  1 
ATOM   1486 C CD  . GLN A 1 193 ? -0.763  8.794   -14.146 1.00 39.25 ? 231 GLN A CD  1 
ATOM   1487 O OE1 . GLN A 1 193 ? -0.703  8.795   -15.377 1.00 42.36 ? 231 GLN A OE1 1 
ATOM   1488 N NE2 . GLN A 1 193 ? 0.316   8.643   -13.364 1.00 40.41 ? 231 GLN A NE2 1 
ATOM   1489 N N   . PRO A 1 194 ? -1.666  13.783  -12.934 1.00 28.51 ? 232 PRO A N   1 
ATOM   1490 C CA  . PRO A 1 194 ? -2.165  15.146  -13.018 1.00 28.14 ? 232 PRO A CA  1 
ATOM   1491 C C   . PRO A 1 194 ? -3.344  15.311  -13.975 1.00 28.02 ? 232 PRO A C   1 
ATOM   1492 O O   . PRO A 1 194 ? -4.142  16.213  -13.792 1.00 27.26 ? 232 PRO A O   1 
ATOM   1493 C CB  . PRO A 1 194 ? -0.967  15.926  -13.558 1.00 28.67 ? 232 PRO A CB  1 
ATOM   1494 C CG  . PRO A 1 194 ? 0.221   15.145  -13.125 1.00 28.93 ? 232 PRO A CG  1 
ATOM   1495 C CD  . PRO A 1 194 ? -0.221  13.710  -13.241 1.00 28.17 ? 232 PRO A CD  1 
ATOM   1496 N N   . GLU A 1 195 ? -3.428  14.468  -15.000 1.00 28.06 ? 233 GLU A N   1 
ATOM   1497 C CA  . GLU A 1 195 ? -4.555  14.504  -15.928 1.00 28.59 ? 233 GLU A CA  1 
ATOM   1498 C C   . GLU A 1 195 ? -5.867  14.070  -15.258 1.00 28.30 ? 233 GLU A C   1 
ATOM   1499 O O   . GLU A 1 195 ? -6.940  14.474  -15.700 1.00 28.38 ? 233 GLU A O   1 
ATOM   1500 C CB  . GLU A 1 195 ? -4.291  13.584  -17.127 1.00 29.57 ? 233 GLU A CB  1 
ATOM   1501 C CG  . GLU A 1 195 ? -3.041  13.914  -17.965 1.00 32.55 ? 233 GLU A CG  1 
ATOM   1502 C CD  . GLU A 1 195 ? -1.709  13.427  -17.333 1.00 37.48 ? 233 GLU A CD  1 
ATOM   1503 O OE1 . GLU A 1 195 ? -1.701  12.815  -16.231 1.00 37.66 ? 233 GLU A OE1 1 
ATOM   1504 O OE2 . GLU A 1 195 ? -0.653  13.677  -17.956 1.00 41.08 ? 233 GLU A OE2 1 
ATOM   1505 N N   . LYS A 1 196 ? -5.777  13.238  -14.218 1.00 27.51 ? 234 LYS A N   1 
ATOM   1506 C CA  . LYS A 1 196 ? -6.964  12.585  -13.622 1.00 28.12 ? 234 LYS A CA  1 
ATOM   1507 C C   . LYS A 1 196 ? -7.270  13.085  -12.199 1.00 26.54 ? 234 LYS A C   1 
ATOM   1508 O O   . LYS A 1 196 ? -8.420  13.151  -11.783 1.00 25.76 ? 234 LYS A O   1 
ATOM   1509 C CB  . LYS A 1 196 ? -6.740  11.068  -13.525 1.00 28.79 ? 234 LYS A CB  1 
ATOM   1510 C CG  . LYS A 1 196 ? -6.735  10.326  -14.847 1.00 32.40 ? 234 LYS A CG  1 
ATOM   1511 C CD  . LYS A 1 196 ? -5.812  9.110   -14.794 1.00 36.45 ? 234 LYS A CD  1 
ATOM   1512 C CE  . LYS A 1 196 ? -6.136  8.139   -13.650 1.00 37.52 ? 234 LYS A CE  1 
ATOM   1513 N NZ  . LYS A 1 196 ? -5.830  6.724   -14.040 1.00 35.89 ? 234 LYS A NZ  1 
ATOM   1514 N N   . VAL A 1 197 ? -6.225  13.375  -11.451 1.00 26.08 ? 235 VAL A N   1 
ATOM   1515 C CA  . VAL A 1 197 ? -6.383  13.709  -10.031 1.00 25.87 ? 235 VAL A CA  1 
ATOM   1516 C C   . VAL A 1 197 ? -6.612  15.200  -9.832  1.00 25.80 ? 235 VAL A C   1 
ATOM   1517 O O   . VAL A 1 197 ? -5.779  16.036  -10.184 1.00 25.78 ? 235 VAL A O   1 
ATOM   1518 C CB  . VAL A 1 197 ? -5.214  13.213  -9.179  1.00 25.93 ? 235 VAL A CB  1 
ATOM   1519 C CG1 . VAL A 1 197 ? -5.402  13.613  -7.707  1.00 25.27 ? 235 VAL A CG1 1 
ATOM   1520 C CG2 . VAL A 1 197 ? -5.095  11.693  -9.278  1.00 25.90 ? 235 VAL A CG2 1 
ATOM   1521 N N   . GLN A 1 198 ? -7.760  15.515  -9.257  1.00 25.32 ? 236 GLN A N   1 
ATOM   1522 C CA  . GLN A 1 198 ? -8.159  16.886  -9.057  1.00 25.39 ? 236 GLN A CA  1 
ATOM   1523 C C   . GLN A 1 198 ? -7.546  17.436  -7.767  1.00 24.89 ? 236 GLN A C   1 
ATOM   1524 O O   . GLN A 1 198 ? -6.966  18.516  -7.754  1.00 24.27 ? 236 GLN A O   1 
ATOM   1525 C CB  . GLN A 1 198 ? -9.678  16.941  -9.011  1.00 24.93 ? 236 GLN A CB  1 
ATOM   1526 C CG  . GLN A 1 198 ? -10.241 18.279  -9.392  1.00 29.22 ? 236 GLN A CG  1 
ATOM   1527 C CD  . GLN A 1 198 ? -10.614 19.104  -8.221  1.00 32.98 ? 236 GLN A CD  1 
ATOM   1528 O OE1 . GLN A 1 198 ? -10.816 18.589  -7.114  1.00 33.92 ? 236 GLN A OE1 1 
ATOM   1529 N NE2 . GLN A 1 198 ? -10.762 20.401  -8.451  1.00 34.18 ? 236 GLN A NE2 1 
ATOM   1530 N N   . THR A 1 199 ? -7.663  16.659  -6.697  1.00 25.02 ? 237 THR A N   1 
ATOM   1531 C CA  . THR A 1 199 ? -7.259  17.071  -5.357  1.00 25.41 ? 237 THR A CA  1 
ATOM   1532 C C   . THR A 1 199 ? -6.703  15.880  -4.599  1.00 25.54 ? 237 THR A C   1 
ATOM   1533 O O   . THR A 1 199 ? -7.231  14.778  -4.697  1.00 25.21 ? 237 THR A O   1 
ATOM   1534 C CB  . THR A 1 199 ? -8.465  17.592  -4.550  1.00 25.49 ? 237 THR A CB  1 
ATOM   1535 O OG1 . THR A 1 199 ? -9.083  18.663  -5.259  1.00 26.01 ? 237 THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 199 ? -8.036  18.101  -3.159  1.00 25.87 ? 237 THR A CG2 1 
ATOM   1537 N N   . LEU A 1 200 ? -5.619  16.116  -3.865  1.00 25.62 ? 238 LEU A N   1 
ATOM   1538 C CA  . LEU A 1 200 ? -5.192  15.202  -2.827  1.00 26.11 ? 238 LEU A CA  1 
ATOM   1539 C C   . LEU A 1 200 ? -5.614  15.838  -1.508  1.00 26.00 ? 238 LEU A C   1 
ATOM   1540 O O   . LEU A 1 200 ? -5.219  16.974  -1.193  1.00 26.00 ? 238 LEU A O   1 
ATOM   1541 C CB  . LEU A 1 200 ? -3.675  15.049  -2.832  1.00 25.79 ? 238 LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 200 ? -3.123  14.190  -1.688  1.00 28.28 ? 238 LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 200 ? -3.506  12.754  -1.908  1.00 26.84 ? 238 LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 200 ? -1.602  14.330  -1.577  1.00 27.89 ? 238 LEU A CD2 1 
ATOM   1545 N N   . GLU A 1 201 ? -6.402  15.110  -0.735  1.00 25.12 ? 239 GLU A N   1 
ATOM   1546 C CA  . GLU A 1 201 ? -6.825  15.629  0.553   1.00 25.42 ? 239 GLU A CA  1 
ATOM   1547 C C   . GLU A 1 201 ? -6.244  14.769  1.654   1.00 25.05 ? 239 GLU A C   1 
ATOM   1548 O O   . GLU A 1 201 ? -6.458  13.560  1.683   1.00 24.71 ? 239 GLU A O   1 
ATOM   1549 C CB  . GLU A 1 201 ? -8.340  15.683  0.664   1.00 24.59 ? 239 GLU A CB  1 
ATOM   1550 C CG  . GLU A 1 201 ? -8.830  16.062  2.095   1.00 25.79 ? 239 GLU A CG  1 
ATOM   1551 C CD  . GLU A 1 201 ? -10.304 16.415  2.148   1.00 26.43 ? 239 GLU A CD  1 
ATOM   1552 O OE1 . GLU A 1 201 ? -11.088 15.604  2.665   1.00 26.61 ? 239 GLU A OE1 1 
ATOM   1553 O OE2 . GLU A 1 201 ? -10.667 17.517  1.683   1.00 30.78 ? 239 GLU A OE2 1 
ATOM   1554 N N   . ALA A 1 202 ? -5.513  15.405  2.558   1.00 24.67 ? 240 ALA A N   1 
ATOM   1555 C CA  . ALA A 1 202 ? -4.911  14.700  3.675   1.00 24.61 ? 240 ALA A CA  1 
ATOM   1556 C C   . ALA A 1 202 ? -5.813  14.786  4.892   1.00 24.59 ? 240 ALA A C   1 
ATOM   1557 O O   . ALA A 1 202 ? -6.408  15.823  5.167   1.00 24.95 ? 240 ALA A O   1 
ATOM   1558 C CB  . ALA A 1 202 ? -3.532  15.263  3.975   1.00 24.17 ? 240 ALA A CB  1 
ATOM   1559 N N   . TRP A 1 203 ? -5.951  13.664  5.587   1.00 24.11 ? 241 TRP A N   1 
ATOM   1560 C CA  . TRP A 1 203 ? -6.637  13.626  6.863   1.00 24.90 ? 241 TRP A CA  1 
ATOM   1561 C C   . TRP A 1 203 ? -5.561  13.340  7.883   1.00 24.92 ? 241 TRP A C   1 
ATOM   1562 O O   . TRP A 1 203 ? -5.007  12.238  7.904   1.00 25.66 ? 241 TRP A O   1 
ATOM   1563 C CB  . TRP A 1 203 ? -7.668  12.494  6.884   1.00 24.93 ? 241 TRP A CB  1 
ATOM   1564 C CG  . TRP A 1 203 ? -8.806  12.664  5.918   1.00 25.35 ? 241 TRP A CG  1 
ATOM   1565 C CD1 . TRP A 1 203 ? -9.156  13.807  5.245   1.00 25.29 ? 241 TRP A CD1 1 
ATOM   1566 C CD2 . TRP A 1 203 ? -9.755  11.665  5.524   1.00 25.96 ? 241 TRP A CD2 1 
ATOM   1567 N NE1 . TRP A 1 203 ? -10.265 13.584  4.478   1.00 24.96 ? 241 TRP A NE1 1 
ATOM   1568 C CE2 . TRP A 1 203 ? -10.644 12.273  4.611   1.00 25.46 ? 241 TRP A CE2 1 
ATOM   1569 C CE3 . TRP A 1 203 ? -9.925  10.311  5.835   1.00 25.91 ? 241 TRP A CE3 1 
ATOM   1570 C CZ2 . TRP A 1 203 ? -11.712 11.582  4.028   1.00 26.60 ? 241 TRP A CZ2 1 
ATOM   1571 C CZ3 . TRP A 1 203 ? -10.984 9.622   5.252   1.00 26.16 ? 241 TRP A CZ3 1 
ATOM   1572 C CH2 . TRP A 1 203 ? -11.870 10.263  4.358   1.00 25.75 ? 241 TRP A CH2 1 
ATOM   1573 N N   . VAL A 1 204 ? -5.250  14.324  8.716   1.00 24.88 ? 242 VAL A N   1 
ATOM   1574 C CA  . VAL A 1 204 ? -4.135  14.198  9.632   1.00 24.71 ? 242 VAL A CA  1 
ATOM   1575 C C   . VAL A 1 204 ? -4.688  13.756  10.981  1.00 25.38 ? 242 VAL A C   1 
ATOM   1576 O O   . VAL A 1 204 ? -5.422  14.495  11.636  1.00 24.56 ? 242 VAL A O   1 
ATOM   1577 C CB  . VAL A 1 204 ? -3.348  15.525  9.750   1.00 25.04 ? 242 VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 204 ? -2.206  15.378  10.754  1.00 23.79 ? 242 VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 204 ? -2.825  15.931  8.378   1.00 24.23 ? 242 VAL A CG2 1 
ATOM   1580 N N   . ILE A 1 205 ? -4.351  12.528  11.352  1.00 26.12 ? 243 ILE A N   1 
ATOM   1581 C CA  . ILE A 1 205 ? -4.913  11.858  12.521  1.00 27.08 ? 243 ILE A CA  1 
ATOM   1582 C C   . ILE A 1 205 ? -4.116  12.247  13.765  1.00 28.05 ? 243 ILE A C   1 
ATOM   1583 O O   . ILE A 1 205 ? -2.910  12.001  13.836  1.00 27.49 ? 243 ILE A O   1 
ATOM   1584 C CB  . ILE A 1 205 ? -4.833  10.323  12.324  1.00 26.85 ? 243 ILE A CB  1 
ATOM   1585 C CG1 . ILE A 1 205 ? -5.427  9.898   10.960  1.00 26.47 ? 243 ILE A CG1 1 
ATOM   1586 C CG2 . ILE A 1 205 ? -5.452  9.576   13.494  1.00 26.14 ? 243 ILE A CG2 1 
ATOM   1587 C CD1 . ILE A 1 205 ? -6.833  10.393  10.679  1.00 27.12 ? 243 ILE A CD1 1 
ATOM   1588 N N   . HIS A 1 206 ? -4.787  12.843  14.748  1.00 30.22 ? 244 HIS A N   1 
ATOM   1589 C CA  . HIS A 1 206 ? -4.148  13.197  16.012  1.00 31.64 ? 244 HIS A CA  1 
ATOM   1590 C C   . HIS A 1 206 ? -4.058  11.971  16.920  1.00 33.96 ? 244 HIS A C   1 
ATOM   1591 O O   . HIS A 1 206 ? -4.968  11.151  16.935  1.00 34.19 ? 244 HIS A O   1 
ATOM   1592 C CB  . HIS A 1 206 ? -4.956  14.279  16.713  1.00 30.98 ? 244 HIS A CB  1 
ATOM   1593 C CG  . HIS A 1 206 ? -4.797  15.639  16.115  1.00 29.63 ? 244 HIS A CG  1 
ATOM   1594 N ND1 . HIS A 1 206 ? -5.041  15.907  14.782  1.00 27.55 ? 244 HIS A ND1 1 
ATOM   1595 C CD2 . HIS A 1 206 ? -4.426  16.812  16.674  1.00 27.38 ? 244 HIS A CD2 1 
ATOM   1596 C CE1 . HIS A 1 206 ? -4.827  17.189  14.549  1.00 26.76 ? 244 HIS A CE1 1 
ATOM   1597 N NE2 . HIS A 1 206 ? -4.457  17.762  15.681  1.00 30.06 ? 244 HIS A NE2 1 
ATOM   1598 N N   . GLY A 1 207 ? -2.979  11.860  17.695  1.00 36.36 ? 245 GLY A N   1 
ATOM   1599 C CA  . GLY A 1 207 ? -2.777  10.671  18.537  1.00 39.52 ? 245 GLY A CA  1 
ATOM   1600 C C   . GLY A 1 207 ? -2.118  10.872  19.888  1.00 41.90 ? 245 GLY A C   1 
ATOM   1601 O O   . GLY A 1 207 ? -1.057  10.292  20.157  1.00 42.77 ? 245 GLY A O   1 
ATOM   1602 N N   . GLY A 1 208 ? -2.742  11.666  20.758  1.00 43.48 ? 246 GLY A N   1 
ATOM   1603 C CA  . GLY A 1 208 ? -2.144  11.951  22.063  1.00 45.00 ? 246 GLY A CA  1 
ATOM   1604 C C   . GLY A 1 208 ? -2.984  12.728  23.058  1.00 46.31 ? 246 GLY A C   1 
ATOM   1605 O O   . GLY A 1 208 ? -4.220  12.727  22.985  1.00 46.57 ? 246 GLY A O   1 
ATOM   1606 N N   . ARG A 1 209 ? -2.290  13.390  23.991  1.00 47.04 ? 247 ARG A N   1 
ATOM   1607 C CA  . ARG A 1 209 ? -2.903  14.103  25.118  1.00 47.79 ? 247 ARG A CA  1 
ATOM   1608 C C   . ARG A 1 209 ? -3.474  15.469  24.748  1.00 47.69 ? 247 ARG A C   1 
ATOM   1609 O O   . ARG A 1 209 ? -2.902  16.196  23.925  1.00 47.94 ? 247 ARG A O   1 
ATOM   1610 C CB  . ARG A 1 209 ? -1.889  14.292  26.259  1.00 47.76 ? 247 ARG A CB  1 
ATOM   1611 C CG  . ARG A 1 209 ? -1.500  13.020  27.012  1.00 48.54 ? 247 ARG A CG  1 
ATOM   1612 C CD  . ARG A 1 209 ? -0.717  13.359  28.279  1.00 49.04 ? 247 ARG A CD  1 
ATOM   1613 N NE  . ARG A 1 209 ? -0.160  12.171  28.929  1.00 51.95 ? 247 ARG A NE  1 
ATOM   1614 C CZ  . ARG A 1 209 ? 0.645   12.199  29.990  1.00 53.14 ? 247 ARG A CZ  1 
ATOM   1615 N NH1 . ARG A 1 209 ? 0.996   13.358  30.540  1.00 54.03 ? 247 ARG A NH1 1 
ATOM   1616 N NH2 . ARG A 1 209 ? 1.100   11.065  30.510  1.00 54.19 ? 247 ARG A NH2 1 
ATOM   1617 N N   . GLU A 1 210 ? -4.610  15.792  25.373  1.00 47.45 ? 248 GLU A N   1 
ATOM   1618 C CA  . GLU A 1 210 ? -5.232  17.129  25.363  1.00 46.94 ? 248 GLU A CA  1 
ATOM   1619 C C   . GLU A 1 210 ? -5.417  17.805  23.989  1.00 46.17 ? 248 GLU A C   1 
ATOM   1620 O O   . GLU A 1 210 ? -5.287  17.159  22.951  1.00 46.03 ? 248 GLU A O   1 
ATOM   1621 C CB  . GLU A 1 210 ? -4.520  18.063  26.353  1.00 47.17 ? 248 GLU A CB  1 
ATOM   1622 C CG  . GLU A 1 210 ? -4.984  17.935  27.794  1.00 48.00 ? 248 GLU A CG  1 
ATOM   1623 C CD  . GLU A 1 210 ? -4.627  19.152  28.638  1.00 50.00 ? 248 GLU A CD  1 
ATOM   1624 O OE1 . GLU A 1 210 ? -5.300  20.200  28.496  1.00 50.63 ? 248 GLU A OE1 1 
ATOM   1625 O OE2 . GLU A 1 210 ? -3.683  19.058  29.456  1.00 50.29 ? 248 GLU A OE2 1 
ATOM   1626 N N   . ASP A 1 211 ? -5.742  19.103  24.013  1.00 45.27 ? 249 ASP A N   1 
ATOM   1627 C CA  . ASP A 1 211 ? -6.077  19.890  22.809  1.00 44.10 ? 249 ASP A CA  1 
ATOM   1628 C C   . ASP A 1 211 ? -4.855  20.147  21.930  1.00 42.54 ? 249 ASP A C   1 
ATOM   1629 O O   . ASP A 1 211 ? -3.834  20.650  22.398  1.00 42.16 ? 249 ASP A O   1 
ATOM   1630 C CB  . ASP A 1 211 ? -6.737  21.220  23.200  1.00 44.64 ? 249 ASP A CB  1 
ATOM   1631 C CG  . ASP A 1 211 ? -7.960  21.036  24.086  1.00 45.98 ? 249 ASP A CG  1 
ATOM   1632 O OD1 . ASP A 1 211 ? -8.090  19.982  24.756  1.00 47.56 ? 249 ASP A OD1 1 
ATOM   1633 O OD2 . ASP A 1 211 ? -8.794  21.966  24.129  1.00 47.80 ? 249 ASP A OD2 1 
ATOM   1634 N N   . SER A 1 212 ? -4.972  19.798  20.651  1.00 40.77 ? 250 SER A N   1 
ATOM   1635 C CA  . SER A 1 212 ? -3.818  19.728  19.772  1.00 38.90 ? 250 SER A CA  1 
ATOM   1636 C C   . SER A 1 212 ? -3.765  20.914  18.796  1.00 37.24 ? 250 SER A C   1 
ATOM   1637 O O   . SER A 1 212 ? -4.769  21.595  18.568  1.00 36.72 ? 250 SER A O   1 
ATOM   1638 C CB  . SER A 1 212 ? -3.841  18.390  19.016  1.00 39.19 ? 250 SER A CB  1 
ATOM   1639 O OG  . SER A 1 212 ? -2.539  17.841  18.852  1.00 40.25 ? 250 SER A OG  1 
ATOM   1640 N N   . ARG A 1 213 ? -2.577  21.162  18.249  1.00 35.23 ? 251 ARG A N   1 
ATOM   1641 C CA  . ARG A 1 213 ? -2.389  22.136  17.172  1.00 33.75 ? 251 ARG A CA  1 
ATOM   1642 C C   . ARG A 1 213 ? -3.189  21.784  15.922  1.00 31.65 ? 251 ARG A C   1 
ATOM   1643 O O   . ARG A 1 213 ? -3.654  20.655  15.754  1.00 31.33 ? 251 ARG A O   1 
ATOM   1644 C CB  . ARG A 1 213 ? -0.920  22.215  16.741  1.00 33.90 ? 251 ARG A CB  1 
ATOM   1645 C CG  . ARG A 1 213 ? 0.056   22.590  17.810  1.00 35.68 ? 251 ARG A CG  1 
ATOM   1646 C CD  . ARG A 1 213 ? 0.907   21.393  18.153  1.00 38.02 ? 251 ARG A CD  1 
ATOM   1647 N NE  . ARG A 1 213 ? 1.759   20.970  17.047  1.00 39.79 ? 251 ARG A NE  1 
ATOM   1648 C CZ  . ARG A 1 213 ? 2.271   19.747  16.923  1.00 40.77 ? 251 ARG A CZ  1 
ATOM   1649 N NH1 . ARG A 1 213 ? 1.999   18.804  17.823  1.00 39.87 ? 251 ARG A NH1 1 
ATOM   1650 N NH2 . ARG A 1 213 ? 3.040   19.456  15.879  1.00 42.86 ? 251 ARG A NH2 1 
ATOM   1651 N N   . ASP A 1 214 ? -3.323  22.771  15.043  1.00 29.48 ? 252 ASP A N   1 
ATOM   1652 C CA  . ASP A 1 214 ? -3.793  22.551  13.695  1.00 27.53 ? 252 ASP A CA  1 
ATOM   1653 C C   . ASP A 1 214 ? -2.629  21.951  12.918  1.00 26.90 ? 252 ASP A C   1 
ATOM   1654 O O   . ASP A 1 214 ? -1.724  22.659  12.462  1.00 26.72 ? 252 ASP A O   1 
ATOM   1655 C CB  . ASP A 1 214 ? -4.234  23.880  13.072  1.00 27.21 ? 252 ASP A CB  1 
ATOM   1656 C CG  . ASP A 1 214 ? -4.658  23.741  11.607  1.00 25.73 ? 252 ASP A CG  1 
ATOM   1657 O OD1 . ASP A 1 214 ? -4.626  22.623  11.052  1.00 25.29 ? 252 ASP A OD1 1 
ATOM   1658 O OD2 . ASP A 1 214 ? -5.030  24.761  11.011  1.00 23.52 ? 252 ASP A OD2 1 
ATOM   1659 N N   . LEU A 1 215 ? -2.646  20.633  12.774  1.00 25.28 ? 253 LEU A N   1 
ATOM   1660 C CA  . LEU A 1 215 ? -1.515  19.954  12.196  1.00 24.20 ? 253 LEU A CA  1 
ATOM   1661 C C   . LEU A 1 215 ? -1.463  20.122  10.687  1.00 24.37 ? 253 LEU A C   1 
ATOM   1662 O O   . LEU A 1 215 ? -0.479  19.784  10.073  1.00 23.80 ? 253 LEU A O   1 
ATOM   1663 C CB  . LEU A 1 215 ? -1.502  18.478  12.583  1.00 23.65 ? 253 LEU A CB  1 
ATOM   1664 C CG  . LEU A 1 215 ? -1.268  18.179  14.063  1.00 22.14 ? 253 LEU A CG  1 
ATOM   1665 C CD1 . LEU A 1 215 ? -1.324  16.687  14.274  1.00 21.04 ? 253 LEU A CD1 1 
ATOM   1666 C CD2 . LEU A 1 215 ? 0.072   18.734  14.517  1.00 22.36 ? 253 LEU A CD2 1 
ATOM   1667 N N   . CYS A 1 216 ? -2.518  20.661  10.094  1.00 25.22 ? 254 CYS A N   1 
ATOM   1668 C CA  . CYS A 1 216 ? -2.484  20.939  8.660   1.00 26.15 ? 254 CYS A CA  1 
ATOM   1669 C C   . CYS A 1 216 ? -1.527  22.100  8.355   1.00 26.34 ? 254 CYS A C   1 
ATOM   1670 O O   . CYS A 1 216 ? -1.187  22.335  7.200   1.00 26.70 ? 254 CYS A O   1 
ATOM   1671 C CB  . CYS A 1 216 ? -3.885  21.223  8.143   1.00 26.62 ? 254 CYS A CB  1 
ATOM   1672 S SG  . CYS A 1 216 ? -4.831  19.734  8.073   1.00 29.32 ? 254 CYS A SG  1 
ATOM   1673 N N   . GLN A 1 217 ? -1.074  22.794  9.401   1.00 26.21 ? 255 GLN A N   1 
ATOM   1674 C CA  . GLN A 1 217 ? -0.103  23.879  9.253   1.00 26.32 ? 255 GLN A CA  1 
ATOM   1675 C C   . GLN A 1 217 ? 1.325   23.420  9.501   1.00 25.79 ? 255 GLN A C   1 
ATOM   1676 O O   . GLN A 1 217 ? 2.268   24.218  9.448   1.00 25.45 ? 255 GLN A O   1 
ATOM   1677 C CB  . GLN A 1 217 ? -0.431  25.065  10.189  1.00 27.02 ? 255 GLN A CB  1 
ATOM   1678 C CG  . GLN A 1 217 ? -1.888  25.575  10.156  1.00 29.79 ? 255 GLN A CG  1 
ATOM   1679 C CD  . GLN A 1 217 ? -2.495  25.649  8.755   1.00 34.76 ? 255 GLN A CD  1 
ATOM   1680 O OE1 . GLN A 1 217 ? -1.818  25.992  7.778   1.00 38.15 ? 255 GLN A OE1 1 
ATOM   1681 N NE2 . GLN A 1 217 ? -3.789  25.331  8.655   1.00 35.44 ? 255 GLN A NE2 1 
ATOM   1682 N N   . ASP A 1 218 ? 1.487   22.135  9.793   1.00 25.46 ? 256 ASP A N   1 
ATOM   1683 C CA  . ASP A 1 218 ? 2.809   21.565  9.993   1.00 25.90 ? 256 ASP A CA  1 
ATOM   1684 C C   . ASP A 1 218 ? 3.675   21.771  8.744   1.00 26.04 ? 256 ASP A C   1 
ATOM   1685 O O   . ASP A 1 218 ? 3.169   21.693  7.630   1.00 26.53 ? 256 ASP A O   1 
ATOM   1686 C CB  . ASP A 1 218 ? 2.687   20.071  10.284  1.00 25.71 ? 256 ASP A CB  1 
ATOM   1687 C CG  . ASP A 1 218 ? 4.010   19.440  10.628  1.00 26.23 ? 256 ASP A CG  1 
ATOM   1688 O OD1 . ASP A 1 218 ? 4.660   18.875  9.719   1.00 27.06 ? 256 ASP A OD1 1 
ATOM   1689 O OD2 . ASP A 1 218 ? 4.400   19.523  11.807  1.00 25.59 ? 256 ASP A OD2 1 
ATOM   1690 N N   . PRO A 1 219 ? 4.974   22.054  8.930   1.00 26.26 ? 257 PRO A N   1 
ATOM   1691 C CA  . PRO A 1 219 ? 5.895   22.256  7.812   1.00 26.30 ? 257 PRO A CA  1 
ATOM   1692 C C   . PRO A 1 219 ? 5.957   21.090  6.815   1.00 26.32 ? 257 PRO A C   1 
ATOM   1693 O O   . PRO A 1 219 ? 6.103   21.328  5.610   1.00 26.17 ? 257 PRO A O   1 
ATOM   1694 C CB  . PRO A 1 219 ? 7.243   22.473  8.515   1.00 26.69 ? 257 PRO A CB  1 
ATOM   1695 C CG  . PRO A 1 219 ? 6.869   23.063  9.823   1.00 27.02 ? 257 PRO A CG  1 
ATOM   1696 C CD  . PRO A 1 219 ? 5.650   22.268  10.222  1.00 26.11 ? 257 PRO A CD  1 
ATOM   1697 N N   . THR A 1 220 ? 5.813   19.849  7.289   1.00 26.15 ? 258 THR A N   1 
ATOM   1698 C CA  . THR A 1 220 ? 5.812   18.706  6.375   1.00 25.98 ? 258 THR A CA  1 
ATOM   1699 C C   . THR A 1 220 ? 4.546   18.665  5.525   1.00 26.36 ? 258 THR A C   1 
ATOM   1700 O O   . THR A 1 220 ? 4.566   18.164  4.394   1.00 26.91 ? 258 THR A O   1 
ATOM   1701 C CB  . THR A 1 220 ? 6.025   17.354  7.086   1.00 26.03 ? 258 THR A CB  1 
ATOM   1702 O OG1 . THR A 1 220 ? 4.879   17.023  7.879   1.00 25.40 ? 258 THR A OG1 1 
ATOM   1703 C CG2 . THR A 1 220 ? 7.250   17.400  7.961   1.00 26.04 ? 258 THR A CG2 1 
ATOM   1704 N N   . ILE A 1 221 ? 3.444   19.173  6.066   1.00 25.98 ? 259 ILE A N   1 
ATOM   1705 C CA  . ILE A 1 221 ? 2.209   19.293  5.291   1.00 26.00 ? 259 ILE A CA  1 
ATOM   1706 C C   . ILE A 1 221 ? 2.333   20.396  4.223   1.00 26.13 ? 259 ILE A C   1 
ATOM   1707 O O   . ILE A 1 221 ? 1.840   20.243  3.108   1.00 26.21 ? 259 ILE A O   1 
ATOM   1708 C CB  . ILE A 1 221 ? 0.975   19.521  6.217   1.00 25.97 ? 259 ILE A CB  1 
ATOM   1709 C CG1 . ILE A 1 221 ? 0.803   18.339  7.181   1.00 25.15 ? 259 ILE A CG1 1 
ATOM   1710 C CG2 . ILE A 1 221 ? -0.309  19.671  5.411   1.00 25.02 ? 259 ILE A CG2 1 
ATOM   1711 C CD1 . ILE A 1 221 ? 0.325   17.061  6.529   1.00 26.91 ? 259 ILE A CD1 1 
ATOM   1712 N N   . LYS A 1 222 ? 2.983   21.508  4.577   1.00 26.68 ? 260 LYS A N   1 
ATOM   1713 C CA  . LYS A 1 222 ? 3.305   22.543  3.596   1.00 27.01 ? 260 LYS A CA  1 
ATOM   1714 C C   . LYS A 1 222 ? 4.231   21.974  2.509   1.00 27.30 ? 260 LYS A C   1 
ATOM   1715 O O   . LYS A 1 222 ? 4.074   22.278  1.331   1.00 27.08 ? 260 LYS A O   1 
ATOM   1716 C CB  . LYS A 1 222 ? 3.927   23.779  4.268   1.00 27.25 ? 260 LYS A CB  1 
ATOM   1717 C CG  . LYS A 1 222 ? 3.010   24.510  5.254   1.00 27.71 ? 260 LYS A CG  1 
ATOM   1718 C CD  . LYS A 1 222 ? 1.713   25.025  4.613   1.00 30.37 ? 260 LYS A CD  1 
ATOM   1719 C CE  . LYS A 1 222 ? 0.541   24.092  4.860   1.00 32.89 ? 260 LYS A CE  1 
ATOM   1720 N NZ  . LYS A 1 222 ? -0.717  24.559  4.171   1.00 33.70 ? 260 LYS A NZ  1 
ATOM   1721 N N   . GLU A 1 223 ? 5.188   21.153  2.916   1.00 27.81 ? 261 GLU A N   1 
ATOM   1722 C CA  . GLU A 1 223 ? 6.033   20.420  1.973   1.00 28.91 ? 261 GLU A CA  1 
ATOM   1723 C C   . GLU A 1 223 ? 5.175   19.596  0.998   1.00 27.59 ? 261 GLU A C   1 
ATOM   1724 O O   . GLU A 1 223 ? 5.333   19.705  -0.213  1.00 26.78 ? 261 GLU A O   1 
ATOM   1725 C CB  . GLU A 1 223 ? 7.012   19.527  2.742   1.00 28.77 ? 261 GLU A CB  1 
ATOM   1726 C CG  . GLU A 1 223 ? 7.980   18.687  1.893   1.00 32.02 ? 261 GLU A CG  1 
ATOM   1727 C CD  . GLU A 1 223 ? 8.975   17.869  2.748   1.00 33.83 ? 261 GLU A CD  1 
ATOM   1728 O OE1 . GLU A 1 223 ? 10.179  18.234  2.795   1.00 41.00 ? 261 GLU A OE1 1 
ATOM   1729 O OE2 . GLU A 1 223 ? 8.562   16.864  3.384   1.00 39.39 ? 261 GLU A OE2 1 
ATOM   1730 N N   . LEU A 1 224 ? 4.257   18.795  1.530   1.00 27.12 ? 262 LEU A N   1 
ATOM   1731 C CA  . LEU A 1 224 ? 3.398   17.944  0.689   1.00 26.72 ? 262 LEU A CA  1 
ATOM   1732 C C   . LEU A 1 224 ? 2.572   18.784  -0.268  1.00 26.87 ? 262 LEU A C   1 
ATOM   1733 O O   . LEU A 1 224 ? 2.481   18.491  -1.470  1.00 26.26 ? 262 LEU A O   1 
ATOM   1734 C CB  . LEU A 1 224 ? 2.465   17.107  1.565   1.00 26.21 ? 262 LEU A CB  1 
ATOM   1735 C CG  . LEU A 1 224 ? 1.365   16.288  0.880   1.00 25.89 ? 262 LEU A CG  1 
ATOM   1736 C CD1 . LEU A 1 224 ? 1.936   15.353  -0.199  1.00 25.01 ? 262 LEU A CD1 1 
ATOM   1737 C CD2 . LEU A 1 224 ? 0.584   15.510  1.933   1.00 23.34 ? 262 LEU A CD2 1 
ATOM   1738 N N   . GLU A 1 225 ? 1.977   19.843  0.270   1.00 26.95 ? 263 GLU A N   1 
ATOM   1739 C CA  . GLU A 1 225 ? 1.157   20.745  -0.515  1.00 26.90 ? 263 GLU A CA  1 
ATOM   1740 C C   . GLU A 1 225 ? 1.952   21.309  -1.689  1.00 26.77 ? 263 GLU A C   1 
ATOM   1741 O O   . GLU A 1 225 ? 1.471   21.338  -2.812  1.00 25.87 ? 263 GLU A O   1 
ATOM   1742 C CB  . GLU A 1 225 ? 0.668   21.883  0.365   1.00 27.74 ? 263 GLU A CB  1 
ATOM   1743 C CG  . GLU A 1 225 ? -0.114  22.943  -0.383  1.00 29.63 ? 263 GLU A CG  1 
ATOM   1744 C CD  . GLU A 1 225 ? -0.607  24.040  0.536   1.00 33.38 ? 263 GLU A CD  1 
ATOM   1745 O OE1 . GLU A 1 225 ? 0.159   24.482  1.417   1.00 33.94 ? 263 GLU A OE1 1 
ATOM   1746 O OE2 . GLU A 1 225 ? -1.762  24.471  0.361   1.00 36.35 ? 263 GLU A OE2 1 
ATOM   1747 N N   . SER A 1 226 ? 3.173   21.745  -1.402  1.00 26.56 ? 264 SER A N   1 
ATOM   1748 C CA  . SER A 1 226 ? 4.061   22.328  -2.391  1.00 27.47 ? 264 SER A CA  1 
ATOM   1749 C C   . SER A 1 226 ? 4.391   21.326  -3.496  1.00 26.57 ? 264 SER A C   1 
ATOM   1750 O O   . SER A 1 226 ? 4.295   21.656  -4.684  1.00 26.54 ? 264 SER A O   1 
ATOM   1751 C CB  . SER A 1 226 ? 5.343   22.804  -1.703  1.00 26.95 ? 264 SER A CB  1 
ATOM   1752 O OG  . SER A 1 226 ? 6.140   23.552  -2.597  1.00 33.89 ? 264 SER A OG  1 
ATOM   1753 N N   . ILE A 1 227 ? 4.773   20.110  -3.101  1.00 26.57 ? 265 ILE A N   1 
ATOM   1754 C CA  . ILE A 1 227 ? 5.109   19.053  -4.056  1.00 27.08 ? 265 ILE A CA  1 
ATOM   1755 C C   . ILE A 1 227 ? 3.957   18.768  -4.998  1.00 27.27 ? 265 ILE A C   1 
ATOM   1756 O O   . ILE A 1 227 ? 4.122   18.756  -6.230  1.00 26.92 ? 265 ILE A O   1 
ATOM   1757 C CB  . ILE A 1 227 ? 5.499   17.744  -3.355  1.00 27.30 ? 265 ILE A CB  1 
ATOM   1758 C CG1 . ILE A 1 227 ? 6.824   17.917  -2.588  1.00 28.20 ? 265 ILE A CG1 1 
ATOM   1759 C CG2 . ILE A 1 227 ? 5.637   16.604  -4.366  1.00 27.84 ? 265 ILE A CG2 1 
ATOM   1760 C CD1 . ILE A 1 227 ? 7.143   16.706  -1.705  1.00 30.62 ? 265 ILE A CD1 1 
ATOM   1761 N N   . ILE A 1 228 ? 2.791   18.536  -4.408  1.00 27.69 ? 266 ILE A N   1 
ATOM   1762 C CA  . ILE A 1 228 ? 1.615   18.169  -5.184  1.00 29.43 ? 266 ILE A CA  1 
ATOM   1763 C C   . ILE A 1 228 ? 1.152   19.338  -6.064  1.00 29.41 ? 266 ILE A C   1 
ATOM   1764 O O   . ILE A 1 228 ? 0.774   19.128  -7.224  1.00 28.84 ? 266 ILE A O   1 
ATOM   1765 C CB  . ILE A 1 228 ? 0.494   17.554  -4.281  1.00 29.95 ? 266 ILE A CB  1 
ATOM   1766 C CG1 . ILE A 1 228 ? -0.250  16.448  -5.022  1.00 31.65 ? 266 ILE A CG1 1 
ATOM   1767 C CG2 . ILE A 1 228 ? -0.488  18.579  -3.784  1.00 31.06 ? 266 ILE A CG2 1 
ATOM   1768 C CD1 . ILE A 1 228 ? 0.529   15.132  -5.052  1.00 34.49 ? 266 ILE A CD1 1 
ATOM   1769 N N   . SER A 1 229 ? 1.251   20.568  -5.549  1.00 30.30 ? 267 SER A N   1 
ATOM   1770 C CA  . SER A 1 229 ? 0.827   21.754  -6.311  1.00 31.52 ? 267 SER A CA  1 
ATOM   1771 C C   . SER A 1 229 ? 1.652   21.881  -7.574  1.00 32.24 ? 267 SER A C   1 
ATOM   1772 O O   . SER A 1 229 ? 1.129   22.216  -8.634  1.00 31.46 ? 267 SER A O   1 
ATOM   1773 C CB  . SER A 1 229 ? 0.985   23.035  -5.495  1.00 31.71 ? 267 SER A CB  1 
ATOM   1774 O OG  . SER A 1 229 ? 0.328   22.920  -4.253  1.00 34.49 ? 267 SER A OG  1 
ATOM   1775 N N   . LYS A 1 230 ? 2.953   21.601  -7.456  1.00 33.50 ? 268 LYS A N   1 
ATOM   1776 C CA  . LYS A 1 230 ? 3.832   21.655  -8.614  1.00 35.03 ? 268 LYS A CA  1 
ATOM   1777 C C   . LYS A 1 230 ? 3.366   20.668  -9.662  1.00 35.18 ? 268 LYS A C   1 
ATOM   1778 O O   . LYS A 1 230 ? 3.458   20.944  -10.854 1.00 36.45 ? 268 LYS A O   1 
ATOM   1779 C CB  . LYS A 1 230 ? 5.296   21.388  -8.248  1.00 35.77 ? 268 LYS A CB  1 
ATOM   1780 C CG  . LYS A 1 230 ? 6.053   20.577  -9.321  1.00 37.72 ? 268 LYS A CG  1 
ATOM   1781 C CD  . LYS A 1 230 ? 6.542   21.416  -10.510 1.00 38.73 ? 268 LYS A CD  1 
ATOM   1782 C CE  . LYS A 1 230 ? 7.225   20.539  -11.568 1.00 37.98 ? 268 LYS A CE  1 
ATOM   1783 N NZ  . LYS A 1 230 ? 7.362   21.294  -12.863 1.00 39.17 ? 268 LYS A NZ  1 
ATOM   1784 N N   . ARG A 1 231 ? 2.837   19.530  -9.221  1.00 35.01 ? 269 ARG A N   1 
ATOM   1785 C CA  . ARG A 1 231 ? 2.347   18.524  -10.144 1.00 34.67 ? 269 ARG A CA  1 
ATOM   1786 C C   . ARG A 1 231 ? 0.968   18.883  -10.714 1.00 34.28 ? 269 ARG A C   1 
ATOM   1787 O O   . ARG A 1 231 ? 0.342   18.053  -11.344 1.00 34.71 ? 269 ARG A O   1 
ATOM   1788 C CB  . ARG A 1 231 ? 2.306   17.145  -9.474  1.00 34.95 ? 269 ARG A CB  1 
ATOM   1789 C CG  . ARG A 1 231 ? 3.580   16.759  -8.746  1.00 35.06 ? 269 ARG A CG  1 
ATOM   1790 C CD  . ARG A 1 231 ? 3.646   15.245  -8.514  1.00 35.33 ? 269 ARG A CD  1 
ATOM   1791 N NE  . ARG A 1 231 ? 3.665   14.517  -9.791  1.00 34.15 ? 269 ARG A NE  1 
ATOM   1792 C CZ  . ARG A 1 231 ? 2.801   13.563  -10.125 1.00 35.03 ? 269 ARG A CZ  1 
ATOM   1793 N NH1 . ARG A 1 231 ? 1.866   13.204  -9.266  1.00 34.89 ? 269 ARG A NH1 1 
ATOM   1794 N NH2 . ARG A 1 231 ? 2.871   12.964  -11.312 1.00 32.22 ? 269 ARG A NH2 1 
ATOM   1795 N N   . ASN A 1 232 ? 0.510   20.118  -10.490 1.00 33.78 ? 270 ASN A N   1 
ATOM   1796 C CA  . ASN A 1 232 ? -0.815  20.590  -10.933 1.00 33.52 ? 270 ASN A CA  1 
ATOM   1797 C C   . ASN A 1 232 ? -2.016  19.860  -10.308 1.00 32.16 ? 270 ASN A C   1 
ATOM   1798 O O   . ASN A 1 232 ? -3.040  19.649  -10.962 1.00 32.43 ? 270 ASN A O   1 
ATOM   1799 C CB  . ASN A 1 232 ? -0.919  20.618  -12.471 1.00 34.81 ? 270 ASN A CB  1 
ATOM   1800 C CG  . ASN A 1 232 ? -0.028  21.678  -13.107 1.00 37.68 ? 270 ASN A CG  1 
ATOM   1801 O OD1 . ASN A 1 232 ? 0.477   21.488  -14.218 1.00 42.17 ? 270 ASN A OD1 1 
ATOM   1802 N ND2 . ASN A 1 232 ? 0.175   22.799  -12.408 1.00 40.04 ? 270 ASN A ND2 1 
ATOM   1803 N N   . ILE A 1 233 ? -1.886  19.498  -9.034  1.00 29.65 ? 271 ILE A N   1 
ATOM   1804 C CA  . ILE A 1 233 ? -2.951  18.849  -8.269  1.00 27.96 ? 271 ILE A CA  1 
ATOM   1805 C C   . ILE A 1 233 ? -3.230  19.735  -7.048  1.00 28.08 ? 271 ILE A C   1 
ATOM   1806 O O   . ILE A 1 233 ? -2.294  20.281  -6.447  1.00 27.62 ? 271 ILE A O   1 
ATOM   1807 C CB  . ILE A 1 233 ? -2.540  17.408  -7.838  1.00 28.02 ? 271 ILE A CB  1 
ATOM   1808 C CG1 . ILE A 1 233 ? -2.328  16.526  -9.079  1.00 26.57 ? 271 ILE A CG1 1 
ATOM   1809 C CG2 . ILE A 1 233 ? -3.559  16.818  -6.864  1.00 26.66 ? 271 ILE A CG2 1 
ATOM   1810 C CD1 . ILE A 1 233 ? -1.572  15.216  -8.817  1.00 27.01 ? 271 ILE A CD1 1 
ATOM   1811 N N   . GLN A 1 234 ? -4.508  19.919  -6.714  1.00 27.61 ? 272 GLN A N   1 
ATOM   1812 C CA  . GLN A 1 234 ? -4.877  20.781  -5.601  1.00 27.99 ? 272 GLN A CA  1 
ATOM   1813 C C   . GLN A 1 234 ? -4.669  20.038  -4.297  1.00 28.10 ? 272 GLN A C   1 
ATOM   1814 O O   . GLN A 1 234 ? -4.680  18.797  -4.257  1.00 27.99 ? 272 GLN A O   1 
ATOM   1815 C CB  . GLN A 1 234 ? -6.320  21.249  -5.707  1.00 27.90 ? 272 GLN A CB  1 
ATOM   1816 C CG  . GLN A 1 234 ? -6.510  22.247  -6.838  1.00 30.55 ? 272 GLN A CG  1 
ATOM   1817 C CD  . GLN A 1 234 ? -7.954  22.582  -7.125  1.00 33.61 ? 272 GLN A CD  1 
ATOM   1818 O OE1 . GLN A 1 234 ? -8.250  23.231  -8.127  1.00 35.45 ? 272 GLN A OE1 1 
ATOM   1819 N NE2 . GLN A 1 234 ? -8.862  22.143  -6.257  1.00 36.07 ? 272 GLN A NE2 1 
ATOM   1820 N N   . PHE A 1 235 ? -4.474  20.800  -3.233  1.00 28.54 ? 273 PHE A N   1 
ATOM   1821 C CA  . PHE A 1 235 ? -4.269  20.184  -1.942  1.00 28.26 ? 273 PHE A CA  1 
ATOM   1822 C C   . PHE A 1 235 ? -5.287  20.648  -0.938  1.00 28.56 ? 273 PHE A C   1 
ATOM   1823 O O   . PHE A 1 235 ? -5.603  21.826  -0.858  1.00 28.95 ? 273 PHE A O   1 
ATOM   1824 C CB  . PHE A 1 235 ? -2.861  20.450  -1.423  1.00 28.63 ? 273 PHE A CB  1 
ATOM   1825 C CG  . PHE A 1 235 ? -2.569  19.760  -0.120  1.00 27.42 ? 273 PHE A CG  1 
ATOM   1826 C CD1 . PHE A 1 235 ? -2.346  18.390  -0.092  1.00 26.30 ? 273 PHE A CD1 1 
ATOM   1827 C CD2 . PHE A 1 235 ? -2.531  20.478  1.069   1.00 28.80 ? 273 PHE A CD2 1 
ATOM   1828 C CE1 . PHE A 1 235 ? -2.089  17.730  1.107   1.00 28.32 ? 273 PHE A CE1 1 
ATOM   1829 C CE2 . PHE A 1 235 ? -2.262  19.832  2.276   1.00 27.08 ? 273 PHE A CE2 1 
ATOM   1830 C CZ  . PHE A 1 235 ? -2.044  18.463  2.301   1.00 27.19 ? 273 PHE A CZ  1 
ATOM   1831 N N   . SER A 1 236 ? -5.784  19.697  -0.158  1.00 28.39 ? 274 SER A N   1 
ATOM   1832 C CA  . SER A 1 236 ? -6.708  19.958  0.913   1.00 28.24 ? 274 SER A CA  1 
ATOM   1833 C C   . SER A 1 236 ? -6.196  19.218  2.134   1.00 27.71 ? 274 SER A C   1 
ATOM   1834 O O   . SER A 1 236 ? -5.494  18.204  2.007   1.00 27.17 ? 274 SER A O   1 
ATOM   1835 C CB  . SER A 1 236 ? -8.087  19.428  0.524   1.00 28.71 ? 274 SER A CB  1 
ATOM   1836 O OG  . SER A 1 236 ? -9.007  19.606  1.580   1.00 32.56 ? 274 SER A OG  1 
ATOM   1837 N N   . CYS A 1 237 ? -6.532  19.721  3.318   1.00 27.45 ? 275 CYS A N   1 
ATOM   1838 C CA  . CYS A 1 237 ? -6.109  19.059  4.541   1.00 27.20 ? 275 CYS A CA  1 
ATOM   1839 C C   . CYS A 1 237 ? -7.163  19.200  5.630   1.00 27.30 ? 275 CYS A C   1 
ATOM   1840 O O   . CYS A 1 237 ? -7.749  20.275  5.804   1.00 26.11 ? 275 CYS A O   1 
ATOM   1841 C CB  . CYS A 1 237 ? -4.776  19.644  5.019   1.00 28.14 ? 275 CYS A CB  1 
ATOM   1842 S SG  . CYS A 1 237 ? -4.037  18.788  6.430   1.00 27.95 ? 275 CYS A SG  1 
ATOM   1843 N N   . LYS A 1 238 ? -7.393  18.107  6.352   1.00 26.60 ? 276 LYS A N   1 
ATOM   1844 C CA  . LYS A 1 238 ? -8.332  18.083  7.446   1.00 27.14 ? 276 LYS A CA  1 
ATOM   1845 C C   . LYS A 1 238 ? -7.651  17.473  8.651   1.00 26.59 ? 276 LYS A C   1 
ATOM   1846 O O   . LYS A 1 238 ? -6.951  16.472  8.526   1.00 26.14 ? 276 LYS A O   1 
ATOM   1847 C CB  . LYS A 1 238 ? -9.556  17.235  7.096   1.00 27.41 ? 276 LYS A CB  1 
ATOM   1848 C CG  . LYS A 1 238 ? -10.330 17.722  5.902   1.00 30.17 ? 276 LYS A CG  1 
ATOM   1849 C CD  . LYS A 1 238 ? -11.043 19.024  6.225   1.00 34.81 ? 276 LYS A CD  1 
ATOM   1850 C CE  . LYS A 1 238 ? -11.497 19.748  4.961   1.00 38.53 ? 276 LYS A CE  1 
ATOM   1851 N NZ  . LYS A 1 238 ? -12.382 18.867  4.165   1.00 40.80 ? 276 LYS A NZ  1 
ATOM   1852 N N   . ASN A 1 239 ? -7.863  18.086  9.809   1.00 25.69 ? 277 ASN A N   1 
ATOM   1853 C CA  . ASN A 1 239 ? -7.493  17.479  11.075  1.00 25.12 ? 277 ASN A CA  1 
ATOM   1854 C C   . ASN A 1 239 ? -8.570  16.491  11.488  1.00 25.80 ? 277 ASN A C   1 
ATOM   1855 O O   . ASN A 1 239 ? -9.758  16.802  11.442  1.00 25.38 ? 277 ASN A O   1 
ATOM   1856 C CB  . ASN A 1 239 ? -7.383  18.545  12.169  1.00 25.23 ? 277 ASN A CB  1 
ATOM   1857 C CG  . ASN A 1 239 ? -6.197  19.455  11.985  1.00 24.63 ? 277 ASN A CG  1 
ATOM   1858 O OD1 . ASN A 1 239 ? -5.071  19.084  12.301  1.00 25.31 ? 277 ASN A OD1 1 
ATOM   1859 N ND2 . ASN A 1 239 ? -6.447  20.674  11.504  1.00 25.74 ? 277 ASN A ND2 1 
ATOM   1860 N N   . ILE A 1 240 ? -8.158  15.298  11.880  1.00 25.80 ? 278 ILE A N   1 
ATOM   1861 C CA  . ILE A 1 240 ? -9.048  14.424  12.607  1.00 26.52 ? 278 ILE A CA  1 
ATOM   1862 C C   . ILE A 1 240 ? -8.498  14.398  14.028  1.00 26.88 ? 278 ILE A C   1 
ATOM   1863 O O   . ILE A 1 240 ? -7.535  13.698  14.319  1.00 26.88 ? 278 ILE A O   1 
ATOM   1864 C CB  . ILE A 1 240 ? -9.155  13.025  11.959  1.00 26.57 ? 278 ILE A CB  1 
ATOM   1865 C CG1 . ILE A 1 240 ? -9.716  13.167  10.530  1.00 26.77 ? 278 ILE A CG1 1 
ATOM   1866 C CG2 . ILE A 1 240 ? -10.039 12.117  12.806  1.00 26.54 ? 278 ILE A CG2 1 
ATOM   1867 C CD1 . ILE A 1 240 ? -9.924  11.869  9.794   1.00 29.78 ? 278 ILE A CD1 1 
ATOM   1868 N N   . TYR A 1 241 ? -9.106  15.220  14.877  1.00 28.07 ? 279 TYR A N   1 
ATOM   1869 C CA  . TYR A 1 241 ? -8.678  15.443  16.257  1.00 29.38 ? 279 TYR A CA  1 
ATOM   1870 C C   . TYR A 1 241 ? -8.928  14.265  17.176  1.00 30.28 ? 279 TYR A C   1 
ATOM   1871 O O   . TYR A 1 241 ? -8.103  13.966  18.051  1.00 30.06 ? 279 TYR A O   1 
ATOM   1872 C CB  . TYR A 1 241 ? -9.365  16.693  16.826  1.00 29.53 ? 279 TYR A CB  1 
ATOM   1873 C CG  . TYR A 1 241 ? -8.784  17.973  16.272  1.00 30.16 ? 279 TYR A CG  1 
ATOM   1874 C CD1 . TYR A 1 241 ? -7.543  18.437  16.710  1.00 30.95 ? 279 TYR A CD1 1 
ATOM   1875 C CD2 . TYR A 1 241 ? -9.451  18.702  15.288  1.00 28.94 ? 279 TYR A CD2 1 
ATOM   1876 C CE1 . TYR A 1 241 ? -6.991  19.606  16.200  1.00 30.92 ? 279 TYR A CE1 1 
ATOM   1877 C CE2 . TYR A 1 241 ? -8.909  19.873  14.777  1.00 28.96 ? 279 TYR A CE2 1 
ATOM   1878 C CZ  . TYR A 1 241 ? -7.674  20.311  15.233  1.00 30.52 ? 279 TYR A CZ  1 
ATOM   1879 O OH  . TYR A 1 241 ? -7.107  21.465  14.738  1.00 31.42 ? 279 TYR A OH  1 
ATOM   1880 N N   . ARG A 1 242 ? -10.067 13.605  16.981  1.00 30.96 ? 280 ARG A N   1 
ATOM   1881 C CA  . ARG A 1 242 ? -10.447 12.467  17.809  1.00 32.32 ? 280 ARG A CA  1 
ATOM   1882 C C   . ARG A 1 242 ? -10.764 11.285  16.897  1.00 32.12 ? 280 ARG A C   1 
ATOM   1883 O O   . ARG A 1 242 ? -11.890 11.175  16.400  1.00 31.90 ? 280 ARG A O   1 
ATOM   1884 C CB  . ARG A 1 242 ? -11.654 12.812  18.686  1.00 32.13 ? 280 ARG A CB  1 
ATOM   1885 C CG  . ARG A 1 242 ? -11.322 13.399  20.063  1.00 33.70 ? 280 ARG A CG  1 
ATOM   1886 C CD  . ARG A 1 242 ? -12.585 13.899  20.758  1.00 34.47 ? 280 ARG A CD  1 
