data_2I66
# 
_entry.id   2I66 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2I66         
RCSB  RCSB039186   
WWPDB D_1000039186 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2I65 'Structural Basis for the Mechanistic Understanding Human CD38 Controlled Multiple Catalysis' unspecified 
PDB 2I67 'Structural Basis for the Mechanistic Understanding Human CD38 Controlled Multiple Catalysis' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2I66 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, Q.'         1 
'Kriksunov, I.A.' 2 
'Graeff, R.'      3 
'Munshi, C.'      4 
'Lee, H.C.'       5 
'Hao, Q.'         6 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the mechanistic understanding of human CD38-controlled multiple catalysis.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                32861 
_citation.page_last                 32869 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16951430 
_citation.pdbx_database_id_DOI      10.1074/jbc.M606365200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, Q.'         1 
primary 'Kriksunov, I.A.' 2 
primary 'Graeff, R.'      3 
primary 'Munshi, C.'      4 
primary 'Lee, H.C.'       5 
primary 'Hao, Q.'         6 
# 
_cell.entry_id           2I66 
_cell.length_a           41.710 
_cell.length_b           52.812 
_cell.length_c           65.424 
_cell.angle_alpha        105.93 
_cell.angle_beta         91.80 
_cell.angle_gamma        95.22 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2I66 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADP-ribosyl cyclase 1' 30380.393 2   3.2.2.5 'Q49T, N100D, N164D, N209D, N219D' ? ? 
2 non-polymer syn 
;[(2R,3R,4R,5R)-5-(2-AMINO-6-OXO-1,6-DIHYDRO-9H-PURIN-9-YL)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL [(2R,3S,4R,5S)-3,4,5-TRIHYDROXYTETRAHYDROFURAN-2-YL]METHYL DIHYDROGEN DIPHOSPHATE
;
575.315   3   ?       ?                                  ? ? 
3 non-polymer syn 
;[(2R,3R,4R,5R)-5-(2-AMINO-6-OXO-1,6-DIHYDRO-9H-PURIN-9-YL)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL [(2R,3S,4S)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL DIHYDROGEN DIPHOSPHATE
;
559.316   1   ?       ?                                  ? ? 
4 water       nat water 18.015    444 ?       ?                                  ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Cyclic ADP-ribose hydrolase 1, cADPr hydrolase 1, Lymphocyte differentiation antigen CD38, T10, Acute lymphoblastic leukemia cells antigen CD38
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KREAEARWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVP
CNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAE
AACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNI
YRPDKFLQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KREAEARWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVP
CNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAE
AACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNI
YRPDKFLQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   ARG n 
1 3   GLU n 
1 4   ALA n 
1 5   GLU n 
1 6   ALA n 
1 7   ARG n 
1 8   TRP n 
1 9   ARG n 
1 10  GLN n 
1 11  THR n 
1 12  TRP n 
1 13  SER n 
1 14  GLY n 
1 15  PRO n 
1 16  GLY n 
1 17  THR n 
1 18  THR n 
1 19  LYS n 
1 20  ARG n 
1 21  PHE n 
1 22  PRO n 
1 23  GLU n 
1 24  THR n 
1 25  VAL n 
1 26  LEU n 
1 27  ALA n 
1 28  ARG n 
1 29  CYS n 
1 30  VAL n 
1 31  LYS n 
1 32  TYR n 
1 33  THR n 
1 34  GLU n 
1 35  ILE n 
1 36  HIS n 
1 37  PRO n 
1 38  GLU n 
1 39  MET n 
1 40  ARG n 
1 41  HIS n 
1 42  VAL n 
1 43  ASP n 
1 44  CYS n 
1 45  GLN n 
1 46  SER n 
1 47  VAL n 
1 48  TRP n 
1 49  ASP n 
1 50  ALA n 
1 51  PHE n 
1 52  LYS n 
1 53  GLY n 
1 54  ALA n 
1 55  PHE n 
1 56  ILE n 
1 57  SER n 
1 58  LYS n 
1 59  HIS n 
1 60  PRO n 
1 61  CYS n 
1 62  ASP n 
1 63  ILE n 
1 64  THR n 
1 65  GLU n 
1 66  GLU n 
1 67  ASP n 
1 68  TYR n 
1 69  GLN n 
1 70  PRO n 
1 71  LEU n 
1 72  MET n 
1 73  LYS n 
1 74  LEU n 
1 75  GLY n 
1 76  THR n 
1 77  GLN n 
1 78  THR n 
1 79  VAL n 
1 80  PRO n 
1 81  CYS n 
1 82  ASN n 
1 83  LYS n 
1 84  ILE n 
1 85  LEU n 
1 86  LEU n 
1 87  TRP n 
1 88  SER n 
1 89  ARG n 
1 90  ILE n 
1 91  LYS n 
1 92  ASP n 
1 93  LEU n 
1 94  ALA n 
1 95  HIS n 
1 96  GLN n 
1 97  PHE n 
1 98  THR n 
1 99  GLN n 
1 100 VAL n 
1 101 GLN n 
1 102 ARG n 
1 103 ASP n 
1 104 MET n 
1 105 PHE n 
1 106 THR n 
1 107 LEU n 
1 108 GLU n 
1 109 ASP n 
1 110 THR n 
1 111 LEU n 
1 112 LEU n 
1 113 GLY n 
1 114 TYR n 
1 115 LEU n 
1 116 ALA n 
1 117 ASP n 
1 118 ASP n 
1 119 LEU n 
1 120 THR n 
1 121 TRP n 
1 122 CYS n 
1 123 GLY n 
1 124 GLU n 
1 125 PHE n 
1 126 ASP n 
1 127 THR n 
1 128 SER n 
1 129 LYS n 
1 130 ILE n 
1 131 ASN n 
1 132 TYR n 
1 133 GLN n 
1 134 SER n 
1 135 CYS n 
1 136 PRO n 
1 137 ASP n 
1 138 TRP n 
1 139 ARG n 
1 140 LYS n 
1 141 ASP n 
1 142 CYS n 
1 143 SER n 
1 144 ASN n 
1 145 ASN n 
1 146 PRO n 
1 147 VAL n 
1 148 SER n 
1 149 VAL n 
1 150 PHE n 
1 151 TRP n 
1 152 LYS n 
1 153 THR n 
1 154 VAL n 
1 155 SER n 
1 156 ARG n 
1 157 ARG n 
1 158 PHE n 
1 159 ALA n 
1 160 GLU n 
1 161 ALA n 
1 162 ALA n 
1 163 CYS n 
1 164 ASP n 
1 165 VAL n 
1 166 VAL n 
1 167 HIS n 
1 168 VAL n 
1 169 MET n 
1 170 LEU n 
1 171 ASP n 
1 172 GLY n 
1 173 SER n 
1 174 ARG n 
1 175 SER n 
1 176 LYS n 
1 177 ILE n 
1 178 PHE n 
1 179 ASP n 
1 180 LYS n 
1 181 ASP n 
1 182 SER n 
1 183 THR n 
1 184 PHE n 
1 185 GLY n 
1 186 SER n 
1 187 VAL n 
1 188 GLU n 
1 189 VAL n 
1 190 HIS n 
1 191 ASN n 
1 192 LEU n 
1 193 GLN n 
1 194 PRO n 
1 195 GLU n 
1 196 LYS n 
1 197 VAL n 
1 198 GLN n 
1 199 THR n 
1 200 LEU n 
1 201 GLU n 
1 202 ALA n 
1 203 TRP n 
1 204 VAL n 
1 205 ILE n 
1 206 HIS n 
1 207 GLY n 
1 208 GLY n 
1 209 ARG n 
1 210 GLU n 
1 211 ASP n 
1 212 SER n 
1 213 ARG n 
1 214 ASP n 
1 215 LEU n 
1 216 CYS n 
1 217 GLN n 
1 218 ASP n 
1 219 PRO n 
1 220 THR n 
1 221 ILE n 
1 222 LYS n 
1 223 GLU n 
1 224 LEU n 
1 225 GLU n 
1 226 SER n 
1 227 ILE n 
1 228 ILE n 
1 229 SER n 
1 230 LYS n 
1 231 ARG n 
1 232 ASN n 
1 233 ILE n 
1 234 GLN n 
1 235 PHE n 
1 236 SER n 
1 237 CYS n 
1 238 LYS n 
1 239 ASN n 
1 240 ILE n 
1 241 TYR n 
1 242 ARG n 
1 243 PRO n 
1 244 ASP n 
1 245 LYS n 
1 246 PHE n 
1 247 LEU n 
1 248 GLN n 
1 249 CYS n 
1 250 VAL n 
1 251 LYS n 
1 252 ASN n 
1 253 PRO n 
1 254 GLU n 
1 255 ASP n 
1 256 SER n 
1 257 SER n 
1 258 CYS n 
1 259 THR n 
1 260 SER n 
1 261 GLU n 
1 262 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CD38 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     Pichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               X-33 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPICZaA 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD38_HUMAN 
_struct_ref.pdbx_db_accession          P28907 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
;
_struct_ref.pdbx_align_begin           45 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2I66 A 7 ? 262 ? P28907 45 ? 300 ? 45 300 
2 1 2I66 B 7 ? 262 ? P28907 45 ? 300 ? 45 300 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2I66 LYS A 1   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 39  1  
1 2I66 ARG A 2   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 40  2  
1 2I66 GLU A 3   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 41  3  
1 2I66 ALA A 4   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 42  4  
1 2I66 GLU A 5   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 43  5  
1 2I66 ALA A 6   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 44  6  
1 2I66 THR A 11  ? UNP P28907 GLN 49  ENGINEERED         49  7  
1 2I66 ASP A 62  ? UNP P28907 ASN 100 ENGINEERED         100 8  
1 2I66 ASP A 126 ? UNP P28907 ASN 164 ENGINEERED         164 9  
1 2I66 ASP A 171 ? UNP P28907 ASN 209 ENGINEERED         209 10 
1 2I66 ASP A 181 ? UNP P28907 ASN 219 ENGINEERED         219 11 
2 2I66 LYS B 1   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 39  12 
2 2I66 ARG B 2   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 40  13 
2 2I66 GLU B 3   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 41  14 
2 2I66 ALA B 4   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 42  15 
2 2I66 GLU B 5   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 43  16 
2 2I66 ALA B 6   ? UNP P28907 ?   ?   'CLONING ARTIFACT' 44  17 
2 2I66 THR B 11  ? UNP P28907 GLN 49  ENGINEERED         49  18 
2 2I66 ASP B 62  ? UNP P28907 ASN 100 ENGINEERED         100 19 
2 2I66 ASP B 126 ? UNP P28907 ASN 164 ENGINEERED         164 20 
2 2I66 ASP B 171 ? UNP P28907 ASN 209 ENGINEERED         209 21 
2 2I66 ASP B 181 ? UNP P28907 ASN 219 ENGINEERED         219 22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                        'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ?                                        'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                                        'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                        'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE ?                                        'C3 H7 N O2 S'      121.158 
G1R non-polymer         . 
;[(2R,3R,4R,5R)-5-(2-AMINO-6-OXO-1,6-DIHYDRO-9H-PURIN-9-YL)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL [(2R,3S,4R,5S)-3,4,5-TRIHYDROXYTETRAHYDROFURAN-2-YL]METHYL DIHYDROGEN DIPHOSPHATE
;
'GUANOSINE DIPHOSPHORIBOSE'              'C15 H23 N5 O15 P2' 575.315 
G2R non-polymer         . 
;[(2R,3R,4R,5R)-5-(2-AMINO-6-OXO-1,6-DIHYDRO-9H-PURIN-9-YL)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL [(2R,3S,4S)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL DIHYDROGEN DIPHOSPHATE
;
'GUANOSINE DIPHOSPHORIBOSE INTERMEDIATE' 'C15 H23 N5 O14 P2' 559.316 
GLN 'L-peptide linking' y GLUTAMINE ?                                        'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                        'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ?                                        'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ?                                        'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ?                                        'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                                        'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ?                                        'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ?                                        'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ?                                        'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                                        'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ?                                        'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ?                                        'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ?                                        'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                                        'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ?                                        'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ?                                        'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2I66 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.27 
_exptl_crystal.density_percent_sol   45.73 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '100 mM MES, 12% PEG 4000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2006-02-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.976 
# 
_reflns.entry_id                     2I66 
_reflns.observed_criterion_sigma_F   2.8 
_reflns.observed_criterion_sigma_I   2.8 
_reflns.d_resolution_high            1.7 
_reflns.d_resolution_low             30 
_reflns.number_all                   57966 
_reflns.number_obs                   56343 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   95.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2I66 
_refine.ls_number_reflns_obs                     53472 
_refine.ls_number_reflns_all                     55012 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.18468 
_refine.ls_R_factor_all                          0.2 
_refine.ls_R_factor_R_work                       0.18224 
_refine.ls_R_factor_R_free                       0.22913 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2857 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.B_iso_mean                               40.807 
_refine.aniso_B[1][1]                            -1.38 
_refine.aniso_B[2][2]                            1.24 
_refine.aniso_B[3][3]                            1.48 
_refine.aniso_B[1][2]                            0.93 
_refine.aniso_B[1][3]                            0.96 
_refine.aniso_B[2][3]                            2.02 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1YH3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.116 
_refine.pdbx_overall_ESU_R_Free                  0.118 
_refine.overall_SU_ML                            0.091 
_refine.overall_SU_B                             5.441 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4100 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         146 
_refine_hist.number_atoms_solvent             444 
_refine_hist.number_atoms_total               4690 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 4373 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.732  1.982  ? 5963 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.239  5.000  ? 502  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.230 24.038 ? 208  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.869 15.000 ? 742  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.049 15.000 ? 30   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.124  0.200  ? 650  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 3254 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.233  0.200  ? 2154 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.314  0.200  ? 2951 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.163  0.200  ? 419  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.218  0.200  ? 68   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.154  0.200  ? 35   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.085  1.500  ? 2578 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.788  2.000  ? 4114 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.810  3.000  ? 2089 'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.468  4.500  ? 1849 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.705 
_refine_ls_shell.d_res_low                        1.749 
_refine_ls_shell.number_reflns_R_work             3674 
_refine_ls_shell.R_factor_R_work                  0.225 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.25 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             186 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2I66 
_struct.title                     'Structural Basis for the Mechanistic Understanding Human CD38 Controlled Multiple Catalysis' 
_struct.pdbx_descriptor           'ADP-ribosyl cyclase 1 (E.C.3.2.2.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2I66 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'the catalytic pocket, reaction product, reaction intermediate, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'There are two biological units in the crystallographic asymmetric unit.' ? 
2 ?                                                                         ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 20  ? HIS A 36  ? ARG A 58  HIS A 74  1 ? 17 
HELX_P HELX_P2  2  PRO A 37  ? ARG A 40  ? PRO A 75  ARG A 78  5 ? 4  
HELX_P HELX_P3  3  ASP A 43  ? ILE A 56  ? ASP A 81  ILE A 94  1 ? 14 
HELX_P HELX_P4  4  THR A 64  ? ASP A 67  ? THR A 102 ASP A 105 5 ? 4  
HELX_P HELX_P5  5  TYR A 68  ? GLY A 75  ? TYR A 106 GLY A 113 1 ? 8  
HELX_P HELX_P6  6  PRO A 80  ? LYS A 83  ? PRO A 118 LYS A 121 5 ? 4  
HELX_P HELX_P7  7  ILE A 90  ? VAL A 100 ? ILE A 128 VAL A 138 1 ? 11 
HELX_P HELX_P8  8  THR A 106 ? ASP A 109 ? THR A 144 ASP A 147 5 ? 4  
HELX_P HELX_P9  9  THR A 110 ? ASP A 117 ? THR A 148 ASP A 155 1 ? 8  
HELX_P HELX_P10 10 ASN A 145 ? ALA A 162 ? ASN A 183 ALA A 200 1 ? 18 
HELX_P HELX_P11 11 SER A 182 ? VAL A 187 ? SER A 220 VAL A 225 1 ? 6  
HELX_P HELX_P12 12 VAL A 187 ? LEU A 192 ? VAL A 225 LEU A 230 1 ? 6  
HELX_P HELX_P13 13 ASP A 214 ? GLN A 217 ? ASP A 252 GLN A 255 5 ? 4  
HELX_P HELX_P14 14 ASP A 218 ? ARG A 231 ? ASP A 256 ARG A 269 1 ? 14 
HELX_P HELX_P15 15 ARG A 242 ? ASN A 252 ? ARG A 280 ASN A 290 1 ? 11 
HELX_P HELX_P16 16 ARG B 20  ? HIS B 36  ? ARG B 58  HIS B 74  1 ? 17 
HELX_P HELX_P17 17 PRO B 37  ? ARG B 40  ? PRO B 75  ARG B 78  5 ? 4  
HELX_P HELX_P18 18 ASP B 43  ? ILE B 56  ? ASP B 81  ILE B 94  1 ? 14 
HELX_P HELX_P19 19 THR B 64  ? ASP B 67  ? THR B 102 ASP B 105 5 ? 4  
HELX_P HELX_P20 20 TYR B 68  ? GLY B 75  ? TYR B 106 GLY B 113 1 ? 8  
HELX_P HELX_P21 21 ILE B 90  ? GLN B 101 ? ILE B 128 GLN B 139 1 ? 12 
HELX_P HELX_P22 22 THR B 106 ? ASP B 109 ? THR B 144 ASP B 147 5 ? 4  
HELX_P HELX_P23 23 THR B 110 ? ASP B 117 ? THR B 148 ASP B 155 1 ? 8  
HELX_P HELX_P24 24 ASN B 145 ? ALA B 162 ? ASN B 183 ALA B 200 1 ? 18 
HELX_P HELX_P25 25 SER B 182 ? VAL B 187 ? SER B 220 VAL B 225 1 ? 6  
HELX_P HELX_P26 26 GLU B 188 ? LEU B 192 ? GLU B 226 LEU B 230 5 ? 5  
HELX_P HELX_P27 27 ASP B 214 ? GLN B 217 ? ASP B 252 GLN B 255 5 ? 4  
HELX_P HELX_P28 28 ASP B 218 ? ARG B 231 ? ASP B 256 ARG B 269 1 ? 14 
HELX_P HELX_P29 29 ARG B 242 ? ASN B 252 ? ARG B 280 ASN B 290 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 29  SG  ? ? ? 1_555 A CYS 44  SG ? ? A CYS 67  A CYS 82  1_555 ? ? ? ? ? ? ? 2.088 ? 
disulf2  disulf ? ? A CYS 61  SG  ? ? ? 1_555 A CYS 142 SG ? ? A CYS 99  A CYS 180 1_555 ? ? ? ? ? ? ? 2.071 ? 
disulf3  disulf ? ? A CYS 81  SG  ? ? ? 1_555 A CYS 163 SG ? ? A CYS 119 A CYS 201 1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf4  disulf ? ? A CYS 122 SG  ? ? ? 1_555 A CYS 135 SG ? ? A CYS 160 A CYS 173 1_555 ? ? ? ? ? ? ? 2.087 ? 
disulf5  disulf ? ? A CYS 216 SG  ? ? ? 1_555 A CYS 237 SG ? ? A CYS 254 A CYS 275 1_555 ? ? ? ? ? ? ? 2.137 ? 
disulf6  disulf ? ? A CYS 249 SG  ? ? ? 1_555 A CYS 258 SG ? ? A CYS 287 A CYS 296 1_555 ? ? ? ? ? ? ? 1.871 ? 
disulf7  disulf ? ? B CYS 29  SG  ? ? ? 1_555 B CYS 44  SG ? ? B CYS 67  B CYS 82  1_555 ? ? ? ? ? ? ? 2.096 ? 
disulf8  disulf ? ? B CYS 61  SG  ? ? ? 1_555 B CYS 142 SG ? ? B CYS 99  B CYS 180 1_555 ? ? ? ? ? ? ? 2.100 ? 
disulf9  disulf ? ? B CYS 81  SG  ? ? ? 1_555 B CYS 163 SG ? ? B CYS 119 B CYS 201 1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf10 disulf ? ? B CYS 122 SG  ? ? ? 1_555 B CYS 135 SG ? ? B CYS 160 B CYS 173 1_555 ? ? ? ? ? ? ? 2.156 ? 
disulf11 disulf ? ? B CYS 216 SG  ? ? ? 1_555 B CYS 237 SG ? ? B CYS 254 B CYS 275 1_555 ? ? ? ? ? ? ? 2.058 ? 
disulf12 disulf ? ? B CYS 249 SG  ? ? ? 1_555 B CYS 258 SG ? ? B CYS 287 B CYS 296 1_555 ? ? ? ? ? ? ? 2.039 ? 
covale1  covale ? ? C G1R .   C1X ? ? ? 1_555 D G1R .   O6 ? ? A G1R 301 A G1R 302 1_555 ? ? ? ? ? ? ? 1.665 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 85  ? SER A 88  ? LEU A 123 SER A 126 
A 2 ASP A 164 ? ASP A 171 ? ASP A 202 ASP A 209 
A 3 VAL A 197 ? ILE A 205 ? VAL A 235 ILE A 243 
A 4 GLN A 234 ? ILE A 240 ? GLN A 272 ILE A 278 
B 1 GLY B 14  ? PRO B 15  ? GLY B 52  PRO B 53  
B 2 SER B 134 ? CYS B 135 ? SER B 172 CYS B 173 
C 1 LEU B 85  ? SER B 88  ? LEU B 123 SER B 126 
C 2 ASP B 164 ? ASP B 171 ? ASP B 202 ASP B 209 
C 3 VAL B 197 ? ILE B 205 ? VAL B 235 ILE B 243 
C 4 GLN B 234 ? ILE B 240 ? GLN B 272 ILE B 278 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 86  ? N LEU A 124 O HIS A 167 ? O HIS A 205 
A 2 3 N VAL A 168 ? N VAL A 206 O TRP A 203 ? O TRP A 241 
A 3 4 N ALA A 202 ? N ALA A 240 O SER A 236 ? O SER A 274 
B 1 2 N GLY B 14  ? N GLY B 52  O CYS B 135 ? O CYS B 173 
C 1 2 N LEU B 86  ? N LEU B 124 O HIS B 167 ? O HIS B 205 
C 2 3 N VAL B 168 ? N VAL B 206 O TRP B 203 ? O TRP B 241 
C 3 4 N ALA B 202 ? N ALA B 240 O SER B 236 ? O SER B 274 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE G1R A 301' 
AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE G1R A 302' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE G1R B 301' 
AC4 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE G2R B 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 LEU A 86  ? LEU A 124 . ? 1_555 ? 