ATOM   1887 N NE  . ARG A 1 242 ? -12.525 13.750  22.217  1.00 38.56 ? 280 ARG A NE  1 
ATOM   1888 C CZ  . ARG A 1 242 ? -13.576 13.843  23.037  1.00 41.52 ? 280 ARG A CZ  1 
ATOM   1889 N NH1 . ARG A 1 242 ? -14.794 14.084  22.554  1.00 43.10 ? 280 ARG A NH1 1 
ATOM   1890 N NH2 . ARG A 1 242 ? -13.418 13.693  24.349  1.00 41.43 ? 280 ARG A NH2 1 
ATOM   1891 N N   . PRO A 1 243 ? -9.768  10.405  16.664  1.00 32.22 ? 281 PRO A N   1 
ATOM   1892 C CA  . PRO A 1 243 ? -9.956  9.241   15.800  1.00 32.43 ? 281 PRO A CA  1 
ATOM   1893 C C   . PRO A 1 243 ? -11.044 8.292   16.293  1.00 32.29 ? 281 PRO A C   1 
ATOM   1894 O O   . PRO A 1 243 ? -11.732 7.684   15.469  1.00 32.37 ? 281 PRO A O   1 
ATOM   1895 C CB  . PRO A 1 243 ? -8.587  8.549   15.836  1.00 32.91 ? 281 PRO A CB  1 
ATOM   1896 C CG  . PRO A 1 243 ? -7.639  9.614   16.242  1.00 33.13 ? 281 PRO A CG  1 
ATOM   1897 C CD  . PRO A 1 243 ? -8.396  10.463  17.193  1.00 32.32 ? 281 PRO A CD  1 
ATOM   1898 N N   . ASP A 1 244 ? -11.191 8.171   17.617  1.00 32.08 ? 282 ASP A N   1 
ATOM   1899 C CA  . ASP A 1 244 ? -12.217 7.319   18.220  1.00 31.82 ? 282 ASP A CA  1 
ATOM   1900 C C   . ASP A 1 244 ? -13.619 7.809   17.874  1.00 31.55 ? 282 ASP A C   1 
ATOM   1901 O O   . ASP A 1 244 ? -14.462 7.016   17.453  1.00 31.56 ? 282 ASP A O   1 
ATOM   1902 C CB  . ASP A 1 244 ? -12.033 7.176   19.747  1.00 31.78 ? 282 ASP A CB  1 
ATOM   1903 C CG  . ASP A 1 244 ? -11.888 8.516   20.469  1.00 33.13 ? 282 ASP A CG  1 
ATOM   1904 O OD1 . ASP A 1 244 ? -11.610 9.552   19.828  1.00 34.89 ? 282 ASP A OD1 1 
ATOM   1905 O OD2 . ASP A 1 244 ? -12.039 8.537   21.711  1.00 35.85 ? 282 ASP A OD2 1 
ATOM   1906 N N   . LYS A 1 245 ? -13.856 9.110   18.036  1.00 31.16 ? 283 LYS A N   1 
ATOM   1907 C CA  . LYS A 1 245 ? -15.125 9.711   17.638  1.00 31.09 ? 283 LYS A CA  1 
ATOM   1908 C C   . LYS A 1 245 ? -15.275 9.716   16.113  1.00 30.66 ? 283 LYS A C   1 
ATOM   1909 O O   . LYS A 1 245 ? -16.371 9.541   15.594  1.00 30.72 ? 283 LYS A O   1 
ATOM   1910 C CB  . LYS A 1 245 ? -15.272 11.132  18.177  1.00 31.31 ? 283 LYS A CB  1 
ATOM   1911 C CG  . LYS A 1 245 ? -16.707 11.624  18.121  1.00 33.01 ? 283 LYS A CG  1 
ATOM   1912 C CD  . LYS A 1 245 ? -16.803 13.119  17.892  1.00 36.14 ? 283 LYS A CD  1 
ATOM   1913 C CE  . LYS A 1 245 ? -18.213 13.500  17.465  1.00 36.15 ? 283 LYS A CE  1 
ATOM   1914 N NZ  . LYS A 1 245 ? -18.638 14.757  18.132  1.00 38.98 ? 283 LYS A NZ  1 
ATOM   1915 N N   . PHE A 1 246 ? -14.175 9.920   15.400  1.00 30.13 ? 284 PHE A N   1 
ATOM   1916 C CA  . PHE A 1 246 ? -14.194 9.801   13.935  1.00 29.71 ? 284 PHE A CA  1 
ATOM   1917 C C   . PHE A 1 246 ? -14.796 8.464   13.498  1.00 29.63 ? 284 PHE A C   1 
ATOM   1918 O O   . PHE A 1 246 ? -15.775 8.441   12.766  1.00 29.74 ? 284 PHE A O   1 
ATOM   1919 C CB  . PHE A 1 246 ? -12.794 10.000  13.345  1.00 29.56 ? 284 PHE A CB  1 
ATOM   1920 C CG  . PHE A 1 246 ? -12.710 9.731   11.860  1.00 29.32 ? 284 PHE A CG  1 
ATOM   1921 C CD1 . PHE A 1 246 ? -13.442 10.499  10.962  1.00 29.27 ? 284 PHE A CD1 1 
ATOM   1922 C CD2 . PHE A 1 246 ? -11.888 8.721   11.369  1.00 29.33 ? 284 PHE A CD2 1 
ATOM   1923 C CE1 . PHE A 1 246 ? -13.368 10.260  9.589   1.00 29.29 ? 284 PHE A CE1 1 
ATOM   1924 C CE2 . PHE A 1 246 ? -11.802 8.471   9.994   1.00 30.48 ? 284 PHE A CE2 1 
ATOM   1925 C CZ  . PHE A 1 246 ? -12.546 9.248   9.106   1.00 29.99 ? 284 PHE A CZ  1 
ATOM   1926 N N   . LEU A 1 247 ? -14.222 7.357   13.965  1.00 29.68 ? 285 LEU A N   1 
ATOM   1927 C CA  . LEU A 1 247 ? -14.720 6.031   13.615  1.00 30.30 ? 285 LEU A CA  1 
ATOM   1928 C C   . LEU A 1 247 ? -16.148 5.790   14.058  1.00 30.55 ? 285 LEU A C   1 
ATOM   1929 O O   . LEU A 1 247 ? -16.913 5.132   13.351  1.00 30.66 ? 285 LEU A O   1 
ATOM   1930 C CB  . LEU A 1 247 ? -13.841 4.938   14.206  1.00 30.06 ? 285 LEU A CB  1 
ATOM   1931 C CG  . LEU A 1 247 ? -12.639 4.501   13.392  1.00 31.62 ? 285 LEU A CG  1 
ATOM   1932 C CD1 . LEU A 1 247 ? -11.965 3.414   14.211  1.00 31.89 ? 285 LEU A CD1 1 
ATOM   1933 C CD2 . LEU A 1 247 ? -13.040 3.988   12.000  1.00 30.96 ? 285 LEU A CD2 1 
ATOM   1934 N N   . GLN A 1 248 ? -16.496 6.301   15.239  1.00 30.69 ? 286 GLN A N   1 
ATOM   1935 C CA  . GLN A 1 248 ? -17.844 6.153   15.750  1.00 31.59 ? 286 GLN A CA  1 
ATOM   1936 C C   . GLN A 1 248 ? -18.825 6.864   14.827  1.00 31.50 ? 286 GLN A C   1 
ATOM   1937 O O   . GLN A 1 248 ? -19.889 6.343   14.530  1.00 31.54 ? 286 GLN A O   1 
ATOM   1938 C CB  . GLN A 1 248 ? -17.951 6.661   17.198  1.00 31.45 ? 286 GLN A CB  1 
ATOM   1939 C CG  . GLN A 1 248 ? -19.230 6.248   17.889  1.00 34.07 ? 286 GLN A CG  1 
ATOM   1940 C CD  . GLN A 1 248 ? -19.458 4.729   17.901  1.00 37.61 ? 286 GLN A CD  1 
ATOM   1941 O OE1 . GLN A 1 248 ? -20.594 4.268   17.764  1.00 40.78 ? 286 GLN A OE1 1 
ATOM   1942 N NE2 . GLN A 1 248 ? -18.388 3.954   18.081  1.00 38.98 ? 286 GLN A NE2 1 
ATOM   1943 N N   . CYS A 1 249 ? -18.444 8.041   14.354  1.00 32.11 ? 287 CYS A N   1 
ATOM   1944 C CA  . CYS A 1 249 ? -19.248 8.772   13.388  1.00 33.52 ? 287 CYS A CA  1 
ATOM   1945 C C   . CYS A 1 249 ? -19.335 8.034   12.055  1.00 34.09 ? 287 CYS A C   1 
ATOM   1946 O O   . CYS A 1 249 ? -20.376 8.038   11.406  1.00 34.21 ? 287 CYS A O   1 
ATOM   1947 C CB  . CYS A 1 249 ? -18.698 10.180  13.202  1.00 33.54 ? 287 CYS A CB  1 
ATOM   1948 S SG  . CYS A 1 249 ? -19.114 11.257  14.593  1.00 35.94 ? 287 CYS A SG  1 
ATOM   1949 N N   . VAL A 1 250 ? -18.243 7.393   11.655  1.00 34.78 ? 288 VAL A N   1 
ATOM   1950 C CA  . VAL A 1 250 ? -18.254 6.613   10.419  1.00 35.79 ? 288 VAL A CA  1 
ATOM   1951 C C   . VAL A 1 250 ? -19.221 5.425   10.546  1.00 36.73 ? 288 VAL A C   1 
ATOM   1952 O O   . VAL A 1 250 ? -19.972 5.142   9.613   1.00 36.92 ? 288 VAL A O   1 
ATOM   1953 C CB  . VAL A 1 250 ? -16.831 6.148   9.986   1.00 35.41 ? 288 VAL A CB  1 
ATOM   1954 C CG1 . VAL A 1 250 ? -16.883 5.431   8.645   1.00 35.32 ? 288 VAL A CG1 1 
ATOM   1955 C CG2 . VAL A 1 250 ? -15.892 7.331   9.868   1.00 34.51 ? 288 VAL A CG2 1 
ATOM   1956 N N   . LYS A 1 251 ? -19.208 4.761   11.702  1.00 37.86 ? 289 LYS A N   1 
ATOM   1957 C CA  . LYS A 1 251 ? -20.019 3.556   11.944  1.00 39.31 ? 289 LYS A CA  1 
ATOM   1958 C C   . LYS A 1 251 ? -21.519 3.837   11.987  1.00 40.37 ? 289 LYS A C   1 
ATOM   1959 O O   . LYS A 1 251 ? -22.331 2.986   11.616  1.00 40.52 ? 289 LYS A O   1 
ATOM   1960 C CB  . LYS A 1 251 ? -19.598 2.868   13.245  1.00 39.34 ? 289 LYS A CB  1 
ATOM   1961 C CG  . LYS A 1 251 ? -18.243 2.201   13.190  1.00 39.77 ? 289 LYS A CG  1 
ATOM   1962 C CD  . LYS A 1 251 ? -17.811 1.701   14.559  1.00 41.02 ? 289 LYS A CD  1 
ATOM   1963 C CE  . LYS A 1 251 ? -16.415 1.093   14.476  1.00 41.75 ? 289 LYS A CE  1 
ATOM   1964 N NZ  . LYS A 1 251 ? -15.977 0.417   15.740  1.00 41.91 ? 289 LYS A NZ  1 
ATOM   1965 N N   . ASN A 1 252 ? -21.874 5.023   12.470  1.00 41.53 ? 290 ASN A N   1 
ATOM   1966 C CA  . ASN A 1 252 ? -23.260 5.474   12.497  1.00 42.86 ? 290 ASN A CA  1 
ATOM   1967 C C   . ASN A 1 252 ? -23.332 6.967   12.187  1.00 43.59 ? 290 ASN A C   1 
ATOM   1968 O O   . ASN A 1 252 ? -23.391 7.801   13.096  1.00 43.33 ? 290 ASN A O   1 
ATOM   1969 C CB  . ASN A 1 252 ? -23.936 5.120   13.828  1.00 43.13 ? 290 ASN A CB  1 
ATOM   1970 C CG  . ASN A 1 252 ? -22.973 5.144   14.991  1.00 44.05 ? 290 ASN A CG  1 
ATOM   1971 O OD1 . ASN A 1 252 ? -22.517 4.094   15.452  1.00 44.83 ? 290 ASN A OD1 1 
ATOM   1972 N ND2 . ASN A 1 252 ? -22.635 6.341   15.459  1.00 44.98 ? 290 ASN A ND2 1 
ATOM   1973 N N   . PRO A 1 253 ? -23.311 7.302   10.885  1.00 44.64 ? 291 PRO A N   1 
ATOM   1974 C CA  . PRO A 1 253 ? -23.226 8.680   10.408  1.00 45.60 ? 291 PRO A CA  1 
ATOM   1975 C C   . PRO A 1 253 ? -24.538 9.444   10.540  1.00 46.68 ? 291 PRO A C   1 
ATOM   1976 O O   . PRO A 1 253 ? -24.512 10.650  10.763  1.00 46.82 ? 291 PRO A O   1 
ATOM   1977 C CB  . PRO A 1 253 ? -22.846 8.516   8.937   1.00 45.72 ? 291 PRO A CB  1 
ATOM   1978 C CG  . PRO A 1 253 ? -23.410 7.190   8.552   1.00 45.41 ? 291 PRO A CG  1 
ATOM   1979 C CD  . PRO A 1 253 ? -23.380 6.331   9.775   1.00 44.65 ? 291 PRO A CD  1 
ATOM   1980 N N   . GLU A 1 254 ? -25.663 8.746   10.388  1.00 47.94 ? 292 GLU A N   1 
ATOM   1981 C CA  . GLU A 1 254 ? -26.982 9.330   10.607  1.00 49.22 ? 292 GLU A CA  1 
ATOM   1982 C C   . GLU A 1 254 ? -27.180 9.472   12.117  1.00 49.43 ? 292 GLU A C   1 
ATOM   1983 O O   . GLU A 1 254 ? -27.934 8.720   12.736  1.00 49.69 ? 292 GLU A O   1 
ATOM   1984 C CB  . GLU A 1 254 ? -28.080 8.466   9.957   1.00 49.39 ? 292 GLU A CB  1 
ATOM   1985 C CG  . GLU A 1 254 ? -28.175 8.590   8.415   1.00 50.26 ? 292 GLU A CG  1 
ATOM   1986 C CD  . GLU A 1 254 ? -29.036 7.495   7.759   1.00 50.33 ? 292 GLU A CD  1 
ATOM   1987 O OE1 . GLU A 1 254 ? -30.113 7.821   7.208   1.00 50.49 ? 292 GLU A OE1 1 
ATOM   1988 O OE2 . GLU A 1 254 ? -28.635 6.308   7.784   1.00 51.48 ? 292 GLU A OE2 1 
ATOM   1989 N N   . ASP A 1 255 ? -26.457 10.437  12.691  1.00 49.71 ? 293 ASP A N   1 
ATOM   1990 C CA  . ASP A 1 255 ? -26.439 10.721  14.125  1.00 49.66 ? 293 ASP A CA  1 
ATOM   1991 C C   . ASP A 1 255 ? -25.958 12.151  14.365  1.00 49.51 ? 293 ASP A C   1 
ATOM   1992 O O   . ASP A 1 255 ? -24.889 12.546  13.891  1.00 49.49 ? 293 ASP A O   1 
ATOM   1993 C CB  . ASP A 1 255 ? -25.510 9.753   14.866  1.00 49.80 ? 293 ASP A CB  1 
ATOM   1994 C CG  . ASP A 1 255 ? -26.196 8.452   15.242  1.00 50.87 ? 293 ASP A CG  1 
ATOM   1995 O OD1 . ASP A 1 255 ? -27.217 8.495   15.964  1.00 51.03 ? 293 ASP A OD1 1 
ATOM   1996 O OD2 . ASP A 1 255 ? -25.706 7.381   14.824  1.00 52.25 ? 293 ASP A OD2 1 
ATOM   1997 N N   . SER A 1 256 ? -26.756 12.918  15.105  1.00 49.16 ? 294 SER A N   1 
ATOM   1998 C CA  . SER A 1 256 ? -26.382 14.268  15.530  1.00 48.71 ? 294 SER A CA  1 
ATOM   1999 C C   . SER A 1 256 ? -25.054 14.234  16.283  1.00 48.26 ? 294 SER A C   1 
ATOM   2000 O O   . SER A 1 256 ? -24.801 13.298  17.047  1.00 48.46 ? 294 SER A O   1 
ATOM   2001 C CB  . SER A 1 256 ? -27.472 14.856  16.428  1.00 48.62 ? 294 SER A CB  1 
ATOM   2002 O OG  . SER A 1 256 ? -27.579 14.116  17.630  1.00 48.71 ? 294 SER A OG  1 
ATOM   2003 N N   . SER A 1 257 ? -24.229 15.258  16.055  1.00 47.37 ? 295 SER A N   1 
ATOM   2004 C CA  . SER A 1 257 ? -22.869 15.402  16.619  1.00 46.52 ? 295 SER A CA  1 
ATOM   2005 C C   . SER A 1 257 ? -21.786 14.966  15.635  1.00 45.72 ? 295 SER A C   1 
ATOM   2006 O O   . SER A 1 257 ? -20.608 15.303  15.805  1.00 45.52 ? 295 SER A O   1 
ATOM   2007 C CB  . SER A 1 257 ? -22.698 14.723  17.998  1.00 46.69 ? 295 SER A CB  1 
ATOM   2008 O OG  . SER A 1 257 ? -22.553 13.315  17.901  1.00 46.81 ? 295 SER A OG  1 
ATOM   2009 N N   . CYS A 1 258 ? -22.205 14.232  14.602  1.00 44.86 ? 296 CYS A N   1 
ATOM   2010 C CA  . CYS A 1 258 ? -21.320 13.802  13.514  1.00 43.85 ? 296 CYS A CA  1 
ATOM   2011 C C   . CYS A 1 258 ? -21.557 14.637  12.257  1.00 44.11 ? 296 CYS A C   1 
ATOM   2012 O O   . CYS A 1 258 ? -20.647 15.303  11.763  1.00 44.49 ? 296 CYS A O   1 
ATOM   2013 C CB  . CYS A 1 258 ? -21.540 12.322  13.197  1.00 43.16 ? 296 CYS A CB  1 
ATOM   2014 S SG  . CYS A 1 258 ? -21.144 11.208  14.551  1.00 39.61 ? 296 CYS A SG  1 
ATOM   2015 N N   . ARG B 1 7   ? 25.332  15.925  4.114   1.00 37.91 ? 45  ARG B N   1 
ATOM   2016 C CA  . ARG B 1 7   ? 25.384  14.817  5.104   1.00 37.02 ? 45  ARG B CA  1 
ATOM   2017 C C   . ARG B 1 7   ? 25.801  13.508  4.415   1.00 36.38 ? 45  ARG B C   1 
ATOM   2018 O O   . ARG B 1 7   ? 26.316  13.516  3.298   1.00 36.51 ? 45  ARG B O   1 
ATOM   2019 C CB  . ARG B 1 7   ? 24.041  14.679  5.844   1.00 37.35 ? 45  ARG B CB  1 
ATOM   2020 C CG  . ARG B 1 7   ? 22.956  13.878  5.099   1.00 38.48 ? 45  ARG B CG  1 
ATOM   2021 C CD  . ARG B 1 7   ? 21.569  14.337  5.487   1.00 42.49 ? 45  ARG B CD  1 
ATOM   2022 N NE  . ARG B 1 7   ? 21.359  14.319  6.935   1.00 43.12 ? 45  ARG B NE  1 
ATOM   2023 C CZ  . ARG B 1 7   ? 20.667  13.385  7.586   1.00 44.72 ? 45  ARG B CZ  1 
ATOM   2024 N NH1 . ARG B 1 7   ? 20.104  12.376  6.933   1.00 45.44 ? 45  ARG B NH1 1 
ATOM   2025 N NH2 . ARG B 1 7   ? 20.523  13.467  8.900   1.00 44.87 ? 45  ARG B NH2 1 
ATOM   2026 N N   . TRP B 1 8   ? 25.573  12.394  5.098   1.00 35.40 ? 46  TRP B N   1 
ATOM   2027 C CA  . TRP B 1 8   ? 26.040  11.094  4.669   1.00 34.62 ? 46  TRP B CA  1 
ATOM   2028 C C   . TRP B 1 8   ? 25.023  10.355  3.792   1.00 34.01 ? 46  TRP B C   1 
ATOM   2029 O O   . TRP B 1 8   ? 25.341  9.308   3.223   1.00 33.50 ? 46  TRP B O   1 
ATOM   2030 C CB  . TRP B 1 8   ? 26.339  10.266  5.911   1.00 34.65 ? 46  TRP B CB  1 
ATOM   2031 C CG  . TRP B 1 8   ? 25.131  10.029  6.752   1.00 34.89 ? 46  TRP B CG  1 
ATOM   2032 C CD1 . TRP B 1 8   ? 24.264  8.986   6.654   1.00 34.95 ? 46  TRP B CD1 1 
ATOM   2033 C CD2 . TRP B 1 8   ? 24.642  10.862  7.810   1.00 34.94 ? 46  TRP B CD2 1 
ATOM   2034 N NE1 . TRP B 1 8   ? 23.275  9.102   7.594   1.00 35.42 ? 46  TRP B NE1 1 
ATOM   2035 C CE2 . TRP B 1 8   ? 23.478  10.250  8.314   1.00 35.27 ? 46  TRP B CE2 1 
ATOM   2036 C CE3 . TRP B 1 8   ? 25.078  12.059  8.384   1.00 35.42 ? 46  TRP B CE3 1 
ATOM   2037 C CZ2 . TRP B 1 8   ? 22.739  10.793  9.370   1.00 35.33 ? 46  TRP B CZ2 1 
ATOM   2038 C CZ3 . TRP B 1 8   ? 24.344  12.600  9.437   1.00 36.18 ? 46  TRP B CZ3 1 
ATOM   2039 C CH2 . TRP B 1 8   ? 23.190  11.961  9.921   1.00 35.36 ? 46  TRP B CH2 1 
ATOM   2040 N N   . ARG B 1 9   ? 23.801  10.885  3.711   1.00 33.45 ? 47  ARG B N   1 
ATOM   2041 C CA  . ARG B 1 9   ? 22.711  10.237  2.980   1.00 33.34 ? 47  ARG B CA  1 
ATOM   2042 C C   . ARG B 1 9   ? 22.521  10.831  1.592   1.00 32.41 ? 47  ARG B C   1 
ATOM   2043 O O   . ARG B 1 9   ? 22.211  12.019  1.451   1.00 32.82 ? 47  ARG B O   1 
ATOM   2044 C CB  . ARG B 1 9   ? 21.393  10.390  3.740   1.00 33.96 ? 47  ARG B CB  1 
ATOM   2045 C CG  . ARG B 1 9   ? 21.136  9.388   4.856   1.00 37.23 ? 47  ARG B CG  1 
ATOM   2046 C CD  . ARG B 1 9   ? 19.647  9.414   5.215   1.00 40.95 ? 47  ARG B CD  1 
ATOM   2047 N NE  . ARG B 1 9   ? 19.130  8.105   5.609   1.00 45.13 ? 47  ARG B NE  1 
ATOM   2048 C CZ  . ARG B 1 9   ? 18.938  7.077   4.782   1.00 47.49 ? 47  ARG B CZ  1 
ATOM   2049 N NH1 . ARG B 1 9   ? 19.237  7.179   3.490   1.00 47.94 ? 47  ARG B NH1 1 
ATOM   2050 N NH2 . ARG B 1 9   ? 18.452  5.931   5.254   1.00 48.62 ? 47  ARG B NH2 1 
ATOM   2051 N N   . GLN B 1 10  ? 22.665  10.015  0.559   1.00 30.46 ? 48  GLN B N   1 
ATOM   2052 C CA  . GLN B 1 10  ? 22.332  10.491  -0.776  1.00 28.89 ? 48  GLN B CA  1 
ATOM   2053 C C   . GLN B 1 10  ? 20.864  10.182  -1.068  1.00 28.25 ? 48  GLN B C   1 
ATOM   2054 O O   . GLN B 1 10  ? 20.301  9.228   -0.549  1.00 27.30 ? 48  GLN B O   1 
ATOM   2055 C CB  . GLN B 1 10  ? 23.254  9.887   -1.831  1.00 29.08 ? 48  GLN B CB  1 
ATOM   2056 C CG  . GLN B 1 10  ? 24.737  10.209  -1.609  1.00 27.14 ? 48  GLN B CG  1 
ATOM   2057 C CD  . GLN B 1 10  ? 25.602  9.694   -2.738  1.00 26.74 ? 48  GLN B CD  1 
ATOM   2058 O OE1 . GLN B 1 10  ? 25.099  9.282   -3.783  1.00 24.00 ? 48  GLN B OE1 1 
ATOM   2059 N NE2 . GLN B 1 10  ? 26.904  9.679   -2.521  1.00 25.79 ? 48  GLN B NE2 1 
ATOM   2060 N N   . THR B 1 11  ? 20.262  11.000  -1.914  1.00 28.15 ? 49  THR B N   1 
ATOM   2061 C CA  . THR B 1 11  ? 18.823  10.950  -2.147  1.00 28.24 ? 49  THR B CA  1 
ATOM   2062 C C   . THR B 1 11  ? 18.475  9.909   -3.189  1.00 27.94 ? 49  THR B C   1 
ATOM   2063 O O   . THR B 1 11  ? 17.483  9.196   -3.047  1.00 28.72 ? 49  THR B O   1 
ATOM   2064 C CB  . THR B 1 11  ? 18.329  12.319  -2.614  1.00 28.25 ? 49  THR B CB  1 
ATOM   2065 O OG1 . THR B 1 11  ? 18.834  13.313  -1.725  1.00 31.00 ? 49  THR B OG1 1 
ATOM   2066 C CG2 . THR B 1 11  ? 16.803  12.380  -2.647  1.00 28.62 ? 49  THR B CG2 1 
ATOM   2067 N N   . TRP B 1 12  ? 19.313  9.797   -4.219  1.00 26.97 ? 50  TRP B N   1 
ATOM   2068 C CA  . TRP B 1 12  ? 18.980  8.984   -5.381  1.00 25.90 ? 50  TRP B CA  1 
ATOM   2069 C C   . TRP B 1 12  ? 19.964  7.850   -5.595  1.00 26.32 ? 50  TRP B C   1 
ATOM   2070 O O   . TRP B 1 12  ? 21.054  7.871   -5.027  1.00 25.56 ? 50  TRP B O   1 
ATOM   2071 C CB  . TRP B 1 12  ? 18.911  9.865   -6.619  1.00 25.49 ? 50  TRP B CB  1 
ATOM   2072 C CG  . TRP B 1 12  ? 18.006  11.049  -6.435  1.00 24.64 ? 50  TRP B CG  1 
ATOM   2073 C CD1 . TRP B 1 12  ? 18.374  12.354  -6.375  1.00 24.96 ? 50  TRP B CD1 1 
ATOM   2074 C CD2 . TRP B 1 12  ? 16.582  11.022  -6.251  1.00 23.88 ? 50  TRP B CD2 1 
ATOM   2075 N NE1 . TRP B 1 12  ? 17.271  13.151  -6.193  1.00 22.99 ? 50  TRP B NE1 1 
ATOM   2076 C CE2 . TRP B 1 12  ? 16.156  12.362  -6.109  1.00 23.17 ? 50  TRP B CE2 1 
ATOM   2077 C CE3 . TRP B 1 12  ? 15.627  10.001  -6.205  1.00 25.11 ? 50  TRP B CE3 1 
ATOM   2078 C CZ2 . TRP B 1 12  ? 14.813  12.708  -5.922  1.00 23.07 ? 50  TRP B CZ2 1 
ATOM   2079 C CZ3 . TRP B 1 12  ? 14.283  10.343  -6.023  1.00 25.71 ? 50  TRP B CZ3 1 
ATOM   2080 C CH2 . TRP B 1 12  ? 13.892  11.692  -5.881  1.00 24.64 ? 50  TRP B CH2 1 
ATOM   2081 N N   . SER B 1 13  ? 19.561  6.889   -6.431  1.00 26.73 ? 51  SER B N   1 
ATOM   2082 C CA  . SER B 1 13  ? 20.344  5.690   -6.762  1.00 27.65 ? 51  SER B CA  1 
ATOM   2083 C C   . SER B 1 13  ? 21.312  5.928   -7.900  1.00 27.51 ? 51  SER B C   1 
ATOM   2084 O O   . SER B 1 13  ? 22.352  5.266   -7.980  1.00 27.21 ? 51  SER B O   1 
ATOM   2085 C CB  . SER B 1 13  ? 19.407  4.540   -7.177  1.00 27.70 ? 51  SER B CB  1 
ATOM   2086 O OG  . SER B 1 13  ? 18.523  4.220   -6.128  1.00 30.99 ? 51  SER B OG  1 
ATOM   2087 N N   . GLY B 1 14  ? 20.944  6.853   -8.788  1.00 26.83 ? 52  GLY B N   1 
ATOM   2088 C CA  . GLY B 1 14  ? 21.669  7.077   -10.033 1.00 26.38 ? 52  GLY B CA  1 
ATOM   2089 C C   . GLY B 1 14  ? 22.812  8.044   -9.828  1.00 26.04 ? 52  GLY B C   1 
ATOM   2090 O O   . GLY B 1 14  ? 22.893  8.684   -8.776  1.00 26.04 ? 52  GLY B O   1 
ATOM   2091 N N   . PRO B 1 15  ? 23.717  8.138   -10.821 1.00 26.03 ? 53  PRO B N   1 
ATOM   2092 C CA  . PRO B 1 15  ? 24.812  9.104   -10.766 1.00 25.29 ? 53  PRO B CA  1 
ATOM   2093 C C   . PRO B 1 15  ? 24.264  10.521  -10.692 1.00 24.04 ? 53  PRO B C   1 
ATOM   2094 O O   . PRO B 1 15  ? 23.164  10.803  -11.184 1.00 23.32 ? 53  PRO B O   1 
ATOM   2095 C CB  . PRO B 1 15  ? 25.533  8.896   -12.106 1.00 26.07 ? 53  PRO B CB  1 
ATOM   2096 C CG  . PRO B 1 15  ? 25.242  7.435   -12.444 1.00 27.16 ? 53  PRO B CG  1 
ATOM   2097 C CD  . PRO B 1 15  ? 23.771  7.340   -12.065 1.00 26.51 ? 53  PRO B CD  1 
ATOM   2098 N N   . GLY B 1 16  ? 25.029  11.404  -10.072 1.00 22.92 ? 54  GLY B N   1 
ATOM   2099 C CA  . GLY B 1 16  ? 24.630  12.781  -9.948  1.00 22.68 ? 54  GLY B CA  1 
ATOM   2100 C C   . GLY B 1 16  ? 24.868  13.563  -11.221 1.00 22.95 ? 54  GLY B C   1 
ATOM   2101 O O   . GLY B 1 16  ? 25.298  13.004  -12.235 1.00 22.23 ? 54  GLY B O   1 
ATOM   2102 N N   . THR B 1 17  ? 24.599  14.864  -11.163 1.00 21.95 ? 55  THR B N   1 
ATOM   2103 C CA  . THR B 1 17  ? 24.827  15.727  -12.315 1.00 22.56 ? 55  THR B CA  1 
ATOM   2104 C C   . THR B 1 17  ? 26.299  15.682  -12.714 1.00 22.25 ? 55  THR B C   1 
ATOM   2105 O O   . THR B 1 17  ? 27.186  15.670  -11.859 1.00 21.87 ? 55  THR B O   1 
ATOM   2106 C CB  . THR B 1 17  ? 24.390  17.171  -12.020 1.00 22.40 ? 55  THR B CB  1 
ATOM   2107 O OG1 . THR B 1 17  ? 23.007  17.158  -11.645 1.00 22.98 ? 55  THR B OG1 1 
ATOM   2108 C CG2 . THR B 1 17  ? 24.585  18.068  -13.238 1.00 22.30 ? 55  THR B CG2 1 
ATOM   2109 N N   . THR B 1 18  ? 26.554  15.619  -14.018 1.00 22.55 ? 56  THR B N   1 
ATOM   2110 C CA  . THR B 1 18  ? 27.917  15.597  -14.518 1.00 23.19 ? 56  THR B CA  1 
ATOM   2111 C C   . THR B 1 18  ? 28.627  16.830  -14.005 1.00 23.61 ? 56  THR B C   1 
ATOM   2112 O O   . THR B 1 18  ? 28.059  17.926  -14.003 1.00 24.57 ? 56  THR B O   1 
ATOM   2113 C CB  . THR B 1 18  ? 27.917  15.623  -16.049 1.00 23.77 ? 56  THR B CB  1 
ATOM   2114 O OG1 . THR B 1 18  ? 27.054  14.585  -16.514 1.00 23.54 ? 56  THR B OG1 1 
ATOM   2115 C CG2 . THR B 1 18  ? 29.310  15.405  -16.610 1.00 23.73 ? 56  THR B CG2 1 
ATOM   2116 N N   . LYS B 1 19  ? 29.866  16.667  -13.568 1.00 23.87 ? 57  LYS B N   1 
ATOM   2117 C CA  . LYS B 1 19  ? 30.621  17.814  -13.086 1.00 24.68 ? 57  LYS B CA  1 
ATOM   2118 C C   . LYS B 1 19  ? 30.706  18.879  -14.160 1.00 25.06 ? 57  LYS B C   1 
ATOM   2119 O O   . LYS B 1 19  ? 30.833  18.564  -15.352 1.00 24.17 ? 57  LYS B O   1 
ATOM   2120 C CB  . LYS B 1 19  ? 32.015  17.403  -12.630 1.00 25.06 ? 57  LYS B CB  1 
ATOM   2121 C CG  . LYS B 1 19  ? 33.037  17.198  -13.717 1.00 24.79 ? 57  LYS B CG  1 
ATOM   2122 C CD  . LYS B 1 19  ? 34.410  16.961  -13.108 1.00 23.64 ? 57  LYS B CD  1 
ATOM   2123 C CE  . LYS B 1 19  ? 35.123  18.255  -12.683 1.00 23.02 ? 57  LYS B CE  1 
ATOM   2124 N NZ  . LYS B 1 19  ? 36.425  17.951  -12.003 1.00 22.20 ? 57  LYS B NZ  1 
ATOM   2125 N N   . ARG B 1 20  ? 30.609  20.132  -13.727 1.00 25.41 ? 58  ARG B N   1 
ATOM   2126 C CA  . ARG B 1 20  ? 30.694  21.288  -14.610 1.00 26.32 ? 58  ARG B CA  1 
ATOM   2127 C C   . ARG B 1 20  ? 29.659  21.211  -15.716 1.00 26.43 ? 58  ARG B C   1 
ATOM   2128 O O   . ARG B 1 20  ? 29.880  21.674  -16.830 1.00 26.87 ? 58  ARG B O   1 
ATOM   2129 C CB  . ARG B 1 20  ? 32.102  21.449  -15.196 1.00 27.20 ? 58  ARG B CB  1 
ATOM   2130 C CG  . ARG B 1 20  ? 33.119  21.932  -14.198 1.00 29.08 ? 58  ARG B CG  1 
ATOM   2131 C CD  . ARG B 1 20  ? 34.528  21.904  -14.765 1.00 33.99 ? 58  ARG B CD  1 
ATOM   2132 N NE  . ARG B 1 20  ? 34.632  22.575  -16.062 1.00 38.31 ? 58  ARG B NE  1 
ATOM   2133 C CZ  . ARG B 1 20  ? 34.836  23.879  -16.225 1.00 41.29 ? 58  ARG B CZ  1 
ATOM   2134 N NH1 . ARG B 1 20  ? 34.952  24.680  -15.172 1.00 42.68 ? 58  ARG B NH1 1 
ATOM   2135 N NH2 . ARG B 1 20  ? 34.922  24.388  -17.447 1.00 42.27 ? 58  ARG B NH2 1 
ATOM   2136 N N   . PHE B 1 21  ? 28.519  20.627  -15.381 1.00 26.60 ? 59  PHE B N   1 
ATOM   2137 C CA  . PHE B 1 21  ? 27.400  20.549  -16.288 1.00 26.18 ? 59  PHE B CA  1 
ATOM   2138 C C   . PHE B 1 21  ? 27.045  21.895  -16.962 1.00 26.35 ? 59  PHE B C   1 
ATOM   2139 O O   . PHE B 1 21  ? 26.912  21.930  -18.191 1.00 26.01 ? 59  PHE B O   1 
ATOM   2140 C CB  . PHE B 1 21  ? 26.199  19.942  -15.577 1.00 25.87 ? 59  PHE B CB  1 
ATOM   2141 C CG  . PHE B 1 21  ? 25.001  19.786  -16.448 1.00 25.50 ? 59  PHE B CG  1 
ATOM   2142 C CD1 . PHE B 1 21  ? 24.996  18.880  -17.497 1.00 26.14 ? 59  PHE B CD1 1 
ATOM   2143 C CD2 . PHE B 1 21  ? 23.868  20.559  -16.216 1.00 24.61 ? 59  PHE B CD2 1 
ATOM   2144 C CE1 . PHE B 1 21  ? 23.861  18.744  -18.306 1.00 25.09 ? 59  PHE B CE1 1 
ATOM   2145 C CE2 . PHE B 1 21  ? 22.742  20.423  -17.002 1.00 23.39 ? 59  PHE B CE2 1 
ATOM   2146 C CZ  . PHE B 1 21  ? 22.742  19.531  -18.062 1.00 24.60 ? 59  PHE B CZ  1 
ATOM   2147 N N   . PRO B 1 22  ? 26.886  22.988  -16.176 1.00 25.94 ? 60  PRO B N   1 
ATOM   2148 C CA  . PRO B 1 22  ? 26.561  24.274  -16.802 1.00 26.38 ? 60  PRO B CA  1 
ATOM   2149 C C   . PRO B 1 22  ? 27.600  24.699  -17.820 1.00 26.69 ? 60  PRO B C   1 
ATOM   2150 O O   . PRO B 1 22  ? 27.238  25.046  -18.942 1.00 26.54 ? 60  PRO B O   1 
ATOM   2151 C CB  . PRO B 1 22  ? 26.537  25.246  -15.621 1.00 25.94 ? 60  PRO B CB  1 
ATOM   2152 C CG  . PRO B 1 22  ? 26.202  24.394  -14.449 1.00 26.13 ? 60  PRO B CG  1 
ATOM   2153 C CD  . PRO B 1 22  ? 26.948  23.117  -14.708 1.00 26.29 ? 60  PRO B CD  1 
ATOM   2154 N N   . GLU B 1 23  ? 28.879  24.654  -17.435 1.00 27.05 ? 61  GLU B N   1 
ATOM   2155 C CA  . GLU B 1 23  ? 29.968  25.018  -18.339 1.00 27.72 ? 61  GLU B CA  1 
ATOM   2156 C C   . GLU B 1 23  ? 29.978  24.131  -19.583 1.00 27.33 ? 61  GLU B C   1 
ATOM   2157 O O   . GLU B 1 23  ? 30.219  24.610  -20.695 1.00 27.24 ? 61  GLU B O   1 
ATOM   2158 C CB  . GLU B 1 23  ? 31.326  24.951  -17.634 1.00 27.97 ? 61  GLU B CB  1 
ATOM   2159 C CG  . GLU B 1 23  ? 31.497  25.950  -16.504 1.00 31.36 ? 61  GLU B CG  1 
ATOM   2160 C CD  . GLU B 1 23  ? 31.196  25.355  -15.140 1.00 35.88 ? 61  GLU B CD  1 
ATOM   2161 O OE1 . GLU B 1 23  ? 30.249  24.545  -15.001 1.00 36.15 ? 61  GLU B OE1 1 
ATOM   2162 O OE2 . GLU B 1 23  ? 31.923  25.703  -14.186 1.00 40.39 ? 61  GLU B OE2 1 
ATOM   2163 N N   . THR B 1 24  ? 29.702  22.843  -19.387 1.00 27.06 ? 62  THR B N   1 
ATOM   2164 C CA  . THR B 1 24  ? 29.714  21.876  -20.481 1.00 27.45 ? 62  THR B CA  1 
ATOM   2165 C C   . THR B 1 24  ? 28.623  22.180  -21.505 1.00 27.25 ? 62  THR B C   1 
ATOM   2166 O O   . THR B 1 24  ? 28.907  22.291  -22.701 1.00 27.01 ? 62  THR B O   1 
ATOM   2167 C CB  . THR B 1 24  ? 29.593  20.434  -19.952 1.00 27.50 ? 62  THR B CB  1 
ATOM   2168 O OG1 . THR B 1 24  ? 30.682  20.180  -19.053 1.00 28.77 ? 62  THR B OG1 1 
ATOM   2169 C CG2 . THR B 1 24  ? 29.640  19.422  -21.098 1.00 27.62 ? 62  THR B CG2 1 
ATOM   2170 N N   . VAL B 1 25  ? 27.388  22.331  -21.029 1.00 27.26 ? 63  VAL B N   1 
ATOM   2171 C CA  . VAL B 1 25  ? 26.245  22.640  -21.899 1.00 27.19 ? 63  VAL B CA  1 
ATOM   2172 C C   . VAL B 1 25  ? 26.522  23.918  -22.671 1.00 27.55 ? 63  VAL B C   1 
ATOM   2173 O O   . VAL B 1 25  ? 26.305  23.984  -23.901 1.00 26.86 ? 63  VAL B O   1 
ATOM   2174 C CB  . VAL B 1 25  ? 24.943  22.784  -21.098 1.00 27.36 ? 63  VAL B CB  1 
ATOM   2175 C CG1 . VAL B 1 25  ? 23.840  23.428  -21.966 1.00 28.30 ? 63  VAL B CG1 1 
ATOM   2176 C CG2 . VAL B 1 25  ? 24.500  21.425  -20.588 1.00 25.78 ? 63  VAL B CG2 1 
ATOM   2177 N N   . LEU B 1 26  ? 27.026  24.918  -21.947 1.00 27.24 ? 64  LEU B N   1 
ATOM   2178 C CA  . LEU B 1 26  ? 27.411  26.189  -22.550 1.00 28.34 ? 64  LEU B CA  1 
ATOM   2179 C C   . LEU B 1 26  ? 28.492  26.011  -23.625 1.00 27.94 ? 64  LEU B C   1 
ATOM   2180 O O   . LEU B 1 26  ? 28.355  26.527  -24.741 1.00 28.02 ? 64  LEU B O   1 
ATOM   2181 C CB  . LEU B 1 26  ? 27.878  27.164  -21.466 1.00 28.57 ? 64  LEU B CB  1 
ATOM   2182 C CG  . LEU B 1 26  ? 27.580  28.652  -21.651 1.00 31.79 ? 64  LEU B CG  1 
ATOM   2183 C CD1 . LEU B 1 26  ? 28.417  29.264  -22.769 1.00 33.80 ? 64  LEU B CD1 1 
ATOM   2184 C CD2 . LEU B 1 26  ? 26.073  28.899  -21.867 1.00 32.86 ? 64  LEU B CD2 1 
ATOM   2185 N N   . ALA B 1 27  ? 29.552  25.276  -23.294 1.00 27.64 ? 65  ALA B N   1 
ATOM   2186 C CA  . ALA B 1 27  ? 30.660  25.059  -24.221 1.00 27.31 ? 65  ALA B CA  1 
ATOM   2187 C C   . ALA B 1 27  ? 30.189  24.280  -25.444 1.00 27.32 ? 65  ALA B C   1 
ATOM   2188 O O   . ALA B 1 27  ? 30.559  24.602  -26.578 1.00 26.90 ? 65  ALA B O   1 
ATOM   2189 C CB  . ALA B 1 27  ? 31.812  24.329  -23.530 1.00 27.17 ? 65  ALA B CB  1 
ATOM   2190 N N   . ARG B 1 28  ? 29.362  23.266  -25.212 1.00 27.28 ? 66  ARG B N   1 
ATOM   2191 C CA  . ARG B 1 28  ? 28.827  22.450  -26.305 1.00 27.39 ? 66  ARG B CA  1 
ATOM   2192 C C   . ARG B 1 28  ? 27.938  23.268  -27.238 1.00 27.82 ? 66  ARG B C   1 
ATOM   2193 O O   . ARG B 1 28  ? 27.955  23.079  -28.461 1.00 27.75 ? 66  ARG B O   1 
ATOM   2194 C CB  . ARG B 1 28  ? 28.064  21.255  -25.755 1.00 26.94 ? 66  ARG B CB  1 
ATOM   2195 C CG  . ARG B 1 28  ? 28.980  20.151  -25.249 1.00 26.53 ? 66  ARG B CG  1 
ATOM   2196 C CD  . ARG B 1 28  ? 28.157  19.049  -24.657 1.00 25.62 ? 66  ARG B CD  1 
ATOM   2197 N NE  . ARG B 1 28  ? 28.964  17.941  -24.170 1.00 26.03 ? 66  ARG B NE  1 
ATOM   2198 C CZ  . ARG B 1 28  ? 28.490  16.714  -23.982 1.00 25.64 ? 66  ARG B CZ  1 
ATOM   2199 N NH1 . ARG B 1 28  ? 27.224  16.438  -24.269 1.00 23.84 ? 66  ARG B NH1 1 
ATOM   2200 N NH2 . ARG B 1 28  ? 29.287  15.763  -23.533 1.00 26.12 ? 66  ARG B NH2 1 
ATOM   2201 N N   . CYS B 1 29  ? 27.174  24.186  -26.660 1.00 28.50 ? 67  CYS B N   1 
ATOM   2202 C CA  . CYS B 1 29  ? 26.319  25.056  -27.448 1.00 28.73 ? 67  CYS B CA  1 
ATOM   2203 C C   . CYS B 1 29  ? 27.163  25.983  -28.315 1.00 28.64 ? 67  CYS B C   1 
ATOM   2204 O O   . CYS B 1 29  ? 26.894  26.138  -29.502 1.00 28.48 ? 67  CYS B O   1 
ATOM   2205 C CB  . CYS B 1 29  ? 25.391  25.853  -26.541 1.00 29.04 ? 67  CYS B CB  1 
ATOM   2206 S SG  . CYS B 1 29  ? 24.281  26.911  -27.445 1.00 30.83 ? 67  CYS B SG  1 
ATOM   2207 N N   . VAL B 1 30  ? 28.186  26.591  -27.718 1.00 28.69 ? 68  VAL B N   1 
ATOM   2208 C CA  . VAL B 1 30  ? 29.112  27.443  -28.469 1.00 28.85 ? 68  VAL B CA  1 
ATOM   2209 C C   . VAL B 1 30  ? 29.778  26.626  -29.576 1.00 29.02 ? 68  VAL B C   1 
ATOM   2210 O O   . VAL B 1 30  ? 29.825  27.062  -30.721 1.00 29.55 ? 68  VAL B O   1 
ATOM   2211 C CB  . VAL B 1 30  ? 30.158  28.116  -27.551 1.00 28.67 ? 68  VAL B CB  1 
ATOM   2212 C CG1 . VAL B 1 30  ? 31.227  28.829  -28.377 1.00 28.36 ? 68  VAL B CG1 1 
ATOM   2213 C CG2 . VAL B 1 30  ? 29.476  29.101  -26.623 1.00 28.22 ? 68  VAL B CG2 1 
ATOM   2214 N N   . LYS B 1 31  ? 30.259  25.432  -29.242 1.00 29.18 ? 69  LYS B N   1 
ATOM   2215 C CA  . LYS B 1 31  ? 30.912  24.567  -30.224 1.00 29.77 ? 69  LYS B CA  1 
ATOM   2216 C C   . LYS B 1 31  ? 29.973  24.212  -31.383 1.00 29.73 ? 69  LYS B C   1 
ATOM   2217 O O   . LYS B 1 31  ? 30.344  24.335  -32.552 1.00 29.40 ? 69  LYS B O   1 
ATOM   2218 C CB  . LYS B 1 31  ? 31.452  23.299  -29.547 1.00 30.14 ? 69  LYS B CB  1 
ATOM   2219 C CG  . LYS B 1 31  ? 32.290  22.393  -30.449 1.00 31.22 ? 69  LYS B CG  1 
ATOM   2220 C CD  . LYS B 1 31  ? 33.678  22.955  -30.732 1.00 34.57 ? 69  LYS B CD  1 
ATOM   2221 C CE  . LYS B 1 31  ? 34.377  22.144  -31.806 1.00 35.38 ? 69  LYS B CE  1 
ATOM   2222 N NZ  . LYS B 1 31  ? 35.736  22.664  -32.081 1.00 38.05 ? 69  LYS B NZ  1 
ATOM   2223 N N   . TYR B 1 32  ? 28.758  23.782  -31.057 1.00 29.61 ? 70  TYR B N   1 
ATOM   2224 C CA  . TYR B 1 32  ? 27.794  23.386  -32.083 1.00 29.67 ? 70  TYR B CA  1 
ATOM   2225 C C   . TYR B 1 32  ? 27.475  24.524  -33.046 1.00 30.26 ? 70  TYR B C   1 
ATOM   2226 O O   . TYR B 1 32  ? 27.376  24.306  -34.254 1.00 30.36 ? 70  TYR B O   1 
ATOM   2227 C CB  . TYR B 1 32  ? 26.503  22.863  -31.455 1.00 29.29 ? 70  TYR B CB  1 
ATOM   2228 C CG  . TYR B 1 32  ? 25.614  22.146  -32.442 1.00 28.33 ? 70  TYR B CG  1 
ATOM   2229 C CD1 . TYR B 1 32  ? 25.657  20.756  -32.558 1.00 28.65 ? 70  TYR B CD1 1 
ATOM   2230 C CD2 . TYR B 1 32  ? 24.734  22.854  -33.261 1.00 26.35 ? 70  TYR B CD2 1 
ATOM   2231 C CE1 . TYR B 1 32  ? 24.848  20.090  -33.466 1.00 27.84 ? 70  TYR B CE1 1 
ATOM   2232 C CE2 . TYR B 1 32  ? 23.925  22.205  -34.177 1.00 27.11 ? 70  TYR B CE2 1 
ATOM   2233 C CZ  . TYR B 1 32  ? 23.985  20.823  -34.280 1.00 28.25 ? 70  TYR B CZ  1 
ATOM   2234 O OH  . TYR B 1 32  ? 23.184  20.176  -35.190 1.00 27.80 ? 70  TYR B OH  1 
ATOM   2235 N N   . THR B 1 33  ? 27.306  25.730  -32.509 1.00 31.14 ? 71  THR B N   1 
ATOM   2236 C CA  . THR B 1 33  ? 26.963  26.887  -33.330 1.00 32.09 ? 71  THR B CA  1 
ATOM   2237 C C   . THR B 1 33  ? 28.151  27.253  -34.204 1.00 32.74 ? 71  THR B C   1 
ATOM   2238 O O   . THR B 1 33  ? 27.982  27.724  -35.331 1.00 32.50 ? 71  THR B O   1 
ATOM   2239 C CB  . THR B 1 33  ? 26.496  28.104  -32.489 1.00 32.24 ? 71  THR B CB  1 
ATOM   2240 O OG1 . THR B 1 33  ? 27.547  28.537  -31.620 1.00 33.28 ? 71  THR B OG1 1 
ATOM   2241 C CG2 . THR B 1 33  ? 25.266  27.753  -31.659 1.00 31.72 ? 71  THR B CG2 1 
ATOM   2242 N N   . GLU B 1 34  ? 29.351  27.014  -33.684 1.00 33.53 ? 72  GLU B N   1 
ATOM   2243 C CA  . GLU B 1 34  ? 30.574  27.186  -34.467 1.00 35.03 ? 72  GLU B CA  1 
ATOM   2244 C C   . GLU B 1 34  ? 30.645  26.214  -35.647 1.00 35.09 ? 72  GLU B C   1 
ATOM   2245 O O   . GLU B 1 34  ? 30.931  26.626  -36.777 1.00 35.23 ? 72  GLU B O   1 
ATOM   2246 C CB  . GLU B 1 34  ? 31.815  27.072  -33.578 1.00 34.65 ? 72  GLU B CB  1 
ATOM   2247 C CG  . GLU B 1 34  ? 32.090  28.330  -32.773 1.00 36.13 ? 72  GLU B CG  1 
ATOM   2248 C CD  . GLU B 1 34  ? 33.321  28.219  -31.892 1.00 36.68 ? 72  GLU B CD  1 
ATOM   2249 O OE1 . GLU B 1 34  ? 33.973  27.151  -31.894 1.00 39.01 ? 72  GLU B OE1 1 
ATOM   2250 O OE2 . GLU B 1 34  ? 33.638  29.212  -31.197 1.00 39.25 ? 72  GLU B OE2 1 
ATOM   2251 N N   . ILE B 1 35  ? 30.372  24.940  -35.387 1.00 35.42 ? 73  ILE B N   1 
ATOM   2252 C CA  . ILE B 1 35  ? 30.383  23.904  -36.428 1.00 36.34 ? 73  ILE B CA  1 
ATOM   2253 C C   . ILE B 1 35  ? 29.195  24.049  -37.385 1.00 36.70 ? 73  ILE B C   1 
ATOM   2254 O O   . ILE B 1 35  ? 29.341  23.866  -38.592 1.00 36.88 ? 73  ILE B O   1 
ATOM   2255 C CB  . ILE B 1 35  ? 30.376  22.475  -35.826 1.00 36.38 ? 73  ILE B CB  1 
ATOM   2256 C CG1 . ILE B 1 35  ? 31.601  22.248  -34.935 1.00 36.69 ? 73  ILE B CG1 1 
ATOM   2257 C CG2 . ILE B 1 35  ? 30.329  21.417  -36.927 1.00 36.32 ? 73  ILE B CG2 1 
ATOM   2258 C CD1 . ILE B 1 35  ? 31.474  21.022  -34.033 1.00 36.70 ? 73  ILE B CD1 1 
ATOM   2259 N N   . HIS B 1 36  ? 28.024  24.370  -36.840 1.00 37.09 ? 74  HIS B N   1 
ATOM   2260 C CA  . HIS B 1 36  ? 26.817  24.533  -37.648 1.00 37.36 ? 74  HIS B CA  1 
ATOM   2261 C C   . HIS B 1 36  ? 26.420  26.000  -37.758 1.00 37.14 ? 74  HIS B C   1 
ATOM   2262 O O   . HIS B 1 36  ? 25.810  26.547  -36.837 1.00 37.32 ? 74  HIS B O   1 
ATOM   2263 C CB  . HIS B 1 36  ? 25.663  23.719  -37.069 1.00 37.57 ? 74  HIS B CB  1 
ATOM   2264 C CG  . HIS B 1 36  ? 25.874  22.241  -37.137 1.00 38.46 ? 74  HIS B CG  1 
ATOM   2265 N ND1 . HIS B 1 36  ? 26.642  21.557  -36.219 1.00 38.89 ? 74  HIS B ND1 1 
ATOM   2266 C CD2 . HIS B 1 36  ? 25.411  21.313  -38.007 1.00 39.47 ? 74  HIS B CD2 1 
ATOM   2267 C CE1 . HIS B 1 36  ? 26.642  20.271  -36.520 1.00 39.71 ? 74  HIS B CE1 1 
ATOM   2268 N NE2 . HIS B 1 36  ? 25.906  20.097  -37.603 1.00 40.80 ? 74  HIS B NE2 1 
ATOM   2269 N N   . PRO B 1 37  ? 26.770  26.646  -38.886 1.00 36.82 ? 75  PRO B N   1 
ATOM   2270 C CA  . PRO B 1 37  ? 26.423  28.050  -39.090 1.00 36.63 ? 75  PRO B CA  1 
ATOM   2271 C C   . PRO B 1 37  ? 24.914  28.309  -39.127 1.00 36.50 ? 75  PRO B C   1 
ATOM   2272 O O   . PRO B 1 37  ? 24.474  29.397  -38.754 1.00 36.42 ? 75  PRO B O   1 
ATOM   2273 C CB  . PRO B 1 37  ? 27.061  28.374  -40.447 1.00 36.57 ? 75  PRO B CB  1 
ATOM   2274 C CG  . PRO B 1 37  ? 28.122  27.339  -40.620 1.00 36.56 ? 75  PRO B CG  1 
ATOM   2275 C CD  . PRO B 1 37  ? 27.532  26.111  -40.028 1.00 36.71 ? 75  PRO B CD  1 
ATOM   2276 N N   . GLU B 1 38  ? 24.134  27.316  -39.553 1.00 36.42 ? 76  GLU B N   1 
ATOM   2277 C CA  . GLU B 1 38  ? 22.678  27.465  -39.633 1.00 36.67 ? 76  GLU B CA  1 
ATOM   2278 C C   . GLU B 1 38  ? 22.015  27.612  -38.256 1.00 36.46 ? 76  GLU B C   1 
ATOM   2279 O O   . GLU B 1 38  ? 20.870  28.060  -38.161 1.00 36.72 ? 76  GLU B O   1 
ATOM   2280 C CB  . GLU B 1 38  ? 22.040  26.329  -40.453 1.00 36.68 ? 76  GLU B CB  1 
ATOM   2281 C CG  . GLU B 1 38  ? 22.006  24.953  -39.779 1.00 37.02 ? 76  GLU B CG  1 
ATOM   2282 C CD  . GLU B 1 38  ? 23.323  24.203  -39.873 1.00 37.87 ? 76  GLU B CD  1 
ATOM   2283 O OE1 . GLU B 1 38  ? 24.341  24.806  -40.290 1.00 38.72 ? 76  GLU B OE1 1 
ATOM   2284 O OE2 . GLU B 1 38  ? 23.338  23.003  -39.528 1.00 38.15 ? 76  GLU B OE2 1 
ATOM   2285 N N   . MET B 1 39  ? 22.752  27.259  -37.204 1.00 36.24 ? 77  MET B N   1 
ATOM   2286 C CA  . MET B 1 39  ? 22.279  27.387  -35.816 1.00 35.99 ? 77  MET B CA  1 
ATOM   2287 C C   . MET B 1 39  ? 22.942  28.527  -35.017 1.00 35.85 ? 77  MET B C   1 
ATOM   2288 O O   . MET B 1 39  ? 22.799  28.587  -33.790 1.00 35.86 ? 77  MET B O   1 
ATOM   2289 C CB  . MET B 1 39  ? 22.464  26.057  -35.072 1.00 35.93 ? 77  MET B CB  1 