2  AC1 13 TRP A 87  ? TRP A 125 . ? 1_555 ? 
3  AC1 13 SER A 88  ? SER A 126 . ? 1_555 ? 
4  AC1 13 ARG A 89  ? ARG A 127 . ? 1_555 ? 
5  AC1 13 LEU A 107 ? LEU A 145 . ? 1_555 ? 
6  AC1 13 SER A 155 ? SER A 193 . ? 1_555 ? 
7  AC1 13 SER A 182 ? SER A 220 . ? 1_555 ? 
8  AC1 13 THR A 183 ? THR A 221 . ? 1_555 ? 
9  AC1 13 PHE A 184 ? PHE A 222 . ? 1_555 ? 
10 AC1 13 GLU A 188 ? GLU A 226 . ? 1_555 ? 
11 AC1 13 G1R D .   ? G1R A 302 . ? 1_555 ? 
12 AC1 13 HOH G .   ? HOH A 304 . ? 1_555 ? 
13 AC1 13 HOH G .   ? HOH A 528 . ? 1_555 ? 
14 AC2 20 TRP A 87  ? TRP A 125 . ? 1_555 ? 
15 AC2 20 GLU A 108 ? GLU A 146 . ? 1_555 ? 
16 AC2 20 ASP A 117 ? ASP A 155 . ? 1_555 ? 
17 AC2 20 TRP A 138 ? TRP A 176 . ? 1_555 ? 
18 AC2 20 VAL A 147 ? VAL A 185 . ? 1_555 ? 
19 AC2 20 SER A 148 ? SER A 186 . ? 1_555 ? 
20 AC2 20 TRP A 151 ? TRP A 189 . ? 1_555 ? 
21 AC2 20 LYS A 152 ? LYS A 190 . ? 1_555 ? 
22 AC2 20 SER A 155 ? SER A 193 . ? 1_555 ? 
23 AC2 20 ASP A 181 ? ASP A 219 . ? 1_555 ? 
24 AC2 20 THR A 183 ? THR A 221 . ? 1_555 ? 
25 AC2 20 SER A 186 ? SER A 224 . ? 1_555 ? 
26 AC2 20 VAL A 187 ? VAL A 225 . ? 1_555 ? 
27 AC2 20 G1R C .   ? G1R A 301 . ? 1_555 ? 
28 AC2 20 HOH G .   ? HOH A 311 . ? 1_555 ? 
29 AC2 20 HOH G .   ? HOH A 345 . ? 1_555 ? 
30 AC2 20 HOH G .   ? HOH A 347 . ? 1_555 ? 
31 AC2 20 HOH G .   ? HOH A 416 . ? 1_555 ? 
32 AC2 20 HOH G .   ? HOH A 439 . ? 1_555 ? 
33 AC2 20 HOH G .   ? HOH A 537 . ? 1_555 ? 
34 AC3 13 TRP B 87  ? TRP B 125 . ? 1_555 ? 
35 AC3 13 ARG B 89  ? ARG B 127 . ? 1_555 ? 
36 AC3 13 ILE B 90  ? ILE B 128 . ? 1_555 ? 
37 AC3 13 GLU B 108 ? GLU B 146 . ? 1_555 ? 
38 AC3 13 ASP B 117 ? ASP B 155 . ? 1_555 ? 
39 AC3 13 VAL B 147 ? VAL B 185 . ? 1_555 ? 
40 AC3 13 TRP B 151 ? TRP B 189 . ? 1_555 ? 
41 AC3 13 ARG B 174 ? ARG B 212 . ? 1_555 ? 
42 AC3 13 THR B 183 ? THR B 221 . ? 1_555 ? 
43 AC3 13 G2R F .   ? G2R B 302 . ? 1_555 ? 
44 AC3 13 HOH H .   ? HOH B 312 . ? 1_555 ? 
45 AC3 13 HOH H .   ? HOH B 403 . ? 1_555 ? 
46 AC3 13 HOH H .   ? HOH B 414 . ? 1_555 ? 
47 AC4 17 LEU B 86  ? LEU B 124 . ? 1_555 ? 
48 AC4 17 TRP B 87  ? TRP B 125 . ? 1_555 ? 
49 AC4 17 SER B 88  ? SER B 126 . ? 1_555 ? 
50 AC4 17 ARG B 89  ? ARG B 127 . ? 1_555 ? 
51 AC4 17 LEU B 107 ? LEU B 145 . ? 1_555 ? 
52 AC4 17 TRP B 138 ? TRP B 176 . ? 1_555 ? 
53 AC4 17 SER B 148 ? SER B 186 . ? 1_555 ? 
54 AC4 17 ASP B 179 ? ASP B 217 . ? 1_555 ? 
55 AC4 17 ASP B 181 ? ASP B 219 . ? 1_555 ? 
56 AC4 17 SER B 182 ? SER B 220 . ? 1_555 ? 
57 AC4 17 THR B 183 ? THR B 221 . ? 1_555 ? 
58 AC4 17 PHE B 184 ? PHE B 222 . ? 1_555 ? 
59 AC4 17 GLU B 188 ? GLU B 226 . ? 1_555 ? 
60 AC4 17 G1R E .   ? G1R B 301 . ? 1_555 ? 
61 AC4 17 HOH H .   ? HOH B 317 . ? 1_555 ? 
62 AC4 17 HOH H .   ? HOH B 350 . ? 1_555 ? 
63 AC4 17 HOH H .   ? HOH B 511 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2I66 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2I66 
_atom_sites.fract_transf_matrix[1][1]   0.023975 
_atom_sites.fract_transf_matrix[1][2]   0.002190 
_atom_sites.fract_transf_matrix[1][3]   0.001420 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019014 
_atom_sites.fract_transf_matrix[2][3]   0.005516 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015923 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ARG A 1 7   ? 21.027  -21.947 13.913  1.00 55.56 ? 45  ARG A N     1 
ATOM   2    C CA    . ARG A 1 7   ? 21.933  -20.777 13.741  1.00 55.30 ? 45  ARG A CA    1 
ATOM   3    C C     . ARG A 1 7   ? 21.766  -19.754 14.855  1.00 54.54 ? 45  ARG A C     1 
ATOM   4    O O     . ARG A 1 7   ? 20.646  -19.420 15.266  1.00 54.25 ? 45  ARG A O     1 
ATOM   5    C CB    . ARG A 1 7   ? 21.687  -20.081 12.393  1.00 55.82 ? 45  ARG A CB    1 
ATOM   6    C CG    . ARG A 1 7   ? 22.291  -20.773 11.184  1.00 57.72 ? 45  ARG A CG    1 
ATOM   7    C CD    . ARG A 1 7   ? 23.700  -20.288 10.945  1.00 60.15 ? 45  ARG A CD    1 
ATOM   8    N NE    . ARG A 1 7   ? 24.115  -20.363 9.541   1.00 62.33 ? 45  ARG A NE    1 
ATOM   9    C CZ    . ARG A 1 7   ? 23.717  -19.541 8.566   1.00 63.17 ? 45  ARG A CZ    1 
ATOM   10   N NH1   . ARG A 1 7   ? 22.838  -18.566 8.797   1.00 63.16 ? 45  ARG A NH1   1 
ATOM   11   N NH2   . ARG A 1 7   ? 24.194  -19.709 7.337   1.00 63.53 ? 45  ARG A NH2   1 
ATOM   12   N N     . TRP A 1 8   ? 22.904  -19.258 15.316  1.00 53.49 ? 46  TRP A N     1 
ATOM   13   C CA    . TRP A 1 8   ? 22.995  -18.099 16.186  1.00 52.75 ? 46  TRP A CA    1 
ATOM   14   C C     . TRP A 1 8   ? 23.176  -16.826 15.357  1.00 52.39 ? 46  TRP A C     1 
ATOM   15   O O     . TRP A 1 8   ? 23.228  -15.724 15.910  1.00 52.63 ? 46  TRP A O     1 
ATOM   16   C CB    . TRP A 1 8   ? 24.195  -18.265 17.113  1.00 52.77 ? 46  TRP A CB    1 
ATOM   17   C CG    . TRP A 1 8   ? 25.451  -18.591 16.364  1.00 52.52 ? 46  TRP A CG    1 
ATOM   18   C CD1   . TRP A 1 8   ? 26.408  -17.712 15.949  1.00 53.03 ? 46  TRP A CD1   1 
ATOM   19   C CD2   . TRP A 1 8   ? 25.878  -19.888 15.923  1.00 52.10 ? 46  TRP A CD2   1 
ATOM   20   N NE1   . TRP A 1 8   ? 27.414  -18.382 15.292  1.00 52.86 ? 46  TRP A NE1   1 
ATOM   21   C CE2   . TRP A 1 8   ? 27.109  -19.717 15.253  1.00 52.34 ? 46  TRP A CE2   1 
ATOM   22   C CE3   . TRP A 1 8   ? 25.336  -21.174 16.023  1.00 52.03 ? 46  TRP A CE3   1 
ATOM   23   C CZ2   . TRP A 1 8   ? 27.814  -20.785 14.693  1.00 52.88 ? 46  TRP A CZ2   1 
ATOM   24   C CZ3   . TRP A 1 8   ? 26.035  -22.235 15.465  1.00 52.97 ? 46  TRP A CZ3   1 
ATOM   25   C CH2   . TRP A 1 8   ? 27.263  -22.032 14.809  1.00 53.06 ? 46  TRP A CH2   1 
ATOM   26   N N     . ARG A 1 9   ? 23.296  -16.984 14.035  1.00 51.54 ? 47  ARG A N     1 
ATOM   27   C CA    . ARG A 1 9   ? 23.436  -15.848 13.115  1.00 51.01 ? 47  ARG A CA    1 
ATOM   28   C C     . ARG A 1 9   ? 22.719  -16.116 11.791  1.00 50.17 ? 47  ARG A C     1 
ATOM   29   O O     . ARG A 1 9   ? 22.977  -17.116 11.122  1.00 50.45 ? 47  ARG A O     1 
ATOM   30   C CB    . ARG A 1 9   ? 24.905  -15.503 12.851  1.00 50.72 ? 47  ARG A CB    1 
ATOM   31   C CG    . ARG A 1 9   ? 25.542  -16.274 11.699  1.00 51.33 ? 47  ARG A CG    1 
ATOM   32   C CD    . ARG A 1 9   ? 26.906  -15.716 11.285  1.00 52.06 ? 47  ARG A CD    1 
ATOM   33   N NE    . ARG A 1 9   ? 27.900  -15.809 12.358  1.00 54.75 ? 47  ARG A NE    1 
ATOM   34   C CZ    . ARG A 1 9   ? 28.591  -16.906 12.669  1.00 55.87 ? 47  ARG A CZ    1 
ATOM   35   N NH1   . ARG A 1 9   ? 28.409  -18.038 11.993  1.00 57.12 ? 47  ARG A NH1   1 
ATOM   36   N NH2   . ARG A 1 9   ? 29.470  -16.871 13.665  1.00 55.17 ? 47  ARG A NH2   1 
ATOM   37   N N     . GLN A 1 10  ? 21.828  -15.214 11.407  1.00 48.92 ? 48  GLN A N     1 
ATOM   38   C CA    . GLN A 1 10  ? 21.096  -15.392 10.169  1.00 47.68 ? 48  GLN A CA    1 
ATOM   39   C C     . GLN A 1 10  ? 21.774  -14.692 8.984   1.00 46.33 ? 48  GLN A C     1 
ATOM   40   O O     . GLN A 1 10  ? 22.634  -13.815 9.169   1.00 46.44 ? 48  GLN A O     1 
ATOM   41   C CB    . GLN A 1 10  ? 19.633  -14.959 10.339  1.00 48.25 ? 48  GLN A CB    1 
ATOM   42   C CG    . GLN A 1 10  ? 18.814  -15.745 11.401  1.00 49.81 ? 48  GLN A CG    1 
ATOM   43   C CD    . GLN A 1 10  ? 18.938  -17.273 11.311  1.00 52.39 ? 48  GLN A CD    1 
ATOM   44   O OE1   . GLN A 1 10  ? 19.121  -17.947 12.325  1.00 53.79 ? 48  GLN A OE1   1 
ATOM   45   N NE2   . GLN A 1 10  ? 18.843  -17.817 10.104  1.00 52.85 ? 48  GLN A NE2   1 
ATOM   46   N N     . THR A 1 11  ? 21.393  -15.093 7.771   1.00 44.41 ? 49  THR A N     1 
ATOM   47   C CA    . THR A 1 11  ? 21.984  -14.567 6.543   1.00 42.58 ? 49  THR A CA    1 
ATOM   48   C C     . THR A 1 11  ? 21.641  -13.106 6.380   1.00 41.79 ? 49  THR A C     1 
ATOM   49   O O     . THR A 1 11  ? 22.515  -12.280 6.085   1.00 41.57 ? 49  THR A O     1 
ATOM   50   C CB    . THR A 1 11  ? 21.507  -15.355 5.295   1.00 42.82 ? 49  THR A CB    1 
ATOM   51   O OG1   . THR A 1 11  ? 21.901  -16.724 5.425   1.00 41.12 ? 49  THR A OG1   1 
ATOM   52   C CG2   . THR A 1 11  ? 22.115  -14.791 4.014   1.00 42.67 ? 49  THR A CG2   1 
ATOM   53   N N     . TRP A 1 12  ? 20.365  -12.792 6.572   1.00 40.51 ? 50  TRP A N     1 
ATOM   54   C CA    . TRP A 1 12  ? 19.882  -11.436 6.378   1.00 39.75 ? 50  TRP A CA    1 
ATOM   55   C C     . TRP A 1 12  ? 19.527  -10.798 7.707   1.00 40.80 ? 50  TRP A C     1 
ATOM   56   O O     . TRP A 1 12  ? 19.400  -11.496 8.726   1.00 40.78 ? 50  TRP A O     1 
ATOM   57   C CB    . TRP A 1 12  ? 18.668  -11.441 5.453   1.00 38.17 ? 50  TRP A CB    1 
ATOM   58   C CG    . TRP A 1 12  ? 18.930  -12.123 4.171   1.00 36.30 ? 50  TRP A CG    1 
ATOM   59   C CD1   . TRP A 1 12  ? 18.380  -13.296 3.746   1.00 34.80 ? 50  TRP A CD1   1 
ATOM   60   C CD2   . TRP A 1 12  ? 19.823  -11.692 3.134   1.00 33.54 ? 50  TRP A CD2   1 
ATOM   61   N NE1   . TRP A 1 12  ? 18.862  -13.621 2.498   1.00 34.31 ? 50  TRP A NE1   1 
ATOM   62   C CE2   . TRP A 1 12  ? 19.765  -12.658 2.110   1.00 35.31 ? 50  TRP A CE2   1 
ATOM   63   C CE3   . TRP A 1 12  ? 20.664  -10.577 2.967   1.00 32.98 ? 50  TRP A CE3   1 
ATOM   64   C CZ2   . TRP A 1 12  ? 20.503  -12.541 0.927   1.00 36.53 ? 50  TRP A CZ2   1 
ATOM   65   C CZ3   . TRP A 1 12  ? 21.404  -10.468 1.800   1.00 34.49 ? 50  TRP A CZ3   1 
ATOM   66   C CH2   . TRP A 1 12  ? 21.314  -11.442 0.789   1.00 36.28 ? 50  TRP A CH2   1 
ATOM   67   N N     . SER A 1 13  ? 19.344  -9.478  7.675   1.00 41.29 ? 51  SER A N     1 
ATOM   68   C CA    . SER A 1 13  ? 19.072  -8.687  8.875   1.00 42.40 ? 51  SER A CA    1 
ATOM   69   C C     . SER A 1 13  ? 17.587  -8.539  9.201   1.00 42.89 ? 51  SER A C     1 
ATOM   70   O O     . SER A 1 13  ? 17.232  -8.108  10.299  1.00 44.52 ? 51  SER A O     1 
ATOM   71   C CB    . SER A 1 13  ? 19.721  -7.308  8.733   1.00 42.67 ? 51  SER A CB    1 
ATOM   72   O OG    . SER A 1 13  ? 21.103  -7.439  8.461   1.00 44.94 ? 51  SER A OG    1 
ATOM   73   N N     . GLY A 1 14  ? 16.712  -8.907  8.271   1.00 42.32 ? 52  GLY A N     1 
ATOM   74   C CA    . GLY A 1 14  ? 15.269  -8.812  8.507   1.00 41.76 ? 52  GLY A CA    1 
ATOM   75   C C     . GLY A 1 14  ? 14.604  -10.097 8.975   1.00 42.32 ? 52  GLY A C     1 
ATOM   76   O O     . GLY A 1 14  ? 15.197  -11.179 8.869   1.00 42.20 ? 52  GLY A O     1 
ATOM   77   N N     . PRO A 1 15  ? 13.365  -9.997  9.508   1.00 42.41 ? 53  PRO A N     1 
ATOM   78   C CA    . PRO A 1 15  ? 12.563  -11.195 9.844   1.00 41.41 ? 53  PRO A CA    1 
ATOM   79   C C     . PRO A 1 15  ? 12.361  -12.085 8.625   1.00 40.77 ? 53  PRO A C     1 
ATOM   80   O O     . PRO A 1 15  ? 12.308  -11.582 7.507   1.00 40.27 ? 53  PRO A O     1 
ATOM   81   C CB    . PRO A 1 15  ? 11.218  -10.612 10.275  1.00 42.01 ? 53  PRO A CB    1 
ATOM   82   C CG    . PRO A 1 15  ? 11.558  -9.211  10.757  1.00 42.90 ? 53  PRO A CG    1 
ATOM   83   C CD    . PRO A 1 15  ? 12.657  -8.744  9.848   1.00 43.01 ? 53  PRO A CD    1 
ATOM   84   N N     . GLY A 1 16  ? 12.282  -13.390 8.855   1.00 39.24 ? 54  GLY A N     1 
ATOM   85   C CA    . GLY A 1 16  ? 12.146  -14.383 7.791   1.00 38.12 ? 54  GLY A CA    1 
ATOM   86   C C     . GLY A 1 16  ? 10.704  -14.467 7.343   1.00 36.70 ? 54  GLY A C     1 
ATOM   87   O O     . GLY A 1 16  ? 9.858   -13.709 7.826   1.00 36.67 ? 54  GLY A O     1 
ATOM   88   N N     . THR A 1 17  ? 10.425  -15.376 6.404   1.00 35.77 ? 55  THR A N     1 
ATOM   89   C CA    . THR A 1 17  ? 9.079   -15.519 5.836   1.00 34.62 ? 55  THR A CA    1 
ATOM   90   C C     . THR A 1 17  ? 8.033   -15.864 6.900   1.00 35.41 ? 55  THR A C     1 
ATOM   91   O O     . THR A 1 17  ? 8.280   -16.696 7.770   1.00 34.92 ? 55  THR A O     1 
ATOM   92   C CB    . THR A 1 17  ? 9.072   -16.562 4.711   1.00 35.00 ? 55  THR A CB    1 
ATOM   93   O OG1   . THR A 1 17  ? 9.978   -16.139 3.683   1.00 32.24 ? 55  THR A OG1   1 
ATOM   94   C CG2   . THR A 1 17  ? 7.655   -16.753 4.114   1.00 35.42 ? 55  THR A CG2   1 
ATOM   95   N N     . THR A 1 18  ? 6.866   -15.224 6.826   1.00 35.51 ? 56  THR A N     1 
ATOM   96   C CA    . THR A 1 18  ? 5.776   -15.485 7.770   1.00 36.69 ? 56  THR A CA    1 
ATOM   97   C C     . THR A 1 18  ? 5.464   -16.968 7.769   1.00 37.07 ? 56  THR A C     1 
ATOM   98   O O     . THR A 1 18  ? 5.404   -17.605 6.710   1.00 37.06 ? 56  THR A O     1 
ATOM   99   C CB    . THR A 1 18  ? 4.513   -14.678 7.403   1.00 35.67 ? 56  THR A CB    1 
ATOM   100  O OG1   . THR A 1 18  ? 4.878   -13.321 7.249   1.00 37.49 ? 56  THR A OG1   1 
ATOM   101  C CG2   . THR A 1 18  ? 3.440   -14.783 8.508   1.00 36.93 ? 56  THR A CG2   1 
ATOM   102  N N     . LYS A 1 19  ? 5.299   -17.532 8.964   1.00 38.41 ? 57  LYS A N     1 
ATOM   103  C CA    . LYS A 1 19  ? 5.086   -18.961 9.096   1.00 39.18 ? 57  LYS A CA    1 
ATOM   104  C C     . LYS A 1 19  ? 3.855   -19.339 8.290   1.00 38.99 ? 57  LYS A C     1 
ATOM   105  O O     . LYS A 1 19  ? 2.889   -18.567 8.199   1.00 39.00 ? 57  LYS A O     1 
ATOM   106  C CB    . LYS A 1 19  ? 4.937   -19.366 10.568  1.00 39.78 ? 57  LYS A CB    1 
ATOM   107  C CG    . LYS A 1 19  ? 3.769   -18.694 11.274  1.00 43.55 ? 57  LYS A CG    1 
ATOM   108  C CD    . LYS A 1 19  ? 3.163   -19.609 12.310  1.00 48.14 ? 57  LYS A CD    1 
ATOM   109  C CE    . LYS A 1 19  ? 1.756   -19.152 12.657  1.00 50.21 ? 57  LYS A CE    1 
ATOM   110  N NZ    . LYS A 1 19  ? 1.136   -20.031 13.703  1.00 53.28 ? 57  LYS A NZ    1 
ATOM   111  N N     . ARG A 1 20  ? 3.924   -20.502 7.653   1.00 38.81 ? 58  ARG A N     1 
ATOM   112  C CA    . ARG A 1 20  ? 2.839   -21.000 6.812   1.00 38.68 ? 58  ARG A CA    1 
ATOM   113  C C     . ARG A 1 20  ? 2.420   -19.982 5.750   1.00 38.14 ? 58  ARG A C     1 
ATOM   114  O O     . ARG A 1 20  ? 1.245   -19.843 5.443   1.00 38.51 ? 58  ARG A O     1 
ATOM   115  C CB    . ARG A 1 20  ? 1.638   -21.435 7.660   1.00 39.78 ? 58  ARG A CB    1 
ATOM   116  C CG    . ARG A 1 20  ? 1.985   -22.543 8.663   1.00 41.87 ? 58  ARG A CG    1 
ATOM   117  C CD    . ARG A 1 20  ? 0.920   -23.621 8.681   1.00 47.58 ? 58  ARG A CD    1 
ATOM   118  N NE    . ARG A 1 20  ? -0.408  -23.074 8.930   1.00 52.59 ? 58  ARG A NE    1 
ATOM   119  C CZ    . ARG A 1 20  ? -1.539  -23.732 8.705   1.00 54.58 ? 58  ARG A CZ    1 
ATOM   120  N NH1   . ARG A 1 20  ? -1.505  -24.966 8.222   1.00 55.85 ? 58  ARG A NH1   1 
ATOM   121  N NH2   . ARG A 1 20  ? -2.706  -23.155 8.961   1.00 56.13 ? 58  ARG A NH2   1 
ATOM   122  N N     . PHE A 1 21  ? 3.400   -19.267 5.197   1.00 36.97 ? 59  PHE A N     1 
ATOM   123  C CA    . PHE A 1 21  ? 3.136   -18.314 4.108   1.00 36.24 ? 59  PHE A CA    1 
ATOM   124  C C     . PHE A 1 21  ? 2.235   -18.839 2.968   1.00 35.60 ? 59  PHE A C     1 
ATOM   125  O O     . PHE A 1 21  ? 1.236   -18.194 2.625   1.00 35.77 ? 59  PHE A O     1 
ATOM   126  C CB    . PHE A 1 21  ? 4.467   -17.758 3.562   1.00 35.31 ? 59  PHE A CB    1 
ATOM   127  C CG    . PHE A 1 21  ? 4.306   -16.648 2.561   1.00 34.73 ? 59  PHE A CG    1 
ATOM   128  C CD1   . PHE A 1 21  ? 3.765   -15.405 2.926   1.00 35.59 ? 59  PHE A CD1   1 
ATOM   129  C CD2   . PHE A 1 21  ? 4.721   -16.829 1.248   1.00 34.83 ? 59  PHE A CD2   1 
ATOM   130  C CE1   . PHE A 1 21  ? 3.632   -14.367 1.971   1.00 35.60 ? 59  PHE A CE1   1 
ATOM   131  C CE2   . PHE A 1 21  ? 4.576   -15.819 0.288   1.00 32.18 ? 59  PHE A CE2   1 
ATOM   132  C CZ    . PHE A 1 21  ? 4.051   -14.577 0.649   1.00 34.40 ? 59  PHE A CZ    1 
ATOM   133  N N     . PRO A 1 22  ? 2.579   -19.993 2.376   1.00 36.26 ? 60  PRO A N     1 
ATOM   134  C CA    . PRO A 1 22  ? 1.824   -20.517 1.233   1.00 35.90 ? 60  PRO A CA    1 
ATOM   135  C C     . PRO A 1 22  ? 0.357   -20.747 1.551   1.00 35.74 ? 60  PRO A C     1 
ATOM   136  O O     . PRO A 1 22  ? -0.507  -20.350 0.776   1.00 36.08 ? 60  PRO A O     1 
ATOM   137  C CB    . PRO A 1 22  ? 2.527   -21.848 0.950   1.00 35.07 ? 60  PRO A CB    1 
ATOM   138  C CG    . PRO A 1 22  ? 3.933   -21.601 1.408   1.00 35.80 ? 60  PRO A CG    1 
ATOM   139  C CD    . PRO A 1 22  ? 3.716   -20.891 2.697   1.00 36.03 ? 60  PRO A CD    1 
ATOM   140  N N     . GLU A 1 23  ? 0.105   -21.391 2.690   1.00 36.64 ? 61  GLU A N     1 
ATOM   141  C CA    . GLU A 1 23  ? -1.243  -21.668 3.197   1.00 37.27 ? 61  GLU A CA    1 
ATOM   142  C C     . GLU A 1 23  ? -1.995  -20.380 3.496   1.00 37.75 ? 61  GLU A C     1 
ATOM   143  O O     . GLU A 1 23  ? -3.203  -20.278 3.206   1.00 37.46 ? 61  GLU A O     1 
ATOM   144  C CB    . GLU A 1 23  ? -1.148  -22.493 4.480   1.00 37.77 ? 61  GLU A CB    1 
ATOM   145  C CG    . GLU A 1 23  ? -0.620  -23.917 4.276   1.00 40.25 ? 61  GLU A CG    1 
ATOM   146  C CD    . GLU A 1 23  ? 0.905   -24.066 4.351   1.00 44.74 ? 61  GLU A CD    1 
ATOM   147  O OE1   . GLU A 1 23  ? 1.662   -23.065 4.404   1.00 45.53 ? 61  GLU A OE1   1 
ATOM   148  O OE2   . GLU A 1 23  ? 1.353   -25.231 4.353   1.00 48.32 ? 61  GLU A OE2   1 
ATOM   149  N N     . THR A 1 24  ? -1.290  -19.407 4.080   1.00 37.56 ? 62  THR A N     1 
ATOM   150  C CA    . THR A 1 24  ? -1.903  -18.102 4.438   1.00 37.88 ? 62  THR A CA    1 
ATOM   151  C C     . THR A 1 24  ? -2.354  -17.316 3.209   1.00 36.88 ? 62  THR A C     1 
ATOM   152  O O     . THR A 1 24  ? -3.482  -16.811 3.179   1.00 37.04 ? 62  THR A O     1 
ATOM   153  C CB    . THR A 1 24  ? -0.975  -17.248 5.333   1.00 37.65 ? 62  THR A CB    1 
ATOM   154  O OG1   . THR A 1 24  ? -0.735  -17.951 6.568   1.00 42.02 ? 62  THR A OG1   1 
ATOM   155  C CG2   . THR A 1 24  ? -1.594  -15.864 5.628   1.00 39.49 ? 62  THR A CG2   1 
ATOM   156  N N     . VAL A 1 25  ? -1.495  -17.243 2.192   1.00 35.37 ? 63  VAL A N     1 
ATOM   157  C CA    . VAL A 1 25  ? -1.829  -16.530 0.954   1.00 34.92 ? 63  VAL A CA    1 
ATOM   158  C C     . VAL A 1 25  ? -2.981  -17.232 0.232   1.00 34.88 ? 63  VAL A C     1 
ATOM   159  O O     . VAL A 1 25  ? -3.915  -16.585 -0.225  1.00 34.49 ? 63  VAL A O     1 
ATOM   160  C CB    . VAL A 1 25  ? -0.603  -16.399 0.008   1.00 34.64 ? 63  VAL A CB    1 
ATOM   161  C CG1   . VAL A 1 25  ? -1.016  -15.832 -1.337  1.00 34.03 ? 63  VAL A CG1   1 
ATOM   162  C CG2   . VAL A 1 25  ? 0.460   -15.516 0.631   1.00 35.33 ? 63  VAL A CG2   1 
ATOM   163  N N     . LEU A 1 26  ? -2.919  -18.559 0.173   1.00 35.11 ? 64  LEU A N     1 
ATOM   164  C CA    . LEU A 1 26  ? -3.963  -19.330 -0.498  1.00 36.66 ? 64  LEU A CA    1 
ATOM   165  C C     . LEU A 1 26  ? -5.306  -19.090 0.195   1.00 36.28 ? 64  LEU A C     1 
ATOM   166  O O     . LEU A 1 26  ? -6.311  -18.797 -0.467  1.00 36.72 ? 64  LEU A O     1 
ATOM   167  C CB    . LEU A 1 26  ? -3.585  -20.818 -0.553  1.00 36.62 ? 64  LEU A CB    1 
ATOM   168  C CG    . LEU A 1 26  ? -4.204  -21.624 -1.716  1.00 40.19 ? 64  LEU A CG    1 
ATOM   169  C CD1   . LEU A 1 26  ? -3.558  -21.201 -3.042  1.00 43.13 ? 64  LEU A CD1   1 
ATOM   170  C CD2   . LEU A 1 26  ? -4.027  -23.126 -1.510  1.00 39.31 ? 64  LEU A CD2   1 
ATOM   171  N N     . ALA A 1 27  ? -5.321  -19.177 1.524   1.00 36.93 ? 65  ALA A N     1 
ATOM   172  C CA    . ALA A 1 27  ? -6.551  -18.951 2.295   1.00 37.94 ? 65  ALA A CA    1 
ATOM   173  C C     . ALA A 1 27  ? -7.117  -17.563 2.074   1.00 38.12 ? 65  ALA A C     1 
ATOM   174  O O     . ALA A 1 27  ? -8.338  -17.409 1.910   1.00 38.49 ? 65  ALA A O     1 
ATOM   175  C CB    . ALA A 1 27  ? -6.322  -19.191 3.791   1.00 38.53 ? 65  ALA A CB    1 
ATOM   176  N N     . ARG A 1 28  ? -6.239  -16.556 2.083   1.00 36.97 ? 66  ARG A N     1 
ATOM   177  C CA    . ARG A 1 28  ? -6.638  -15.165 1.861   1.00 36.85 ? 66  ARG A CA    1 
ATOM   178  C C     . ARG A 1 28  ? -7.236  -14.991 0.481   1.00 37.02 ? 66  ARG A C     1 
ATOM   179  O O     . ARG A 1 28  ? -8.225  -14.287 0.314   1.00 37.84 ? 66  ARG A O     1 
ATOM   180  C CB    . ARG A 1 28  ? -5.446  -14.239 2.062   1.00 37.26 ? 66  ARG A CB    1 
ATOM   181  C CG    . ARG A 1 28  ? -5.079  -14.043 3.507   1.00 35.33 ? 66  ARG A CG    1 
ATOM   182  C CD    . ARG A 1 28  ? -3.985  -13.018 3.627   1.00 38.18 ? 66  ARG A CD    1 
ATOM   183  N NE    . ARG A 1 28  ? -3.642  -12.754 5.010   1.00 37.93 ? 66  ARG A NE    1 
ATOM   184  C CZ    . ARG A 1 28  ? -2.818  -11.781 5.384   1.00 38.57 ? 66  ARG A CZ    1 
ATOM   185  N NH1   . ARG A 1 28  ? -2.227  -11.021 4.473   1.00 36.72 ? 66  ARG A NH1   1 
ATOM   186  N NH2   . ARG A 1 28  ? -2.562  -11.594 6.666   1.00 39.28 ? 66  ARG A NH2   1 
ATOM   187  N N     . CYS A 1 29  ? -6.669  -15.663 -0.506  1.00 37.24 ? 67  CYS A N     1 
ATOM   188  C CA    . CYS A 1 29  ? -7.181  -15.567 -1.845  1.00 37.96 ? 67  CYS A CA    1 
ATOM   189  C C     . CYS A 1 29  ? -8.582  -16.189 -1.880  1.00 36.99 ? 67  CYS A C     1 
ATOM   190  O O     . CYS A 1 29  ? -9.525  -15.578 -2.390  1.00 37.56 ? 67  CYS A O     1 
ATOM   191  C CB    . CYS A 1 29  ? -6.234  -16.240 -2.814  1.00 37.62 ? 67  CYS A CB    1 
ATOM   192  S SG    . CYS A 1 29  ? -6.706  -16.032 -4.485  1.00 41.76 ? 67  CYS A SG    1 
ATOM   193  N N     . VAL A 1 30  ? -8.737  -17.369 -1.294  1.00 37.35 ? 68  VAL A N     1 
ATOM   194  C CA    . VAL A 1 30  ? -10.079 -17.993 -1.232  1.00 37.30 ? 68  VAL A CA    1 
ATOM   195  C C     . VAL A 1 30  ? -11.100 -17.082 -0.532  1.00 37.83 ? 68  VAL A C     1 
ATOM   196  O O     . VAL A 1 30  ? -12.184 -16.799 -1.075  1.00 38.65 ? 68  VAL A O     1 
ATOM   197  C CB    . VAL A 1 30  ? -10.035 -19.390 -0.585  1.00 37.56 ? 68  VAL A CB    1 
ATOM   198  C CG1   . VAL A 1 30  ? -11.456 -19.979 -0.475  1.00 37.35 ? 68  VAL A CG1   1 
ATOM   199  C CG2   . VAL A 1 30  ? -9.149  -20.323 -1.401  1.00 35.83 ? 68  VAL A CG2   1 
ATOM   200  N N     . LYS A 1 31  ? -10.757 -16.582 0.645   1.00 38.90 ? 69  LYS A N     1 
ATOM   201  C CA    . LYS A 1 31  ? -11.658 -15.675 1.365   1.00 39.42 ? 69  LYS A CA    1 
ATOM   202  C C     . LYS A 1 31  ? -12.033 -14.418 0.557   1.00 39.26 ? 69  LYS A C     1 
ATOM   203  O O     . LYS A 1 31  ? -13.220 -14.078 0.434   1.00 38.60 ? 69  LYS A O     1 
ATOM   204  C CB    . LYS A 1 31  ? -11.063 -15.254 2.706   1.00 39.98 ? 69  LYS A CB    1 
ATOM   205  C CG    . LYS A 1 31  ? -12.082 -14.586 3.616   1.00 44.84 ? 69  LYS A CG    1 
ATOM   206  C CD    . LYS A 1 31  ? -11.415 -13.916 4.813   1.00 51.55 ? 69  LYS A CD    1 
ATOM   207  C CE    . LYS A 1 31  ? -12.166 -14.201 6.123   1.00 54.96 ? 69  LYS A CE    1 
ATOM   208  N NZ    . LYS A 1 31  ? -11.728 -13.269 7.219   1.00 57.27 ? 69  LYS A NZ    1 
ATOM   209  N N     . TYR A 1 32  ? -11.022 -13.724 0.025   1.00 38.10 ? 70  TYR A N     1 
ATOM   210  C CA    . TYR A 1 32  ? -11.258 -12.546 -0.797  1.00 37.31 ? 70  TYR A CA    1 
ATOM   211  C C     . TYR A 1 32  ? -12.205 -12.821 -1.978  1.00 37.74 ? 70  TYR A C     1 
ATOM   212  O O     . TYR A 1 32  ? -13.165 -12.085 -2.218  1.00 36.46 ? 70  TYR A O     1 
ATOM   213  C CB    . TYR A 1 32  ? -9.918  -11.936 -1.290  1.00 37.35 ? 70  TYR A CB    1 
ATOM   214  C CG    . TYR A 1 32  ? -10.125 -10.536 -1.832  1.00 34.91 ? 70  TYR A CG    1 
ATOM   215  C CD1   . TYR A 1 32  ? -9.925  -9.426  -1.028  1.00 36.76 ? 70  TYR A CD1   1 
ATOM   216  C CD2   . TYR A 1 32  ? -10.541 -10.334 -3.144  1.00 35.17 ? 70  TYR A CD2   1 
ATOM   217  C CE1   . TYR A 1 32  ? -10.136 -8.138  -1.521  1.00 37.16 ? 70  TYR A CE1   1 
ATOM   218  C CE2   . TYR A 1 32  ? -10.787 -9.050  -3.648  1.00 35.87 ? 70  TYR A CE2   1 
ATOM   219  C CZ    . TYR A 1 32  ? -10.568 -7.956  -2.820  1.00 36.09 ? 70  TYR A CZ    1 
ATOM   220  O OH    . TYR A 1 32  ? -10.804 -6.676  -3.314  1.00 38.49 ? 70  TYR A OH    1 
ATOM   221  N N     . THR A 1 33  ? -11.918 -13.874 -2.726  1.00 38.30 ? 71  THR A N     1 
ATOM   222  C CA    . THR A 1 33  ? -12.682 -14.165 -3.929  1.00 39.71 ? 71  THR A CA    1 
ATOM   223  C C     . THR A 1 33  ? -14.108 -14.664 -3.590  1.00 40.02 ? 71  THR A C     1 
ATOM   224  O O     . THR A 1 33  ? -15.040 -14.553 -4.406  1.00 39.62 ? 71  THR A O     1 
ATOM   225  C CB    . THR A 1 33  ? -11.944 -15.156 -4.812  1.00 39.77 ? 71  THR A CB    1 
ATOM   226  O OG1   . THR A 1 33  ? -11.705 -16.358 -4.067  1.00 42.76 ? 71  THR A OG1   1 
ATOM   227  C CG2   . THR A 1 33  ? -10.605 -14.552 -5.338  1.00 39.20 ? 71  THR A CG2   1 
ATOM   228  N N     . GLU A 1 34  ? -14.292 -15.169 -2.371  1.00 40.69 ? 72  GLU A N     1 
ATOM   229  C CA    . GLU A 1 34  ? -15.643 -15.549 -1.932  1.00 42.01 ? 72  GLU A CA    1 
ATOM   230  C C     . GLU A 1 34  ? -16.476 -14.320 -1.620  1.00 41.75 ? 72  GLU A C     1 
ATOM   231  O O     . GLU A 1 34  ? -17.658 -14.265 -1.977  1.00 41.21 ? 72  GLU A O     1 
ATOM   232  C CB    . GLU A 1 34  ? -15.598 -16.497 -0.719  1.00 42.16 ? 72  GLU A CB    1 
ATOM   233  C CG    . GLU A 1 34  ? -15.106 -17.907 -1.056  1.00 43.64 ? 72  GLU A CG    1 
ATOM   234  C CD    . GLU A 1 34  ? -14.865 -18.788 0.170   1.00 43.99 ? 72  GLU A CD    1 
ATOM   235  O OE1   . GLU A 1 34  ? -14.616 -18.247 1.279   1.00 46.10 ? 72  GLU A OE1   1 
ATOM   236  O OE2   . GLU A 1 34  ? -14.908 -20.031 0.008   1.00 44.86 ? 72  GLU A OE2   1 
ATOM   237  N N     . ILE A 1 35  ? -15.860 -13.338 -0.963  1.00 41.90 ? 73  ILE A N     1 
ATOM   238  C CA    . ILE A 1 35  ? -16.536 -12.126 -0.484  1.00 42.61 ? 73  ILE A CA    1 
ATOM   239  C C     . ILE A 1 35  ? -16.769 -11.072 -1.582  1.00 42.17 ? 73  ILE A C     1 
ATOM   240  O O     . ILE A 1 35  ? -17.858 -10.454 -1.677  1.00 41.08 ? 73  ILE A O     1 
ATOM   241  C CB    . ILE A 1 35  ? -15.709 -11.512 0.674   1.00 43.02 ? 73  ILE A CB    1 
ATOM   242  C CG1   . ILE A 1 35  ? -15.765 -12.426 1.907   1.00 44.11 ? 73  ILE A CG1   1 
ATOM   243  C CG2   . ILE A 1 35  ? -16.169 -10.103 1.024   1.00 44.29 ? 73  ILE A CG2   1 
ATOM   244  C CD1   . ILE A 1 35  ? -14.824 -11.969 3.035   1.00 44.65 ? 73  ILE A CD1   1 
ATOM   245  N N     . HIS A 1 36  ? -15.748 -10.857 -2.403  1.00 41.21 ? 74  HIS A N     1 
ATOM   246  C CA    . HIS A 1 36  ? -15.778 -9.812  -3.415  1.00 41.53 ? 74  HIS A CA    1 
ATOM   247  C C     . HIS A 1 36  ? -16.218 -10.355 -4.748  1.00 41.62 ? 74  HIS A C     1 
ATOM   248  O O     . HIS A 1 36  ? -15.501 -11.116 -5.373  1.00 42.03 ? 74  HIS A O     1 
ATOM   249  C CB    . HIS A 1 36  ? -14.406 -9.150  -3.516  1.00 41.05 ? 74  HIS A CB    1 
ATOM   250  C CG    . HIS A 1 36  ? -14.046 -8.383  -2.291  1.00 42.04 ? 74  HIS A CG    1 
ATOM   251  N ND1   . HIS A 1 36  ? -13.510 -8.976  -1.170  1.00 43.39 ? 74  HIS A ND1   1 
ATOM   252  C CD2   . HIS A 1 36  ? -14.207 -7.076  -1.984  1.00 44.85 ? 74  HIS A CD2   1 
ATOM   253  C CE1   . HIS A 1 36  ? -13.316 -8.060  -0.238  1.00 42.92 ? 74  HIS A CE1   1 
ATOM   254  N NE2   . HIS A 1 36  ? -13.728 -6.898  -0.708  1.00 46.87 ? 74  HIS A NE2   1 
ATOM   255  N N     . PRO A 1 37  ? -17.434 -9.990  -5.181  1.00 43.20 ? 75  PRO A N     1 
ATOM   256  C CA    . PRO A 1 37  ? -18.030 -10.654 -6.335  1.00 43.23 ? 75  PRO A CA    1 
ATOM   257  C C     . PRO A 1 37  ? -17.279 -10.484 -7.670  1.00 43.90 ? 75  PRO A C     1 
ATOM   258  O O     . PRO A 1 37  ? -17.312 -11.383 -8.510  1.00 44.41 ? 75  PRO A O     1 
ATOM   259  C CB    . PRO A 1 37  ? -19.444 -10.048 -6.405  1.00 43.12 ? 75  PRO A CB    1 
ATOM   260  C CG    . PRO A 1 37  ? -19.358 -8.778  -5.664  1.00 43.50 ? 75  PRO A CG    1 
ATOM   261  C CD    . PRO A 1 37  ? -18.311 -8.938  -4.618  1.00 43.39 ? 75  PRO A CD    1 
ATOM   262  N N     . GLU A 1 38  ? -16.621 -9.345  -7.873  1.00 45.17 ? 76  GLU A N     1 
ATOM   263  C CA    . GLU A 1 38  ? -15.897 -9.122  -9.136  1.00 46.27 ? 76  GLU A CA    1 
ATOM   264  C C     . GLU A 1 38  ? -14.687 -10.060 -9.267  1.00 46.57 ? 76  GLU A C     1 
ATOM   265  O O     . GLU A 1 38  ? -14.176 -10.248 -10.361 1.00 46.53 ? 76  GLU A O     1 
ATOM   266  C CB    . GLU A 1 38  ? -15.463 -7.655  -9.288  1.00 46.70 ? 76  GLU A CB    1 
ATOM   267  C CG    . GLU A 1 38  ? -14.284 -7.277  -8.435  1.00 50.16 ? 76  GLU A CG    1 
ATOM   268  C CD    . GLU A 1 38  ? -14.659 -6.752  -7.067  1.00 55.32 ? 76  GLU A CD    1 
ATOM   269  O OE1   . GLU A 1 38  ? -15.754 -7.081  -6.529  1.00 54.33 ? 76  GLU A OE1   1 
ATOM   270  O OE2   . GLU A 1 38  ? -13.830 -5.975  -6.528  1.00 57.07 ? 76  GLU A OE2   1 
ATOM   271  N N     . MET A 1 39  ? -14.242 -10.639 -8.155  1.00 46.73 ? 77  MET A N     1 
ATOM   272  C CA    . MET A 1 39  ? -13.099 -11.551 -8.174  1.00 47.17 ? 77  MET A CA    1 
ATOM   273  C C     . MET A 1 39  ? -13.507 -13.008 -7.995  1.00 47.65 ? 77  MET A C     1 
ATOM   274  O O     . MET A 1 39  ? -12.642 -13.878 -7.840  1.00 47.80 ? 77  MET A O     1 
ATOM   275  C CB    . MET A 1 39  ? -12.074 -11.144 -7.124  1.00 46.58 ? 77  MET A CB    1 
ATOM   276  C CG    . MET A 1 39  ? -11.637 -9.709  -7.252  1.00 47.45 ? 77  MET A CG    1 
ATOM   277  S SD    . MET A 1 39  ? -10.820 -9.323  -8.807  1.00 47.45 ? 77  MET A SD    1 
ATOM   278  C CE    . MET A 1 39  ? -9.096  -9.536  -8.346  1.00 42.84 ? 77  MET A CE    1 
ATOM   279  N N     . ARG A 1 40  ? -14.823 -13.249 -8.030  1.00 48.50 ? 78  ARG A N     1 
ATOM   280  C CA    . ARG A 1 40  ? -15.445 -14.573 -7.890  1.00 49.29 ? 78  ARG A CA    1 
ATOM   281  C C     . ARG A 1 40  ? -14.816 -15.678 -8.708  1.00 49.14 ? 78  ARG A C     1 
ATOM   282  O O     . ARG A 1 40  ? -14.929 -16.848 -8.356  1.00 49.10 ? 78  ARG A O     1 
ATOM   283  C CB    . ARG A 1 40  ? -16.883 -14.521 -8.385  1.00 49.82 ? 78  ARG A CB    1 
ATOM   284  C CG    . ARG A 1 40  ? -17.938 -14.169 -7.396  1.00 52.86 ? 78  ARG A CG    1 
ATOM   285  C CD    . ARG A 1 40  ? -19.295 -14.324 -8.101  1.00 53.67 ? 78  ARG A CD    1 
ATOM   286  N NE    . ARG A 1 40  ? -19.429 -13.433 -9.258  1.00 56.72 ? 78  ARG A NE    1 
ATOM   287  C CZ    . ARG A 1 40  ? -20.339 -13.566 -10.223 1.00 58.70 ? 78  ARG A CZ    1 
ATOM   288  N NH1   . ARG A 1 40  ? -21.210 -14.558 -10.189 1.00 60.43 ? 78  ARG A NH1   1 
ATOM   289  N NH2   . ARG A 1 40  ? -20.387 -12.698 -11.229 1.00 60.31 ? 78  ARG A NH2   1 
ATOM   290  N N     . HIS A 1 41  ? -14.205 -15.309 -9.827  1.00 49.13 ? 79  HIS A N     1 
ATOM   291  C CA    . HIS A 1 41  ? -13.784 -16.286 -10.821 1.00 48.49 ? 79  HIS A CA    1 
ATOM   292  C C     . HIS A 1 41  ? -12.285 -16.545 -10.779 1.00 47.73 ? 79  HIS A C     1 
ATOM   293  O O     . HIS A 1 41  ? -11.787 -17.418 -11.493 1.00 47.97 ? 79  HIS A O     1 
ATOM   294  C CB    . HIS A 1 41  ? -14.152 -15.787 -12.212 1.00 49.37 ? 79  HIS A CB    1 
ATOM   295  C CG    . HIS A 1 41  ? -13.244 -14.711 -12.718 1.00 50.97 ? 79  HIS A CG    1 
ATOM   296  N ND1   . HIS A 1 41  ? -13.173 -13.462 -12.136 1.00 54.60 ? 79  HIS A ND1   1 
ATOM   297  C CD2   . HIS A 1 41  ? -12.351 -14.705 -13.735 1.00 53.01 ? 79  HIS A CD2   1 
ATOM   298  C CE1   . HIS A 1 41  ? -12.284 -12.727 -12.783 1.00 54.62 ? 79  HIS A CE1   1 
ATOM   299  N NE2   . HIS A 1 41  ? -11.770 -13.459 -13.756 1.00 55.43 ? 79  HIS A NE2   1 
ATOM   300  N N     . VAL A 1 42  ? -11.561 -15.776 -9.968  1.00 46.19 ? 80  VAL A N     1 
ATOM   301  C CA    . VAL A 1 42  ? -10.109 -15.936 -9.881  1.00 44.42 ? 80  VAL A CA    1 
ATOM   302  C C     . VAL A 1 42  ? -9.762  -17.346 -9.399  1.00 44.30 ? 80  VAL A C     1 
ATOM   303  O O     . VAL A 1 42  ? -10.455 -17.886 -8.522  1.00 44.75 ? 80  VAL A O     1 
ATOM   304  C CB    . VAL A 1 42  ? -9.481  -14.866 -8.954  1.00 44.36 ? 80  VAL A CB    1 
ATOM   305  C CG1   . VAL A 1 42  ? -8.101  -15.304 -8.477  1.00 42.36 ? 80  VAL A CG1   1 
ATOM   306  C CG2   . VAL A 1 42  ? -9.411  -13.501 -9.660  1.00 42.44 ? 80  VAL A CG2   1 
ATOM   307  N N     . ASP A 1 43  ? -8.725  -17.950 -9.993  1.00 43.67 ? 81  ASP A N     1 
ATOM   308  C CA    . ASP A 1 43  ? -8.244  -19.275 -9.583  1.00 43.02 ? 81  ASP A CA    1 
ATOM   309  C C     . ASP A 1 43  ? -7.101  -19.015 -8.615  1.00 42.18 ? 81  ASP A C     1 
ATOM   310  O O     . ASP A 1 43  ? -6.044  -18.524 -9.011  1.00 41.06 ? 81  ASP A O     1 
ATOM   311  C CB    . ASP A 1 43  ? -7.793  -20.097 -10.817 1.00 43.16 ? 81  ASP A CB    1 
ATOM   312  C CG    . ASP A 1 43  ? -7.316  -21.523 -10.474 1.00 44.83 ? 81  ASP A CG    1 
ATOM   313  O OD1   . ASP A 1 43  ? -7.894  -22.484 -11.031 1.00 46.79 ? 81  ASP A OD1   1 
ATOM   314  O OD2   . ASP A 1 43  ? -6.349  -21.705 -9.691  1.00 46.05 ? 81  ASP A OD2   1 
ATOM   315  N N     . CYS A 1 44  ? -7.334  -19.341 -7.346  1.00 41.32 ? 82  CYS A N     1 
ATOM   316  C CA    . CYS A 1 44  ? -6.408  -19.016 -6.272  1.00 41.72 ? 82  CYS A CA    1 
ATOM   317  C C     . CYS A 1 44  ? -5.132  -19.845 -6.287  1.00 40.44 ? 82  CYS A C     1 
ATOM   318  O O     . CYS A 1 44  ? -4.083  -19.375 -5.870  1.00 39.60 ? 82  CYS A O     1 
ATOM   319  C CB    . CYS A 1 44  ? -7.118  -19.051 -4.919  1.00 41.90 ? 82  CYS A CB    1 
ATOM   320  S SG    . CYS A 1 44  ? -8.140  -17.538 -4.672  1.00 48.26 ? 82  CYS A SG    1 
ATOM   321  N N     . GLN A 1 45  ? -5.213  -21.072 -6.799  1.00 39.39 ? 83  GLN A N     1 
ATOM   322  C CA    . GLN A 1 45  ? -4.015  -21.845 -7.061  1.00 39.08 ? 83  GLN A CA    1 
ATOM   323  C C     . GLN A 1 45  ? -3.112  -21.125 -8.070  1.00 38.21 ? 83  GLN A C     1 
ATOM   324  O O     . GLN A 1 45  ? -1.890  -21.063 -7.890  1.00 39.04 ? 83  GLN A O     1 
ATOM   325  C CB    . GLN A 1 45  ? -4.349  -23.274 -7.534  1.00 39.48 ? 83  GLN A CB    1 
ATOM   326  C CG    . GLN A 1 45  ? -3.107  -24.112 -7.857  1.00 42.70 ? 83  GLN A CG    1 
ATOM   327  C CD    . GLN A 1 45  ? -2.136  -24.250 -6.684  1.00 45.56 ? 83  GLN A CD    1 
ATOM   328  O OE1   . GLN A 1 45  ? -0.939  -24.000 -6.822  1.00 47.15 ? 83  GLN A OE1   1 
ATOM   329  N NE2   . GLN A 1 45  ? -2.652  -24.647 -5.526  1.00 47.11 ? 83  GLN A NE2   1 
ATOM   330  N N     . SER A 1 46  ? -3.714  -20.569 -9.115  1.00 37.27 ? 84  SER A N     1 
ATOM   331  C CA    . SER A 1 46  ? -2.966  -19.849 -10.149 1.00 36.25 ? 84  SER A CA    1 
ATOM   332  C C     . SER A 1 46  ? -2.316  -18.591 -9.557  1.00 35.51 ? 84  SER A C     1 
ATOM   333  O O     . SER A 1 46  ? -1.177  -18.257 -9.880  1.00 34.23 ? 84  SER A O     1 
ATOM   334  C CB    . SER A 1 46  ? -3.887  -19.499 -11.323 1.00 36.69 ? 84  SER A CB    1 
ATOM   335  O OG    . SER A 1 46  ? -4.500  -20.702 -11.850 1.00 38.68 ? 84  SER A OG    1 
ATOM   336  N N     . VAL A 1 47  ? -3.052  -17.922 -8.678  1.00 35.10 ? 85  VAL A N     1 
ATOM   337  C CA    . VAL A 1 47  ? -2.534  -16.725 -8.006  1.00 35.36 ? 85  VAL A CA    1 
ATOM   338  C C     . VAL A 1 47  ? -1.343  -17.107 -7.154  1.00 35.99 ? 85  VAL A C     1 
ATOM   339  O O     . VAL A 1 47  ? -0.317  -16.423 -7.200  1.00 37.42 ? 85  VAL A O     1 
ATOM   340  C CB    . VAL A 1 47  ? -3.608  -16.038 -7.171  1.00 34.74 ? 85  VAL A CB    1 
ATOM   341  C CG1   . VAL A 1 47  ? -2.994  -14.976 -6.233  1.00 34.71 ? 85  VAL A CG1   1 
ATOM   342  C CG2   . VAL A 1 47  ? -4.591  -15.365 -8.089  1.00 35.76 ? 85  VAL A CG2   1 
ATOM   343  N N     . TRP A 1 48  ? -1.473  -18.172 -6.360  1.00 36.95 ? 86  TRP A N     1 
ATOM   344  C CA    . TRP A 1 48  ? -0.313  -18.635 -5.579  1.00 37.10 ? 86  TRP A CA    1 
ATOM   345  C C     . TRP A 1 48  ? 0.886   -19.003 -6.451  1.00 37.34 ? 86  TRP A C     1 
ATOM   346  O O     . TRP A 1 48  ? 2.037   -18.636 -6.135  1.00 37.08 ? 86  TRP A O     1 
ATOM   347  C CB    . TRP A 1 48  ? -0.659  -19.782 -4.632  1.00 37.93 ? 86  TRP A CB    1 
ATOM   348  C CG    . TRP A 1 48  ? 0.578   -20.360 -4.021  1.00 36.55 ? 86  TRP A CG    1 
ATOM   349  C CD1   . TRP A 1 48  ? 1.067   -21.617 -4.192  1.00 36.51 ? 86  TRP A CD1   1 
ATOM   350  C CD2   . TRP A 1 48  ? 1.518   -19.671 -3.182  1.00 36.57 ? 86  TRP A CD2   1 
ATOM   351  N NE1   . TRP A 1 48  ? 2.246   -21.764 -3.499  1.00 37.31 ? 86  TRP A NE1   1 
ATOM   352  C CE2   . TRP A 1 48  ? 2.543   -20.589 -2.867  1.00 34.79 ? 86  TRP A CE2   1 
ATOM   353  C CE3   . TRP A 1 48  ? 1.577   -18.377 -2.644  1.00 35.49 ? 86  TRP A CE3   1 
ATOM   354  C CZ2   . TRP A 1 48  ? 3.631   -20.257 -2.050  1.00 37.44 ? 86  TRP A CZ2   1 
ATOM   355  C CZ3   . TRP A 1 48  ? 2.676   -18.039 -1.840  1.00 37.02 ? 86  TRP A CZ3   1 
ATOM   356  C CH2   . TRP A 1 48  ? 3.677   -18.972 -1.545  1.00 35.98 ? 86  TRP A CH2   1 
ATOM   357  N N     . ASP A 1 49  ? 0.651   -19.736 -7.540  1.00 37.04 ? 87  ASP A N     1 
ATOM   358  C CA    . ASP A 1 49  ? 1.760   -20.110 -8.442  1.00 37.32 ? 87  ASP A CA    1 
ATOM   359  C C     . ASP A 1 49  ? 2.526   -18.904 -9.012  1.00 37.18 ? 87  ASP A C     1 
ATOM   360  O O     . ASP A 1 49  ? 3.768   -18.904 -9.075  1.00 36.45 ? 87  ASP A O     1 
ATOM   361  C CB    . ASP A 1 49  ? 1.259   -21.033 -9.548  1.00 37.86 ? 87  ASP A CB    1 
ATOM   362  C CG    . ASP A 1 49  ? 0.831   -22.366 -9.012  1.00 41.13 ? 87  ASP A CG    1 
ATOM   363  O OD1   . ASP A 1 49  ? 1.250   -22.690 -7.876  1.00 44.59 ? 87  ASP A OD1   1 
ATOM   364  O OD2   . ASP A 1 49  ? 0.079   -23.086 -9.712  1.00 42.56 ? 87  ASP A OD2   1 
ATOM   365  N N     . ALA A 1 50  ? 1.778   -17.854 -9.358  1.00 36.83 ? 88  ALA A N     1 
ATOM   366  C CA    . ALA A 1 50  ? 2.359   -16.652 -9.932  1.00 35.05 ? 88  ALA A CA    1 
ATOM   367  C C     . ALA A 1 50  ? 3.081   -15.852 -8.845  1.00 35.15 ? 88  ALA A C     1 
ATOM   368  O O     . ALA A 1 50  ? 4.110   -15.252 -9.111  1.00 34.64 ? 88  ALA A O     1 
ATOM   369  C CB    . ALA A 1 50  ? 1.292   -15.809 -10.572 1.00 35.97 ? 88  ALA A CB    1 
ATOM   370  N N     . PHE A 1 51  ? 2.545   -15.888 -7.626  1.00 35.67 ? 89  PHE A N     1 
ATOM   371  C CA    . PHE A 1 51  ? 3.142   -15.123 -6.495  1.00 35.25 ? 89  PHE A CA    1 
ATOM   372  C C     . PHE A 1 51  ? 4.492   -15.806 -6.219  1.00 35.71 ? 89  PHE A C     1 
ATOM   373  O O     . PHE A 1 51  ? 5.545   -15.163 -6.217  1.00 36.41 ? 89  PHE A O     1 
ATOM   374  C CB    . PHE A 1 51  ? 2.219   -15.189 -5.264  1.00 35.24 ? 89  PHE A CB    1 
ATOM   375  C CG    . PHE A 1 51  ? 2.449   -14.106 -4.229  1.00 35.12 ? 89  PHE A CG    1 
ATOM   376  C CD1   . PHE A 1 51  ? 3.723   -13.728 -3.836  1.00 36.76 ? 89  PHE A CD1   1 
ATOM   377  C CD2   . PHE A 1 51  ? 1.350   -13.507 -3.601  1.00 37.77 ? 89  PHE A CD2   1 
ATOM   378  C CE1   . PHE A 1 51  ? 3.903   -12.731 -2.867  1.00 35.41 ? 89  PHE A CE1   1 
ATOM   379  C CE2   . PHE A 1 51  ? 1.521   -12.504 -2.648  1.00 36.51 ? 89  PHE A CE2   1 
ATOM   380  C CZ    . PHE A 1 51  ? 2.810   -12.139 -2.276  1.00 37.13 ? 89  PHE A CZ    1 
ATOM   381  N N     . LYS A 1 52  ? 4.437   -17.128 -6.035  1.00 36.32 ? 90  LYS A N     1 
ATOM   382  C CA    . LYS A 1 52  ? 5.614   -17.968 -5.838  1.00 36.46 ? 90  LYS A CA    1 
ATOM   383  C C     . LYS A 1 52  ? 6.657   -17.762 -6.943  1.00 35.96 ? 90  LYS A C     1 
ATOM   384  O O     . LYS A 1 52  ? 7.846   -17.569 -6.662  1.00 35.84 ? 90  LYS A O     1 
ATOM   385  C CB    . LYS A 1 52  ? 5.161   -19.423 -5.782  1.00 37.35 ? 90  LYS A CB    1 
ATOM   386  C CG    . LYS A 1 52  ? 5.856   -20.237 -4.744  1.00 40.46 ? 90  LYS A CG    1 
ATOM   387  C CD    . LYS A 1 52  ? 5.847   -21.719 -5.118  1.00 40.32 ? 90  LYS A CD    1 
ATOM   388  C CE    . LYS A 1 52  ? 4.523   -22.176 -5.711  1.00 43.59 ? 90  LYS A CE    1 
ATOM   389  N NZ    . LYS A 1 52  ? 4.446   -23.663 -5.690  1.00 42.98 ? 90  LYS A NZ    1 
ATOM   390  N N     . GLY A 1 53  ? 6.210   -17.715 -8.194  1.00 35.82 ? 91  GLY A N     1 
ATOM   391  C CA    . GLY A 1 53  ? 7.129   -17.544 -9.333  1.00 35.18 ? 91  GLY A CA    1 
ATOM   392  C C     . GLY A 1 53  ? 7.932   -16.263 -9.320  1.00 35.63 ? 91  GLY A C     1 
ATOM   393  O O     . GLY A 1 53  ? 9.017   -16.196 -9.887  1.00 35.72 ? 91  GLY A O     1 
ATOM   394  N N     . ALA A 1 54  ? 7.402   -15.245 -8.643  1.00 35.29 ? 92  ALA A N     1 
ATOM   395  C CA    . ALA A 1 54  ? 8.068   -13.956 -8.498  1.00 34.75 ? 92  ALA A CA    1 
ATOM   396  C C     . ALA A 1 54  ? 9.356   -14.033 -7.699  1.00 34.29 ? 92  ALA A C     1 
ATOM   397  O O     . ALA A 1 54  ? 10.272  -13.282 -7.967  1.00 35.54 ? 92  ALA A O     1 
ATOM   398  C CB    . ALA A 1 54  ? 7.143   -12.949 -7.837  1.00 34.80 ? 92  ALA A CB    1 
ATOM   399  N N     . PHE A 1 55  ? 9.411   -14.893 -6.686  1.00 33.36 ? 93  PHE A N     1 
ATOM   400  C CA    . PHE A 1 55  ? 10.571  -14.871 -5.797  1.00 32.82 ? 93  PHE A CA    1 
ATOM   401  C C     . PHE A 1 55  ? 11.300  -16.192 -5.552  1.00 32.37 ? 93  PHE A C     1 
ATOM   402  O O     . PHE A 1 55  ? 12.439  -16.211 -5.093  1.00 31.85 ? 93  PHE A O     1 
ATOM   403  C CB    . PHE A 1 55  ? 10.188  -14.183 -4.475  1.00 32.11 ? 93  PHE A CB    1 
ATOM   404  C CG    . PHE A 1 55  ? 9.290   -14.991 -3.595  1.00 30.64 ? 93  PHE A CG    1 
ATOM   405  C CD1   . PHE A 1 55  ? 9.813   -15.727 -2.542  1.00 29.36 ? 93  PHE A CD1   1 
ATOM   406  C CD2   . PHE A 1 55  ? 7.893   -14.982 -3.782  1.00 31.62 ? 93  PHE A CD2   1 
ATOM   407  C CE1   . PHE A 1 55  ? 8.981   -16.501 -1.723  1.00 33.46 ? 93  PHE A CE1   1 
ATOM   408  C CE2   . PHE A 1 55  ? 7.047   -15.753 -2.958  1.00 33.39 ? 93  PHE A CE2   1 
ATOM   409  C CZ    . PHE A 1 55  ? 7.591   -16.491 -1.914  1.00 32.64 ? 93  PHE A CZ    1 
ATOM   410  N N     . ILE A 1 56  ? 10.652  -17.309 -5.828  1.00 31.82 ? 94  ILE A N     1 
ATOM   411  C CA    . ILE A 1 56  ? 11.294  -18.604 -5.572  1.00 32.54 ? 94  ILE A CA    1 
ATOM   412  C C     . ILE A 1 56  ? 12.447  -18.831 -6.552  1.00 32.43 ? 94  ILE A C     1 
ATOM   413  O O     . ILE A 1 56  ? 12.339  -18.473 -7.727  1.00 33.41 ? 94  ILE A O     1 
ATOM   414  C CB    . ILE A 1 56  ? 10.267  -19.755 -5.601  1.00 32.39 ? 94  ILE A CB    1 
ATOM   415  C CG1   . ILE A 1 56  ? 9.337   -19.630 -4.390  1.00 34.97 ? 94  ILE A CG1   1 
ATOM   416  C CG2   . ILE A 1 56  ? 10.952  -21.076 -5.499  1.00 32.58 ? 94  ILE A CG2   1 
ATOM   417  C CD1   . ILE A 1 56  ? 10.035  -20.076 -3.053  1.00 39.37 ? 94  ILE A CD1   1 
ATOM   418  N N     . SER A 1 57  ? 13.559  -19.347 -6.041  1.00 31.91 ? 95  SER A N     1 
ATOM   419  C CA    . SER A 1 57  ? 14.740  -19.652 -6.860  1.00 33.32 ? 95  SER A CA    1 
ATOM   420  C C     . SER A 1 57  ? 15.463  -18.382 -7.344  1.00 33.69 ? 95  SER A C     1 
ATOM   421  O O     . SER A 1 57  ? 16.357  -18.446 -8.179  1.00 35.37 ? 95  SER A O     1 
ATOM   422  C CB    . SER A 1 57  ? 14.355  -20.572 -8.032  1.00 32.43 ? 95  SER A CB    1 
ATOM   423  O OG    . SER A 1 57  ? 13.942  -21.847 -7.547  1.00 36.55 ? 95  SER A OG    1 
ATOM   424  N N     . LYS A 1 58  ? 15.096  -17.233 -6.789  1.00 33.75 ? 96  LYS A N     1 
ATOM   425  C CA    . LYS A 1 58  ? 15.695  -15.990 -7.228  1.00 34.38 ? 96  LYS A CA    1 
ATOM   426  C C     . LYS A 1 58  ? 16.454  -15.413 -6.056  1.00 34.61 ? 96  LYS A C     1 
ATOM   427  O O     . LYS A 1 58  ? 16.099  -15.680 -4.901  1.00 34.49 ? 96  LYS A O     1 
ATOM   428  C CB    . LYS A 1 58  ? 14.607  -15.054 -7.769  1.00 34.06 ? 96  LYS A CB    1 
ATOM   429  C CG    . LYS A 1 58  ? 13.933  -15.668 -9.004  1.00 36.46 ? 96  LYS A CG    1 
ATOM   430  C CD    . LYS A 1 58  ? 12.914  -14.780 -9.623  1.00 38.20 ? 96  LYS A CD    1 
ATOM   431  C CE    . LYS A 1 58  ? 12.297  -15.459 -10.858 1.00 38.52 ? 96  LYS A CE    1 
ATOM   432  N NZ    . LYS A 1 58  ? 11.013  -14.775 -11.207 1.00 43.17 ? 96  LYS A NZ    1 
ATOM   433  N N     . HIS A 1 59  ? 17.521  -14.665 -6.334  1.00 34.21 ? 97  HIS A N     1 
ATOM   434  C CA    . HIS A 1 59  ? 18.282  -14.045 -5.262  1.00 34.21 ? 97  HIS A CA    1 
ATOM   435  C C     . HIS A 1 59  ? 17.412  -12.952 -4.672  1.00 33.58 ? 97  HIS A C     1 
ATOM   436  O O     . HIS A 1 59  ? 16.877  -12.151 -5.408  1.00 33.47 ? 97  HIS A O     1 
ATOM   437  C CB    . HIS A 1 59  ? 19.562  -13.429 -5.779  1.00 34.00 ? 97  HIS A CB    1 
ATOM   438  C CG    . HIS A 1 59  ? 20.520  -13.095 -4.695  1.00 32.79 ? 97  HIS A CG    1 
ATOM   439  N ND1   . HIS A 1 59  ? 20.291  -12.070 -3.805  1.00 32.89 ? 97  HIS A ND1   1 
ATOM   440  C CD2   . HIS A 1 59  ? 21.696  -13.658 -4.337  1.00 34.49 ? 97  HIS A CD2   1 
ATOM   441  C CE1   . HIS A 1 59  ? 21.289  -12.011 -2.944  1.00 34.66 ? 97  HIS A CE1   1 
ATOM   442  N NE2   . HIS A 1 59  ? 22.158  -12.964 -3.244  1.00 35.54 ? 97  HIS A NE2   1 
ATOM   443  N N     . PRO A 1 60  ? 17.234  -12.942 -3.342  1.00 33.72 ? 98  PRO A N     1 
ATOM   444  C CA    . PRO A 1 60  ? 16.253  -12.021 -2.784  1.00 33.60 ? 98  PRO A CA    1 
ATOM   445  C C     . PRO A 1 60  ? 16.761  -10.587 -2.720  1.00 34.03 ? 98  PRO A C     1 
ATOM   446  O O     . PRO A 1 60  ? 16.051  -9.735  -2.224  1.00 32.34 ? 98  PRO A O     1 
ATOM   447  C CB    . PRO A 1 60  ? 16.042  -12.547 -1.366  1.00 33.51 ? 98  PRO A CB    1 
ATOM   448  C CG    . PRO A 1 60  ? 17.386  -13.193 -1.034  1.00 34.36 ? 98  PRO A CG    1 
ATOM   449  C CD    . PRO A 1 60  ? 17.845  -13.812 -2.314  1.00 34.26 ? 98  PRO A CD    1 
ATOM   450  N N     . CYS A 1 61  ? 17.951  -10.328 -3.236  1.00 34.17 ? 99  CYS A N     1 
ATOM   451  C CA    . CYS A 1 61  ? 18.374  -8.936  -3.459  1.00 36.52 ? 99  CYS A CA    1 
ATOM   452  C C     . CYS A 1 61  ? 18.344  -8.534  -4.922  1.00 37.24 ? 99  CYS A C     1 
ATOM   453  O O     . CYS A 1 61  ? 18.875  -7.478  -5.277  1.00 38.29 ? 99  CYS A O     1 
ATOM   454  C CB    . CYS A 1 61  ? 19.756  -8.684  -2.853  1.00 37.15 ? 99  CYS A CB    1 
ATOM   455  S SG    . CYS A 1 61  ? 19.626  -8.560  -1.067  1.00 39.58 ? 99  CYS A SG    1 
ATOM   456  N N     . ASP A 1 62  ? 17.699  -9.343  -5.756  1.00 37.19 ? 100 ASP A N     1 
ATOM   457  C CA    . ASP A 1 62  ? 17.675  -9.086  -7.185  1.00 38.33 ? 100 ASP A CA    1 
ATOM   458  C C     . ASP A 1 62  ? 16.288  -9.250  -7.777  1.00 38.08 ? 100 ASP A C     1 
ATOM   459  O O     . ASP A 1 62  ? 16.126  -9.831  -8.837  1.00 38.77 ? 100 ASP A O     1 
ATOM   460  C CB    . ASP A 1 62  ? 18.668  -9.992  -7.930  1.00 39.67 ? 100 ASP A CB    1 
ATOM   461  C CG    . ASP A 1 62  ? 18.925  -9.507  -9.349  1.00 42.28 ? 100 ASP A CG    1 
ATOM   462  O OD1   . ASP A 1 62  ? 19.216  -10.357 -10.219 1.00 49.04 ? 100 ASP A OD1   1 
ATOM   463  O OD2   . ASP A 1 62  ? 18.805  -8.275  -9.589  1.00 47.35 ? 100 ASP A OD2   1 
ATOM   464  N N     . ILE A 1 63  ? 15.278  -8.749  -7.079  1.00 36.74 ? 101 ILE A N     1 
ATOM   465  C CA    . ILE A 1 63  ? 13.904  -8.901  -7.554  1.00 36.65 ? 101 ILE A CA    1 
ATOM   466  C C     . ILE A 1 63  ? 13.570  -7.641  -8.322  1.00 37.12 ? 101 ILE A C     1 