ATOM   2290 C CG  . MET B 1 39  ? 21.591  24.914  -35.579 1.00 36.05 ? 77  MET B CG  1 
ATOM   2291 S SD  . MET B 1 39  ? 19.823  25.234  -35.368 1.00 37.26 ? 77  MET B SD  1 
ATOM   2292 C CE  . MET B 1 39  ? 19.600  24.981  -33.613 1.00 36.36 ? 77  MET B CE  1 
ATOM   2293 N N   . ARG B 1 40  ? 23.649  29.431  -35.699 1.00 35.60 ? 78  ARG B N   1 
ATOM   2294 C CA  . ARG B 1 40  ? 24.410  30.495  -35.015 1.00 35.59 ? 78  ARG B CA  1 
ATOM   2295 C C   . ARG B 1 40  ? 23.537  31.591  -34.403 1.00 35.22 ? 78  ARG B C   1 
ATOM   2296 O O   . ARG B 1 40  ? 24.023  32.449  -33.649 1.00 35.03 ? 78  ARG B O   1 
ATOM   2297 C CB  . ARG B 1 40  ? 25.474  31.106  -35.932 1.00 35.84 ? 78  ARG B CB  1 
ATOM   2298 C CG  . ARG B 1 40  ? 26.685  30.211  -36.118 1.00 37.12 ? 78  ARG B CG  1 
ATOM   2299 C CD  . ARG B 1 40  ? 27.988  30.999  -36.146 1.00 38.42 ? 78  ARG B CD  1 
ATOM   2300 N NE  . ARG B 1 40  ? 28.311  31.497  -37.479 1.00 41.12 ? 78  ARG B NE  1 
ATOM   2301 C CZ  . ARG B 1 40  ? 29.118  30.882  -38.340 1.00 40.89 ? 78  ARG B CZ  1 
ATOM   2302 N NH1 . ARG B 1 40  ? 29.696  29.726  -38.019 1.00 40.76 ? 78  ARG B NH1 1 
ATOM   2303 N NH2 . ARG B 1 40  ? 29.341  31.426  -39.529 1.00 41.40 ? 78  ARG B NH2 1 
ATOM   2304 N N   . HIS B 1 41  ? 22.247  31.547  -34.725 1.00 34.62 ? 79  HIS B N   1 
ATOM   2305 C CA  . HIS B 1 41  ? 21.270  32.463  -34.154 1.00 34.25 ? 79  HIS B CA  1 
ATOM   2306 C C   . HIS B 1 41  ? 21.020  32.184  -32.668 1.00 33.78 ? 79  HIS B C   1 
ATOM   2307 O O   . HIS B 1 41  ? 20.550  33.055  -31.940 1.00 33.73 ? 79  HIS B O   1 
ATOM   2308 C CB  . HIS B 1 41  ? 19.959  32.378  -34.932 1.00 34.27 ? 79  HIS B CB  1 
ATOM   2309 C CG  . HIS B 1 41  ? 19.354  31.011  -34.952 1.00 34.71 ? 79  HIS B CG  1 
ATOM   2310 N ND1 . HIS B 1 41  ? 19.470  30.163  -36.032 1.00 34.51 ? 79  HIS B ND1 1 
ATOM   2311 C CD2 . HIS B 1 41  ? 18.628  30.343  -34.024 1.00 34.85 ? 79  HIS B CD2 1 
ATOM   2312 C CE1 . HIS B 1 41  ? 18.838  29.033  -35.773 1.00 35.23 ? 79  HIS B CE1 1 
ATOM   2313 N NE2 . HIS B 1 41  ? 18.317  29.117  -34.561 1.00 35.38 ? 79  HIS B NE2 1 
ATOM   2314 N N   . VAL B 1 42  ? 21.342  30.968  -32.230 1.00 33.36 ? 80  VAL B N   1 
ATOM   2315 C CA  . VAL B 1 42  ? 21.087  30.540  -30.860 1.00 32.42 ? 80  VAL B CA  1 
ATOM   2316 C C   . VAL B 1 42  ? 21.932  31.329  -29.855 1.00 32.38 ? 80  VAL B C   1 
ATOM   2317 O O   . VAL B 1 42  ? 23.146  31.469  -30.029 1.00 32.48 ? 80  VAL B O   1 
ATOM   2318 C CB  . VAL B 1 42  ? 21.331  29.016  -30.701 1.00 32.56 ? 80  VAL B CB  1 
ATOM   2319 C CG1 . VAL B 1 42  ? 21.440  28.639  -29.238 1.00 31.72 ? 80  VAL B CG1 1 
ATOM   2320 C CG2 . VAL B 1 42  ? 20.220  28.230  -31.384 1.00 31.60 ? 80  VAL B CG2 1 
ATOM   2321 N N   . ASP B 1 43  ? 21.277  31.872  -28.833 1.00 32.16 ? 81  ASP B N   1 
ATOM   2322 C CA  . ASP B 1 43  ? 21.971  32.498  -27.705 1.00 32.26 ? 81  ASP B CA  1 
ATOM   2323 C C   . ASP B 1 43  ? 22.201  31.400  -26.664 1.00 32.39 ? 81  ASP B C   1 
ATOM   2324 O O   . ASP B 1 43  ? 21.268  30.946  -26.004 1.00 31.82 ? 81  ASP B O   1 
ATOM   2325 C CB  . ASP B 1 43  ? 21.140  33.647  -27.125 1.00 32.48 ? 81  ASP B CB  1 
ATOM   2326 C CG  . ASP B 1 43  ? 21.866  34.413  -26.016 1.00 33.14 ? 81  ASP B CG  1 
ATOM   2327 O OD1 . ASP B 1 43  ? 22.565  33.800  -25.189 1.00 33.49 ? 81  ASP B OD1 1 
ATOM   2328 O OD2 . ASP B 1 43  ? 21.727  35.648  -25.961 1.00 35.37 ? 81  ASP B OD2 1 
ATOM   2329 N N   . CYS B 1 44  ? 23.454  30.975  -26.531 1.00 32.31 ? 82  CYS B N   1 
ATOM   2330 C CA  . CYS B 1 44  ? 23.789  29.818  -25.713 1.00 32.32 ? 82  CYS B CA  1 
ATOM   2331 C C   . CYS B 1 44  ? 23.527  30.013  -24.228 1.00 32.08 ? 82  CYS B C   1 
ATOM   2332 O O   . CYS B 1 44  ? 23.201  29.058  -23.531 1.00 32.03 ? 82  CYS B O   1 
ATOM   2333 C CB  . CYS B 1 44  ? 25.224  29.383  -25.981 1.00 32.29 ? 82  CYS B CB  1 
ATOM   2334 S SG  . CYS B 1 44  ? 25.352  28.660  -27.623 1.00 34.08 ? 82  CYS B SG  1 
ATOM   2335 N N   . GLN B 1 45  ? 23.655  31.253  -23.763 1.00 31.88 ? 83  GLN B N   1 
ATOM   2336 C CA  . GLN B 1 45  ? 23.280  31.608  -22.405 1.00 31.80 ? 83  GLN B CA  1 
ATOM   2337 C C   . GLN B 1 45  ? 21.772  31.423  -22.234 1.00 31.36 ? 83  GLN B C   1 
ATOM   2338 O O   . GLN B 1 45  ? 21.322  30.842  -21.244 1.00 31.49 ? 83  GLN B O   1 
ATOM   2339 C CB  . GLN B 1 45  ? 23.711  33.045  -22.086 1.00 32.00 ? 83  GLN B CB  1 
ATOM   2340 C CG  . GLN B 1 45  ? 23.425  33.481  -20.653 1.00 33.53 ? 83  GLN B CG  1 
ATOM   2341 C CD  . GLN B 1 45  ? 24.163  32.649  -19.617 1.00 36.64 ? 83  GLN B CD  1 
ATOM   2342 O OE1 . GLN B 1 45  ? 23.543  32.007  -18.762 1.00 38.06 ? 83  GLN B OE1 1 
ATOM   2343 N NE2 . GLN B 1 45  ? 25.495  32.651  -19.690 1.00 36.68 ? 83  GLN B NE2 1 
ATOM   2344 N N   . SER B 1 46  ? 20.994  31.893  -23.210 1.00 30.79 ? 84  SER B N   1 
ATOM   2345 C CA  . SER B 1 46  ? 19.544  31.678  -23.195 1.00 30.53 ? 84  SER B CA  1 
ATOM   2346 C C   . SER B 1 46  ? 19.220  30.186  -23.186 1.00 30.59 ? 84  SER B C   1 
ATOM   2347 O O   . SER B 1 46  ? 18.352  29.744  -22.437 1.00 30.54 ? 84  SER B O   1 
ATOM   2348 C CB  . SER B 1 46  ? 18.864  32.361  -24.385 1.00 30.65 ? 84  SER B CB  1 
ATOM   2349 O OG  . SER B 1 46  ? 18.906  33.768  -24.258 1.00 30.49 ? 84  SER B OG  1 
ATOM   2350 N N   . VAL B 1 47  ? 19.933  29.418  -24.009 1.00 29.93 ? 85  VAL B N   1 
ATOM   2351 C CA  . VAL B 1 47  ? 19.735  27.972  -24.070 1.00 30.08 ? 85  VAL B CA  1 
ATOM   2352 C C   . VAL B 1 47  ? 20.031  27.339  -22.718 1.00 29.64 ? 85  VAL B C   1 
ATOM   2353 O O   . VAL B 1 47  ? 19.249  26.525  -22.244 1.00 29.32 ? 85  VAL B O   1 
ATOM   2354 C CB  . VAL B 1 47  ? 20.581  27.298  -25.183 1.00 29.91 ? 85  VAL B CB  1 
ATOM   2355 C CG1 . VAL B 1 47  ? 20.544  25.783  -25.048 1.00 29.75 ? 85  VAL B CG1 1 
ATOM   2356 C CG2 . VAL B 1 47  ? 20.053  27.694  -26.537 1.00 29.46 ? 85  VAL B CG2 1 
ATOM   2357 N N   . TRP B 1 48  ? 21.146  27.730  -22.098 1.00 29.61 ? 86  TRP B N   1 
ATOM   2358 C CA  . TRP B 1 48  ? 21.455  27.246  -20.759 1.00 30.11 ? 86  TRP B CA  1 
ATOM   2359 C C   . TRP B 1 48  ? 20.340  27.605  -19.772 1.00 30.12 ? 86  TRP B C   1 
ATOM   2360 O O   . TRP B 1 48  ? 19.854  26.745  -19.020 1.00 30.19 ? 86  TRP B O   1 
ATOM   2361 C CB  . TRP B 1 48  ? 22.818  27.749  -20.244 1.00 30.22 ? 86  TRP B CB  1 
ATOM   2362 C CG  . TRP B 1 48  ? 22.981  27.488  -18.774 1.00 30.28 ? 86  TRP B CG  1 
ATOM   2363 C CD1 . TRP B 1 48  ? 23.207  28.408  -17.787 1.00 29.43 ? 86  TRP B CD1 1 
ATOM   2364 C CD2 . TRP B 1 48  ? 22.886  26.217  -18.126 1.00 31.06 ? 86  TRP B CD2 1 
ATOM   2365 N NE1 . TRP B 1 48  ? 23.270  27.780  -16.564 1.00 30.35 ? 86  TRP B NE1 1 
ATOM   2366 C CE2 . TRP B 1 48  ? 23.074  26.437  -16.745 1.00 30.88 ? 86  TRP B CE2 1 
ATOM   2367 C CE3 . TRP B 1 48  ? 22.665  24.907  -18.581 1.00 30.81 ? 86  TRP B CE3 1 
ATOM   2368 C CZ2 . TRP B 1 48  ? 23.044  25.393  -15.813 1.00 30.57 ? 86  TRP B CZ2 1 
ATOM   2369 C CZ3 . TRP B 1 48  ? 22.631  23.880  -17.654 1.00 30.19 ? 86  TRP B CZ3 1 
ATOM   2370 C CH2 . TRP B 1 48  ? 22.820  24.131  -16.288 1.00 30.05 ? 86  TRP B CH2 1 
ATOM   2371 N N   . ASP B 1 49  ? 19.937  28.871  -19.778 1.00 30.02 ? 87  ASP B N   1 
ATOM   2372 C CA  . ASP B 1 49  ? 18.872  29.327  -18.888 1.00 30.12 ? 87  ASP B CA  1 
ATOM   2373 C C   . ASP B 1 49  ? 17.594  28.490  -19.031 1.00 29.44 ? 87  ASP B C   1 
ATOM   2374 O O   . ASP B 1 49  ? 16.965  28.154  -18.034 1.00 28.83 ? 87  ASP B O   1 
ATOM   2375 C CB  . ASP B 1 49  ? 18.588  30.815  -19.108 1.00 30.67 ? 87  ASP B CB  1 
ATOM   2376 C CG  . ASP B 1 49  ? 19.626  31.717  -18.443 1.00 32.79 ? 87  ASP B CG  1 
ATOM   2377 O OD1 . ASP B 1 49  ? 20.520  31.208  -17.726 1.00 35.16 ? 87  ASP B OD1 1 
ATOM   2378 O OD2 . ASP B 1 49  ? 19.546  32.948  -18.637 1.00 35.97 ? 87  ASP B OD2 1 
ATOM   2379 N N   . ALA B 1 50  ? 17.240  28.138  -20.272 1.00 29.00 ? 88  ALA B N   1 
ATOM   2380 C CA  . ALA B 1 50  ? 16.043  27.345  -20.566 1.00 28.64 ? 88  ALA B CA  1 
ATOM   2381 C C   . ALA B 1 50  ? 16.223  25.897  -20.144 1.00 28.46 ? 88  ALA B C   1 
ATOM   2382 O O   . ALA B 1 50  ? 15.283  25.256  -19.679 1.00 28.06 ? 88  ALA B O   1 
ATOM   2383 C CB  . ALA B 1 50  ? 15.698  27.415  -22.061 1.00 28.47 ? 88  ALA B CB  1 
ATOM   2384 N N   . PHE B 1 51  ? 17.432  25.381  -20.325 1.00 28.33 ? 89  PHE B N   1 
ATOM   2385 C CA  . PHE B 1 51  ? 17.744  24.026  -19.894 1.00 28.63 ? 89  PHE B CA  1 
ATOM   2386 C C   . PHE B 1 51  ? 17.597  23.954  -18.371 1.00 28.89 ? 89  PHE B C   1 
ATOM   2387 O O   . PHE B 1 51  ? 16.856  23.115  -17.832 1.00 28.64 ? 89  PHE B O   1 
ATOM   2388 C CB  . PHE B 1 51  ? 19.181  23.684  -20.292 1.00 28.37 ? 89  PHE B CB  1 
ATOM   2389 C CG  . PHE B 1 51  ? 19.434  22.208  -20.471 1.00 28.56 ? 89  PHE B CG  1 
ATOM   2390 C CD1 . PHE B 1 51  ? 18.865  21.273  -19.615 1.00 28.52 ? 89  PHE B CD1 1 
ATOM   2391 C CD2 . PHE B 1 51  ? 20.248  21.760  -21.500 1.00 28.83 ? 89  PHE B CD2 1 
ATOM   2392 C CE1 . PHE B 1 51  ? 19.111  19.913  -19.779 1.00 28.92 ? 89  PHE B CE1 1 
ATOM   2393 C CE2 . PHE B 1 51  ? 20.488  20.400  -21.675 1.00 29.71 ? 89  PHE B CE2 1 
ATOM   2394 C CZ  . PHE B 1 51  ? 19.922  19.480  -20.812 1.00 28.36 ? 89  PHE B CZ  1 
ATOM   2395 N N   . LYS B 1 52  ? 18.323  24.843  -17.701 1.00 29.35 ? 90  LYS B N   1 
ATOM   2396 C CA  . LYS B 1 52  ? 18.312  25.004  -16.246 1.00 30.85 ? 90  LYS B CA  1 
ATOM   2397 C C   . LYS B 1 52  ? 16.892  25.168  -15.722 1.00 30.53 ? 90  LYS B C   1 
ATOM   2398 O O   . LYS B 1 52  ? 16.511  24.542  -14.737 1.00 31.31 ? 90  LYS B O   1 
ATOM   2399 C CB  . LYS B 1 52  ? 19.153  26.232  -15.878 1.00 30.82 ? 90  LYS B CB  1 
ATOM   2400 C CG  . LYS B 1 52  ? 19.745  26.232  -14.479 1.00 33.17 ? 90  LYS B CG  1 
ATOM   2401 C CD  . LYS B 1 52  ? 20.611  27.474  -14.282 1.00 32.15 ? 90  LYS B CD  1 
ATOM   2402 C CE  . LYS B 1 52  ? 19.834  28.646  -13.695 1.00 36.47 ? 90  LYS B CE  1 
ATOM   2403 N NZ  . LYS B 1 52  ? 20.431  29.956  -14.135 1.00 36.16 ? 90  LYS B NZ  1 
ATOM   2404 N N   . GLY B 1 53  ? 16.113  26.001  -16.403 1.00 30.96 ? 91  GLY B N   1 
ATOM   2405 C CA  . GLY B 1 53  ? 14.716  26.254  -16.058 1.00 30.66 ? 91  GLY B CA  1 
ATOM   2406 C C   . GLY B 1 53  ? 13.842  25.012  -16.038 1.00 30.21 ? 91  GLY B C   1 
ATOM   2407 O O   . GLY B 1 53  ? 12.946  24.900  -15.199 1.00 30.45 ? 91  GLY B O   1 
ATOM   2408 N N   . ALA B 1 54  ? 14.111  24.074  -16.946 1.00 29.42 ? 92  ALA B N   1 
ATOM   2409 C CA  . ALA B 1 54  ? 13.340  22.829  -17.024 1.00 28.48 ? 92  ALA B CA  1 
ATOM   2410 C C   . ALA B 1 54  ? 13.384  21.979  -15.746 1.00 27.87 ? 92  ALA B C   1 
ATOM   2411 O O   . ALA B 1 54  ? 12.423  21.284  -15.432 1.00 27.73 ? 92  ALA B O   1 
ATOM   2412 C CB  . ALA B 1 54  ? 13.795  22.008  -18.196 1.00 28.95 ? 92  ALA B CB  1 
ATOM   2413 N N   . PHE B 1 55  ? 14.497  22.003  -15.026 1.00 27.40 ? 93  PHE B N   1 
ATOM   2414 C CA  . PHE B 1 55  ? 14.657  21.054  -13.930 1.00 26.99 ? 93  PHE B CA  1 
ATOM   2415 C C   . PHE B 1 55  ? 15.034  21.634  -12.567 1.00 27.21 ? 93  PHE B C   1 
ATOM   2416 O O   . PHE B 1 55  ? 14.837  20.987  -11.533 1.00 27.27 ? 93  PHE B O   1 
ATOM   2417 C CB  . PHE B 1 55  ? 15.621  19.929  -14.349 1.00 26.52 ? 93  PHE B CB  1 
ATOM   2418 C CG  . PHE B 1 55  ? 17.053  20.357  -14.428 1.00 26.19 ? 93  PHE B CG  1 
ATOM   2419 C CD1 . PHE B 1 55  ? 17.899  20.215  -13.328 1.00 25.58 ? 93  PHE B CD1 1 
ATOM   2420 C CD2 . PHE B 1 55  ? 17.566  20.909  -15.600 1.00 24.09 ? 93  PHE B CD2 1 
ATOM   2421 C CE1 . PHE B 1 55  ? 19.227  20.619  -13.407 1.00 23.83 ? 93  PHE B CE1 1 
ATOM   2422 C CE2 . PHE B 1 55  ? 18.894  21.311  -15.677 1.00 24.03 ? 93  PHE B CE2 1 
ATOM   2423 C CZ  . PHE B 1 55  ? 19.723  21.162  -14.589 1.00 24.78 ? 93  PHE B CZ  1 
ATOM   2424 N N   . ILE B 1 56  ? 15.576  22.847  -12.552 1.00 27.53 ? 94  ILE B N   1 
ATOM   2425 C CA  . ILE B 1 56  ? 16.027  23.449  -11.300 1.00 27.81 ? 94  ILE B CA  1 
ATOM   2426 C C   . ILE B 1 56  ? 14.838  23.807  -10.417 1.00 27.49 ? 94  ILE B C   1 
ATOM   2427 O O   . ILE B 1 56  ? 13.799  24.239  -10.910 1.00 26.56 ? 94  ILE B O   1 
ATOM   2428 C CB  . ILE B 1 56  ? 16.958  24.669  -11.545 1.00 28.57 ? 94  ILE B CB  1 
ATOM   2429 C CG1 . ILE B 1 56  ? 18.329  24.207  -12.049 1.00 29.31 ? 94  ILE B CG1 1 
ATOM   2430 C CG2 . ILE B 1 56  ? 17.143  25.504  -10.286 1.00 29.33 ? 94  ILE B CG2 1 
ATOM   2431 C CD1 . ILE B 1 56  ? 19.075  23.306  -11.138 1.00 31.54 ? 94  ILE B CD1 1 
ATOM   2432 N N   . SER B 1 57  ? 14.992  23.576  -9.114  1.00 27.82 ? 95  SER B N   1 
ATOM   2433 C CA  . SER B 1 57  ? 13.967  23.867  -8.109  1.00 28.42 ? 95  SER B CA  1 
ATOM   2434 C C   . SER B 1 57  ? 12.759  22.957  -8.259  1.00 28.32 ? 95  SER B C   1 
ATOM   2435 O O   . SER B 1 57  ? 11.730  23.192  -7.639  1.00 29.79 ? 95  SER B O   1 
ATOM   2436 C CB  . SER B 1 57  ? 13.530  25.338  -8.157  1.00 28.66 ? 95  SER B CB  1 
ATOM   2437 O OG  . SER B 1 57  ? 14.621  26.195  -7.829  1.00 31.80 ? 95  SER B OG  1 
ATOM   2438 N N   . LYS B 1 58  ? 12.882  21.930  -9.089  1.00 26.66 ? 96  LYS B N   1 
ATOM   2439 C CA  . LYS B 1 58  ? 11.767  21.034  -9.358  1.00 26.08 ? 96  LYS B CA  1 
ATOM   2440 C C   . LYS B 1 58  ? 12.063  19.662  -8.789  1.00 25.43 ? 96  LYS B C   1 
ATOM   2441 O O   . LYS B 1 58  ? 13.219  19.248  -8.738  1.00 24.27 ? 96  LYS B O   1 
ATOM   2442 C CB  . LYS B 1 58  ? 11.472  20.979  -10.856 1.00 26.17 ? 96  LYS B CB  1 
ATOM   2443 C CG  . LYS B 1 58  ? 10.881  22.291  -11.357 1.00 27.36 ? 96  LYS B CG  1 
ATOM   2444 C CD  . LYS B 1 58  ? 10.851  22.372  -12.883 1.00 26.87 ? 96  LYS B CD  1 
ATOM   2445 C CE  . LYS B 1 58  ? 10.273  23.719  -13.312 1.00 30.20 ? 96  LYS B CE  1 
ATOM   2446 N NZ  . LYS B 1 58  ? 10.242  23.827  -14.784 1.00 32.72 ? 96  LYS B NZ  1 
ATOM   2447 N N   . HIS B 1 59  ? 11.029  18.983  -8.298  1.00 24.87 ? 97  HIS B N   1 
ATOM   2448 C CA  . HIS B 1 59  ? 11.240  17.636  -7.784  1.00 25.12 ? 97  HIS B CA  1 
ATOM   2449 C C   . HIS B 1 59  ? 11.654  16.779  -8.971  1.00 25.66 ? 97  HIS B C   1 
ATOM   2450 O O   . HIS B 1 59  ? 10.963  16.756  -9.980  1.00 26.01 ? 97  HIS B O   1 
ATOM   2451 C CB  . HIS B 1 59  ? 9.997   17.074  -7.108  1.00 24.96 ? 97  HIS B CB  1 
ATOM   2452 C CG  . HIS B 1 59  ? 10.268  15.847  -6.300  1.00 24.39 ? 97  HIS B CG  1 
ATOM   2453 N ND1 . HIS B 1 59  ? 10.608  14.643  -6.876  1.00 22.95 ? 97  HIS B ND1 1 
ATOM   2454 C CD2 . HIS B 1 59  ? 10.279  15.645  -4.961  1.00 23.15 ? 97  HIS B CD2 1 
ATOM   2455 C CE1 . HIS B 1 59  ? 10.809  13.747  -5.927  1.00 24.25 ? 97  HIS B CE1 1 
ATOM   2456 N NE2 . HIS B 1 59  ? 10.613  14.331  -4.756  1.00 24.28 ? 97  HIS B NE2 1 
ATOM   2457 N N   . PRO B 1 60  ? 12.810  16.104  -8.872  1.00 26.48 ? 98  PRO B N   1 
ATOM   2458 C CA  . PRO B 1 60  ? 13.311  15.354  -10.021 1.00 26.67 ? 98  PRO B CA  1 
ATOM   2459 C C   . PRO B 1 60  ? 12.547  14.074  -10.379 1.00 27.40 ? 98  PRO B C   1 
ATOM   2460 O O   . PRO B 1 60  ? 13.020  13.324  -11.202 1.00 27.43 ? 98  PRO B O   1 
ATOM   2461 C CB  . PRO B 1 60  ? 14.756  15.029  -9.638  1.00 27.21 ? 98  PRO B CB  1 
ATOM   2462 C CG  . PRO B 1 60  ? 14.821  15.143  -8.183  1.00 26.45 ? 98  PRO B CG  1 
ATOM   2463 C CD  . PRO B 1 60  ? 13.733  16.062  -7.727  1.00 26.19 ? 98  PRO B CD  1 
ATOM   2464 N N   . CYS B 1 61  ? 11.406  13.815  -9.747  1.00 26.82 ? 99  CYS B N   1 
ATOM   2465 C CA  . CYS B 1 61  ? 10.505  12.754  -10.211 1.00 27.18 ? 99  CYS B CA  1 
ATOM   2466 C C   . CYS B 1 61  ? 9.231   13.329  -10.820 1.00 26.32 ? 99  CYS B C   1 
ATOM   2467 O O   . CYS B 1 61  ? 8.364   12.580  -11.261 1.00 26.66 ? 99  CYS B O   1 
ATOM   2468 C CB  . CYS B 1 61  ? 10.152  11.795  -9.074  1.00 27.56 ? 99  CYS B CB  1 
ATOM   2469 S SG  . CYS B 1 61  ? 11.602  10.942  -8.487  1.00 29.06 ? 99  CYS B SG  1 
ATOM   2470 N N   . ASP B 1 62  ? 9.150   14.657  -10.874 1.00 25.80 ? 100 ASP B N   1 
ATOM   2471 C CA  . ASP B 1 62  ? 7.939   15.355  -11.280 1.00 25.41 ? 100 ASP B CA  1 
ATOM   2472 C C   . ASP B 1 62  ? 8.116   16.164  -12.577 1.00 25.54 ? 100 ASP B C   1 
ATOM   2473 O O   . ASP B 1 62  ? 7.297   17.034  -12.895 1.00 25.93 ? 100 ASP B O   1 
ATOM   2474 C CB  . ASP B 1 62  ? 7.478   16.261  -10.138 1.00 24.91 ? 100 ASP B CB  1 
ATOM   2475 C CG  . ASP B 1 62  ? 6.999   15.478  -8.941  1.00 25.14 ? 100 ASP B CG  1 
ATOM   2476 O OD1 . ASP B 1 62  ? 6.697   14.279  -9.112  1.00 25.40 ? 100 ASP B OD1 1 
ATOM   2477 O OD2 . ASP B 1 62  ? 6.908   16.048  -7.833  1.00 25.67 ? 100 ASP B OD2 1 
ATOM   2478 N N   . ILE B 1 63  ? 9.176   15.865  -13.314 1.00 25.71 ? 101 ILE B N   1 
ATOM   2479 C CA  . ILE B 1 63  ? 9.501   16.592  -14.541 1.00 25.76 ? 101 ILE B CA  1 
ATOM   2480 C C   . ILE B 1 63  ? 8.539   16.177  -15.661 1.00 25.72 ? 101 ILE B C   1 
ATOM   2481 O O   . ILE B 1 63  ? 8.153   15.014  -15.777 1.00 24.79 ? 101 ILE B O   1 
ATOM   2482 C CB  . ILE B 1 63  ? 10.981  16.377  -14.948 1.00 25.86 ? 101 ILE B CB  1 
ATOM   2483 C CG1 . ILE B 1 63  ? 11.926  16.672  -13.757 1.00 25.87 ? 101 ILE B CG1 1 
ATOM   2484 C CG2 . ILE B 1 63  ? 11.358  17.208  -16.183 1.00 25.75 ? 101 ILE B CG2 1 
ATOM   2485 C CD1 . ILE B 1 63  ? 11.837  18.091  -13.168 1.00 26.80 ? 101 ILE B CD1 1 
ATOM   2486 N N   . THR B 1 64  ? 8.113   17.146  -16.458 1.00 26.16 ? 102 THR B N   1 
ATOM   2487 C CA  . THR B 1 64  ? 7.188   16.853  -17.539 1.00 26.91 ? 102 THR B CA  1 
ATOM   2488 C C   . THR B 1 64  ? 7.783   17.383  -18.835 1.00 27.80 ? 102 THR B C   1 
ATOM   2489 O O   . THR B 1 64  ? 8.740   18.156  -18.814 1.00 27.14 ? 102 THR B O   1 
ATOM   2490 C CB  . THR B 1 64  ? 5.800   17.472  -17.304 1.00 27.23 ? 102 THR B CB  1 
ATOM   2491 O OG1 . THR B 1 64  ? 5.905   18.898  -17.365 1.00 26.75 ? 102 THR B OG1 1 
ATOM   2492 C CG2 . THR B 1 64  ? 5.217   17.050  -15.929 1.00 27.62 ? 102 THR B CG2 1 
ATOM   2493 N N   . GLU B 1 65  ? 7.211   16.971  -19.959 1.00 28.81 ? 103 GLU B N   1 
ATOM   2494 C CA  . GLU B 1 65  ? 7.701   17.421  -21.254 1.00 30.64 ? 103 GLU B CA  1 
ATOM   2495 C C   . GLU B 1 65  ? 7.535   18.936  -21.338 1.00 30.53 ? 103 GLU B C   1 
ATOM   2496 O O   . GLU B 1 65  ? 8.386   19.623  -21.892 1.00 30.73 ? 103 GLU B O   1 
ATOM   2497 C CB  . GLU B 1 65  ? 7.007   16.667  -22.392 1.00 30.69 ? 103 GLU B CB  1 
ATOM   2498 C CG  . GLU B 1 65  ? 7.061   15.130  -22.169 1.00 35.41 ? 103 GLU B CG  1 
ATOM   2499 C CD  . GLU B 1 65  ? 7.187   14.288  -23.440 1.00 39.67 ? 103 GLU B CD  1 
ATOM   2500 O OE1 . GLU B 1 65  ? 7.420   14.860  -24.520 1.00 42.41 ? 103 GLU B OE1 1 
ATOM   2501 O OE2 . GLU B 1 65  ? 7.062   13.043  -23.353 1.00 41.70 ? 103 GLU B OE2 1 
ATOM   2502 N N   . GLU B 1 66  ? 6.477   19.443  -20.704 1.00 30.86 ? 104 GLU B N   1 
ATOM   2503 C CA  . GLU B 1 66  ? 6.193   20.879  -20.619 1.00 31.35 ? 104 GLU B CA  1 
ATOM   2504 C C   . GLU B 1 66  ? 7.349   21.666  -20.006 1.00 30.57 ? 104 GLU B C   1 
ATOM   2505 O O   . GLU B 1 66  ? 7.601   22.807  -20.393 1.00 30.20 ? 104 GLU B O   1 
ATOM   2506 C CB  . GLU B 1 66  ? 4.914   21.142  -19.806 1.00 31.95 ? 104 GLU B CB  1 
ATOM   2507 C CG  . GLU B 1 66  ? 3.662   20.402  -20.328 1.00 36.21 ? 104 GLU B CG  1 
ATOM   2508 C CD  . GLU B 1 66  ? 3.438   19.041  -19.653 1.00 39.17 ? 104 GLU B CD  1 
ATOM   2509 O OE1 . GLU B 1 66  ? 3.936   18.011  -20.182 1.00 37.23 ? 104 GLU B OE1 1 
ATOM   2510 O OE2 . GLU B 1 66  ? 2.761   19.021  -18.588 1.00 42.26 ? 104 GLU B OE2 1 
ATOM   2511 N N   . ASP B 1 67  ? 8.036   21.065  -19.036 1.00 29.36 ? 105 ASP B N   1 
ATOM   2512 C CA  . ASP B 1 67  ? 9.198   21.705  -18.416 1.00 28.72 ? 105 ASP B CA  1 
ATOM   2513 C C   . ASP B 1 67  ? 10.279  22.050  -19.437 1.00 28.29 ? 105 ASP B C   1 
ATOM   2514 O O   . ASP B 1 67  ? 11.004  23.033  -19.273 1.00 28.36 ? 105 ASP B O   1 
ATOM   2515 C CB  . ASP B 1 67  ? 9.771   20.809  -17.325 1.00 28.38 ? 105 ASP B CB  1 
ATOM   2516 C CG  . ASP B 1 67  ? 8.910   20.792  -16.083 1.00 29.12 ? 105 ASP B CG  1 
ATOM   2517 O OD1 . ASP B 1 67  ? 8.443   21.879  -15.660 1.00 27.88 ? 105 ASP B OD1 1 
ATOM   2518 O OD2 . ASP B 1 67  ? 8.704   19.695  -15.531 1.00 28.36 ? 105 ASP B OD2 1 
ATOM   2519 N N   . TYR B 1 68  ? 10.362  21.251  -20.501 1.00 28.20 ? 106 TYR B N   1 
ATOM   2520 C CA  . TYR B 1 68  ? 11.393  21.422  -21.527 1.00 27.76 ? 106 TYR B CA  1 
ATOM   2521 C C   . TYR B 1 68  ? 10.981  22.229  -22.746 1.00 29.08 ? 106 TYR B C   1 
ATOM   2522 O O   . TYR B 1 68  ? 11.792  22.430  -23.658 1.00 28.93 ? 106 TYR B O   1 
ATOM   2523 C CB  . TYR B 1 68  ? 11.910  20.069  -21.981 1.00 27.64 ? 106 TYR B CB  1 
ATOM   2524 C CG  . TYR B 1 68  ? 12.855  19.472  -20.994 1.00 26.48 ? 106 TYR B CG  1 
ATOM   2525 C CD1 . TYR B 1 68  ? 12.449  18.416  -20.162 1.00 26.91 ? 106 TYR B CD1 1 
ATOM   2526 C CD2 . TYR B 1 68  ? 14.153  19.964  -20.866 1.00 26.42 ? 106 TYR B CD2 1 
ATOM   2527 C CE1 . TYR B 1 68  ? 13.338  17.854  -19.231 1.00 25.91 ? 106 TYR B CE1 1 
ATOM   2528 C CE2 . TYR B 1 68  ? 15.050  19.407  -19.932 1.00 24.22 ? 106 TYR B CE2 1 
ATOM   2529 C CZ  . TYR B 1 68  ? 14.626  18.363  -19.125 1.00 25.29 ? 106 TYR B CZ  1 
ATOM   2530 O OH  . TYR B 1 68  ? 15.503  17.801  -18.220 1.00 25.98 ? 106 TYR B OH  1 
ATOM   2531 N N   . GLN B 1 69  ? 9.736   22.691  -22.773 1.00 29.99 ? 107 GLN B N   1 
ATOM   2532 C CA  . GLN B 1 69  ? 9.250   23.435  -23.933 1.00 30.86 ? 107 GLN B CA  1 
ATOM   2533 C C   . GLN B 1 69  ? 10.108  24.670  -24.235 1.00 30.54 ? 107 GLN B C   1 
ATOM   2534 O O   . GLN B 1 69  ? 10.523  24.850  -25.379 1.00 31.23 ? 107 GLN B O   1 
ATOM   2535 C CB  . GLN B 1 69  ? 7.756   23.766  -23.824 1.00 31.52 ? 107 GLN B CB  1 
ATOM   2536 C CG  . GLN B 1 69  ? 6.817   22.572  -24.075 1.00 35.43 ? 107 GLN B CG  1 
ATOM   2537 C CD  . GLN B 1 69  ? 7.107   21.789  -25.373 1.00 40.76 ? 107 GLN B CD  1 
ATOM   2538 O OE1 . GLN B 1 69  ? 7.278   22.369  -26.457 1.00 42.31 ? 107 GLN B OE1 1 
ATOM   2539 N NE2 . GLN B 1 69  ? 7.144   20.457  -25.260 1.00 41.65 ? 107 GLN B NE2 1 
ATOM   2540 N N   . PRO B 1 70  ? 10.406  25.510  -23.223 1.00 30.26 ? 108 PRO B N   1 
ATOM   2541 C CA  . PRO B 1 70  ? 11.283  26.644  -23.519 1.00 29.99 ? 108 PRO B CA  1 
ATOM   2542 C C   . PRO B 1 70  ? 12.570  26.214  -24.210 1.00 29.54 ? 108 PRO B C   1 
ATOM   2543 O O   . PRO B 1 70  ? 12.913  26.758  -25.256 1.00 28.93 ? 108 PRO B O   1 
ATOM   2544 C CB  . PRO B 1 70  ? 11.568  27.231  -22.131 1.00 30.06 ? 108 PRO B CB  1 
ATOM   2545 C CG  . PRO B 1 70  ? 10.331  26.923  -21.375 1.00 30.47 ? 108 PRO B CG  1 
ATOM   2546 C CD  . PRO B 1 70  ? 9.972   25.532  -21.812 1.00 30.44 ? 108 PRO B CD  1 
ATOM   2547 N N   . LEU B 1 71  ? 13.250  25.216  -23.655 1.00 28.98 ? 109 LEU B N   1 
ATOM   2548 C CA  . LEU B 1 71  ? 14.430  24.659  -24.296 1.00 28.77 ? 109 LEU B CA  1 
ATOM   2549 C C   . LEU B 1 71  ? 14.166  24.169  -25.730 1.00 28.54 ? 109 LEU B C   1 
ATOM   2550 O O   . LEU B 1 71  ? 14.931  24.497  -26.637 1.00 27.65 ? 109 LEU B O   1 
ATOM   2551 C CB  . LEU B 1 71  ? 15.024  23.530  -23.448 1.00 28.88 ? 109 LEU B CB  1 
ATOM   2552 C CG  . LEU B 1 71  ? 16.271  22.854  -24.010 1.00 28.68 ? 109 LEU B CG  1 
ATOM   2553 C CD1 . LEU B 1 71  ? 17.448  23.837  -24.158 1.00 29.90 ? 109 LEU B CD1 1 
ATOM   2554 C CD2 . LEU B 1 71  ? 16.655  21.645  -23.145 1.00 28.01 ? 109 LEU B CD2 1 
ATOM   2555 N N   . MET B 1 72  ? 13.105  23.375  -25.916 1.00 28.86 ? 110 MET B N   1 
ATOM   2556 C CA  . MET B 1 72  ? 12.738  22.821  -27.231 1.00 29.74 ? 110 MET B CA  1 
ATOM   2557 C C   . MET B 1 72  ? 12.568  23.930  -28.252 1.00 29.93 ? 110 MET B C   1 
ATOM   2558 O O   . MET B 1 72  ? 13.036  23.831  -29.391 1.00 29.57 ? 110 MET B O   1 
ATOM   2559 C CB  . MET B 1 72  ? 11.421  22.026  -27.159 1.00 30.33 ? 110 MET B CB  1 
ATOM   2560 C CG  . MET B 1 72  ? 11.466  20.709  -26.384 1.00 32.25 ? 110 MET B CG  1 
ATOM   2561 S SD  . MET B 1 72  ? 12.813  19.637  -26.886 1.00 39.18 ? 110 MET B SD  1 
ATOM   2562 C CE  . MET B 1 72  ? 13.877  19.793  -25.441 1.00 38.55 ? 110 MET B CE  1 
ATOM   2563 N N   . LYS B 1 73  ? 11.895  24.992  -27.828 1.00 30.42 ? 111 LYS B N   1 
ATOM   2564 C CA  . LYS B 1 73  ? 11.655  26.133  -28.691 1.00 31.31 ? 111 LYS B CA  1 
ATOM   2565 C C   . LYS B 1 73  ? 12.973  26.804  -29.091 1.00 31.19 ? 111 LYS B C   1 
ATOM   2566 O O   . LYS B 1 73  ? 13.219  27.034  -30.274 1.00 31.01 ? 111 LYS B O   1 
ATOM   2567 C CB  . LYS B 1 73  ? 10.673  27.103  -28.031 1.00 32.22 ? 111 LYS B CB  1 
ATOM   2568 C CG  . LYS B 1 73  ? 9.252   26.502  -27.856 1.00 34.04 ? 111 LYS B CG  1 
ATOM   2569 C CD  . LYS B 1 73  ? 8.592   26.143  -29.207 1.00 37.15 ? 111 LYS B CD  1 
ATOM   2570 C CE  . LYS B 1 73  ? 7.511   25.060  -29.058 1.00 36.74 ? 111 LYS B CE  1 
ATOM   2571 N NZ  . LYS B 1 73  ? 8.077   23.724  -28.669 1.00 38.43 ? 111 LYS B NZ  1 
ATOM   2572 N N   . LEU B 1 74  ? 13.842  27.059  -28.115 1.00 30.69 ? 112 LEU B N   1 
ATOM   2573 C CA  . LEU B 1 74  ? 15.148  27.642  -28.402 1.00 30.90 ? 112 LEU B CA  1 
ATOM   2574 C C   . LEU B 1 74  ? 16.029  26.732  -29.287 1.00 31.01 ? 112 LEU B C   1 
ATOM   2575 O O   . LEU B 1 74  ? 16.812  27.213  -30.117 1.00 31.39 ? 112 LEU B O   1 
ATOM   2576 C CB  . LEU B 1 74  ? 15.857  28.012  -27.098 1.00 30.49 ? 112 LEU B CB  1 
ATOM   2577 C CG  . LEU B 1 74  ? 15.874  29.463  -26.606 1.00 30.89 ? 112 LEU B CG  1 
ATOM   2578 C CD1 . LEU B 1 74  ? 14.716  30.322  -27.118 1.00 30.15 ? 112 LEU B CD1 1 
ATOM   2579 C CD2 . LEU B 1 74  ? 15.951  29.527  -25.091 1.00 30.05 ? 112 LEU B CD2 1 
ATOM   2580 N N   . GLY B 1 75  ? 15.883  25.425  -29.120 1.00 31.07 ? 113 GLY B N   1 
ATOM   2581 C CA  . GLY B 1 75  ? 16.698  24.468  -29.853 1.00 31.23 ? 113 GLY B CA  1 
ATOM   2582 C C   . GLY B 1 75  ? 16.081  24.016  -31.165 1.00 31.40 ? 113 GLY B C   1 
ATOM   2583 O O   . GLY B 1 75  ? 16.561  23.057  -31.773 1.00 31.09 ? 113 GLY B O   1 
ATOM   2584 N N   . THR B 1 76  ? 15.022  24.707  -31.598 1.00 31.48 ? 114 THR B N   1 
ATOM   2585 C CA  . THR B 1 76  ? 14.334  24.390  -32.852 1.00 31.93 ? 114 THR B CA  1 
ATOM   2586 C C   . THR B 1 76  ? 15.353  24.217  -33.970 1.00 31.37 ? 114 THR B C   1 
ATOM   2587 O O   . THR B 1 76  ? 16.209  25.075  -34.183 1.00 30.86 ? 114 THR B O   1 
ATOM   2588 C CB  . THR B 1 76  ? 13.316  25.483  -33.245 1.00 32.18 ? 114 THR B CB  1 
ATOM   2589 O OG1 . THR B 1 76  ? 12.291  25.566  -32.248 1.00 33.53 ? 114 THR B OG1 1 
ATOM   2590 C CG2 . THR B 1 76  ? 12.667  25.174  -34.592 1.00 32.94 ? 114 THR B CG2 1 
ATOM   2591 N N   . GLN B 1 77  ? 15.265  23.083  -34.654 1.00 31.47 ? 115 GLN B N   1 
ATOM   2592 C CA  . GLN B 1 77  ? 16.182  22.772  -35.737 1.00 31.49 ? 115 GLN B CA  1 
ATOM   2593 C C   . GLN B 1 77  ? 15.551  21.817  -36.730 1.00 31.95 ? 115 GLN B C   1 
ATOM   2594 O O   . GLN B 1 77  ? 15.051  20.750  -36.361 1.00 31.73 ? 115 GLN B O   1 
ATOM   2595 C CB  . GLN B 1 77  ? 17.463  22.161  -35.178 1.00 31.17 ? 115 GLN B CB  1 
ATOM   2596 C CG  . GLN B 1 77  ? 18.462  21.714  -36.242 1.00 30.57 ? 115 GLN B CG  1 
ATOM   2597 C CD  . GLN B 1 77  ? 19.786  21.308  -35.657 1.00 29.69 ? 115 GLN B CD  1 
ATOM   2598 O OE1 . GLN B 1 77  ? 20.761  21.098  -36.380 1.00 28.94 ? 115 GLN B OE1 1 
ATOM   2599 N NE2 . GLN B 1 77  ? 19.832  21.193  -34.334 1.00 28.87 ? 115 GLN B NE2 1 
ATOM   2600 N N   . THR B 1 78  ? 15.588  22.196  -38.001 1.00 32.33 ? 116 THR B N   1 
ATOM   2601 C CA  . THR B 1 78  ? 15.108  21.307  -39.043 1.00 32.93 ? 116 THR B CA  1 
ATOM   2602 C C   . THR B 1 78  ? 16.263  20.583  -39.722 1.00 32.68 ? 116 THR B C   1 
ATOM   2603 O O   . THR B 1 78  ? 17.157  21.207  -40.290 1.00 33.19 ? 116 THR B O   1 
ATOM   2604 C CB  . THR B 1 78  ? 14.260  22.055  -40.079 1.00 33.02 ? 116 THR B CB  1 
ATOM   2605 O OG1 . THR B 1 78  ? 13.257  22.816  -39.394 1.00 34.63 ? 116 THR B OG1 1 
ATOM   2606 C CG2 . THR B 1 78  ? 13.582  21.068  -41.027 1.00 33.41 ? 116 THR B CG2 1 
ATOM   2607 N N   . VAL B 1 79  ? 16.241  19.261  -39.632 1.00 32.08 ? 117 VAL B N   1 
ATOM   2608 C CA  . VAL B 1 79  ? 17.129  18.420  -40.415 1.00 31.44 ? 117 VAL B CA  1 
ATOM   2609 C C   . VAL B 1 79  ? 16.308  17.799  -41.552 1.00 30.64 ? 117 VAL B C   1 
ATOM   2610 O O   . VAL B 1 79  ? 15.079  17.697  -41.437 1.00 30.38 ? 117 VAL B O   1 
ATOM   2611 C CB  . VAL B 1 79  ? 17.777  17.319  -39.549 1.00 31.89 ? 117 VAL B CB  1 
ATOM   2612 C CG1 . VAL B 1 79  ? 18.486  17.940  -38.337 1.00 32.22 ? 117 VAL B CG1 1 
ATOM   2613 C CG2 . VAL B 1 79  ? 16.745  16.283  -39.106 1.00 32.32 ? 117 VAL B CG2 1 
ATOM   2614 N N   . PRO B 1 80  ? 16.972  17.384  -42.651 1.00 30.02 ? 118 PRO B N   1 
ATOM   2615 C CA  . PRO B 1 80  ? 16.222  16.748  -43.738 1.00 29.30 ? 118 PRO B CA  1 
ATOM   2616 C C   . PRO B 1 80  ? 15.565  15.481  -43.208 1.00 28.95 ? 118 PRO B C   1 
ATOM   2617 O O   . PRO B 1 80  ? 16.257  14.593  -42.714 1.00 29.20 ? 118 PRO B O   1 
ATOM   2618 C CB  . PRO B 1 80  ? 17.301  16.412  -44.764 1.00 29.41 ? 118 PRO B CB  1 
ATOM   2619 C CG  . PRO B 1 80  ? 18.448  17.293  -44.433 1.00 29.91 ? 118 PRO B CG  1 
ATOM   2620 C CD  . PRO B 1 80  ? 18.412  17.460  -42.951 1.00 29.76 ? 118 PRO B CD  1 
ATOM   2621 N N   . CYS B 1 81  ? 14.236  15.429  -43.276 1.00 28.32 ? 119 CYS B N   1 
ATOM   2622 C CA  . CYS B 1 81  ? 13.447  14.373  -42.632 1.00 27.23 ? 119 CYS B CA  1 
ATOM   2623 C C   . CYS B 1 81  ? 13.738  12.973  -43.165 1.00 26.60 ? 119 CYS B C   1 
ATOM   2624 O O   . CYS B 1 81  ? 13.469  11.983  -42.484 1.00 26.08 ? 119 CYS B O   1 
ATOM   2625 C CB  . CYS B 1 81  ? 11.944  14.670  -42.748 1.00 27.14 ? 119 CYS B CB  1 
ATOM   2626 S SG  . CYS B 1 81  ? 11.291  14.756  -44.444 1.00 28.53 ? 119 CYS B SG  1 
ATOM   2627 N N   . ASN B 1 82  ? 14.257  12.901  -44.391 1.00 25.57 ? 120 ASN B N   1 
ATOM   2628 C CA  . ASN B 1 82  ? 14.644  11.624  -45.003 1.00 24.99 ? 120 ASN B CA  1 
ATOM   2629 C C   . ASN B 1 82  ? 16.079  11.190  -44.687 1.00 24.64 ? 120 ASN B C   1 
ATOM   2630 O O   . ASN B 1 82  ? 16.584  10.224  -45.264 1.00 24.39 ? 120 ASN B O   1 
ATOM   2631 C CB  . ASN B 1 82  ? 14.430  11.668  -46.528 1.00 24.91 ? 120 ASN B CB  1 
ATOM   2632 C CG  . ASN B 1 82  ? 15.220  12.777  -47.208 1.00 24.78 ? 120 ASN B CG  1 
ATOM   2633 O OD1 . ASN B 1 82  ? 15.310  13.907  -46.708 1.00 24.40 ? 120 ASN B OD1 1 
ATOM   2634 N ND2 . ASN B 1 82  ? 15.781  12.462  -48.368 1.00 22.75 ? 120 ASN B ND2 1 
ATOM   2635 N N   . LYS B 1 83  ? 16.732  11.899  -43.769 1.00 23.78 ? 121 LYS B N   1 
ATOM   2636 C CA  . LYS B 1 83  ? 18.137  11.635  -43.474 1.00 23.99 ? 121 LYS B CA  1 
ATOM   2637 C C   . LYS B 1 83  ? 18.343  11.294  -41.996 1.00 23.88 ? 121 LYS B C   1 
ATOM   2638 O O   . LYS B 1 83  ? 19.408  11.531  -41.425 1.00 24.01 ? 121 LYS B O   1 
ATOM   2639 C CB  . LYS B 1 83  ? 19.006  12.831  -43.902 1.00 23.99 ? 121 LYS B CB  1 
ATOM   2640 C CG  . LYS B 1 83  ? 18.941  13.160  -45.413 1.00 24.13 ? 121 LYS B CG  1 
ATOM   2641 C CD  . LYS B 1 83  ? 19.732  12.175  -46.250 1.00 23.77 ? 121 LYS B CD  1 
ATOM   2642 C CE  . LYS B 1 83  ? 19.606  12.467  -47.734 1.00 24.70 ? 121 LYS B CE  1 
ATOM   2643 N NZ  . LYS B 1 83  ? 19.884  11.216  -48.480 1.00 26.98 ? 121 LYS B NZ  1 
ATOM   2644 N N   . ILE B 1 84  ? 17.316  10.711  -41.395 1.00 23.24 ? 122 ILE B N   1 
ATOM   2645 C CA  . ILE B 1 84  ? 17.331  10.449  -39.971 1.00 23.70 ? 122 ILE B CA  1 
ATOM   2646 C C   . ILE B 1 84  ? 17.796  9.030   -39.668 1.00 23.85 ? 122 ILE B C   1 
ATOM   2647 O O   . ILE B 1 84  ? 17.323  8.049   -40.268 1.00 23.97 ? 122 ILE B O   1 
ATOM   2648 C CB  . ILE B 1 84  ? 15.972  10.778  -39.341 1.00 23.20 ? 122 ILE B CB  1 
ATOM   2649 C CG1 . ILE B 1 84  ? 15.826  12.303  -39.267 1.00 22.97 ? 122 ILE B CG1 1 
ATOM   2650 C CG2 . ILE B 1 84  ? 15.833  10.141  -37.964 1.00 23.36 ? 122 ILE B CG2 1 
ATOM   2651 C CD1 . ILE B 1 84  ? 14.409  12.771  -39.145 1.00 23.80 ? 122 ILE B CD1 1 
ATOM   2652 N N   . LEU B 1 85  ? 18.773  8.951   -38.769 1.00 23.57 ? 123 LEU B N   1 
ATOM   2653 C CA  . LEU B 1 85  ? 19.248  7.678   -38.247 1.00 23.67 ? 123 LEU B CA  1 
ATOM   2654 C C   . LEU B 1 85  ? 18.890  7.558   -36.760 1.00 23.61 ? 123 LEU B C   1 
ATOM   2655 O O   . LEU B 1 85  ? 19.385  8.309   -35.921 1.00 23.47 ? 123 LEU B O   1 
ATOM   2656 C CB  . LEU B 1 85  ? 20.754  7.530   -38.461 1.00 23.24 ? 123 LEU B CB  1 
ATOM   2657 C CG  . LEU B 1 85  ? 21.398  6.249   -37.912 1.00 23.65 ? 123 LEU B CG  1 
ATOM   2658 C CD1 . LEU B 1 85  ? 20.834  4.990   -38.579 1.00 24.84 ? 123 LEU B CD1 1 
ATOM   2659 C CD2 . LEU B 1 85  ? 22.895  6.292   -38.081 1.00 23.80 ? 123 LEU B CD2 1 
ATOM   2660 N N   . LEU B 1 86  ? 18.008  6.614   -36.462 1.00 23.50 ? 124 LEU B N   1 
ATOM   2661 C CA  . LEU B 1 86  ? 17.683  6.258   -35.092 1.00 23.72 ? 124 LEU B CA  1 
ATOM   2662 C C   . LEU B 1 86  ? 18.627  5.139   -34.712 1.00 24.85 ? 124 LEU B C   1 
ATOM   2663 O O   . LEU B 1 86  ? 19.256  4.518   -35.580 1.00 23.64 ? 124 LEU B O   1 
ATOM   2664 C CB  . LEU B 1 86  ? 16.222  5.793   -34.967 1.00 23.15 ? 124 LEU B CB  1 
ATOM   2665 C CG  . LEU B 1 86  ? 15.181  6.748   -35.567 1.00 22.64 ? 124 LEU B CG  1 
ATOM   2666 C CD1 . LEU B 1 86  ? 13.799  6.213   -35.336 1.00 21.30 ? 124 LEU B CD1 1 
ATOM   2667 C CD2 . LEU B 1 86  ? 15.342  8.155   -34.993 1.00 24.52 ? 124 LEU B CD2 1 
ATOM   2668 N N   . TRP B 1 87  ? 18.745  4.891   -33.412 1.00 25.95 ? 125 TRP B N   1 
ATOM   2669 C CA  . TRP B 1 87  ? 19.607  3.818   -32.943 1.00 28.03 ? 125 TRP B CA  1 
ATOM   2670 C C   . TRP B 1 87  ? 19.069  3.283   -31.622 1.00 28.80 ? 125 TRP B C   1 
ATOM   2671 O O   . TRP B 1 87  ? 18.232  3.911   -30.999 1.00 28.33 ? 125 TRP B O   1 
ATOM   2672 C CB  . TRP B 1 87  ? 21.067  4.283   -32.799 1.00 28.39 ? 125 TRP B CB  1 
ATOM   2673 C CG  . TRP B 1 87  ? 21.266  5.480   -31.895 1.00 29.11 ? 125 TRP B CG  1 
ATOM   2674 C CD1 . TRP B 1 87  ? 21.341  6.793   -32.280 1.00 30.10 ? 125 TRP B CD1 1 
ATOM   2675 C CD2 . TRP B 1 87  ? 21.416  5.473   -30.461 1.00 29.00 ? 125 TRP B CD2 1 
ATOM   2676 N NE1 . TRP B 1 87  ? 21.512  7.602   -31.178 1.00 29.41 ? 125 TRP B NE1 1 
ATOM   2677 C CE2 . TRP B 1 87  ? 21.568  6.819   -30.052 1.00 29.56 ? 125 TRP B CE2 1 
ATOM   2678 C CE3 . TRP B 1 87  ? 21.436  4.462   -29.487 1.00 29.48 ? 125 TRP B CE3 1 
ATOM   2679 C CZ2 . TRP B 1 87  ? 21.736  7.186   -28.706 1.00 29.41 ? 125 TRP B CZ2 1 
ATOM   2680 C CZ3 . TRP B 1 87  ? 21.604  4.831   -28.137 1.00 30.24 ? 125 TRP B CZ3 1 
ATOM   2681 C CH2 . TRP B 1 87  ? 21.742  6.184   -27.769 1.00 29.52 ? 125 TRP B CH2 1 
ATOM   2682 N N   . SER B 1 88  ? 19.520  2.099   -31.236 1.00 30.60 ? 126 SER B N   1 
ATOM   2683 C CA  . SER B 1 88  ? 19.211  1.562   -29.922 1.00 32.23 ? 126 SER B CA  1 
ATOM   2684 C C   . SER B 1 88  ? 20.384  0.699   -29.517 1.00 33.41 ? 126 SER B C   1 
ATOM   2685 O O   . SER B 1 88  ? 20.741  -0.241  -30.232 1.00 33.59 ? 126 SER B O   1 
ATOM   2686 C CB  . SER B 1 88  ? 17.919  0.746   -29.952 1.00 32.26 ? 126 SER B CB  1 
ATOM   2687 O OG  . SER B 1 88  ? 17.423  0.504   -28.646 1.00 32.98 ? 126 SER B OG  1 
ATOM   2688 N N   . ARG B 1 89  ? 21.001  1.056   -28.390 1.00 34.61 ? 127 ARG B N   1 
ATOM   2689 C CA  . ARG B 1 89  ? 22.045  0.245   -27.752 1.00 36.14 ? 127 ARG B CA  1 
ATOM   2690 C C   . ARG B 1 89  ? 23.376  0.247   -28.488 1.00 36.33 ? 127 ARG B C   1 
ATOM   2691 O O   . ARG B 1 89  ? 24.268  -0.517  -28.125 1.00 37.08 ? 127 ARG B O   1 