ATOM   467  O O     . ILE A 1 63  ? 14.062  -6.556  -7.988  1.00 38.61 ? 101 ILE A O     1 
ATOM   468  C CB    . ILE A 1 63  ? 12.950  -9.140  -6.374  1.00 35.30 ? 101 ILE A CB    1 
ATOM   469  C CG1   . ILE A 1 63  ? 13.482  -10.255 -5.462  1.00 35.62 ? 101 ILE A CG1   1 
ATOM   470  C CG2   . ILE A 1 63  ? 11.506  -9.414  -6.839  1.00 35.73 ? 101 ILE A CG2   1 
ATOM   471  C CD1   . ILE A 1 63  ? 13.506  -11.673 -6.114  1.00 34.56 ? 101 ILE A CD1   1 
ATOM   472  N N     . THR A 1 64  ? 12.773  -7.793  -9.372  1.00 39.02 ? 102 THR A N     1 
ATOM   473  C CA    . THR A 1 64  ? 12.398  -6.674  -10.226 1.00 39.68 ? 102 THR A CA    1 
ATOM   474  C C     . THR A 1 64  ? 10.885  -6.661  -10.296 1.00 40.69 ? 102 THR A C     1 
ATOM   475  O O     . THR A 1 64  ? 10.215  -7.597  -9.847  1.00 39.89 ? 102 THR A O     1 
ATOM   476  C CB    . THR A 1 64  ? 12.934  -6.839  -11.665 1.00 40.42 ? 102 THR A CB    1 
ATOM   477  O OG1   . THR A 1 64  ? 12.264  -7.934  -12.300 1.00 38.63 ? 102 THR A OG1   1 
ATOM   478  C CG2   . THR A 1 64  ? 14.453  -7.083  -11.685 1.00 42.00 ? 102 THR A CG2   1 
ATOM   479  N N     . GLU A 1 65  ? 10.350  -5.590  -10.872 1.00 41.87 ? 103 GLU A N     1 
ATOM   480  C CA    . GLU A 1 65  ? 8.907   -5.462  -11.023 1.00 43.73 ? 103 GLU A CA    1 
ATOM   481  C C     . GLU A 1 65  ? 8.407   -6.501  -12.008 1.00 43.21 ? 103 GLU A C     1 
ATOM   482  O O     . GLU A 1 65  ? 7.287   -6.989  -11.864 1.00 44.06 ? 103 GLU A O     1 
ATOM   483  C CB    . GLU A 1 65  ? 8.507   -4.040  -11.419 1.00 43.91 ? 103 GLU A CB    1 
ATOM   484  C CG    . GLU A 1 65  ? 8.869   -3.040  -10.322 1.00 48.47 ? 103 GLU A CG    1 
ATOM   485  C CD    . GLU A 1 65  ? 7.998   -1.808  -10.263 1.00 53.17 ? 103 GLU A CD    1 
ATOM   486  O OE1   . GLU A 1 65  ? 7.049   -1.666  -11.078 1.00 55.67 ? 103 GLU A OE1   1 
ATOM   487  O OE2   . GLU A 1 65  ? 8.293   -0.968  -9.384  1.00 55.01 ? 103 GLU A OE2   1 
ATOM   488  N N     . GLU A 1 66  ? 9.257   -6.898  -12.961 1.00 42.84 ? 104 GLU A N     1 
ATOM   489  C CA    . GLU A 1 66  ? 8.848   -7.859  -13.983 1.00 42.60 ? 104 GLU A CA    1 
ATOM   490  C C     . GLU A 1 66  ? 8.524   -9.193  -13.352 1.00 41.56 ? 104 GLU A C     1 
ATOM   491  O O     . GLU A 1 66  ? 7.668   -9.931  -13.855 1.00 41.87 ? 104 GLU A O     1 
ATOM   492  C CB    . GLU A 1 66  ? 9.935   -8.048  -15.054 1.00 43.62 ? 104 GLU A CB    1 
ATOM   493  C CG    . GLU A 1 66  ? 10.135  -6.846  -15.957 1.00 48.01 ? 104 GLU A CG    1 
ATOM   494  C CD    . GLU A 1 66  ? 11.232  -5.899  -15.457 1.00 53.59 ? 104 GLU A CD    1 
ATOM   495  O OE1   . GLU A 1 66  ? 11.056  -5.303  -14.374 1.00 52.58 ? 104 GLU A OE1   1 
ATOM   496  O OE2   . GLU A 1 66  ? 12.273  -5.759  -16.161 1.00 56.67 ? 104 GLU A OE2   1 
ATOM   497  N N     . ASP A 1 67  ? 9.228   -9.517  -12.263 1.00 39.54 ? 105 ASP A N     1 
ATOM   498  C CA    . ASP A 1 67  ? 9.020   -10.778 -11.584 1.00 37.68 ? 105 ASP A CA    1 
ATOM   499  C C     . ASP A 1 67  ? 7.577   -10.882 -11.143 1.00 36.16 ? 105 ASP A C     1 
ATOM   500  O O     . ASP A 1 67  ? 7.038   -11.960 -11.124 1.00 34.05 ? 105 ASP A O     1 
ATOM   501  C CB    . ASP A 1 67  ? 9.960   -10.944 -10.375 1.00 37.50 ? 105 ASP A CB    1 
ATOM   502  C CG    . ASP A 1 67  ? 11.400  -11.309 -10.784 1.00 38.91 ? 105 ASP A CG    1 
ATOM   503  O OD1   . ASP A 1 67  ? 11.584  -12.217 -11.634 1.00 39.17 ? 105 ASP A OD1   1 
ATOM   504  O OD2   . ASP A 1 67  ? 12.345  -10.684 -10.248 1.00 38.74 ? 105 ASP A OD2   1 
ATOM   505  N N     . TYR A 1 68  ? 6.966   -9.748  -10.786 1.00 35.99 ? 106 TYR A N     1 
ATOM   506  C CA    . TYR A 1 68  ? 5.595   -9.766  -10.280 1.00 35.26 ? 106 TYR A CA    1 
ATOM   507  C C     . TYR A 1 68  ? 4.530   -9.572  -11.353 1.00 37.23 ? 106 TYR A C     1 
ATOM   508  O O     . TYR A 1 68  ? 3.353   -9.498  -11.041 1.00 36.68 ? 106 TYR A O     1 
ATOM   509  C CB    . TYR A 1 68  ? 5.430   -8.694  -9.202  1.00 34.67 ? 106 TYR A CB    1 
ATOM   510  C CG    . TYR A 1 68  ? 6.008   -9.111  -7.884  1.00 33.67 ? 106 TYR A CG    1 
ATOM   511  C CD1   . TYR A 1 68  ? 7.160   -8.498  -7.395  1.00 32.27 ? 106 TYR A CD1   1 
ATOM   512  C CD2   . TYR A 1 68  ? 5.385   -10.109 -7.101  1.00 32.29 ? 106 TYR A CD2   1 
ATOM   513  C CE1   . TYR A 1 68  ? 7.705   -8.896  -6.169  1.00 32.12 ? 106 TYR A CE1   1 
ATOM   514  C CE2   . TYR A 1 68  ? 5.926   -10.511 -5.882  1.00 32.28 ? 106 TYR A CE2   1 
ATOM   515  C CZ    . TYR A 1 68  ? 7.082   -9.895  -5.424  1.00 32.19 ? 106 TYR A CZ    1 
ATOM   516  O OH    . TYR A 1 68  ? 7.607   -10.266 -4.206  1.00 32.31 ? 106 TYR A OH    1 
ATOM   517  N N     . GLN A 1 69  ? 4.932   -9.512  -12.623 1.00 38.28 ? 107 GLN A N     1 
ATOM   518  C CA    . GLN A 1 69  ? 3.947   -9.214  -13.650 1.00 40.48 ? 107 GLN A CA    1 
ATOM   519  C C     . GLN A 1 69  ? 2.897   -10.331 -13.847 1.00 39.45 ? 107 GLN A C     1 
ATOM   520  O O     . GLN A 1 69  ? 1.711   -10.026 -13.964 1.00 39.59 ? 107 GLN A O     1 
ATOM   521  C CB    . GLN A 1 69  ? 4.621   -8.775  -14.946 1.00 41.25 ? 107 GLN A CB    1 
ATOM   522  C CG    . GLN A 1 69  ? 5.358   -7.432  -14.794 1.00 45.20 ? 107 GLN A CG    1 
ATOM   523  C CD    . GLN A 1 69  ? 4.523   -6.347  -14.126 1.00 51.59 ? 107 GLN A CD    1 
ATOM   524  O OE1   . GLN A 1 69  ? 3.464   -5.940  -14.646 1.00 55.16 ? 107 GLN A OE1   1 
ATOM   525  N NE2   . GLN A 1 69  ? 4.997   -5.862  -12.963 1.00 48.21 ? 107 GLN A NE2   1 
ATOM   526  N N     . PRO A 1 70  ? 3.308   -11.613 -13.821 1.00 39.34 ? 108 PRO A N     1 
ATOM   527  C CA    . PRO A 1 70  ? 2.293   -12.670 -13.875 1.00 38.15 ? 108 PRO A CA    1 
ATOM   528  C C     . PRO A 1 70  ? 1.234   -12.517 -12.781 1.00 37.39 ? 108 PRO A C     1 
ATOM   529  O O     . PRO A 1 70  ? 0.044   -12.657 -13.069 1.00 37.16 ? 108 PRO A O     1 
ATOM   530  C CB    . PRO A 1 70  ? 3.119   -13.944 -13.681 1.00 37.88 ? 108 PRO A CB    1 
ATOM   531  C CG    . PRO A 1 70  ? 4.428   -13.596 -14.330 1.00 38.89 ? 108 PRO A CG    1 
ATOM   532  C CD    . PRO A 1 70  ? 4.674   -12.182 -13.845 1.00 39.44 ? 108 PRO A CD    1 
ATOM   533  N N     . LEU A 1 71  ? 1.666   -12.158 -11.562 1.00 36.02 ? 109 LEU A N     1 
ATOM   534  C CA    . LEU A 1 71  ? 0.778   -11.971 -10.424 1.00 34.93 ? 109 LEU A CA    1 
ATOM   535  C C     . LEU A 1 71  ? -0.107  -10.745 -10.622 1.00 34.14 ? 109 LEU A C     1 
ATOM   536  O O     . LEU A 1 71  ? -1.292  -10.775 -10.269 1.00 34.70 ? 109 LEU A O     1 
ATOM   537  C CB    . LEU A 1 71  ? 1.568   -11.820 -9.099  1.00 35.08 ? 109 LEU A CB    1 
ATOM   538  C CG    . LEU A 1 71  ? 0.708   -11.598 -7.833  1.00 34.01 ? 109 LEU A CG    1 
ATOM   539  C CD1   . LEU A 1 71  ? -0.274  -12.727 -7.576  1.00 33.31 ? 109 LEU A CD1   1 
ATOM   540  C CD2   . LEU A 1 71  ? 1.523   -11.359 -6.593  1.00 35.19 ? 109 LEU A CD2   1 
ATOM   541  N N     . MET A 1 72  ? 0.477   -9.671  -11.141 1.00 33.69 ? 110 MET A N     1 
ATOM   542  C CA    . MET A 1 72  ? -0.271  -8.441  -11.444 1.00 36.30 ? 110 MET A CA    1 
ATOM   543  C C     . MET A 1 72  ? -1.388  -8.681  -12.451 1.00 37.12 ? 110 MET A C     1 
ATOM   544  O O     . MET A 1 72  ? -2.507  -8.180  -12.273 1.00 37.94 ? 110 MET A O     1 
ATOM   545  C CB    . MET A 1 72  ? 0.661   -7.314  -11.953 1.00 36.70 ? 110 MET A CB    1 
ATOM   546  C CG    . MET A 1 72  ? 1.696   -6.757  -10.953 1.00 40.13 ? 110 MET A CG    1 
ATOM   547  S SD    . MET A 1 72  ? 0.929   -6.006  -9.495  1.00 44.24 ? 110 MET A SD    1 
ATOM   548  C CE    . MET A 1 72  ? 1.359   -7.305  -8.318  1.00 46.96 ? 110 MET A CE    1 
ATOM   549  N N     . LYS A 1 73  ? -1.083  -9.462  -13.484 1.00 38.05 ? 111 LYS A N     1 
ATOM   550  C CA    . LYS A 1 73  ? -2.084  -9.814  -14.505 1.00 38.86 ? 111 LYS A CA    1 
ATOM   551  C C     . LYS A 1 73  ? -3.233  -10.557 -13.849 1.00 38.32 ? 111 LYS A C     1 
ATOM   552  O O     . LYS A 1 73  ? -4.397  -10.209 -14.054 1.00 38.57 ? 111 LYS A O     1 
ATOM   553  C CB    . LYS A 1 73  ? -1.463  -10.650 -15.626 1.00 39.35 ? 111 LYS A CB    1 
ATOM   554  C CG    . LYS A 1 73  ? -2.407  -10.936 -16.815 1.00 41.83 ? 111 LYS A CG    1 
ATOM   555  C CD    . LYS A 1 73  ? -1.895  -12.066 -17.710 1.00 41.71 ? 111 LYS A CD    1 
ATOM   556  C CE    . LYS A 1 73  ? -1.056  -11.564 -18.913 1.00 46.92 ? 111 LYS A CE    1 
ATOM   557  N NZ    . LYS A 1 73  ? -0.712  -12.632 -19.950 1.00 46.64 ? 111 LYS A NZ    1 
ATOM   558  N N     . LEU A 1 74  ? -2.916  -11.559 -13.034 1.00 37.01 ? 112 LEU A N     1 
ATOM   559  C CA    . LEU A 1 74  ? -3.955  -12.326 -12.383 1.00 37.42 ? 112 LEU A CA    1 
ATOM   560  C C     . LEU A 1 74  ? -4.824  -11.567 -11.411 1.00 38.57 ? 112 LEU A C     1 
ATOM   561  O O     . LEU A 1 74  ? -6.023  -11.850 -11.277 1.00 38.38 ? 112 LEU A O     1 
ATOM   562  C CB    . LEU A 1 74  ? -3.382  -13.565 -11.716 1.00 37.39 ? 112 LEU A CB    1 
ATOM   563  C CG    . LEU A 1 74  ? -3.086  -14.706 -12.699 1.00 36.58 ? 112 LEU A CG    1 
ATOM   564  C CD1   . LEU A 1 74  ? -2.215  -15.695 -11.976 1.00 36.75 ? 112 LEU A CD1   1 
ATOM   565  C CD2   . LEU A 1 74  ? -4.347  -15.405 -13.356 1.00 38.51 ? 112 LEU A CD2   1 
ATOM   566  N N     . GLY A 1 75  ? -4.218  -10.600 -10.717 1.00 39.14 ? 113 GLY A N     1 
ATOM   567  C CA    . GLY A 1 75  ? -4.939  -9.824  -9.721  1.00 42.48 ? 113 GLY A CA    1 
ATOM   568  C C     . GLY A 1 75  ? -5.468  -8.504  -10.245 1.00 43.31 ? 113 GLY A C     1 
ATOM   569  O O     . GLY A 1 75  ? -5.821  -7.628  -9.454  1.00 44.00 ? 113 GLY A O     1 
ATOM   570  N N     . THR A 1 76  ? -5.523  -8.381  -11.579 1.00 44.25 ? 114 THR A N     1 
ATOM   571  C CA    . THR A 1 76  ? -6.141  -7.256  -12.302 1.00 44.63 ? 114 THR A CA    1 
ATOM   572  C C     . THR A 1 76  ? -7.508  -7.014  -11.698 1.00 44.02 ? 114 THR A C     1 
ATOM   573  O O     . THR A 1 76  ? -8.297  -7.940  -11.568 1.00 43.02 ? 114 THR A O     1 
ATOM   574  C CB    . THR A 1 76  ? -6.283  -7.576  -13.826 1.00 45.76 ? 114 THR A CB    1 
ATOM   575  O OG1   . THR A 1 76  ? -5.034  -7.347  -14.483 1.00 47.40 ? 114 THR A OG1   1 
ATOM   576  C CG2   . THR A 1 76  ? -7.339  -6.714  -14.509 1.00 46.13 ? 114 THR A CG2   1 
ATOM   577  N N     . GLN A 1 77  ? -7.781  -5.773  -11.298 1.00 43.66 ? 115 GLN A N     1 
ATOM   578  C CA    . GLN A 1 77  ? -9.052  -5.484  -10.653 1.00 43.91 ? 115 GLN A CA    1 
ATOM   579  C C     . GLN A 1 77  ? -9.419  -4.006  -10.762 1.00 44.56 ? 115 GLN A C     1 
ATOM   580  O O     . GLN A 1 77  ? -8.580  -3.137  -10.481 1.00 44.34 ? 115 GLN A O     1 
ATOM   581  C CB    . GLN A 1 77  ? -8.954  -5.914  -9.182  1.00 43.73 ? 115 GLN A CB    1 
ATOM   582  C CG    . GLN A 1 77  ? -10.066 -5.502  -8.294  1.00 44.39 ? 115 GLN A CG    1 
ATOM   583  C CD    . GLN A 1 77  ? -9.894  -5.961  -6.863  1.00 43.36 ? 115 GLN A CD    1 
ATOM   584  O OE1   . GLN A 1 77  ? -10.850 -5.927  -6.094  1.00 45.89 ? 115 GLN A OE1   1 
ATOM   585  N NE2   . GLN A 1 77  ? -8.691  -6.380  -6.491  1.00 36.82 ? 115 GLN A NE2   1 
ATOM   586  N N     . THR A 1 78  ? -10.674 -3.747  -11.120 1.00 44.08 ? 116 THR A N     1 
ATOM   587  C CA    . THR A 1 78  ? -11.242 -2.391  -11.156 1.00 45.63 ? 116 THR A CA    1 
ATOM   588  C C     . THR A 1 78  ? -11.445 -1.870  -9.740  1.00 44.84 ? 116 THR A C     1 
ATOM   589  O O     . THR A 1 78  ? -11.931 -2.582  -8.881  1.00 45.59 ? 116 THR A O     1 
ATOM   590  C CB    . THR A 1 78  ? -12.620 -2.388  -11.832 1.00 46.03 ? 116 THR A CB    1 
ATOM   591  O OG1   . THR A 1 78  ? -12.580 -3.165  -13.029 1.00 49.42 ? 116 THR A OG1   1 
ATOM   592  C CG2   . THR A 1 78  ? -13.036 -0.979  -12.200 1.00 47.62 ? 116 THR A CG2   1 
ATOM   593  N N     . VAL A 1 79  ? -11.085 -0.618  -9.511  1.00 44.80 ? 117 VAL A N     1 
ATOM   594  C CA    . VAL A 1 79  ? -11.259 0.028   -8.207  1.00 44.31 ? 117 VAL A CA    1 
ATOM   595  C C     . VAL A 1 79  ? -12.072 1.315   -8.509  1.00 42.79 ? 117 VAL A C     1 
ATOM   596  O O     . VAL A 1 79  ? -11.830 1.939   -9.537  1.00 44.28 ? 117 VAL A O     1 
ATOM   597  C CB    . VAL A 1 79  ? -9.879  0.361   -7.572  1.00 45.12 ? 117 VAL A CB    1 
ATOM   598  C CG1   . VAL A 1 79  ? -9.131  -0.938  -7.242  1.00 47.16 ? 117 VAL A CG1   1 
ATOM   599  C CG2   . VAL A 1 79  ? -9.006  1.203   -8.521  1.00 47.07 ? 117 VAL A CG2   1 
ATOM   600  N N     . PRO A 1 80  ? -13.102 1.642   -7.707  1.00 40.88 ? 118 PRO A N     1 
ATOM   601  C CA    . PRO A 1 80  ? -13.770 2.935   -7.906  1.00 38.82 ? 118 PRO A CA    1 
ATOM   602  C C     . PRO A 1 80  ? -12.749 4.065   -7.799  1.00 37.14 ? 118 PRO A C     1 
ATOM   603  O O     . PRO A 1 80  ? -12.248 4.362   -6.696  1.00 36.21 ? 118 PRO A O     1 
ATOM   604  C CB    . PRO A 1 80  ? -14.822 2.950   -6.799  1.00 38.28 ? 118 PRO A CB    1 
ATOM   605  C CG    . PRO A 1 80  ? -15.212 1.428   -6.702  1.00 41.90 ? 118 PRO A CG    1 
ATOM   606  C CD    . PRO A 1 80  ? -13.800 0.829   -6.697  1.00 41.90 ? 118 PRO A CD    1 
ATOM   607  N N     . CYS A 1 81  ? -12.427 4.673   -8.941  1.00 35.69 ? 119 CYS A N     1 
ATOM   608  C CA    . CYS A 1 81  ? -11.224 5.545   -9.040  1.00 35.58 ? 119 CYS A CA    1 
ATOM   609  C C     . CYS A 1 81  ? -11.290 6.798   -8.194  1.00 34.70 ? 119 CYS A C     1 
ATOM   610  O O     . CYS A 1 81  ? -10.255 7.331   -7.815  1.00 34.56 ? 119 CYS A O     1 
ATOM   611  C CB    . CYS A 1 81  ? -10.899 5.925   -10.513 1.00 37.24 ? 119 CYS A CB    1 
ATOM   612  S SG    . CYS A 1 81  ? -12.034 7.025   -11.408 1.00 43.09 ? 119 CYS A SG    1 
ATOM   613  N N     . ASN A 1 82  ? -12.510 7.255   -7.901  1.00 33.06 ? 120 ASN A N     1 
ATOM   614  C CA    . ASN A 1 82  ? -12.724 8.510   -7.216  1.00 31.64 ? 120 ASN A CA    1 
ATOM   615  C C     . ASN A 1 82  ? -12.872 8.293   -5.713  1.00 32.53 ? 120 ASN A C     1 
ATOM   616  O O     . ASN A 1 82  ? -13.155 9.224   -5.021  1.00 32.29 ? 120 ASN A O     1 
ATOM   617  C CB    . ASN A 1 82  ? -14.000 9.209   -7.737  1.00 32.24 ? 120 ASN A CB    1 
ATOM   618  C CG    . ASN A 1 82  ? -15.260 8.349   -7.629  1.00 31.13 ? 120 ASN A CG    1 
ATOM   619  O OD1   . ASN A 1 82  ? -15.262 7.142   -7.925  1.00 32.53 ? 120 ASN A OD1   1 
ATOM   620  N ND2   . ASN A 1 82  ? -16.360 8.993   -7.282  1.00 32.93 ? 120 ASN A ND2   1 
ATOM   621  N N     . LYS A 1 83  ? -12.688 7.072   -5.241  1.00 31.95 ? 121 LYS A N     1 
ATOM   622  C CA    . LYS A 1 83  ? -12.855 6.780   -3.813  1.00 33.29 ? 121 LYS A CA    1 
ATOM   623  C C     . LYS A 1 83  ? -11.608 6.183   -3.149  1.00 32.78 ? 121 LYS A C     1 
ATOM   624  O O     . LYS A 1 83  ? -11.724 5.398   -2.216  1.00 35.03 ? 121 LYS A O     1 
ATOM   625  C CB    . LYS A 1 83  ? -14.075 5.862   -3.611  1.00 34.82 ? 121 LYS A CB    1 
ATOM   626  C CG    . LYS A 1 83  ? -15.377 6.402   -4.269  1.00 35.14 ? 121 LYS A CG    1 
ATOM   627  C CD    . LYS A 1 83  ? -16.540 5.468   -3.998  1.00 34.71 ? 121 LYS A CD    1 
ATOM   628  C CE    . LYS A 1 83  ? -17.824 5.965   -4.630  1.00 37.20 ? 121 LYS A CE    1 
ATOM   629  N NZ    . LYS A 1 83  ? -18.277 7.244   -3.948  1.00 34.57 ? 121 LYS A NZ    1 
ATOM   630  N N     . ILE A 1 84  ? -10.431 6.568   -3.613  1.00 30.97 ? 122 ILE A N     1 
ATOM   631  C CA    . ILE A 1 84  ? -9.183  5.941   -3.180  1.00 30.96 ? 122 ILE A CA    1 
ATOM   632  C C     . ILE A 1 84  ? -8.685  6.665   -1.945  1.00 30.66 ? 122 ILE A C     1 
ATOM   633  O O     . ILE A 1 84  ? -8.727  7.898   -1.913  1.00 31.79 ? 122 ILE A O     1 
ATOM   634  C CB    . ILE A 1 84  ? -8.167  6.028   -4.266  1.00 32.27 ? 122 ILE A CB    1 
ATOM   635  C CG1   . ILE A 1 84  ? -8.551  4.892   -5.292  1.00 35.38 ? 122 ILE A CG1   1 
ATOM   636  C CG2   . ILE A 1 84  ? -6.740  5.778   -3.754  1.00 32.67 ? 122 ILE A CG2   1 
ATOM   637  C CD1   . ILE A 1 84  ? -7.555  4.667   -6.443  1.00 42.23 ? 122 ILE A CD1   1 
ATOM   638  N N     . LEU A 1 85  ? -8.273  5.856   -0.992  1.00 30.52 ? 123 LEU A N     1 
ATOM   639  C CA    . LEU A 1 85  ? -7.670  6.388   0.275   1.00 29.84 ? 123 LEU A CA    1 
ATOM   640  C C     . LEU A 1 85  ? -6.266  5.815   0.386   1.00 31.48 ? 123 LEU A C     1 
ATOM   641  O O     . LEU A 1 85  ? -6.074  4.586   0.481   1.00 31.64 ? 123 LEU A O     1 
ATOM   642  C CB    . LEU A 1 85  ? -8.528  6.003   1.454   1.00 31.05 ? 123 LEU A CB    1 
ATOM   643  C CG    . LEU A 1 85  ? -7.868  6.441   2.802   1.00 28.34 ? 123 LEU A CG    1 
ATOM   644  C CD1   . LEU A 1 85  ? -7.784  8.003   2.809   1.00 31.81 ? 123 LEU A CD1   1 
ATOM   645  C CD2   . LEU A 1 85  ? -8.610  5.876   4.019   1.00 31.95 ? 123 LEU A CD2   1 
ATOM   646  N N     . LEU A 1 86  ? -5.292  6.730   0.380   1.00 30.57 ? 124 LEU A N     1 
ATOM   647  C CA    . LEU A 1 86  ? -3.913  6.376   0.563   1.00 30.93 ? 124 LEU A CA    1 
ATOM   648  C C     . LEU A 1 86  ? -3.566  6.635   2.038   1.00 32.81 ? 124 LEU A C     1 
ATOM   649  O O     . LEU A 1 86  ? -4.351  7.291   2.718   1.00 33.17 ? 124 LEU A O     1 
ATOM   650  C CB    . LEU A 1 86  ? -3.056  7.211   -0.351  1.00 31.09 ? 124 LEU A CB    1 
ATOM   651  C CG    . LEU A 1 86  ? -3.404  7.153   -1.843  1.00 33.86 ? 124 LEU A CG    1 
ATOM   652  C CD1   . LEU A 1 86  ? -2.498  8.084   -2.606  1.00 36.15 ? 124 LEU A CD1   1 
ATOM   653  C CD2   . LEU A 1 86  ? -3.259  5.696   -2.257  1.00 35.91 ? 124 LEU A CD2   1 
ATOM   654  N N     . TRP A 1 87  ? -2.453  6.115   2.514   1.00 32.58 ? 125 TRP A N     1 
ATOM   655  C CA    . TRP A 1 87  ? -2.111  6.378   3.948   1.00 34.92 ? 125 TRP A CA    1 
ATOM   656  C C     . TRP A 1 87  ? -0.612  6.266   4.142   1.00 34.53 ? 125 TRP A C     1 
ATOM   657  O O     . TRP A 1 87  ? 0.092   5.676   3.328   1.00 33.94 ? 125 TRP A O     1 
ATOM   658  C CB    . TRP A 1 87  ? -2.866  5.431   4.908   1.00 35.05 ? 125 TRP A CB    1 
ATOM   659  C CG    . TRP A 1 87  ? -2.701  3.953   4.577   1.00 34.83 ? 125 TRP A CG    1 
ATOM   660  C CD1   . TRP A 1 87  ? -3.555  3.178   3.780   1.00 35.16 ? 125 TRP A CD1   1 
ATOM   661  C CD2   . TRP A 1 87  ? -1.612  3.113   4.919   1.00 34.68 ? 125 TRP A CD2   1 
ATOM   662  N NE1   . TRP A 1 87  ? -3.056  1.898   3.681   1.00 34.60 ? 125 TRP A NE1   1 
ATOM   663  C CE2   . TRP A 1 87  ? -1.855  1.833   4.323   1.00 35.13 ? 125 TRP A CE2   1 
ATOM   664  C CE3   . TRP A 1 87  ? -0.448  3.289   5.676   1.00 36.96 ? 125 TRP A CE3   1 
ATOM   665  C CZ2   . TRP A 1 87  ? -0.985  0.751   4.503   1.00 36.94 ? 125 TRP A CZ2   1 
ATOM   666  C CZ3   . TRP A 1 87  ? 0.435   2.209   5.843   1.00 37.90 ? 125 TRP A CZ3   1 
ATOM   667  C CH2   . TRP A 1 87  ? 0.162   0.962   5.266   1.00 36.39 ? 125 TRP A CH2   1 
ATOM   668  N N     . SER A 1 88  ? -0.112  6.773   5.257   1.00 35.99 ? 126 SER A N     1 
ATOM   669  C CA    . SER A 1 88  ? 1.280   6.571   5.553   1.00 37.03 ? 126 SER A CA    1 
ATOM   670  C C     . SER A 1 88  ? 1.375   6.458   7.081   1.00 37.54 ? 126 SER A C     1 
ATOM   671  O O     . SER A 1 88  ? 0.923   7.382   7.771   1.00 36.26 ? 126 SER A O     1 
ATOM   672  C CB    . SER A 1 88  ? 2.059   7.795   5.102   1.00 39.51 ? 126 SER A CB    1 
ATOM   673  O OG    . SER A 1 88  ? 3.441   7.467   4.874   1.00 43.41 ? 126 SER A OG    1 
ATOM   674  N N     . ARG A 1 89  ? 1.887   5.331   7.589   1.00 36.31 ? 127 ARG A N     1 
ATOM   675  C CA    . ARG A 1 89  ? 2.163   5.195   9.064   1.00 40.06 ? 127 ARG A CA    1 
ATOM   676  C C     . ARG A 1 89  ? 0.903   5.268   9.922   1.00 40.48 ? 127 ARG A C     1 
ATOM   677  O O     . ARG A 1 89  ? 0.977   5.434   11.160  1.00 42.74 ? 127 ARG A O     1 
ATOM   678  C CB    . ARG A 1 89  ? 3.160   6.274   9.528   1.00 40.66 ? 127 ARG A CB    1 
ATOM   679  C CG    . ARG A 1 89  ? 4.621   6.031   9.124   1.00 46.02 ? 127 ARG A CG    1 
ATOM   680  C CD    . ARG A 1 89  ? 4.844   6.300   7.647   1.00 53.78 ? 127 ARG A CD    1 
ATOM   681  N NE    . ARG A 1 89  ? 6.115   5.803   7.118   1.00 56.51 ? 127 ARG A NE    1 
ATOM   682  C CZ    . ARG A 1 89  ? 7.250   6.495   7.119   1.00 57.93 ? 127 ARG A CZ    1 
ATOM   683  N NH1   . ARG A 1 89  ? 7.300   7.708   7.656   1.00 57.75 ? 127 ARG A NH1   1 
ATOM   684  N NH2   . ARG A 1 89  ? 8.347   5.969   6.587   1.00 61.71 ? 127 ARG A NH2   1 
ATOM   685  N N     . ILE A 1 90  ? -0.250  5.093   9.303   1.00 40.07 ? 128 ILE A N     1 
ATOM   686  C CA    . ILE A 1 90  ? -1.507  5.181   10.018  1.00 41.03 ? 128 ILE A CA    1 
ATOM   687  C C     . ILE A 1 90  ? -2.536  4.152   9.450   1.00 40.38 ? 128 ILE A C     1 
ATOM   688  O O     . ILE A 1 90  ? -3.729  4.456   9.323   1.00 39.81 ? 128 ILE A O     1 
ATOM   689  C CB    . ILE A 1 90  ? -2.026  6.676   10.036  1.00 40.68 ? 128 ILE A CB    1 
ATOM   690  C CG1   . ILE A 1 90  ? -3.106  6.854   11.100  1.00 41.76 ? 128 ILE A CG1   1 
ATOM   691  C CG2   . ILE A 1 90  ? -2.541  7.128   8.685   1.00 43.24 ? 128 ILE A CG2   1 
ATOM   692  C CD1   . ILE A 1 90  ? -2.587  7.449   12.432  1.00 45.57 ? 128 ILE A CD1   1 
ATOM   693  N N     . LYS A 1 91  ? -2.074  2.937   9.128   1.00 39.90 ? 129 LYS A N     1 
ATOM   694  C CA    . LYS A 1 91  ? -2.944  2.008   8.389   1.00 40.19 ? 129 LYS A CA    1 
ATOM   695  C C     . LYS A 1 91  ? -4.150  1.510   9.189   1.00 38.92 ? 129 LYS A C     1 
ATOM   696  O O     . LYS A 1 91  ? -5.205  1.291   8.616   1.00 38.48 ? 129 LYS A O     1 
ATOM   697  C CB    . LYS A 1 91  ? -2.160  0.878   7.673   1.00 40.24 ? 129 LYS A CB    1 
ATOM   698  C CG    . LYS A 1 91  ? -2.075  -0.495  8.288   1.00 44.99 ? 129 LYS A CG    1 
ATOM   699  C CD    . LYS A 1 91  ? -1.647  -1.543  7.178   1.00 42.34 ? 129 LYS A CD    1 
ATOM   700  C CE    . LYS A 1 91  ? -1.385  -2.923  7.755   1.00 44.78 ? 129 LYS A CE    1 
ATOM   701  N NZ    . LYS A 1 91  ? 0.041   -3.318  7.686   1.00 42.40 ? 129 LYS A NZ    1 
ATOM   702  N N     . ASP A 1 92  ? -4.013  1.336   10.502  1.00 37.62 ? 130 ASP A N     1 
ATOM   703  C CA    . ASP A 1 92  ? -5.144  0.853   11.302  1.00 37.68 ? 130 ASP A CA    1 
ATOM   704  C C     . ASP A 1 92  ? -6.368  1.777   11.244  1.00 36.38 ? 130 ASP A C     1 
ATOM   705  O O     . ASP A 1 92  ? -7.496  1.315   11.071  1.00 36.19 ? 130 ASP A O     1 
ATOM   706  C CB    . ASP A 1 92  ? -4.741  0.632   12.754  1.00 38.91 ? 130 ASP A CB    1 
ATOM   707  C CG    . ASP A 1 92  ? -3.912  -0.622  12.945  1.00 42.84 ? 130 ASP A CG    1 
ATOM   708  O OD1   . ASP A 1 92  ? -3.488  -1.260  11.944  1.00 47.57 ? 130 ASP A OD1   1 
ATOM   709  O OD2   . ASP A 1 92  ? -3.674  -0.977  14.132  1.00 49.20 ? 130 ASP A OD2   1 
ATOM   710  N N     . LEU A 1 93  ? -6.155  3.085   11.362  1.00 34.59 ? 131 LEU A N     1 
ATOM   711  C CA    . LEU A 1 93  ? -7.279  4.024   11.287  1.00 34.35 ? 131 LEU A CA    1 
ATOM   712  C C     . LEU A 1 93  ? -7.850  4.054   9.865   1.00 32.92 ? 131 LEU A C     1 
ATOM   713  O O     . LEU A 1 93  ? -9.075  4.094   9.709   1.00 33.58 ? 131 LEU A O     1 
ATOM   714  C CB    . LEU A 1 93  ? -6.858  5.441   11.693  1.00 34.48 ? 131 LEU A CB    1 
ATOM   715  C CG    . LEU A 1 93  ? -7.812  6.530   12.211  1.00 36.24 ? 131 LEU A CG    1 
ATOM   716  C CD1   . LEU A 1 93  ? -7.684  7.905   11.605  1.00 38.31 ? 131 LEU A CD1   1 