ATOM   2692 C CB  . ARG B 1 89  ? 21.580  -1.211  -27.550 1.00 36.64 ? 127 ARG B CB  1 
ATOM   2693 C CG  . ARG B 1 89  ? 20.191  -1.386  -26.936 1.00 39.67 ? 127 ARG B CG  1 
ATOM   2694 C CD  . ARG B 1 89  ? 20.163  -0.984  -25.477 1.00 44.48 ? 127 ARG B CD  1 
ATOM   2695 N NE  . ARG B 1 89  ? 18.805  -0.718  -24.994 1.00 47.70 ? 127 ARG B NE  1 
ATOM   2696 C CZ  . ARG B 1 89  ? 17.969  -1.648  -24.537 1.00 49.86 ? 127 ARG B CZ  1 
ATOM   2697 N NH1 . ARG B 1 89  ? 18.327  -2.929  -24.507 1.00 50.88 ? 127 ARG B NH1 1 
ATOM   2698 N NH2 . ARG B 1 89  ? 16.767  -1.296  -24.108 1.00 51.05 ? 127 ARG B NH2 1 
ATOM   2699 N N   . ILE B 1 90  ? 23.506  1.072   -29.527 1.00 36.28 ? 128 ILE B N   1 
ATOM   2700 C CA  . ILE B 1 90  ? 24.761  1.165   -30.289 1.00 36.37 ? 128 ILE B CA  1 
ATOM   2701 C C   . ILE B 1 90  ? 25.002  2.602   -30.762 1.00 36.11 ? 128 ILE B C   1 
ATOM   2702 O O   . ILE B 1 90  ? 25.146  2.877   -31.963 1.00 35.44 ? 128 ILE B O   1 
ATOM   2703 C CB  . ILE B 1 90  ? 24.821  0.121   -31.453 1.00 36.52 ? 128 ILE B CB  1 
ATOM   2704 C CG1 . ILE B 1 90  ? 25.214  -1.261  -30.924 1.00 38.37 ? 128 ILE B CG1 1 
ATOM   2705 C CG2 . ILE B 1 90  ? 25.836  0.486   -32.503 1.00 36.78 ? 128 ILE B CG2 1 
ATOM   2706 C CD1 . ILE B 1 90  ? 26.554  -1.342  -30.150 1.00 40.53 ? 128 ILE B CD1 1 
ATOM   2707 N N   . LYS B 1 91  ? 25.054  3.516   -29.796 1.00 35.59 ? 129 LYS B N   1 
ATOM   2708 C CA  . LYS B 1 91  ? 25.189  4.944   -30.085 1.00 35.80 ? 129 LYS B CA  1 
ATOM   2709 C C   . LYS B 1 91  ? 26.512  5.317   -30.742 1.00 34.83 ? 129 LYS B C   1 
ATOM   2710 O O   . LYS B 1 91  ? 26.554  6.221   -31.573 1.00 34.61 ? 129 LYS B O   1 
ATOM   2711 C CB  . LYS B 1 91  ? 24.970  5.795   -28.824 1.00 35.56 ? 129 LYS B CB  1 
ATOM   2712 C CG  . LYS B 1 91  ? 25.959  5.551   -27.692 1.00 36.86 ? 129 LYS B CG  1 
ATOM   2713 C CD  . LYS B 1 91  ? 25.605  6.365   -26.452 1.00 37.87 ? 129 LYS B CD  1 
ATOM   2714 C CE  . LYS B 1 91  ? 25.793  7.861   -26.661 1.00 37.96 ? 129 LYS B CE  1 
ATOM   2715 N NZ  . LYS B 1 91  ? 25.444  8.589   -25.408 1.00 37.95 ? 129 LYS B NZ  1 
ATOM   2716 N N   . ASP B 1 92  ? 27.585  4.622   -30.369 1.00 34.26 ? 130 ASP B N   1 
ATOM   2717 C CA  . ASP B 1 92  ? 28.913  4.962   -30.860 1.00 34.12 ? 130 ASP B CA  1 
ATOM   2718 C C   . ASP B 1 92  ? 29.043  4.750   -32.371 1.00 33.39 ? 130 ASP B C   1 
ATOM   2719 O O   . ASP B 1 92  ? 29.468  5.655   -33.082 1.00 33.27 ? 130 ASP B O   1 
ATOM   2720 C CB  . ASP B 1 92  ? 29.988  4.197   -30.086 1.00 34.66 ? 130 ASP B CB  1 
ATOM   2721 C CG  . ASP B 1 92  ? 30.095  4.652   -28.636 1.00 37.43 ? 130 ASP B CG  1 
ATOM   2722 O OD1 . ASP B 1 92  ? 29.504  5.703   -28.285 1.00 39.45 ? 130 ASP B OD1 1 
ATOM   2723 O OD2 . ASP B 1 92  ? 30.770  3.956   -27.843 1.00 40.50 ? 130 ASP B OD2 1 
ATOM   2724 N N   . LEU B 1 93  ? 28.646  3.576   -32.860 1.00 32.52 ? 131 LEU B N   1 
ATOM   2725 C CA  . LEU B 1 93  ? 28.703  3.294   -34.298 1.00 32.29 ? 131 LEU B CA  1 
ATOM   2726 C C   . LEU B 1 93  ? 27.765  4.218   -35.069 1.00 31.64 ? 131 LEU B C   1 
ATOM   2727 O O   . LEU B 1 93  ? 28.140  4.744   -36.120 1.00 31.45 ? 131 LEU B O   1 
ATOM   2728 C CB  . LEU B 1 93  ? 28.353  1.832   -34.589 1.00 32.48 ? 131 LEU B CB  1 
ATOM   2729 C CG  . LEU B 1 93  ? 29.114  0.995   -35.621 1.00 33.90 ? 131 LEU B CG  1 
ATOM   2730 C CD1 . LEU B 1 93  ? 28.130  0.089   -36.350 1.00 34.33 ? 131 LEU B CD1 1 
ATOM   2731 C CD2 . LEU B 1 93  ? 29.892  1.834   -36.627 1.00 34.37 ? 131 LEU B CD2 1 
ATOM   2732 N N   . ALA B 1 94  ? 26.554  4.419   -34.547 1.00 31.04 ? 132 ALA B N   1 
ATOM   2733 C CA  . ALA B 1 94  ? 25.606  5.349   -35.149 1.00 30.99 ? 132 ALA B CA  1 
ATOM   2734 C C   . ALA B 1 94  ? 26.236  6.735   -35.338 1.00 31.09 ? 132 ALA B C   1 
ATOM   2735 O O   . ALA B 1 94  ? 26.148  7.323   -36.422 1.00 30.87 ? 132 ALA B O   1 
ATOM   2736 C CB  . ALA B 1 94  ? 24.330  5.437   -34.312 1.00 30.56 ? 132 ALA B CB  1 
ATOM   2737 N N   . HIS B 1 95  ? 26.891  7.234   -34.289 1.00 31.27 ? 133 HIS B N   1 
ATOM   2738 C CA  . HIS B 1 95  ? 27.569  8.534   -34.351 1.00 31.53 ? 133 HIS B CA  1 
ATOM   2739 C C   . HIS B 1 95  ? 28.753  8.535   -35.303 1.00 31.47 ? 133 HIS B C   1 
ATOM   2740 O O   . HIS B 1 95  ? 28.924  9.485   -36.072 1.00 31.48 ? 133 HIS B O   1 
ATOM   2741 C CB  . HIS B 1 95  ? 28.000  9.013   -32.966 1.00 31.43 ? 133 HIS B CB  1 
ATOM   2742 C CG  . HIS B 1 95  ? 26.854  9.354   -32.064 1.00 32.20 ? 133 HIS B CG  1 
ATOM   2743 N ND1 . HIS B 1 95  ? 27.006  9.532   -30.706 1.00 32.04 ? 133 HIS B ND1 1 
ATOM   2744 C CD2 . HIS B 1 95  ? 25.537  9.541   -32.324 1.00 31.21 ? 133 HIS B CD2 1 
ATOM   2745 C CE1 . HIS B 1 95  ? 25.834  9.825   -30.170 1.00 32.99 ? 133 HIS B CE1 1 
ATOM   2746 N NE2 . HIS B 1 95  ? 24.925  9.827   -31.129 1.00 34.18 ? 133 HIS B NE2 1 
ATOM   2747 N N   . GLN B 1 96  ? 29.561  7.475   -35.256 1.00 31.47 ? 134 GLN B N   1 
ATOM   2748 C CA  . GLN B 1 96  ? 30.698  7.338   -36.169 1.00 31.78 ? 134 GLN B CA  1 
ATOM   2749 C C   . GLN B 1 96  ? 30.203  7.315   -37.612 1.00 31.20 ? 134 GLN B C   1 
ATOM   2750 O O   . GLN B 1 96  ? 30.849  7.880   -38.493 1.00 31.23 ? 134 GLN B O   1 
ATOM   2751 C CB  . GLN B 1 96  ? 31.524  6.080   -35.869 1.00 31.87 ? 134 GLN B CB  1 
ATOM   2752 C CG  . GLN B 1 96  ? 32.165  6.050   -34.473 1.00 32.72 ? 134 GLN B CG  1 
ATOM   2753 C CD  . GLN B 1 96  ? 32.675  4.663   -34.077 1.00 33.25 ? 134 GLN B CD  1 
ATOM   2754 O OE1 . GLN B 1 96  ? 33.091  3.877   -34.921 1.00 35.74 ? 134 GLN B OE1 1 
ATOM   2755 N NE2 . GLN B 1 96  ? 32.650  4.370   -32.781 1.00 35.57 ? 134 GLN B NE2 1 
ATOM   2756 N N   . PHE B 1 97  ? 29.050  6.680   -37.836 1.00 30.69 ? 135 PHE B N   1 
ATOM   2757 C CA  . PHE B 1 97  ? 28.442  6.605   -39.166 1.00 30.28 ? 135 PHE B CA  1 
ATOM   2758 C C   . PHE B 1 97  ? 28.041  7.984   -39.688 1.00 30.23 ? 135 PHE B C   1 
ATOM   2759 O O   . PHE B 1 97  ? 28.280  8.299   -40.854 1.00 29.96 ? 135 PHE B O   1 
ATOM   2760 C CB  . PHE B 1 97  ? 27.245  5.638   -39.191 1.00 30.26 ? 135 PHE B CB  1 
ATOM   2761 C CG  . PHE B 1 97  ? 26.482  5.642   -40.499 1.00 29.69 ? 135 PHE B CG  1 
ATOM   2762 C CD1 . PHE B 1 97  ? 25.433  6.530   -40.703 1.00 29.97 ? 135 PHE B CD1 1 
ATOM   2763 C CD2 . PHE B 1 97  ? 26.824  4.765   -41.530 1.00 30.46 ? 135 PHE B CD2 1 
ATOM   2764 C CE1 . PHE B 1 97  ? 24.729  6.550   -41.913 1.00 30.02 ? 135 PHE B CE1 1 
ATOM   2765 C CE2 . PHE B 1 97  ? 26.127  4.770   -42.737 1.00 29.00 ? 135 PHE B CE2 1 
ATOM   2766 C CZ  . PHE B 1 97  ? 25.080  5.662   -42.931 1.00 30.17 ? 135 PHE B CZ  1 
ATOM   2767 N N   . THR B 1 98  ? 27.437  8.810   -38.837 1.00 30.16 ? 136 THR B N   1 
ATOM   2768 C CA  . THR B 1 98  ? 27.041  10.149  -39.282 1.00 30.39 ? 136 THR B CA  1 
ATOM   2769 C C   . THR B 1 98  ? 28.220  11.119  -39.341 1.00 31.18 ? 136 THR B C   1 
ATOM   2770 O O   . THR B 1 98  ? 28.144  12.152  -40.002 1.00 31.10 ? 136 THR B O   1 
ATOM   2771 C CB  . THR B 1 98  ? 25.901  10.757  -38.437 1.00 30.56 ? 136 THR B CB  1 
ATOM   2772 O OG1 . THR B 1 98  ? 26.321  10.862  -37.073 1.00 29.09 ? 136 THR B OG1 1 
ATOM   2773 C CG2 . THR B 1 98  ? 24.626  9.914   -38.539 1.00 29.05 ? 136 THR B CG2 1 
ATOM   2774 N N   . GLN B 1 99  ? 29.305  10.794  -38.645 1.00 32.07 ? 137 GLN B N   1 
ATOM   2775 C CA  . GLN B 1 99  ? 30.537  11.565  -38.792 1.00 33.49 ? 137 GLN B CA  1 
ATOM   2776 C C   . GLN B 1 99  ? 31.147  11.356  -40.182 1.00 34.03 ? 137 GLN B C   1 
ATOM   2777 O O   . GLN B 1 99  ? 31.777  12.256  -40.725 1.00 34.47 ? 137 GLN B O   1 
ATOM   2778 C CB  . GLN B 1 99  ? 31.550  11.213  -37.698 1.00 33.57 ? 137 GLN B CB  1 
ATOM   2779 C CG  . GLN B 1 99  ? 31.249  11.826  -36.325 1.00 34.68 ? 137 GLN B CG  1 
ATOM   2780 C CD  . GLN B 1 99  ? 31.143  13.348  -36.355 1.00 36.34 ? 137 GLN B CD  1 
ATOM   2781 O OE1 . GLN B 1 99  ? 30.167  13.920  -35.867 1.00 38.50 ? 137 GLN B OE1 1 
ATOM   2782 N NE2 . GLN B 1 99  ? 32.142  14.006  -36.929 1.00 36.19 ? 137 GLN B NE2 1 
ATOM   2783 N N   . VAL B 1 100 ? 30.940  10.166  -40.747 1.00 34.80 ? 138 VAL B N   1 
ATOM   2784 C CA  . VAL B 1 100 ? 31.452  9.807   -42.073 1.00 35.68 ? 138 VAL B CA  1 
ATOM   2785 C C   . VAL B 1 100 ? 30.444  10.163  -43.169 1.00 36.11 ? 138 VAL B C   1 
ATOM   2786 O O   . VAL B 1 100 ? 30.784  10.828  -44.149 1.00 36.58 ? 138 VAL B O   1 
ATOM   2787 C CB  . VAL B 1 100 ? 31.793  8.297   -42.150 1.00 35.49 ? 138 VAL B CB  1 
ATOM   2788 C CG1 . VAL B 1 100 ? 32.105  7.889   -43.567 1.00 36.18 ? 138 VAL B CG1 1 
ATOM   2789 C CG2 . VAL B 1 100 ? 32.960  7.959   -41.239 1.00 36.14 ? 138 VAL B CG2 1 
ATOM   2790 N N   . GLN B 1 101 ? 29.213  9.690   -43.002 1.00 36.47 ? 139 GLN B N   1 
ATOM   2791 C CA  . GLN B 1 101 ? 28.097  10.059  -43.851 1.00 36.97 ? 139 GLN B CA  1 
ATOM   2792 C C   . GLN B 1 101 ? 27.459  11.314  -43.240 1.00 37.18 ? 139 GLN B C   1 
ATOM   2793 O O   . GLN B 1 101 ? 26.531  11.229  -42.430 1.00 36.64 ? 139 GLN B O   1 
ATOM   2794 C CB  . GLN B 1 101 ? 27.108  8.891   -43.923 1.00 37.18 ? 139 GLN B CB  1 
ATOM   2795 C CG  . GLN B 1 101 ? 25.950  9.067   -44.889 1.00 39.01 ? 139 GLN B CG  1 
ATOM   2796 C CD  . GLN B 1 101 ? 26.380  9.031   -46.333 1.00 42.32 ? 139 GLN B CD  1 
ATOM   2797 O OE1 . GLN B 1 101 ? 27.074  8.106   -46.771 1.00 43.76 ? 139 GLN B OE1 1 
ATOM   2798 N NE2 . GLN B 1 101 ? 25.966  10.042  -47.091 1.00 42.86 ? 139 GLN B NE2 1 
ATOM   2799 N N   . ARG B 1 102 ? 27.987  12.475  -43.625 1.00 37.37 ? 140 ARG B N   1 
ATOM   2800 C CA  . ARG B 1 102 ? 27.630  13.758  -43.002 1.00 37.68 ? 140 ARG B CA  1 
ATOM   2801 C C   . ARG B 1 102 ? 26.262  14.252  -43.474 1.00 37.43 ? 140 ARG B C   1 
ATOM   2802 O O   . ARG B 1 102 ? 25.730  15.255  -42.978 1.00 37.66 ? 140 ARG B O   1 
ATOM   2803 C CB  . ARG B 1 102 ? 28.724  14.809  -43.259 1.00 38.04 ? 140 ARG B CB  1 
ATOM   2804 C CG  . ARG B 1 102 ? 30.112  14.382  -42.775 1.00 39.06 ? 140 ARG B CG  1 
ATOM   2805 C CD  . ARG B 1 102 ? 31.033  15.565  -42.535 1.00 40.53 ? 140 ARG B CD  1 
ATOM   2806 N NE  . ARG B 1 102 ? 30.728  16.250  -41.283 1.00 42.33 ? 140 ARG B NE  1 
ATOM   2807 C CZ  . ARG B 1 102 ? 31.252  15.933  -40.100 1.00 43.99 ? 140 ARG B CZ  1 
ATOM   2808 N NH1 . ARG B 1 102 ? 32.114  14.928  -39.990 1.00 44.39 ? 140 ARG B NH1 1 
ATOM   2809 N NH2 . ARG B 1 102 ? 30.908  16.619  -39.016 1.00 44.37 ? 140 ARG B NH2 1 
ATOM   2810 N N   . ASP B 1 103 ? 25.706  13.511  -44.428 1.00 36.85 ? 141 ASP B N   1 
ATOM   2811 C CA  . ASP B 1 103 ? 24.353  13.693  -44.932 1.00 36.23 ? 141 ASP B CA  1 
ATOM   2812 C C   . ASP B 1 103 ? 23.300  13.321  -43.867 1.00 35.21 ? 141 ASP B C   1 
ATOM   2813 O O   . ASP B 1 103 ? 22.203  13.886  -43.843 1.00 35.03 ? 141 ASP B O   1 
ATOM   2814 C CB  . ASP B 1 103 ? 24.184  12.806  -46.176 1.00 36.98 ? 141 ASP B CB  1 
ATOM   2815 C CG  . ASP B 1 103 ? 23.085  13.282  -47.099 1.00 38.46 ? 141 ASP B CG  1 
ATOM   2816 O OD1 . ASP B 1 103 ? 22.907  12.667  -48.172 1.00 40.92 ? 141 ASP B OD1 1 
ATOM   2817 O OD2 . ASP B 1 103 ? 22.397  14.269  -46.763 1.00 41.89 ? 141 ASP B OD2 1 
ATOM   2818 N N   . MET B 1 104 ? 23.657  12.384  -42.989 1.00 33.60 ? 142 MET B N   1 
ATOM   2819 C CA  . MET B 1 104 ? 22.713  11.743  -42.068 1.00 32.69 ? 142 MET B CA  1 
ATOM   2820 C C   . MET B 1 104 ? 22.798  12.316  -40.648 1.00 31.49 ? 142 MET B C   1 
ATOM   2821 O O   . MET B 1 104 ? 23.859  12.767  -40.224 1.00 31.03 ? 142 MET B O   1 
ATOM   2822 C CB  . MET B 1 104 ? 22.977  10.234  -42.025 1.00 32.92 ? 142 MET B CB  1 
ATOM   2823 C CG  . MET B 1 104 ? 22.813  9.520   -43.372 1.00 34.67 ? 142 MET B CG  1 
ATOM   2824 S SD  . MET B 1 104 ? 21.083  9.353   -43.848 1.00 38.40 ? 142 MET B SD  1 
ATOM   2825 C CE  . MET B 1 104 ? 20.457  8.226   -42.595 1.00 35.01 ? 142 MET B CE  1 
ATOM   2826 N N   . PHE B 1 105 ? 21.679  12.281  -39.925 1.00 30.14 ? 143 PHE B N   1 
ATOM   2827 C CA  . PHE B 1 105 ? 21.609  12.819  -38.563 1.00 29.63 ? 143 PHE B CA  1 
ATOM   2828 C C   . PHE B 1 105 ? 21.051  11.815  -37.570 1.00 28.20 ? 143 PHE B C   1 
ATOM   2829 O O   . PHE B 1 105 ? 19.964  11.265  -37.761 1.00 27.53 ? 143 PHE B O   1 
ATOM   2830 C CB  . PHE B 1 105 ? 20.724  14.082  -38.502 1.00 30.20 ? 143 PHE B CB  1 
ATOM   2831 C CG  . PHE B 1 105 ? 21.255  15.247  -39.300 1.00 32.15 ? 143 PHE B CG  1 
ATOM   2832 C CD1 . PHE B 1 105 ? 21.898  16.305  -38.662 1.00 33.45 ? 143 PHE B CD1 1 
ATOM   2833 C CD2 . PHE B 1 105 ? 21.092  15.295  -40.682 1.00 33.03 ? 143 PHE B CD2 1 
ATOM   2834 C CE1 . PHE B 1 105 ? 22.382  17.393  -39.394 1.00 34.00 ? 143 PHE B CE1 1 
ATOM   2835 C CE2 . PHE B 1 105 ? 21.580  16.379  -41.429 1.00 34.98 ? 143 PHE B CE2 1 
ATOM   2836 C CZ  . PHE B 1 105 ? 22.225  17.427  -40.776 1.00 34.67 ? 143 PHE B CZ  1 
ATOM   2837 N N   . THR B 1 106 ? 21.785  11.603  -36.487 1.00 27.61 ? 144 THR B N   1 
ATOM   2838 C CA  . THR B 1 106 ? 21.204  11.009  -35.293 1.00 26.79 ? 144 THR B CA  1 
ATOM   2839 C C   . THR B 1 106 ? 20.671  12.177  -34.464 1.00 26.42 ? 144 THR B C   1 
ATOM   2840 O O   . THR B 1 106 ? 21.023  13.321  -34.710 1.00 26.39 ? 144 THR B O   1 
ATOM   2841 C CB  . THR B 1 106 ? 22.250  10.240  -34.457 1.00 27.28 ? 144 THR B CB  1 
ATOM   2842 O OG1 . THR B 1 106 ? 23.250  11.150  -33.988 1.00 27.15 ? 144 THR B OG1 1 
ATOM   2843 C CG2 . THR B 1 106 ? 22.918  9.146   -35.284 1.00 26.86 ? 144 THR B CG2 1 
ATOM   2844 N N   . LEU B 1 107 ? 19.853  11.885  -33.461 1.00 25.97 ? 145 LEU B N   1 
ATOM   2845 C CA  . LEU B 1 107 ? 19.377  12.916  -32.552 1.00 25.73 ? 145 LEU B CA  1 
ATOM   2846 C C   . LEU B 1 107 ? 20.528  13.729  -31.933 1.00 25.33 ? 145 LEU B C   1 
ATOM   2847 O O   . LEU B 1 107 ? 20.415  14.929  -31.724 1.00 24.67 ? 145 LEU B O   1 
ATOM   2848 C CB  . LEU B 1 107 ? 18.497  12.279  -31.466 1.00 25.72 ? 145 LEU B CB  1 
ATOM   2849 C CG  . LEU B 1 107 ? 17.988  13.167  -30.327 1.00 25.87 ? 145 LEU B CG  1 
ATOM   2850 C CD1 . LEU B 1 107 ? 17.161  14.320  -30.860 1.00 25.30 ? 145 LEU B CD1 1 
ATOM   2851 C CD2 . LEU B 1 107 ? 17.181  12.335  -29.362 1.00 26.09 ? 145 LEU B CD2 1 
ATOM   2852 N N   . GLU B 1 108 ? 21.650  13.074  -31.670 1.00 25.45 ? 146 GLU B N   1 
ATOM   2853 C CA  . GLU B 1 108 ? 22.769  13.747  -31.010 1.00 25.44 ? 146 GLU B CA  1 
ATOM   2854 C C   . GLU B 1 108 ? 23.585  14.588  -31.987 1.00 25.94 ? 146 GLU B C   1 
ATOM   2855 O O   . GLU B 1 108 ? 24.533  15.264  -31.582 1.00 25.96 ? 146 GLU B O   1 
ATOM   2856 C CB  . GLU B 1 108 ? 23.672  12.725  -30.293 1.00 26.02 ? 146 GLU B CB  1 
ATOM   2857 C CG  . GLU B 1 108 ? 22.957  11.847  -29.252 1.00 25.14 ? 146 GLU B CG  1 
ATOM   2858 C CD  . GLU B 1 108 ? 21.962  10.857  -29.842 1.00 27.80 ? 146 GLU B CD  1 
ATOM   2859 O OE1 . GLU B 1 108 ? 22.230  10.237  -30.898 1.00 26.12 ? 146 GLU B OE1 1 
ATOM   2860 O OE2 . GLU B 1 108 ? 20.897  10.683  -29.228 1.00 26.05 ? 146 GLU B OE2 1 
ATOM   2861 N N   . ASP B 1 109 ? 23.223  14.541  -33.274 1.00 25.97 ? 147 ASP B N   1 
ATOM   2862 C CA  . ASP B 1 109 ? 23.806  15.429  -34.276 1.00 25.79 ? 147 ASP B CA  1 
ATOM   2863 C C   . ASP B 1 109 ? 23.059  16.772  -34.359 1.00 26.02 ? 147 ASP B C   1 
ATOM   2864 O O   . ASP B 1 109 ? 23.535  17.719  -34.984 1.00 26.03 ? 147 ASP B O   1 
ATOM   2865 C CB  . ASP B 1 109 ? 23.865  14.748  -35.657 1.00 25.90 ? 147 ASP B CB  1 
ATOM   2866 C CG  . ASP B 1 109 ? 24.818  13.569  -35.689 1.00 25.38 ? 147 ASP B CG  1 
ATOM   2867 O OD1 . ASP B 1 109 ? 24.364  12.439  -35.930 1.00 25.82 ? 147 ASP B OD1 1 
ATOM   2868 O OD2 . ASP B 1 109 ? 26.030  13.760  -35.473 1.00 27.04 ? 147 ASP B OD2 1 
ATOM   2869 N N   . THR B 1 110 ? 21.886  16.836  -33.733 1.00 26.15 ? 148 THR B N   1 
ATOM   2870 C CA  . THR B 1 110 ? 21.125  18.077  -33.611 1.00 25.77 ? 148 THR B CA  1 
ATOM   2871 C C   . THR B 1 110 ? 21.627  18.801  -32.370 1.00 25.88 ? 148 THR B C   1 
ATOM   2872 O O   . THR B 1 110 ? 22.169  18.169  -31.460 1.00 25.83 ? 148 THR B O   1 
ATOM   2873 C CB  . THR B 1 110 ? 19.610  17.820  -33.429 1.00 26.13 ? 148 THR B CB  1 
ATOM   2874 O OG1 . THR B 1 110 ? 19.350  17.272  -32.115 1.00 25.37 ? 148 THR B OG1 1 
ATOM   2875 C CG2 . THR B 1 110 ? 19.072  16.895  -34.522 1.00 26.42 ? 148 THR B CG2 1 
ATOM   2876 N N   . LEU B 1 111 ? 21.435  20.112  -32.312 1.00 25.34 ? 149 LEU B N   1 
ATOM   2877 C CA  . LEU B 1 111 ? 21.915  20.890  -31.168 1.00 25.60 ? 149 LEU B CA  1 
ATOM   2878 C C   . LEU B 1 111 ? 21.500  20.323  -29.790 1.00 25.41 ? 149 LEU B C   1 
ATOM   2879 O O   . LEU B 1 111 ? 22.341  20.115  -28.907 1.00 24.98 ? 149 LEU B O   1 
ATOM   2880 C CB  . LEU B 1 111 ? 21.477  22.354  -31.302 1.00 25.55 ? 149 LEU B CB  1 
ATOM   2881 C CG  . LEU B 1 111 ? 21.672  23.229  -30.058 1.00 26.81 ? 149 LEU B CG  1 
ATOM   2882 C CD1 . LEU B 1 111 ? 23.146  23.491  -29.804 1.00 26.57 ? 149 LEU B CD1 1 
ATOM   2883 C CD2 . LEU B 1 111 ? 20.925  24.529  -30.215 1.00 26.70 ? 149 LEU B CD2 1 
ATOM   2884 N N   . LEU B 1 112 ? 20.209  20.075  -29.606 1.00 25.52 ? 150 LEU B N   1 
ATOM   2885 C CA  . LEU B 1 112 ? 19.706  19.626  -28.303 1.00 24.90 ? 150 LEU B CA  1 
ATOM   2886 C C   . LEU B 1 112 ? 20.284  18.288  -27.883 1.00 25.16 ? 150 LEU B C   1 
ATOM   2887 O O   . LEU B 1 112 ? 20.680  18.121  -26.732 1.00 24.51 ? 150 LEU B O   1 
ATOM   2888 C CB  . LEU B 1 112 ? 18.171  19.579  -28.301 1.00 25.58 ? 150 LEU B CB  1 
ATOM   2889 C CG  . LEU B 1 112 ? 17.473  20.935  -28.456 1.00 25.24 ? 150 LEU B CG  1 
ATOM   2890 C CD1 . LEU B 1 112 ? 15.993  20.756  -28.674 1.00 27.04 ? 150 LEU B CD1 1 
ATOM   2891 C CD2 . LEU B 1 112 ? 17.728  21.803  -27.237 1.00 27.31 ? 150 LEU B CD2 1 
ATOM   2892 N N   . GLY B 1 113 ? 20.323  17.334  -28.814 1.00 25.12 ? 151 GLY B N   1 
ATOM   2893 C CA  . GLY B 1 113 ? 20.914  16.017  -28.550 1.00 25.86 ? 151 GLY B CA  1 
ATOM   2894 C C   . GLY B 1 113 ? 22.397  16.158  -28.256 1.00 26.13 ? 151 GLY B C   1 
ATOM   2895 O O   . GLY B 1 113 ? 22.930  15.485  -27.371 1.00 26.37 ? 151 GLY B O   1 
ATOM   2896 N N   . TYR B 1 114 ? 23.050  17.055  -28.994 1.00 26.65 ? 152 TYR B N   1 
ATOM   2897 C CA  . TYR B 1 114 ? 24.478  17.340  -28.832 1.00 26.90 ? 152 TYR B CA  1 
ATOM   2898 C C   . TYR B 1 114 ? 24.812  17.922  -27.457 1.00 26.94 ? 152 TYR B C   1 
ATOM   2899 O O   . TYR B 1 114 ? 25.794  17.508  -26.833 1.00 26.58 ? 152 TYR B O   1 
ATOM   2900 C CB  . TYR B 1 114 ? 24.951  18.295  -29.916 1.00 27.23 ? 152 TYR B CB  1 
ATOM   2901 C CG  . TYR B 1 114 ? 26.428  18.599  -29.892 1.00 29.03 ? 152 TYR B CG  1 
ATOM   2902 C CD1 . TYR B 1 114 ? 26.925  19.706  -29.203 1.00 28.41 ? 152 TYR B CD1 1 
ATOM   2903 C CD2 . TYR B 1 114 ? 27.330  17.800  -30.601 1.00 30.23 ? 152 TYR B CD2 1 
ATOM   2904 C CE1 . TYR B 1 114 ? 28.281  19.984  -29.191 1.00 29.36 ? 152 TYR B CE1 1 
ATOM   2905 C CE2 . TYR B 1 114 ? 28.684  18.077  -30.605 1.00 30.96 ? 152 TYR B CE2 1 
ATOM   2906 C CZ  . TYR B 1 114 ? 29.155  19.166  -29.896 1.00 29.98 ? 152 TYR B CZ  1 
ATOM   2907 O OH  . TYR B 1 114 ? 30.503  19.438  -29.912 1.00 30.12 ? 152 TYR B OH  1 
ATOM   2908 N N   . LEU B 1 115 ? 24.009  18.881  -27.003 1.00 26.33 ? 153 LEU B N   1 
ATOM   2909 C CA  . LEU B 1 115 ? 24.168  19.472  -25.663 1.00 26.35 ? 153 LEU B CA  1 
ATOM   2910 C C   . LEU B 1 115 ? 24.158  18.450  -24.539 1.00 26.38 ? 153 LEU B C   1 
ATOM   2911 O O   . LEU B 1 115 ? 24.956  18.524  -23.608 1.00 26.92 ? 153 LEU B O   1 
ATOM   2912 C CB  . LEU B 1 115 ? 23.044  20.470  -25.375 1.00 26.15 ? 153 LEU B CB  1 
ATOM   2913 C CG  . LEU B 1 115 ? 22.910  21.697  -26.267 1.00 25.77 ? 153 LEU B CG  1 
ATOM   2914 C CD1 . LEU B 1 115 ? 21.816  22.576  -25.708 1.00 26.77 ? 153 LEU B CD1 1 
ATOM   2915 C CD2 . LEU B 1 115 ? 24.226  22.428  -26.348 1.00 26.67 ? 153 LEU B CD2 1 
ATOM   2916 N N   . ALA B 1 116 ? 23.232  17.506  -24.620 1.00 26.19 ? 154 ALA B N   1 
ATOM   2917 C CA  . ALA B 1 116 ? 22.945  16.653  -23.500 1.00 26.07 ? 154 ALA B CA  1 
ATOM   2918 C C   . ALA B 1 116 ? 23.566  15.276  -23.571 1.00 26.48 ? 154 ALA B C   1 
ATOM   2919 O O   . ALA B 1 116 ? 23.529  14.563  -22.579 1.00 25.73 ? 154 ALA B O   1 
ATOM   2920 C CB  . ALA B 1 116 ? 21.452  16.531  -23.323 1.00 26.58 ? 154 ALA B CB  1 
ATOM   2921 N N   . ASP B 1 117 ? 24.093  14.882  -24.734 1.00 26.53 ? 155 ASP B N   1 
ATOM   2922 C CA  . ASP B 1 117 ? 24.567  13.500  -24.916 1.00 26.95 ? 155 ASP B CA  1 
ATOM   2923 C C   . ASP B 1 117 ? 25.619  13.110  -23.876 1.00 27.02 ? 155 ASP B C   1 
ATOM   2924 O O   . ASP B 1 117 ? 26.579  13.846  -23.659 1.00 26.82 ? 155 ASP B O   1 
ATOM   2925 C CB  . ASP B 1 117 ? 25.119  13.276  -26.339 1.00 27.97 ? 155 ASP B CB  1 
ATOM   2926 C CG  . ASP B 1 117 ? 25.291  11.805  -26.676 1.00 29.33 ? 155 ASP B CG  1 
ATOM   2927 O OD1 . ASP B 1 117 ? 26.095  11.498  -27.575 1.00 33.01 ? 155 ASP B OD1 1 
ATOM   2928 O OD2 . ASP B 1 117 ? 24.618  10.949  -26.060 1.00 31.98 ? 155 ASP B OD2 1 
ATOM   2929 N N   . ASP B 1 118 ? 25.423  11.946  -23.249 1.00 27.50 ? 156 ASP B N   1 
ATOM   2930 C CA  . ASP B 1 118 ? 26.318  11.407  -22.211 1.00 27.87 ? 156 ASP B CA  1 
ATOM   2931 C C   . ASP B 1 118 ? 26.289  12.170  -20.884 1.00 27.56 ? 156 ASP B C   1 
ATOM   2932 O O   . ASP B 1 118 ? 27.079  11.877  -19.986 1.00 28.72 ? 156 ASP B O   1 
ATOM   2933 C CB  . ASP B 1 118 ? 27.768  11.302  -22.689 1.00 28.71 ? 156 ASP B CB  1 
ATOM   2934 C CG  . ASP B 1 118 ? 27.952  10.277  -23.787 1.00 31.49 ? 156 ASP B CG  1 
ATOM   2935 O OD1 . ASP B 1 118 ? 27.350  9.182   -23.712 1.00 34.47 ? 156 ASP B OD1 1 
ATOM   2936 O OD2 . ASP B 1 118 ? 28.715  10.574  -24.725 1.00 35.62 ? 156 ASP B OD2 1 
ATOM   2937 N N   . LEU B 1 119 ? 25.418  13.157  -20.758 1.00 26.55 ? 157 LEU B N   1 
ATOM   2938 C CA  . LEU B 1 119 ? 25.370  13.925  -19.508 1.00 25.80 ? 157 LEU B CA  1 
ATOM   2939 C C   . LEU B 1 119 ? 24.207  13.502  -18.617 1.00 25.73 ? 157 LEU B C   1 
ATOM   2940 O O   . LEU B 1 119 ? 23.238  12.918  -19.080 1.00 25.33 ? 157 LEU B O   1 
ATOM   2941 C CB  . LEU B 1 119 ? 25.327  15.430  -19.792 1.00 25.28 ? 157 LEU B CB  1 
ATOM   2942 C CG  . LEU B 1 119 ? 26.467  16.037  -20.617 1.00 24.38 ? 157 LEU B CG  1 
ATOM   2943 C CD1 . LEU B 1 119 ? 26.260  17.529  -20.760 1.00 25.12 ? 157 LEU B CD1 1 
ATOM   2944 C CD2 . LEU B 1 119 ? 27.860  15.736  -20.068 1.00 23.46 ? 157 LEU B CD2 1 
ATOM   2945 N N   . THR B 1 120 ? 24.330  13.790  -17.321 1.00 25.69 ? 158 THR B N   1 
ATOM   2946 C CA  . THR B 1 120 ? 23.298  13.526  -16.350 1.00 25.79 ? 158 THR B CA  1 
ATOM   2947 C C   . THR B 1 120 ? 23.108  14.839  -15.610 1.00 26.25 ? 158 THR B C   1 
ATOM   2948 O O   . THR B 1 120 ? 24.072  15.576  -15.412 1.00 26.37 ? 158 THR B O   1 
ATOM   2949 C CB  . THR B 1 120 ? 23.741  12.440  -15.359 1.00 26.10 ? 158 THR B CB  1 
ATOM   2950 O OG1 . THR B 1 120 ? 23.982  11.235  -16.083 1.00 24.71 ? 158 THR B OG1 1 
ATOM   2951 C CG2 . THR B 1 120 ? 22.672  12.181  -14.274 1.00 26.52 ? 158 THR B CG2 1 
ATOM   2952 N N   . TRP B 1 121 ? 21.871  15.130  -15.236 1.00 25.71 ? 159 TRP B N   1 
ATOM   2953 C CA  . TRP B 1 121 ? 21.555  16.349  -14.502 1.00 25.63 ? 159 TRP B CA  1 
ATOM   2954 C C   . TRP B 1 121 ? 20.273  16.151  -13.719 1.00 26.53 ? 159 TRP B C   1 
ATOM   2955 O O   . TRP B 1 121 ? 19.398  15.364  -14.127 1.00 26.79 ? 159 TRP B O   1 
ATOM   2956 C CB  . TRP B 1 121 ? 21.427  17.554  -15.448 1.00 25.02 ? 159 TRP B CB  1 
ATOM   2957 C CG  . TRP B 1 121 ? 20.306  17.404  -16.435 1.00 24.35 ? 159 TRP B CG  1 
ATOM   2958 C CD1 . TRP B 1 121 ? 19.038  17.872  -16.305 1.00 23.23 ? 159 TRP B CD1 1 
ATOM   2959 C CD2 . TRP B 1 121 ? 20.366  16.748  -17.708 1.00 24.00 ? 159 TRP B CD2 1 
ATOM   2960 N NE1 . TRP B 1 121 ? 18.295  17.545  -17.410 1.00 23.68 ? 159 TRP B NE1 1 
ATOM   2961 C CE2 . TRP B 1 121 ? 19.087  16.859  -18.292 1.00 24.38 ? 159 TRP B CE2 1 
ATOM   2962 C CE3 . TRP B 1 121 ? 21.382  16.101  -18.422 1.00 23.15 ? 159 TRP B CE3 1 
ATOM   2963 C CZ2 . TRP B 1 121 ? 18.785  16.316  -19.559 1.00 24.84 ? 159 TRP B CZ2 1 
ATOM   2964 C CZ3 . TRP B 1 121 ? 21.075  15.551  -19.680 1.00 23.60 ? 159 TRP B CZ3 1 
ATOM   2965 C CH2 . TRP B 1 121 ? 19.787  15.664  -20.223 1.00 23.12 ? 159 TRP B CH2 1 
ATOM   2966 N N   . CYS B 1 122 ? 20.180  16.852  -12.590 1.00 26.48 ? 160 CYS B N   1 
ATOM   2967 C CA  . CYS B 1 122 ? 18.949  16.950  -11.811 1.00 27.01 ? 160 CYS B CA  1 
ATOM   2968 C C   . CYS B 1 122 ? 19.104  18.055  -10.791 1.00 26.90 ? 160 CYS B C   1 
ATOM   2969 O O   . CYS B 1 122 ? 20.224  18.465  -10.452 1.00 25.46 ? 160 CYS B O   1 
ATOM   2970 C CB  . CYS B 1 122 ? 18.587  15.620  -11.116 1.00 27.55 ? 160 CYS B CB  1 
ATOM   2971 S SG  . CYS B 1 122 ? 19.776  15.051  -9.882  1.00 28.94 ? 160 CYS B SG  1 
ATOM   2972 N N   . GLY B 1 123 ? 17.966  18.561  -10.340 1.00 27.47 ? 161 GLY B N   1 
ATOM   2973 C CA  . GLY B 1 123 ? 17.933  19.595  -9.324  1.00 28.62 ? 161 GLY B CA  1 
ATOM   2974 C C   . GLY B 1 123 ? 17.354  19.025  -8.059  1.00 29.96 ? 161 GLY B C   1 
ATOM   2975 O O   . GLY B 1 123 ? 17.395  17.808  -7.834  1.00 30.33 ? 161 GLY B O   1 
ATOM   2976 N N   . GLU B 1 124 ? 16.805  19.904  -7.233  1.00 30.58 ? 162 GLU B N   1 
ATOM   2977 C CA  . GLU B 1 124 ? 16.240  19.511  -5.953  1.00 32.77 ? 162 GLU B CA  1 
ATOM   2978 C C   . GLU B 1 124 ? 14.991  20.331  -5.764  1.00 32.18 ? 162 GLU B C   1 
ATOM   2979 O O   . GLU B 1 124 ? 14.971  21.505  -6.122  1.00 32.05 ? 162 GLU B O   1 
ATOM   2980 C CB  . GLU B 1 124 ? 17.210  19.820  -4.806  1.00 32.64 ? 162 GLU B CB  1 
ATOM   2981 C CG  . GLU B 1 124 ? 18.670  19.494  -5.077  1.00 35.39 ? 162 GLU B CG  1 
ATOM   2982 C CD  . GLU B 1 124 ? 19.554  19.721  -3.865  1.00 37.25 ? 162 GLU B CD  1 
ATOM   2983 O OE1 . GLU B 1 124 ? 20.789  19.847  -4.042  1.00 43.92 ? 162 GLU B OE1 1 
ATOM   2984 O OE2 . GLU B 1 124 ? 19.013  19.788  -2.737  1.00 44.25 ? 162 GLU B OE2 1 
ATOM   2985 N N   . PHE B 1 125 ? 13.949  19.728  -5.203  1.00 31.85 ? 163 PHE B N   1 
ATOM   2986 C CA  . PHE B 1 125 ? 12.701  20.446  -5.014  1.00 31.89 ? 163 PHE B CA  1 
ATOM   2987 C C   . PHE B 1 125 ? 12.896  21.677  -4.136  1.00 32.06 ? 163 PHE B C   1 
ATOM   2988 O O   . PHE B 1 125 ? 12.416  22.769  -4.464  1.00 31.82 ? 163 PHE B O   1 
ATOM   2989 C CB  . PHE B 1 125 ? 11.599  19.537  -4.434  1.00 31.68 ? 163 PHE B CB  1 
ATOM   2990 C CG  . PHE B 1 125 ? 10.285  20.236  -4.252  1.00 32.57 ? 163 PHE B CG  1 
ATOM   2991 C CD1 . PHE B 1 125 ? 9.476   20.522  -5.348  1.00 32.92 ? 163 PHE B CD1 1 
ATOM   2992 C CD2 . PHE B 1 125 ? 9.853   20.609  -2.984  1.00 32.14 ? 163 PHE B CD2 1 
ATOM   2993 C CE1 . PHE B 1 125 ? 8.254   21.173  -5.187  1.00 32.38 ? 163 PHE B CE1 1 
ATOM   2994 C CE2 . PHE B 1 125 ? 8.650   21.265  -2.813  1.00 31.84 ? 163 PHE B CE2 1 
ATOM   2995 C CZ  . PHE B 1 125 ? 7.845   21.551  -3.912  1.00 33.11 ? 163 PHE B CZ  1 
ATOM   2996 N N   . ASP B 1 126 ? 13.623  21.508  -3.035  1.00 32.24 ? 164 ASP B N   1 
ATOM   2997 C CA  . ASP B 1 126 ? 13.650  22.541  -1.992  1.00 34.04 ? 164 ASP B CA  1 
ATOM   2998 C C   . ASP B 1 126 ? 14.679  23.654  -2.236  1.00 34.54 ? 164 ASP B C   1 
ATOM   2999 O O   . ASP B 1 126 ? 14.918  24.489  -1.355  1.00 34.82 ? 164 ASP B O   1 
ATOM   3000 C CB  . ASP B 1 126 ? 13.833  21.891  -0.608  1.00 33.97 ? 164 ASP B CB  1 
ATOM   3001 C CG  . ASP B 1 126 ? 12.696  20.940  -0.260  1.00 35.28 ? 164 ASP B CG  1 
ATOM   3002 O OD1 . ASP B 1 126 ? 11.536  21.410  -0.139  1.00 34.15 ? 164 ASP B OD1 1 
ATOM   3003 O OD2 . ASP B 1 126 ? 12.963  19.722  -0.103  1.00 38.44 ? 164 ASP B OD2 1 
ATOM   3004 N N   . THR B 1 127 ? 15.262  23.699  -3.438  1.00 34.57 ? 165 THR B N   1 
ATOM   3005 C CA  . THR B 1 127 ? 16.410  24.573  -3.639  1.00 34.48 ? 165 THR B CA  1 
ATOM   3006 C C   . THR B 1 127 ? 16.699  24.866  -5.104  1.00 33.42 ? 165 THR B C   1 
ATOM   3007 O O   . THR B 1 127 ? 16.123  24.241  -5.989  1.00 34.40 ? 165 THR B O   1 
ATOM   3008 C CB  . THR B 1 127 ? 17.647  23.977  -2.924  1.00 34.77 ? 165 THR B CB  1 
ATOM   3009 O OG1 . THR B 1 127 ? 18.495  25.035  -2.464  1.00 40.45 ? 165 THR B OG1 1 
ATOM   3010 C CG2 . THR B 1 127 ? 18.411  23.076  -3.833  1.00 34.12 ? 165 THR B CG2 1 
ATOM   3011 N N   . SER B 1 128 ? 17.580  25.825  -5.367  1.00 31.94 ? 166 SER B N   1 
ATOM   3012 C CA  . SER B 1 128 ? 17.980  26.128  -6.740  1.00 31.49 ? 166 SER B CA  1 
ATOM   3013 C C   . SER B 1 128 ? 19.289  25.419  -7.116  1.00 30.78 ? 166 SER B C   1 
ATOM   3014 O O   . SER B 1 128 ? 19.944  25.788  -8.084  1.00 31.16 ? 166 SER B O   1 
ATOM   3015 C CB  . SER B 1 128 ? 18.139  27.635  -6.939  1.00 31.22 ? 166 SER B CB  1 
ATOM   3016 O OG  . SER B 1 128 ? 19.127  28.119  -6.055  1.00 30.91 ? 166 SER B OG  1 
ATOM   3017 N N   . LYS B 1 129 ? 19.668  24.414  -6.340  1.00 30.10 ? 167 LYS B N   1 
ATOM   3018 C CA  . LYS B 1 129 ? 20.961  23.773  -6.518  1.00 29.84 ? 167 LYS B CA  1 
ATOM   3019 C C   . LYS B 1 129 ? 20.883  22.660  -7.552  1.00 28.41 ? 167 LYS B C   1 
ATOM   3020 O O   . LYS B 1 129 ? 19.874  21.982  -7.683  1.00 27.17 ? 167 LYS B O   1 
ATOM   3021 C CB  . LYS B 1 129 ? 21.497  23.236  -5.184  1.00 29.84 ? 167 LYS B CB  1 
ATOM   3022 C CG  . LYS B 1 129 ? 22.001  24.337  -4.255  1.00 31.33 ? 167 LYS B CG  1 
ATOM   3023 C CD  . LYS B 1 129 ? 22.562  23.779  -2.956  1.00 33.27 ? 167 LYS B CD  1 
ATOM   3024 C CE  . LYS B 1 129 ? 21.527  23.807  -1.829  1.00 39.03 ? 167 LYS B CE  1 
ATOM   3025 N NZ  . LYS B 1 129 ? 21.820  22.797  -0.754  1.00 41.50 ? 167 LYS B NZ  1 
ATOM   3026 N N   . ILE B 1 130 ? 21.962  22.516  -8.307  1.00 27.12 ? 168 ILE B N   1 
ATOM   3027 C CA  . ILE B 1 130 ? 22.141  21.351  -9.128  1.00 25.97 ? 168 ILE B CA  1 
ATOM   3028 C C   . ILE B 1 130 ? 22.662  20.255  -8.180  1.00 25.46 ? 168 ILE B C   1 
ATOM   3029 O O   . ILE B 1 130 ? 23.588  20.481  -7.378  1.00 25.55 ? 168 ILE B O   1 
ATOM   3030 C CB  . ILE B 1 130 ? 23.114  21.663  -10.272 1.00 26.14 ? 168 ILE B CB  1 
ATOM   3031 C CG1 . ILE B 1 130 ? 22.454  22.625  -11.264 1.00 26.43 ? 168 ILE B CG1 1 
ATOM   3032 C CG2 . ILE B 1 130 ? 23.553  20.392  -10.973 1.00 25.47 ? 168 ILE B CG2 1 
ATOM   3033 C CD1 . ILE B 1 130 ? 23.409  23.309  -12.203 1.00 27.19 ? 168 ILE B CD1 1 
ATOM   3034 N N   . ASN B 1 131 ? 22.045  19.086  -8.243  1.00 24.79 ? 169 ASN B N   1 
ATOM   3035 C CA  . ASN B 1 131 ? 22.494  17.943  -7.447  1.00 24.34 ? 169 ASN B CA  1 
ATOM   3036 C C   . ASN B 1 131 ? 23.625  17.194  -8.158  1.00 24.56 ? 169 ASN B C   1 
ATOM   3037 O O   . ASN B 1 131 ? 23.394  16.430  -9.122  1.00 24.68 ? 169 ASN B O   1 
ATOM   3038 C CB  . ASN B 1 131 ? 21.314  17.001  -7.138  1.00 23.77 ? 169 ASN B CB  1 
ATOM   3039 C CG  . ASN B 1 131 ? 21.654  15.974  -6.069  1.00 23.23 ? 169 ASN B CG  1 
ATOM   3040 O OD1 . ASN B 1 131 ? 22.819  15.651  -5.852  1.00 25.11 ? 169 ASN B OD1 1 
ATOM   3041 N ND2 . ASN B 1 131 ? 20.641  15.437  -5.418  1.00 23.91 ? 169 ASN B ND2 1 
ATOM   3042 N N   . TYR B 1 132 ? 24.849  17.435  -7.697  1.00 23.42 ? 170 TYR B N   1 
ATOM   3043 C CA  . TYR B 1 132 ? 26.033  16.805  -8.247  1.00 23.65 ? 170 TYR B CA  1 
ATOM   3044 C C   . TYR B 1 132 ? 26.359  15.496  -7.553  1.00 23.37 ? 170 TYR B C   1 
ATOM   3045 O O   . TYR B 1 132 ? 27.323  14.827  -7.909  1.00 23.87 ? 170 TYR B O   1 
ATOM   3046 C CB  . TYR B 1 132 ? 27.237  17.744  -8.119  1.00 23.83 ? 170 TYR B CB  1 
ATOM   3047 C CG  . TYR B 1 132 ? 27.153  18.936  -9.037  1.00 24.22 ? 170 TYR B CG  1 
ATOM   3048 C CD1 . TYR B 1 132 ? 26.775  20.192  -8.548  1.00 24.49 ? 170 TYR B CD1 1 
ATOM   3049 C CD2 . TYR B 1 132 ? 27.425  18.807  -10.398 1.00 24.40 ? 170 TYR B CD2 1 
ATOM   3050 C CE1 . TYR B 1 132 ? 26.711  21.295  -9.395  1.00 23.93 ? 170 TYR B CE1 1 
ATOM   3051 C CE2 . TYR B 1 132 ? 27.346  19.893  -11.251 1.00 23.86 ? 170 TYR B CE2 1 
ATOM   3052 C CZ  . TYR B 1 132 ? 26.992  21.133  -10.743 1.00 24.87 ? 170 TYR B CZ  1 
ATOM   3053 O OH  . TYR B 1 132 ? 26.915  22.200  -11.599 1.00 25.01 ? 170 TYR B OH  1 
ATOM   3054 N N   . GLN B 1 133 ? 25.555  15.134  -6.568  1.00 23.05 ? 171 GLN B N   1 
ATOM   3055 C CA  . GLN B 1 133 ? 25.819  13.945  -5.782  1.00 23.73 ? 171 GLN B CA  1 
ATOM   3056 C C   . GLN B 1 133 ? 25.102  12.695  -6.316  1.00 23.09 ? 171 GLN B C   1 
ATOM   3057 O O   . GLN B 1 133 ? 25.712  11.629  -6.432  1.00 22.36 ? 171 GLN B O   1 
ATOM   3058 C CB  . GLN B 1 133 ? 25.495  14.227  -4.311  1.00 25.00 ? 171 GLN B CB  1 
ATOM   3059 C CG  . GLN B 1 133 ? 26.079  15.609  -3.804  1.00 30.83 ? 171 GLN B CG  1 
ATOM   3060 C CD  . GLN B 1 133 ? 25.111  16.817  -3.892  1.00 39.21 ? 171 GLN B CD  1 
ATOM   3061 O OE1 . GLN B 1 133 ? 24.028  16.798  -3.289  1.00 43.25 ? 171 GLN B OE1 1 
ATOM   3062 N NE2 . GLN B 1 133 ? 25.518  17.888  -4.631  1.00 38.81 ? 171 GLN B NE2 1 
ATOM   3063 N N   . SER B 1 134 ? 23.815  12.828  -6.644  1.00 22.63 ? 172 SER B N   1 
ATOM   3064 C CA  . SER B 1 134 ? 23.040  11.715  -7.176  1.00 22.42 ? 172 SER B CA  1 
ATOM   3065 C C   . SER B 1 134 ? 21.806  12.252  -7.869  1.00 23.16 ? 172 SER B C   1 
ATOM   3066 O O   . SER B 1 134 ? 21.372  13.369  -7.566  1.00 22.66 ? 172 SER B O   1 
ATOM   3067 C CB  . SER B 1 134 ? 22.647  10.715  -6.088  1.00 22.64 ? 172 SER B CB  1 
ATOM   3068 O OG  . SER B 1 134 ? 21.662  11.238  -5.208  1.00 23.27 ? 172 SER B OG  1 
ATOM   3069 N N   . CYS B 1 135 ? 21.273  11.464  -8.815  1.00 23.49 ? 173 CYS B N   1 
ATOM   3070 C CA  . CYS B 1 135 ? 20.041  11.795  -9.551  1.00 24.08 ? 173 CYS B CA  1 
ATOM   3071 C C   . CYS B 1 135 ? 19.236  10.523  -9.698  1.00 25.15 ? 173 CYS B C   1 
ATOM   3072 O O   . CYS B 1 135 ? 19.797  9.439   -9.630  1.00 25.34 ? 173 CYS B O   1 
ATOM   3073 C CB  . CYS B 1 135 ? 20.369  12.336  -10.948 1.00 23.92 ? 173 CYS B CB  1 
ATOM   3074 S SG  . CYS B 1 135 ? 21.162  13.931  -10.901 1.00 25.78 ? 173 CYS B SG  1 
ATOM   3075 N N   . PRO B 1 136 ? 17.912  10.637  -9.870  1.00 25.96 ? 174 PRO B N   1 
ATOM   3076 C CA  . PRO B 1 136 ? 17.098  9.439   -9.914  1.00 27.06 ? 174 PRO B CA  1 
ATOM   3077 C C   . PRO B 1 136 ? 17.576  8.449   -10.983 1.00 28.28 ? 174 PRO B C   1 
ATOM   3078 O O   . PRO B 1 136 ? 17.886  8.836   -12.095 1.00 28.01 ? 174 PRO B O   1 
ATOM   3079 C CB  . PRO B 1 136 ? 15.714  9.990   -10.272 1.00 27.15 ? 174 PRO B CB  1 
ATOM   3080 C CG  . PRO B 1 136 ? 15.719  11.355  -9.733  1.00 25.97 ? 174 PRO B CG  1 
ATOM   3081 C CD  . PRO B 1 136 ? 17.095  11.851  -10.023 1.00 26.39 ? 174 PRO B CD  1 
ATOM   3082 N N   . ASP B 1 137 ? 17.675  7.181   -10.619 1.00 29.87 ? 175 ASP B N   1 
ATOM   3083 C CA  . ASP B 1 137 ? 17.824  6.142   -11.620 1.00 31.10 ? 175 ASP B CA  1 
ATOM   3084 C C   . ASP B 1 137 ? 16.435  5.853   -12.178 1.00 31.77 ? 175 ASP B C   1 
ATOM   3085 O O   . ASP B 1 137 ? 15.506  5.647   -11.413 1.00 31.00 ? 175 ASP B O   1 
ATOM   3086 C CB  . ASP B 1 137 ? 18.375  4.871   -10.986 1.00 31.75 ? 175 ASP B CB  1 
ATOM   3087 C CG  . ASP B 1 137 ? 18.480  3.761   -11.981 1.00 33.01 ? 175 ASP B CG  1 
ATOM   3088 O OD1 . ASP B 1 137 ? 17.608  2.879   -11.975 1.00 34.28 ? 175 ASP B OD1 1 
ATOM   3089 O OD2 . ASP B 1 137 ? 19.380  3.830   -12.837 1.00 36.04 ? 175 ASP B OD2 1 
ATOM   3090 N N   . TRP B 1 138 ? 16.277  5.840   -13.500 1.00 33.53 ? 176 TRP B N   1 
ATOM   3091 C CA  . TRP B 1 138 ? 14.929  5.746   -14.068 1.00 35.42 ? 176 TRP B CA  1 
ATOM   3092 C C   . TRP B 1 138 ? 14.174  4.457   -13.736 1.00 35.80 ? 176 TRP B C   1 
ATOM   3093 O O   . TRP B 1 138 ? 12.945  4.449   -13.660 1.00 35.58 ? 176 TRP B O   1 
ATOM   3094 C CB  . TRP B 1 138 ? 14.925  6.031   -15.573 1.00 37.51 ? 176 TRP B CB  1 