ATOM   717  C CD2   . LEU A 1 93  ? -9.291  6.149   12.526  1.00 38.75 ? 131 LEU A CD2   1 
ATOM   718  N N     . ALA A 1 94  ? -6.977  3.982   8.860   1.00 32.18 ? 132 ALA A N     1 
ATOM   719  C CA    . ALA A 1 94  ? -7.434  3.982   7.458   1.00 33.85 ? 132 ALA A CA    1 
ATOM   720  C C     . ALA A 1 94  ? -8.362  2.795   7.269   1.00 34.28 ? 132 ALA A C     1 
ATOM   721  O O     . ALA A 1 94  ? -9.456  2.945   6.712   1.00 34.74 ? 132 ALA A O     1 
ATOM   722  C CB    . ALA A 1 94  ? -6.242  3.949   6.471   1.00 33.65 ? 132 ALA A CB    1 
ATOM   723  N N     . HIS A 1 95  ? -7.967  1.638   7.795   1.00 33.95 ? 133 HIS A N     1 
ATOM   724  C CA    . HIS A 1 95  ? -8.782  0.444   7.621   1.00 34.41 ? 133 HIS A CA    1 
ATOM   725  C C     . HIS A 1 95  ? -10.059 0.495   8.447   1.00 34.04 ? 133 HIS A C     1 
ATOM   726  O O     . HIS A 1 95  ? -11.116 0.085   7.979   1.00 34.34 ? 133 HIS A O     1 
ATOM   727  C CB    . HIS A 1 95  ? -7.992  -0.823  7.929   1.00 35.06 ? 133 HIS A CB    1 
ATOM   728  C CG    . HIS A 1 95  ? -6.854  -1.084  6.981   1.00 37.43 ? 133 HIS A CG    1 
ATOM   729  N ND1   . HIS A 1 95  ? -5.869  -2.007  7.255   1.00 40.54 ? 133 HIS A ND1   1 
ATOM   730  C CD2   . HIS A 1 95  ? -6.558  -0.572  5.758   1.00 41.98 ? 133 HIS A CD2   1 
ATOM   731  C CE1   . HIS A 1 95  ? -4.999  -2.032  6.257   1.00 43.42 ? 133 HIS A CE1   1 
ATOM   732  N NE2   . HIS A 1 95  ? -5.391  -1.168  5.337   1.00 40.97 ? 133 HIS A NE2   1 
ATOM   733  N N     . GLN A 1 96  ? -9.978  0.971   9.697   1.00 33.12 ? 134 GLN A N     1 
ATOM   734  C CA    . GLN A 1 96  ? -11.170 1.068   10.502  1.00 33.88 ? 134 GLN A CA    1 
ATOM   735  C C     . GLN A 1 96  ? -12.173 1.991   9.856   1.00 33.09 ? 134 GLN A C     1 
ATOM   736  O O     . GLN A 1 96  ? -13.362 1.725   9.905   1.00 34.37 ? 134 GLN A O     1 
ATOM   737  C CB    . GLN A 1 96  ? -10.831 1.544   11.922  1.00 34.71 ? 134 GLN A CB    1 
ATOM   738  C CG    . GLN A 1 96  ? -10.147 0.474   12.760  1.00 38.26 ? 134 GLN A CG    1 
ATOM   739  C CD    . GLN A 1 96  ? -9.480  1.029   14.013  1.00 43.93 ? 134 GLN A CD    1 
ATOM   740  O OE1   . GLN A 1 96  ? -9.275  0.305   14.963  1.00 48.20 ? 134 GLN A OE1   1 
ATOM   741  N NE2   . GLN A 1 96  ? -9.108  2.301   13.998  1.00 47.68 ? 134 GLN A NE2   1 
ATOM   742  N N     . PHE A 1 97  ? -11.686 3.093   9.281   1.00 33.72 ? 135 PHE A N     1 
ATOM   743  C CA    . PHE A 1 97  ? -12.546 4.051   8.573   1.00 33.45 ? 135 PHE A CA    1 
ATOM   744  C C     . PHE A 1 97  ? -13.264 3.391   7.347   1.00 33.87 ? 135 PHE A C     1 
ATOM   745  O O     . PHE A 1 97  ? -14.499 3.490   7.225   1.00 34.50 ? 135 PHE A O     1 
ATOM   746  C CB    . PHE A 1 97  ? -11.723 5.249   8.091   1.00 32.90 ? 135 PHE A CB    1 
ATOM   747  C CG    . PHE A 1 97  ? -12.452 6.126   7.105   1.00 30.75 ? 135 PHE A CG    1 
ATOM   748  C CD1   . PHE A 1 97  ? -11.980 6.246   5.806   1.00 33.86 ? 135 PHE A CD1   1 
ATOM   749  C CD2   . PHE A 1 97  ? -13.638 6.735   7.460   1.00 31.14 ? 135 PHE A CD2   1 
ATOM   750  C CE1   . PHE A 1 97  ? -12.644 7.052   4.887   1.00 34.99 ? 135 PHE A CE1   1 
ATOM   751  C CE2   . PHE A 1 97  ? -14.329 7.547   6.571   1.00 34.12 ? 135 PHE A CE2   1 
ATOM   752  C CZ    . PHE A 1 97  ? -13.842 7.675   5.252   1.00 33.86 ? 135 PHE A CZ    1 
ATOM   753  N N     . THR A 1 98  ? -12.503 2.743   6.475   1.00 35.64 ? 136 THR A N     1 
ATOM   754  C CA    . THR A 1 98  ? -13.141 2.193   5.258   1.00 35.68 ? 136 THR A CA    1 
ATOM   755  C C     . THR A 1 98  ? -14.084 1.046   5.616   1.00 36.36 ? 136 THR A C     1 
ATOM   756  O O     . THR A 1 98  ? -15.058 0.787   4.888   1.00 37.84 ? 136 THR A O     1 
ATOM   757  C CB    . THR A 1 98  ? -12.130 1.750   4.183   1.00 35.19 ? 136 THR A CB    1 
ATOM   758  O OG1   . THR A 1 98  ? -11.367 0.649   4.664   1.00 34.33 ? 136 THR A OG1   1 
ATOM   759  C CG2   . THR A 1 98  ? -11.187 2.938   3.811   1.00 33.80 ? 136 THR A CG2   1 
ATOM   760  N N     . GLN A 1 99  ? -13.841 0.382   6.745   1.00 36.26 ? 137 GLN A N     1 
ATOM   761  C CA    . GLN A 1 99  ? -14.715 -0.723  7.154   1.00 36.93 ? 137 GLN A CA    1 
ATOM   762  C C     . GLN A 1 99  ? -16.132 -0.333  7.596   1.00 37.07 ? 137 GLN A C     1 
ATOM   763  O O     . GLN A 1 99  ? -17.030 -1.179  7.614   1.00 37.35 ? 137 GLN A O     1 
ATOM   764  C CB    . GLN A 1 99  ? -14.016 -1.631  8.163   1.00 37.10 ? 137 GLN A CB    1 
ATOM   765  C CG    . GLN A 1 99  ? -12.976 -2.518  7.480   1.00 42.38 ? 137 GLN A CG    1 
ATOM   766  C CD    . GLN A 1 99  ? -11.883 -3.034  8.396   1.00 47.91 ? 137 GLN A CD    1 
ATOM   767  O OE1   . GLN A 1 99  ? -10.739 -3.253  7.958   1.00 51.11 ? 137 GLN A OE1   1 
ATOM   768  N NE2   . GLN A 1 99  ? -12.207 -3.223  9.667   1.00 51.10 ? 137 GLN A NE2   1 
ATOM   769  N N     . VAL A 1 100 ? -16.354 0.938   7.929   1.00 36.27 ? 138 VAL A N     1 
ATOM   770  C CA    . VAL A 1 100 ? -17.645 1.344   8.462   1.00 36.39 ? 138 VAL A CA    1 
ATOM   771  C C     . VAL A 1 100 ? -18.771 1.182   7.425   1.00 36.30 ? 138 VAL A C     1 
ATOM   772  O O     . VAL A 1 100 ? -19.826 0.535   7.689   1.00 38.23 ? 138 VAL A O     1 
ATOM   773  C CB    . VAL A 1 100 ? -17.584 2.793   9.040   1.00 36.03 ? 138 VAL A CB    1 
ATOM   774  C CG1   . VAL A 1 100 ? -19.008 3.293   9.391   1.00 34.61 ? 138 VAL A CG1   1 
ATOM   775  C CG2   . VAL A 1 100 ? -16.686 2.794   10.304  1.00 37.06 ? 138 VAL A CG2   1 
ATOM   776  N N     . GLN A 1 101 ? -18.533 1.751   6.253   1.00 36.39 ? 139 GLN A N     1 
ATOM   777  C CA    . GLN A 1 101 ? -19.566 1.770   5.202   1.00 37.50 ? 139 GLN A CA    1 
ATOM   778  C C     . GLN A 1 101 ? -18.949 1.902   3.827   1.00 37.17 ? 139 GLN A C     1 
ATOM   779  O O     . GLN A 1 101 ? -19.626 2.338   2.896   1.00 38.13 ? 139 GLN A O     1 
ATOM   780  C CB    . GLN A 1 101 ? -20.602 2.876   5.463   1.00 36.97 ? 139 GLN A CB    1 
ATOM   781  C CG    . GLN A 1 101 ? -20.057 4.303   5.415   1.00 39.84 ? 139 GLN A CG    1 
ATOM   782  C CD    . GLN A 1 101 ? -20.944 5.338   6.130   1.00 40.39 ? 139 GLN A CD    1 
ATOM   783  O OE1   . GLN A 1 101 ? -20.509 6.486   6.397   1.00 44.02 ? 139 GLN A OE1   1 
ATOM   784  N NE2   . GLN A 1 101 ? -22.188 4.958   6.418   1.00 40.65 ? 139 GLN A NE2   1 
ATOM   785  N N     . ARG A 1 102 ? -17.662 1.565   3.725   1.00 36.76 ? 140 ARG A N     1 
ATOM   786  C CA    . ARG A 1 102 ? -16.959 1.483   2.466   1.00 38.83 ? 140 ARG A CA    1 
ATOM   787  C C     . ARG A 1 102 ? -16.986 2.821   1.735   1.00 38.07 ? 140 ARG A C     1 
ATOM   788  O O     . ARG A 1 102 ? -17.194 2.885   0.515   1.00 38.57 ? 140 ARG A O     1 
ATOM   789  C CB    . ARG A 1 102 ? -17.512 0.332   1.619   1.00 39.69 ? 140 ARG A CB    1 
ATOM   790  C CG    . ARG A 1 102 ? -17.647 -0.971  2.433   1.00 43.23 ? 140 ARG A CG    1 
ATOM   791  C CD    . ARG A 1 102 ? -18.944 -1.712  2.098   1.00 50.75 ? 140 ARG A CD    1 
ATOM   792  N NE    . ARG A 1 102 ? -19.126 -1.679  0.666   1.00 54.09 ? 140 ARG A NE    1 
ATOM   793  C CZ    . ARG A 1 102 ? -20.237 -1.330  0.040   1.00 52.59 ? 140 ARG A CZ    1 
ATOM   794  N NH1   . ARG A 1 102 ? -21.357 -1.037  0.704   1.00 53.30 ? 140 ARG A NH1   1 
ATOM   795  N NH2   . ARG A 1 102 ? -20.222 -1.322  -1.275  1.00 53.84 ? 140 ARG A NH2   1 
ATOM   796  N N     . ASP A 1 103 ? -16.744 3.900   2.485   1.00 37.76 ? 141 ASP A N     1 
ATOM   797  C CA    . ASP A 1 103 ? -16.790 5.254   1.929   1.00 37.84 ? 141 ASP A CA    1 
ATOM   798  C C     . ASP A 1 103 ? -15.611 5.453   0.988   1.00 37.80 ? 141 ASP A C     1 
ATOM   799  O O     . ASP A 1 103 ? -15.704 6.221   0.030   1.00 38.35 ? 141 ASP A O     1 
ATOM   800  C CB    . ASP A 1 103 ? -16.667 6.293   3.044   1.00 38.23 ? 141 ASP A CB    1 
ATOM   801  C CG    . ASP A 1 103 ? -17.944 6.505   3.799   1.00 37.31 ? 141 ASP A CG    1 
ATOM   802  O OD1   . ASP A 1 103 ? -19.001 6.693   3.158   1.00 37.43 ? 141 ASP A OD1   1 
ATOM   803  O OD2   . ASP A 1 103 ? -17.910 6.543   5.060   1.00 39.81 ? 141 ASP A OD2   1 
ATOM   804  N N     . MET A 1 104 ? -14.495 4.794   1.306   1.00 36.81 ? 142 MET A N     1 
ATOM   805  C CA    . MET A 1 104 ? -13.303 4.773   0.470   1.00 36.30 ? 142 MET A CA    1 
ATOM   806  C C     . MET A 1 104 ? -12.685 3.349   0.402   1.00 35.33 ? 142 MET A C     1 
ATOM   807  O O     . MET A 1 104 ? -13.092 2.429   1.125   1.00 34.82 ? 142 MET A O     1 
ATOM   808  C CB    . MET A 1 104 ? -12.280 5.825   0.919   1.00 37.50 ? 142 MET A CB    1 
ATOM   809  C CG    . MET A 1 104 ? -12.791 7.264   0.863   1.00 37.24 ? 142 MET A CG    1 
ATOM   810  S SD    . MET A 1 104 ? -11.610 8.496   1.451   1.00 39.52 ? 142 MET A SD    1 
ATOM   811  C CE    . MET A 1 104 ? -12.688 9.904   1.614   1.00 40.60 ? 142 MET A CE    1 
ATOM   812  N N     . PHE A 1 105 ? -11.646 3.201   -0.430  1.00 35.30 ? 143 PHE A N     1 
ATOM   813  C CA    . PHE A 1 105 ? -10.946 1.947   -0.675  1.00 35.92 ? 143 PHE A CA    1 
ATOM   814  C C     . PHE A 1 105 ? -9.463  2.188   -0.521  1.00 34.55 ? 143 PHE A C     1 
ATOM   815  O O     . PHE A 1 105 ? -8.944  3.076   -1.175  1.00 33.84 ? 143 PHE A O     1 
ATOM   816  C CB    . PHE A 1 105 ? -11.249 1.475   -2.125  1.00 39.31 ? 143 PHE A CB    1 
ATOM   817  C CG    . PHE A 1 105 ? -12.705 1.226   -2.332  1.00 42.64 ? 143 PHE A CG    1 
ATOM   818  C CD1   . PHE A 1 105 ? -13.255 -0.017  -2.014  1.00 47.41 ? 143 PHE A CD1   1 
ATOM   819  C CD2   . PHE A 1 105 ? -13.558 2.279   -2.668  1.00 45.91 ? 143 PHE A CD2   1 
ATOM   820  C CE1   . PHE A 1 105 ? -14.639 -0.239  -2.107  1.00 49.28 ? 143 PHE A CE1   1 
ATOM   821  C CE2   . PHE A 1 105 ? -14.957 2.075   -2.747  1.00 47.53 ? 143 PHE A CE2   1 
ATOM   822  C CZ    . PHE A 1 105 ? -15.486 0.795   -2.476  1.00 48.45 ? 143 PHE A CZ    1 
ATOM   823  N N     . THR A 1 106 ? -8.796  1.359   0.285   1.00 34.27 ? 144 THR A N     1 
ATOM   824  C CA    . THR A 1 106 ? -7.331  1.419   0.380   1.00 35.07 ? 144 THR A CA    1 
ATOM   825  C C     . THR A 1 106 ? -6.715  0.287   -0.432  1.00 34.42 ? 144 THR A C     1 
ATOM   826  O O     . THR A 1 106 ? -7.430  -0.563  -0.940  1.00 35.19 ? 144 THR A O     1 
ATOM   827  C CB    . THR A 1 106 ? -6.827  1.258   1.808   1.00 36.21 ? 144 THR A CB    1 
ATOM   828  O OG1   . THR A 1 106 ? -7.122  -0.060  2.303   1.00 36.39 ? 144 THR A OG1   1 
ATOM   829  C CG2   . THR A 1 106 ? -7.417  2.336   2.734   1.00 35.79 ? 144 THR A CG2   1 
ATOM   830  N N     . LEU A 1 107 ? -5.383  0.270   -0.524  1.00 34.76 ? 145 LEU A N     1 
ATOM   831  C CA    . LEU A 1 107 ? -4.736  -0.791  -1.335  1.00 35.02 ? 145 LEU A CA    1 
ATOM   832  C C     . LEU A 1 107 ? -5.059  -2.169  -0.773  1.00 35.10 ? 145 LEU A C     1 
ATOM   833  O O     . LEU A 1 107 ? -5.170  -3.170  -1.511  1.00 35.59 ? 145 LEU A O     1 
ATOM   834  C CB    . LEU A 1 107 ? -3.223  -0.533  -1.298  1.00 34.76 ? 145 LEU A CB    1 
ATOM   835  C CG    . LEU A 1 107 ? -2.288  -1.496  -2.031  1.00 35.49 ? 145 LEU A CG    1 
ATOM   836  C CD1   . LEU A 1 107 ? -2.726  -1.690  -3.477  1.00 35.87 ? 145 LEU A CD1   1 
ATOM   837  C CD2   . LEU A 1 107 ? -0.859  -1.060  -1.948  1.00 37.52 ? 145 LEU A CD2   1 
ATOM   838  N N     . GLU A 1 108 ? -5.259  -2.225  0.548   1.00 36.61 ? 146 GLU A N     1 
ATOM   839  C CA    . GLU A 1 108 ? -5.542  -3.508  1.224   1.00 37.94 ? 146 GLU A CA    1 
ATOM   840  C C     . GLU A 1 108 ? -7.004  -3.995  1.026   1.00 38.25 ? 146 GLU A C     1 
ATOM   841  O O     . GLU A 1 108 ? -7.362  -5.121  1.389   1.00 40.04 ? 146 GLU A O     1 
ATOM   842  C CB    . GLU A 1 108 ? -5.100  -3.456  2.696   1.00 37.93 ? 146 GLU A CB    1 
ATOM   843  C CG    . GLU A 1 108 ? -3.580  -3.174  2.885   1.00 39.30 ? 146 GLU A CG    1 
ATOM   844  C CD    . GLU A 1 108 ? -3.187  -1.721  2.623   1.00 39.91 ? 146 GLU A CD    1 
ATOM   845  O OE1   . GLU A 1 108 ? -3.995  -0.815  2.911   1.00 37.21 ? 146 GLU A OE1   1 
ATOM   846  O OE2   . GLU A 1 108 ? -2.085  -1.460  2.103   1.00 40.38 ? 146 GLU A OE2   1 
ATOM   847  N N     . ASP A 1 109 ? -7.823  -3.167  0.385   1.00 36.95 ? 147 ASP A N     1 
ATOM   848  C CA    . ASP A 1 109 ? -9.156  -3.557  -0.064  1.00 38.86 ? 147 ASP A CA    1 
ATOM   849  C C     . ASP A 1 109 ? -9.124  -4.248  -1.407  1.00 38.09 ? 147 ASP A C     1 
ATOM   850  O O     . ASP A 1 109 ? -10.159 -4.746  -1.854  1.00 38.94 ? 147 ASP A O     1 
ATOM   851  C CB    . ASP A 1 109 ? -10.110 -2.364  -0.169  1.00 39.64 ? 147 ASP A CB    1 
ATOM   852  C CG    . ASP A 1 109 ? -10.513 -1.847  1.157   1.00 43.16 ? 147 ASP A CG    1 
ATOM   853  O OD1   . ASP A 1 109 ? -10.486 -0.618  1.355   1.00 46.37 ? 147 ASP A OD1   1 
ATOM   854  O OD2   . ASP A 1 109 ? -10.862 -2.672  2.023   1.00 47.32 ? 147 ASP A OD2   1 
ATOM   855  N N     . THR A 1 110 ? -7.968  -4.250  -2.075  1.00 35.89 ? 148 THR A N     1 
ATOM   856  C CA    . THR A 1 110 ? -7.794  -4.947  -3.379  1.00 35.38 ? 148 THR A CA    1 
ATOM   857  C C     . THR A 1 110 ? -7.311  -6.378  -3.114  1.00 34.27 ? 148 THR A C     1 
ATOM   858  O O     . THR A 1 110 ? -6.777  -6.633  -2.061  1.00 33.77 ? 148 THR A O     1 
ATOM   859  C CB    . THR A 1 110 ? -6.756  -4.223  -4.311  1.00 34.04 ? 148 THR A CB    1 
ATOM   860  O OG1   . THR A 1 110 ? -5.415  -4.352  -3.795  1.00 34.98 ? 148 THR A OG1   1 
ATOM   861  C CG2   . THR A 1 110 ? -7.108  -2.744  -4.544  1.00 38.54 ? 148 THR A CG2   1 
ATOM   862  N N     . LEU A 1 111 ? -7.470  -7.301  -4.057  1.00 33.41 ? 149 LEU A N     1 
ATOM   863  C CA    . LEU A 1 111 ? -7.023  -8.665  -3.847  1.00 33.70 ? 149 LEU A CA    1 
ATOM   864  C C     . LEU A 1 111 ? -5.547  -8.710  -3.491  1.00 33.88 ? 149 LEU A C     1 
ATOM   865  O O     . LEU A 1 111 ? -5.154  -9.348  -2.515  1.00 33.66 ? 149 LEU A O     1 
ATOM   866  C CB    . LEU A 1 111 ? -7.300  -9.552  -5.074  1.00 33.18 ? 149 LEU A CB    1 
ATOM   867  C CG    . LEU A 1 111 ? -6.718  -10.976 -4.992  1.00 34.79 ? 149 LEU A CG    1 
ATOM   868  C CD1   . LEU A 1 111 ? -7.301  -11.774 -3.802  1.00 33.82 ? 149 LEU A CD1   1 
ATOM   869  C CD2   . LEU A 1 111 ? -6.939  -11.710 -6.309  1.00 34.49 ? 149 LEU A CD2   1 
ATOM   870  N N     . LEU A 1 112 ? -4.732  -8.003  -4.243  1.00 34.14 ? 150 LEU A N     1 
ATOM   871  C CA    . LEU A 1 112 ? -3.284  -8.147  -4.015  1.00 33.84 ? 150 LEU A CA    1 
ATOM   872  C C     . LEU A 1 112 ? -2.831  -7.571  -2.701  1.00 34.19 ? 150 LEU A C     1 
ATOM   873  O O     . LEU A 1 112 ? -1.993  -8.161  -2.041  1.00 34.09 ? 150 LEU A O     1 
ATOM   874  C CB    . LEU A 1 112 ? -2.484  -7.564  -5.169  1.00 35.29 ? 150 LEU A CB    1 
ATOM   875  C CG    . LEU A 1 112 ? -2.723  -8.342  -6.494  1.00 34.49 ? 150 LEU A CG    1 
ATOM   876  C CD1   . LEU A 1 112 ? -1.847  -7.708  -7.538  1.00 40.05 ? 150 LEU A CD1   1 
ATOM   877  C CD2   . LEU A 1 112 ? -2.462  -9.868  -6.442  1.00 36.52 ? 150 LEU A CD2   1 
ATOM   878  N N     . GLY A 1 113 ? -3.372  -6.411  -2.339  1.00 33.65 ? 151 GLY A N     1 
ATOM   879  C CA    . GLY A 1 113 ? -3.010  -5.760  -1.066  1.00 33.28 ? 151 GLY A CA    1 
ATOM   880  C C     . GLY A 1 113 ? -3.478  -6.616  0.110   1.00 33.64 ? 151 GLY A C     1 
ATOM   881  O O     . GLY A 1 113 ? -2.760  -6.769  1.112   1.00 33.51 ? 151 GLY A O     1 
ATOM   882  N N     . TYR A 1 114 ? -4.673  -7.189  -0.019  1.00 33.58 ? 152 TYR A N     1 
ATOM   883  C CA    . TYR A 1 114 ? -5.218  -8.100  0.975   1.00 34.03 ? 152 TYR A CA    1 
ATOM   884  C C     . TYR A 1 114 ? -4.345  -9.355  1.172   1.00 34.61 ? 152 TYR A C     1 
ATOM   885  O O     . TYR A 1 114 ? -4.082  -9.755  2.306   1.00 34.24 ? 152 TYR A O     1 
ATOM   886  C CB    . TYR A 1 114 ? -6.631  -8.502  0.550   1.00 35.20 ? 152 TYR A CB    1 
ATOM   887  C CG    . TYR A 1 114 ? -7.352  -9.306  1.605   1.00 37.92 ? 152 TYR A CG    1 
ATOM   888  C CD1   . TYR A 1 114 ? -7.415  -10.674 1.500   1.00 35.58 ? 152 TYR A CD1   1 
ATOM   889  C CD2   . TYR A 1 114 ? -7.969  -8.682  2.691   1.00 38.08 ? 152 TYR A CD2   1 
ATOM   890  C CE1   . TYR A 1 114 ? -8.072  -11.446 2.463   1.00 39.04 ? 152 TYR A CE1   1 
ATOM   891  C CE2   . TYR A 1 114 ? -8.622  -9.432  3.676   1.00 40.41 ? 152 TYR A CE2   1 
ATOM   892  C CZ    . TYR A 1 114 ? -8.657  -10.830 3.543   1.00 38.83 ? 152 TYR A CZ    1 
ATOM   893  O OH    . TYR A 1 114 ? -9.309  -11.613 4.466   1.00 42.34 ? 152 TYR A OH    1 
ATOM   894  N N     . LEU A 1 115 ? -3.868  -9.937  0.066   1.00 34.12 ? 153 LEU A N     1 
ATOM   895  C CA    . LEU A 1 115 ? -3.032  -11.151 0.132   1.00 35.13 ? 153 LEU A CA    1 
ATOM   896  C C     . LEU A 1 115 ? -1.787  -10.928 0.923   1.00 34.57 ? 153 LEU A C     1 
ATOM   897  O O     . LEU A 1 115 ? -1.389  -11.780 1.721   1.00 34.30 ? 153 LEU A O     1 
ATOM   898  C CB    . LEU A 1 115 ? -2.616  -11.629 -1.270  1.00 34.33 ? 153 LEU A CB    1 
ATOM   899  C CG    . LEU A 1 115 ? -3.693  -12.224 -2.195  1.00 36.67 ? 153 LEU A CG    1 
ATOM   900  C CD1   . LEU A 1 115 ? -2.951  -12.738 -3.427  1.00 36.79 ? 153 LEU A CD1   1 
ATOM   901  C CD2   . LEU A 1 115 ? -4.522  -13.319 -1.488  1.00 34.27 ? 153 LEU A CD2   1 
ATOM   902  N N     . ALA A 1 116 ? -1.149  -9.779  0.708   1.00 34.31 ? 154 ALA A N     1 
ATOM   903  C CA    . ALA A 1 116 ? 0.189   -9.567  1.262   1.00 34.95 ? 154 ALA A CA    1 
ATOM   904  C C     . ALA A 1 116 ? 0.294   -8.734  2.555   1.00 35.28 ? 154 ALA A C     1 
ATOM   905  O O     . ALA A 1 116 ? 1.363   -8.664  3.174   1.00 34.78 ? 154 ALA A O     1 
ATOM   906  C CB    . ALA A 1 116 ? 1.060   -8.976  0.194   1.00 35.73 ? 154 ALA A CB    1 
ATOM   907  N N     . ASP A 1 117 ? -0.814  -8.103  2.966   1.00 36.46 ? 155 ASP A N     1 
ATOM   908  C CA    . ASP A 1 117 ? -0.781  -7.194  4.122   1.00 36.25 ? 155 ASP A CA    1 
ATOM   909  C C     . ASP A 1 117 ? -0.181  -7.882  5.354   1.00 35.97 ? 155 ASP A C     1 
ATOM   910  O O     . ASP A 1 117 ? -0.599  -8.957  5.693   1.00 36.19 ? 155 ASP A O     1 
ATOM   911  C CB    . ASP A 1 117 ? -2.212  -6.744  4.456   1.00 36.55 ? 155 ASP A CB    1 
ATOM   912  C CG    . ASP A 1 117 ? -2.239  -5.456  5.277   1.00 39.84 ? 155 ASP A CG    1 
ATOM   913  O OD1   . ASP A 1 117 ? -3.350  -5.065  5.735   1.00 43.40 ? 155 ASP A OD1   1 
ATOM   914  O OD2   . ASP A 1 117 ? -1.163  -4.854  5.469   1.00 41.96 ? 155 ASP A OD2   1 
ATOM   915  N N     . ASP A 1 118 ? 0.792   -7.245  6.000   1.00 36.13 ? 156 ASP A N     1 
ATOM   916  C CA    . ASP A 1 118 ? 1.445   -7.750  7.215   1.00 37.05 ? 156 ASP A CA    1 
ATOM   917  C C     . ASP A 1 118 ? 2.320   -9.023  7.038   1.00 37.23 ? 156 ASP A C     1 
ATOM   918  O O     . ASP A 1 118 ? 2.811   -9.601  8.022   1.00 38.14 ? 156 ASP A O     1 
ATOM   919  C CB    . ASP A 1 118 ? 0.403   -7.950  8.340   1.00 38.06 ? 156 ASP A CB    1 
ATOM   920  C CG    . ASP A 1 118 ? -0.259  -6.653  8.769   1.00 41.28 ? 156 ASP A CG    1 
ATOM   921  O OD1   . ASP A 1 118 ? 0.442   -5.646  8.965   1.00 46.14 ? 156 ASP A OD1   1 
ATOM   922  O OD2   . ASP A 1 118 ? -1.491  -6.637  8.919   1.00 47.88 ? 156 ASP A OD2   1 
ATOM   923  N N     . LEU A 1 119 ? 2.537   -9.450  5.803   1.00 35.93 ? 157 LEU A N     1 
ATOM   924  C CA    . LEU A 1 119 ? 3.316   -10.666 5.557   1.00 35.10 ? 157 LEU A CA    1 
ATOM   925  C C     . LEU A 1 119 ? 4.723   -10.312 5.060   1.00 34.70 ? 157 LEU A C     1 
ATOM   926  O O     . LEU A 1 119 ? 4.936   -9.227  4.482   1.00 35.83 ? 157 LEU A O     1 
ATOM   927  C CB    . LEU A 1 119 ? 2.597   -11.556 4.545   1.00 34.69 ? 157 LEU A CB    1 
ATOM   928  C CG    . LEU A 1 119 ? 1.189   -12.063 4.872   1.00 34.40 ? 157 LEU A CG    1 
ATOM   929  C CD1   . LEU A 1 119 ? 0.743   -13.087 3.849   1.00 34.62 ? 157 LEU A CD1   1 
ATOM   930  C CD2   . LEU A 1 119 ? 1.172   -12.667 6.261   1.00 34.97 ? 157 LEU A CD2   1 
ATOM   931  N N     . THR A 1 120 ? 5.662   -11.220 5.325   1.00 35.21 ? 158 THR A N     1 
ATOM   932  C CA    . THR A 1 120 ? 7.050   -11.156 4.880   1.00 35.53 ? 158 THR A CA    1 
ATOM   933  C C     . THR A 1 120 ? 7.329   -12.453 4.096   1.00 34.49 ? 158 THR A C     1 
ATOM   934  O O     . THR A 1 120 ? 6.764   -13.504 4.415   1.00 34.76 ? 158 THR A O     1 
ATOM   935  C CB    . THR A 1 120 ? 8.020   -11.058 6.104   1.00 37.61 ? 158 THR A CB    1 
ATOM   936  O OG1   . THR A 1 120 ? 7.758   -9.834  6.803   1.00 40.03 ? 158 THR A OG1   1 
ATOM   937  C CG2   . THR A 1 120 ? 9.494   -11.038 5.673   1.00 37.67 ? 158 THR A CG2   1 
ATOM   938  N N     . TRP A 1 121 ? 8.142   -12.370 3.038   1.00 33.22 ? 159 TRP A N     1 
ATOM   939  C CA    . TRP A 1 121 ? 8.492   -13.579 2.280   1.00 32.09 ? 159 TRP A CA    1 
ATOM   940  C C     . TRP A 1 121 ? 9.799   -13.335 1.525   1.00 31.68 ? 159 TRP A C     1 
ATOM   941  O O     . TRP A 1 121 ? 10.121  -12.194 1.169   1.00 32.63 ? 159 TRP A O     1 
ATOM   942  C CB    . TRP A 1 121 ? 7.385   -13.993 1.305   1.00 31.32 ? 159 TRP A CB    1 
ATOM   943  C CG    . TRP A 1 121 ? 7.103   -12.939 0.274   1.00 30.75 ? 159 TRP A CG    1 
ATOM   944  C CD1   . TRP A 1 121 ? 7.662   -12.839 -0.971  1.00 32.11 ? 159 TRP A CD1   1 
ATOM   945  C CD2   . TRP A 1 121 ? 6.228   -11.802 0.408   1.00 32.01 ? 159 TRP A CD2   1 
ATOM   946  N NE1   . TRP A 1 121 ? 7.193   -11.734 -1.618  1.00 31.45 ? 159 TRP A NE1   1 
ATOM   947  C CE2   . TRP A 1 121 ? 6.295   -11.081 -0.806  1.00 31.22 ? 159 TRP A CE2   1 
ATOM   948  C CE3   . TRP A 1 121 ? 5.373   -11.343 1.419   1.00 32.22 ? 159 TRP A CE3   1 
ATOM   949  C CZ2   . TRP A 1 121 ? 5.556   -9.907  -1.027  1.00 32.87 ? 159 TRP A CZ2   1 
ATOM   950  C CZ3   . TRP A 1 121 ? 4.629   -10.153 1.196   1.00 30.63 ? 159 TRP A CZ3   1 
ATOM   951  C CH2   . TRP A 1 121 ? 4.734   -9.456  -0.008  1.00 31.58 ? 159 TRP A CH2   1 
ATOM   952  N N     . CYS A 1 122 ? 10.569  -14.405 1.354   1.00 32.30 ? 160 CYS A N     1 
ATOM   953  C CA    . CYS A 1 122 ? 11.725  -14.384 0.466   1.00 32.31 ? 160 CYS A CA    1 
ATOM   954  C C     . CYS A 1 122 ? 12.122  -15.816 0.159   1.00 32.09 ? 160 CYS A C     1 
ATOM   955  O O     . CYS A 1 122 ? 11.704  -16.753 0.840   1.00 31.79 ? 160 CYS A O     1 
ATOM   956  C CB    . CYS A 1 122 ? 12.916  -13.566 1.018   1.00 34.03 ? 160 CYS A CB    1 
ATOM   957  S SG    . CYS A 1 122 ? 13.699  -14.211 2.511   1.00 38.07 ? 160 CYS A SG    1 
ATOM   958  N N     . GLY A 1 123 ? 12.872  -15.973 -0.923  1.00 32.86 ? 161 GLY A N     1 
ATOM   959  C CA    . GLY A 1 123 ? 13.443  -17.266 -1.300  1.00 32.49 ? 161 GLY A CA    1 
ATOM   960  C C     . GLY A 1 123 ? 14.958  -17.229 -1.280  1.00 33.19 ? 161 GLY A C     1 
ATOM   961  O O     . GLY A 1 123 ? 15.584  -16.378 -0.618  1.00 32.82 ? 161 GLY A O     1 
ATOM   962  N N     . GLU A 1 124 ? 15.552  -18.132 -2.049  1.00 33.69 ? 162 GLU A N     1 
ATOM   963  C CA    . GLU A 1 124 ? 16.996  -18.337 -2.055  1.00 35.36 ? 162 GLU A CA    1 
ATOM   964  C C     . GLU A 1 124 ? 17.455  -18.527 -3.479  1.00 35.75 ? 162 GLU A C     1 
ATOM   965  O O     . GLU A 1 124 ? 16.762  -19.179 -4.266  1.00 34.90 ? 162 GLU A O     1 
ATOM   966  C CB    . GLU A 1 124 ? 17.325  -19.590 -1.258  1.00 36.51 ? 162 GLU A CB    1 
ATOM   967  C CG    . GLU A 1 124 ? 17.298  -19.370 0.254   1.00 41.45 ? 162 GLU A CG    1 