ATOM   3095 C CG  . TRP B 1 138 ? 15.396  4.939   -16.459 1.00 39.27 ? 176 TRP B CG  1 
ATOM   3096 C CD1 . TRP B 1 138 ? 16.683  4.704   -16.851 1.00 41.31 ? 176 TRP B CD1 1 
ATOM   3097 C CD2 . TRP B 1 138 ? 14.586  3.945   -17.116 1.00 41.37 ? 176 TRP B CD2 1 
ATOM   3098 N NE1 . TRP B 1 138 ? 16.729  3.621   -17.699 1.00 41.79 ? 176 TRP B NE1 1 
ATOM   3099 C CE2 . TRP B 1 138 ? 15.458  3.136   -17.879 1.00 41.99 ? 176 TRP B CE2 1 
ATOM   3100 C CE3 . TRP B 1 138 ? 13.209  3.660   -17.129 1.00 42.14 ? 176 TRP B CE3 1 
ATOM   3101 C CZ2 . TRP B 1 138 ? 14.999  2.058   -18.662 1.00 41.26 ? 176 TRP B CZ2 1 
ATOM   3102 C CZ3 . TRP B 1 138 ? 12.748  2.584   -17.908 1.00 41.64 ? 176 TRP B CZ3 1 
ATOM   3103 C CH2 . TRP B 1 138 ? 13.647  1.796   -18.659 1.00 41.09 ? 176 TRP B CH2 1 
ATOM   3104 N N   . ARG B 1 139 ? 14.911  3.378   -13.513 1.00 35.94 ? 177 ARG B N   1 
ATOM   3105 C CA  . ARG B 1 139 ? 14.288  2.108   -13.174 1.00 36.41 ? 177 ARG B CA  1 
ATOM   3106 C C   . ARG B 1 139 ? 14.077  1.975   -11.674 1.00 35.88 ? 177 ARG B C   1 
ATOM   3107 O O   . ARG B 1 139 ? 13.045  1.473   -11.223 1.00 36.42 ? 177 ARG B O   1 
ATOM   3108 C CB  . ARG B 1 139 ? 15.130  0.947   -13.695 1.00 36.93 ? 177 ARG B CB  1 
ATOM   3109 C CG  . ARG B 1 139 ? 14.319  -0.109  -14.410 1.00 39.40 ? 177 ARG B CG  1 
ATOM   3110 C CD  . ARG B 1 139 ? 14.850  -1.504  -14.142 1.00 43.10 ? 177 ARG B CD  1 
ATOM   3111 N NE  . ARG B 1 139 ? 14.492  -1.975  -12.804 1.00 46.05 ? 177 ARG B NE  1 
ATOM   3112 C CZ  . ARG B 1 139 ? 15.331  -2.029  -11.772 1.00 47.48 ? 177 ARG B CZ  1 
ATOM   3113 N NH1 . ARG B 1 139 ? 16.596  -1.644  -11.916 1.00 48.08 ? 177 ARG B NH1 1 
ATOM   3114 N NH2 . ARG B 1 139 ? 14.905  -2.477  -10.595 1.00 47.50 ? 177 ARG B NH2 1 
ATOM   3115 N N   . LYS B 1 140 ? 15.051  2.422   -10.892 1.00 34.88 ? 178 LYS B N   1 
ATOM   3116 C CA  . LYS B 1 140 ? 15.010  2.185   -9.447  1.00 34.16 ? 178 LYS B CA  1 
ATOM   3117 C C   . LYS B 1 140 ? 14.341  3.306   -8.685  1.00 32.53 ? 178 LYS B C   1 
ATOM   3118 O O   . LYS B 1 140 ? 13.799  3.077   -7.607  1.00 32.08 ? 178 LYS B O   1 
ATOM   3119 C CB  . LYS B 1 140 ? 16.417  1.960   -8.884  1.00 34.55 ? 178 LYS B CB  1 
ATOM   3120 C CG  . LYS B 1 140 ? 17.089  0.668   -9.358  1.00 35.72 ? 178 LYS B CG  1 
ATOM   3121 C CD  . LYS B 1 140 ? 18.460  0.482   -8.711  1.00 36.38 ? 178 LYS B CD  1 
ATOM   3122 C CE  . LYS B 1 140 ? 18.346  0.176   -7.220  1.00 39.51 ? 178 LYS B CE  1 
ATOM   3123 N NZ  . LYS B 1 140 ? 19.638  -0.314  -6.631  1.00 40.94 ? 178 LYS B NZ  1 
ATOM   3124 N N   . ASP B 1 141 ? 14.391  4.523   -9.220  1.00 30.59 ? 179 ASP B N   1 
ATOM   3125 C CA  . ASP B 1 141 ? 13.855  5.651   -8.476  1.00 29.99 ? 179 ASP B CA  1 
ATOM   3126 C C   . ASP B 1 141 ? 12.550  6.124   -9.080  1.00 29.76 ? 179 ASP B C   1 
ATOM   3127 O O   . ASP B 1 141 ? 11.487  5.870   -8.526  1.00 30.28 ? 179 ASP B O   1 
ATOM   3128 C CB  . ASP B 1 141 ? 14.870  6.790   -8.363  1.00 29.23 ? 179 ASP B CB  1 
ATOM   3129 C CG  . ASP B 1 141 ? 16.077  6.404   -7.518  1.00 30.27 ? 179 ASP B CG  1 
ATOM   3130 O OD1 . ASP B 1 141 ? 15.889  5.671   -6.527  1.00 34.71 ? 179 ASP B OD1 1 
ATOM   3131 O OD2 . ASP B 1 141 ? 17.201  6.822   -7.841  1.00 28.91 ? 179 ASP B OD2 1 
ATOM   3132 N N   . CYS B 1 142 ? 12.635  6.785   -10.227 1.00 29.39 ? 180 CYS B N   1 
ATOM   3133 C CA  . CYS B 1 142 ? 11.450  7.285   -10.902 1.00 29.59 ? 180 CYS B CA  1 
ATOM   3134 C C   . CYS B 1 142 ? 11.782  7.534   -12.366 1.00 29.47 ? 180 CYS B C   1 
ATOM   3135 O O   . CYS B 1 142 ? 12.892  7.960   -12.706 1.00 27.94 ? 180 CYS B O   1 
ATOM   3136 C CB  . CYS B 1 142 ? 10.946  8.565   -10.231 1.00 29.76 ? 180 CYS B CB  1 
ATOM   3137 S SG  . CYS B 1 142 ? 12.183  9.845   -10.106 1.00 31.77 ? 180 CYS B SG  1 
ATOM   3138 N N   . SER B 1 143 ? 10.807  7.263   -13.227 1.00 29.16 ? 181 SER B N   1 
ATOM   3139 C CA  . SER B 1 143 ? 11.028  7.361   -14.660 1.00 30.15 ? 181 SER B CA  1 
ATOM   3140 C C   . SER B 1 143 ? 10.881  8.789   -15.191 1.00 29.85 ? 181 SER B C   1 
ATOM   3141 O O   . SER B 1 143 ? 11.354  9.070   -16.286 1.00 30.20 ? 181 SER B O   1 
ATOM   3142 C CB  . SER B 1 143 ? 10.072  6.424   -15.393 1.00 30.09 ? 181 SER B CB  1 
ATOM   3143 O OG  . SER B 1 143 ? 8.750   6.713   -15.015 1.00 32.20 ? 181 SER B OG  1 
ATOM   3144 N N   . ASN B 1 144 ? 10.209  9.671   -14.439 1.00 29.53 ? 182 ASN B N   1 
ATOM   3145 C CA  . ASN B 1 144 ? 9.989   11.058  -14.869 1.00 29.39 ? 182 ASN B CA  1 
ATOM   3146 C C   . ASN B 1 144 ? 11.003  12.012  -14.293 1.00 28.75 ? 182 ASN B C   1 
ATOM   3147 O O   . ASN B 1 144 ? 10.686  13.009  -13.638 1.00 28.63 ? 182 ASN B O   1 
ATOM   3148 C CB  . ASN B 1 144 ? 8.560   11.525  -14.576 1.00 30.06 ? 182 ASN B CB  1 
ATOM   3149 C CG  . ASN B 1 144 ? 7.536   10.764  -15.394 1.00 32.13 ? 182 ASN B CG  1 
ATOM   3150 O OD1 . ASN B 1 144 ? 7.806   10.357  -16.526 1.00 34.23 ? 182 ASN B OD1 1 
ATOM   3151 N ND2 . ASN B 1 144 ? 6.359   10.563  -14.822 1.00 34.31 ? 182 ASN B ND2 1 
ATOM   3152 N N   . ASN B 1 145 ? 12.249  11.697  -14.566 1.00 27.73 ? 183 ASN B N   1 
ATOM   3153 C CA  . ASN B 1 145 ? 13.337  12.495  -14.076 1.00 27.38 ? 183 ASN B CA  1 
ATOM   3154 C C   . ASN B 1 145 ? 13.851  13.441  -15.183 1.00 26.85 ? 183 ASN B C   1 
ATOM   3155 O O   . ASN B 1 145 ? 13.505  13.269  -16.367 1.00 26.53 ? 183 ASN B O   1 
ATOM   3156 C CB  . ASN B 1 145 ? 14.421  11.553  -13.545 1.00 27.14 ? 183 ASN B CB  1 
ATOM   3157 C CG  . ASN B 1 145 ? 14.970  10.637  -14.612 1.00 27.21 ? 183 ASN B CG  1 
ATOM   3158 O OD1 . ASN B 1 145 ? 14.729  9.414   -14.618 1.00 27.69 ? 183 ASN B OD1 1 
ATOM   3159 N ND2 . ASN B 1 145 ? 15.733  11.207  -15.503 1.00 23.44 ? 183 ASN B ND2 1 
ATOM   3160 N N   . PRO B 1 146 ? 14.657  14.455  -14.804 1.00 26.57 ? 184 PRO B N   1 
ATOM   3161 C CA  . PRO B 1 146 ? 15.134  15.453  -15.769 1.00 26.03 ? 184 PRO B CA  1 
ATOM   3162 C C   . PRO B 1 146 ? 15.752  14.833  -17.022 1.00 26.00 ? 184 PRO B C   1 
ATOM   3163 O O   . PRO B 1 146 ? 15.505  15.302  -18.134 1.00 26.16 ? 184 PRO B O   1 
ATOM   3164 C CB  . PRO B 1 146 ? 16.189  16.227  -14.967 1.00 25.94 ? 184 PRO B CB  1 
ATOM   3165 C CG  . PRO B 1 146 ? 15.639  16.182  -13.553 1.00 27.01 ? 184 PRO B CG  1 
ATOM   3166 C CD  . PRO B 1 146 ? 15.116  14.760  -13.431 1.00 26.35 ? 184 PRO B CD  1 
ATOM   3167 N N   . VAL B 1 147 ? 16.542  13.781  -16.848 1.00 25.65 ? 185 VAL B N   1 
ATOM   3168 C CA  . VAL B 1 147 ? 17.255  13.206  -17.973 1.00 25.65 ? 185 VAL B CA  1 
ATOM   3169 C C   . VAL B 1 147 ? 16.286  12.413  -18.851 1.00 25.71 ? 185 VAL B C   1 
ATOM   3170 O O   . VAL B 1 147 ? 16.216  12.644  -20.048 1.00 25.46 ? 185 VAL B O   1 
ATOM   3171 C CB  . VAL B 1 147 ? 18.452  12.353  -17.508 1.00 25.91 ? 185 VAL B CB  1 
ATOM   3172 C CG1 . VAL B 1 147 ? 19.026  11.516  -18.669 1.00 26.23 ? 185 VAL B CG1 1 
ATOM   3173 C CG2 . VAL B 1 147 ? 19.536  13.266  -16.913 1.00 24.88 ? 185 VAL B CG2 1 
ATOM   3174 N N   . SER B 1 148 ? 15.553  11.481  -18.246 1.00 25.56 ? 186 SER B N   1 
ATOM   3175 C CA  . SER B 1 148 ? 14.616  10.637  -18.987 1.00 26.47 ? 186 SER B CA  1 
ATOM   3176 C C   . SER B 1 148 ? 13.590  11.448  -19.746 1.00 26.02 ? 186 SER B C   1 
ATOM   3177 O O   . SER B 1 148 ? 13.300  11.168  -20.911 1.00 26.91 ? 186 SER B O   1 
ATOM   3178 C CB  . SER B 1 148 ? 13.902  9.667   -18.051 1.00 26.33 ? 186 SER B CB  1 
ATOM   3179 O OG  . SER B 1 148 ? 14.855  8.919   -17.318 1.00 28.90 ? 186 SER B OG  1 
ATOM   3180 N N   . VAL B 1 149 ? 13.029  12.452  -19.088 1.00 25.65 ? 187 VAL B N   1 
ATOM   3181 C CA  . VAL B 1 149 ? 11.962  13.250  -19.698 1.00 24.83 ? 187 VAL B CA  1 
ATOM   3182 C C   . VAL B 1 149 ? 12.534  14.040  -20.860 1.00 24.84 ? 187 VAL B C   1 
ATOM   3183 O O   . VAL B 1 149 ? 11.896  14.149  -21.911 1.00 25.04 ? 187 VAL B O   1 
ATOM   3184 C CB  . VAL B 1 149 ? 11.272  14.176  -18.665 1.00 24.74 ? 187 VAL B CB  1 
ATOM   3185 C CG1 . VAL B 1 149 ? 10.292  15.125  -19.352 1.00 23.90 ? 187 VAL B CG1 1 
ATOM   3186 C CG2 . VAL B 1 149 ? 10.530  13.333  -17.630 1.00 24.15 ? 187 VAL B CG2 1 
ATOM   3187 N N   . PHE B 1 150 ? 13.736  14.591  -20.677 1.00 24.98 ? 188 PHE B N   1 
ATOM   3188 C CA  . PHE B 1 150 ? 14.401  15.298  -21.758 1.00 25.03 ? 188 PHE B CA  1 
ATOM   3189 C C   . PHE B 1 150 ? 14.512  14.398  -22.984 1.00 25.77 ? 188 PHE B C   1 
ATOM   3190 O O   . PHE B 1 150 ? 14.113  14.787  -24.078 1.00 26.44 ? 188 PHE B O   1 
ATOM   3191 C CB  . PHE B 1 150 ? 15.800  15.774  -21.356 1.00 24.46 ? 188 PHE B CB  1 
ATOM   3192 C CG  . PHE B 1 150 ? 16.606  16.283  -22.526 1.00 24.25 ? 188 PHE B CG  1 
ATOM   3193 C CD1 . PHE B 1 150 ? 16.445  17.595  -22.981 1.00 24.80 ? 188 PHE B CD1 1 
ATOM   3194 C CD2 . PHE B 1 150 ? 17.472  15.435  -23.212 1.00 24.28 ? 188 PHE B CD2 1 
ATOM   3195 C CE1 . PHE B 1 150 ? 17.158  18.056  -24.097 1.00 24.76 ? 188 PHE B CE1 1 
ATOM   3196 C CE2 . PHE B 1 150 ? 18.192  15.890  -24.325 1.00 23.49 ? 188 PHE B CE2 1 
ATOM   3197 C CZ  . PHE B 1 150 ? 18.035  17.201  -24.758 1.00 22.28 ? 188 PHE B CZ  1 
ATOM   3198 N N   . TRP B 1 151 ? 15.082  13.213  -22.797 1.00 26.39 ? 189 TRP B N   1 
ATOM   3199 C CA  . TRP B 1 151 ? 15.320  12.302  -23.918 1.00 27.49 ? 189 TRP B CA  1 
ATOM   3200 C C   . TRP B 1 151 ? 14.037  11.762  -24.521 1.00 28.02 ? 189 TRP B C   1 
ATOM   3201 O O   . TRP B 1 151 ? 13.960  11.625  -25.730 1.00 27.87 ? 189 TRP B O   1 
ATOM   3202 C CB  . TRP B 1 151 ? 16.267  11.170  -23.553 1.00 27.54 ? 189 TRP B CB  1 
ATOM   3203 C CG  . TRP B 1 151 ? 17.689  11.654  -23.387 1.00 28.11 ? 189 TRP B CG  1 
ATOM   3204 C CD1 . TRP B 1 151 ? 18.416  11.669  -22.231 1.00 27.99 ? 189 TRP B CD1 1 
ATOM   3205 C CD2 . TRP B 1 151 ? 18.544  12.193  -24.408 1.00 28.52 ? 189 TRP B CD2 1 
ATOM   3206 N NE1 . TRP B 1 151 ? 19.662  12.191  -22.462 1.00 28.09 ? 189 TRP B NE1 1 
ATOM   3207 C CE2 . TRP B 1 151 ? 19.768  12.527  -23.789 1.00 28.55 ? 189 TRP B CE2 1 
ATOM   3208 C CE3 . TRP B 1 151 ? 18.392  12.429  -25.787 1.00 26.98 ? 189 TRP B CE3 1 
ATOM   3209 C CZ2 . TRP B 1 151 ? 20.843  13.072  -24.501 1.00 29.72 ? 189 TRP B CZ2 1 
ATOM   3210 C CZ3 . TRP B 1 151 ? 19.449  12.980  -26.491 1.00 27.89 ? 189 TRP B CZ3 1 
ATOM   3211 C CH2 . TRP B 1 151 ? 20.666  13.291  -25.849 1.00 28.26 ? 189 TRP B CH2 1 
ATOM   3212 N N   . LYS B 1 152 ? 13.039  11.462  -23.694 1.00 28.60 ? 190 LYS B N   1 
ATOM   3213 C CA  . LYS B 1 152 ? 11.729  11.036  -24.216 1.00 30.21 ? 190 LYS B CA  1 
ATOM   3214 C C   . LYS B 1 152 ? 11.167  12.114  -25.147 1.00 30.02 ? 190 LYS B C   1 
ATOM   3215 O O   . LYS B 1 152 ? 10.724  11.819  -26.262 1.00 29.95 ? 190 LYS B O   1 
ATOM   3216 C CB  . LYS B 1 152 ? 10.758  10.692  -23.067 1.00 30.46 ? 190 LYS B CB  1 
ATOM   3217 C CG  . LYS B 1 152 ? 9.299   10.430  -23.505 1.00 33.31 ? 190 LYS B CG  1 
ATOM   3218 C CD  . LYS B 1 152 ? 8.508   9.489   -22.552 1.00 33.02 ? 190 LYS B CD  1 
ATOM   3219 C CE  . LYS B 1 152 ? 7.944   10.195  -21.305 1.00 37.93 ? 190 LYS B CE  1 
ATOM   3220 N NZ  . LYS B 1 152 ? 6.872   9.375   -20.599 1.00 36.95 ? 190 LYS B NZ  1 
ATOM   3221 N N   . THR B 1 153 ? 11.246  13.367  -24.699 1.00 29.81 ? 191 THR B N   1 
ATOM   3222 C CA  . THR B 1 153 ? 10.684  14.499  -25.418 1.00 30.23 ? 191 THR B CA  1 
ATOM   3223 C C   . THR B 1 153 ? 11.343  14.731  -26.772 1.00 29.78 ? 191 THR B C   1 
ATOM   3224 O O   . THR B 1 153 ? 10.654  14.808  -27.796 1.00 29.39 ? 191 THR B O   1 
ATOM   3225 C CB  . THR B 1 153 ? 10.749  15.783  -24.571 1.00 30.60 ? 191 THR B CB  1 
ATOM   3226 O OG1 . THR B 1 153 ? 10.098  15.556  -23.307 1.00 32.61 ? 191 THR B OG1 1 
ATOM   3227 C CG2 . THR B 1 153 ? 10.050  16.924  -25.276 1.00 31.75 ? 191 THR B CG2 1 
ATOM   3228 N N   . VAL B 1 154 ? 12.668  14.856  -26.788 1.00 29.47 ? 192 VAL B N   1 
ATOM   3229 C CA  . VAL B 1 154 ? 13.371  15.143  -28.033 1.00 29.35 ? 192 VAL B CA  1 
ATOM   3230 C C   . VAL B 1 154 ? 13.368  13.928  -28.953 1.00 29.49 ? 192 VAL B C   1 
ATOM   3231 O O   . VAL B 1 154 ? 13.343  14.077  -30.163 1.00 29.32 ? 192 VAL B O   1 
ATOM   3232 C CB  . VAL B 1 154 ? 14.835  15.620  -27.824 1.00 30.19 ? 192 VAL B CB  1 
ATOM   3233 C CG1 . VAL B 1 154 ? 14.889  16.996  -27.194 1.00 30.60 ? 192 VAL B CG1 1 
ATOM   3234 C CG2 . VAL B 1 154 ? 15.637  14.641  -27.007 1.00 28.77 ? 192 VAL B CG2 1 
ATOM   3235 N N   . SER B 1 155 ? 13.398  12.734  -28.370 1.00 29.38 ? 193 SER B N   1 
ATOM   3236 C CA  . SER B 1 155 ? 13.383  11.495  -29.141 1.00 29.84 ? 193 SER B CA  1 
ATOM   3237 C C   . SER B 1 155 ? 12.070  11.324  -29.879 1.00 29.95 ? 193 SER B C   1 
ATOM   3238 O O   . SER B 1 155 ? 12.056  10.966  -31.068 1.00 29.63 ? 193 SER B O   1 
ATOM   3239 C CB  . SER B 1 155 ? 13.644  10.302  -28.241 1.00 29.22 ? 193 SER B CB  1 
ATOM   3240 O OG  . SER B 1 155 ? 14.977  10.357  -27.759 1.00 30.75 ? 193 SER B OG  1 
ATOM   3241 N N   . ARG B 1 156 ? 10.974  11.585  -29.172 1.00 30.60 ? 194 ARG B N   1 
ATOM   3242 C CA  . ARG B 1 156 ? 9.643   11.588  -29.774 1.00 31.60 ? 194 ARG B CA  1 
ATOM   3243 C C   . ARG B 1 156 ? 9.554   12.585  -30.910 1.00 31.81 ? 194 ARG B C   1 
ATOM   3244 O O   . ARG B 1 156 ? 9.113   12.231  -32.002 1.00 31.68 ? 194 ARG B O   1 
ATOM   3245 C CB  . ARG B 1 156 ? 8.557   11.883  -28.730 1.00 32.12 ? 194 ARG B CB  1 
ATOM   3246 C CG  . ARG B 1 156 ? 7.146   11.554  -29.230 1.00 34.41 ? 194 ARG B CG  1 
ATOM   3247 C CD  . ARG B 1 156 ? 6.074   12.161  -28.364 1.00 38.34 ? 194 ARG B CD  1 
ATOM   3248 N NE  . ARG B 1 156 ? 5.920   13.583  -28.652 1.00 42.20 ? 194 ARG B NE  1 
ATOM   3249 C CZ  . ARG B 1 156 ? 6.338   14.555  -27.847 1.00 43.70 ? 194 ARG B CZ  1 
ATOM   3250 N NH1 . ARG B 1 156 ? 6.925   14.248  -26.702 1.00 44.16 ? 194 ARG B NH1 1 
ATOM   3251 N NH2 . ARG B 1 156 ? 6.164   15.828  -28.181 1.00 43.81 ? 194 ARG B NH2 1 
ATOM   3252 N N   . ARG B 1 157 ? 9.969   13.828  -30.656 1.00 31.67 ? 195 ARG B N   1 
ATOM   3253 C CA  . ARG B 1 157 ? 9.921   14.881  -31.676 1.00 32.09 ? 195 ARG B CA  1 
ATOM   3254 C C   . ARG B 1 157 ? 10.798  14.567  -32.893 1.00 31.03 ? 195 ARG B C   1 
ATOM   3255 O O   . ARG B 1 157 ? 10.418  14.850  -34.021 1.00 30.65 ? 195 ARG B O   1 
ATOM   3256 C CB  . ARG B 1 157 ? 10.260  16.239  -31.069 1.00 32.37 ? 195 ARG B CB  1 
ATOM   3257 C CG  . ARG B 1 157 ? 9.257   16.651  -29.999 1.00 33.67 ? 195 ARG B CG  1 
ATOM   3258 C CD  . ARG B 1 157 ? 9.669   17.909  -29.228 1.00 34.86 ? 195 ARG B CD  1 
ATOM   3259 N NE  . ARG B 1 157 ? 8.871   19.080  -29.607 1.00 41.57 ? 195 ARG B NE  1 
ATOM   3260 C CZ  . ARG B 1 157 ? 9.339   20.125  -30.288 1.00 43.18 ? 195 ARG B CZ  1 
ATOM   3261 N NH1 . ARG B 1 157 ? 10.609  20.165  -30.673 1.00 44.77 ? 195 ARG B NH1 1 
ATOM   3262 N NH2 . ARG B 1 157 ? 8.537   21.140  -30.577 1.00 45.23 ? 195 ARG B NH2 1 
ATOM   3263 N N   . PHE B 1 158 ? 11.948  13.943  -32.660 1.00 30.33 ? 196 PHE B N   1 
ATOM   3264 C CA  . PHE B 1 158 ? 12.837  13.527  -33.748 1.00 29.67 ? 196 PHE B CA  1 
ATOM   3265 C C   . PHE B 1 158 ? 12.178  12.464  -34.636 1.00 29.54 ? 196 PHE B C   1 
ATOM   3266 O O   . PHE B 1 158 ? 12.200  12.569  -35.859 1.00 28.77 ? 196 PHE B O   1 
ATOM   3267 C CB  . PHE B 1 158 ? 14.150  12.999  -33.166 1.00 29.69 ? 196 PHE B CB  1 
ATOM   3268 C CG  . PHE B 1 158 ? 15.304  13.048  -34.115 1.00 29.27 ? 196 PHE B CG  1 
ATOM   3269 C CD1 . PHE B 1 158 ? 15.700  14.254  -34.702 1.00 29.72 ? 196 PHE B CD1 1 
ATOM   3270 C CD2 . PHE B 1 158 ? 16.025  11.896  -34.394 1.00 28.89 ? 196 PHE B CD2 1 
ATOM   3271 C CE1 . PHE B 1 158 ? 16.783  14.300  -35.574 1.00 29.27 ? 196 PHE B CE1 1 
ATOM   3272 C CE2 . PHE B 1 158 ? 17.106  11.931  -35.255 1.00 29.99 ? 196 PHE B CE2 1 
ATOM   3273 C CZ  . PHE B 1 158 ? 17.489  13.139  -35.849 1.00 30.84 ? 196 PHE B CZ  1 
ATOM   3274 N N   . ALA B 1 159 ? 11.596  11.446  -34.007 1.00 29.43 ? 197 ALA B N   1 
ATOM   3275 C CA  . ALA B 1 159 ? 10.866  10.402  -34.716 1.00 29.27 ? 197 ALA B CA  1 
ATOM   3276 C C   . ALA B 1 159 ? 9.709   11.007  -35.501 1.00 29.71 ? 197 ALA B C   1 
ATOM   3277 O O   . ALA B 1 159 ? 9.478   10.642  -36.655 1.00 29.43 ? 197 ALA B O   1 
ATOM   3278 C CB  . ALA B 1 159 ? 10.342  9.367   -33.738 1.00 28.99 ? 197 ALA B CB  1 
ATOM   3279 N N   . GLU B 1 160 ? 8.991   11.932  -34.862 1.00 29.88 ? 198 GLU B N   1 
ATOM   3280 C CA  . GLU B 1 160 ? 7.851   12.611  -35.470 1.00 30.75 ? 198 GLU B CA  1 
ATOM   3281 C C   . GLU B 1 160 ? 8.213   13.371  -36.733 1.00 30.15 ? 198 GLU B C   1 
ATOM   3282 O O   . GLU B 1 160 ? 7.384   13.511  -37.625 1.00 30.37 ? 198 GLU B O   1 
ATOM   3283 C CB  . GLU B 1 160 ? 7.230   13.601  -34.485 1.00 31.12 ? 198 GLU B CB  1 
ATOM   3284 C CG  . GLU B 1 160 ? 6.295   12.976  -33.487 1.00 33.60 ? 198 GLU B CG  1 
ATOM   3285 C CD  . GLU B 1 160 ? 5.787   13.973  -32.459 1.00 36.96 ? 198 GLU B CD  1 
ATOM   3286 O OE1 . GLU B 1 160 ? 6.008   15.202  -32.619 1.00 38.94 ? 198 GLU B OE1 1 
ATOM   3287 O OE2 . GLU B 1 160 ? 5.153   13.516  -31.490 1.00 37.55 ? 198 GLU B OE2 1 
ATOM   3288 N N   . ALA B 1 161 ? 9.446   13.871  -36.791 1.00 29.76 ? 199 ALA B N   1 
ATOM   3289 C CA  . ALA B 1 161 ? 9.896   14.706  -37.909 1.00 28.70 ? 199 ALA B CA  1 
ATOM   3290 C C   . ALA B 1 161 ? 10.317  13.872  -39.121 1.00 28.05 ? 199 ALA B C   1 
ATOM   3291 O O   . ALA B 1 161 ? 10.397  14.386  -40.232 1.00 27.41 ? 199 ALA B O   1 
ATOM   3292 C CB  . ALA B 1 161 ? 11.051  15.603  -37.457 1.00 29.11 ? 199 ALA B CB  1 
ATOM   3293 N N   . ALA B 1 162 ? 10.584  12.591  -38.880 1.00 26.97 ? 200 ALA B N   1 
ATOM   3294 C CA  . ALA B 1 162 ? 11.094  11.662  -39.884 1.00 26.33 ? 200 ALA B CA  1 
ATOM   3295 C C   . ALA B 1 162 ? 10.126  11.409  -41.035 1.00 25.97 ? 200 ALA B C   1 
ATOM   3296 O O   . ALA B 1 162 ? 8.906   11.402  -40.857 1.00 25.71 ? 200 ALA B O   1 
ATOM   3297 C CB  . ALA B 1 162 ? 11.498  10.344  -39.229 1.00 26.16 ? 200 ALA B CB  1 
ATOM   3298 N N   . CYS B 1 163 ? 10.696  11.189  -42.215 1.00 25.95 ? 201 CYS B N   1 
ATOM   3299 C CA  . CYS B 1 163 ? 9.920   10.908  -43.416 1.00 26.13 ? 201 CYS B CA  1 
ATOM   3300 C C   . CYS B 1 163 ? 10.681  9.956   -44.339 1.00 25.70 ? 201 CYS B C   1 
ATOM   3301 O O   . CYS B 1 163 ? 11.853  9.655   -44.098 1.00 25.61 ? 201 CYS B O   1 
ATOM   3302 C CB  . CYS B 1 163 ? 9.630   12.213  -44.155 1.00 26.27 ? 201 CYS B CB  1 
ATOM   3303 S SG  . CYS B 1 163 ? 11.075  12.816  -45.038 1.00 27.73 ? 201 CYS B SG  1 
ATOM   3304 N N   . ASP B 1 164 ? 10.004  9.514   -45.402 1.00 25.36 ? 202 ASP B N   1 
ATOM   3305 C CA  . ASP B 1 164 ? 10.568  8.635   -46.432 1.00 25.05 ? 202 ASP B CA  1 
ATOM   3306 C C   . ASP B 1 164 ? 11.106  7.351   -45.812 1.00 24.47 ? 202 ASP B C   1 
ATOM   3307 O O   . ASP B 1 164 ? 10.350  6.559   -45.239 1.00 24.48 ? 202 ASP B O   1 
ATOM   3308 C CB  . ASP B 1 164 ? 11.637  9.366   -47.265 1.00 25.30 ? 202 ASP B CB  1 
ATOM   3309 C CG  . ASP B 1 164 ? 12.075  8.571   -48.505 1.00 27.97 ? 202 ASP B CG  1 
ATOM   3310 O OD1 . ASP B 1 164 ? 11.208  8.012   -49.219 1.00 29.08 ? 202 ASP B OD1 1 
ATOM   3311 O OD2 . ASP B 1 164 ? 13.296  8.503   -48.768 1.00 30.45 ? 202 ASP B OD2 1 
ATOM   3312 N N   . VAL B 1 165 ? 12.410  7.140   -45.912 1.00 23.94 ? 203 VAL B N   1 
ATOM   3313 C CA  . VAL B 1 165 ? 13.012  5.979   -45.295 1.00 23.54 ? 203 VAL B CA  1 
ATOM   3314 C C   . VAL B 1 165 ? 13.730  6.441   -44.030 1.00 23.56 ? 203 VAL B C   1 
ATOM   3315 O O   . VAL B 1 165 ? 14.582  7.339   -44.070 1.00 23.54 ? 203 VAL B O   1 
ATOM   3316 C CB  . VAL B 1 165 ? 13.987  5.242   -46.238 1.00 23.22 ? 203 VAL B CB  1 
ATOM   3317 C CG1 . VAL B 1 165 ? 14.544  3.997   -45.553 1.00 22.94 ? 203 VAL B CG1 1 
ATOM   3318 C CG2 . VAL B 1 165 ? 13.308  4.881   -47.577 1.00 22.76 ? 203 VAL B CG2 1 
ATOM   3319 N N   . VAL B 1 166 ? 13.350  5.835   -42.911 1.00 23.46 ? 204 VAL B N   1 
ATOM   3320 C CA  . VAL B 1 166 ? 13.990  6.083   -41.626 1.00 23.27 ? 204 VAL B CA  1 
ATOM   3321 C C   . VAL B 1 166 ? 14.840  4.856   -41.328 1.00 23.19 ? 204 VAL B C   1 
ATOM   3322 O O   . VAL B 1 166 ? 14.340  3.736   -41.382 1.00 23.89 ? 204 VAL B O   1 
ATOM   3323 C CB  . VAL B 1 166 ? 12.949  6.286   -40.496 1.00 23.12 ? 204 VAL B CB  1 
ATOM   3324 C CG1 . VAL B 1 166 ? 13.644  6.512   -39.155 1.00 22.55 ? 204 VAL B CG1 1 
ATOM   3325 C CG2 . VAL B 1 166 ? 12.051  7.460   -40.820 1.00 24.41 ? 204 VAL B CG2 1 
ATOM   3326 N N   . HIS B 1 167 ? 16.119  5.068   -41.033 1.00 22.56 ? 205 HIS B N   1 
ATOM   3327 C CA  . HIS B 1 167 ? 17.010  3.968   -40.703 1.00 22.22 ? 205 HIS B CA  1 
ATOM   3328 C C   . HIS B 1 167 ? 17.185  3.899   -39.189 1.00 22.34 ? 205 HIS B C   1 
ATOM   3329 O O   . HIS B 1 167 ? 17.167  4.927   -38.503 1.00 21.70 ? 205 HIS B O   1 
ATOM   3330 C CB  . HIS B 1 167 ? 18.352  4.141   -41.406 1.00 22.58 ? 205 HIS B CB  1 
ATOM   3331 C CG  . HIS B 1 167 ? 18.238  4.192   -42.899 1.00 22.69 ? 205 HIS B CG  1 
ATOM   3332 N ND1 . HIS B 1 167 ? 17.865  5.336   -43.573 1.00 22.65 ? 205 HIS B ND1 1 
ATOM   3333 C CD2 . HIS B 1 167 ? 18.428  3.240   -43.845 1.00 23.49 ? 205 HIS B CD2 1 
ATOM   3334 C CE1 . HIS B 1 167 ? 17.843  5.088   -44.874 1.00 23.75 ? 205 HIS B CE1 1 
ATOM   3335 N NE2 . HIS B 1 167 ? 18.174  3.823   -45.063 1.00 22.42 ? 205 HIS B NE2 1 
ATOM   3336 N N   . VAL B 1 168 ? 17.314  2.681   -38.675 1.00 22.02 ? 206 VAL B N   1 
ATOM   3337 C CA  . VAL B 1 168 ? 17.624  2.474   -37.268 1.00 22.08 ? 206 VAL B CA  1 
ATOM   3338 C C   . VAL B 1 168 ? 18.744  1.451   -37.158 1.00 22.87 ? 206 VAL B C   1 
ATOM   3339 O O   . VAL B 1 168 ? 18.690  0.381   -37.779 1.00 23.14 ? 206 VAL B O   1 
ATOM   3340 C CB  . VAL B 1 168 ? 16.384  2.076   -36.407 1.00 21.67 ? 206 VAL B CB  1 
ATOM   3341 C CG1 . VAL B 1 168 ? 15.763  0.741   -36.863 1.00 20.26 ? 206 VAL B CG1 1 
ATOM   3342 C CG2 . VAL B 1 168 ? 16.760  2.025   -34.917 1.00 21.18 ? 206 VAL B CG2 1 
ATOM   3343 N N   . MET B 1 169 ? 19.779  1.815   -36.409 1.00 23.84 ? 207 MET B N   1 
ATOM   3344 C CA  . MET B 1 169 ? 20.852  0.892   -36.083 1.00 25.28 ? 207 MET B CA  1 
ATOM   3345 C C   . MET B 1 169 ? 20.525  0.184   -34.791 1.00 25.23 ? 207 MET B C   1 
ATOM   3346 O O   . MET B 1 169 ? 20.233  0.838   -33.788 1.00 24.91 ? 207 MET B O   1 
ATOM   3347 C CB  . MET B 1 169 ? 22.151  1.647   -35.855 1.00 25.43 ? 207 MET B CB  1 
ATOM   3348 C CG  . MET B 1 169 ? 22.961  1.906   -37.064 1.00 26.70 ? 207 MET B CG  1 
ATOM   3349 S SD  . MET B 1 169 ? 24.649  2.188   -36.500 1.00 28.27 ? 207 MET B SD  1 
ATOM   3350 C CE  . MET B 1 169 ? 25.375  2.554   -38.102 1.00 27.66 ? 207 MET B CE  1 
ATOM   3351 N N   . LEU B 1 170 ? 20.621  -1.143  -34.805 1.00 25.33 ? 208 LEU B N   1 
ATOM   3352 C CA  . LEU B 1 170 ? 20.384  -1.934  -33.614 1.00 26.05 ? 208 LEU B CA  1 
ATOM   3353 C C   . LEU B 1 170 ? 21.583  -2.813  -33.319 1.00 26.93 ? 208 LEU B C   1 
ATOM   3354 O O   . LEU B 1 170 ? 22.312  -3.210  -34.226 1.00 26.46 ? 208 LEU B O   1 
ATOM   3355 C CB  . LEU B 1 170 ? 19.136  -2.808  -33.783 1.00 25.92 ? 208 LEU B CB  1 
ATOM   3356 C CG  . LEU B 1 170 ? 17.842  -2.083  -34.158 1.00 24.93 ? 208 LEU B CG  1 
ATOM   3357 C CD1 . LEU B 1 170 ? 16.797  -3.083  -34.577 1.00 25.12 ? 208 LEU B CD1 1 
ATOM   3358 C CD2 . LEU B 1 170 ? 17.341  -1.198  -33.022 1.00 26.90 ? 208 LEU B CD2 1 
ATOM   3359 N N   . ASP B 1 171 ? 21.768  -3.121  -32.043 1.00 27.97 ? 209 ASP B N   1 
ATOM   3360 C CA  . ASP B 1 171 ? 22.861  -3.967  -31.599 1.00 29.72 ? 209 ASP B CA  1 
ATOM   3361 C C   . ASP B 1 171 ? 22.468  -5.441  -31.694 1.00 30.42 ? 209 ASP B C   1 
ATOM   3362 O O   . ASP B 1 171 ? 21.675  -5.930  -30.891 1.00 30.48 ? 209 ASP B O   1 
ATOM   3363 C CB  . ASP B 1 171 ? 23.215  -3.595  -30.161 1.00 29.91 ? 209 ASP B CB  1 
ATOM   3364 C CG  . ASP B 1 171 ? 24.499  -4.233  -29.682 1.00 31.51 ? 209 ASP B CG  1 
ATOM   3365 O OD1 . ASP B 1 171 ? 25.074  -5.060  -30.414 1.00 31.99 ? 209 ASP B OD1 1 
ATOM   3366 O OD2 . ASP B 1 171 ? 24.930  -3.879  -28.557 1.00 35.45 ? 209 ASP B OD2 1 
ATOM   3367 N N   . GLY B 1 172 ? 23.036  -6.147  -32.670 1.00 31.63 ? 210 GLY B N   1 
ATOM   3368 C CA  . GLY B 1 172 ? 22.742  -7.565  -32.876 1.00 33.41 ? 210 GLY B CA  1 
ATOM   3369 C C   . GLY B 1 172 ? 23.333  -8.529  -31.854 1.00 34.83 ? 210 GLY B C   1 
ATOM   3370 O O   . GLY B 1 172 ? 23.235  -9.744  -32.018 1.00 34.31 ? 210 GLY B O   1 
ATOM   3371 N N   . SER B 1 173 ? 23.941  -8.005  -30.824 1.00 36.46 ? 211 SER B N   1 
ATOM   3372 C CA  . SER B 1 173 ? 24.636  -8.895  -29.895 1.00 38.25 ? 211 SER B CA  1 
ATOM   3373 C C   . SER B 1 173 ? 24.100  -8.721  -28.506 1.00 39.45 ? 211 SER B C   1 
ATOM   3374 O O   . SER B 1 173 ? 24.622  -9.189  -27.493 1.00 40.07 ? 211 SER B O   1 
ATOM   3375 C CB  . SER B 1 173 ? 26.132  -8.621  -29.910 1.00 38.27 ? 211 SER B CB  1 
ATOM   3376 O OG  . SER B 1 173 ? 26.408  -7.242  -29.725 1.00 37.36 ? 211 SER B OG  1 
ATOM   3377 N N   . ARG B 1 174 ? 23.018  -7.989  -28.549 1.00 40.73 ? 212 ARG B N   1 
ATOM   3378 C CA  . ARG B 1 174 ? 22.220  -7.794  -27.412 1.00 41.70 ? 212 ARG B CA  1 
ATOM   3379 C C   . ARG B 1 174 ? 21.206  -8.889  -27.486 1.00 41.75 ? 212 ARG B C   1 
ATOM   3380 O O   . ARG B 1 174 ? 20.373  -8.926  -28.390 1.00 42.47 ? 212 ARG B O   1 
ATOM   3381 C CB  . ARG B 1 174 ? 21.722  -6.349  -27.348 1.00 42.04 ? 212 ARG B CB  1 
ATOM   3382 C CG  . ARG B 1 174 ? 22.782  -5.347  -26.923 1.00 44.57 ? 212 ARG B CG  1 
ATOM   3383 C CD  . ARG B 1 174 ? 22.719  -5.076  -25.430 1.00 49.04 ? 212 ARG B CD  1 
ATOM   3384 N NE  . ARG B 1 174 ? 23.732  -4.114  -25.005 1.00 52.28 ? 212 ARG B NE  1 
ATOM   3385 C CZ  . ARG B 1 174 ? 23.893  -3.704  -23.752 1.00 53.84 ? 212 ARG B CZ  1 
ATOM   3386 N NH1 . ARG B 1 174 ? 23.105  -4.173  -22.796 1.00 54.60 ? 212 ARG B NH1 1 
ATOM   3387 N NH2 . ARG B 1 174 ? 24.841  -2.826  -23.459 1.00 53.95 ? 212 ARG B NH2 1 
ATOM   3388 N N   . SER B 1 175 ? 21.256  -9.764  -26.540 1.00 41.47 ? 213 SER B N   1 
ATOM   3389 C CA  . SER B 1 175 ? 20.028  -10.543 -26.534 1.00 41.32 ? 213 SER B CA  1 
ATOM   3390 C C   . SER B 1 175 ? 18.975  -9.493  -26.105 1.00 40.88 ? 213 SER B C   1 
ATOM   3391 O O   . SER B 1 175 ? 18.984  -8.984  -24.983 1.00 41.20 ? 213 SER B O   1 
ATOM   3392 C CB  . SER B 1 175 ? 20.218  -11.836 -25.740 1.00 41.55 ? 213 SER B CB  1 
ATOM   3393 O OG  . SER B 1 175 ? 20.505  -11.562 -24.380 1.00 41.75 ? 213 SER B OG  1 
ATOM   3394 N N   . LYS B 1 176 ? 18.028  -9.207  -27.088 1.00 39.60 ? 214 LYS B N   1 
ATOM   3395 C CA  . LYS B 1 176 ? 16.896  -8.226  -27.142 1.00 38.39 ? 214 LYS B CA  1 
ATOM   3396 C C   . LYS B 1 176 ? 17.420  -7.183  -28.124 1.00 37.49 ? 214 LYS B C   1 
ATOM   3397 O O   . LYS B 1 176 ? 17.695  -6.054  -27.765 1.00 37.28 ? 214 LYS B O   1 
ATOM   3398 C CB  . LYS B 1 176 ? 16.545  -7.549  -25.807 1.00 38.83 ? 214 LYS B CB  1 
ATOM   3399 C CG  . LYS B 1 176 ? 16.086  -8.526  -24.724 1.00 39.52 ? 214 LYS B CG  1 
ATOM   3400 C CD  . LYS B 1 176 ? 14.590  -8.715  -24.673 1.00 42.02 ? 214 LYS B CD  1 
ATOM   3401 C CE  . LYS B 1 176 ? 14.172  -9.310  -23.347 1.00 42.48 ? 214 LYS B CE  1 
ATOM   3402 N NZ  . LYS B 1 176 ? 14.189  -8.302  -22.257 1.00 43.00 ? 214 LYS B NZ  1 
ATOM   3403 N N   . ILE B 1 177 ? 17.540  -7.598  -29.377 1.00 36.05 ? 215 ILE B N   1 
ATOM   3404 C CA  . ILE B 1 177 ? 18.042  -6.727  -30.446 1.00 34.91 ? 215 ILE B CA  1 
ATOM   3405 C C   . ILE B 1 177 ? 17.128  -5.511  -30.576 1.00 34.47 ? 215 ILE B C   1 
ATOM   3406 O O   . ILE B 1 177 ? 17.590  -4.369  -30.521 1.00 34.33 ? 215 ILE B O   1 
ATOM   3407 C CB  . ILE B 1 177 ? 18.197  -7.457  -31.793 1.00 34.81 ? 215 ILE B CB  1 
ATOM   3408 C CG1 . ILE B 1 177 ? 19.204  -8.610  -31.662 1.00 34.20 ? 215 ILE B CG1 1 
ATOM   3409 C CG2 . ILE B 1 177 ? 18.636  -6.465  -32.868 1.00 34.26 ? 215 ILE B CG2 1 
ATOM   3410 C CD1 . ILE B 1 177 ? 19.280  -9.518  -32.868 1.00 33.31 ? 215 ILE B CD1 1 
ATOM   3411 N N   . PHE B 1 178 ? 15.834  -5.773  -30.739 1.00 34.00 ? 216 PHE B N   1 
ATOM   3412 C CA  . PHE B 1 178 ? 14.815  -4.761  -30.535 1.00 34.06 ? 216 PHE B CA  1 
ATOM   3413 C C   . PHE B 1 178 ? 14.250  -4.900  -29.128 1.00 34.92 ? 216 PHE B C   1 
ATOM   3414 O O   . PHE B 1 178 ? 13.738  -5.959  -28.747 1.00 35.16 ? 216 PHE B O   1 
ATOM   3415 C CB  . PHE B 1 178 ? 13.686  -4.888  -31.556 1.00 33.58 ? 216 PHE B CB  1 
ATOM   3416 C CG  . PHE B 1 178 ? 12.515  -4.001  -31.260 1.00 32.32 ? 216 PHE B CG  1 
ATOM   3417 C CD1 . PHE B 1 178 ? 12.625  -2.616  -31.398 1.00 31.05 ? 216 PHE B CD1 1 
ATOM   3418 C CD2 . PHE B 1 178 ? 11.308  -4.541  -30.833 1.00 31.67 ? 216 PHE B CD2 1 
ATOM   3419 C CE1 . PHE B 1 178 ? 11.553  -1.790  -31.123 1.00 30.22 ? 216 PHE B CE1 1 
ATOM   3420 C CE2 . PHE B 1 178 ? 10.224  -3.716  -30.558 1.00 31.11 ? 216 PHE B CE2 1 
ATOM   3421 C CZ  . PHE B 1 178 ? 10.349  -2.337  -30.701 1.00 30.67 ? 216 PHE B CZ  1 
ATOM   3422 N N   . ASP B 1 179 ? 14.348  -3.830  -28.356 1.00 35.50 ? 217 ASP B N   1 
ATOM   3423 C CA  . ASP B 1 179 ? 13.784  -3.835  -27.027 1.00 36.64 ? 217 ASP B CA  1 
ATOM   3424 C C   . ASP B 1 179 ? 12.570  -2.931  -27.022 1.00 36.96 ? 217 ASP B C   1 
ATOM   3425 O O   . ASP B 1 179 ? 12.687  -1.701  -27.074 1.00 36.68 ? 217 ASP B O   1 
ATOM   3426 C CB  . ASP B 1 179 ? 14.820  -3.421  -25.983 1.00 36.72 ? 217 ASP B CB  1 
ATOM   3427 C CG  . ASP B 1 179 ? 14.232  -3.305  -24.583 1.00 38.44 ? 217 ASP B CG  1 
ATOM   3428 O OD1 . ASP B 1 179 ? 13.419  -4.159  -24.183 1.00 39.78 ? 217 ASP B OD1 1 
ATOM   3429 O OD2 . ASP B 1 179 ? 14.580  -2.339  -23.881 1.00 41.32 ? 217 ASP B OD2 1 
ATOM   3430 N N   . LYS B 1 180 ? 11.411  -3.582  -26.982 1.00 37.73 ? 218 LYS B N   1 
ATOM   3431 C CA  . LYS B 1 180 ? 10.096  -2.959  -26.919 1.00 39.09 ? 218 LYS B CA  1 
ATOM   3432 C C   . LYS B 1 180 ? 10.050  -1.785  -25.945 1.00 39.35 ? 218 LYS B C   1 
ATOM   3433 O O   . LYS B 1 180 ? 9.330   -0.815  -26.179 1.00 39.79 ? 218 LYS B O   1 
ATOM   3434 C CB  . LYS B 1 180 ? 9.066   -4.027  -26.525 1.00 39.25 ? 218 LYS B CB  1 
ATOM   3435 C CG  . LYS B 1 180 ? 7.619   -3.565  -26.396 1.00 40.31 ? 218 LYS B CG  1 
ATOM   3436 C CD  . LYS B 1 180 ? 6.682   -4.749  -26.126 1.00 40.27 ? 218 LYS B CD  1 
ATOM   3437 C CE  . LYS B 1 180 ? 6.872   -5.351  -24.726 1.00 42.23 ? 218 LYS B CE  1 
ATOM   3438 N NZ  . LYS B 1 180 ? 6.298   -4.494  -23.644 1.00 43.55 ? 218 LYS B NZ  1 
ATOM   3439 N N   . ASP B 1 181 ? 10.845  -1.873  -24.879 1.00 39.61 ? 219 ASP B N   1 
ATOM   3440 C CA  . ASP B 1 181 ? 10.828  -0.904  -23.781 1.00 39.69 ? 219 ASP B CA  1 
ATOM   3441 C C   . ASP B 1 181 ? 11.957  0.131   -23.823 1.00 39.03 ? 219 ASP B C   1 
ATOM   3442 O O   . ASP B 1 181 ? 12.061  0.970   -22.919 1.00 39.49 ? 219 ASP B O   1 
ATOM   3443 C CB  . ASP B 1 181 ? 10.863  -1.636  -22.426 1.00 40.19 ? 219 ASP B CB  1 
ATOM   3444 C CG  . ASP B 1 181 ? 9.685   -2.586  -22.229 1.00 42.13 ? 219 ASP B CG  1 
ATOM   3445 O OD1 . ASP B 1 181 ? 8.535   -2.222  -22.571 1.00 43.92 ? 219 ASP B OD1 1 
ATOM   3446 O OD2 . ASP B 1 181 ? 9.911   -3.704  -21.712 1.00 44.24 ? 219 ASP B OD2 1 
ATOM   3447 N N   . SER B 1 182 ? 12.804  0.081   -24.853 1.00 37.76 ? 220 SER B N   1 
ATOM   3448 C CA  . SER B 1 182 ? 13.843  1.109   -25.044 1.00 36.35 ? 220 SER B CA  1 
ATOM   3449 C C   . SER B 1 182 ? 13.188  2.413   -25.491 1.00 35.49 ? 220 SER B C   1 
ATOM   3450 O O   . SER B 1 182 ? 11.992  2.430   -25.784 1.00 35.69 ? 220 SER B O   1 
ATOM   3451 C CB  . SER B 1 182 ? 14.878  0.662   -26.084 1.00 36.56 ? 220 SER B CB  1 
ATOM   3452 O OG  . SER B 1 182 ? 14.334  0.695   -27.397 1.00 36.06 ? 220 SER B OG  1 
ATOM   3453 N N   . THR B 1 183 ? 13.952  3.499   -25.551 1.00 34.22 ? 221 THR B N   1 
ATOM   3454 C CA  . THR B 1 183 ? 13.388  4.762   -26.033 1.00 33.84 ? 221 THR B CA  1 
ATOM   3455 C C   . THR B 1 183 ? 13.059  4.629   -27.511 1.00 32.79 ? 221 THR B C   1 
ATOM   3456 O O   . THR B 1 183 ? 12.037  5.121   -27.963 1.00 32.30 ? 221 THR B O   1 
ATOM   3457 C CB  . THR B 1 183 ? 14.322  5.957   -25.844 1.00 33.88 ? 221 THR B CB  1 
ATOM   3458 O OG1 . THR B 1 183 ? 14.891  5.913   -24.531 1.00 35.46 ? 221 THR B OG1 1 
ATOM   3459 C CG2 . THR B 1 183 ? 13.554  7.279   -26.026 1.00 34.11 ? 221 THR B CG2 1 
ATOM   3460 N N   . PHE B 1 184 ? 13.925  3.956   -28.262 1.00 31.87 ? 222 PHE B N   1 
ATOM   3461 C CA  . PHE B 1 184 ? 13.580  3.692   -29.649 1.00 30.94 ? 222 PHE B CA  1 
ATOM   3462 C C   . PHE B 1 184 ? 12.280  2.909   -29.702 1.00 31.16 ? 222 PHE B C   1 
ATOM   3463 O O   . PHE B 1 184 ? 11.339  3.323   -30.371 1.00 31.05 ? 222 PHE B O   1 
ATOM   3464 C CB  . PHE B 1 184 ? 14.675  2.951   -30.405 1.00 30.37 ? 222 PHE B CB  1 
ATOM   3465 C CG  . PHE B 1 184 ? 14.211  2.428   -31.736 1.00 28.40 ? 222 PHE B CG  1 
ATOM   3466 C CD1 . PHE B 1 184 ? 13.831  3.307   -32.739 1.00 27.19 ? 222 PHE B CD1 1 
ATOM   3467 C CD2 . PHE B 1 184 ? 14.125  1.059   -31.970 1.00 28.66 ? 222 PHE B CD2 1 
ATOM   3468 C CE1 . PHE B 1 184 ? 13.379  2.830   -33.977 1.00 27.48 ? 222 PHE B CE1 1 
ATOM   3469 C CE2 . PHE B 1 184 ? 13.682  0.567   -33.206 1.00 27.75 ? 222 PHE B CE2 1 
ATOM   3470 C CZ  . PHE B 1 184 ? 13.308  1.456   -34.204 1.00 27.51 ? 222 PHE B CZ  1 
ATOM   3471 N N   . GLY B 1 185 ? 12.226  1.811   -28.951 1.00 31.46 ? 223 GLY B N   1 
ATOM   3472 C CA  . GLY B 1 185 ? 11.115  0.872   -29.013 1.00 32.80 ? 223 GLY B CA  1 
ATOM   3473 C C   . GLY B 1 185 ? 9.795   1.293   -28.399 1.00 33.53 ? 223 GLY B C   1 
ATOM   3474 O O   . GLY B 1 185 ? 8.765   0.751   -28.760 1.00 33.87 ? 223 GLY B O   1 
ATOM   3475 N N   . SER B 1 186 ? 9.819   2.241   -27.467 1.00 34.52 ? 224 SER B N   1 
ATOM   3476 C CA  . SER B 1 186 ? 8.607   2.650   -26.757 1.00 35.18 ? 224 SER B CA  1 
ATOM   3477 C C   . SER B 1 186 ? 8.089   4.023   -27.166 1.00 35.60 ? 224 SER B C   1 
ATOM   3478 O O   . SER B 1 186 ? 6.883   4.272   -27.097 1.00 37.01 ? 224 SER B O   1 
ATOM   3479 C CB  . SER B 1 186 ? 8.856   2.663   -25.250 1.00 35.45 ? 224 SER B CB  1 
ATOM   3480 O OG  . SER B 1 186 ? 9.849   3.626   -24.939 1.00 36.03 ? 224 SER B OG  1 
ATOM   3481 N N   . VAL B 1 187 ? 8.998   4.916   -27.554 1.00 35.08 ? 225 VAL B N   1 
ATOM   3482 C CA  . VAL B 1 187 ? 8.642   6.271   -27.953 1.00 34.09 ? 225 VAL B CA  1 
ATOM   3483 C C   . VAL B 1 187 ? 8.807   6.473   -29.468 1.00 33.57 ? 225 VAL B C   1 
ATOM   3484 O O   . VAL B 1 187 ? 7.875   6.904   -30.147 1.00 33.33 ? 225 VAL B O   1 
ATOM   3485 C CB  . VAL B 1 187 ? 9.469   7.314   -27.157 1.00 34.88 ? 225 VAL B CB  1 
ATOM   3486 C CG1 . VAL B 1 187 ? 9.274   8.699   -27.714 1.00 34.86 ? 225 VAL B CG1 1 
ATOM   3487 C CG2 . VAL B 1 187 ? 9.072   7.291   -25.671 1.00 34.38 ? 225 VAL B CG2 1 
ATOM   3488 N N   . GLN B 1 188 ? 9.976   6.129   -29.997 1.00 32.40 ? 226 GLN B N   1 
ATOM   3489 C CA  . GLN B 1 188 ? 10.289  6.469   -31.378 1.00 31.65 ? 226 GLN B CA  1 
ATOM   3490 C C   . GLN B 1 188 ? 9.517   5.656   -32.412 1.00 31.16 ? 226 GLN B C   1 
ATOM   3491 O O   . GLN B 1 188 ? 8.912   6.244   -33.311 1.00 31.10 ? 226 GLN B O   1 
ATOM   3492 C CB  . GLN B 1 188 ? 11.798  6.461   -31.625 1.00 31.30 ? 226 GLN B CB  1 
ATOM   3493 C CG  . GLN B 1 188 ? 12.491  7.573   -30.888 1.00 29.46 ? 226 GLN B CG  1 
ATOM   3494 C CD  . GLN B 1 188 ? 13.934  7.706   -31.245 1.00 27.53 ? 226 GLN B CD  1 
ATOM   3495 O OE1 . GLN B 1 188 ? 14.664  6.719   -31.312 1.00 26.56 ? 226 GLN B OE1 1 
ATOM   3496 N NE2 . GLN B 1 188 ? 14.368  8.938   -31.474 1.00 28.44 ? 226 GLN B NE2 1 
ATOM   3497 N N   . VAL B 1 189 ? 9.507   4.328   -32.279 1.00 30.86 ? 227 VAL B N   1 
ATOM   3498 C CA  . VAL B 1 189 ? 8.781   3.479   -33.238 1.00 30.84 ? 227 VAL B CA  1 
ATOM   3499 C C   . VAL B 1 189 ? 7.313   3.860   -33.319 1.00 30.82 ? 227 VAL B C   1 
ATOM   3500 O O   . VAL B 1 189 ? 6.711   3.809   -34.397 1.00 30.27 ? 227 VAL B O   1 
ATOM   3501 C CB  . VAL B 1 189 ? 8.860   1.936   -32.960 1.00 30.91 ? 227 VAL B CB  1 
ATOM   3502 C CG1 . VAL B 1 189 ? 10.247  1.409   -33.176 1.00 30.93 ? 227 VAL B CG1 1 
ATOM   3503 C CG2 . VAL B 1 189 ? 8.362   1.570   -31.580 1.00 31.60 ? 227 VAL B CG2 1 
ATOM   3504 N N   . HIS B 1 190 ? 6.750   4.247   -32.178 1.00 30.50 ? 228 HIS B N   1 
ATOM   3505 C CA  . HIS B 1 190 ? 5.329   4.528   -32.076 1.00 30.74 ? 228 HIS B CA  1 
ATOM   3506 C C   . HIS B 1 190 ? 4.976   5.931   -32.538 1.00 30.45 ? 228 HIS B C   1 
ATOM   3507 O O   . HIS B 1 190 ? 3.803   6.257   -32.664 1.00 30.62 ? 228 HIS B O   1 
ATOM   3508 C CB  . HIS B 1 190 ? 4.843   4.273   -30.651 1.00 31.08 ? 228 HIS B CB  1 
ATOM   3509 C CG  . HIS B 1 190 ? 5.004   2.847   -30.224 1.00 32.58 ? 228 HIS B CG  1 
ATOM   3510 N ND1 . HIS B 1 190 ? 5.920   2.453   -29.272 1.00 34.34 ? 228 HIS B ND1 1 
ATOM   3511 C CD2 . HIS B 1 190 ? 4.398   1.716   -30.655 1.00 32.49 ? 228 HIS B CD2 1 
ATOM   3512 C CE1 . HIS B 1 190 ? 5.851   1.143   -29.115 1.00 34.34 ? 228 HIS B CE1 1 
ATOM   3513 N NE2 . HIS B 1 190 ? 4.940   0.671   -29.947 1.00 34.22 ? 228 HIS B NE2 1 
ATOM   3514 N N   . ASN B 1 191 ? 5.991   6.746   -32.810 1.00 30.08 ? 229 ASN B N   1 
ATOM   3515 C CA  . ASN B 1 191 ? 5.763   8.097   -33.329 1.00 30.02 ? 229 ASN B CA  1 
ATOM   3516 C C   . ASN B 1 191 ? 6.225   8.345   -34.774 1.00 29.29 ? 229 ASN B C   1 
ATOM   3517 O O   . ASN B 1 191 ? 6.159   9.472   -35.288 1.00 29.23 ? 229 ASN B O   1 
ATOM   3518 C CB  . ASN B 1 191 ? 6.308   9.119   -32.340 1.00 30.21 ? 229 ASN B CB  1 
ATOM   3519 C CG  . ASN B 1 191 ? 5.432   9.220   -31.117 1.00 31.35 ? 229 ASN B CG  1 
ATOM   3520 O OD1 . ASN B 1 191 ? 4.440   9.943   -31.121 1.00 33.25 ? 229 ASN B OD1 1 
ATOM   3521 N ND2 . ASN B 1 191 ? 5.750   8.446   -30.086 1.00 31.16 ? 229 ASN B ND2 1 
ATOM   3522 N N   . LEU B 1 192 ? 6.684   7.283   -35.426 1.00 28.56 ? 230 LEU B N   1 
ATOM   3523 C CA  . LEU B 1 192 ? 6.901   7.311   -36.872 1.00 28.02 ? 230 LEU B CA  1 
ATOM   3524 C C   . LEU B 1 192 ? 5.544   7.428   -37.544 1.00 28.19 ? 230 LEU B C   1 
ATOM   3525 O O   . LEU B 1 192 ? 4.653   6.631   -37.296 1.00 28.34 ? 230 LEU B O   1 
ATOM   3526 C CB  . LEU B 1 192 ? 7.628   6.056   -37.342 1.00 27.79 ? 230 LEU B CB  1 
ATOM   3527 C CG  . LEU B 1 192 ? 9.012   5.784   -36.740 1.00 26.88 ? 230 LEU B CG  1 
ATOM   3528 C CD1 . LEU B 1 192 ? 9.600   4.512   -37.313 1.00 25.72 ? 230 LEU B CD1 1 
ATOM   3529 C CD2 . LEU B 1 192 ? 9.956   6.943   -36.984 1.00 25.39 ? 230 LEU B CD2 1 
ATOM   3530 N N   . GLN B 1 193 ? 5.374   8.453   -38.364 1.00 28.15 ? 231 GLN B N   1 
ATOM   3531 C CA  . GLN B 1 193 ? 4.082   8.718   -38.992 1.00 28.57 ? 231 GLN B CA  1 
ATOM   3532 C C   . GLN B 1 193 ? 3.960   8.048   -40.360 1.00 28.03 ? 231 GLN B C   1 
ATOM   3533 O O   . GLN B 1 193 ? 4.733   8.366   -41.259 1.00 27.94 ? 231 GLN B O   1 
ATOM   3534 C CB  . GLN B 1 193 ? 3.876   10.229  -39.113 1.00 28.87 ? 231 GLN B CB  1 
ATOM   3535 C CG  . GLN B 1 193 ? 3.679   10.926  -37.774 1.00 31.16 ? 231 GLN B CG  1 
ATOM   3536 C CD  . GLN B 1 193 ? 2.409   10.467  -37.088 1.00 35.70 ? 231 GLN B CD  1 
ATOM   3537 O OE1 . GLN B 1 193 ? 1.328   10.454  -37.692 1.00 38.26 ? 231 GLN B OE1 1 
ATOM   3538 N NE2 . GLN B 1 193 ? 2.530   10.068  -35.827 1.00 38.12 ? 231 GLN B NE2 1 
ATOM   3539 N N   . PRO B 1 194 ? 2.998   7.110   -40.525 1.00 27.94 ? 232 PRO B N   1 
ATOM   3540 C CA  . PRO B 1 194 ? 2.766   6.495   -41.843 1.00 27.97 ? 232 PRO B CA  1 
ATOM   3541 C C   . PRO B 1 194 ? 2.505   7.516   -42.948 1.00 28.40 ? 232 PRO B C   1 
ATOM   3542 O O   . PRO B 1 194 ? 2.806   7.245   -44.111 1.00 28.05 ? 232 PRO B O   1 
ATOM   3543 C CB  . PRO B 1 194 ? 1.520   5.629   -41.628 1.00 27.87 ? 232 PRO B CB  1 
ATOM   3544 C CG  . PRO B 1 194 ? 0.954   6.053   -40.300 1.00 27.43 ? 232 PRO B CG  1 
ATOM   3545 C CD  . PRO B 1 194 ? 2.099   6.549   -39.503 1.00 27.80 ? 232 PRO B CD  1 
ATOM   3546 N N   . GLU B 1 195 ? 1.972   8.683   -42.583 1.00 28.61 ? 233 GLU B N   1 
ATOM   3547 C CA  . GLU B 1 195 ? 1.694   9.749   -43.558 1.00 29.35 ? 233 GLU B CA  1 
ATOM   3548 C C   . GLU B 1 195 ? 2.976   10.336  -44.181 1.00 28.68 ? 233 GLU B C   1 
ATOM   3549 O O   . GLU B 1 195 ? 2.947   10.902  -45.281 1.00 28.71 ? 233 GLU B O   1 
ATOM   3550 C CB  . GLU B 1 195 ? 0.864   10.866  -42.909 1.00 29.86 ? 233 GLU B CB  1 
ATOM   3551 C CG  . GLU B 1 195 ? -0.604  10.503  -42.629 1.00 32.17 ? 233 GLU B CG  1 
ATOM   3552 C CD  . GLU B 1 195 ? -0.810  9.733   -41.324 1.00 35.22 ? 233 GLU B CD  1 
ATOM   3553 O OE1 . GLU B 1 195 ? 0.104   9.722   -40.465 1.00 37.45 ? 233 GLU B OE1 1 
ATOM   3554 O OE2 . GLU B 1 195 ? -1.900  9.140   -41.152 1.00 36.69 ? 233 GLU B OE2 1 
ATOM   3555 N N   . LYS B 1 196 ? 4.090   10.163  -43.475 1.00 27.98 ? 234 LYS B N   1 
ATOM   3556 C CA  . LYS B 1 196 ? 5.395   10.717  -43.839 1.00 27.70 ? 234 LYS B CA  1 
ATOM   3557 C C   . LYS B 1 196 ? 6.422   9.609   -44.097 1.00 26.63 ? 234 LYS B C   1 
ATOM   3558 O O   . LYS B 1 196 ? 7.239   9.708   -45.009 1.00 25.74 ? 234 LYS B O   1 
ATOM   3559 C CB  . LYS B 1 196 ? 5.924   11.599  -42.695 1.00 27.70 ? 234 LYS B CB  1 
ATOM   3560 C CG  . LYS B 1 196 ? 5.011   12.743  -42.273 1.00 28.69 ? 234 LYS B CG  1 
ATOM   3561 C CD  . LYS B 1 196 ? 5.575   13.407  -41.021 1.00 29.60 ? 234 LYS B CD  1 
ATOM   3562 C CE  . LYS B 1 196 ? 5.156   14.866  -40.929 1.00 33.42 ? 234 LYS B CE  1 
ATOM   3563 N NZ  . LYS B 1 196 ? 6.083   15.593  -40.015 1.00 35.63 ? 234 LYS B NZ  1 
ATOM   3564 N N   . VAL B 1 197 ? 6.397   8.572   -43.263 1.00 26.11 ? 235 VAL B N   1 
ATOM   3565 C CA  . VAL B 1 197 ? 7.381   7.495   -43.346 1.00 25.90 ? 235 VAL B CA  1 
ATOM   3566 C C   . VAL B 1 197 ? 6.877   6.355   -44.242 1.00 25.92 ? 235 VAL B C   1 
ATOM   3567 O O   . VAL B 1 197 ? 5.801   5.804   -44.013 1.00 25.96 ? 235 VAL B O   1 
ATOM   3568 C CB  . VAL B 1 197 ? 7.762   6.963   -41.947 1.00 25.80 ? 235 VAL B CB  1 
ATOM   3569 C CG1 . VAL B 1 197 ? 8.792   5.855   -42.047 1.00 25.13 ? 235 VAL B CG1 1 
ATOM   3570 C CG2 . VAL B 1 197 ? 8.283   8.098   -41.061 1.00 25.31 ? 235 VAL B CG2 1 
ATOM   3571 N N   . GLN B 1 198 ? 7.665   6.014   -45.261 1.00 26.02 ? 236 GLN B N   1 
ATOM   3572 C CA  . GLN B 1 198 ? 7.345   4.901   -46.154 1.00 26.05 ? 236 GLN B CA  1 
ATOM   3573 C C   . GLN B 1 198 ? 7.900   3.609   -45.570 1.00 25.29 ? 236 GLN B C   1 
ATOM   3574 O O   . GLN B 1 198 ? 7.222   2.587   -45.556 1.00 25.26 ? 236 GLN B O   1 
ATOM   3575 C CB  . GLN B 1 198 ? 7.950   5.096   -47.556 1.00 26.33 ? 236 GLN B CB  1 
ATOM   3576 C CG  . GLN B 1 198 ? 7.647   6.425   -48.270 1.00 29.99 ? 236 GLN B CG  1 
ATOM   3577 C CD  . GLN B 1 198 ? 6.218   6.895   -48.104 1.00 33.08 ? 236 GLN B CD  1 
ATOM   3578 O OE1 . GLN B 1 198 ? 5.306   6.403   -48.773 1.00 34.59 ? 236 GLN B OE1 1 
ATOM   3579 N NE2 . GLN B 1 198 ? 6.016   7.870   -47.216 1.00 33.92 ? 236 GLN B NE2 1 
ATOM   3580 N N   . THR B 1 199 ? 9.139   3.675   -45.093 1.00 24.52 ? 237 THR B N   1 
ATOM   3581 C CA  . THR B 1 199 ? 9.897   2.488   -44.717 1.00 23.87 ? 237 THR B CA  1 
ATOM   3582 C C   . THR B 1 199 ? 10.717  2.750   -43.468 1.00 23.77 ? 237 THR B C   1 
ATOM   3583 O O   . THR B 1 199 ? 11.353  3.797   -43.344 1.00 23.86 ? 237 THR B O   1 
ATOM   3584 C CB  . THR B 1 199 ? 10.843  2.036   -45.880 1.00 23.73 ? 237 THR B CB  1 
ATOM   3585 O OG1 . THR B 1 199 ? 10.082  1.879   -47.077 1.00 23.54 ? 237 THR B OG1 1 
ATOM   3586 C CG2 . THR B 1 199 ? 11.540  0.708   -45.563 1.00 23.64 ? 237 THR B CG2 1 
ATOM   3587 N N   . LEU B 1 200 ? 10.664  1.815   -42.522 1.00 23.60 ? 238 LEU B N   1 
ATOM   3588 C CA  . LEU B 1 200 ? 11.674  1.758   -41.482 1.00 23.52 ? 238 LEU B CA  1 
ATOM   3589 C C   . LEU B 1 200 ? 12.651  0.674   -41.865 1.00 23.33 ? 238 LEU B C   1 
ATOM   3590 O O   . LEU B 1 200 ? 12.269  -0.489  -42.055 1.00 23.67 ? 238 LEU B O   1 
ATOM   3591 C CB  . LEU B 1 200 ? 11.082  1.466   -40.099 1.00 23.72 ? 238 LEU B CB  1 
ATOM   3592 C CG  . LEU B 1 200 ? 12.124  1.237   -38.994 1.00 24.19 ? 238 LEU B CG  1 
ATOM   3593 C CD1 . LEU B 1 200 ? 12.687  2.558   -38.471 1.00 24.03 ? 238 LEU B CD1 1 
ATOM   3594 C CD2 . LEU B 1 200 ? 11.523  0.450   -37.861 1.00 24.64 ? 238 LEU B CD2 1 
ATOM   3595 N N   . GLU B 1 201 ? 13.912  1.044   -41.996 1.00 22.93 ? 239 GLU B N   1 
ATOM   3596 C CA  . GLU B 1 201 ? 14.914  0.041   -42.277 1.00 23.13 ? 239 GLU B CA  1 
ATOM   3597 C C   . GLU B 1 201 ? 15.849  -0.116  -41.102 1.00 22.81 ? 239 GLU B C   1 
ATOM   3598 O O   . GLU B 1 201 ? 16.534  0.831   -40.703 1.00 22.15 ? 239 GLU B O   1 
ATOM   3599 C CB  . GLU B 1 201 ? 15.698  0.359   -43.541 1.00 23.19 ? 239 GLU B CB  1 
ATOM   3600 C CG  . GLU B 1 201 ? 16.936  -0.515  -43.695 1.00 24.26 ? 239 GLU B CG  1 
ATOM   3601 C CD  . GLU B 1 201 ? 17.484  -0.507  -45.111 1.00 25.96 ? 239 GLU B CD  1 
ATOM   3602 O OE1 . GLU B 1 201 ? 18.581  0.049   -45.324 1.00 26.08 ? 239 GLU B OE1 1 
ATOM   3603 O OE2 . GLU B 1 201 ? 16.816  -1.062  -46.003 1.00 27.42 ? 239 GLU B OE2 1 
ATOM   3604 N N   . ALA B 1 202 ? 15.870  -1.330  -40.565 1.00 22.90 ? 240 ALA B N   1 
ATOM   3605 C CA  . ALA B 1 202 ? 16.741  -1.667  -39.459 1.00 23.49 ? 240 ALA B CA  1 
ATOM   3606 C C   . ALA B 1 202 ? 18.068  -2.179  -39.997 1.00 23.86 ? 240 ALA B C   1 
ATOM   3607 O O   . ALA B 1 202 ? 18.105  -3.002  -40.923 1.00 23.58 ? 240 ALA B O   1 
ATOM   3608 C CB  . ALA B 1 202 ? 16.085  -2.719  -38.580 1.00 23.44 ? 240 ALA B CB  1 
ATOM   3609 N N   . TRP B 1 203 ? 19.155  -1.674  -39.423 1.00 24.43 ? 241 TRP B N   1 
ATOM   3610 C CA  . TRP B 1 203 ? 20.472  -2.234  -39.667 1.00 25.28 ? 241 TRP B CA  1 
ATOM   3611 C C   . TRP B 1 203 ? 20.875  -2.914  -38.384 1.00 25.94 ? 241 TRP B C   1 
ATOM   3612 O O   . TRP B 1 203 ? 21.132  -2.250  -37.377 1.00 25.96 ? 241 TRP B O   1 
ATOM   3613 C CB  . TRP B 1 203 ? 21.485  -1.147  -40.000 1.00 25.69 ? 241 TRP B CB  1 
ATOM   3614 C CG  . TRP B 1 203 ? 21.230  -0.434  -41.281 1.00 26.11 ? 241 TRP B CG  1 
ATOM   3615 C CD1 . TRP B 1 203 ? 20.470  -0.871  -42.330 1.00 25.57 ? 241 TRP B CD1 1 
ATOM   3616 C CD2 . TRP B 1 203 ? 21.771  0.833   -41.674 1.00 27.08 ? 241 TRP B CD2 1 
ATOM   3617 N NE1 . TRP B 1 203 ? 20.481  0.061   -43.336 1.00 25.59 ? 241 TRP B NE1 1 
ATOM   3618 C CE2 . TRP B 1 203 ? 21.278  1.113   -42.964 1.00 26.25 ? 241 TRP B CE2 1 
ATOM   3619 C CE3 . TRP B 1 203 ? 22.612  1.771   -41.048 1.00 28.63 ? 241 TRP B CE3 1 
ATOM   3620 C CZ2 . TRP B 1 203 ? 21.604  2.291   -43.655 1.00 26.99 ? 241 TRP B CZ2 1 
ATOM   3621 C CZ3 . TRP B 1 203 ? 22.936  2.946   -41.736 1.00 27.04 ? 241 TRP B CZ3 1 
ATOM   3622 C CH2 . TRP B 1 203 ? 22.428  3.192   -43.026 1.00 26.65 ? 241 TRP B CH2 1 
ATOM   3623 N N   . VAL B 1 204 ? 20.884  -4.239  -38.414 1.00 26.70 ? 242 VAL B N   1 
ATOM   3624 C CA  . VAL B 1 204 ? 21.255  -5.023  -37.250 1.00 27.59 ? 242 VAL B CA  1 
ATOM   3625 C C   . VAL B 1 204 ? 22.758  -5.253  -37.311 1.00 28.72 ? 242 VAL B C   1 
ATOM   3626 O O   . VAL B 1 204 ? 23.250  -6.009  -38.154 1.00 28.32 ? 242 VAL B O   1 
ATOM   3627 C CB  . VAL B 1 204 ? 20.490  -6.362  -37.200 1.00 27.51 ? 242 VAL B CB  1 
ATOM   3628 C CG1 . VAL B 1 204 ? 20.940  -7.183  -36.003 1.00 27.20 ? 242 VAL B CG1 1 
ATOM   3629 C CG2 . VAL B 1 204 ? 18.983  -6.111  -37.145 1.00 26.93 ? 242 VAL B CG2 1 
ATOM   3630 N N   . ILE B 1 205 ? 23.469  -4.575  -36.419 1.00 30.30 ? 243 ILE B N   1 
ATOM   3631 C CA  . ILE B 1 205 ? 24.922  -4.611  -36.383 1.00 32.09 ? 243 ILE B CA  1 
ATOM   3632 C C   . ILE B 1 205 ? 25.403  -5.876  -35.682 1.00 33.54 ? 243 ILE B C   1 
ATOM   3633 O O   . ILE B 1 205 ? 25.050  -6.133  -34.533 1.00 33.67 ? 243 ILE B O   1 
ATOM   3634 C CB  . ILE B 1 205 ? 25.515  -3.374  -35.649 1.00 31.84 ? 243 ILE B CB  1 
ATOM   3635 C CG1 . ILE B 1 205 ? 24.880  -2.058  -36.138 1.00 31.28 ? 243 ILE B CG1 1 
ATOM   3636 C CG2 . ILE B 1 205 ? 27.057  -3.372  -35.738 1.00 31.92 ? 243 ILE B CG2 1 
ATOM   3637 C CD1 . ILE B 1 205 ? 24.975  -1.797  -37.620 1.00 30.85 ? 243 ILE B CD1 1 
ATOM   3638 N N   . HIS B 1 206 ? 26.213  -6.659  -36.378 1.00 35.33 ? 244 HIS B N   1 
ATOM   3639 C CA  . HIS B 1 206 ? 26.766  -7.871  -35.790 1.00 37.33 ? 244 HIS B CA  1 
ATOM   3640 C C   . HIS B 1 206 ? 27.982  -7.499  -34.961 1.00 39.15 ? 244 HIS B C   1 
ATOM   3641 O O   . HIS B 1 206 ? 28.900  -6.846  -35.461 1.00 39.70 ? 244 HIS B O   1 
ATOM   3642 C CB  . HIS B 1 206 ? 27.093  -8.887  -36.876 1.00 36.84 ? 244 HIS B CB  1 
ATOM   3643 C CG  . HIS B 1 206 ? 25.878  -9.483  -37.520 1.00 35.97 ? 244 HIS B CG  1 
ATOM   3644 N ND1 . HIS B 1 206 ? 25.732  -10.837 -37.723 1.00 35.95 ? 244 HIS B ND1 1 
ATOM   3645 C CD2 . HIS B 1 206 ? 24.745  -8.911  -37.991 1.00 35.00 ? 244 HIS B CD2 1 
ATOM   3646 C CE1 . HIS B 1 206 ? 24.568  -11.072 -38.302 1.00 34.77 ? 244 HIS B CE1 1 
ATOM   3647 N NE2 . HIS B 1 206 ? 23.950  -9.919  -38.474 1.00 34.08 ? 244 HIS B NE2 1 
ATOM   3648 N N   . GLY B 1 207 ? 27.966  -7.901  -33.690 1.00 40.94 ? 245 GLY B N   1 
ATOM   3649 C CA  . GLY B 1 207 ? 28.960  -7.461  -32.708 1.00 43.02 ? 245 GLY B CA  1 
ATOM   3650 C C   . GLY B 1 207 ? 29.805  -8.574  -32.114 1.00 44.41 ? 245 GLY B C   1 
ATOM   3651 O O   . GLY B 1 207 ? 29.283  -9.514  -31.502 1.00 44.84 ? 245 GLY B O   1 
ATOM   3652 N N   . GLY B 1 208 ? 31.118  -8.457  -32.293 1.00 45.31 ? 246 GLY B N   1 
ATOM   3653 C CA  . GLY B 1 208 ? 32.074  -9.428  -31.770 1.00 46.39 ? 246 GLY B CA  1 
ATOM   3654 C C   . GLY B 1 208 ? 33.250  -9.553  -32.714 1.00 47.11 ? 246 GLY B C   1 
ATOM   3655 O O   . GLY B 1 208 ? 33.399  -8.745  -33.636 1.00 47.44 ? 246 GLY B O   1 
ATOM   3656 N N   . ARG B 1 209 ? 34.086  -10.563 -32.494 1.00 47.74 ? 247 ARG B N   1 
ATOM   3657 C CA  . ARG B 1 209 ? 35.192  -10.852 -33.408 1.00 48.20 ? 247 ARG B CA  1 
ATOM   3658 C C   . ARG B 1 209 ? 34.685  -11.596 -34.650 1.00 48.35 ? 247 ARG B C   1 
ATOM   3659 O O   . ARG B 1 209 ? 35.354  -12.504 -35.159 1.00 48.62 ? 247 ARG B O   1 
ATOM   3660 C CB  . ARG B 1 209 ? 36.299  -11.647 -32.701 1.00 48.41 ? 247 ARG B CB  1 
ATOM   3661 C CG  . ARG B 1 209 ? 37.112  -10.848 -31.689 1.00 48.89 ? 247 ARG B CG  1 
ATOM   3662 C CD  . ARG B 1 209 ? 38.470  -11.501 -31.441 1.00 50.30 ? 247 ARG B CD  1 
ATOM   3663 N NE  . ARG B 1 209 ? 39.191  -10.863 -30.340 1.00 51.17 ? 247 ARG B NE  1 
ATOM   3664 C CZ  . ARG B 1 209 ? 40.503  -10.965 -30.128 1.00 51.65 ? 247 ARG B CZ  1 
ATOM   3665 N NH1 . ARG B 1 209 ? 41.272  -11.676 -30.947 1.00 51.06 ? 247 ARG B NH1 1 
ATOM   3666 N NH2 . ARG B 1 209 ? 41.050  -10.340 -29.091 1.00 51.95 ? 247 ARG B NH2 1 
ATOM   3667 N N   . GLU B 1 210 ? 33.506  -11.183 -35.128 1.00 48.45 ? 248 GLU B N   1 
ATOM   3668 C CA  . GLU B 1 210 ? 32.797  -11.788 -36.275 1.00 48.48 ? 248 GLU B CA  1 
ATOM   3669 C C   . GLU B 1 210 ? 32.070  -13.087 -35.916 1.00 47.95 ? 248 GLU B C   1 
ATOM   3670 O O   . GLU B 1 210 ? 32.694  -14.102 -35.595 1.00 47.93 ? 248 GLU B O   1 
ATOM   3671 C CB  . GLU B 1 210 ? 33.705  -11.943 -37.508 1.00 48.77 ? 248 GLU B CB  1 
ATOM   3672 C CG  . GLU B 1 210 ? 34.147  -10.604 -38.102 1.00 50.23 ? 248 GLU B CG  1 
ATOM   3673 C CD  . GLU B 1 210 ? 32.970  -9.705  -38.457 1.00 52.06 ? 248 GLU B CD  1 
ATOM   3674 O OE1 . GLU B 1 210 ? 32.404  -9.879  -39.559 1.00 53.28 ? 248 GLU B OE1 1 
ATOM   3675 O OE2 . GLU B 1 210 ? 32.615  -8.825  -37.637 1.00 52.71 ? 248 GLU B OE2 1 
ATOM   3676 N N   . ASP B 1 211 ? 30.741  -13.038 -36.006 1.00 47.31 ? 249 ASP B N   1 
ATOM   3677 C CA  . ASP B 1 211 ? 29.886  -14.032 -35.365 1.00 46.40 ? 249 ASP B CA  1 
ATOM   3678 C C   . ASP B 1 211 ? 28.916  -14.824 -36.263 1.00 45.51 ? 249 ASP B C   1 
ATOM   3679 O O   . ASP B 1 211 ? 29.197  -15.975 -36.605 1.00 45.53 ? 249 ASP B O   1 
ATOM   3680 C CB  . ASP B 1 211 ? 29.099  -13.370 -34.225 1.00 46.66 ? 249 ASP B CB  1 
ATOM   3681 C CG  . ASP B 1 211 ? 29.883  -12.273 -33.527 1.00 47.08 ? 249 ASP B CG  1 
ATOM   3682 O OD1 . ASP B 1 211 ? 30.873  -12.577 -32.825 1.00 47.76 ? 249 ASP B OD1 1 
ATOM   3683 O OD2 . ASP B 1 211 ? 29.496  -11.096 -33.680 1.00 48.59 ? 249 ASP B OD2 1 
ATOM   3684 N N   . SER B 1 212 ? 27.805  -14.196 -36.658 1.00 44.31 ? 250 SER B N   1 
ATOM   3685 C CA  . SER B 1 212 ? 26.518  -14.912 -36.790 1.00 43.12 ? 250 SER B CA  1 
ATOM   3686 C C   . SER B 1 212 ? 25.838  -15.164 -38.157 1.00 42.23 ? 250 SER B C   1 
ATOM   3687 O O   . SER B 1 212 ? 26.483  -15.326 -39.202 1.00 42.13 ? 250 SER B O   1 
ATOM   3688 C CB  . SER B 1 212 ? 25.487  -14.246 -35.871 1.00 43.02 ? 250 SER B CB  1 
ATOM   3689 O OG  . SER B 1 212 ? 26.048  -13.888 -34.626 1.00 43.11 ? 250 SER B OG  1 
ATOM   3690 N N   . ARG B 1 213 ? 24.503  -15.211 -38.081 1.00 40.89 ? 251 ARG B N   1 
ATOM   3691 C CA  . ARG B 1 213 ? 23.588  -15.560 -39.168 1.00 39.31 ? 251 ARG B CA  1 
ATOM   3692 C C   . ARG B 1 213 ? 22.612  -14.401 -39.432 1.00 37.99 ? 251 ARG B C   1 
ATOM   3693 O O   . ARG B 1 213 ? 22.947  -13.249 -39.186 1.00 37.69 ? 251 ARG B O   1 
ATOM   3694 C CB  . ARG B 1 213 ? 22.819  -16.833 -38.793 1.00 39.69 ? 251 ARG B CB  1 
ATOM   3695 C CG  . ARG B 1 213 ? 21.947  -16.690 -37.538 1.00 39.97 ? 251 ARG B CG  1 
ATOM   3696 C CD  . ARG B 1 213 ? 22.170  -17.838 -36.564 1.00 40.38 ? 251 ARG B CD  1 
ATOM   3697 N NE  . ARG B 1 213 ? 21.642  -17.555 -35.225 1.00 41.28 ? 251 ARG B NE  1 
ATOM   3698 C CZ  . ARG B 1 213 ? 22.161  -16.674 -34.370 1.00 41.73 ? 251 ARG B CZ  1 
ATOM   3699 N NH1 . ARG B 1 213 ? 23.219  -15.955 -34.705 1.00 42.68 ? 251 ARG B NH1 1 
ATOM   3700 N NH2 . ARG B 1 213 ? 21.611  -16.496 -33.177 1.00 42.48 ? 251 ARG B NH2 1 
ATOM   3701 N N   . ASP B 1 214 ? 21.411  -14.716 -39.917 1.00 36.42 ? 252 ASP B N   1 
ATOM   3702 C CA  . ASP B 1 214 ? 20.428  -13.706 -40.313 1.00 35.05 ? 252 ASP B CA  1 
ATOM   3703 C C   . ASP B 1 214 ? 19.582  -13.193 -39.138 1.00 34.30 ? 252 ASP B C   1 
ATOM   3704 O O   . ASP B 1 214 ? 18.439  -13.616 -38.937 1.00 34.00 ? 252 ASP B O   1 
ATOM   3705 C CB  . ASP B 1 214 ? 19.538  -14.240 -41.444 1.00 34.73 ? 252 ASP B CB  1 
ATOM   3706 C CG  . ASP B 1 214 ? 18.582  -13.186 -41.996 1.00 34.10 ? 252 ASP B CG  1 
ATOM   3707 O OD1 . ASP B 1 214 ? 18.588  -12.029 -41.516 1.00 32.13 ? 252 ASP B OD1 1 
ATOM   3708 O OD2 . ASP B 1 214 ? 17.812  -13.524 -42.917 1.00 32.18 ? 252 ASP B OD2 1 
ATOM   3709 N N   . LEU B 1 215 ? 20.153  -12.249 -38.395 1.00 33.30 ? 253 LEU B N   1 
ATOM   3710 C CA  . LEU B 1 215 ? 19.520  -11.676 -37.204 1.00 32.59 ? 253 LEU B CA  1 
ATOM   3711 C C   . LEU B 1 215 ? 18.241  -10.894 -37.484 1.00 32.41 ? 253 LEU B C   1 
ATOM   3712 O O   . LEU B 1 215 ? 17.579  -10.422 -36.549 1.00 31.90 ? 253 LEU B O   1 
ATOM   3713 C CB  . LEU B 1 215 ? 20.516  -10.805 -36.444 1.00 32.11 ? 253 LEU B CB  1 
ATOM   3714 C CG  . LEU B 1 215 ? 21.779  -11.522 -35.952 1.00 31.87 ? 253 LEU B CG  1 
ATOM   3715 C CD1 . LEU B 1 215 ? 22.674  -10.562 -35.191 1.00 30.76 ? 253 LEU B CD1 1 
ATOM   3716 C CD2 . LEU B 1 215 ? 21.453  -12.758 -35.101 1.00 30.76 ? 253 LEU B CD2 1 
ATOM   3717 N N   . CYS B 1 216 ? 17.897  -10.771 -38.766 1.00 32.22 ? 254 CYS B N   1 
ATOM   3718 C CA  . CYS B 1 216 ? 16.644  -10.150 -39.189 1.00 32.50 ? 254 CYS B CA  1 
ATOM   3719 C C   . CYS B 1 216 ? 15.425  -11.059 -38.981 1.00 32.85 ? 254 CYS B C   1 
ATOM   3720 O O   . CYS B 1 216 ? 14.285  -10.617 -39.149 1.00 32.73 ? 254 CYS B O   1 
ATOM   3721 C CB  . CYS B 1 216 ? 16.729  -9.672  -40.643 1.00 32.19 ? 254 CYS B CB  1 
ATOM   3722 S SG  . CYS B 1 216 ? 17.760  -8.207  -40.874 1.00 31.67 ? 254 CYS B SG  1 
ATOM   3723 N N   . GLN B 1 217 ? 15.658  -12.324 -38.625 1.00 33.52 ? 255 GLN B N   1 
ATOM   3724 C CA  . GLN B 1 217 ? 14.556  -13.167 -38.138 1.00 34.19 ? 255 GLN B CA  1 
ATOM   3725 C C   . GLN B 1 217 ? 14.697  -13.538 -36.671 1.00 34.08 ? 255 GLN B C   1 
ATOM   3726 O O   . GLN B 1 217 ? 14.138  -14.540 -36.223 1.00 34.16 ? 255 GLN B O   1 
ATOM   3727 C CB  . GLN B 1 217 ? 14.316  -14.419 -38.987 1.00 34.38 ? 255 GLN B CB  1 
ATOM   3728 C CG  . GLN B 1 217 ? 15.531  -15.271 -39.249 1.00 35.62 ? 255 GLN B CG  1 
ATOM   3729 C CD  . GLN B 1 217 ? 16.013  -15.118 -40.664 1.00 36.83 ? 255 GLN B CD  1 
ATOM   3730 O OE1 . GLN B 1 217 ? 15.723  -14.117 -41.321 1.00 37.87 ? 255 GLN B OE1 1 
ATOM   3731 N NE2 . GLN B 1 217 ? 16.735  -16.122 -41.158 1.00 38.50 ? 255 GLN B NE2 1 
ATOM   3732 N N   . ASP B 1 218 ? 15.452  -12.728 -35.935 1.00 34.12 ? 256 ASP B N   1 
ATOM   3733 C CA  . ASP B 1 218 ? 15.445  -12.792 -34.482 1.00 34.10 ? 256 ASP B CA  1 
ATOM   3734 C C   . ASP B 1 218 ? 14.031  -12.416 -34.041 1.00 33.79 ? 256 ASP B C   1 
ATOM   3735 O O   . ASP B 1 218 ? 13.452  -11.462 -34.585 1.00 34.46 ? 256 ASP B O   1 
ATOM   3736 C CB  . ASP B 1 218 ? 16.474  -11.825 -33.895 1.00 34.26 ? 256 ASP B CB  1 
ATOM   3737 C CG  . ASP B 1 218 ? 16.571  -11.919 -32.383 1.00 35.13 ? 256 ASP B CG  1 
ATOM   3738 O OD1 . ASP B 1 218 ? 17.177  -12.887 -31.879 1.00 35.78 ? 256 ASP B OD1 1 
ATOM   3739 O OD2 . ASP B 1 218 ? 16.051  -11.016 -31.696 1.00 36.59 ? 256 ASP B OD2 1 
ATOM   3740 N N   . PRO B 1 219 ? 13.447  -13.189 -33.099 1.00 33.19 ? 257 PRO B N   1 
ATOM   3741 C CA  . PRO B 1 219 ? 12.089  -12.930 -32.611 1.00 32.56 ? 257 PRO B CA  1 
ATOM   3742 C C   . PRO B 1 219 ? 11.769  -11.457 -32.318 1.00 31.83 ? 257 PRO B C   1 
ATOM   3743 O O   . PRO B 1 219 ? 10.676  -11.002 -32.668 1.00 31.90 ? 257 PRO B O   1 
ATOM   3744 C CB  . PRO B 1 219 ? 12.013  -13.772 -31.334 1.00 32.62 ? 257 PRO B CB  1 
ATOM   3745 C CG  . PRO B 1 219 ? 12.895  -14.926 -31.624 1.00 32.77 ? 257 PRO B CG  1 
ATOM   3746 C CD  . PRO B 1 219 ? 14.028  -14.390 -32.464 1.00 32.99 ? 257 PRO B CD  1 
ATOM   3747 N N   . THR B 1 220 ? 12.701  -10.718 -31.710 1.00 30.94 ? 258 THR B N   1 
ATOM   3748 C CA  . THR B 1 220 ? 12.462  -9.304  -31.405 1.00 30.04 ? 258 THR B CA  1 
ATOM   3749 C C   . THR B 1 220 ? 12.376  -8.437  -32.658 1.00 29.72 ? 258 THR B C   1 
ATOM   3750 O O   . THR B 1 220 ? 11.736  -7.385  -32.636 1.00 29.91 ? 258 THR B O   1 
ATOM   3751 C CB  . THR B 1 220 ? 13.517  -8.680  -30.452 1.00 30.10 ? 258 THR B CB  1 
ATOM   3752 O OG1 . THR B 1 220 ? 14.789  -8.585  -31.109 1.00 29.53 ? 258 THR B OG1 1 
ATOM   3753 C CG2 . THR B 1 220 ? 13.639  -9.474  -29.155 1.00 29.94 ? 258 THR B CG2 1 
ATOM   3754 N N   . ILE B 1 221 ? 13.036  -8.862  -33.735 1.00 29.00 ? 259 ILE B N   1 
ATOM   3755 C CA  . ILE B 1 221 ? 12.983  -8.115  -34.990 1.00 28.46 ? 259 ILE B CA  1 
ATOM   3756 C C   . ILE B 1 221 ? 11.645  -8.344  -35.690 1.00 28.45 ? 259 ILE B C   1 
ATOM   3757 O O   . ILE B 1 221 ? 11.057  -7.407  -36.233 1.00 28.18 ? 259 ILE B O   1 
ATOM   3758 C CB  . ILE B 1 221 ? 14.175  -8.432  -35.934 1.00 28.44 ? 259 ILE B CB  1 
ATOM   3759 C CG1 . ILE B 1 221 ? 15.501  -7.983  -35.313 1.00 27.70 ? 259 ILE B CG1 1 
ATOM   3760 C CG2 . ILE B 1 221 ? 13.980  -7.767  -37.316 1.00 28.81 ? 259 ILE B CG2 1 
ATOM   3761 C CD1 . ILE B 1 221 ? 15.579  -6.501  -35.009 1.00 26.82 ? 259 ILE B CD1 1 
ATOM   3762 N N   . LYS B 1 222 ? 11.162  -9.584  -35.656 1.00 28.14 ? 260 LYS B N   1 
ATOM   3763 C CA  . LYS B 1 222 ? 9.829   -9.903  -36.169 1.00 28.47 ? 260 LYS B CA  1 
ATOM   3764 C C   . LYS B 1 222 ? 8.758   -9.164  -35.368 1.00 28.18 ? 260 LYS B C   1 
ATOM   3765 O O   . LYS B 1 222 ? 7.697   -8.831  -35.892 1.00 27.98 ? 260 LYS B O   1 
ATOM   3766 C CB  . LYS B 1 222 ? 9.582   -11.415 -36.147 1.00 28.85 ? 260 LYS B CB  1 
ATOM   3767 C CG  . LYS B 1 222 ? 10.443  -12.209 -37.135 1.00 29.86 ? 260 LYS B CG  1 
ATOM   3768 C CD  . LYS B 1 222 ? 9.883   -12.152 -38.566 1.00 31.90 ? 260 LYS B CD  1 
ATOM   3769 C CE  . LYS B 1 222 ? 10.707  -13.010 -39.525 1.00 32.66 ? 260 LYS B CE  1 
ATOM   3770 N NZ  . LYS B 1 222 ? 11.838  -12.236 -40.125 1.00 35.69 ? 260 LYS B NZ  1 
ATOM   3771 N N   . GLU B 1 223 ? 9.050   -8.904  -34.095 1.00 27.93 ? 261 GLU B N   1 
ATOM   3772 C CA  . GLU B 1 223 ? 8.176   -8.101  -33.253 1.00 28.18 ? 261 GLU B CA  1 
ATOM   3773 C C   . GLU B 1 223 ? 8.187   -6.641  -33.715 1.00 28.29 ? 261 GLU B C   1 
ATOM   3774 O O   . GLU B 1 223 ? 7.129   -6.018  -33.844 1.00 28.44 ? 261 GLU B O   1 
ATOM   3775 C CB  . GLU B 1 223 ? 8.635   -8.191  -31.802 1.00 28.37 ? 261 GLU B CB  1 
ATOM   3776 C CG  . GLU B 1 223 ? 7.658   -7.633  -30.787 1.00 29.56 ? 261 GLU B CG  1 
ATOM   3777 C CD  . GLU B 1 223 ? 8.271   -7.561  -29.401 1.00 33.04 ? 261 GLU B CD  1 
ATOM   3778 O OE1 . GLU B 1 223 ? 9.121   -8.426  -29.088 1.00 34.34 ? 261 GLU B OE1 1 
ATOM   3779 O OE2 . GLU B 1 223 ? 7.913   -6.640  -28.630 1.00 34.58 ? 261 GLU B OE2 1 
ATOM   3780 N N   . LEU B 1 224 ? 9.382   -6.102  -33.953 1.00 27.64 ? 262 LEU B N   1 
ATOM   3781 C CA  . LEU B 1 224 ? 9.529   -4.762  -34.508 1.00 27.51 ? 262 LEU B CA  1 
ATOM   3782 C C   . LEU B 1 224 ? 8.806   -4.667  -35.848 1.00 27.77 ? 262 LEU B C   1 
ATOM   3783 O O   . LEU B 1 224 ? 8.113   -3.682  -36.118 1.00 27.47 ? 262 LEU B O   1 
ATOM   3784 C CB  . LEU B 1 224 ? 11.011  -4.406  -34.678 1.00 27.17 ? 262 LEU B CB  1 
ATOM   3785 C CG  . LEU B 1 224 ? 11.374  -3.113  -35.436 1.00 26.31 ? 262 LEU B CG  1 
ATOM   3786 C CD1 . LEU B 1 224 ? 10.726  -1.872  -34.829 1.00 25.53 ? 262 LEU B CD1 1 
ATOM   3787 C CD2 . LEU B 1 224 ? 12.885  -2.938  -35.528 1.00 24.56 ? 262 LEU B CD2 1 
ATOM   3788 N N   . GLU B 1 225 ? 8.970   -5.710  -36.658 1.00 28.07 ? 263 GLU B N   1 
ATOM   3789 C CA  . GLU B 1 225 ? 8.350   -5.831  -37.971 1.00 29.15 ? 263 GLU B CA  1 
ATOM   3790 C C   . GLU B 1 225 ? 6.829   -5.741  -37.868 1.00 29.17 ? 263 GLU B C   1 
ATOM   3791 O O   . GLU B 1 225 ? 6.188   -5.010  -38.622 1.00 29.12 ? 263 GLU B O   1 
ATOM   3792 C CB  . GLU B 1 225 ? 8.777   -7.160  -38.608 1.00 28.78 ? 263 GLU B CB  1 
ATOM   3793 C CG  . GLU B 1 225 ? 8.075   -7.540  -39.886 1.00 29.50 ? 263 GLU B CG  1 
ATOM   3794 C CD  . GLU B 1 225 ? 8.486   -8.935  -40.374 1.00 30.46 ? 263 GLU B CD  1 
ATOM   3795 O OE1 . GLU B 1 225 ? 7.592   -9.771  -40.606 1.00 34.70 ? 263 GLU B OE1 1 
ATOM   3796 O OE2 . GLU B 1 225 ? 9.702   -9.203  -40.518 1.00 31.45 ? 263 GLU B OE2 1 
ATOM   3797 N N   . SER B 1 226 ? 6.262   -6.487  -36.924 1.00 29.51 ? 264 SER B N   1 
ATOM   3798 C CA  . SER B 1 226 ? 4.830   -6.444  -36.657 1.00 29.55 ? 264 SER B CA  1 
ATOM   3799 C C   . SER B 1 226 ? 4.400   -5.068  -36.163 1.00 29.35 ? 264 SER B C   1 
ATOM   3800 O O   . SER B 1 226 ? 3.392   -4.539  -36.618 1.00 29.42 ? 264 SER B O   1 
ATOM   3801 C CB  . SER B 1 226 ? 4.456   -7.514  -35.640 1.00 29.82 ? 264 SER B CB  1 
ATOM   3802 O OG  . SER B 1 226 ? 4.793   -8.788  -36.158 1.00 29.98 ? 264 SER B OG  1 
ATOM   3803 N N   . ILE B 1 227 ? 5.167   -4.483  -35.250 1.00 29.01 ? 265 ILE B N   1 
ATOM   3804 C CA  . ILE B 1 227 ? 4.855   -3.130  -34.779 1.00 29.19 ? 265 ILE B CA  1 
ATOM   3805 C C   . ILE B 1 227 ? 4.763   -2.166  -35.968 1.00 29.19 ? 265 ILE B C   1 
ATOM   3806 O O   . ILE B 1 227 ? 3.720   -1.556  -36.194 1.00 29.37 ? 265 ILE B O   1 
ATOM   3807 C CB  . ILE B 1 227 ? 5.837   -2.604  -33.698 1.00 29.15 ? 265 ILE B CB  1 
ATOM   3808 C CG1 . ILE B 1 227 ? 5.746   -3.447  -32.423 1.00 29.19 ? 265 ILE B CG1 1 
ATOM   3809 C CG2 . ILE B 1 227 ? 5.537   -1.124  -33.361 1.00 29.35 ? 265 ILE B CG2 1 
ATOM   3810 C CD1 . ILE B 1 227 ? 6.761   -3.059  -31.339 1.00 29.16 ? 265 ILE B CD1 1 
ATOM   3811 N N   . ILE B 1 228 ? 5.825   -2.053  -36.757 1.00 28.95 ? 266 ILE B N   1 
ATOM   3812 C CA  . ILE B 1 228 ? 5.780   -1.068  -37.826 1.00 29.06 ? 266 ILE B CA  1 
ATOM   3813 C C   . ILE B 1 228 ? 4.870   -1.462  -39.008 1.00 28.58 ? 266 ILE B C   1 
ATOM   3814 O O   . ILE B 1 228 ? 4.342   -0.584  -39.686 1.00 28.36 ? 266 ILE B O   1 
ATOM   3815 C CB  . ILE B 1 228 ? 7.171   -0.570  -38.290 1.00 29.41 ? 266 ILE B CB  1 
ATOM   3816 C CG1 . ILE B 1 228 ? 7.701   -1.417  -39.420 1.00 29.82 ? 266 ILE B CG1 1 
ATOM   3817 C CG2 . ILE B 1 228 ? 8.161   -0.462  -37.126 1.00 29.95 ? 266 ILE B CG2 1 
ATOM   3818 C CD1 . ILE B 1 228 ? 8.353   -0.591  -40.432 1.00 31.43 ? 266 ILE B CD1 1 
ATOM   3819 N N   . SER B 1 229 ? 4.669   -2.763  -39.234 1.00 28.44 ? 267 SER B N   1 
ATOM   3820 C CA  . SER B 1 229 ? 3.705   -3.215  -40.243 1.00 28.67 ? 267 SER B CA  1 
ATOM   3821 C C   . SER B 1 229 ? 2.320   -2.734  -39.851 1.00 29.15 ? 267 SER B C   1 
ATOM   3822 O O   . SER B 1 229 ? 1.549   -2.301  -40.709 1.00 29.19 ? 267 SER B O   1 
ATOM   3823 C CB  . SER B 1 229 ? 3.684   -4.748  -40.401 1.00 28.62 ? 267 SER B CB  1 
ATOM   3824 O OG  . SER B 1 229 ? 4.852   -5.245  -41.039 1.00 27.63 ? 267 SER B OG  1 
ATOM   3825 N N   . LYS B 1 230 ? 2.020   -2.820  -38.552 1.00 29.54 ? 268 LYS B N   1 
ATOM   3826 C CA  . LYS B 1 230 ? 0.735   -2.393  -37.986 1.00 30.49 ? 268 LYS B CA  1 
ATOM   3827 C C   . LYS B 1 230 ? 0.491   -0.901  -38.126 1.00 30.60 ? 268 LYS B C   1 
ATOM   3828 O O   . LYS B 1 230 ? -0.655  -0.460  -38.200 1.00 30.88 ? 268 LYS B O   1 
ATOM   3829 C CB  . LYS B 1 230 ? 0.647   -2.759  -36.504 1.00 30.61 ? 268 LYS B CB  1 
ATOM   3830 C CG  . LYS B 1 230 ? 0.015   -4.114  -36.231 1.00 31.84 ? 268 LYS B CG  1 
ATOM   3831 C CD  . LYS B 1 230 ? -0.025  -4.377  -34.736 1.00 33.46 ? 268 LYS B CD  1 
ATOM   3832 C CE  . LYS B 1 230 ? -0.810  -5.631  -34.395 1.00 35.12 ? 268 LYS B CE  1 
ATOM   3833 N NZ  . LYS B 1 230 ? -0.061  -6.877  -34.708 1.00 37.26 ? 268 LYS B NZ  1 
ATOM   3834 N N   . ARG B 1 231 ? 1.576   -0.133  -38.138 1.00 30.61 ? 269 ARG B N   1 
ATOM   3835 C CA  . ARG B 1 231 ? 1.512   1.314   -38.310 1.00 30.55 ? 269 ARG B CA  1 
ATOM   3836 C C   . ARG B 1 231 ? 1.466   1.677   -39.802 1.00 29.93 ? 269 ARG B C   1 
ATOM   3837 O O   . ARG B 1 231 ? 1.625   2.837   -40.179 1.00 30.00 ? 269 ARG B O   1 
ATOM   3838 C CB  . ARG B 1 231 ? 2.697   1.968   -37.591 1.00 30.54 ? 269 ARG B CB  1 
ATOM   3839 C CG  . ARG B 1 231 ? 2.854   1.485   -36.138 1.00 31.50 ? 269 ARG B CG  1 
ATOM   3840 C CD  . ARG B 1 231 ? 3.706   2.382   -35.262 1.00 32.07 ? 269 ARG B CD  1 
ATOM   3841 N NE  . ARG B 1 231 ? 3.019   3.641   -34.960 1.00 35.45 ? 269 ARG B NE  1 
ATOM   3842 C CZ  . ARG B 1 231 ? 2.997   4.661   -35.803 1.00 35.98 ? 269 ARG B CZ  1 
ATOM   3843 N NH1 . ARG B 1 231 ? 3.635   4.538   -36.956 1.00 36.99 ? 269 ARG B NH1 1 
ATOM   3844 N NH2 . ARG B 1 231 ? 2.351   5.784   -35.511 1.00 35.24 ? 269 ARG B NH2 1 
ATOM   3845 N N   . ASN B 1 232 ? 1.213   0.666   -40.635 1.00 29.03 ? 270 ASN B N   1 
ATOM   3846 C CA  . ASN B 1 232 ? 1.211   0.783   -42.095 1.00 28.44 ? 270 ASN B CA  1 
ATOM   3847 C C   . ASN B 1 232 ? 2.506   1.386   -42.631 1.00 27.48 ? 270 ASN B C   1 
ATOM   3848 O O   . ASN B 1 232 ? 2.490   2.254   -43.506 1.00 27.56 ? 270 ASN B O   1 
ATOM   3849 C CB  . ASN B 1 232 ? -0.021  1.553   -42.598 1.00 28.62 ? 270 ASN B CB  1 
ATOM   3850 C CG  . ASN B 1 232 ? -0.251  1.385   -44.087 1.00 30.79 ? 270 ASN B CG  1 
ATOM   3851 O OD1 . ASN B 1 232 ? -0.585  2.347   -44.788 1.00 32.89 ? 270 ASN B OD1 1 
ATOM   3852 N ND2 . ASN B 1 232 ? -0.078  0.160   -44.585 1.00 32.34 ? 270 ASN B ND2 1 
ATOM   3853 N N   . ILE B 1 233 ? 3.627   0.934   -42.076 1.00 26.40 ? 271 ILE B N   1 
ATOM   3854 C CA  . ILE B 1 233 ? 4.945   1.343   -42.545 1.00 25.33 ? 271 ILE B CA  1 
ATOM   3855 C C   . ILE B 1 233 ? 5.685   0.101   -43.020 1.00 25.31 ? 271 ILE B C   1 
ATOM   3856 O O   . ILE B 1 233 ? 5.562   -0.971  -42.430 1.00 25.06 ? 271 ILE B O   1 
ATOM   3857 C CB  . ILE B 1 233 ? 5.748   2.092   -41.443 1.00 25.00 ? 271 ILE B CB  1 
ATOM   3858 C CG1 . ILE B 1 233 ? 5.038   3.395   -41.066 1.00 24.50 ? 271 ILE B CG1 1 
ATOM   3859 C CG2 . ILE B 1 233 ? 7.162   2.436   -41.916 1.00 24.94 ? 271 ILE B CG2 1 
ATOM   3860 C CD1 . ILE B 1 233 ? 5.515   4.033   -39.770 1.00 25.21 ? 271 ILE B CD1 1 
ATOM   3861 N N   . GLN B 1 234 ? 6.447   0.263   -44.091 1.00 24.91 ? 272 GLN B N   1 
ATOM   3862 C CA  . GLN B 1 234 ? 7.199   -0.824  -44.696 1.00 25.44 ? 272 GLN B CA  1 
ATOM   3863 C C   . GLN B 1 234 ? 8.399   -1.183  -43.814 1.00 25.28 ? 272 GLN B C   1 
ATOM   3864 O O   . GLN B 1 234 ? 9.179   -0.318  -43.439 1.00 24.69 ? 272 GLN B O   1 
ATOM   3865 C CB  . GLN B 1 234 ? 7.666   -0.376  -46.080 1.00 25.31 ? 272 GLN B CB  1 
ATOM   3866 C CG  . GLN B 1 234 ? 7.797   -1.454  -47.113 1.00 25.68 ? 272 GLN B CG  1 
ATOM   3867 C CD  . GLN B 1 234 ? 8.073   -0.889  -48.504 1.00 26.51 ? 272 GLN B CD  1 
ATOM   3868 O OE1 . GLN B 1 234 ? 9.002   -0.094  -48.699 1.00 27.73 ? 272 GLN B OE1 1 
ATOM   3869 N NE2 . GLN B 1 234 ? 7.264   -1.298  -49.478 1.00 26.25 ? 272 GLN B NE2 1 
ATOM   3870 N N   . PHE B 1 235 ? 8.549   -2.458  -43.471 1.00 25.66 ? 273 PHE B N   1 
ATOM   3871 C CA  . PHE B 1 235 ? 9.736   -2.862  -42.715 1.00 25.70 ? 273 PHE B CA  1 
ATOM   3872 C C   . PHE B 1 235 ? 10.798  -3.500  -43.600 1.00 26.00 ? 273 PHE B C   1 
ATOM   3873 O O   . PHE B 1 235 ? 10.531  -4.438  -44.361 1.00 25.18 ? 273 PHE B O   1 
ATOM   3874 C CB  . PHE B 1 235 ? 9.401   -3.776  -41.535 1.00 25.62 ? 273 PHE B CB  1 
ATOM   3875 C CG  . PHE B 1 235 ? 10.567  -4.003  -40.606 1.00 26.27 ? 273 PHE B CG  1 
ATOM   3876 C CD1 . PHE B 1 235 ? 11.073  -2.957  -39.836 1.00 26.01 ? 273 PHE B CD1 1 
ATOM   3877 C CD2 . PHE B 1 235 ? 11.169  -5.255  -40.514 1.00 26.75 ? 273 PHE B CD2 1 
ATOM   3878 C CE1 . PHE B 1 235 ? 12.155  -3.150  -38.995 1.00 25.81 ? 273 PHE B CE1 1 
ATOM   3879 C CE2 . PHE B 1 235 ? 12.254  -5.459  -39.660 1.00 26.04 ? 273 PHE B CE2 1 
ATOM   3880 C CZ  . PHE B 1 235 ? 12.744  -4.406  -38.903 1.00 25.85 ? 273 PHE B CZ  1 
ATOM   3881 N N   . SER B 1 236 ? 12.005  -2.964  -43.501 1.00 26.10 ? 274 SER B N   1 
ATOM   3882 C CA  . SER B 1 236 ? 13.146  -3.541  -44.180 1.00 26.94 ? 274 SER B CA  1 
ATOM   3883 C C   . SER B 1 236 ? 14.200  -3.800  -43.124 1.00 27.31 ? 274 SER B C   1 
ATOM   3884 O O   . SER B 1 236 ? 14.354  -3.009  -42.192 1.00 27.40 ? 274 SER B O   1 
ATOM   3885 C CB  . SER B 1 236 ? 13.675  -2.581  -45.239 1.00 26.60 ? 274 SER B CB  1 
ATOM   3886 O OG  . SER B 1 236 ? 14.895  -3.050  -45.773 1.00 26.68 ? 274 SER B OG  1 
ATOM   3887 N N   . CYS B 1 237 ? 14.909  -4.915  -43.246 1.00 27.80 ? 275 CYS B N   1 
ATOM   3888 C CA  . CYS B 1 237 ? 15.961  -5.228  -42.286 1.00 28.44 ? 275 CYS B CA  1 
ATOM   3889 C C   . CYS B 1 237 ? 17.216  -5.709  -42.996 1.00 28.66 ? 275 CYS B C   1 
ATOM   3890 O O   . CYS B 1 237 ? 17.153  -6.580  -43.861 1.00 28.86 ? 275 CYS B O   1 
ATOM   3891 C CB  . CYS B 1 237 ? 15.475  -6.257  -41.258 1.00 28.66 ? 275 CYS B CB  1 
ATOM   3892 S SG  . CYS B 1 237 ? 16.697  -6.700  -39.989 1.00 28.79 ? 275 CYS B SG  1 
ATOM   3893 N N   . LYS B 1 238 ? 18.349  -5.125  -42.626 1.00 29.23 ? 276 LYS B N   1 
ATOM   3894 C CA  . LYS B 1 238 ? 19.639  -5.515  -43.179 1.00 29.97 ? 276 LYS B CA  1 
ATOM   3895 C C   . LYS B 1 238 ? 20.578  -5.977  -42.071 1.00 30.14 ? 276 LYS B C   1 
ATOM   3896 O O   . LYS B 1 238 ? 20.633  -5.379  -40.996 1.00 29.87 ? 276 LYS B O   1 
ATOM   3897 C CB  . LYS B 1 238 ? 20.274  -4.358  -43.976 1.00 30.04 ? 276 LYS B CB  1 
ATOM   3898 C CG  . LYS B 1 238 ? 19.552  -3.999  -45.284 1.00 31.41 ? 276 LYS B CG  1 
ATOM   3899 C CD  . LYS B 1 238 ? 19.684  -5.111  -46.319 1.00 34.77 ? 276 LYS B CD  1 