ATOM   968  C CD    . GLU A 1 124 ? 17.298  -20.660 1.059   1.00 47.12 ? 162 GLU A CD    1 
ATOM   969  O OE1   . GLU A 1 124 ? 16.653  -20.668 2.135   1.00 50.67 ? 162 GLU A OE1   1 
ATOM   970  O OE2   . GLU A 1 124 ? 17.898  -21.671 0.616   1.00 48.25 ? 162 GLU A OE2   1 
ATOM   971  N N     . PHE A 1 125 ? 18.627  -18.000 -3.814  1.00 35.61 ? 163 PHE A N     1 
ATOM   972  C CA    . PHE A 1 125 ? 19.092  -18.141 -5.174  1.00 36.90 ? 163 PHE A CA    1 
ATOM   973  C C     . PHE A 1 125 ? 19.310  -19.625 -5.414  1.00 37.29 ? 163 PHE A C     1 
ATOM   974  O O     . PHE A 1 125 ? 19.909  -20.300 -4.586  1.00 37.76 ? 163 PHE A O     1 
ATOM   975  C CB    . PHE A 1 125 ? 20.381  -17.362 -5.448  1.00 36.60 ? 163 PHE A CB    1 
ATOM   976  C CG    . PHE A 1 125 ? 20.882  -17.508 -6.860  1.00 37.72 ? 163 PHE A CG    1 
ATOM   977  C CD1   . PHE A 1 125 ? 20.087  -17.123 -7.942  1.00 39.28 ? 163 PHE A CD1   1 
ATOM   978  C CD2   . PHE A 1 125 ? 22.144  -18.042 -7.111  1.00 39.83 ? 163 PHE A CD2   1 
ATOM   979  C CE1   . PHE A 1 125 ? 20.549  -17.263 -9.254  1.00 40.43 ? 163 PHE A CE1   1 
ATOM   980  C CE2   . PHE A 1 125 ? 22.623  -18.179 -8.423  1.00 41.19 ? 163 PHE A CE2   1 
ATOM   981  C CZ    . PHE A 1 125 ? 21.809  -17.790 -9.496  1.00 40.27 ? 163 PHE A CZ    1 
ATOM   982  N N     . ASP A 1 126 ? 18.778  -20.135 -6.516  1.00 38.63 ? 164 ASP A N     1 
ATOM   983  C CA    . ASP A 1 126 ? 19.105  -21.498 -6.953  1.00 39.82 ? 164 ASP A CA    1 
ATOM   984  C C     . ASP A 1 126 ? 18.758  -22.646 -5.983  1.00 39.83 ? 164 ASP A C     1 
ATOM   985  O O     . ASP A 1 126 ? 19.326  -23.731 -6.094  1.00 39.81 ? 164 ASP A O     1 
ATOM   986  C CB    . ASP A 1 126 ? 20.589  -21.586 -7.328  1.00 40.55 ? 164 ASP A CB    1 
ATOM   987  C CG    . ASP A 1 126 ? 20.846  -21.371 -8.817  1.00 42.67 ? 164 ASP A CG    1 
ATOM   988  O OD1   . ASP A 1 126 ? 19.907  -20.979 -9.551  1.00 45.54 ? 164 ASP A OD1   1 
ATOM   989  O OD2   . ASP A 1 126 ? 22.003  -21.603 -9.241  1.00 45.51 ? 164 ASP A OD2   1 
ATOM   990  N N     . THR A 1 127 ? 17.861  -22.396 -5.026  1.00 39.37 ? 165 THR A N     1 
ATOM   991  C CA    . THR A 1 127 ? 17.042  -23.470 -4.442  1.00 39.06 ? 165 THR A CA    1 
ATOM   992  C C     . THR A 1 127 ? 15.605  -23.060 -4.583  1.00 38.61 ? 165 THR A C     1 
ATOM   993  O O     . THR A 1 127 ? 15.319  -21.891 -4.787  1.00 39.10 ? 165 THR A O     1 
ATOM   994  C CB    . THR A 1 127 ? 17.301  -23.766 -2.950  1.00 39.14 ? 165 THR A CB    1 
ATOM   995  O OG1   . THR A 1 127 ? 16.849  -25.095 -2.668  1.00 42.93 ? 165 THR A OG1   1 
ATOM   996  C CG2   . THR A 1 127 ? 16.515  -22.836 -2.050  1.00 36.72 ? 165 THR A CG2   1 
ATOM   997  N N     . SER A 1 128 ? 14.684  -24.007 -4.459  1.00 37.14 ? 166 SER A N     1 
ATOM   998  C CA    . SER A 1 128 ? 13.277  -23.610 -4.503  1.00 36.41 ? 166 SER A CA    1 
ATOM   999  C C     . SER A 1 128 ? 12.666  -23.431 -3.097  1.00 36.24 ? 166 SER A C     1 
ATOM   1000 O O     . SER A 1 128 ? 11.441  -23.377 -2.946  1.00 36.66 ? 166 SER A O     1 
ATOM   1001 C CB    . SER A 1 128 ? 12.459  -24.580 -5.359  1.00 36.48 ? 166 SER A CB    1 
ATOM   1002 O OG    . SER A 1 128 ? 12.694  -25.900 -4.943  1.00 36.38 ? 166 SER A OG    1 
ATOM   1003 N N     . LYS A 1 129 ? 13.519  -23.303 -2.078  1.00 35.43 ? 167 LYS A N     1 
ATOM   1004 C CA    . LYS A 1 129 ? 13.039  -23.201 -0.702  1.00 35.40 ? 167 LYS A CA    1 
ATOM   1005 C C     . LYS A 1 129 ? 12.613  -21.802 -0.335  1.00 34.62 ? 167 LYS A C     1 
ATOM   1006 O O     . LYS A 1 129 ? 13.264  -20.825 -0.721  1.00 35.40 ? 167 LYS A O     1 
ATOM   1007 C CB    . LYS A 1 129 ? 14.085  -23.683 0.295   1.00 35.29 ? 167 LYS A CB    1 
ATOM   1008 C CG    . LYS A 1 129 ? 14.258  -25.200 0.347   1.00 37.09 ? 167 LYS A CG    1 
ATOM   1009 C CD    . LYS A 1 129 ? 15.444  -25.584 1.188   1.00 41.09 ? 167 LYS A CD    1 
ATOM   1010 C CE    . LYS A 1 129 ? 15.748  -27.078 1.032   1.00 42.61 ? 167 LYS A CE    1 
ATOM   1011 N NZ    . LYS A 1 129 ? 17.167  -27.406 1.337   1.00 46.75 ? 167 LYS A NZ    1 
ATOM   1012 N N     . ILE A 1 130 ? 11.532  -21.709 0.433   1.00 34.83 ? 168 ILE A N     1 
ATOM   1013 C CA    . ILE A 1 130 ? 11.180  -20.438 1.081   1.00 35.01 ? 168 ILE A CA    1 
ATOM   1014 C C     . ILE A 1 130 ? 12.136  -20.265 2.262   1.00 35.19 ? 168 ILE A C     1 
ATOM   1015 O O     . ILE A 1 130 ? 12.479  -21.246 2.918   1.00 36.01 ? 168 ILE A O     1 
ATOM   1016 C CB    . ILE A 1 130 ? 9.733   -20.449 1.574   1.00 34.73 ? 168 ILE A CB    1 
ATOM   1017 C CG1   . ILE A 1 130 ? 8.773   -20.308 0.395   1.00 35.66 ? 168 ILE A CG1   1 
ATOM   1018 C CG2   . ILE A 1 130 ? 9.476   -19.277 2.501   1.00 35.27 ? 168 ILE A CG2   1 
ATOM   1019 C CD1   . ILE A 1 130 ? 7.309   -20.270 0.795   1.00 38.11 ? 168 ILE A CD1   1 
ATOM   1020 N N     . ASN A 1 131 ? 12.572  -19.036 2.532   1.00 35.40 ? 169 ASN A N     1 
ATOM   1021 C CA    . ASN A 1 131 ? 13.478  -18.792 3.651   1.00 35.96 ? 169 ASN A CA    1 
ATOM   1022 C C     . ASN A 1 131 ? 12.690  -18.286 4.858   1.00 36.05 ? 169 ASN A C     1 
ATOM   1023 O O     . ASN A 1 131 ? 12.262  -17.126 4.886   1.00 37.10 ? 169 ASN A O     1 
ATOM   1024 C CB    . ASN A 1 131 ? 14.579  -17.800 3.261   1.00 35.11 ? 169 ASN A CB    1 
ATOM   1025 C CG    . ASN A 1 131 ? 15.677  -17.691 4.328   1.00 36.78 ? 169 ASN A CG    1 
ATOM   1026 O OD1   . ASN A 1 131 ? 15.461  -18.047 5.490   1.00 36.77 ? 169 ASN A OD1   1 
ATOM   1027 N ND2   . ASN A 1 131 ? 16.847  -17.186 3.939   1.00 35.87 ? 169 ASN A ND2   1 
ATOM   1028 N N     . TYR A 1 132 ? 12.510  -19.159 5.847   1.00 37.09 ? 170 TYR A N     1 
ATOM   1029 C CA    . TYR A 1 132 ? 11.750  -18.817 7.055   1.00 37.81 ? 170 TYR A CA    1 
ATOM   1030 C C     . TYR A 1 132 ? 12.651  -18.283 8.160   1.00 38.34 ? 170 TYR A C     1 
ATOM   1031 O O     . TYR A 1 132 ? 12.175  -17.933 9.237   1.00 38.72 ? 170 TYR A O     1 
ATOM   1032 C CB    . TYR A 1 132 ? 10.955  -20.028 7.579   1.00 38.51 ? 170 TYR A CB    1 
ATOM   1033 C CG    . TYR A 1 132 ? 9.834   -20.458 6.679   1.00 38.04 ? 170 TYR A CG    1 
ATOM   1034 C CD1   . TYR A 1 132 ? 9.986   -21.543 5.820   1.00 38.12 ? 170 TYR A CD1   1 
ATOM   1035 C CD2   . TYR A 1 132 ? 8.611   -19.766 6.666   1.00 38.50 ? 170 TYR A CD2   1 
ATOM   1036 C CE1   . TYR A 1 132 ? 8.951   -21.943 4.977   1.00 39.03 ? 170 TYR A CE1   1 
ATOM   1037 C CE2   . TYR A 1 132 ? 7.585   -20.158 5.832   1.00 38.16 ? 170 TYR A CE2   1 
ATOM   1038 C CZ    . TYR A 1 132 ? 7.754   -21.244 4.995   1.00 40.31 ? 170 TYR A CZ    1 
ATOM   1039 O OH    . TYR A 1 132 ? 6.725   -21.620 4.166   1.00 40.19 ? 170 TYR A OH    1 
ATOM   1040 N N     . GLN A 1 133 ? 13.951  -18.224 7.894   1.00 38.57 ? 171 GLN A N     1 
ATOM   1041 C CA    . GLN A 1 133 ? 14.905  -17.814 8.903   1.00 39.00 ? 171 GLN A CA    1 
ATOM   1042 C C     . GLN A 1 133 ? 15.221  -16.315 8.886   1.00 39.00 ? 171 GLN A C     1 
ATOM   1043 O O     . GLN A 1 133 ? 15.285  -15.684 9.943   1.00 39.44 ? 171 GLN A O     1 
ATOM   1044 C CB    . GLN A 1 133 ? 16.156  -18.675 8.794   1.00 39.43 ? 171 GLN A CB    1 
ATOM   1045 C CG    . GLN A 1 133 ? 15.856  -20.142 9.097   1.00 43.00 ? 171 GLN A CG    1 
ATOM   1046 C CD    . GLN A 1 133 ? 15.458  -20.362 10.553  1.00 47.76 ? 171 GLN A CD    1 
ATOM   1047 O OE1   . GLN A 1 133 ? 14.379  -20.882 10.842  1.00 50.20 ? 171 GLN A OE1   1 
ATOM   1048 N NE2   . GLN A 1 133 ? 16.328  -19.948 11.478  1.00 50.65 ? 171 GLN A NE2   1 
ATOM   1049 N N     . SER A 1 134 ? 15.394  -15.744 7.695   1.00 37.81 ? 172 SER A N     1 
ATOM   1050 C CA    . SER A 1 134 ? 15.607  -14.302 7.554   1.00 37.31 ? 172 SER A CA    1 
ATOM   1051 C C     . SER A 1 134 ? 15.316  -13.858 6.132   1.00 37.21 ? 172 SER A C     1 
ATOM   1052 O O     . SER A 1 134 ? 15.353  -14.662 5.213   1.00 37.90 ? 172 SER A O     1 
ATOM   1053 C CB    . SER A 1 134 ? 17.030  -13.898 7.967   1.00 37.12 ? 172 SER A CB    1 
ATOM   1054 O OG    . SER A 1 134 ? 17.996  -14.450 7.097   1.00 36.68 ? 172 SER A OG    1 
ATOM   1055 N N     . CYS A 1 135 ? 15.017  -12.579 5.967   1.00 37.10 ? 173 CYS A N     1 
ATOM   1056 C CA    . CYS A 1 135 ? 14.857  -11.973 4.656   1.00 37.15 ? 173 CYS A CA    1 
ATOM   1057 C C     . CYS A 1 135 ? 15.550  -10.618 4.664   1.00 37.41 ? 173 CYS A C     1 
ATOM   1058 O O     . CYS A 1 135 ? 15.741  -10.033 5.724   1.00 37.51 ? 173 CYS A O     1 
ATOM   1059 C CB    . CYS A 1 135 ? 13.389  -11.787 4.329   1.00 37.51 ? 173 CYS A CB    1 
ATOM   1060 S SG    . CYS A 1 135 ? 12.529  -13.349 4.009   1.00 38.83 ? 173 CYS A SG    1 
ATOM   1061 N N     . PRO A 1 136 ? 15.945  -10.131 3.487   1.00 37.57 ? 174 PRO A N     1 
ATOM   1062 C CA    . PRO A 1 136 ? 16.659  -8.851  3.447   1.00 37.34 ? 174 PRO A CA    1 
ATOM   1063 C C     . PRO A 1 136 ? 15.924  -7.696  4.148   1.00 37.78 ? 174 PRO A C     1 
ATOM   1064 O O     . PRO A 1 136 ? 14.728  -7.494  3.965   1.00 36.44 ? 174 PRO A O     1 
ATOM   1065 C CB    . PRO A 1 136 ? 16.786  -8.575  1.941   1.00 37.56 ? 174 PRO A CB    1 
ATOM   1066 C CG    . PRO A 1 136 ? 16.817  -9.983  1.319   1.00 37.14 ? 174 PRO A CG    1 
ATOM   1067 C CD    . PRO A 1 136 ? 15.801  -10.727 2.141   1.00 37.80 ? 174 PRO A CD    1 
ATOM   1068 N N     . ASP A 1 137 ? 16.678  -6.932  4.935   1.00 39.36 ? 175 ASP A N     1 
ATOM   1069 C CA    . ASP A 1 137 ? 16.214  -5.661  5.461   1.00 41.15 ? 175 ASP A CA    1 
ATOM   1070 C C     . ASP A 1 137 ? 16.400  -4.592  4.385   1.00 41.80 ? 175 ASP A C     1 
ATOM   1071 O O     . ASP A 1 137 ? 17.465  -4.528  3.740   1.00 41.66 ? 175 ASP A O     1 
ATOM   1072 C CB    . ASP A 1 137 ? 17.040  -5.312  6.699   1.00 41.72 ? 175 ASP A CB    1 
ATOM   1073 C CG    . ASP A 1 137 ? 16.639  -3.978  7.303   1.00 44.66 ? 175 ASP A CG    1 
ATOM   1074 O OD1   . ASP A 1 137 ? 17.472  -3.049  7.324   1.00 47.88 ? 175 ASP A OD1   1 
ATOM   1075 O OD2   . ASP A 1 137 ? 15.489  -3.871  7.744   1.00 46.66 ? 175 ASP A OD2   1 
ATOM   1076 N N     . TRP A 1 138 ? 15.371  -3.769  4.172   1.00 43.53 ? 176 TRP A N     1 
ATOM   1077 C CA    . TRP A 1 138 ? 15.388  -2.733  3.139   1.00 44.93 ? 176 TRP A CA    1 
ATOM   1078 C C     . TRP A 1 138 ? 16.596  -1.779  3.310   1.00 44.76 ? 176 TRP A C     1 
ATOM   1079 O O     . TRP A 1 138 ? 17.262  -1.432  2.331   1.00 44.48 ? 176 TRP A O     1 
ATOM   1080 C CB    . TRP A 1 138 ? 14.060  -1.958  3.161   1.00 46.66 ? 176 TRP A CB    1 
ATOM   1081 C CG    . TRP A 1 138 ? 13.946  -0.903  2.131   1.00 50.04 ? 176 TRP A CG    1 
ATOM   1082 C CD1   . TRP A 1 138 ? 13.669  -1.083  0.804   1.00 52.10 ? 176 TRP A CD1   1 
ATOM   1083 C CD2   . TRP A 1 138 ? 14.092  0.513   2.321   1.00 52.01 ? 176 TRP A CD2   1 
ATOM   1084 N NE1   . TRP A 1 138 ? 13.629  0.134   0.155   1.00 54.02 ? 176 TRP A NE1   1 
ATOM   1085 C CE2   . TRP A 1 138 ? 13.888  1.128   1.061   1.00 53.66 ? 176 TRP A CE2   1 
ATOM   1086 C CE3   . TRP A 1 138 ? 14.362  1.324   3.431   1.00 53.07 ? 176 TRP A CE3   1 
ATOM   1087 C CZ2   . TRP A 1 138 ? 13.963  2.518   0.881   1.00 52.39 ? 176 TRP A CZ2   1 
ATOM   1088 C CZ3   . TRP A 1 138 ? 14.428  2.708   3.250   1.00 51.96 ? 176 TRP A CZ3   1 
ATOM   1089 C CH2   . TRP A 1 138 ? 14.235  3.287   1.984   1.00 51.39 ? 176 TRP A CH2   1 
ATOM   1090 N N     . ARG A 1 139 ? 16.890  -1.399  4.552   1.00 44.69 ? 177 ARG A N     1 
ATOM   1091 C CA    . ARG A 1 139 ? 18.036  -0.498  4.843   1.00 45.69 ? 177 ARG A CA    1 
ATOM   1092 C C     . ARG A 1 139 ? 19.403  -1.211  4.807   1.00 45.13 ? 177 ARG A C     1 
ATOM   1093 O O     . ARG A 1 139 ? 20.303  -0.825  4.048   1.00 44.61 ? 177 ARG A O     1 
ATOM   1094 C CB    . ARG A 1 139 ? 17.892  0.142   6.229   1.00 46.10 ? 177 ARG A CB    1 
ATOM   1095 C CG    . ARG A 1 139 ? 16.817  1.191   6.395   1.00 47.17 ? 177 ARG A CG    1 
ATOM   1096 C CD    . ARG A 1 139 ? 16.982  1.823   7.810   1.00 47.67 ? 177 ARG A CD    1 
ATOM   1097 N NE    . ARG A 1 139 ? 17.924  2.958   7.886   1.00 51.13 ? 177 ARG A NE    1 
ATOM   1098 C CZ    . ARG A 1 139 ? 18.545  3.373   8.995   1.00 50.40 ? 177 ARG A CZ    1 
ATOM   1099 N NH1   . ARG A 1 139 ? 18.372  2.731   10.142  1.00 52.86 ? 177 ARG A NH1   1 
ATOM   1100 N NH2   . ARG A 1 139 ? 19.360  4.428   8.962   1.00 51.07 ? 177 ARG A NH2   1 
ATOM   1101 N N     . LYS A 1 140 ? 19.565  -2.232  5.651   1.00 44.72 ? 178 LYS A N     1 
ATOM   1102 C CA    . LYS A 1 140 ? 20.868  -2.859  5.852   1.00 44.31 ? 178 LYS A CA    1 
ATOM   1103 C C     . LYS A 1 140 ? 21.366  -3.700  4.693   1.00 43.26 ? 178 LYS A C     1 
ATOM   1104 O O     . LYS A 1 140 ? 22.578  -3.784  4.462   1.00 42.60 ? 178 LYS A O     1 
ATOM   1105 C CB    . LYS A 1 140 ? 20.885  -3.746  7.107   1.00 45.49 ? 178 LYS A CB    1 
ATOM   1106 C CG    . LYS A 1 140 ? 21.199  -3.022  8.408   1.00 49.02 ? 178 LYS A CG    1 
ATOM   1107 C CD    . LYS A 1 140 ? 19.957  -2.910  9.290   1.00 53.23 ? 178 LYS A CD    1 
ATOM   1108 C CE    . LYS A 1 140 ? 20.344  -2.736  10.756  1.00 56.18 ? 178 LYS A CE    1 
ATOM   1109 N NZ    . LYS A 1 140 ? 19.153  -2.875  11.650  1.00 58.80 ? 178 LYS A NZ    1 
ATOM   1110 N N     . ASP A 1 141 ? 20.435  -4.351  3.993   1.00 40.87 ? 179 ASP A N     1 
ATOM   1111 C CA    . ASP A 1 141 ? 20.795  -5.398  3.044   1.00 40.26 ? 179 ASP A CA    1 
ATOM   1112 C C     . ASP A 1 141 ? 20.575  -4.983  1.603   1.00 39.30 ? 179 ASP A C     1 
ATOM   1113 O O     . ASP A 1 141 ? 21.537  -4.939  0.827   1.00 38.56 ? 179 ASP A O     1 
ATOM   1114 C CB    . ASP A 1 141 ? 20.005  -6.697  3.325   1.00 39.67 ? 179 ASP A CB    1 
ATOM   1115 C CG    . ASP A 1 141 ? 20.320  -7.303  4.667   1.00 40.86 ? 179 ASP A CG    1 
ATOM   1116 O OD1   . ASP A 1 141 ? 21.516  -7.348  5.060   1.00 43.58 ? 179 ASP A OD1   1 
ATOM   1117 O OD2   . ASP A 1 141 ? 19.369  -7.767  5.325   1.00 41.90 ? 179 ASP A OD2   1 
ATOM   1118 N N     . CYS A 1 142 ? 19.315  -4.732  1.239   1.00 38.18 ? 180 CYS A N     1 
ATOM   1119 C CA    . CYS A 1 142 ? 18.988  -4.331  -0.132  1.00 38.51 ? 180 CYS A CA    1 
ATOM   1120 C C     . CYS A 1 142 ? 17.552  -3.908  -0.273  1.00 38.72 ? 180 CYS A C     1 
ATOM   1121 O O     . CYS A 1 142 ? 16.661  -4.473  0.365   1.00 36.55 ? 180 CYS A O     1 
ATOM   1122 C CB    . CYS A 1 142 ? 19.332  -5.445  -1.127  1.00 38.73 ? 180 CYS A CB    1 
ATOM   1123 S SG    . CYS A 1 142 ? 18.337  -6.957  -0.829  1.00 42.96 ? 180 CYS A SG    1 
ATOM   1124 N N     . SER A 1 143 ? 17.328  -2.907  -1.118  1.00 38.92 ? 181 SER A N     1 
ATOM   1125 C CA    . SER A 1 143 ? 15.980  -2.448  -1.412  1.00 40.11 ? 181 SER A CA    1 
ATOM   1126 C C     . SER A 1 143 ? 15.228  -3.352  -2.414  1.00 39.49 ? 181 SER A C     1 
ATOM   1127 O O     . SER A 1 143 ? 13.998  -3.353  -2.417  1.00 40.23 ? 181 SER A O     1 
ATOM   1128 C CB    . SER A 1 143 ? 16.026  -1.015  -1.950  1.00 41.71 ? 181 SER A CB    1 
ATOM   1129 O OG    . SER A 1 143 ? 16.941  -0.945  -3.041  1.00 44.52 ? 181 SER A OG    1 
ATOM   1130 N N     . ASN A 1 144 ? 15.955  -4.077  -3.275  1.00 39.03 ? 182 ASN A N     1 
ATOM   1131 C CA    . ASN A 1 144 ? 15.324  -4.872  -4.333  1.00 38.20 ? 182 ASN A CA    1 
ATOM   1132 C C     . ASN A 1 144 ? 14.955  -6.270  -3.826  1.00 37.71 ? 182 ASN A C     1 
ATOM   1133 O O     . ASN A 1 144 ? 15.308  -7.278  -4.453  1.00 38.07 ? 182 ASN A O     1 
ATOM   1134 C CB    . ASN A 1 144 ? 16.226  -4.995  -5.584  1.00 40.09 ? 182 ASN A CB    1 
ATOM   1135 C CG    . ASN A 1 144 ? 16.387  -3.678  -6.358  1.00 43.86 ? 182 ASN A CG    1 
ATOM   1136 O OD1   . ASN A 1 144 ? 15.715  -2.689  -6.097  1.00 49.36 ? 182 ASN A OD1   1 
ATOM   1137 N ND2   . ASN A 1 144 ? 17.300  -3.679  -7.324  1.00 50.11 ? 182 ASN A ND2   1 
ATOM   1138 N N     . ASN A 1 145 ? 14.269  -6.318  -2.685  1.00 36.16 ? 183 ASN A N     1 
ATOM   1139 C CA    . ASN A 1 145 ? 13.905  -7.581  -2.048  1.00 34.56 ? 183 ASN A CA    1 
ATOM   1140 C C     . ASN A 1 145 ? 12.420  -7.906  -2.377  1.00 33.84 ? 183 ASN A C     1 
ATOM   1141 O O     . ASN A 1 145 ? 11.673  -7.027  -2.803  1.00 31.62 ? 183 ASN A O     1 
ATOM   1142 C CB    . ASN A 1 145 ? 14.215  -7.499  -0.545  1.00 34.54 ? 183 ASN A CB    1 
ATOM   1143 C CG    . ASN A 1 145 ? 13.355  -6.457  0.163   1.00 36.55 ? 183 ASN A CG    1 
ATOM   1144 O OD1   . ASN A 1 145 ? 13.843  -5.390  0.576   1.00 41.54 ? 183 ASN A OD1   1 
ATOM   1145 N ND2   . ASN A 1 145 ? 12.088  -6.746  0.292   1.00 29.88 ? 183 ASN A ND2   1 
ATOM   1146 N N     . PRO A 1 146 ? 11.998  -9.179  -2.220  1.00 32.64 ? 184 PRO A N     1 
ATOM   1147 C CA    . PRO A 1 146 ? 10.674  -9.552  -2.678  1.00 32.29 ? 184 PRO A CA    1 
ATOM   1148 C C     . PRO A 1 146 ? 9.547   -8.689  -2.086  1.00 32.47 ? 184 PRO A C     1 
ATOM   1149 O O     . PRO A 1 146 ? 8.601   -8.327  -2.793  1.00 32.56 ? 184 PRO A O     1 
ATOM   1150 C CB    . PRO A 1 146 ? 10.547  -11.023 -2.228  1.00 31.73 ? 184 PRO A CB    1 
ATOM   1151 C CG    . PRO A 1 146 ? 11.994  -11.523 -2.273  1.00 30.72 ? 184 PRO A CG    1 
ATOM   1152 C CD    . PRO A 1 146 ? 12.759  -10.346 -1.708  1.00 33.40 ? 184 PRO A CD    1 
ATOM   1153 N N     . VAL A 1 147 ? 9.617   -8.392  -0.794  1.00 32.70 ? 185 VAL A N     1 
ATOM   1154 C CA    . VAL A 1 147 ? 8.549   -7.605  -0.181  1.00 32.90 ? 185 VAL A CA    1 
ATOM   1155 C C     . VAL A 1 147 ? 8.560   -6.148  -0.649  1.00 33.48 ? 185 VAL A C     1 
ATOM   1156 O O     . VAL A 1 147 ? 7.515   -5.594  -1.001  1.00 32.83 ? 185 VAL A O     1 
ATOM   1157 C CB    . VAL A 1 147 ? 8.624   -7.708  1.368   1.00 32.88 ? 185 VAL A CB    1 
ATOM   1158 C CG1   . VAL A 1 147 ? 7.659   -6.711  2.034   1.00 33.42 ? 185 VAL A CG1   1 
ATOM   1159 C CG2   . VAL A 1 147 ? 8.331   -9.136  1.819   1.00 32.24 ? 185 VAL A CG2   1 
ATOM   1160 N N     . SER A 1 148 ? 9.722   -5.489  -0.621  1.00 33.96 ? 186 SER A N     1 
ATOM   1161 C CA    . SER A 1 148 ? 9.770   -4.067  -1.000  1.00 35.25 ? 186 SER A CA    1 
ATOM   1162 C C     . SER A 1 148 ? 9.353   -3.884  -2.459  1.00 34.43 ? 186 SER A C     1 
ATOM   1163 O O     . SER A 1 148 ? 8.585   -2.967  -2.802  1.00 32.74 ? 186 SER A O     1 
ATOM   1164 C CB    . SER A 1 148 ? 11.158  -3.496  -0.739  1.00 35.31 ? 186 SER A CB    1 
ATOM   1165 O OG    . SER A 1 148 ? 11.446  -3.608  0.636   1.00 36.67 ? 186 SER A OG    1 
ATOM   1166 N N     . VAL A 1 149 ? 9.810   -4.806  -3.302  1.00 33.35 ? 187 VAL A N     1 
ATOM   1167 C CA    . VAL A 1 149 ? 9.516   -4.700  -4.718  1.00 33.72 ? 187 VAL A CA    1 
ATOM   1168 C C     . VAL A 1 149 ? 8.000   -4.911  -4.977  1.00 33.06 ? 187 VAL A C     1 
ATOM   1169 O O     . VAL A 1 149 ? 7.420   -4.223  -5.808  1.00 33.84 ? 187 VAL A O     1 
ATOM   1170 C CB    . VAL A 1 149 ? 10.385  -5.657  -5.573  1.00 32.99 ? 187 VAL A CB    1 
ATOM   1171 C CG1   . VAL A 1 149 ? 9.907   -5.631  -6.993  1.00 34.80 ? 187 VAL A CG1   1 
ATOM   1172 C CG2   . VAL A 1 149 ? 11.845  -5.191  -5.503  1.00 33.48 ? 187 VAL A CG2   1 
ATOM   1173 N N     . PHE A 1 150 ? 7.393   -5.872  -4.279  1.00 31.89 ? 188 PHE A N     1 
ATOM   1174 C CA    . PHE A 1 150 ? 5.945   -6.111  -4.362  1.00 32.20 ? 188 PHE A CA    1 
ATOM   1175 C C     . PHE A 1 150 ? 5.175   -4.830  -4.021  1.00 32.42 ? 188 PHE A C     1 
ATOM   1176 O O     . PHE A 1 150 ? 4.318   -4.404  -4.791  1.00 33.10 ? 188 PHE A O     1 
ATOM   1177 C CB    . PHE A 1 150 ? 5.519   -7.219  -3.412  1.00 31.81 ? 188 PHE A CB    1 
ATOM   1178 C CG    . PHE A 1 150 ? 4.061   -7.351  -3.294  1.00 31.90 ? 188 PHE A CG    1 
ATOM   1179 C CD1   . PHE A 1 150 ? 3.356   -8.117  -4.186  1.00 30.70 ? 188 PHE A CD1   1 
ATOM   1180 C CD2   . PHE A 1 150 ? 3.370   -6.676  -2.327  1.00 29.60 ? 188 PHE A CD2   1 
ATOM   1181 C CE1   . PHE A 1 150 ? 1.972   -8.234  -4.086  1.00 34.26 ? 188 PHE A CE1   1 
ATOM   1182 C CE2   . PHE A 1 150 ? 1.980   -6.777  -2.225  1.00 29.64 ? 188 PHE A CE2   1 
ATOM   1183 C CZ    . PHE A 1 150 ? 1.290   -7.569  -3.117  1.00 33.36 ? 188 PHE A CZ    1 
ATOM   1184 N N     . TRP A 1 151 ? 5.500   -4.206  -2.895  1.00 34.27 ? 189 TRP A N     1 
ATOM   1185 C CA    . TRP A 1 151 ? 4.710   -3.049  -2.496  1.00 33.91 ? 189 TRP A CA    1 
ATOM   1186 C C     . TRP A 1 151 ? 4.894   -1.895  -3.463  1.00 34.01 ? 189 TRP A C     1 
ATOM   1187 O O     . TRP A 1 151 ? 3.952   -1.145  -3.737  1.00 35.02 ? 189 TRP A O     1 
ATOM   1188 C CB    . TRP A 1 151 ? 4.970   -2.664  -1.034  1.00 34.15 ? 189 TRP A CB    1 
ATOM   1189 C CG    . TRP A 1 151 ? 4.333   -3.684  -0.126  1.00 31.12 ? 189 TRP A CG    1 
ATOM   1190 C CD1   . TRP A 1 151 ? 4.987   -4.523  0.690   1.00 34.23 ? 189 TRP A CD1   1 
ATOM   1191 C CD2   . TRP A 1 151 ? 2.932   -3.932  0.056   1.00 31.09 ? 189 TRP A CD2   1 
ATOM   1192 N NE1   . TRP A 1 151 ? 4.103   -5.302  1.383   1.00 34.47 ? 189 TRP A NE1   1 
ATOM   1193 C CE2   . TRP A 1 151 ? 2.829   -4.971  1.013   1.00 34.72 ? 189 TRP A CE2   1 
ATOM   1194 C CE3   . TRP A 1 151 ? 1.761   -3.392  -0.500  1.00 32.50 ? 189 TRP A CE3   1 
ATOM   1195 C CZ2   . TRP A 1 151 ? 1.599   -5.492  1.431   1.00 37.78 ? 189 TRP A CZ2   1 
ATOM   1196 C CZ3   . TRP A 1 151 ? 0.512   -3.923  -0.092  1.00 34.02 ? 189 TRP A CZ3   1 
ATOM   1197 C CH2   . TRP A 1 151 ? 0.450   -4.967  0.848   1.00 34.20 ? 189 TRP A CH2   1 
ATOM   1198 N N     . LYS A 1 152 ? 6.104   -1.740  -3.986  1.00 34.44 ? 190 LYS A N     1 
ATOM   1199 C CA    . LYS A 1 152 ? 6.341   -0.633  -4.882  1.00 36.66 ? 190 LYS A CA    1 
ATOM   1200 C C     . LYS A 1 152 ? 5.536   -0.880  -6.165  1.00 36.45 ? 190 LYS A C     1 
ATOM   1201 O O     . LYS A 1 152 ? 4.946   0.055   -6.743  1.00 37.92 ? 190 LYS A O     1 
ATOM   1202 C CB    . LYS A 1 152 ? 7.866   -0.448  -5.114  1.00 36.57 ? 190 LYS A CB    1 
ATOM   1203 C CG    . LYS A 1 152 ? 8.189   0.730   -6.059  1.00 40.20 ? 190 LYS A CG    1 
ATOM   1204 C CD    . LYS A 1 152 ? 9.653   0.956   -6.198  1.00 40.92 ? 190 LYS A CD    1 
ATOM   1205 C CE    . LYS A 1 152 ? 9.840   2.386   -6.685  1.00 46.42 ? 190 LYS A CE    1 
ATOM   1206 N NZ    . LYS A 1 152 ? 11.232  2.671   -7.037  1.00 48.17 ? 190 LYS A NZ    1 
ATOM   1207 N N     . THR A 1 153 ? 5.496   -2.138  -6.608  1.00 34.76 ? 191 THR A N     1 
ATOM   1208 C CA    . THR A 1 153 ? 4.817   -2.494  -7.832  1.00 34.53 ? 191 THR A CA    1 
ATOM   1209 C C     . THR A 1 153 ? 3.314   -2.281  -7.720  1.00 34.61 ? 191 THR A C     1 
ATOM   1210 O O     . THR A 1 153 ? 2.705   -1.627  -8.585  1.00 35.71 ? 191 THR A O     1 
ATOM   1211 C CB    . THR A 1 153 ? 5.133   -3.945  -8.208  1.00 34.60 ? 191 THR A CB    1 
ATOM   1212 O OG1   . THR A 1 153 ? 6.547   -4.074  -8.356  1.00 37.51 ? 191 THR A OG1   1 
ATOM   1213 C CG2   . THR A 1 153 ? 4.443   -4.356  -9.566  1.00 36.53 ? 191 THR A CG2   1 
ATOM   1214 N N     . VAL A 1 154 ? 2.716   -2.862  -6.691  1.00 32.52 ? 192 VAL A N     1 
ATOM   1215 C CA    . VAL A 1 154 ? 1.261   -2.785  -6.496  1.00 33.97 ? 192 VAL A CA    1 
ATOM   1216 C C     . VAL A 1 154 ? 0.802   -1.360  -6.178  1.00 34.96 ? 192 VAL A C     1 
ATOM   1217 O O     . VAL A 1 154 ? -0.246  -0.929  -6.707  1.00 35.43 ? 192 VAL A O     1 