ATOM   3900 C CE  . LYS B 1 238 ? 18.581  -5.048  -47.372 1.00 36.83 ? 276 LYS B CE  1 
ATOM   3901 N NZ  . LYS B 1 238 ? 18.993  -4.300  -48.600 1.00 39.51 ? 276 LYS B NZ  1 
ATOM   3902 N N   . ASN B 1 239 ? 21.292  -7.066  -42.329 1.00 30.33 ? 277 ASN B N   1 
ATOM   3903 C CA  . ASN B 1 239 ? 22.404  -7.454  -41.478 1.00 31.18 ? 277 ASN B CA  1 
ATOM   3904 C C   . ASN B 1 239 ? 23.635  -6.648  -41.857 1.00 32.13 ? 277 ASN B C   1 
ATOM   3905 O O   . ASN B 1 239 ? 23.908  -6.440  -43.038 1.00 32.33 ? 277 ASN B O   1 
ATOM   3906 C CB  . ASN B 1 239 ? 22.716  -8.942  -41.641 1.00 30.92 ? 277 ASN B CB  1 
ATOM   3907 C CG  . ASN B 1 239 ? 21.697  -9.825  -40.978 1.00 30.00 ? 277 ASN B CG  1 
ATOM   3908 O OD1 . ASN B 1 239 ? 21.634  -9.905  -39.753 1.00 28.47 ? 277 ASN B OD1 1 
ATOM   3909 N ND2 . ASN B 1 239 ? 20.891  -10.501 -41.784 1.00 28.09 ? 277 ASN B ND2 1 
ATOM   3910 N N   . ILE B 1 240 ? 24.363  -6.176  -40.855 1.00 33.42 ? 278 ILE B N   1 
ATOM   3911 C CA  . ILE B 1 240 ? 25.677  -5.603  -41.077 1.00 34.62 ? 278 ILE B CA  1 
ATOM   3912 C C   . ILE B 1 240 ? 26.670  -6.477  -40.322 1.00 35.78 ? 278 ILE B C   1 
ATOM   3913 O O   . ILE B 1 240 ? 26.971  -6.257  -39.149 1.00 35.58 ? 278 ILE B O   1 
ATOM   3914 C CB  . ILE B 1 240 ? 25.756  -4.113  -40.676 1.00 34.47 ? 278 ILE B CB  1 
ATOM   3915 C CG1 . ILE B 1 240 ? 24.801  -3.295  -41.553 1.00 34.31 ? 278 ILE B CG1 1 
ATOM   3916 C CG2 . ILE B 1 240 ? 27.190  -3.602  -40.805 1.00 34.50 ? 278 ILE B CG2 1 
ATOM   3917 C CD1 . ILE B 1 240 ? 24.739  -1.826  -41.225 1.00 34.80 ? 278 ILE B CD1 1 
ATOM   3918 N N   . TYR B 1 241 ? 27.151  -7.493  -41.025 1.00 37.28 ? 279 TYR B N   1 
ATOM   3919 C CA  . TYR B 1 241 ? 28.042  -8.496  -40.458 1.00 38.85 ? 279 TYR B CA  1 
ATOM   3920 C C   . TYR B 1 241 ? 29.367  -7.898  -39.976 1.00 40.08 ? 279 TYR B C   1 
ATOM   3921 O O   . TYR B 1 241 ? 29.910  -8.317  -38.950 1.00 40.49 ? 279 TYR B O   1 
ATOM   3922 C CB  . TYR B 1 241 ? 28.266  -9.618  -41.474 1.00 38.56 ? 279 TYR B CB  1 
ATOM   3923 C CG  . TYR B 1 241 ? 26.978  -10.294 -41.905 1.00 38.41 ? 279 TYR B CG  1 
ATOM   3924 C CD1 . TYR B 1 241 ? 26.388  -11.281 -41.114 1.00 38.78 ? 279 TYR B CD1 1 
ATOM   3925 C CD2 . TYR B 1 241 ? 26.342  -9.939  -43.093 1.00 38.80 ? 279 TYR B CD2 1 
ATOM   3926 C CE1 . TYR B 1 241 ? 25.196  -11.903 -41.497 1.00 38.33 ? 279 TYR B CE1 1 
ATOM   3927 C CE2 . TYR B 1 241 ? 25.150  -10.562 -43.493 1.00 38.53 ? 279 TYR B CE2 1 
ATOM   3928 C CZ  . TYR B 1 241 ? 24.586  -11.542 -42.685 1.00 38.60 ? 279 TYR B CZ  1 
ATOM   3929 O OH  . TYR B 1 241 ? 23.413  -12.159 -43.060 1.00 38.35 ? 279 TYR B OH  1 
ATOM   3930 N N   . ARG B 1 242 ? 29.846  -6.887  -40.694 1.00 41.56 ? 280 ARG B N   1 
ATOM   3931 C CA  . ARG B 1 242 ? 31.184  -6.334  -40.506 1.00 42.95 ? 280 ARG B CA  1 
ATOM   3932 C C   . ARG B 1 242 ? 31.163  -4.840  -40.182 1.00 43.66 ? 280 ARG B C   1 
ATOM   3933 O O   . ARG B 1 242 ? 31.275  -4.017  -41.087 1.00 43.83 ? 280 ARG B O   1 
ATOM   3934 C CB  . ARG B 1 242 ? 32.029  -6.591  -41.765 1.00 43.26 ? 280 ARG B CB  1 
ATOM   3935 C CG  . ARG B 1 242 ? 31.229  -6.763  -43.088 1.00 44.66 ? 280 ARG B CG  1 
ATOM   3936 C CD  . ARG B 1 242 ? 30.328  -5.559  -43.429 1.00 46.99 ? 280 ARG B CD  1 
ATOM   3937 N NE  . ARG B 1 242 ? 29.649  -5.698  -44.718 1.00 49.04 ? 280 ARG B NE  1 
ATOM   3938 C CZ  . ARG B 1 242 ? 28.474  -6.301  -44.905 1.00 50.00 ? 280 ARG B CZ  1 
ATOM   3939 N NH1 . ARG B 1 242 ? 27.818  -6.850  -43.891 1.00 49.42 ? 280 ARG B NH1 1 
ATOM   3940 N NH2 . ARG B 1 242 ? 27.956  -6.367  -46.126 1.00 50.83 ? 280 ARG B NH2 1 
ATOM   3941 N N   . PRO B 1 243 ? 31.033  -4.481  -38.888 1.00 44.51 ? 281 PRO B N   1 
ATOM   3942 C CA  . PRO B 1 243 ? 30.965  -3.068  -38.477 1.00 45.04 ? 281 PRO B CA  1 
ATOM   3943 C C   . PRO B 1 243 ? 32.167  -2.237  -38.941 1.00 45.46 ? 281 PRO B C   1 
ATOM   3944 O O   . PRO B 1 243 ? 32.017  -1.048  -39.242 1.00 45.53 ? 281 PRO B O   1 
ATOM   3945 C CB  . PRO B 1 243 ? 30.943  -3.144  -36.947 1.00 45.12 ? 281 PRO B CB  1 
ATOM   3946 C CG  . PRO B 1 243 ? 30.457  -4.501  -36.639 1.00 44.97 ? 281 PRO B CG  1 
ATOM   3947 C CD  . PRO B 1 243 ? 30.939  -5.391  -37.733 1.00 44.51 ? 281 PRO B CD  1 
ATOM   3948 N N   . ASP B 1 244 ? 33.339  -2.865  -39.002 1.00 45.91 ? 282 ASP B N   1 
ATOM   3949 C CA  . ASP B 1 244 ? 34.569  -2.180  -39.399 1.00 46.24 ? 282 ASP B CA  1 
ATOM   3950 C C   . ASP B 1 244 ? 34.613  -1.852  -40.891 1.00 46.22 ? 282 ASP B C   1 
ATOM   3951 O O   . ASP B 1 244 ? 34.782  -0.684  -41.261 1.00 46.18 ? 282 ASP B O   1 
ATOM   3952 C CB  . ASP B 1 244 ? 35.804  -2.977  -38.963 1.00 46.53 ? 282 ASP B CB  1 
ATOM   3953 C CG  . ASP B 1 244 ? 36.124  -2.798  -37.482 1.00 47.11 ? 282 ASP B CG  1 
ATOM   3954 O OD1 . ASP B 1 244 ? 36.708  -3.727  -36.882 1.00 48.31 ? 282 ASP B OD1 1 
ATOM   3955 O OD2 . ASP B 1 244 ? 35.794  -1.732  -36.916 1.00 47.84 ? 282 ASP B OD2 1 
ATOM   3956 N N   . LYS B 1 245 ? 34.451  -2.869  -41.739 1.00 46.10 ? 283 LYS B N   1 
ATOM   3957 C CA  . LYS B 1 245 ? 34.389  -2.650  -43.189 1.00 46.09 ? 283 LYS B CA  1 
ATOM   3958 C C   . LYS B 1 245 ? 33.197  -1.778  -43.589 1.00 45.95 ? 283 LYS B C   1 
ATOM   3959 O O   . LYS B 1 245 ? 33.276  -1.029  -44.560 1.00 45.90 ? 283 LYS B O   1 
ATOM   3960 C CB  . LYS B 1 245 ? 34.380  -3.972  -43.964 1.00 46.05 ? 283 LYS B CB  1 
ATOM   3961 C CG  . LYS B 1 245 ? 35.774  -4.542  -44.219 1.00 46.33 ? 283 LYS B CG  1 
ATOM   3962 C CD  . LYS B 1 245 ? 35.729  -5.818  -45.062 1.00 46.16 ? 283 LYS B CD  1 
ATOM   3963 C CE  . LYS B 1 245 ? 37.118  -6.453  -45.192 1.00 45.98 ? 283 LYS B CE  1 
ATOM   3964 N NZ  . LYS B 1 245 ? 37.062  -7.828  -45.761 1.00 45.10 ? 283 LYS B NZ  1 
ATOM   3965 N N   . PHE B 1 246 ? 32.105  -1.878  -42.834 1.00 45.89 ? 284 PHE B N   1 
ATOM   3966 C CA  . PHE B 1 246 ? 30.937  -1.021  -43.038 1.00 45.92 ? 284 PHE B CA  1 
ATOM   3967 C C   . PHE B 1 246 ? 31.340  0.451   -43.002 1.00 45.83 ? 284 PHE B C   1 
ATOM   3968 O O   . PHE B 1 246 ? 31.065  1.189   -43.945 1.00 45.75 ? 284 PHE B O   1 
ATOM   3969 C CB  . PHE B 1 246 ? 29.847  -1.322  -41.995 1.00 45.87 ? 284 PHE B CB  1 
ATOM   3970 C CG  . PHE B 1 246 ? 28.645  -0.419  -42.085 1.00 46.08 ? 284 PHE B CG  1 
ATOM   3971 C CD1 . PHE B 1 246 ? 27.805  -0.456  -43.194 1.00 46.32 ? 284 PHE B CD1 1 
ATOM   3972 C CD2 . PHE B 1 246 ? 28.346  0.458   -41.049 1.00 46.44 ? 284 PHE B CD2 1 
ATOM   3973 C CE1 . PHE B 1 246 ? 26.692  0.379   -43.279 1.00 46.51 ? 284 PHE B CE1 1 
ATOM   3974 C CE2 . PHE B 1 246 ? 27.236  1.294   -41.122 1.00 46.45 ? 284 PHE B CE2 1 
ATOM   3975 C CZ  . PHE B 1 246 ? 26.407  1.253   -42.242 1.00 46.40 ? 284 PHE B CZ  1 
ATOM   3976 N N   . LEU B 1 247 ? 32.015  0.851   -41.923 1.00 45.94 ? 285 LEU B N   1 
ATOM   3977 C CA  . LEU B 1 247 ? 32.491  2.227   -41.731 1.00 46.17 ? 285 LEU B CA  1 
ATOM   3978 C C   . LEU B 1 247 ? 33.462  2.684   -42.819 1.00 46.35 ? 285 LEU B C   1 
ATOM   3979 O O   . LEU B 1 247 ? 33.407  3.833   -43.266 1.00 46.30 ? 285 LEU B O   1 
ATOM   3980 C CB  . LEU B 1 247 ? 33.131  2.377   -40.347 1.00 46.16 ? 285 LEU B CB  1 
ATOM   3981 C CG  . LEU B 1 247 ? 32.389  3.100   -39.212 1.00 46.30 ? 285 LEU B CG  1 
ATOM   3982 C CD1 . LEU B 1 247 ? 33.162  4.335   -38.796 1.00 47.09 ? 285 LEU B CD1 1 
ATOM   3983 C CD2 . LEU B 1 247 ? 30.935  3.455   -39.546 1.00 46.04 ? 285 LEU B CD2 1 
ATOM   3984 N N   . GLN B 1 248 ? 34.340  1.778   -43.238 1.00 46.55 ? 286 GLN B N   1 
ATOM   3985 C CA  . GLN B 1 248 ? 35.274  2.042   -44.328 1.00 46.82 ? 286 GLN B CA  1 
ATOM   3986 C C   . GLN B 1 248 ? 34.547  2.186   -45.663 1.00 46.97 ? 286 GLN B C   1 
ATOM   3987 O O   . GLN B 1 248 ? 34.873  3.071   -46.454 1.00 46.94 ? 286 GLN B O   1 
ATOM   3988 C CB  . GLN B 1 248 ? 36.330  0.938   -44.407 1.00 46.81 ? 286 GLN B CB  1 
ATOM   3989 C CG  . GLN B 1 248 ? 37.235  0.851   -43.175 1.00 47.14 ? 286 GLN B CG  1 
ATOM   3990 C CD  . GLN B 1 248 ? 38.070  -0.424  -43.128 1.00 47.21 ? 286 GLN B CD  1 
ATOM   3991 O OE1 . GLN B 1 248 ? 38.095  -1.207  -44.080 1.00 47.76 ? 286 GLN B OE1 1 
ATOM   3992 N NE2 . GLN B 1 248 ? 38.759  -0.636  -42.008 1.00 47.80 ? 286 GLN B NE2 1 
ATOM   3993 N N   . CYS B 1 249 ? 33.556  1.327   -45.901 1.00 47.40 ? 287 CYS B N   1 
ATOM   3994 C CA  . CYS B 1 249 ? 32.788  1.347   -47.153 1.00 47.99 ? 287 CYS B CA  1 
ATOM   3995 C C   . CYS B 1 249 ? 31.835  2.536   -47.256 1.00 48.34 ? 287 CYS B C   1 
ATOM   3996 O O   . CYS B 1 249 ? 31.449  2.924   -48.356 1.00 48.51 ? 287 CYS B O   1 
ATOM   3997 C CB  . CYS B 1 249 ? 32.022  0.038   -47.363 1.00 48.03 ? 287 CYS B CB  1 
ATOM   3998 S SG  . CYS B 1 249 ? 33.071  -1.389  -47.745 1.00 48.81 ? 287 CYS B SG  1 
ATOM   3999 N N   . VAL B 1 250 ? 31.443  3.099   -46.115 1.00 48.73 ? 288 VAL B N   1 
ATOM   4000 C CA  . VAL B 1 250 ? 30.695  4.352   -46.114 1.00 49.10 ? 288 VAL B CA  1 
ATOM   4001 C C   . VAL B 1 250 ? 31.682  5.482   -46.407 1.00 49.40 ? 288 VAL B C   1 
ATOM   4002 O O   . VAL B 1 250 ? 31.391  6.375   -47.203 1.00 49.44 ? 288 VAL B O   1 
ATOM   4003 C CB  . VAL B 1 250 ? 29.938  4.588   -44.773 1.00 49.08 ? 288 VAL B CB  1 
ATOM   4004 C CG1 . VAL B 1 250 ? 29.172  5.904   -44.796 1.00 48.96 ? 288 VAL B CG1 1 
ATOM   4005 C CG2 . VAL B 1 250 ? 28.977  3.441   -44.498 1.00 49.00 ? 288 VAL B CG2 1 
ATOM   4006 N N   . LYS B 1 251 ? 32.855  5.406   -45.778 1.00 49.86 ? 289 LYS B N   1 
ATOM   4007 C CA  . LYS B 1 251 ? 33.925  6.394   -45.951 1.00 50.54 ? 289 LYS B CA  1 
ATOM   4008 C C   . LYS B 1 251 ? 34.389  6.483   -47.406 1.00 50.80 ? 289 LYS B C   1 
ATOM   4009 O O   . LYS B 1 251 ? 34.526  7.581   -47.950 1.00 50.97 ? 289 LYS B O   1 
ATOM   4010 C CB  . LYS B 1 251 ? 35.099  6.083   -45.014 1.00 50.41 ? 289 LYS B CB  1 
ATOM   4011 C CG  . LYS B 1 251 ? 36.092  7.226   -44.831 1.00 50.78 ? 289 LYS B CG  1 
ATOM   4012 C CD  . LYS B 1 251 ? 37.085  6.940   -43.704 1.00 50.96 ? 289 LYS B CD  1 
ATOM   4013 C CE  . LYS B 1 251 ? 36.444  7.112   -42.323 1.00 51.53 ? 289 LYS B CE  1 
ATOM   4014 N NZ  . LYS B 1 251 ? 37.419  6.943   -41.206 1.00 51.73 ? 289 LYS B NZ  1 
ATOM   4015 N N   . ASN B 1 252 ? 34.622  5.325   -48.021 1.00 51.18 ? 290 ASN B N   1 
ATOM   4016 C CA  . ASN B 1 252 ? 34.936  5.235   -49.449 1.00 51.41 ? 290 ASN B CA  1 
ATOM   4017 C C   . ASN B 1 252 ? 34.198  4.068   -50.122 1.00 51.67 ? 290 ASN B C   1 
ATOM   4018 O O   . ASN B 1 252 ? 34.659  2.925   -50.063 1.00 51.66 ? 290 ASN B O   1 
ATOM   4019 C CB  . ASN B 1 252 ? 36.454  5.179   -49.695 1.00 51.48 ? 290 ASN B CB  1 
ATOM   4020 C CG  . ASN B 1 252 ? 37.192  4.296   -48.694 1.00 51.52 ? 290 ASN B CG  1 
ATOM   4021 O OD1 . ASN B 1 252 ? 37.220  4.578   -47.494 1.00 51.17 ? 290 ASN B OD1 1 
ATOM   4022 N ND2 . ASN B 1 252 ? 37.819  3.234   -49.194 1.00 51.33 ? 290 ASN B ND2 1 
ATOM   4023 N N   . PRO B 1 253 ? 33.032  4.361   -50.741 1.00 52.00 ? 291 PRO B N   1 
ATOM   4024 C CA  . PRO B 1 253 ? 32.093  3.410   -51.372 1.00 52.21 ? 291 PRO B CA  1 
ATOM   4025 C C   . PRO B 1 253 ? 32.691  2.307   -52.265 1.00 52.29 ? 291 PRO B C   1 
ATOM   4026 O O   . PRO B 1 253 ? 32.458  1.130   -51.996 1.00 52.39 ? 291 PRO B O   1 
ATOM   4027 C CB  . PRO B 1 253 ? 31.152  4.324   -52.160 1.00 52.27 ? 291 PRO B CB  1 
ATOM   4028 C CG  . PRO B 1 253 ? 31.104  5.558   -51.332 1.00 52.16 ? 291 PRO B CG  1 
ATOM   4029 C CD  . PRO B 1 253 ? 32.518  5.742   -50.829 1.00 52.04 ? 291 PRO B CD  1 
ATOM   4030 N N   . GLU B 1 254 ? 33.680  2.602   -53.158 1.00 52.42 ? 292 GLU B N   1 
ATOM   4031 C CA  . GLU B 1 254 ? 34.351  1.478   -53.920 1.00 52.54 ? 292 GLU B CA  1 
ATOM   4032 C C   . GLU B 1 254 ? 35.885  1.204   -53.428 1.00 52.67 ? 292 GLU B C   1 
ATOM   4033 O O   . GLU B 1 254 ? 36.808  1.712   -54.067 1.00 52.70 ? 292 GLU B O   1 
ATOM   4034 C CB  . GLU B 1 254 ? 34.253  1.757   -55.481 1.00 52.59 ? 292 GLU B CB  1 
ATOM   4035 C CG  . GLU B 1 254 ? 32.908  1.442   -56.214 1.00 52.44 ? 292 GLU B CG  1 
ATOM   4036 C CD  . GLU B 1 254 ? 32.749  1.786   -57.727 1.00 52.43 ? 292 GLU B CD  1 
ATOM   4037 O OE1 . GLU B 1 254 ? 33.781  1.883   -58.419 1.00 51.79 ? 292 GLU B OE1 1 
ATOM   4038 O OE2 . GLU B 1 254 ? 31.604  1.959   -58.182 1.00 52.67 ? 292 GLU B OE2 1 
ATOM   4039 N N   . ASP B 1 255 ? 36.098  0.429   -52.355 1.00 52.78 ? 293 ASP B N   1 
ATOM   4040 C CA  . ASP B 1 255 ? 37.397  -0.059  -51.892 1.00 52.84 ? 293 ASP B CA  1 
ATOM   4041 C C   . ASP B 1 255 ? 37.547  -1.456  -52.640 1.00 52.83 ? 293 ASP B C   1 
ATOM   4042 O O   . ASP B 1 255 ? 38.646  -1.963  -52.766 1.00 52.78 ? 293 ASP B O   1 
ATOM   4043 C CB  . ASP B 1 255 ? 37.508  -0.133  -50.338 1.00 52.91 ? 293 ASP B CB  1 
ATOM   4044 C CG  . ASP B 1 255 ? 38.938  -0.226  -49.777 1.00 53.00 ? 293 ASP B CG  1 
ATOM   4045 O OD1 . ASP B 1 255 ? 39.809  -0.749  -50.501 1.00 52.83 ? 293 ASP B OD1 1 
ATOM   4046 O OD2 . ASP B 1 255 ? 39.162  0.227   -48.638 1.00 52.58 ? 293 ASP B OD2 1 
ATOM   4047 N N   . SER B 1 256 ? 36.366  -2.053  -53.121 1.00 52.82 ? 294 SER B N   1 
ATOM   4048 C CA  . SER B 1 256 ? 36.029  -3.346  -53.822 1.00 52.70 ? 294 SER B CA  1 
ATOM   4049 C C   . SER B 1 256 ? 35.715  -4.531  -52.849 1.00 52.63 ? 294 SER B C   1 
ATOM   4050 O O   . SER B 1 256 ? 35.083  -5.521  -53.232 1.00 52.63 ? 294 SER B O   1 
ATOM   4051 C CB  . SER B 1 256 ? 37.176  -3.773  -54.738 1.00 52.70 ? 294 SER B CB  1 
ATOM   4052 O OG  . SER B 1 256 ? 36.886  -3.473  -56.092 1.00 52.85 ? 294 SER B OG  1 
ATOM   4053 N N   . SER B 1 257 ? 36.191  -4.346  -51.605 1.00 52.47 ? 295 SER B N   1 
ATOM   4054 C CA  . SER B 1 257 ? 35.984  -5.202  -50.448 1.00 52.28 ? 295 SER B CA  1 
ATOM   4055 C C   . SER B 1 257 ? 34.571  -4.914  -49.937 1.00 52.15 ? 295 SER B C   1 
ATOM   4056 O O   . SER B 1 257 ? 34.194  -5.354  -48.850 1.00 52.18 ? 295 SER B O   1 
ATOM   4057 C CB  . SER B 1 257 ? 36.952  -4.829  -49.322 1.00 52.31 ? 295 SER B CB  1 
ATOM   4058 O OG  . SER B 1 257 ? 36.995  -3.428  -49.123 1.00 52.43 ? 295 SER B OG  1 
ATOM   4059 N N   . CYS B 1 258 ? 33.829  -4.163  -50.745 1.00 51.91 ? 296 CYS B N   1 
ATOM   4060 C CA  . CYS B 1 258 ? 32.483  -3.669  -50.421 1.00 51.61 ? 296 CYS B CA  1 
ATOM   4061 C C   . CYS B 1 258 ? 31.401  -4.410  -51.204 1.00 51.72 ? 296 CYS B C   1 
ATOM   4062 O O   . CYS B 1 258 ? 31.573  -4.720  -52.384 1.00 51.86 ? 296 CYS B O   1 
ATOM   4063 C CB  . CYS B 1 258 ? 32.391  -2.159  -50.670 1.00 51.40 ? 296 CYS B CB  1 
ATOM   4064 S SG  . CYS B 1 258 ? 33.682  -1.187  -49.835 1.00 50.32 ? 296 CYS B SG  1 
HETATM 4065 P PA  . NAD C 2 .   ? 4.455   3.135   6.253   1.00 29.51 ? 301 NAD A PA  1 
HETATM 4066 O O1A . NAD C 2 .   ? 3.624   3.091   7.472   1.00 28.55 ? 301 NAD A O1A 1 
HETATM 4067 O O2A . NAD C 2 .   ? 5.811   3.685   6.488   1.00 27.44 ? 301 NAD A O2A 1 
HETATM 4068 O O5B . NAD C 2 .   ? 4.544   1.650   5.612   1.00 30.61 ? 301 NAD A O5B 1 
HETATM 4069 C C5B . NAD C 2 .   ? 3.521   0.686   5.745   1.00 33.63 ? 301 NAD A C5B 1 
HETATM 4070 C C4B . NAD C 2 .   ? 4.110   -0.701  6.014   1.00 35.55 ? 301 NAD A C4B 1 
HETATM 4071 O O4B . NAD C 2 .   ? 4.954   -1.096  4.951   1.00 35.95 ? 301 NAD A O4B 1 
HETATM 4072 C C3B . NAD C 2 .   ? 4.972   -0.745  7.268   1.00 37.33 ? 301 NAD A C3B 1 
HETATM 4073 O O3B . NAD C 2 .   ? 4.800   -1.995  7.893   1.00 37.34 ? 301 NAD A O3B 1 
HETATM 4074 C C2B . NAD C 2 .   ? 6.399   -0.619  6.768   1.00 38.23 ? 301 NAD A C2B 1 
HETATM 4075 O O2B . NAD C 2 .   ? 7.317   -1.245  7.656   1.00 40.29 ? 301 NAD A O2B 1 
HETATM 4076 C C1B . NAD C 2 .   ? 6.301   -1.248  5.376   1.00 37.65 ? 301 NAD A C1B 1 
HETATM 4077 N N9A . NAD C 2 .   ? 7.135   -0.574  4.369   1.00 37.70 ? 301 NAD A N9A 1 
HETATM 4078 C C8A . NAD C 2 .   ? 7.133   0.759   4.021   1.00 38.15 ? 301 NAD A C8A 1 
HETATM 4079 N N7A . NAD C 2 .   ? 8.042   0.946   3.031   1.00 38.65 ? 301 NAD A N7A 1 
HETATM 4080 C C5A . NAD C 2 .   ? 8.611   -0.258  2.738   1.00 38.69 ? 301 NAD A C5A 1 
HETATM 4081 C C6A . NAD C 2 .   ? 9.596   -0.663  1.834   1.00 38.46 ? 301 NAD A C6A 1 
HETATM 4082 N N6A . NAD C 2 .   ? 10.149  0.200   0.978   1.00 39.04 ? 301 NAD A N6A 1 
HETATM 4083 N N1A . NAD C 2 .   ? 9.964   -1.994  1.786   1.00 37.11 ? 301 NAD A N1A 1 
HETATM 4084 C C2A . NAD C 2 .   ? 9.382   -2.928  2.617   1.00 37.31 ? 301 NAD A C2A 1 
HETATM 4085 N N3A . NAD C 2 .   ? 8.417   -2.526  3.509   1.00 37.59 ? 301 NAD A N3A 1 
HETATM 4086 C C4A . NAD C 2 .   ? 8.042   -1.217  3.574   1.00 38.42 ? 301 NAD A C4A 1 
HETATM 4087 O O3  . NAD C 2 .   ? 3.650   3.976   5.159   1.00 25.87 ? 301 NAD A O3  1 
HETATM 4088 P PN  . NAD C 2 .   ? 4.142   4.102   3.621   1.00 26.01 ? 301 NAD A PN  1 
HETATM 4089 O O1N . NAD C 2 .   ? 3.724   5.474   3.195   1.00 23.06 ? 301 NAD A O1N 1 
HETATM 4090 O O2N . NAD C 2 .   ? 5.555   3.629   3.536   1.00 26.13 ? 301 NAD A O2N 1 
HETATM 4091 O O5D . NAD C 2 .   ? 3.136   3.090   2.885   1.00 25.13 ? 301 NAD A O5D 1 
HETATM 4092 C C5D . NAD C 2 .   ? 1.738   3.317   2.947   1.00 23.40 ? 301 NAD A C5D 1 
HETATM 4093 C C4D . NAD C 2 .   ? 1.135   3.674   1.578   1.00 24.85 ? 301 NAD A C4D 1 
HETATM 4094 O O4D . NAD C 2 .   ? 1.698   2.881   0.547   1.00 26.08 ? 301 NAD A O4D 1 
HETATM 4095 C C3D . NAD C 2 .   ? -0.329  3.302   1.582   1.00 22.21 ? 301 NAD A C3D 1 
HETATM 4096 O O3D . NAD C 2 .   ? -1.050  4.076   0.640   1.00 17.95 ? 301 NAD A O3D 1 
HETATM 4097 C C2D . NAD C 2 .   ? -0.281  1.826   1.243   1.00 23.92 ? 301 NAD A C2D 1 
HETATM 4098 O O2D . NAD C 2 .   ? -1.426  1.410   0.544   1.00 27.36 ? 301 NAD A O2D 1 
HETATM 4099 C C1D . NAD C 2 .   ? 1.000   1.649   0.438   1.00 24.95 ? 301 NAD A C1D 1 
HETATM 4100 N N1N . NAD C 2 .   ? 1.847   0.611   1.056   1.00 24.65 ? 301 NAD A N1N 1 
HETATM 4101 C C2N . NAD C 2 .   ? 1.296   -0.404  1.781   1.00 25.24 ? 301 NAD A C2N 1 
HETATM 4102 C C3N . NAD C 2 .   ? 2.108   -1.364  2.377   1.00 27.48 ? 301 NAD A C3N 1 
HETATM 4103 C C7N . NAD C 2 .   ? 1.525   -2.320  3.377   1.00 28.32 ? 301 NAD A C7N 1 
HETATM 4104 O O7N . NAD C 2 .   ? 2.388   -2.913  4.305   1.00 30.08 ? 301 NAD A O7N 1 
HETATM 4105 N N7N . NAD C 2 .   ? 0.220   -2.598  3.370   1.00 28.21 ? 301 NAD A N7N 1 
HETATM 4106 C C4N . NAD C 2 .   ? 3.495   -1.288  2.229   1.00 26.13 ? 301 NAD A C4N 1 
HETATM 4107 C C5N . NAD C 2 .   ? 4.062   -0.254  1.488   1.00 24.51 ? 301 NAD A C5N 1 
HETATM 4108 C C6N . NAD C 2 .   ? 3.218   0.685   0.910   1.00 25.10 ? 301 NAD A C6N 1 
HETATM 4109 P PA  . NAD D 2 .   ? 19.568  2.794   -25.253 1.00 48.44 ? 301 NAD B PA  1 
HETATM 4110 O O1A . NAD D 2 .   ? 20.982  2.485   -25.557 1.00 47.07 ? 301 NAD B O1A 1 
HETATM 4111 O O2A . NAD D 2 .   ? 18.870  1.673   -24.600 1.00 46.62 ? 301 NAD B O2A 1 
HETATM 4112 O O5B . NAD D 2 .   ? 19.487  4.195   -24.451 1.00 51.58 ? 301 NAD B O5B 1 
HETATM 4113 C C5B . NAD D 2 .   ? 19.609  4.291   -23.049 1.00 58.05 ? 301 NAD B C5B 1 
HETATM 4114 C C4B . NAD D 2 .   ? 20.610  5.381   -22.663 1.00 60.99 ? 301 NAD B C4B 1 
HETATM 4115 O O4B . NAD D 2 .   ? 20.862  5.290   -21.272 1.00 62.10 ? 301 NAD B O4B 1 
HETATM 4116 C C3B . NAD D 2 .   ? 21.943  5.213   -23.387 1.00 62.73 ? 301 NAD B C3B 1 
HETATM 4117 O O3B . NAD D 2 .   ? 22.243  6.313   -24.225 1.00 63.48 ? 301 NAD B O3B 1 
HETATM 4118 C C2B . NAD D 2 .   ? 22.992  5.061   -22.303 1.00 63.35 ? 301 NAD B C2B 1 
HETATM 4119 O O2B . NAD D 2 .   ? 23.973  6.076   -22.369 1.00 63.97 ? 301 NAD B O2B 1 
HETATM 4120 C C1B . NAD D 2 .   ? 22.238  5.114   -20.980 1.00 64.16 ? 301 NAD B C1B 1 
HETATM 4121 N N9A . NAD D 2 .   ? 22.452  3.845   -20.251 1.00 64.80 ? 301 NAD B N9A 1 
HETATM 4122 C C8A . NAD D 2 .   ? 21.471  2.989   -19.813 1.00 64.95 ? 301 NAD B C8A 1 
HETATM 4123 N N7A . NAD D 2 .   ? 22.063  1.939   -19.199 1.00 65.31 ? 301 NAD B N7A 1 
HETATM 4124 C C5A . NAD D 2 .   ? 23.409  2.105   -19.235 1.00 65.45 ? 301 NAD B C5A 1 
HETATM 4125 C C6A . NAD D 2 .   ? 24.475  1.332   -18.756 1.00 65.21 ? 301 NAD B C6A 1 
HETATM 4126 N N6A . NAD D 2 .   ? 24.267  0.065   -18.402 1.00 65.20 ? 301 NAD B N6A 1 
HETATM 4127 N N1A . NAD D 2 .   ? 25.778  1.773   -18.946 1.00 65.11 ? 301 NAD B N1A 1 
HETATM 4128 C C2A . NAD D 2 .   ? 26.021  2.966   -19.606 1.00 65.16 ? 301 NAD B C2A 1 
HETATM 4129 N N3A . NAD D 2 .   ? 24.958  3.720   -20.076 1.00 65.33 ? 301 NAD B N3A 1 
HETATM 4130 C C4A . NAD D 2 .   ? 23.671  3.303   -19.896 1.00 65.08 ? 301 NAD B C4A 1 
HETATM 4131 O O3  . NAD D 2 .   ? 18.762  3.147   -26.599 1.00 44.36 ? 301 NAD B O3  1 
HETATM 4132 P PN  . NAD D 2 .   ? 17.249  3.729   -26.571 1.00 42.24 ? 301 NAD B PN  1 
HETATM 4133 O O1N . NAD D 2 .   ? 16.468  2.968   -27.567 1.00 42.28 ? 301 NAD B O1N 1 
HETATM 4134 O O2N . NAD D 2 .   ? 16.748  3.870   -25.184 1.00 42.73 ? 301 NAD B O2N 1 
HETATM 4135 O O5D . NAD D 2 .   ? 17.451  5.206   -27.164 1.00 40.56 ? 301 NAD B O5D 1 
HETATM 4136 C C5D . NAD D 2 .   ? 18.056  5.339   -28.424 1.00 38.49 ? 301 NAD B C5D 1 
HETATM 4137 C C4D . NAD D 2 .   ? 17.210  6.227   -29.327 1.00 36.41 ? 301 NAD B C4D 1 
HETATM 4138 O O4D . NAD D 2 .   ? 16.599  7.268   -28.589 1.00 36.15 ? 301 NAD B O4D 1 
HETATM 4139 C C3D . NAD D 2 .   ? 18.110  6.903   -30.337 1.00 35.22 ? 301 NAD B C3D 1 
HETATM 4140 O O3D . NAD D 2 .   ? 17.424  7.040   -31.572 1.00 32.61 ? 301 NAD B O3D 1 
HETATM 4141 C C2D . NAD D 2 .   ? 18.437  8.237   -29.688 1.00 35.45 ? 301 NAD B C2D 1 
HETATM 4142 O O2D . NAD D 2 .   ? 18.340  9.250   -30.651 1.00 36.42 ? 301 NAD B O2D 1 
HETATM 4143 C C1D . NAD D 2 .   ? 17.420  8.421   -28.560 1.00 35.48 ? 301 NAD B C1D 1 
HETATM 4144 N N1N . NAD D 2 .   ? 18.027  8.534   -27.206 1.00 35.12 ? 301 NAD B N1N 1 
HETATM 4145 C C2N . NAD D 2 .   ? 19.231  9.155   -27.023 1.00 34.22 ? 301 NAD B C2N 1 
HETATM 4146 C C3N . NAD D 2 .   ? 19.797  9.255   -25.755 1.00 34.99 ? 301 NAD B C3N 1 
HETATM 4147 C C7N . NAD D 2 .   ? 21.269  9.497   -25.631 1.00 35.04 ? 301 NAD B C7N 1 
HETATM 4148 O O7N . NAD D 2 .   ? 21.951  8.916   -24.549 1.00 35.74 ? 301 NAD B O7N 1 
HETATM 4149 N N7N . NAD D 2 .   ? 21.904  10.245  -26.528 1.00 33.63 ? 301 NAD B N7N 1 
HETATM 4150 C C4N . NAD D 2 .   ? 19.118  8.732   -24.657 1.00 34.85 ? 301 NAD B C4N 1 
HETATM 4151 C C5N . NAD D 2 .   ? 17.891  8.104   -24.841 1.00 34.85 ? 301 NAD B C5N 1 
HETATM 4152 C C6N . NAD D 2 .   ? 17.353  8.029   -26.119 1.00 33.91 ? 301 NAD B C6N 1 
HETATM 4153 O O   . HOH E 3 .   ? -9.580  8.621   -5.244  1.00 13.02 ? 302 HOH A O   1 
HETATM 4154 O O   . HOH E 3 .   ? -3.893  2.492   0.188   1.00 16.20 ? 303 HOH A O   1 
HETATM 4155 O O   . HOH E 3 .   ? -3.667  8.904   -10.529 1.00 17.30 ? 304 HOH A O   1 
HETATM 4156 O O   . HOH E 3 .   ? -10.821 9.138   -2.386  1.00 17.56 ? 305 HOH A O   1 
HETATM 4157 O O   . HOH E 3 .   ? -9.908  -2.485  5.311   1.00 21.06 ? 306 HOH A O   1 
HETATM 4158 O O   . HOH E 3 .   ? 13.609  -14.305 -3.454  1.00 19.80 ? 307 HOH A O   1 
HETATM 4159 O O   . HOH E 3 .   ? -5.871  -6.660  -6.926  1.00 16.53 ? 308 HOH A O   1 
HETATM 4160 O O   . HOH E 3 .   ? 11.544  -9.618  1.123   1.00 21.81 ? 309 HOH A O   1 
HETATM 4161 O O   . HOH E 3 .   ? 11.926  -8.186  3.477   1.00 25.74 ? 310 HOH A O   1 
HETATM 4162 O O   . HOH E 3 .   ? 4.385   -12.658 -10.617 1.00 21.83 ? 311 HOH A O   1 
HETATM 4163 O O   . HOH E 3 .   ? -13.132 4.095   -11.896 1.00 25.84 ? 312 HOH A O   1 
HETATM 4164 O O   . HOH E 3 .   ? -2.563  22.753  4.803   1.00 24.15 ? 313 HOH A O   1 
HETATM 4165 O O   . HOH E 3 .   ? 13.703  -21.772 5.349   1.00 27.39 ? 314 HOH A O   1 
HETATM 4166 O O   . HOH E 3 .   ? -17.196 7.688   1.068   1.00 22.79 ? 315 HOH A O   1 
HETATM 4167 O O   . HOH E 3 .   ? 4.091   -6.813  3.727   1.00 26.68 ? 316 HOH A O   1 
HETATM 4168 O O   . HOH E 3 .   ? 4.110   10.135  5.094   1.00 22.85 ? 317 HOH A O   1 
HETATM 4169 O O   . HOH E 3 .   ? -5.007  -8.857  4.632   1.00 28.38 ? 318 HOH A O   1 
HETATM 4170 O O   . HOH E 3 .   ? 18.737  -4.596  -3.894  1.00 33.74 ? 319 HOH A O   1 
HETATM 4171 O O   . HOH E 3 .   ? 7.713   -13.895 -12.891 1.00 28.38 ? 320 HOH A O   1 
HETATM 4172 O O   . HOH E 3 .   ? -7.125  22.626  3.199   1.00 24.08 ? 321 HOH A O   1 
HETATM 4173 O O   . HOH E 3 .   ? 11.319  -23.587 3.031   1.00 27.50 ? 322 HOH A O   1 
HETATM 4174 O O   . HOH E 3 .   ? 2.360   10.602  -13.243 1.00 38.64 ? 323 HOH A O   1 
HETATM 4175 O O   . HOH E 3 .   ? -5.343  -6.387  5.278   1.00 35.47 ? 324 HOH A O   1 
HETATM 4176 O O   . HOH E 3 .   ? 5.805   16.680  10.849  1.00 32.26 ? 325 HOH A O   1 
HETATM 4177 O O   . HOH E 3 .   ? -13.369 -1.965  1.286   1.00 36.72 ? 326 HOH A O   1 
HETATM 4178 O O   . HOH E 3 .   ? 2.233   9.988   8.824   1.00 24.34 ? 327 HOH A O   1 
HETATM 4179 O O   . HOH E 3 .   ? 17.364  -15.918 0.791   1.00 27.75 ? 328 HOH A O   1 
HETATM 4180 O O   . HOH E 3 .   ? -9.136  20.702  10.180  1.00 28.14 ? 329 HOH A O   1 
HETATM 4181 O O   . HOH E 3 .   ? -11.860 15.764  14.454  1.00 36.06 ? 330 HOH A O   1 
HETATM 4182 O O   . HOH E 3 .   ? 4.781   9.882   8.502   1.00 36.82 ? 331 HOH A O   1 
HETATM 4183 O O   . HOH E 3 .   ? -5.217  -3.602  -11.349 1.00 39.94 ? 332 HOH A O   1 
HETATM 4184 O O   . HOH E 3 .   ? 20.045  -15.984 -2.163  1.00 35.48 ? 333 HOH A O   1 
HETATM 4185 O O   . HOH E 3 .   ? -6.413  19.976  -9.858  1.00 30.41 ? 334 HOH A O   1 
HETATM 4186 O O   . HOH E 3 .   ? 4.048   24.906  0.247   1.00 65.26 ? 335 HOH A O   1 
HETATM 4187 O O   . HOH E 3 .   ? 0.249   24.657  14.390  1.00 53.77 ? 336 HOH A O   1 
HETATM 4188 O O   . HOH E 3 .   ? -13.073 15.096  0.964   1.00 31.38 ? 337 HOH A O   1 
HETATM 4189 O O   . HOH E 3 .   ? 2.484   -5.082  5.261   1.00 29.30 ? 338 HOH A O   1 
HETATM 4190 O O   . HOH E 3 .   ? 13.662  -19.644 -3.487  1.00 27.57 ? 339 HOH A O   1 
HETATM 4191 O O   . HOH E 3 .   ? -7.086  -13.802 -12.729 1.00 35.94 ? 340 HOH A O   1 
HETATM 4192 O O   . HOH E 3 .   ? -8.647  6.166   -14.682 1.00 63.96 ? 341 HOH A O   1 
HETATM 4193 O O   . HOH E 3 .   ? 6.173   -2.348  -13.138 1.00 42.28 ? 342 HOH A O   1 
HETATM 4194 O O   . HOH E 3 .   ? 3.440   26.498  8.638   1.00 41.44 ? 343 HOH A O   1 
HETATM 4195 O O   . HOH E 3 .   ? 5.875   -11.924 9.561   1.00 35.07 ? 344 HOH A O   1 
HETATM 4196 O O   . HOH E 3 .   ? 15.678  -23.626 -8.493  1.00 69.02 ? 345 HOH A O   1 
HETATM 4197 O O   . HOH E 3 .   ? 7.981   4.055   5.405   1.00 36.21 ? 346 HOH A O   1 
HETATM 4198 O O   . HOH E 3 .   ? -19.989 7.020   7.456   1.00 38.21 ? 347 HOH A O   1 
HETATM 4199 O O   . HOH E 3 .   ? 9.246   3.047   0.144   1.00 37.99 ? 348 HOH A O   1 
HETATM 4200 O O   . HOH E 3 .   ? 14.639  -11.263 -11.021 1.00 31.86 ? 349 HOH A O   1 
HETATM 4201 O O   . HOH E 3 .   ? 9.412   3.385   2.586   1.00 36.27 ? 350 HOH A O   1 
HETATM 4202 O O   . HOH E 3 .   ? -8.090  -10.152 -12.661 1.00 32.37 ? 351 HOH A O   1 
HETATM 4203 O O   . HOH E 3 .   ? 2.631   17.621  -13.465 1.00 34.75 ? 352 HOH A O   1 
HETATM 4204 O O   . HOH E 3 .   ? -4.885  -3.813  9.266   1.00 37.28 ? 353 HOH A O   1 
HETATM 4205 O O   . HOH E 3 .   ? -14.391 4.150   17.786  1.00 48.05 ? 354 HOH A O   1 
HETATM 4206 O O   . HOH E 3 .   ? -7.303  -16.511 -12.341 1.00 34.98 ? 355 HOH A O   1 
HETATM 4207 O O   . HOH E 3 .   ? 5.377   -22.208 7.597   1.00 36.31 ? 356 HOH A O   1 
HETATM 4208 O O   . HOH E 3 .   ? 7.763   6.056   -9.298  1.00 34.37 ? 357 HOH A O   1 
HETATM 4209 O O   . HOH E 3 .   ? 12.295  5.868   0.379   1.00 45.04 ? 358 HOH A O   1 
HETATM 4210 O O   . HOH E 3 .   ? -10.648 14.025  -12.993 1.00 28.12 ? 359 HOH A O   1 
HETATM 4211 O O   . HOH E 3 .   ? -7.833  22.290  7.992   1.00 45.57 ? 360 HOH A O   1 
HETATM 4212 O O   . HOH E 3 .   ? 15.119  -12.639 11.171  1.00 40.92 ? 361 HOH A O   1 
HETATM 4213 O O   . HOH E 3 .   ? 13.658  -16.338 11.672  1.00 35.05 ? 362 HOH A O   1 
HETATM 4214 O O   . HOH E 3 .   ? 23.845  -16.908 11.940  1.00 64.05 ? 363 HOH A O   1 
HETATM 4215 O O   . HOH E 3 .   ? 11.433  11.252  -2.953  1.00 43.48 ? 364 HOH A O   1 
HETATM 4216 O O   . HOH E 3 .   ? 2.310   0.723   -14.362 1.00 46.22 ? 365 HOH A O   1 
HETATM 4217 O O   . HOH E 3 .   ? -3.839  -4.087  -6.565  1.00 38.92 ? 366 HOH A O   1 
HETATM 4218 O O   . HOH E 3 .   ? -1.186  1.094   12.438  1.00 41.38 ? 367 HOH A O   1 
HETATM 4219 O O   . HOH E 3 .   ? 13.318  13.141  -2.243  1.00 76.98 ? 368 HOH A O   1 
HETATM 4220 O O   . HOH E 3 .   ? 9.417   -16.544 10.164  1.00 37.81 ? 369 HOH A O   1 
HETATM 4221 O O   . HOH E 3 .   ? 1.720   15.220  -16.405 1.00 40.16 ? 370 HOH A O   1 
HETATM 4222 O O   . HOH E 3 .   ? 22.474  -11.252 10.660  1.00 48.45 ? 371 HOH A O   1 
HETATM 4223 O O   . HOH E 3 .   ? 11.711  3.615   -4.567  1.00 42.23 ? 372 HOH A O   1 
HETATM 4224 O O   . HOH E 3 .   ? -1.100  27.319  4.850   1.00 38.93 ? 373 HOH A O   1 
HETATM 4225 O O   . HOH E 3 .   ? 15.847  -26.196 -5.651  1.00 31.77 ? 374 HOH A O   1 
HETATM 4226 O O   . HOH E 3 .   ? -13.777 -1.175  11.880  1.00 36.62 ? 375 HOH A O   1 
HETATM 4227 O O   . HOH E 3 .   ? 2.984   21.027  13.863  1.00 41.81 ? 376 HOH A O   1 
HETATM 4228 O O   . HOH E 3 .   ? -7.485  -5.275  4.743   1.00 46.49 ? 377 HOH A O   1 
HETATM 4229 O O   . HOH E 3 .   ? 1.349   -22.936 15.470  1.00 54.76 ? 378 HOH A O   1 
HETATM 4230 O O   . HOH E 3 .   ? -13.565 -0.358  14.417  1.00 47.55 ? 379 HOH A O   1 
HETATM 4231 O O   . HOH E 3 .   ? -21.200 5.896   -2.722  1.00 48.46 ? 380 HOH A O   1 
HETATM 4232 O O   . HOH E 3 .   ? 10.551  9.420   -5.275  1.00 34.96 ? 381 HOH A O   1 
HETATM 4233 O O   . HOH E 3 .   ? -23.881 -13.309 -9.517  1.00 50.44 ? 382 HOH A O   1 
HETATM 4234 O O   . HOH E 3 .   ? 10.637  -17.959 -10.228 1.00 43.04 ? 383 HOH A O   1 
HETATM 4235 O O   . HOH E 3 .   ? 8.222   -12.685 -15.133 1.00 42.63 ? 384 HOH A O   1 
HETATM 4236 O O   . HOH E 3 .   ? 5.206   -20.597 -9.937  1.00 43.23 ? 385 HOH A O   1 
HETATM 4237 O O   . HOH E 3 .   ? 24.428  -22.933 -2.991  1.00 45.56 ? 386 HOH A O   1 
HETATM 4238 O O   . HOH E 3 .   ? -2.812  -5.519  -15.362 1.00 50.13 ? 387 HOH A O   1 
HETATM 4239 O O   . HOH E 3 .   ? 8.401   13.120  -2.253  1.00 31.29 ? 388 HOH A O   1 
HETATM 4240 O O   . HOH E 3 .   ? 14.249  12.552  1.139   1.00 42.03 ? 389 HOH A O   1 
HETATM 4241 O O   . HOH E 3 .   ? -10.392 20.686  -11.091 1.00 53.32 ? 390 HOH A O   1 
HETATM 4242 O O   . HOH E 3 .   ? 4.332   20.406  -14.018 1.00 57.63 ? 391 HOH A O   1 
HETATM 4243 O O   . HOH E 3 .   ? 26.932  -23.261 -2.194  1.00 53.46 ? 392 HOH A O   1 
HETATM 4244 O O   . HOH E 3 .   ? 18.655  -17.761 9.642   1.00 45.74 ? 393 HOH A O   1 
HETATM 4245 O O   . HOH E 3 .   ? -5.762  -20.986 -14.953 1.00 51.99 ? 394 HOH A O   1 
HETATM 4246 O O   . HOH E 3 .   ? 9.007   15.106  4.798   1.00 41.64 ? 395 HOH A O   1 
HETATM 4247 O O   . HOH E 3 .   ? -3.746  3.348   13.101  1.00 43.70 ? 396 HOH A O   1 
HETATM 4248 O O   . HOH E 3 .   ? 19.775  0.253   10.228  1.00 49.57 ? 397 HOH A O   1 
HETATM 4249 O O   . HOH E 3 .   ? -11.632 22.050  -6.346  1.00 44.73 ? 398 HOH A O   1 
HETATM 4250 O O   . HOH E 3 .   ? -18.016 -7.981  3.982   1.00 42.81 ? 399 HOH A O   1 
HETATM 4251 O O   . HOH E 3 .   ? -3.120  23.680  -3.585  1.00 49.56 ? 400 HOH A O   1 
HETATM 4252 O O   . HOH E 3 .   ? -20.176 0.961   3.762   1.00 42.45 ? 401 HOH A O   1 
HETATM 4253 O O   . HOH E 3 .   ? -5.970  24.062  1.134   1.00 45.64 ? 402 HOH A O   1 
HETATM 4254 O O   . HOH E 3 .   ? 0.153   -25.507 -9.075  1.00 39.13 ? 403 HOH A O   1 
HETATM 4255 O O   . HOH E 3 .   ? 16.735  -5.860  -9.358  1.00 38.51 ? 404 HOH A O   1 
HETATM 4256 O O   . HOH E 3 .   ? 13.175  10.270  -1.356  1.00 52.84 ? 405 HOH A O   1 
HETATM 4257 O O   . HOH E 3 .   ? -12.171 -0.037  16.498  1.00 43.77 ? 406 HOH A O   1 
HETATM 4258 O O   . HOH E 3 .   ? 22.397  -16.040 14.955  1.00 45.35 ? 407 HOH A O   1 
HETATM 4259 O O   . HOH F 3 .   ? 22.100  13.540  -3.028  1.00 9.55  ? 302 HOH B O   1 
HETATM 4260 O O   . HOH F 3 .   ? 17.898  13.073  -13.922 1.00 16.44 ? 303 HOH B O   1 
HETATM 4261 O O   . HOH F 3 .   ? 15.263  18.454  -10.812 1.00 16.16 ? 304 HOH B O   1 
HETATM 4262 O O   . HOH F 3 .   ? 28.246  11.687  -5.552  1.00 15.73 ? 305 HOH B O   1 
HETATM 4263 O O   . HOH F 3 .   ? 17.260  22.507  -7.769  1.00 15.13 ? 306 HOH B O   1 
HETATM 4264 O O   . HOH F 3 .   ? 8.503   19.951  -8.594  1.00 19.50 ? 307 HOH B O   1 
HETATM 4265 O O   . HOH F 3 .   ? 29.094  15.468  -10.069 1.00 20.67 ? 308 HOH B O   1 
HETATM 4266 O O   . HOH F 3 .   ? 23.284  10.304  -22.992 1.00 23.68 ? 309 HOH B O   1 
HETATM 4267 O O   . HOH F 3 .   ? 19.011  9.242   -33.375 1.00 22.57 ? 310 HOH B O   1 
HETATM 4268 O O   . HOH F 3 .   ? 27.677  11.936  -13.249 1.00 22.32 ? 311 HOH B O   1 
HETATM 4269 O O   . HOH F 3 .   ? 18.935  10.600  -13.795 1.00 22.99 ? 312 HOH B O   1 
HETATM 4270 O O   . HOH F 3 .   ? 13.004  24.295  -20.904 1.00 25.36 ? 313 HOH B O   1 
HETATM 4271 O O   . HOH F 3 .   ? 8.423   9.760   -11.928 1.00 29.62 ? 314 HOH B O   1 
HETATM 4272 O O   . HOH F 3 .   ? 14.782  9.606   -42.323 1.00 23.34 ? 315 HOH B O   1 
HETATM 4273 O O   . HOH F 3 .   ? 7.593   10.299  -38.705 1.00 30.55 ? 316 HOH B O   1 
HETATM 4274 O O   . HOH F 3 .   ? 6.780   18.530  -7.274  1.00 20.35 ? 317 HOH B O   1 
HETATM 4275 O O   . HOH F 3 .   ? 17.692  15.769  -5.879  1.00 25.14 ? 318 HOH B O   1 
HETATM 4276 O O   . HOH F 3 .   ? 5.289   14.770  -19.554 1.00 28.20 ? 319 HOH B O   1 
HETATM 4277 O O   . HOH F 3 .   ? 24.788  5.314   -9.060  1.00 26.32 ? 320 HOH B O   1 
HETATM 4278 O O   . HOH F 3 .   ? 18.218  21.005  -31.910 1.00 25.54 ? 321 HOH B O   1 
HETATM 4279 O O   . HOH F 3 .   ? 17.222  7.698   -42.978 1.00 26.31 ? 322 HOH B O   1 
HETATM 4280 O O   . HOH F 3 .   ? 10.350  25.269  -17.959 1.00 27.86 ? 323 HOH B O   1 
HETATM 4281 O O   . HOH F 3 .   ? 25.507  3.909   -11.142 1.00 34.35 ? 324 HOH B O   1 
HETATM 4282 O O   . HOH F 3 .   ? 26.979  13.416  -1.499  1.00 32.32 ? 325 HOH B O   1 
HETATM 4283 O O   . HOH F 3 .   ? 14.118  16.775  -4.316  1.00 29.44 ? 326 HOH B O   1 
HETATM 4284 O O   . HOH F 3 .   ? 8.054   6.945   -11.750 1.00 38.37 ? 327 HOH B O   1 
HETATM 4285 O O   . HOH F 3 .   ? 15.009  28.629  -8.824  1.00 36.62 ? 328 HOH B O   1 
HETATM 4286 O O   . HOH F 3 .   ? 13.056  17.899  -44.468 1.00 40.76 ? 329 HOH B O   1 
HETATM 4287 O O   . HOH F 3 .   ? 9.224   21.164  0.999   1.00 48.00 ? 330 HOH B O   1 
HETATM 4288 O O   . HOH F 3 .   ? 4.464   15.888  -12.580 1.00 26.72 ? 331 HOH B O   1 
HETATM 4289 O O   . HOH F 3 .   ? 6.021   -3.700  -42.778 1.00 29.39 ? 332 HOH B O   1 
HETATM 4290 O O   . HOH F 3 .   ? 14.958  19.223  -1.827  1.00 34.65 ? 333 HOH B O   1 
HETATM 4291 O O   . HOH F 3 .   ? 26.395  12.251  0.923   1.00 33.84 ? 334 HOH B O   1 
HETATM 4292 O O   . HOH F 3 .   ? 12.155  -2.917  -11.035 1.00 35.04 ? 335 HOH B O   1 
HETATM 4293 O O   . HOH F 3 .   ? 13.070  26.189  -12.517 1.00 30.10 ? 336 HOH B O   1 
HETATM 4294 O O   . HOH F 3 .   ? 24.272  24.340  -8.005  1.00 30.04 ? 337 HOH B O   1 
HETATM 4295 O O   . HOH F 3 .   ? 13.870  6.688   -50.561 1.00 32.90 ? 338 HOH B O   1 
HETATM 4296 O O   . HOH F 3 .   ? 15.659  9.628   -48.828 1.00 36.61 ? 339 HOH B O   1 
HETATM 4297 O O   . HOH F 3 .   ? 21.970  11.923  -21.204 1.00 26.78 ? 340 HOH B O   1 
HETATM 4298 O O   . HOH F 3 .   ? 19.901  -9.068  -44.755 1.00 39.22 ? 341 HOH B O   1 
HETATM 4299 O O   . HOH F 3 .   ? 25.929  14.744  -39.529 1.00 55.91 ? 342 HOH B O   1 
HETATM 4300 O O   . HOH F 3 .   ? 20.704  21.661  -39.151 1.00 41.79 ? 343 HOH B O   1 
HETATM 4301 O O   . HOH F 3 .   ? 19.730  -3.011  -30.023 1.00 34.48 ? 344 HOH B O   1 
HETATM 4302 O O   . HOH F 3 .   ? 21.303  9.467   -12.783 1.00 29.31 ? 345 HOH B O   1 
HETATM 4303 O O   . HOH F 3 .   ? 16.966  24.707  -38.469 1.00 37.09 ? 346 HOH B O   1 
HETATM 4304 O O   . HOH F 3 .   ? 15.967  31.367  -21.786 1.00 38.24 ? 347 HOH B O   1 
HETATM 4305 O O   . HOH F 3 .   ? 24.991  22.469  -6.143  1.00 35.70 ? 348 HOH B O   1 
HETATM 4306 O O   . HOH F 3 .   ? 5.568   17.030  -30.530 1.00 43.94 ? 349 HOH B O   1 
HETATM 4307 O O   . HOH F 3 .   ? 24.666  13.977  -1.332  1.00 38.52 ? 350 HOH B O   1 
HETATM 4308 O O   . HOH F 3 .   ? 31.853  18.727  -24.239 1.00 36.11 ? 351 HOH B O   1 
HETATM 4309 O O   . HOH F 3 .   ? 28.685  1.206   -30.777 1.00 45.92 ? 352 HOH B O   1 
HETATM 4310 O O   . HOH F 3 .   ? 28.224  15.712  -27.379 1.00 43.31 ? 353 HOH B O   1 
HETATM 4311 O O   . HOH F 3 .   ? 10.572  8.182   -51.747 1.00 35.23 ? 354 HOH B O   1 
HETATM 4312 O O   . HOH F 3 .   ? 16.548  18.379  -31.853 1.00 39.73 ? 355 HOH B O   1 
HETATM 4313 O O   . HOH F 3 .   ? 27.324  13.303  -29.107 1.00 44.29 ? 356 HOH B O   1 
HETATM 4314 O O   . HOH F 3 .   ? 23.517  3.168   -25.237 1.00 49.28 ? 357 HOH B O   1 
HETATM 4315 O O   . HOH F 3 .   ? 28.044  11.909  -35.072 1.00 32.73 ? 358 HOH B O   1 
HETATM 4316 O O   . HOH F 3 .   ? 6.015   11.883  -11.712 1.00 31.62 ? 359 HOH B O   1 
HETATM 4317 O O   . HOH F 3 .   ? 18.857  12.236  10.000  1.00 44.90 ? 360 HOH B O   1 
HETATM 4318 O O   . HOH F 3 .   ? 26.222  24.406  -10.508 1.00 33.03 ? 361 HOH B O   1 
HETATM 4319 O O   . HOH F 3 .   ? 8.876   23.617  -31.775 1.00 57.57 ? 362 HOH B O   1 
HETATM 4320 O O   . HOH F 3 .   ? 17.058  14.685  -49.881 1.00 39.90 ? 363 HOH B O   1 
HETATM 4321 O O   . HOH F 3 .   ? 13.953  -7.181  -44.867 1.00 41.38 ? 364 HOH B O   1 
HETATM 4322 O O   . HOH F 3 .   ? 33.248  25.522  -26.718 1.00 38.46 ? 365 HOH B O   1 
HETATM 4323 O O   . HOH F 3 .   ? 15.858  -1.526  -29.094 1.00 34.98 ? 366 HOH B O   1 
HETATM 4324 O O   . HOH F 3 .   ? 17.034  27.534  -32.799 1.00 34.79 ? 367 HOH B O   1 
HETATM 4325 O O   . HOH F 3 .   ? 17.416  30.216  -30.381 1.00 34.61 ? 368 HOH B O   1 
HETATM 4326 O O   . HOH F 3 .   ? 20.858  26.981  -9.926  1.00 39.76 ? 369 HOH B O   1 
HETATM 4327 O O   . HOH F 3 .   ? 15.479  -7.002  -46.993 1.00 51.82 ? 370 HOH B O   1 
HETATM 4328 O O   . HOH F 3 .   ? 16.661  29.505  -15.880 1.00 41.77 ? 371 HOH B O   1 
HETATM 4329 O O   . HOH F 3 .   ? 29.939  10.624  -14.189 1.00 36.23 ? 372 HOH B O   1 
HETATM 4330 O O   . HOH F 3 .   ? 12.745  -9.003  -40.582 1.00 43.74 ? 373 HOH B O   1 
HETATM 4331 O O   . HOH F 3 .   ? 26.225  23.069  -40.655 1.00 45.30 ? 374 HOH B O   1 
HETATM 4332 O O   . HOH F 3 .   ? 17.662  33.822  -20.380 1.00 52.40 ? 375 HOH B O   1 
HETATM 4333 O O   . HOH F 3 .   ? 19.987  9.125   -50.406 1.00 44.28 ? 376 HOH B O   1 
HETATM 4334 O O   . HOH F 3 .   ? 18.029  2.074   -47.400 1.00 40.96 ? 377 HOH B O   1 
HETATM 4335 O O   . HOH F 3 .   ? 29.540  8.633   -29.186 1.00 43.78 ? 378 HOH B O   1 
HETATM 4336 O O   . HOH F 3 .   ? 12.973  21.533  -30.832 1.00 40.67 ? 379 HOH B O   1 
HETATM 4337 O O   . HOH F 3 .   ? 9.006   26.185  -15.290 1.00 45.42 ? 380 HOH B O   1 
HETATM 4338 O O   . HOH F 3 .   ? 17.130  7.655   -18.944 1.00 37.96 ? 381 HOH B O   1 
HETATM 4339 O O   . HOH F 3 .   ? 23.777  19.708  -3.575  1.00 59.52 ? 382 HOH B O   1 
HETATM 4340 O O   . HOH F 3 .   ? 25.969  1.261   -11.383 1.00 48.68 ? 383 HOH B O   1 
HETATM 4341 O O   . HOH F 3 .   ? 10.792  3.457   -11.692 1.00 39.10 ? 384 HOH B O   1 
HETATM 4342 O O   . HOH F 3 .   ? 15.666  26.599  -36.837 1.00 45.81 ? 385 HOH B O   1 
HETATM 4343 O O   . HOH F 3 .   ? 3.699   4.338   -44.830 1.00 42.19 ? 386 HOH B O   1 
HETATM 4344 O O   . HOH F 3 .   ? 24.525  15.009  1.129   1.00 44.72 ? 387 HOH B O   1 
HETATM 4345 O O   . HOH F 3 .   ? 2.693   -5.910  -32.886 1.00 50.55 ? 388 HOH B O   1 
HETATM 4346 O O   . HOH F 3 .   ? 18.512  -14.856 -33.545 1.00 54.13 ? 389 HOH B O   1 
HETATM 4347 O O   . HOH F 3 .   ? 17.350  -15.927 -35.360 1.00 55.55 ? 390 HOH B O   1 
HETATM 4348 O O   . HOH F 3 .   ? 15.391  6.164   -20.037 1.00 43.89 ? 391 HOH B O   1 
HETATM 4349 O O   . HOH F 3 .   ? 13.806  -9.307  -42.880 1.00 49.58 ? 392 HOH B O   1 
HETATM 4350 O O   . HOH F 3 .   ? 17.759  8.925   -16.073 1.00 47.09 ? 393 HOH B O   1 
HETATM 4351 O O   . HOH F 3 .   ? 28.073  11.921  -15.742 1.00 38.06 ? 394 HOH B O   1 
HETATM 4352 O O   . HOH F 3 .   ? 27.825  2.749   -27.946 1.00 54.96 ? 395 HOH B O   1 
HETATM 4353 O O   . HOH F 3 .   ? -2.079  4.485   -43.190 1.00 73.14 ? 396 HOH B O   1 
HETATM 4354 O O   . HOH F 3 .   ? 6.160   -9.776  -38.318 1.00 50.60 ? 397 HOH B O   1 
HETATM 4355 O O   . HOH F 3 .   ? 6.798   12.511  -19.251 1.00 65.82 ? 398 HOH B O   1 
HETATM 4356 O O   . HOH F 3 .   ? 16.361  4.344   -21.762 1.00 48.42 ? 399 HOH B O   1 
HETATM 4357 O O   . HOH F 3 .   ? 26.706  -10.834 -34.090 1.00 55.89 ? 400 HOH B O   1 
HETATM 4358 O O   . HOH F 3 .   ? 18.429  8.571   -47.209 1.00 68.84 ? 401 HOH B O   1 
HETATM 4359 O O   . HOH F 3 .   ? 26.357  10.878  -17.595 1.00 35.99 ? 402 HOH B O   1 
HETATM 4360 O O   . HOH F 3 .   ? 27.525  15.509  -37.981 1.00 39.41 ? 403 HOH B O   1 
HETATM 4361 O O   . HOH F 3 .   ? 18.321  16.641  -3.408  1.00 37.91 ? 404 HOH B O   1 
HETATM 4362 O O   . HOH F 3 .   ? 21.958  18.022  -2.446  1.00 55.58 ? 405 HOH B O   1 
HETATM 4363 O O   . HOH F 3 .   ? 16.781  2.697   -4.525  1.00 62.60 ? 406 HOH B O   1 
HETATM 4364 O O   . HOH F 3 .   ? 19.441  30.073  -39.402 1.00 46.16 ? 407 HOH B O   1 
HETATM 4365 O O   . HOH F 3 .   ? 41.361  -1.881  -53.760 1.00 50.24 ? 408 HOH B O   1 
HETATM 4366 O O   . HOH F 3 .   ? 20.084  9.416   -15.586 1.00 53.40 ? 409 HOH B O   1 
HETATM 4367 O O   . HOH F 3 .   ? 3.564   8.240   -46.351 1.00 54.86 ? 410 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   39  ?   ?   ?   A . n 
A 1 2   ARG 2   40  ?   ?   ?   A . n 
A 1 3   GLU 3   41  ?   ?   ?   A . n 
A 1 4   ALA 4   42  ?   ?   ?   A . n 
A 1 5   GLU 5   43  ?   ?   ?   A . n 
A 1 6   ALA 6   44  ?   ?   ?   A . n 
A 1 7   ARG 7   45  ?   ?   ?   A . n 
A 1 8   TRP 8   46  ?   ?   ?   A . n 
A 1 9   ARG 9   47  ?   ?   ?   A . n 
A 1 10  GLN 10  48  48  GLN GLN A . n 
A 1 11  THR 11  49  49  THR THR A . n 
A 1 12  TRP 12  50  50  TRP TRP A . n 
A 1 13  SER 13  51  51  SER SER A . n 
A 1 14  GLY 14  52  52  GLY GLY A . n 
A 1 15  PRO 15  53  53  PRO PRO A . n 
A 1 16  GLY 16  54  54  GLY GLY A . n 
A 1 17  THR 17  55  55  THR THR A . n 
A 1 18  THR 18  56  56  THR THR A . n 
A 1 19  LYS 19  57  57  LYS LYS A . n 
A 1 20  ARG 20  58  58  ARG ARG A . n 
A 1 21  PHE 21  59  59  PHE PHE A . n 
A 1 22  PRO 22  60  60  PRO PRO A . n 
A 1 23  GLU 23  61  61  GLU GLU A . n 
A 1 24  THR 24  62  62  THR THR A . n 
A 1 25  VAL 25  63  63  VAL VAL A . n 
A 1 26  LEU 26  64  64  LEU LEU A . n 
A 1 27  ALA 27  65  65  ALA ALA A . n 
A 1 28  ARG 28  66  66  ARG ARG A . n 
A 1 29  CYS 29  67  67  CYS CYS A . n 
A 1 30  VAL 30  68  68  VAL VAL A . n 
A 1 31  LYS 31  69  69  LYS LYS A . n 
A 1 32  TYR 32  70  70  TYR TYR A . n 
A 1 33  THR 33  71  71  THR THR A . n 
A 1 34  GLU 34  72  72  GLU GLU A . n 
A 1 35  ILE 35  73  73  ILE ILE A . n 
A 1 36  HIS 36  74  74  HIS HIS A . n 
A 1 37  PRO 37  75  75  PRO PRO A . n 
A 1 38  GLU 38  76  76  GLU GLU A . n 
A 1 39  MET 39  77  77  MET MET A . n 
A 1 40  ARG 40  78  78  ARG ARG A . n 
A 1 41  HIS 41  79  79  HIS HIS A . n 
A 1 42  VAL 42  80  80  VAL VAL A . n 
A 1 43  ASP 43  81  81  ASP ASP A . n 
A 1 44  CYS 44  82  82  CYS CYS A . n 
A 1 45  GLN 45  83  83  GLN GLN A . n 
A 1 46  SER 46  84  84  SER SER A . n 
A 1 47  VAL 47  85  85  VAL VAL A . n 
A 1 48  TRP 48  86  86  TRP TRP A . n 
A 1 49  ASP 49  87  87  ASP ASP A . n 
A 1 50  ALA 50  88  88  ALA ALA A . n 
A 1 51  PHE 51  89  89  PHE PHE A . n 
A 1 52  LYS 52  90  90  LYS LYS A . n 
A 1 53  GLY 53  91  91  GLY GLY A . n 
A 1 54  ALA 54  92  92  ALA ALA A . n 
A 1 55  PHE 55  93  93  PHE PHE A . n 
A 1 56  ILE 56  94  94  ILE ILE A . n 
A 1 57  SER 57  95  95  SER SER A . n 
A 1 58  LYS 58  96  96  LYS LYS A . n 
A 1 59  HIS 59  97  97  HIS HIS A . n 
A 1 60  PRO 60  98  98  PRO PRO A . n 
A 1 61  CYS 61  99  99  CYS CYS A . n 
A 1 62  ASP 62  100 100 ASP ASP A . n 
A 1 63  ILE 63  101 101 ILE ILE A . n 
A 1 64  THR 64  102 102 THR THR A . n 
A 1 65  GLU 65  103 103 GLU GLU A . n 
A 1 66  GLU 66  104 104 GLU GLU A . n 
A 1 67  ASP 67  105 105 ASP ASP A . n 
A 1 68  TYR 68  106 106 TYR TYR A . n 
A 1 69  GLN 69  107 107 GLN GLN A . n 
A 1 70  PRO 70  108 108 PRO PRO A . n 
A 1 71  LEU 71  109 109 LEU LEU A . n 
A 1 72  MET 72  110 110 MET MET A . n 
A 1 73  LYS 73  111 111 LYS LYS A . n 
A 1 74  LEU 74  112 112 LEU LEU A . n 
A 1 75  GLY 75  113 113 GLY GLY A . n 
A 1 76  THR 76  114 114 THR THR A . n 
A 1 77  GLN 77  115 115 GLN GLN A . n 
A 1 78  THR 78  116 116 THR THR A . n 
A 1 79  VAL 79  117 117 VAL VAL A . n 
A 1 80  PRO 80  118 118 PRO PRO A . n 
A 1 81  CYS 81  119 119 CYS CYS A . n 
A 1 82  ASN 82  120 120 ASN ASN A . n 
A 1 83  LYS 83  121 121 LYS LYS A . n 
A 1 84  ILE 84  122 122 ILE ILE A . n 
A 1 85  LEU 85  123 123 LEU LEU A . n 
A 1 86  LEU 86  124 124 LEU LEU A . n 
A 1 87  TRP 87  125 125 TRP TRP A . n 
A 1 88  SER 88  126 126 SER SER A . n 
A 1 89  ARG 89  127 127 ARG ARG A . n 
A 1 90  ILE 90  128 128 ILE ILE A . n 
A 1 91  LYS 91  129 129 LYS LYS A . n 
A 1 92  ASP 92  130 130 ASP ASP A . n 
A 1 93  LEU 93  131 131 LEU LEU A . n 
A 1 94  ALA 94  132 132 ALA ALA A . n 
A 1 95  HIS 95  133 133 HIS HIS A . n 
A 1 96  GLN 96  134 134 GLN GLN A . n 
A 1 97  PHE 97  135 135 PHE PHE A . n 
A 1 98  THR 98  136 136 THR THR A . n 
A 1 99  GLN 99  137 137 GLN GLN A . n 
A 1 100 VAL 100 138 138 VAL VAL A . n 
A 1 101 GLN 101 139 139 GLN GLN A . n 
A 1 102 ARG 102 140 140 ARG ARG A . n 
A 1 103 ASP 103 141 141 ASP ASP A . n 
A 1 104 MET 104 142 142 MET MET A . n 
A 1 105 PHE 105 143 143 PHE PHE A . n 
A 1 106 THR 106 144 144 THR THR A . n 
A 1 107 LEU 107 145 145 LEU LEU A . n 
A 1 108 GLU 108 146 146 GLU GLU A . n 
A 1 109 ASP 109 147 147 ASP ASP A . n 
A 1 110 THR 110 148 148 THR THR A . n 
A 1 111 LEU 111 149 149 LEU LEU A . n 
A 1 112 LEU 112 150 150 LEU LEU A . n 
A 1 113 GLY 113 151 151 GLY GLY A . n 
A 1 114 TYR 114 152 152 TYR TYR A . n 
A 1 115 LEU 115 153 153 LEU LEU A . n 
A 1 116 ALA 116 154 154 ALA ALA A . n 
A 1 117 ASP 117 155 155 ASP ASP A . n 
A 1 118 ASP 118 156 156 ASP ASP A . n 
A 1 119 LEU 119 157 157 LEU LEU A . n 
A 1 120 THR 120 158 158 THR THR A . n 
A 1 121 TRP 121 159 159 TRP TRP A . n 
A 1 122 CYS 122 160 160 CYS CYS A . n 
A 1 123 GLY 123 161 161 GLY GLY A . n 
A 1 124 GLU 124 162 162 GLU GLU A . n 
A 1 125 PHE 125 163 163 PHE PHE A . n 
A 1 126 ASP 126 164 164 ASP ASP A . n 
A 1 127 THR 127 165 165 THR THR A . n 
A 1 128 SER 128 166 166 SER SER A . n 
A 1 129 LYS 129 167 167 LYS LYS A . n 
A 1 130 ILE 130 168 168 ILE ILE A . n 
A 1 131 ASN 131 169 169 ASN ASN A . n 
A 1 132 TYR 132 170 170 TYR TYR A . n 
A 1 133 GLN 133 171 171 GLN GLN A . n 
A 1 134 SER 134 172 172 SER SER A . n 
A 1 135 CYS 135 173 173 CYS CYS A . n 
A 1 136 PRO 136 174 174 PRO PRO A . n 
A 1 137 ASP 137 175 175 ASP ASP A . n 
A 1 138 TRP 138 176 176 TRP TRP A . n 
A 1 139 ARG 139 177 177 ARG ARG A . n 
A 1 140 LYS 140 178 178 LYS LYS A . n 
A 1 141 ASP 141 179 179 ASP ASP A . n 
A 1 142 CYS 142 180 180 CYS CYS A . n 
A 1 143 SER 143 181 181 SER SER A . n 
A 1 144 ASN 144 182 182 ASN ASN A . n 
A 1 145 ASN 145 183 183 ASN ASN A . n 
A 1 146 PRO 146 184 184 PRO PRO A . n 
A 1 147 VAL 147 185 185 VAL VAL A . n 
A 1 148 SER 148 186 186 SER SER A . n 
A 1 149 VAL 149 187 187 VAL VAL A . n 
A 1 150 PHE 150 188 188 PHE PHE A . n 
A 1 151 TRP 151 189 189 TRP TRP A . n 
A 1 152 LYS 152 190 190 LYS LYS A . n 
A 1 153 THR 153 191 191 THR THR A . n 
A 1 154 VAL 154 192 192 VAL VAL A . n 
A 1 155 SER 155 193 193 SER SER A . n 
A 1 156 ARG 156 194 194 ARG ARG A . n 
A 1 157 ARG 157 195 195 ARG ARG A . n 
A 1 158 PHE 158 196 196 PHE PHE A . n 
A 1 159 ALA 159 197 197 ALA ALA A . n 
A 1 160 GLU 160 198 198 GLU GLU A . n 
A 1 161 ALA 161 199 199 ALA ALA A . n 
A 1 162 ALA 162 200 200 ALA ALA A . n 
A 1 163 CYS 163 201 201 CYS CYS A . n 
A 1 164 ASP 164 202 202 ASP ASP A . n 
A 1 165 VAL 165 203 203 VAL VAL A . n 
A 1 166 VAL 166 204 204 VAL VAL A . n 
A 1 167 HIS 167 205 205 HIS HIS A . n 
A 1 168 VAL 168 206 206 VAL VAL A . n 
A 1 169 MET 169 207 207 MET MET A . n 
A 1 170 LEU 170 208 208 LEU LEU A . n 
A 1 171 ASP 171 209 209 ASP ASP A . n 
A 1 172 GLY 172 210 210 GLY GLY A . n 
A 1 173 SER 173 211 211 SER SER A . n 
A 1 174 ARG 174 212 212 ARG ARG A . n 
A 1 175 SER 175 213 213 SER SER A . n 
A 1 176 LYS 176 214 214 LYS LYS A . n 
A 1 177 ILE 177 215 215 ILE ILE A . n 
A 1 178 PHE 178 216 216 PHE PHE A . n 
A 1 179 ASP 179 217 217 ASP ASP A . n 
A 1 180 LYS 180 218 218 LYS LYS A . n 
A 1 181 ASP 181 219 219 ASP ASP A . n 
A 1 182 SER 182 220 220 SER SER A . n 
A 1 183 THR 183 221 221 THR THR A . n 
A 1 184 PHE 184 222 222 PHE PHE A . n 
A 1 185 GLY 185 223 223 GLY GLY A . n 
A 1 186 SER 186 224 224 SER SER A . n 
A 1 187 VAL 187 225 225 VAL VAL A . n 
A 1 188 GLN 188 226 226 GLN GLN A . n 
A 1 189 VAL 189 227 227 VAL VAL A . n 
A 1 190 HIS 190 228 228 HIS HIS A . n 
A 1 191 ASN 191 229 229 ASN ASN A . n 
A 1 192 LEU 192 230 230 LEU LEU A . n 
A 1 193 GLN 193 231 231 GLN GLN A . n 
A 1 194 PRO 194 232 232 PRO PRO A . n 
A 1 195 GLU 195 233 233 GLU GLU A . n 
A 1 196 LYS 196 234 234 LYS LYS A . n 
A 1 197 VAL 197 235 235 VAL VAL A . n 
A 1 198 GLN 198 236 236 GLN GLN A . n 
A 1 199 THR 199 237 237 THR THR A . n 
A 1 200 LEU 200 238 238 LEU LEU A . n 
A 1 201 GLU 201 239 239 GLU GLU A . n 
A 1 202 ALA 202 240 240 ALA ALA A . n 
A 1 203 TRP 203 241 241 TRP TRP A . n 
A 1 204 VAL 204 242 242 VAL VAL A . n 
A 1 205 ILE 205 243 243 ILE ILE A . n 
A 1 206 HIS 206 244 244 HIS HIS A . n 
A 1 207 GLY 207 245 245 GLY GLY A . n 
A 1 208 GLY 208 246 246 GLY GLY A . n 
A 1 209 ARG 209 247 247 ARG ARG A . n 
A 1 210 GLU 210 248 248 GLU GLU A . n 
A 1 211 ASP 211 249 249 ASP ASP A . n 
A 1 212 SER 212 250 250 SER SER A . n 
A 1 213 ARG 213 251 251 ARG ARG A . n 
A 1 214 ASP 214 252 252 ASP ASP A . n 
A 1 215 LEU 215 253 253 LEU LEU A . n 
A 1 216 CYS 216 254 254 CYS CYS A . n 
A 1 217 GLN 217 255 255 GLN GLN A . n 
A 1 218 ASP 218 256 256 ASP ASP A . n 
A 1 219 PRO 219 257 257 PRO PRO A . n 
A 1 220 THR 220 258 258 THR THR A . n 
A 1 221 ILE 221 259 259 ILE ILE A . n 
A 1 222 LYS 222 260 260 LYS LYS A . n 
A 1 223 GLU 223 261 261 GLU GLU A . n 
A 1 224 LEU 224 262 262 LEU LEU A . n 
A 1 225 GLU 225 263 263 GLU GLU A . n 
A 1 226 SER 226 264 264 SER SER A . n 
A 1 227 ILE 227 265 265 ILE ILE A . n 
A 1 228 ILE 228 266 266 ILE ILE A . n 
A 1 229 SER 229 267 267 SER SER A . n 
A 1 230 LYS 230 268 268 LYS LYS A . n 
A 1 231 ARG 231 269 269 ARG ARG A . n 
A 1 232 ASN 232 270 270 ASN ASN A . n 
A 1 233 ILE 233 271 271 ILE ILE A . n 
A 1 234 GLN 234 272 272 GLN GLN A . n 
A 1 235 PHE 235 273 273 PHE PHE A . n 
A 1 236 SER 236 274 274 SER SER A . n 
A 1 237 CYS 237 275 275 CYS CYS A . n 
A 1 238 LYS 238 276 276 LYS LYS A . n 
A 1 239 ASN 239 277 277 ASN ASN A . n 
A 1 240 ILE 240 278 278 ILE ILE A . n 
A 1 241 TYR 241 279 279 TYR TYR A . n 
A 1 242 ARG 242 280 280 ARG ARG A . n 
A 1 243 PRO 243 281 281 PRO PRO A . n 
A 1 244 ASP 244 282 282 ASP ASP A . n 
A 1 245 LYS 245 283 283 LYS LYS A . n 
A 1 246 PHE 246 284 284 PHE PHE A . n 
A 1 247 LEU 247 285 285 LEU LEU A . n 
A 1 248 GLN 248 286 286 GLN GLN A . n 
A 1 249 CYS 249 287 287 CYS CYS A . n 
A 1 250 VAL 250 288 288 VAL VAL A . n 
A 1 251 LYS 251 289 289 LYS LYS A . n 
A 1 252 ASN 252 290 290 ASN ASN A . n 
A 1 253 PRO 253 291 291 PRO PRO A . n 
A 1 254 GLU 254 292 292 GLU GLU A . n 
A 1 255 ASP 255 293 293 ASP ASP A . n 
A 1 256 SER 256 294 294 SER SER A . n 
A 1 257 SER 257 295 295 SER SER A . n 
A 1 258 CYS 258 296 296 CYS CYS A . n 
A 1 259 THR 259 297 ?   ?   ?   A . n 
A 1 260 SER 260 298 ?   ?   ?   A . n 
A 1 261 GLU 261 299 ?   ?   ?   A . n 
A 1 262 ILE 262 300 ?   ?   ?   A . n 
B 1 1   LYS 1   39  ?   ?   ?   B . n 
B 1 2   ARG 2   40  ?   ?   ?   B . n 
B 1 3   GLU 3   41  ?   ?   ?   B . n 
B 1 4   ALA 4   42  ?   ?   ?   B . n 
B 1 5   GLU 5   43  ?   ?   ?   B . n 
B 1 6   ALA 6   44  ?   ?   ?   B . n 
B 1 7   ARG 7   45  45  ARG ARG B . n 
B 1 8   TRP 8   46  46  TRP TRP B . n 
B 1 9   ARG 9   47  47  ARG ARG B . n 
B 1 10  GLN 10  48  48  GLN GLN B . n 
B 1 11  THR 11  49  49  THR THR B . n 
B 1 12  TRP 12  50  50  TRP TRP B . n 
B 1 13  SER 13  51  51  SER SER B . n 
B 1 14  GLY 14  52  52  GLY GLY B . n 
B 1 15  PRO 15  53  53  PRO PRO B . n 
B 1 16  GLY 16  54  54  GLY GLY B . n 
B 1 17  THR 17  55  55  THR THR B . n 
B 1 18  THR 18  56  56  THR THR B . n 
B 1 19  LYS 19  57  57  LYS LYS B . n 
B 1 20  ARG 20  58  58  ARG ARG B . n 
B 1 21  PHE 21  59  59  PHE PHE B . n 
B 1 22  PRO 22  60  60  PRO PRO B . n 
B 1 23  GLU 23  61  61  GLU GLU B . n 
B 1 24  THR 24  62  62  THR THR B . n 
B 1 25  VAL 25  63  63  VAL VAL B . n 
B 1 26  LEU 26  64  64  LEU LEU B . n 
B 1 27  ALA 27  65  65  ALA ALA B . n 
B 1 28  ARG 28  66  66  ARG ARG B . n 
B 1 29  CYS 29  67  67  CYS CYS B . n 
B 1 30  VAL 30  68  68  VAL VAL B . n 
B 1 31  LYS 31  69  69  LYS LYS B . n 
B 1 32  TYR 32  70  70  TYR TYR B . n 
B 1 33  THR 33  71  71  THR THR B . n 
B 1 34  GLU 34  72  72  GLU GLU B . n 
B 1 35  ILE 35  73  73  ILE ILE B . n 
B 1 36  HIS 36  74  74  HIS HIS B . n 
B 1 37  PRO 37  75  75  PRO PRO B . n 
B 1 38  GLU 38  76  76  GLU GLU B . n 
B 1 39  MET 39  77  77  MET MET B . n 
B 1 40  ARG 40  78  78  ARG ARG B . n 
B 1 41  HIS 41  79  79  HIS HIS B . n 
B 1 42  VAL 42  80  80  VAL VAL B . n 
B 1 43  ASP 43  81  81  ASP ASP B . n 
B 1 44  CYS 44  82  82  CYS CYS B . n 
B 1 45  GLN 45  83  83  GLN GLN B . n 
B 1 46  SER 46  84  84  SER SER B . n 
B 1 47  VAL 47  85  85  VAL VAL B . n 
B 1 48  TRP 48  86  86  TRP TRP B . n 
B 1 49  ASP 49  87  87  ASP ASP B . n 
B 1 50  ALA 50  88  88  ALA ALA B . n 
B 1 51  PHE 51  89  89  PHE PHE B . n 
B 1 52  LYS 52  90  90  LYS LYS B . n 
B 1 53  GLY 53  91  91  GLY GLY B . n 
B 1 54  ALA 54  92  92  ALA ALA B . n 
B 1 55  PHE 55  93  93  PHE PHE B . n 
B 1 56  ILE 56  94  94  ILE ILE B . n 
B 1 57  SER 57  95  95  SER SER B . n 
B 1 58  LYS 58  96  96  LYS LYS B . n 
B 1 59  HIS 59  97  97  HIS HIS B . n 
B 1 60  PRO 60  98  98  PRO PRO B . n 
B 1 61  CYS 61  99  99  CYS CYS B . n 
B 1 62  ASP 62  100 100 ASP ASP B . n 
B 1 63  ILE 63  101 101 ILE ILE B . n 
B 1 64  THR 64  102 102 THR THR B . n 
B 1 65  GLU 65  103 103 GLU GLU B . n 
B 1 66  GLU 66  104 104 GLU GLU B . n 
B 1 67  ASP 67  105 105 ASP ASP B . n 
B 1 68  TYR 68  106 106 TYR TYR B . n 
B 1 69  GLN 69  107 107 GLN GLN B . n 
B 1 70  PRO 70  108 108 PRO PRO B . n 
B 1 71  LEU 71  109 109 LEU LEU B . n 
B 1 72  MET 72  110 110 MET MET B . n 
B 1 73  LYS 73  111 111 LYS LYS B . n 
B 1 74  LEU 74  112 112 LEU LEU B . n 
B 1 75  GLY 75  113 113 GLY GLY B . n 
B 1 76  THR 76  114 114 THR THR B . n 
B 1 77  GLN 77  115 115 GLN GLN B . n 
B 1 78  THR 78  116 116 THR THR B . n 
B 1 79  VAL 79  117 117 VAL VAL B . n 
B 1 80  PRO 80  118 118 PRO PRO B . n 
B 1 81  CYS 81  119 119 CYS CYS B . n 
B 1 82  ASN 82  120 120 ASN ASN B . n 
B 1 83  LYS 83  121 121 LYS LYS B . n 
B 1 84  ILE 84  122 122 ILE ILE B . n 
B 1 85  LEU 85  123 123 LEU LEU B . n 
B 1 86  LEU 86  124 124 LEU LEU B . n 
B 1 87  TRP 87  125 125 TRP TRP B . n 
B 1 88  SER 88  126 126 SER SER B . n 
B 1 89  ARG 89  127 127 ARG ARG B . n 
B 1 90  ILE 90  128 128 ILE ILE B . n 
B 1 91  LYS 91  129 129 LYS LYS B . n 
B 1 92  ASP 92  130 130 ASP ASP B . n 
B 1 93  LEU 93  131 131 LEU LEU B . n 
B 1 94  ALA 94  132 132 ALA ALA B . n 
B 1 95  HIS 95  133 133 HIS HIS B . n 
B 1 96  GLN 96  134 134 GLN GLN B . n 
B 1 97  PHE 97  135 135 PHE PHE B . n 
B 1 98  THR 98  136 136 THR THR B . n 
B 1 99  GLN 99  137 137 GLN GLN B . n 
B 1 100 VAL 100 138 138 VAL VAL B . n 
B 1 101 GLN 101 139 139 GLN GLN B . n 
B 1 102 ARG 102 140 140 ARG ARG B . n 
B 1 103 ASP 103 141 141 ASP ASP B . n 
B 1 104 MET 104 142 142 MET MET B . n 
B 1 105 PHE 105 143 143 PHE PHE B . n 
B 1 106 THR 106 144 144 THR THR B . n 
B 1 107 LEU 107 145 145 LEU LEU B . n 
B 1 108 GLU 108 146 146 GLU GLU B . n 
B 1 109 ASP 109 147 147 ASP ASP B . n 
B 1 110 THR 110 148 148 THR THR B . n 
B 1 111 LEU 111 149 149 LEU LEU B . n 
B 1 112 LEU 112 150 150 LEU LEU B . n 
B 1 113 GLY 113 151 151 GLY GLY B . n 
B 1 114 TYR 114 152 152 TYR TYR B . n 
B 1 115 LEU 115 153 153 LEU LEU B . n 
B 1 116 ALA 116 154 154 ALA ALA B . n 
B 1 117 ASP 117 155 155 ASP ASP B . n 
B 1 118 ASP 118 156 156 ASP ASP B . n 
B 1 119 LEU 119 157 157 LEU LEU B . n 
B 1 120 THR 120 158 158 THR THR B . n 
B 1 121 TRP 121 159 159 TRP TRP B . n 
B 1 122 CYS 122 160 160 CYS CYS B . n 
B 1 123 GLY 123 161 161 GLY GLY B . n 
B 1 124 GLU 124 162 162 GLU GLU B . n 
B 1 125 PHE 125 163 163 PHE PHE B . n 
B 1 126 ASP 126 164 164 ASP ASP B . n 
B 1 127 THR 127 165 165 THR THR B . n 
B 1 128 SER 128 166 166 SER SER B . n 
B 1 129 LYS 129 167 167 LYS LYS B . n 
B 1 130 ILE 130 168 168 ILE ILE B . n 
B 1 131 ASN 131 169 169 ASN ASN B . n 
B 1 132 TYR 132 170 170 TYR TYR B . n 
B 1 133 GLN 133 171 171 GLN GLN B . n 
B 1 134 SER 134 172 172 SER SER B . n 
B 1 135 CYS 135 173 173 CYS CYS B . n 
B 1 136 PRO 136 174 174 PRO PRO B . n 
B 1 137 ASP 137 175 175 ASP ASP B . n 
B 1 138 TRP 138 176 176 TRP TRP B . n 
B 1 139 ARG 139 177 177 ARG ARG B . n 
B 1 140 LYS 140 178 178 LYS LYS B . n 
B 1 141 ASP 141 179 179 ASP ASP B . n 
B 1 142 CYS 142 180 180 CYS CYS B . n 
B 1 143 SER 143 181 181 SER SER B . n 
B 1 144 ASN 144 182 182 ASN ASN B . n 
B 1 145 ASN 145 183 183 ASN ASN B . n 
B 1 146 PRO 146 184 184 PRO PRO B . n 
B 1 147 VAL 147 185 185 VAL VAL B . n 
B 1 148 SER 148 186 186 SER SER B . n 
B 1 149 VAL 149 187 187 VAL VAL B . n 
B 1 150 PHE 150 188 188 PHE PHE B . n 
B 1 151 TRP 151 189 189 TRP TRP B . n 
B 1 152 LYS 152 190 190 LYS LYS B . n 
B 1 153 THR 153 191 191 THR THR B . n 
B 1 154 VAL 154 192 192 VAL VAL B . n 
B 1 155 SER 155 193 193 SER SER B . n 
B 1 156 ARG 156 194 194 ARG ARG B . n 
B 1 157 ARG 157 195 195 ARG ARG B . n 
B 1 158 PHE 158 196 196 PHE PHE B . n 
B 1 159 ALA 159 197 197 ALA ALA B . n 
B 1 160 GLU 160 198 198 GLU GLU B . n 
B 1 161 ALA 161 199 199 ALA ALA B . n 
B 1 162 ALA 162 200 200 ALA ALA B . n 
B 1 163 CYS 163 201 201 CYS CYS B . n 
B 1 164 ASP 164 202 202 ASP ASP B . n 
B 1 165 VAL 165 203 203 VAL VAL B . n 
B 1 166 VAL 166 204 204 VAL VAL B . n 
B 1 167 HIS 167 205 205 HIS HIS B . n 
B 1 168 VAL 168 206 206 VAL VAL B . n 
B 1 169 MET 169 207 207 MET MET B . n 
B 1 170 LEU 170 208 208 LEU LEU B . n 
B 1 171 ASP 171 209 209 ASP ASP B . n 
B 1 172 GLY 172 210 210 GLY GLY B . n 
B 1 173 SER 173 211 211 SER SER B . n 
B 1 174 ARG 174 212 212 ARG ARG B . n 
B 1 175 SER 175 213 213 SER SER B . n 
B 1 176 LYS 176 214 214 LYS LYS B . n 
B 1 177 ILE 177 215 215 ILE ILE B . n 
B 1 178 PHE 178 216 216 PHE PHE B . n 
B 1 179 ASP 179 217 217 ASP ASP B . n 
B 1 180 LYS 180 218 218 LYS LYS B . n 
B 1 181 ASP 181 219 219 ASP ASP B . n 
B 1 182 SER 182 220 220 SER SER B . n 
B 1 183 THR 183 221 221 THR THR B . n 
B 1 184 PHE 184 222 222 PHE PHE B . n 
B 1 185 GLY 185 223 223 GLY GLY B . n 
B 1 186 SER 186 224 224 SER SER B . n 
B 1 187 VAL 187 225 225 VAL VAL B . n 
B 1 188 GLN 188 226 226 GLN GLN B . n 
B 1 189 VAL 189 227 227 VAL VAL B . n 
B 1 190 HIS 190 228 228 HIS HIS B . n 
B 1 191 ASN 191 229 229 ASN ASN B . n 
B 1 192 LEU 192 230 230 LEU LEU B . n 
B 1 193 GLN 193 231 231 GLN GLN B . n 
B 1 194 PRO 194 232 232 PRO PRO B . n 
B 1 195 GLU 195 233 233 GLU GLU B . n 
B 1 196 LYS 196 234 234 LYS LYS B . n 
B 1 197 VAL 197 235 235 VAL VAL B . n 
B 1 198 GLN 198 236 236 GLN GLN B . n 
B 1 199 THR 199 237 237 THR THR B . n 
B 1 200 LEU 200 238 238 LEU LEU B . n 
B 1 201 GLU 201 239 239 GLU GLU B . n 
B 1 202 ALA 202 240 240 ALA ALA B . n 
B 1 203 TRP 203 241 241 TRP TRP B . n 
B 1 204 VAL 204 242 242 VAL VAL B . n 
B 1 205 ILE 205 243 243 ILE ILE B . n 
B 1 206 HIS 206 244 244 HIS HIS B . n 
B 1 207 GLY 207 245 245 GLY GLY B . n 
B 1 208 GLY 208 246 246 GLY GLY B . n 
B 1 209 ARG 209 247 247 ARG ARG B . n 
B 1 210 GLU 210 248 248 GLU GLU B . n 
B 1 211 ASP 211 249 249 ASP ASP B . n 
B 1 212 SER 212 250 250 SER SER B . n 
B 1 213 ARG 213 251 251 ARG ARG B . n 
B 1 214 ASP 214 252 252 ASP ASP B . n 
B 1 215 LEU 215 253 253 LEU LEU B . n 
B 1 216 CYS 216 254 254 CYS CYS B . n 
B 1 217 GLN 217 255 255 GLN GLN B . n 
B 1 218 ASP 218 256 256 ASP ASP B . n 
B 1 219 PRO 219 257 257 PRO PRO B . n 
B 1 220 THR 220 258 258 THR THR B . n 
B 1 221 ILE 221 259 259 ILE ILE B . n 
B 1 222 LYS 222 260 260 LYS LYS B . n 
B 1 223 GLU 223 261 261 GLU GLU B . n 
B 1 224 LEU 224 262 262 LEU LEU B . n 
B 1 225 GLU 225 263 263 GLU GLU B . n 
B 1 226 SER 226 264 264 SER SER B . n 
B 1 227 ILE 227 265 265 ILE ILE B . n 
B 1 228 ILE 228 266 266 ILE ILE B . n 
B 1 229 SER 229 267 267 SER SER B . n 
B 1 230 LYS 230 268 268 LYS LYS B . n 
B 1 231 ARG 231 269 269 ARG ARG B . n 
B 1 232 ASN 232 270 270 ASN ASN B . n 
B 1 233 ILE 233 271 271 ILE ILE B . n 
B 1 234 GLN 234 272 272 GLN GLN B . n 
B 1 235 PHE 235 273 273 PHE PHE B . n 
B 1 236 SER 236 274 274 SER SER B . n 
B 1 237 CYS 237 275 275 CYS CYS B . n 
B 1 238 LYS 238 276 276 LYS LYS B . n 
B 1 239 ASN 239 277 277 ASN ASN B . n 
B 1 240 ILE 240 278 278 ILE ILE B . n 
B 1 241 TYR 241 279 279 TYR TYR B . n 
B 1 242 ARG 242 280 280 ARG ARG B . n 
B 1 243 PRO 243 281 281 PRO PRO B . n 
B 1 244 ASP 244 282 282 ASP ASP B . n 
B 1 245 LYS 245 283 283 LYS LYS B . n 
B 1 246 PHE 246 284 284 PHE PHE B . n 
B 1 247 LEU 247 285 285 LEU LEU B . n 
B 1 248 GLN 248 286 286 GLN GLN B . n 
B 1 249 CYS 249 287 287 CYS CYS B . n 
B 1 250 VAL 250 288 288 VAL VAL B . n 
B 1 251 LYS 251 289 289 LYS LYS B . n 
B 1 252 ASN 252 290 290 ASN ASN B . n 
B 1 253 PRO 253 291 291 PRO PRO B . n 
B 1 254 GLU 254 292 292 GLU GLU B . n 
B 1 255 ASP 255 293 293 ASP ASP B . n 
B 1 256 SER 256 294 294 SER SER B . n 
B 1 257 SER 257 295 295 SER SER B . n 
B 1 258 CYS 258 296 296 CYS CYS B . n 
B 1 259 THR 259 297 ?   ?   ?   B . n 
B 1 260 SER 260 298 ?   ?   ?   B . n 
B 1 261 GLU 261 299 ?   ?   ?   B . n 
B 1 262 ILE 262 300 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAD 1   301 301 NAD NAD A . 
D 2 NAD 1   301 301 NAD NAD B . 
E 3 HOH 1   302 2   HOH HOH A . 
E 3 HOH 2   303 3   HOH HOH A . 
E 3 HOH 3   304 4   HOH HOH A . 
E 3 HOH 4   305 6   HOH HOH A . 
E 3 HOH 5   306 9   HOH HOH A . 
E 3 HOH 6   307 12  HOH HOH A . 
E 3 HOH 7   308 14  HOH HOH A . 
E 3 HOH 8   309 17  HOH HOH A . 
E 3 HOH 9   310 18  HOH HOH A . 
E 3 HOH 10  311 22  HOH HOH A . 
E 3 HOH 11  312 23  HOH HOH A . 
E 3 HOH 12  313 24  HOH HOH A . 
E 3 HOH 13  314 25  HOH HOH A . 
E 3 HOH 14  315 26  HOH HOH A . 
E 3 HOH 15  316 28  HOH HOH A . 
E 3 HOH 16  317 31  HOH HOH A . 
E 3 HOH 17  318 32  HOH HOH A . 
E 3 HOH 18  319 33  HOH HOH A . 
E 3 HOH 19  320 38  HOH HOH A . 
E 3 HOH 20  321 42  HOH HOH A . 
E 3 HOH 21  322 44  HOH HOH A . 
E 3 HOH 22  323 46  HOH HOH A . 
E 3 HOH 23  324 48  HOH HOH A . 
E 3 HOH 24  325 49  HOH HOH A . 
E 3 HOH 25  326 50  HOH HOH A . 
E 3 HOH 26  327 51  HOH HOH A . 
E 3 HOH 27  328 53  HOH HOH A . 
E 3 HOH 28  329 54  HOH HOH A . 
E 3 HOH 29  330 57  HOH HOH A . 
E 3 HOH 30  331 58  HOH HOH A . 
E 3 HOH 31  332 59  HOH HOH A . 
E 3 HOH 32  333 62  HOH HOH A . 
E 3 HOH 33  334 64  HOH HOH A . 
E 3 HOH 34  335 67  HOH HOH A . 
E 3 HOH 35  336 68  HOH HOH A . 
E 3 HOH 36  337 69  HOH HOH A . 
E 3 HOH 37  338 71  HOH HOH A . 
E 3 HOH 38  339 72  HOH HOH A . 
E 3 HOH 39  340 75  HOH HOH A . 
E 3 HOH 40  341 80  HOH HOH A . 
E 3 HOH 41  342 82  HOH HOH A . 
E 3 HOH 42  343 83  HOH HOH A . 
E 3 HOH 43  344 84  HOH HOH A . 
E 3 HOH 44  345 85  HOH HOH A . 
E 3 HOH 45  346 86  HOH HOH A . 
E 3 HOH 46  347 90  HOH HOH A . 
E 3 HOH 47  348 92  HOH HOH A . 
E 3 HOH 48  349 93  HOH HOH A . 
E 3 HOH 49  350 99  HOH HOH A . 
E 3 HOH 50  351 100 HOH HOH A . 
E 3 HOH 51  352 102 HOH HOH A . 
E 3 HOH 52  353 104 HOH HOH A . 
E 3 HOH 53  354 106 HOH HOH A . 
E 3 HOH 54  355 107 HOH HOH A . 
E 3 HOH 55  356 108 HOH HOH A . 
E 3 HOH 56  357 109 HOH HOH A . 
E 3 HOH 57  358 113 HOH HOH A . 
E 3 HOH 58  359 114 HOH HOH A . 
E 3 HOH 59  360 115 HOH HOH A . 
E 3 HOH 60  361 116 HOH HOH A . 
E 3 HOH 61  362 117 HOH HOH A . 
E 3 HOH 62  363 124 HOH HOH A . 
E 3 HOH 63  364 125 HOH HOH A . 
E 3 HOH 64  365 126 HOH HOH A . 
E 3 HOH 65  366 127 HOH HOH A . 
E 3 HOH 66  367 128 HOH HOH A . 
E 3 HOH 67  368 132 HOH HOH A . 
E 3 HOH 68  369 134 HOH HOH A . 
E 3 HOH 69  370 136 HOH HOH A . 
E 3 HOH 70  371 137 HOH HOH A . 
E 3 HOH 71  372 138 HOH HOH A . 
E 3 HOH 72  373 142 HOH HOH A . 
E 3 HOH 73  374 144 HOH HOH A . 
E 3 HOH 74  375 146 HOH HOH A . 
E 3 HOH 75  376 147 HOH HOH A . 
E 3 HOH 76  377 153 HOH HOH A . 
E 3 HOH 77  378 160 HOH HOH A . 
E 3 HOH 78  379 163 HOH HOH A . 
E 3 HOH 79  380 166 HOH HOH A . 
E 3 HOH 80  381 168 HOH HOH A . 
E 3 HOH 81  382 169 HOH HOH A . 
E 3 HOH 82  383 171 HOH HOH A . 
E 3 HOH 83  384 174 HOH HOH A . 
E 3 HOH 84  385 178 HOH HOH A . 
E 3 HOH 85  386 179 HOH HOH A . 
E 3 HOH 86  387 186 HOH HOH A . 
E 3 HOH 87  388 188 HOH HOH A . 
E 3 HOH 88  389 190 HOH HOH A . 
E 3 HOH 89  390 192 HOH HOH A . 
E 3 HOH 90  391 196 HOH HOH A . 
E 3 HOH 91  392 197 HOH HOH A . 
E 3 HOH 92  393 198 HOH HOH A . 
E 3 HOH 93  394 199 HOH HOH A . 
E 3 HOH 94  395 200 HOH HOH A . 
E 3 HOH 95  396 203 HOH HOH A . 
E 3 HOH 96  397 204 HOH HOH A . 
E 3 HOH 97  398 205 HOH HOH A . 
E 3 HOH 98  399 207 HOH HOH A . 
E 3 HOH 99  400 210 HOH HOH A . 
E 3 HOH 100 401 212 HOH HOH A . 
E 3 HOH 101 402 213 HOH HOH A . 
E 3 HOH 102 403 218 HOH HOH A . 
E 3 HOH 103 404 219 HOH HOH A . 
E 3 HOH 104 405 220 HOH HOH A . 
E 3 HOH 105 406 221 HOH HOH A . 
E 3 HOH 106 407 224 HOH HOH A . 
F 3 HOH 1   302 1   HOH HOH B . 
F 3 HOH 2   303 5   HOH HOH B . 
F 3 HOH 3   304 7   HOH HOH B . 
F 3 HOH 4   305 8   HOH HOH B . 
F 3 HOH 5   306 10  HOH HOH B . 
F 3 HOH 6   307 11  HOH HOH B . 
F 3 HOH 7   308 13  HOH HOH B . 
F 3 HOH 8   309 15  HOH HOH B . 
F 3 HOH 9   310 16  HOH HOH B . 
F 3 HOH 10  311 19  HOH HOH B . 
F 3 HOH 11  312 20  HOH HOH B . 
F 3 HOH 12  313 21  HOH HOH B . 
F 3 HOH 13  314 27  HOH HOH B . 
F 3 HOH 14  315 29  HOH HOH B . 
F 3 HOH 15  316 30  HOH HOH B . 
F 3 HOH 16  317 34  HOH HOH B . 
F 3 HOH 17  318 35  HOH HOH B . 
F 3 HOH 18  319 36  HOH HOH B . 
F 3 HOH 19  320 37  HOH HOH B . 
F 3 HOH 20  321 39  HOH HOH B . 
F 3 HOH 21  322 41  HOH HOH B . 
F 3 HOH 22  323 43  HOH HOH B . 
F 3 HOH 23  324 45  HOH HOH B . 
F 3 HOH 24  325 47  HOH HOH B . 
F 3 HOH 25  326 52  HOH HOH B . 
F 3 HOH 26  327 55  HOH HOH B . 
F 3 HOH 27  328 56  HOH HOH B . 
F 3 HOH 28  329 60  HOH HOH B . 
F 3 HOH 29  330 61  HOH HOH B . 
F 3 HOH 30  331 63  HOH HOH B . 
F 3 HOH 31  332 65  HOH HOH B . 
F 3 HOH 32  333 66  HOH HOH B . 
F 3 HOH 33  334 70  HOH HOH B . 
F 3 HOH 34  335 73  HOH HOH B . 
F 3 HOH 35  336 74  HOH HOH B . 
F 3 HOH 36  337 76  HOH HOH B . 
F 3 HOH 37  338 77  HOH HOH B . 
F 3 HOH 38  339 78  HOH HOH B . 
F 3 HOH 39  340 79  HOH HOH B . 
F 3 HOH 40  341 81  HOH HOH B . 
F 3 HOH 41  342 87  HOH HOH B . 
F 3 HOH 42  343 88  HOH HOH B . 
F 3 HOH 43  344 89  HOH HOH B . 
F 3 HOH 44  345 91  HOH HOH B . 
F 3 HOH 45  346 94  HOH HOH B . 
F 3 HOH 46  347 95  HOH HOH B . 
F 3 HOH 47  348 96  HOH HOH B . 
F 3 HOH 48  349 97  HOH HOH B . 
F 3 HOH 49  350 98  HOH HOH B . 
F 3 HOH 50  351 101 HOH HOH B . 
F 3 HOH 51  352 103 HOH HOH B . 
F 3 HOH 52  353 105 HOH HOH B . 
F 3 HOH 53  354 112 HOH HOH B . 
F 3 HOH 54  355 118 HOH HOH B . 
F 3 HOH 55  356 119 HOH HOH B . 
F 3 HOH 56  357 120 HOH HOH B . 
F 3 HOH 57  358 121 HOH HOH B . 
F 3 HOH 58  359 122 HOH HOH B . 
F 3 HOH 59  360 123 HOH HOH B . 
F 3 HOH 60  361 129 HOH HOH B . 
F 3 HOH 61  362 130 HOH HOH B . 
F 3 HOH 62  363 131 HOH HOH B . 
F 3 HOH 63  364 133 HOH HOH B . 
F 3 HOH 64  365 135 HOH HOH B . 
F 3 HOH 65  366 139 HOH HOH B . 
F 3 HOH 66  367 140 HOH HOH B . 
F 3 HOH 67  368 141 HOH HOH B . 
F 3 HOH 68  369 143 HOH HOH B . 
F 3 HOH 69  370 145 HOH HOH B . 
F 3 HOH 70  371 148 HOH HOH B . 
F 3 HOH 71  372 149 HOH HOH B . 
F 3 HOH 72  373 150 HOH HOH B . 
F 3 HOH 73  374 151 HOH HOH B . 
F 3 HOH 74  375 152 HOH HOH B . 
F 3 HOH 75  376 154 HOH HOH B . 
F 3 HOH 76  377 155 HOH HOH B . 
F 3 HOH 77  378 156 HOH HOH B . 
F 3 HOH 78  379 157 HOH HOH B . 
F 3 HOH 79  380 158 HOH HOH B . 
F 3 HOH 80  381 161 HOH HOH B . 
F 3 HOH 81  382 164 HOH HOH B . 
F 3 HOH 82  383 165 HOH HOH B . 
F 3 HOH 83  384 167 HOH HOH B . 
F 3 HOH 84  385 173 HOH HOH B . 
F 3 HOH 85  386 175 HOH HOH B . 
F 3 HOH 86  387 176 HOH HOH B . 
F 3 HOH 87  388 177 HOH HOH B . 
F 3 HOH 88  389 180 HOH HOH B . 
F 3 HOH 89  390 181 HOH HOH B . 
F 3 HOH 90  391 182 HOH HOH B . 
F 3 HOH 91  392 183 HOH HOH B . 
F 3 HOH 92  393 185 HOH HOH B . 
F 3 HOH 93  394 187 HOH HOH B . 
F 3 HOH 94  395 189 HOH HOH B . 
F 3 HOH 95  396 193 HOH HOH B . 
F 3 HOH 96  397 194 HOH HOH B . 
F 3 HOH 97  398 195 HOH HOH B . 
F 3 HOH 98  399 201 HOH HOH B . 
F 3 HOH 99  400 202 HOH HOH B . 
F 3 HOH 100 401 206 HOH HOH B . 
F 3 HOH 101 402 208 HOH HOH B . 
F 3 HOH 102 403 209 HOH HOH B . 
F 3 HOH 103 404 211 HOH HOH B . 
F 3 HOH 104 405 214 HOH HOH B . 
F 3 HOH 105 406 215 HOH HOH B . 
F 3 HOH 106 407 216 HOH HOH B . 
F 3 HOH 107 408 217 HOH HOH B . 
F 3 HOH 108 409 222 HOH HOH B . 
F 3 HOH 109 410 225 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-09-05 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0005 ? 1 
ADSC     'data collection' QUANTUM  ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
MOLREP   phasing           .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 128 ? ? -142.52 46.69   
2  1 ASP A 179 ? ? -122.88 -73.99  
3  1 ASP A 202 ? ? 60.38   -123.59 
4  1 SER A 213 ? ? 81.77   -18.89  
5  1 GLU A 248 ? ? 49.91   -167.78 
6  1 SER A 295 ? ? 98.43   -16.18  
7  1 ILE B 128 ? ? -144.86 57.89   
8  1 ASP B 179 ? ? -107.09 -73.46  
9  1 ASN B 182 ? ? -96.52  56.57   
10 1 ASP B 202 ? ? 56.78   -116.08 
11 1 LYS B 214 ? ? 107.59  68.15   
12 1 ARG B 247 ? ? -78.67  39.12   
13 1 GLU B 248 ? ? 78.30   114.74  
14 1 ASP B 249 ? ? -122.41 -77.34  
15 1 SER B 250 ? ? -111.91 -149.66 
16 1 ARG B 251 ? ? -121.29 -151.33 
17 1 SER B 294 ? ? 89.09   -19.79  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    249 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   SER 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    250 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -143.61 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 39  ? A LYS 1   
2  1 Y 1 A ARG 40  ? A ARG 2   
3  1 Y 1 A GLU 41  ? A GLU 3   
4  1 Y 1 A ALA 42  ? A ALA 4   
5  1 Y 1 A GLU 43  ? A GLU 5   
6  1 Y 1 A ALA 44  ? A ALA 6   
7  1 Y 1 A ARG 45  ? A ARG 7   
8  1 Y 1 A TRP 46  ? A TRP 8   
9  1 Y 1 A ARG 47  ? A ARG 9   
10 1 Y 1 A THR 297 ? A THR 259 
11 1 Y 1 A SER 298 ? A SER 260 
12 1 Y 1 A GLU 299 ? A GLU 261 
13 1 Y 1 A ILE 300 ? A ILE 262 
14 1 Y 1 B LYS 39  ? B LYS 1   
15 1 Y 1 B ARG 40  ? B ARG 2   
16 1 Y 1 B GLU 41  ? B GLU 3   
17 1 Y 1 B ALA 42  ? B ALA 4   
18 1 Y 1 B GLU 43  ? B GLU 5   
19 1 Y 1 B ALA 44  ? B ALA 6   
20 1 Y 1 B THR 297 ? B THR 259 
21 1 Y 1 B SER 298 ? B SER 260 
22 1 Y 1 B GLU 299 ? B GLU 261 
23 1 Y 1 B ILE 300 ? B ILE 262 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 
3 water                             HOH 
#