ATOM   1218 C CB    . VAL A 1 154 ? 0.692   -3.776  -5.427  1.00 35.65 ? 192 VAL A CB    1 
ATOM   1219 C CG1   . VAL A 1 154 ? 0.932   -5.195  -5.837  1.00 36.24 ? 192 VAL A CG1   1 
ATOM   1220 C CG2   . VAL A 1 154 ? 1.319   -3.569  -4.065  1.00 37.19 ? 192 VAL A CG2   1 
ATOM   1221 N N     . SER A 1 155 ? 1.579   -0.636  -5.361  1.00 34.94 ? 193 SER A N     1 
ATOM   1222 C CA    . SER A 1 155 ? 1.238   0.748   -4.981  1.00 37.33 ? 193 SER A CA    1 
ATOM   1223 C C     . SER A 1 155 ? 1.232   1.678   -6.200  1.00 36.80 ? 193 SER A C     1 
ATOM   1224 O O     . SER A 1 155 ? 0.347   2.540   -6.335  1.00 37.41 ? 193 SER A O     1 
ATOM   1225 C CB    . SER A 1 155 ? 2.179   1.341   -3.926  1.00 37.15 ? 193 SER A CB    1 
ATOM   1226 O OG    . SER A 1 155 ? 2.089   0.627   -2.690  1.00 45.49 ? 193 SER A OG    1 
ATOM   1227 N N     . ARG A 1 156 ? 2.226   1.519   -7.074  1.00 36.89 ? 194 ARG A N     1 
ATOM   1228 C CA    . ARG A 1 156 ? 2.279   2.291   -8.300  1.00 35.48 ? 194 ARG A CA    1 
ATOM   1229 C C     . ARG A 1 156 ? 1.007   2.096   -9.128  1.00 35.91 ? 194 ARG A C     1 
ATOM   1230 O O     . ARG A 1 156 ? 0.408   3.050   -9.588  1.00 35.40 ? 194 ARG A O     1 
ATOM   1231 C CB    . ARG A 1 156 ? 3.537   1.923   -9.138  1.00 37.15 ? 194 ARG A CB    1 
ATOM   1232 C CG    . ARG A 1 156 ? 3.650   2.787   -10.351 1.00 41.09 ? 194 ARG A CG    1 
ATOM   1233 C CD    . ARG A 1 156 ? 4.939   2.552   -11.114 1.00 46.56 ? 194 ARG A CD    1 
ATOM   1234 N NE    . ARG A 1 156 ? 4.741   2.927   -12.497 1.00 54.75 ? 194 ARG A NE    1 
ATOM   1235 C CZ    . ARG A 1 156 ? 4.297   2.090   -13.430 1.00 58.73 ? 194 ARG A CZ    1 
ATOM   1236 N NH1   . ARG A 1 156 ? 3.997   0.832   -13.106 1.00 59.15 ? 194 ARG A NH1   1 
ATOM   1237 N NH2   . ARG A 1 156 ? 4.147   2.520   -14.682 1.00 60.26 ? 194 ARG A NH2   1 
ATOM   1238 N N     . ARG A 1 157 ? 0.618   0.850   -9.362  1.00 33.86 ? 195 ARG A N     1 
ATOM   1239 C CA    . ARG A 1 157 ? -0.574  0.577   -10.109 1.00 34.61 ? 195 ARG A CA    1 
ATOM   1240 C C     . ARG A 1 157 ? -1.852  1.146   -9.485  1.00 33.42 ? 195 ARG A C     1 
ATOM   1241 O O     . ARG A 1 157 ? -2.714  1.696   -10.200 1.00 34.39 ? 195 ARG A O     1 
ATOM   1242 C CB    . ARG A 1 157 ? -0.676  -0.933  -10.344 1.00 36.08 ? 195 ARG A CB    1 
ATOM   1243 C CG    . ARG A 1 157 ? 0.525   -1.469  -11.048 1.00 41.68 ? 195 ARG A CG    1 
ATOM   1244 C CD    . ARG A 1 157 ? 0.378   -2.961  -11.289 1.00 50.60 ? 195 ARG A CD    1 
ATOM   1245 N NE    . ARG A 1 157 ? 1.277   -3.415  -12.333 1.00 56.89 ? 195 ARG A NE    1 
ATOM   1246 C CZ    . ARG A 1 157 ? 0.955   -3.512  -13.621 1.00 58.01 ? 195 ARG A CZ    1 
ATOM   1247 N NH1   . ARG A 1 157 ? -0.261  -3.185  -14.048 1.00 57.52 ? 195 ARG A NH1   1 
ATOM   1248 N NH2   . ARG A 1 157 ? 1.866   -3.942  -14.481 1.00 60.59 ? 195 ARG A NH2   1 
ATOM   1249 N N     . PHE A 1 158 ? -1.915  1.083   -8.164  1.00 34.57 ? 196 PHE A N     1 
ATOM   1250 C CA    . PHE A 1 158 ? -3.083  1.582   -7.414  1.00 34.64 ? 196 PHE A CA    1 
ATOM   1251 C C     . PHE A 1 158 ? -3.153  3.100   -7.588  1.00 34.26 ? 196 PHE A C     1 
ATOM   1252 O O     . PHE A 1 158 ? -4.218  3.676   -7.923  1.00 35.28 ? 196 PHE A O     1 
ATOM   1253 C CB    . PHE A 1 158 ? -2.886  1.232   -5.947  1.00 34.35 ? 196 PHE A CB    1 
ATOM   1254 C CG    . PHE A 1 158 ? -4.118  1.435   -5.110  1.00 33.01 ? 196 PHE A CG    1 
ATOM   1255 C CD1   . PHE A 1 158 ? -5.316  0.784   -5.429  1.00 35.73 ? 196 PHE A CD1   1 
ATOM   1256 C CD2   . PHE A 1 158 ? -4.070  2.262   -3.975  1.00 35.13 ? 196 PHE A CD2   1 
ATOM   1257 C CE1   . PHE A 1 158 ? -6.458  0.980   -4.659  1.00 35.16 ? 196 PHE A CE1   1 
ATOM   1258 C CE2   . PHE A 1 158 ? -5.210  2.450   -3.198  1.00 34.04 ? 196 PHE A CE2   1 
ATOM   1259 C CZ    . PHE A 1 158 ? -6.405  1.786   -3.524  1.00 34.38 ? 196 PHE A CZ    1 
ATOM   1260 N N     . ALA A 1 159 ? -2.005  3.761   -7.409  1.00 34.01 ? 197 ALA A N     1 
ATOM   1261 C CA    . ALA A 1 159 ? -1.950  5.210   -7.634  1.00 33.34 ? 197 ALA A CA    1 
ATOM   1262 C C     . ALA A 1 159 ? -2.360  5.616   -9.075  1.00 33.26 ? 197 ALA A C     1 
ATOM   1263 O O     . ALA A 1 159 ? -3.103  6.572   -9.246  1.00 33.49 ? 197 ALA A O     1 
ATOM   1264 C CB    . ALA A 1 159 ? -0.565  5.773   -7.254  1.00 33.43 ? 197 ALA A CB    1 
ATOM   1265 N N     . GLU A 1 160 ? -1.933  4.867   -10.067 1.00 34.55 ? 198 GLU A N     1 
ATOM   1266 C CA    . GLU A 1 160 ? -2.254  5.149   -11.476 1.00 35.68 ? 198 GLU A CA    1 
ATOM   1267 C C     . GLU A 1 160 ? -3.746  5.024   -11.766 1.00 35.59 ? 198 GLU A C     1 
ATOM   1268 O O     . GLU A 1 160 ? -4.242  5.584   -12.725 1.00 36.07 ? 198 GLU A O     1 
ATOM   1269 C CB    . GLU A 1 160 ? -1.508  4.197   -12.422 1.00 35.99 ? 198 GLU A CB    1 
ATOM   1270 C CG    . GLU A 1 160 ? 0.017   4.424   -12.417 1.00 38.32 ? 198 GLU A CG    1 
ATOM   1271 C CD    . GLU A 1 160 ? 0.757   3.359   -13.240 1.00 41.10 ? 198 GLU A CD    1 
ATOM   1272 O OE1   . GLU A 1 160 ? 0.280   2.194   -13.333 1.00 47.31 ? 198 GLU A OE1   1 
ATOM   1273 O OE2   . GLU A 1 160 ? 1.820   3.700   -13.784 1.00 46.69 ? 198 GLU A OE2   1 
ATOM   1274 N N     . ALA A 1 161 ? -4.443  4.277   -10.925 1.00 35.97 ? 199 ALA A N     1 
ATOM   1275 C CA    . ALA A 1 161 ? -5.871  4.042   -11.144 1.00 36.32 ? 199 ALA A CA    1 
ATOM   1276 C C     . ALA A 1 161 ? -6.744  5.152   -10.577 1.00 36.64 ? 199 ALA A C     1 
ATOM   1277 O O     . ALA A 1 161 ? -7.944  5.192   -10.890 1.00 37.66 ? 199 ALA A O     1 
ATOM   1278 C CB    . ALA A 1 161 ? -6.290  2.708   -10.550 1.00 38.76 ? 199 ALA A CB    1 
ATOM   1279 N N     . ALA A 1 162 ? -6.176  6.022   -9.715  1.00 34.60 ? 200 ALA A N     1 
ATOM   1280 C CA    . ALA A 1 162 ? -6.942  7.080   -9.058  1.00 33.90 ? 200 ALA A CA    1 
ATOM   1281 C C     . ALA A 1 162 ? -7.401  8.219   -9.946  1.00 34.21 ? 200 ALA A C     1 
ATOM   1282 O O     . ALA A 1 162 ? -6.747  8.560   -10.927 1.00 35.14 ? 200 ALA A O     1 
ATOM   1283 C CB    . ALA A 1 162 ? -6.101  7.666   -7.905  1.00 33.49 ? 200 ALA A CB    1 
ATOM   1284 N N     . CYS A 1 163 ? -8.586  8.769   -9.661  1.00 33.65 ? 201 CYS A N     1 
ATOM   1285 C CA    . CYS A 1 163 ? -9.068  9.937   -10.369 1.00 33.75 ? 201 CYS A CA    1 
ATOM   1286 C C     . CYS A 1 163 ? -9.774  10.884  -9.375  1.00 33.77 ? 201 CYS A C     1 
ATOM   1287 O O     . CYS A 1 163 ? -9.991  10.544  -8.200  1.00 33.68 ? 201 CYS A O     1 
ATOM   1288 C CB    . CYS A 1 163 ? -10.055 9.534   -11.460 1.00 35.18 ? 201 CYS A CB    1 
ATOM   1289 S SG    . CYS A 1 163 ? -11.628 8.947   -10.802 1.00 38.69 ? 201 CYS A SG    1 
ATOM   1290 N N     . ASP A 1 164 ? -10.154 12.051  -9.881  1.00 33.58 ? 202 ASP A N     1 
ATOM   1291 C CA    . ASP A 1 164 ? -10.981 13.019  -9.145  1.00 33.79 ? 202 ASP A CA    1 
ATOM   1292 C C     . ASP A 1 164 ? -10.312 13.485  -7.848  1.00 33.02 ? 202 ASP A C     1 
ATOM   1293 O O     . ASP A 1 164 ? -9.208  14.015  -7.889  1.00 34.71 ? 202 ASP A O     1 
ATOM   1294 C CB    . ASP A 1 164 ? -12.415 12.460  -8.933  1.00 33.18 ? 202 ASP A CB    1 
ATOM   1295 C CG    . ASP A 1 164 ? -13.082 12.060  -10.269 1.00 35.85 ? 202 ASP A CG    1 
ATOM   1296 O OD1   . ASP A 1 164 ? -12.602 12.498  -11.360 1.00 34.83 ? 202 ASP A OD1   1 
ATOM   1297 O OD2   . ASP A 1 164 ? -14.098 11.337  -10.239 1.00 35.45 ? 202 ASP A OD2   1 
ATOM   1298 N N     . VAL A 1 165 ? -10.958 13.281  -6.716  1.00 31.68 ? 203 VAL A N     1 
ATOM   1299 C CA    . VAL A 1 165 ? -10.374 13.666  -5.419  1.00 32.57 ? 203 VAL A CA    1 
ATOM   1300 C C     . VAL A 1 165 ? -9.785  12.395  -4.780  1.00 32.52 ? 203 VAL A C     1 
ATOM   1301 O O     . VAL A 1 165 ? -10.509 11.408  -4.591  1.00 32.52 ? 203 VAL A O     1 
ATOM   1302 C CB    . VAL A 1 165 ? -11.376 14.320  -4.473  1.00 34.34 ? 203 VAL A CB    1 
ATOM   1303 C CG1   . VAL A 1 165 ? -10.603 14.667  -3.185  1.00 33.50 ? 203 VAL A CG1   1 
ATOM   1304 C CG2   . VAL A 1 165 ? -11.904 15.606  -5.100  1.00 35.24 ? 203 VAL A CG2   1 
ATOM   1305 N N     . VAL A 1 166 ? -8.479  12.408  -4.515  1.00 30.66 ? 204 VAL A N     1 
ATOM   1306 C CA    . VAL A 1 166 ? -7.792  11.304  -3.854  1.00 31.76 ? 204 VAL A CA    1 
ATOM   1307 C C     . VAL A 1 166 ? -7.456  11.763  -2.417  1.00 32.54 ? 204 VAL A C     1 
ATOM   1308 O O     . VAL A 1 166 ? -7.153  12.939  -2.216  1.00 34.08 ? 204 VAL A O     1 
ATOM   1309 C CB    . VAL A 1 166 ? -6.468  10.952  -4.578  1.00 31.75 ? 204 VAL A CB    1 
ATOM   1310 C CG1   . VAL A 1 166 ? -5.821  9.774   -3.875  1.00 34.46 ? 204 VAL A CG1   1 
ATOM   1311 C CG2   . VAL A 1 166 ? -6.790  10.534  -6.032  1.00 34.12 ? 204 VAL A CG2   1 
ATOM   1312 N N     . HIS A 1 167 ? -7.677  10.873  -1.470  1.00 32.47 ? 205 HIS A N     1 
ATOM   1313 C CA    . HIS A 1 167 ? -7.503  11.228  -0.038  1.00 31.44 ? 205 HIS A CA    1 
ATOM   1314 C C     . HIS A 1 167 ? -6.271  10.495  0.495   1.00 32.71 ? 205 HIS A C     1 
ATOM   1315 O O     . HIS A 1 167 ? -5.960  9.388   0.068   1.00 32.81 ? 205 HIS A O     1 
ATOM   1316 C CB    . HIS A 1 167 ? -8.736  10.899  0.782   1.00 31.01 ? 205 HIS A CB    1 
ATOM   1317 C CG    . HIS A 1 167 ? -9.890  11.805  0.515   1.00 34.36 ? 205 HIS A CG    1 
ATOM   1318 N ND1   . HIS A 1 167 ? -10.762 11.598  -0.537  1.00 37.57 ? 205 HIS A ND1   1 
ATOM   1319 C CD2   . HIS A 1 167 ? -10.309 12.931  1.147   1.00 36.09 ? 205 HIS A CD2   1 
ATOM   1320 C CE1   . HIS A 1 167 ? -11.682 12.550  -0.535  1.00 37.06 ? 205 HIS A CE1   1 
ATOM   1321 N NE2   . HIS A 1 167 ? -11.438 13.362  0.490   1.00 36.81 ? 205 HIS A NE2   1 
ATOM   1322 N N     . VAL A 1 168 ? -5.553  11.110  1.449   1.00 32.56 ? 206 VAL A N     1 
ATOM   1323 C CA    . VAL A 1 168 ? -4.449  10.417  2.134   1.00 31.70 ? 206 VAL A CA    1 
ATOM   1324 C C     . VAL A 1 168 ? -4.507  10.752  3.628   1.00 31.36 ? 206 VAL A C     1 
ATOM   1325 O O     . VAL A 1 168 ? -4.596  11.949  3.994   1.00 31.89 ? 206 VAL A O     1 
ATOM   1326 C CB    . VAL A 1 168 ? -3.061  10.766  1.560   1.00 32.67 ? 206 VAL A CB    1 
ATOM   1327 C CG1   . VAL A 1 168 ? -2.799  12.311  1.541   1.00 32.22 ? 206 VAL A CG1   1 
ATOM   1328 C CG2   . VAL A 1 168 ? -1.930  9.921   2.267   1.00 31.95 ? 206 VAL A CG2   1 
ATOM   1329 N N     . MET A 1 169 ? -4.481  9.706   4.427   1.00 32.37 ? 207 MET A N     1 
ATOM   1330 C CA    . MET A 1 169 ? -4.330  9.836   5.909   1.00 32.62 ? 207 MET A CA    1 
ATOM   1331 C C     . MET A 1 169 ? -2.858  9.826   6.283   1.00 32.43 ? 207 MET A C     1 
ATOM   1332 O O     . MET A 1 169 ? -2.113  8.890   5.904   1.00 32.71 ? 207 MET A O     1 
ATOM   1333 C CB    . MET A 1 169 ? -5.004  8.658   6.603   1.00 34.31 ? 207 MET A CB    1 
ATOM   1334 C CG    . MET A 1 169 ? -6.460  8.831   6.743   1.00 37.38 ? 207 MET A CG    1 
ATOM   1335 S SD    . MET A 1 169 ? -7.072  7.560   7.836   1.00 37.70 ? 207 MET A SD    1 
ATOM   1336 C CE    . MET A 1 169 ? -8.773  8.018   7.763   1.00 35.84 ? 207 MET A CE    1 
ATOM   1337 N N     . LEU A 1 170 ? -2.442  10.828  7.051   1.00 32.57 ? 208 LEU A N     1 
ATOM   1338 C CA    . LEU A 1 170 ? -1.045  10.958  7.458   1.00 31.91 ? 208 LEU A CA    1 
ATOM   1339 C C     . LEU A 1 170 ? -0.978  10.982  8.971   1.00 32.77 ? 208 LEU A C     1 
ATOM   1340 O O     . LEU A 1 170 ? -1.878  11.497  9.616   1.00 33.24 ? 208 LEU A O     1 
ATOM   1341 C CB    . LEU A 1 170 ? -0.440  12.246  6.894   1.00 32.30 ? 208 LEU A CB    1 
ATOM   1342 C CG    . LEU A 1 170 ? -0.406  12.381  5.352   1.00 32.62 ? 208 LEU A CG    1 
ATOM   1343 C CD1   . LEU A 1 170 ? 0.194   13.749  5.018   1.00 36.19 ? 208 LEU A CD1   1 
ATOM   1344 C CD2   . LEU A 1 170 ? 0.457   11.318  4.821   1.00 32.09 ? 208 LEU A CD2   1 
ATOM   1345 N N     . ASP A 1 171 ? 0.082   10.388  9.501   1.00 33.16 ? 209 ASP A N     1 
ATOM   1346 C CA    . ASP A 1 171 ? 0.304   10.382  10.974  1.00 33.24 ? 209 ASP A CA    1 
ATOM   1347 C C     . ASP A 1 171 ? 0.927   11.677  11.511  1.00 34.17 ? 209 ASP A C     1 
ATOM   1348 O O     . ASP A 1 171 ? 2.132   11.864  11.387  1.00 34.75 ? 209 ASP A O     1 
ATOM   1349 C CB    . ASP A 1 171 ? 1.222   9.219   11.339  1.00 34.23 ? 209 ASP A CB    1 
ATOM   1350 C CG    . ASP A 1 171 ? 1.343   8.995   12.837  1.00 36.74 ? 209 ASP A CG    1 
ATOM   1351 O OD1   . ASP A 1 171 ? 0.691   9.712   13.636  1.00 38.82 ? 209 ASP A OD1   1 
ATOM   1352 O OD2   . ASP A 1 171 ? 2.075   8.056   13.202  1.00 40.66 ? 209 ASP A OD2   1 
ATOM   1353 N N     . GLY A 1 172 ? 0.109   12.504  12.152  1.00 33.46 ? 210 GLY A N     1 
ATOM   1354 C CA    . GLY A 1 172 ? 0.536   13.800  12.667  1.00 34.38 ? 210 GLY A CA    1 
ATOM   1355 C C     . GLY A 1 172 ? 1.318   13.680  13.948  1.00 35.97 ? 210 GLY A C     1 
ATOM   1356 O O     . GLY A 1 172 ? 1.718   14.704  14.509  1.00 33.85 ? 210 GLY A O     1 
ATOM   1357 N N     . SER A 1 173 ? 1.561   12.464  14.427  1.00 37.30 ? 211 SER A N     1 
ATOM   1358 C CA    . SER A 1 173 ? 2.405   12.328  15.628  1.00 40.77 ? 211 SER A CA    1 
ATOM   1359 C C     . SER A 1 173 ? 3.864   11.974  15.254  1.00 42.27 ? 211 SER A C     1 
ATOM   1360 O O     . SER A 1 173 ? 4.717   11.817  16.107  1.00 44.14 ? 211 SER A O     1 
ATOM   1361 C CB    . SER A 1 173 ? 1.781   11.333  16.609  1.00 39.34 ? 211 SER A CB    1 
ATOM   1362 O OG    . SER A 1 173 ? 1.700   10.025  16.055  1.00 42.01 ? 211 SER A OG    1 
ATOM   1363 N N     . ARG A 1 174 ? 4.139   11.870  13.965  1.00 45.17 ? 212 ARG A N     1 
ATOM   1364 C CA    . ARG A 1 174 ? 5.479   11.576  13.469  1.00 47.35 ? 212 ARG A CA    1 
ATOM   1365 C C     . ARG A 1 174 ? 6.259   12.870  13.302  1.00 47.64 ? 212 ARG A C     1 
ATOM   1366 O O     . ARG A 1 174 ? 5.666   13.917  13.078  1.00 48.45 ? 212 ARG A O     1 
ATOM   1367 C CB    . ARG A 1 174 ? 5.388   10.858  12.114  1.00 48.08 ? 212 ARG A CB    1 
ATOM   1368 C CG    . ARG A 1 174 ? 4.888   9.416   12.187  1.00 52.32 ? 212 ARG A CG    1 
ATOM   1369 C CD    . ARG A 1 174 ? 5.940   8.476   12.775  1.00 58.41 ? 212 ARG A CD    1 
ATOM   1370 N NE    . ARG A 1 174 ? 5.839   7.128   12.203  1.00 63.75 ? 212 ARG A NE    1 
ATOM   1371 C CZ    . ARG A 1 174 ? 6.698   6.136   12.446  1.00 65.65 ? 212 ARG A CZ    1 
ATOM   1372 N NH1   . ARG A 1 174 ? 7.740   6.332   13.253  1.00 64.83 ? 212 ARG A NH1   1 
ATOM   1373 N NH2   . ARG A 1 174 ? 6.517   4.944   11.872  1.00 65.97 ? 212 ARG A NH2   1 
ATOM   1374 N N     . SER A 1 175 ? 7.584   12.800  13.421  1.00 48.11 ? 213 SER A N     1 
ATOM   1375 C CA    . SER A 1 175 ? 8.431   13.959  13.177  1.00 47.83 ? 213 SER A CA    1 
ATOM   1376 C C     . SER A 1 175 ? 8.444   14.422  11.740  1.00 47.41 ? 213 SER A C     1 
ATOM   1377 O O     . SER A 1 175 ? 8.705   15.612  11.496  1.00 48.85 ? 213 SER A O     1 
ATOM   1378 C CB    . SER A 1 175 ? 9.862   13.721  13.667  1.00 48.62 ? 213 SER A CB    1 
ATOM   1379 O OG    . SER A 1 175 ? 10.001  14.127  15.024  1.00 50.99 ? 213 SER A OG    1 
ATOM   1380 N N     . LYS A 1 176 ? 8.190   13.474  10.822  1.00 44.65 ? 214 LYS A N     1 
ATOM   1381 C CA    . LYS A 1 176 ? 7.951   13.687  9.389   1.00 43.45 ? 214 LYS A CA    1 
ATOM   1382 C C     . LYS A 1 176 ? 6.543   13.252  9.044   1.00 40.58 ? 214 LYS A C     1 
ATOM   1383 O O     . LYS A 1 176 ? 6.335   12.109  8.621   1.00 42.39 ? 214 LYS A O     1 
ATOM   1384 C CB    . LYS A 1 176 ? 8.913   12.853  8.545   1.00 43.62 ? 214 LYS A CB    1 
ATOM   1385 C CG    . LYS A 1 176 ? 10.351  13.350  8.510   1.00 46.01 ? 214 LYS A CG    1 
ATOM   1386 C CD    . LYS A 1 176 ? 11.216  12.348  7.773   1.00 51.81 ? 214 LYS A CD    1 
ATOM   1387 C CE    . LYS A 1 176 ? 12.696  12.734  7.828   1.00 52.65 ? 214 LYS A CE    1 
ATOM   1388 N NZ    . LYS A 1 176 ? 12.967  14.069  7.207   1.00 54.86 ? 214 LYS A NZ    1 
ATOM   1389 N N     . ILE A 1 177 ? 5.582   14.159  9.169   1.00 37.53 ? 215 ILE A N     1 
ATOM   1390 C CA    . ILE A 1 177 ? 4.156   13.863  8.855   1.00 35.29 ? 215 ILE A CA    1 
ATOM   1391 C C     . ILE A 1 177 ? 4.019   13.406  7.392   1.00 35.42 ? 215 ILE A C     1 
ATOM   1392 O O     . ILE A 1 177 ? 3.342   12.402  7.077   1.00 35.18 ? 215 ILE A O     1 
ATOM   1393 C CB    . ILE A 1 177 ? 3.260   15.102  9.115   1.00 33.71 ? 215 ILE A CB    1 
ATOM   1394 C CG1   . ILE A 1 177 ? 3.406   15.555  10.588  1.00 34.04 ? 215 ILE A CG1   1 
ATOM   1395 C CG2   . ILE A 1 177 ? 1.774   14.858  8.815   1.00 33.28 ? 215 ILE A CG2   1 
ATOM   1396 C CD1   . ILE A 1 177 ? 2.615   16.809  10.846  1.00 37.27 ? 215 ILE A CD1   1 
ATOM   1397 N N     . PHE A 1 178 ? 4.666   14.147  6.505   1.00 35.61 ? 216 PHE A N     1 
ATOM   1398 C CA    . PHE A 1 178 ? 4.883   13.656  5.144   1.00 36.12 ? 216 PHE A CA    1 
ATOM   1399 C C     . PHE A 1 178 ? 6.332   13.216  5.016   1.00 36.48 ? 216 PHE A C     1 
ATOM   1400 O O     . PHE A 1 178 ? 7.236   14.004  5.271   1.00 37.20 ? 216 PHE A O     1 
ATOM   1401 C CB    . PHE A 1 178 ? 4.592   14.731  4.084   1.00 35.36 ? 216 PHE A CB    1 
ATOM   1402 C CG    . PHE A 1 178 ? 5.050   14.352  2.690   1.00 36.35 ? 216 PHE A CG    1 
ATOM   1403 C CD1   . PHE A 1 178 ? 4.475   13.268  2.017   1.00 36.71 ? 216 PHE A CD1   1 
ATOM   1404 C CD2   . PHE A 1 178 ? 6.077   15.064  2.062   1.00 38.74 ? 216 PHE A CD2   1 
ATOM   1405 C CE1   . PHE A 1 178 ? 4.903   12.938  0.747   1.00 35.51 ? 216 PHE A CE1   1 
ATOM   1406 C CE2   . PHE A 1 178 ? 6.485   14.729  0.750   1.00 37.88 ? 216 PHE A CE2   1 
ATOM   1407 C CZ    . PHE A 1 178 ? 5.913   13.661  0.139   1.00 36.32 ? 216 PHE A CZ    1 
ATOM   1408 N N     . ASP A 1 179 ? 6.539   11.966  4.611   1.00 37.62 ? 217 ASP A N     1 
ATOM   1409 C CA    . ASP A 1 179 ? 7.864   11.375  4.544   1.00 38.59 ? 217 ASP A CA    1 
ATOM   1410 C C     . ASP A 1 179 ? 8.139   10.993  3.114   1.00 39.29 ? 217 ASP A C     1 
ATOM   1411 O O     . ASP A 1 179 ? 7.505   10.082  2.601   1.00 37.51 ? 217 ASP A O     1 
ATOM   1412 C CB    . ASP A 1 179 ? 7.913   10.113  5.431   1.00 39.61 ? 217 ASP A CB    1 
ATOM   1413 C CG    . ASP A 1 179 ? 9.307   9.462   5.509   1.00 44.44 ? 217 ASP A CG    1 
ATOM   1414 O OD1   . ASP A 1 179 ? 10.218  9.783   4.709   1.00 45.32 ? 217 ASP A OD1   1 
ATOM   1415 O OD2   . ASP A 1 179 ? 9.480   8.597   6.393   1.00 48.32 ? 217 ASP A OD2   1 
ATOM   1416 N N     . LYS A 1 180 ? 9.101   11.670  2.500   1.00 40.19 ? 218 LYS A N     1 
ATOM   1417 C CA    . LYS A 1 180 ? 9.409   11.451  1.072   1.00 42.49 ? 218 LYS A CA    1 
ATOM   1418 C C     . LYS A 1 180 ? 9.931   10.052  0.811   1.00 43.13 ? 218 LYS A C     1 
ATOM   1419 O O     . LYS A 1 180 ? 9.875   9.549   -0.338  1.00 43.84 ? 218 LYS A O     1 
ATOM   1420 C CB    . LYS A 1 180 ? 10.424  12.494  0.585   1.00 42.00 ? 218 LYS A CB    1 
ATOM   1421 C CG    . LYS A 1 180 ? 9.864   13.928  0.608   1.00 45.29 ? 218 LYS A CG    1 
ATOM   1422 C CD    . LYS A 1 180 ? 10.704  14.954  -0.184  1.00 45.56 ? 218 LYS A CD    1 
ATOM   1423 C CE    . LYS A 1 180 ? 12.113  15.102  0.400   1.00 48.94 ? 218 LYS A CE    1 
ATOM   1424 N NZ    . LYS A 1 180 ? 12.685  16.460  0.164   1.00 53.41 ? 218 LYS A NZ    1 
ATOM   1425 N N     . ASP A 1 181 ? 10.428  9.418   1.873   1.00 43.45 ? 219 ASP A N     1 
ATOM   1426 C CA    . ASP A 1 181 ? 10.913  8.041   1.794   1.00 44.71 ? 219 ASP A CA    1 
ATOM   1427 C C     . ASP A 1 181 ? 9.866   6.932   1.921   1.00 43.93 ? 219 ASP A C     1 
ATOM   1428 O O     . ASP A 1 181 ? 10.180  5.774   1.670   1.00 45.62 ? 219 ASP A O     1 
ATOM   1429 C CB    . ASP A 1 181 ? 12.038  7.821   2.817   1.00 44.74 ? 219 ASP A CB    1 
ATOM   1430 C CG    . ASP A 1 181 ? 13.302  8.578   2.450   1.00 49.56 ? 219 ASP A CG    1 
ATOM   1431 O OD1   . ASP A 1 181 ? 13.782  8.400   1.304   1.00 56.23 ? 219 ASP A OD1   1 
ATOM   1432 O OD2   . ASP A 1 181 ? 13.803  9.366   3.285   1.00 54.40 ? 219 ASP A OD2   1 
ATOM   1433 N N     . SER A 1 182 ? 8.628   7.262   2.291   1.00 41.98 ? 220 SER A N     1 
ATOM   1434 C CA    . SER A 1 182 ? 7.574   6.269   2.465   1.00 39.73 ? 220 SER A CA    1 
ATOM   1435 C C     . SER A 1 182 ? 7.078   5.786   1.113   1.00 38.98 ? 220 SER A C     1 
ATOM   1436 O O     . SER A 1 182 ? 7.444   6.393   0.093   1.00 38.72 ? 220 SER A O     1 
ATOM   1437 C CB    . SER A 1 182 ? 6.394   6.876   3.233   1.00 39.16 ? 220 SER A CB    1 
ATOM   1438 O OG    . SER A 1 182 ? 5.874   8.010   2.534   1.00 39.03 ? 220 SER A OG    1 
ATOM   1439 N N     . THR A 1 183 ? 6.260   4.742   1.084   1.00 38.45 ? 221 THR A N     1 
ATOM   1440 C CA    . THR A 1 183 ? 5.665   4.301   -0.202  1.00 39.79 ? 221 THR A CA    1 
ATOM   1441 C C     . THR A 1 183 ? 4.787   5.405   -0.724  1.00 38.79 ? 221 THR A C     1 
ATOM   1442 O O     . THR A 1 183 ? 4.759   5.675   -1.934  1.00 36.91 ? 221 THR A O     1 
ATOM   1443 C CB    . THR A 1 183 ? 4.821   3.023   -0.076  1.00 41.10 ? 221 THR A CB    1 
ATOM   1444 O OG1   . THR A 1 183 ? 5.679   1.965   0.367   1.00 43.23 ? 221 THR A OG1   1 
ATOM   1445 C CG2   . THR A 1 183 ? 4.187   2.613   -1.404  1.00 44.73 ? 221 THR A CG2   1 
ATOM   1446 N N     . PHE A 1 184 ? 4.068   6.059   0.191   1.00 35.95 ? 222 PHE A N     1 
ATOM   1447 C CA    . PHE A 1 184 ? 3.217   7.140   -0.267  1.00 36.59 ? 222 PHE A CA    1 
ATOM   1448 C C     . PHE A 1 184 ? 4.059   8.229   -0.952  1.00 35.93 ? 222 PHE A C     1 
ATOM   1449 O O     . PHE A 1 184 ? 3.736   8.697   -2.053  1.00 34.64 ? 222 PHE A O     1 
ATOM   1450 C CB    . PHE A 1 184 ? 2.395   7.718   0.910   1.00 36.09 ? 222 PHE A CB    1 
ATOM   1451 C CG    . PHE A 1 184 ? 1.736   9.030   0.548   1.00 36.03 ? 222 PHE A CG    1 
ATOM   1452 C CD1   . PHE A 1 184 ? 0.751   9.092   -0.478  1.00 34.92 ? 222 PHE A CD1   1 
ATOM   1453 C CD2   . PHE A 1 184 ? 2.135   10.218  1.165   1.00 33.73 ? 222 PHE A CD2   1 
ATOM   1454 C CE1   . PHE A 1 184 ? 0.181   10.315  -0.843  1.00 34.01 ? 222 PHE A CE1   1 
ATOM   1455 C CE2   . PHE A 1 184 ? 1.567   11.439  0.811   1.00 31.88 ? 222 PHE A CE2   1 
ATOM   1456 C CZ    . PHE A 1 184 ? 0.584   11.487  -0.220  1.00 33.23 ? 222 PHE A CZ    1 
ATOM   1457 N N     . GLY A 1 185 ? 5.125   8.682   -0.265  1.00 34.89 ? 223 GLY A N     1 
ATOM   1458 C CA    . GLY A 1 185 ? 5.876   9.820   -0.722  1.00 35.75 ? 223 GLY A CA    1 
ATOM   1459 C C     . GLY A 1 185 ? 6.818   9.525   -1.883  1.00 37.30 ? 223 GLY A C     1 
ATOM   1460 O O     . GLY A 1 185 ? 7.107   10.414  -2.659  1.00 39.12 ? 223 GLY A O     1 
ATOM   1461 N N     . SER A 1 186 ? 7.318   8.295   -1.983  1.00 36.23 ? 224 SER A N     1 
ATOM   1462 C CA    . SER A 1 186 ? 8.360   8.000   -2.974  1.00 37.37 ? 224 SER A CA    1 
ATOM   1463 C C     . SER A 1 186 ? 7.747   7.385   -4.249  1.00 37.58 ? 224 SER A C     1 
ATOM   1464 O O     . SER A 1 186 ? 8.345   7.475   -5.350  1.00 38.16 ? 224 SER A O     1 
ATOM   1465 C CB    . SER A 1 186 ? 9.402   7.049   -2.393  1.00 38.02 ? 224 SER A CB    1 
ATOM   1466 O OG    . SER A 1 186 ? 8.753   5.818   -2.157  1.00 42.43 ? 224 SER A OG    1 
ATOM   1467 N N     . VAL A 1 187 ? 6.565   6.776   -4.109  1.00 35.73 ? 225 VAL A N     1 
ATOM   1468 C CA    . VAL A 1 187 ? 5.897   6.108   -5.215  1.00 35.58 ? 225 VAL A CA    1 
ATOM   1469 C C     . VAL A 1 187 ? 4.502   6.698   -5.538  1.00 35.25 ? 225 VAL A C     1 
ATOM   1470 O O     . VAL A 1 187 ? 4.242   7.106   -6.676  1.00 35.23 ? 225 VAL A O     1 
ATOM   1471 C CB    . VAL A 1 187 ? 5.697   4.561   -4.950  1.00 36.64 ? 225 VAL A CB    1 
ATOM   1472 C CG1   . VAL A 1 187 ? 5.047   3.892   -6.185  1.00 35.77 ? 225 VAL A CG1   1 
ATOM   1473 C CG2   . VAL A 1 187 ? 7.056   3.856   -4.590  1.00 37.70 ? 225 VAL A CG2   1 
ATOM   1474 N N     . GLU A 1 188 ? 3.586   6.666   -4.573  1.00 33.97 ? 226 GLU A N     1 
ATOM   1475 C CA    . GLU A 1 188 ? 2.200   7.052   -4.899  1.00 33.95 ? 226 GLU A CA    1 
ATOM   1476 C C     . GLU A 1 188 ? 2.045   8.498   -5.343  1.00 33.58 ? 226 GLU A C     1 
ATOM   1477 O O     . GLU A 1 188 ? 1.414   8.767   -6.339  1.00 32.95 ? 226 GLU A O     1 
ATOM   1478 C CB    . GLU A 1 188 ? 1.266   6.728   -3.712  1.00 34.58 ? 226 GLU A CB    1 
ATOM   1479 C CG    . GLU A 1 188 ? 1.225   5.197   -3.553  1.00 35.86 ? 226 GLU A CG    1 
ATOM   1480 C CD    . GLU A 1 188 ? 0.453   4.744   -2.330  1.00 42.62 ? 226 GLU A CD    1 
ATOM   1481 O OE1   . GLU A 1 188 ? 0.382   5.492   -1.335  1.00 40.29 ? 226 GLU A OE1   1 
ATOM   1482 O OE2   . GLU A 1 188 ? -0.060  3.614   -2.390  1.00 42.59 ? 226 GLU A OE2   1 
ATOM   1483 N N     . VAL A 1 189 ? 2.695   9.442   -4.663  1.00 33.18 ? 227 VAL A N     1 
ATOM   1484 C CA    . VAL A 1 189 ? 2.580   10.866  -5.077  1.00 33.48 ? 227 VAL A CA    1 
ATOM   1485 C C     . VAL A 1 189 ? 3.006   11.082  -6.527  1.00 34.86 ? 227 VAL A C     1 
ATOM   1486 O O     . VAL A 1 189 ? 2.433   11.920  -7.217  1.00 35.90 ? 227 VAL A O     1 
ATOM   1487 C CB    . VAL A 1 189 ? 3.434   11.804  -4.120  1.00 35.86 ? 227 VAL A CB    1 
ATOM   1488 C CG1   . VAL A 1 189 ? 4.725   11.234  -3.889  1.00 40.53 ? 227 VAL A CG1   1 
ATOM   1489 C CG2   . VAL A 1 189 ? 3.674   13.208  -4.730  1.00 40.12 ? 227 VAL A CG2   1 
ATOM   1490 N N     . HIS A 1 190 ? 3.988   10.308  -6.980  1.00 31.46 ? 228 HIS A N     1 
ATOM   1491 C CA    . HIS A 1 190 ? 4.624   10.556  -8.264  1.00 31.89 ? 228 HIS A CA    1 
ATOM   1492 C C     . HIS A 1 190 ? 3.942   9.729   -9.355  1.00 32.16 ? 228 HIS A C     1 
ATOM   1493 O O     . HIS A 1 190 ? 4.269   9.885   -10.551 1.00 33.71 ? 228 HIS A O     1 
ATOM   1494 C CB    . HIS A 1 190 ? 6.125   10.251  -8.132  1.00 31.75 ? 228 HIS A CB    1 
ATOM   1495 C CG    . HIS A 1 190 ? 6.811   11.226  -7.236  1.00 33.96 ? 228 HIS A CG    1 
ATOM   1496 N ND1   . HIS A 1 190 ? 6.854   12.570  -7.521  1.00 33.62 ? 228 HIS A ND1   1 
ATOM   1497 C CD2   . HIS A 1 190 ? 7.353   11.075  -6.004  1.00 37.31 ? 228 HIS A CD2   1 
ATOM   1498 C CE1   . HIS A 1 190 ? 7.418   13.213  -6.512  1.00 38.00 ? 228 HIS A CE1   1 
ATOM   1499 N NE2   . HIS A 1 190 ? 7.738   12.331  -5.578  1.00 36.42 ? 228 HIS A NE2   1 
ATOM   1500 N N     . ASN A 1 191 ? 2.964   8.913   -8.947  1.00 33.19 ? 229 ASN A N     1 
ATOM   1501 C CA    . ASN A 1 191 ? 2.218   8.096   -9.938  1.00 33.89 ? 229 ASN A CA    1 
ATOM   1502 C C     . ASN A 1 191 ? 0.726   8.381   -10.073 1.00 34.04 ? 229 ASN A C     1 
ATOM   1503 O O     . ASN A 1 191 ? 0.069   7.803   -10.942 1.00 34.73 ? 229 ASN A O     1 
ATOM   1504 C CB    . ASN A 1 191 ? 2.485   6.619   -9.737  1.00 34.69 ? 229 ASN A CB    1 
ATOM   1505 C CG    . ASN A 1 191 ? 3.859   6.266   -10.173 1.00 37.51 ? 229 ASN A CG    1 
ATOM   1506 O OD1   . ASN A 1 191 ? 4.146   6.129   -11.401 1.00 36.66 ? 229 ASN A OD1   1 
ATOM   1507 N ND2   . ASN A 1 191 ? 4.764   6.197   -9.210  1.00 38.41 ? 229 ASN A ND2   1 
ATOM   1508 N N     . LEU A 1 192 ? 0.224   9.317   -9.288  1.00 34.09 ? 230 LEU A N     1 
ATOM   1509 C CA    . LEU A 1 192 ? -1.114  9.912   -9.540  1.00 32.82 ? 230 LEU A CA    1 
ATOM   1510 C C     . LEU A 1 192 ? -1.057  10.562  -10.918 1.00 33.31 ? 230 LEU A C     1 
ATOM   1511 O O     . LEU A 1 192 ? -0.032  11.164  -11.274 1.00 36.23 ? 230 LEU A O     1 
ATOM   1512 C CB    . LEU A 1 192 ? -1.374  10.999  -8.514  1.00 32.98 ? 230 LEU A CB    1 
ATOM   1513 C CG    . LEU A 1 192 ? -1.488  10.431  -7.101  1.00 32.38 ? 230 LEU A CG    1 
ATOM   1514 C CD1   . LEU A 1 192 ? -1.567  11.671  -6.178  1.00 35.07 ? 230 LEU A CD1   1 
ATOM   1515 C CD2   . LEU A 1 192 ? -2.700  9.497   -6.946  1.00 35.64 ? 230 LEU A CD2   1 
ATOM   1516 N N     . GLN A 1 193 ? -2.097  10.415  -11.711 1.00 32.17 ? 231 GLN A N     1 
ATOM   1517 C CA    . GLN A 1 193 ? -2.079  10.925  -13.085 1.00 31.63 ? 231 GLN A CA    1 
ATOM   1518 C C     . GLN A 1 193 ? -2.735  12.286  -13.146 1.00 31.31 ? 231 GLN A C     1 
ATOM   1519 O O     . GLN A 1 193 ? -3.938  12.411  -12.895 1.00 31.98 ? 231 GLN A O     1 
ATOM   1520 C CB    . GLN A 1 193 ? -2.785  9.898   -13.993 1.00 32.58 ? 231 GLN A CB    1 
ATOM   1521 C CG    . GLN A 1 193 ? -2.225  8.504   -13.731 1.00 36.14 ? 231 GLN A CG    1 
ATOM   1522 C CD    . GLN A 1 193 ? -0.922  8.267   -14.460 1.00 46.61 ? 231 GLN A CD    1 
ATOM   1523 O OE1   . GLN A 1 193 ? -0.907  8.230   -15.701 1.00 51.02 ? 231 GLN A OE1   1 
ATOM   1524 N NE2   . GLN A 1 193 ? 0.201   8.085   -13.699 1.00 46.38 ? 231 GLN A NE2   1 
ATOM   1525 N N     . PRO A 1 194 ? -1.945  13.345  -13.410 1.00 32.09 ? 232 PRO A N     1 
ATOM   1526 C CA    . PRO A 1 194 ? -2.533  14.703  -13.370 1.00 33.64 ? 232 PRO A CA    1 
ATOM   1527 C C     . PRO A 1 194 ? -3.664  14.912  -14.349 1.00 34.34 ? 232 PRO A C     1 
ATOM   1528 O O     . PRO A 1 194 ? -4.503  15.778  -14.112 1.00 36.84 ? 232 PRO A O     1 
ATOM   1529 C CB    . PRO A 1 194 ? -1.356  15.622  -13.693 1.00 34.67 ? 232 PRO A CB    1 
ATOM   1530 C CG    . PRO A 1 194 ? -0.101  14.809  -13.261 1.00 36.07 ? 232 PRO A CG    1 
ATOM   1531 C CD    . PRO A 1 194 ? -0.503  13.383  -13.706 1.00 32.04 ? 232 PRO A CD    1 
ATOM   1532 N N     . GLU A 1 195 ? -3.707  14.120  -15.425 1.00 34.61 ? 233 GLU A N     1 
ATOM   1533 C CA    . GLU A 1 195 ? -4.829  14.204  -16.354 1.00 35.78 ? 233 GLU A CA    1 
ATOM   1534 C C     . GLU A 1 195 ? -6.172  13.834  -15.742 1.00 35.05 ? 233 GLU A C     1 
ATOM   1535 O O     . GLU A 1 195 ? -7.195  14.353  -16.216 1.00 35.65 ? 233 GLU A O     1 
ATOM   1536 C CB    . GLU A 1 195 ? -4.587  13.351  -17.597 1.00 35.77 ? 233 GLU A CB    1 
ATOM   1537 C CG    . GLU A 1 195 ? -3.324  13.735  -18.319 1.00 40.81 ? 233 GLU A CG    1 
ATOM   1538 C CD    . GLU A 1 195 ? -2.017  13.164  -17.702 1.00 46.86 ? 233 GLU A CD    1 
ATOM   1539 O OE1   . GLU A 1 195 ? -2.026  12.380  -16.703 1.00 44.11 ? 233 GLU A OE1   1 
ATOM   1540 O OE2   . GLU A 1 195 ? -0.957  13.520  -18.288 1.00 52.90 ? 233 GLU A OE2   1 
ATOM   1541 N N     . LYS A 1 196 ? -6.141  12.963  -14.719 1.00 33.08 ? 234 LYS A N     1 
ATOM   1542 C CA    . LYS A 1 196 ? -7.327  12.311  -14.102 1.00 33.67 ? 234 LYS A CA    1 
ATOM   1543 C C     . LYS A 1 196 ? -7.614  12.862  -12.698 1.00 34.23 ? 234 LYS A C     1 
ATOM   1544 O O     . LYS A 1 196 ? -8.766  12.928  -12.251 1.00 33.37 ? 234 LYS A O     1 
ATOM   1545 C CB    . LYS A 1 196 ? -6.988  10.846  -13.839 1.00 35.51 ? 234 LYS A CB    1 
ATOM   1546 C CG    . LYS A 1 196 ? -7.148  9.857   -14.923 1.00 39.63 ? 234 LYS A CG    1 
ATOM   1547 C CD    . LYS A 1 196 ? -6.230  8.674   -14.704 1.00 45.84 ? 234 LYS A CD    1 
ATOM   1548 C CE    . LYS A 1 196 ? -6.769  7.617   -13.781 1.00 46.30 ? 234 LYS A CE    1 
ATOM   1549 N NZ    . LYS A 1 196 ? -6.429  6.289   -14.355 1.00 47.63 ? 234 LYS A NZ    1 
ATOM   1550 N N     . VAL A 1 197 ? -6.538  13.154  -11.982 1.00 33.24 ? 235 VAL A N     1 
ATOM   1551 C CA    . VAL A 1 197 ? -6.643  13.534  -10.567 1.00 32.00 ? 235 VAL A CA    1 
ATOM   1552 C C     . VAL A 1 197 ? -6.747  15.045  -10.412 1.00 32.44 ? 235 VAL A C     1 
ATOM   1553 O O     . VAL A 1 197 ? -5.842  15.769  -10.804 1.00 33.13 ? 235 VAL A O     1 
ATOM   1554 C CB    . VAL A 1 197 ? -5.463  12.977  -9.749  1.00 30.95 ? 235 VAL A CB    1 
ATOM   1555 C CG1   . VAL A 1 197 ? -5.496  13.495  -8.210  1.00 31.74 ? 235 VAL A CG1   1 
ATOM   1556 C CG2   . VAL A 1 197 ? -5.511  11.460  -9.773  1.00 35.31 ? 235 VAL A CG2   1 
ATOM   1557 N N     . GLN A 1 198 ? -7.835  15.481  -9.765  1.00 33.06 ? 236 GLN A N     1 
ATOM   1558 C CA    . GLN A 1 198 ? -8.117  16.888  -9.589  1.00 33.60 ? 236 GLN A CA    1 
ATOM   1559 C C     . GLN A 1 198 ? -7.400  17.369  -8.334  1.00 32.34 ? 236 GLN A C     1 
ATOM   1560 O O     . GLN A 1 198 ? -6.754  18.423  -8.370  1.00 32.57 ? 236 GLN A O     1 
ATOM   1561 C CB    . GLN A 1 198 ? -9.633  17.115  -9.435  1.00 34.54 ? 236 GLN A CB    1 
ATOM   1562 C CG    . GLN A 1 198 ? -9.973  18.614  -9.491  1.00 38.52 ? 236 GLN A CG    1 
ATOM   1563 C CD    . GLN A 1 198 ? -11.176 18.983  -8.627  1.00 41.71 ? 236 GLN A CD    1 
ATOM   1564 O OE1   . GLN A 1 198 ? -11.427 18.411  -7.536  1.00 42.02 ? 236 GLN A OE1   1 
ATOM   1565 N NE2   . GLN A 1 198 ? -11.924 19.957  -9.110  1.00 41.66 ? 236 GLN A NE2   1 
ATOM   1566 N N     . THR A 1 199 ? -7.525  16.616  -7.265  1.00 33.10 ? 237 THR A N     1 
ATOM   1567 C CA    . THR A 1 199 ? -7.121  17.101  -5.934  1.00 31.36 ? 237 THR A CA    1 
ATOM   1568 C C     . THR A 1 199 ? -6.553  15.944  -5.157  1.00 32.17 ? 237 THR A C     1 
ATOM   1569 O O     . THR A 1 199 ? -7.102  14.831  -5.179  1.00 31.96 ? 237 THR A O     1 
ATOM   1570 C CB    . THR A 1 199 ? -8.340  17.633  -5.176  1.00 32.07 ? 237 THR A CB    1 
ATOM   1571 O OG1   . THR A 1 199 ? -8.909  18.726  -5.899  1.00 34.80 ? 237 THR A OG1   1 
ATOM   1572 C CG2   . THR A 1 199 ? -7.950  18.180  -3.759  1.00 33.80 ? 237 THR A CG2   1 
ATOM   1573 N N     . LEU A 1 200 ? -5.478  16.223  -4.412  1.00 31.86 ? 238 LEU A N     1 
ATOM   1574 C CA    . LEU A 1 200 ? -5.094  15.386  -3.293  1.00 31.79 ? 238 LEU A CA    1 
ATOM   1575 C C     . LEU A 1 200 ? -5.435  16.068  -1.987  1.00 32.48 ? 238 LEU A C     1 
ATOM   1576 O O     . LEU A 1 200 ? -4.989  17.183  -1.754  1.00 32.41 ? 238 LEU A O     1 
ATOM   1577 C CB    . LEU A 1 200 ? -3.583  15.081  -3.306  1.00 31.83 ? 238 LEU A CB    1 
ATOM   1578 C CG    . LEU A 1 200 ? -3.100  14.130  -2.179  1.00 33.85 ? 238 LEU A CG    1 
ATOM   1579 C CD1   . LEU A 1 200 ? -3.534  12.698  -2.380  1.00 37.00 ? 238 LEU A CD1   1 
ATOM   1580 C CD2   . LEU A 1 200 ? -1.594  14.165  -1.997  1.00 36.16 ? 238 LEU A CD2   1 
ATOM   1581 N N     . GLU A 1 201 ? -6.273  15.396  -1.205  1.00 31.67 ? 239 GLU A N     1 
ATOM   1582 C CA    . GLU A 1 201 ? -6.679  15.931  0.111   1.00 32.97 ? 239 GLU A CA    1 
ATOM   1583 C C     . GLU A 1 201 ? -6.056  15.110  1.232   1.00 32.83 ? 239 GLU A C     1 
ATOM   1584 O O     . GLU A 1 201 ? -6.340  13.892  1.362   1.00 33.46 ? 239 GLU A O     1 
ATOM   1585 C CB    . GLU A 1 201 ? -8.176  15.941  0.268   1.00 32.64 ? 239 GLU A CB    1 
ATOM   1586 C CG    . GLU A 1 201 ? -8.530  16.550  1.665   1.00 38.47 ? 239 GLU A CG    1 
ATOM   1587 C CD    . GLU A 1 201 ? -9.954  16.965  1.757   1.00 43.78 ? 239 GLU A CD    1 
ATOM   1588 O OE1   . GLU A 1 201 ? -10.778 16.194  2.297   1.00 43.33 ? 239 GLU A OE1   1 
ATOM   1589 O OE2   . GLU A 1 201 ? -10.246 18.063  1.263   1.00 46.35 ? 239 GLU A OE2   1 
ATOM   1590 N N     . ALA A 1 202 ? -5.241  15.775  2.082   1.00 32.66 ? 240 ALA A N     1 
ATOM   1591 C CA    . ALA A 1 202 ? -4.565  15.060  3.156   1.00 31.80 ? 240 ALA A CA    1 
ATOM   1592 C C     . ALA A 1 202 ? -5.363  15.282  4.414   1.00 32.81 ? 240 ALA A C     1 
ATOM   1593 O O     . ALA A 1 202 ? -5.838  16.381  4.633   1.00 32.25 ? 240 ALA A O     1 
ATOM   1594 C CB    . ALA A 1 202 ? -3.146  15.566  3.330   1.00 33.21 ? 240 ALA A CB    1 
ATOM   1595 N N     . TRP A 1 203 ? -5.531  14.215  5.177   1.00 31.29 ? 241 TRP A N     1 
ATOM   1596 C CA    . TRP A 1 203 ? -6.110  14.279  6.496   1.00 30.98 ? 241 TRP A CA    1 
ATOM   1597 C C     . TRP A 1 203 ? -4.991  13.978  7.475   1.00 31.42 ? 241 TRP A C     1 
ATOM   1598 O O     . TRP A 1 203 ? -4.501  12.855  7.584   1.00 31.81 ? 241 TRP A O     1 
ATOM   1599 C CB    . TRP A 1 203 ? -7.238  13.273  6.682   1.00 32.98 ? 241 TRP A CB    1 
ATOM   1600 C CG    . TRP A 1 203 ? -8.438  13.452  5.795   1.00 33.41 ? 241 TRP A CG    1 
ATOM   1601 C CD1   . TRP A 1 203 ? -8.797  14.555  5.085   1.00 33.65 ? 241 TRP A CD1   1 
ATOM   1602 C CD2   . TRP A 1 203 ? -9.476  12.475  5.594   1.00 36.81 ? 241 TRP A CD2   1 
ATOM   1603 N NE1   . TRP A 1 203 ? -10.003 14.320  4.427   1.00 36.38 ? 241 TRP A NE1   1 
ATOM   1604 C CE2   . TRP A 1 203 ? -10.415 13.039  4.700   1.00 36.47 ? 241 TRP A CE2   1 
ATOM   1605 C CE3   . TRP A 1 203 ? -9.666  11.160  6.044   1.00 37.02 ? 241 TRP A CE3   1 
ATOM   1606 C CZ2   . TRP A 1 203 ? -11.560 12.337  4.267   1.00 36.76 ? 241 TRP A CZ2   1 
ATOM   1607 C CZ3   . TRP A 1 203 ? -10.813 10.440  5.609   1.00 36.75 ? 241 TRP A CZ3   1 
ATOM   1608 C CH2   . TRP A 1 203 ? -11.739 11.045  4.734   1.00 36.30 ? 241 TRP A CH2   1 
ATOM   1609 N N     . VAL A 1 204 ? -4.613  14.992  8.242   1.00 30.66 ? 242 VAL A N     1 
ATOM   1610 C CA    . VAL A 1 204 ? -3.518  14.851  9.172   1.00 29.57 ? 242 VAL A CA    1 
ATOM   1611 C C     . VAL A 1 204 ? -4.063  14.416  10.534  1.00 30.89 ? 242 VAL A C     1 
ATOM   1612 O O     . VAL A 1 204 ? -4.765  15.192  11.184  1.00 31.81 ? 242 VAL A O     1 
ATOM   1613 C CB    . VAL A 1 204 ? -2.718  16.207  9.315   1.00 27.60 ? 242 VAL A CB    1 
ATOM   1614 C CG1   . VAL A 1 204 ? -1.616  16.047  10.388  1.00 32.68 ? 242 VAL A CG1   1 
ATOM   1615 C CG2   . VAL A 1 204 ? -2.112  16.635  7.957   1.00 30.05 ? 242 VAL A CG2   1 
ATOM   1616 N N     . ILE A 1 205 ? -3.731  13.195  10.940  1.00 30.48 ? 243 ILE A N     1 
ATOM   1617 C CA    . ILE A 1 205 ? -4.357  12.557  12.087  1.00 32.55 ? 243 ILE A CA    1 
ATOM   1618 C C     . ILE A 1 205 ? -3.543  12.954  13.317  1.00 32.52 ? 243 ILE A C     1 
ATOM   1619 O O     . ILE A 1 205 ? -2.351  12.637  13.419  1.00 32.42 ? 243 ILE A O     1 
ATOM   1620 C CB    . ILE A 1 205 ? -4.410  11.025  11.963  1.00 32.46 ? 243 ILE A CB    1 
ATOM   1621 C CG1   . ILE A 1 205 ? -4.993  10.606  10.586  1.00 34.36 ? 243 ILE A CG1   1 
ATOM   1622 C CG2   . ILE A 1 205 ? -5.195  10.405  13.128  1.00 33.02 ? 243 ILE A CG2   1 
ATOM   1623 C CD1   . ILE A 1 205 ? -6.353  11.165  10.276  1.00 33.38 ? 243 ILE A CD1   1 
ATOM   1624 N N     . HIS A 1 206 ? -4.184  13.620  14.253  1.00 35.03 ? 244 HIS A N     1 
ATOM   1625 C CA    . HIS A 1 206 ? -3.463  13.993  15.469  1.00 36.62 ? 244 HIS A CA    1 
ATOM   1626 C C     . HIS A 1 206 ? -3.241  12.798  16.417  1.00 39.14 ? 244 HIS A C     1 
ATOM   1627 O O     . HIS A 1 206 ? -4.043  11.864  16.458  1.00 38.01 ? 244 HIS A O     1 
ATOM   1628 C CB    . HIS A 1 206 ? -4.186  15.133  16.201  1.00 36.35 ? 244 HIS A CB    1 
ATOM   1629 C CG    . HIS A 1 206 ? -3.958  16.501  15.619  1.00 35.09 ? 244 HIS A CG    1 
ATOM   1630 N ND1   . HIS A 1 206 ? -4.104  16.794  14.274  1.00 34.63 ? 244 HIS A ND1   1 
ATOM   1631 C CD2   . HIS A 1 206 ? -3.655  17.673  16.224  1.00 31.32 ? 244 HIS A CD2   1 
ATOM   1632 C CE1   . HIS A 1 206 ? -3.874  18.082  14.077  1.00 30.82 ? 244 HIS A CE1   1 
ATOM   1633 N NE2   . HIS A 1 206 ? -3.603  18.639  15.249  1.00 36.78 ? 244 HIS A NE2   1 
ATOM   1634 N N     . GLY A 1 207 ? -2.158  12.854  17.198  1.00 42.10 ? 245 GLY A N     1 
ATOM   1635 C CA    . GLY A 1 207 ? -1.877  11.834  18.216  1.00 45.15 ? 245 GLY A CA    1 
ATOM   1636 C C     . GLY A 1 207 ? -1.965  12.481  19.573  1.00 48.05 ? 245 GLY A C     1 
ATOM   1637 O O     . GLY A 1 207 ? -1.802  11.826  20.619  1.00 48.68 ? 245 GLY A O     1 
ATOM   1638 N N     . GLY A 1 208 ? -2.247  13.782  19.539  1.00 49.79 ? 246 GLY A N     1 
ATOM   1639 C CA    . GLY A 1 208 ? -2.084  14.644  20.678  1.00 51.93 ? 246 GLY A CA    1 
ATOM   1640 C C     . GLY A 1 208 ? -3.081  14.392  21.776  1.00 53.47 ? 246 GLY A C     1 
ATOM   1641 O O     . GLY A 1 208 ? -3.961  13.526  21.672  1.00 54.23 ? 246 GLY A O     1 
ATOM   1642 N N     . ARG A 1 209 ? -2.902  15.152  22.844  1.00 54.42 ? 247 ARG A N     1 
ATOM   1643 C CA    . ARG A 1 209 ? -3.857  15.239  23.915  1.00 55.78 ? 247 ARG A CA    1 
ATOM   1644 C C     . ARG A 1 209 ? -4.529  16.601  23.737  1.00 55.82 ? 247 ARG A C     1 
ATOM   1645 O O     . ARG A 1 209 ? -4.118  17.590  24.350  1.00 56.39 ? 247 ARG A O     1 
ATOM   1646 C CB    . ARG A 1 209 ? -3.129  15.131  25.256  1.00 55.58 ? 247 ARG A CB    1 
ATOM   1647 C CG    . ARG A 1 209 ? -4.021  14.919  26.484  1.00 56.76 ? 247 ARG A CG    1 
ATOM   1648 C CD    . ARG A 1 209 ? -3.227  15.013  27.767  1.00 56.63 ? 247 ARG A CD    1 
ATOM   1649 N NE    . ARG A 1 209 ? -3.758  14.099  28.778  1.00 59.33 ? 247 ARG A NE    1 
ATOM   1650 C CZ    . ARG A 1 209 ? -3.359  14.038  30.050  1.00 60.04 ? 247 ARG A CZ    1 
ATOM   1651 N NH1   . ARG A 1 209 ? -2.415  14.853  30.514  1.00 61.23 ? 247 ARG A NH1   1 
ATOM   1652 N NH2   . ARG A 1 209 ? -3.916  13.155  30.870  1.00 59.86 ? 247 ARG A NH2   1 
ATOM   1653 N N     . GLU A 1 210 ? -5.524  16.643  22.848  1.00 55.75 ? 248 GLU A N     1 
ATOM   1654 C CA    . GLU A 1 210 ? -6.446  17.789  22.682  1.00 55.71 ? 248 GLU A CA    1 
ATOM   1655 C C     . GLU A 1 210 ? -6.014  18.935  21.728  1.00 54.97 ? 248 GLU A C     1 
ATOM   1656 O O     . GLU A 1 210 ? -5.881  18.728  20.493  1.00 54.95 ? 248 GLU A O     1 
ATOM   1657 C CB    . GLU A 1 210 ? -6.875  18.366  24.046  1.00 55.99 ? 248 GLU A CB    1 
ATOM   1658 C CG    . GLU A 1 210 ? -7.263  17.333  25.099  1.00 57.92 ? 248 GLU A CG    1 
ATOM   1659 C CD    . GLU A 1 210 ? -6.781  17.708  26.496  1.00 60.14 ? 248 GLU A CD    1 
ATOM   1660 O OE1   . GLU A 1 210 ? -6.661  18.919  26.799  1.00 61.46 ? 248 GLU A OE1   1 
ATOM   1661 O OE2   . GLU A 1 210 ? -6.526  16.785  27.301  1.00 61.71 ? 248 GLU A OE2   1 
ATOM   1662 N N     . ASP A 1 211 ? -5.798  20.120  22.325  1.00 53.78 ? 249 ASP A N     1 
ATOM   1663 C CA    . ASP A 1 211 ? -5.822  21.437  21.640  1.00 52.24 ? 249 ASP A CA    1 
ATOM   1664 C C     . ASP A 1 211 ? -4.570  21.811  20.821  1.00 50.74 ? 249 ASP A C     1 
ATOM   1665 O O     . ASP A 1 211 ? -3.984  22.899  20.975  1.00 50.43 ? 249 ASP A O     1 
ATOM   1666 C CB    . ASP A 1 211 ? -6.226  22.556  22.634  1.00 52.50 ? 249 ASP A CB    1 
ATOM   1667 C CG    . ASP A 1 211 ? -5.184  22.805  23.734  1.00 53.83 ? 249 ASP A CG    1 
ATOM   1668 O OD1   . ASP A 1 211 ? -5.334  22.246  24.844  1.00 54.74 ? 249 ASP A OD1   1 
ATOM   1669 O OD2   . ASP A 1 211 ? -4.237  23.590  23.504  1.00 54.16 ? 249 ASP A OD2   1 
ATOM   1670 N N     . SER A 1 212 ? -4.221  20.925  19.896  1.00 48.28 ? 250 SER A N     1 
ATOM   1671 C CA    . SER A 1 212 ? -2.927  20.938  19.254  1.00 46.18 ? 250 SER A CA    1 
ATOM   1672 C C     . SER A 1 212 ? -2.840  21.984  18.123  1.00 44.39 ? 250 SER A C     1 
ATOM   1673 O O     . SER A 1 212 ? -3.795  22.707  17.815  1.00 43.74 ? 250 SER A O     1 
ATOM   1674 C CB    . SER A 1 212 ? -2.612  19.513  18.724  1.00 46.59 ? 250 SER A CB    1 
ATOM   1675 O OG    . SER A 1 212 ? -1.218  19.296  18.504  1.00 46.19 ? 250 SER A OG    1 
ATOM   1676 N N     . ARG A 1 213 ? -1.665  22.016  17.508  1.00 42.19 ? 251 ARG A N     1 
ATOM   1677 C CA    . ARG A 1 213 ? -1.311  22.895  16.401  1.00 39.09 ? 251 ARG A CA    1 
ATOM   1678 C C     . ARG A 1 213 ? -2.157  22.633  15.160  1.00 37.75 ? 251 ARG A C     1 
ATOM   1679 O O     . ARG A 1 213 ? -2.786  21.587  15.052  1.00 36.01 ? 251 ARG A O     1 
ATOM   1680 C CB    . ARG A 1 213 ? 0.165   22.672  16.046  1.00 40.05 ? 251 ARG A CB    1 
ATOM   1681 C CG    . ARG A 1 213 ? 1.145   22.596  17.249  1.00 41.14 ? 251 ARG A CG    1 
ATOM   1682 C CD    . ARG A 1 213 ? 1.257   21.181  17.799  1.00 42.50 ? 251 ARG A CD    1 
ATOM   1683 N NE    . ARG A 1 213 ? 2.492   20.495  17.421  1.00 46.98 ? 251 ARG A NE    1 
ATOM   1684 C CZ    . ARG A 1 213 ? 2.592   19.178  17.232  1.00 49.98 ? 251 ARG A CZ    1 
ATOM   1685 N NH1   . ARG A 1 213 ? 1.528   18.386  17.366  1.00 48.82 ? 251 ARG A NH1   1 
ATOM   1686 N NH2   . ARG A 1 213 ? 3.764   18.646  16.907  1.00 52.42 ? 251 ARG A NH2   1 
ATOM   1687 N N     . ASP A 1 214 ? -2.188  23.610  14.262  1.00 34.90 ? 252 ASP A N     1 
ATOM   1688 C CA    . ASP A 1 214 ? -2.683  23.371  12.910  1.00 34.84 ? 252 ASP A CA    1 
ATOM   1689 C C     . ASP A 1 214 ? -1.520  22.718  12.164  1.00 34.65 ? 252 ASP A C     1 
ATOM   1690 O O     . ASP A 1 214 ? -0.583  23.401  11.727  1.00 34.97 ? 252 ASP A O     1 
ATOM   1691 C CB    . ASP A 1 214 ? -3.107  24.691  12.275  1.00 34.74 ? 252 ASP A CB    1 
ATOM   1692 C CG    . ASP A 1 214 ? -3.514  24.533  10.804  1.00 35.33 ? 252 ASP A CG    1 
ATOM   1693 O OD1   . ASP A 1 214 ? -3.629  23.391  10.329  1.00 39.89 ? 252 ASP A OD1   1 
ATOM   1694 O OD2   . ASP A 1 214 ? -3.714  25.554  10.117  1.00 38.63 ? 252 ASP A OD2   1 
ATOM   1695 N N     . LEU A 1 215 ? -1.577  21.389  12.016  1.00 33.46 ? 253 LEU A N     1 
ATOM   1696 C CA    . LEU A 1 215 ? -0.486  20.614  11.411  1.00 33.35 ? 253 LEU A CA    1 
ATOM   1697 C C     . LEU A 1 215 ? -0.504  20.648  9.877   1.00 32.89 ? 253 LEU A C     1 
ATOM   1698 O O     . LEU A 1 215 ? 0.439   20.204  9.234   1.00 33.31 ? 253 LEU A O     1 
ATOM   1699 C CB    . LEU A 1 215 ? -0.485  19.166  11.906  1.00 32.29 ? 253 LEU A CB    1 
ATOM   1700 C CG    . LEU A 1 215 ? -0.286  18.987  13.417  1.00 33.19 ? 253 LEU A CG    1 
ATOM   1701 C CD1   . LEU A 1 215 ? -0.308  17.513  13.831  1.00 33.59 ? 253 LEU A CD1   1 
ATOM   1702 C CD2   . LEU A 1 215 ? 1.020   19.652  13.885  1.00 31.69 ? 253 LEU A CD2   1 
ATOM   1703 N N     . CYS A 1 216 ? -1.545  21.245  9.324   1.00 32.59 ? 254 CYS A N     1 
ATOM   1704 C CA    . CYS A 1 216 ? -1.548  21.555  7.904   1.00 35.25 ? 254 CYS A CA    1 
ATOM   1705 C C     . CYS A 1 216 ? -0.496  22.610  7.549   1.00 34.88 ? 254 CYS A C     1 
ATOM   1706 O O     . CYS A 1 216 ? -0.179  22.776  6.358   1.00 35.19 ? 254 CYS A O     1 
ATOM   1707 C CB    . CYS A 1 216 ? -2.951  21.919  7.446   1.00 34.84 ? 254 CYS A CB    1 
ATOM   1708 S SG    . CYS A 1 216 ? -3.953  20.389  7.358   1.00 44.61 ? 254 CYS A SG    1 
ATOM   1709 N N     . GLN A 1 217 ? 0.067   23.281  8.564   1.00 32.99 ? 255 GLN A N     1 
ATOM   1710 C CA    . GLN A 1 217 ? 1.175   24.225  8.371   1.00 33.12 ? 255 GLN A CA    1 
ATOM   1711 C C     . GLN A 1 217 ? 2.555   23.627  8.601   1.00 32.45 ? 255 GLN A C     1 
ATOM   1712 O O     . GLN A 1 217 ? 3.571   24.366  8.600   1.00 33.87 ? 255 GLN A O     1 
ATOM   1713 C CB    . GLN A 1 217 ? 1.026   25.445  9.300   1.00 32.84 ? 255 GLN A CB    1 
ATOM   1714 C CG    . GLN A 1 217 ? -0.336  26.091  9.294   1.00 37.45 ? 255 GLN A CG    1 
ATOM   1715 C CD    . GLN A 1 217 ? -0.798  26.520  7.925   1.00 44.13 ? 255 GLN A CD    1 
ATOM   1716 O OE1   . GLN A 1 217 ? -0.036  27.092  7.141   1.00 48.19 ? 255 GLN A OE1   1 
ATOM   1717 N NE2   . GLN A 1 217 ? -2.065  26.259  7.628   1.00 45.82 ? 255 GLN A NE2   1 
ATOM   1718 N N     . ASP A 1 218 ? 2.604   22.332  8.864   1.00 30.77 ? 256 ASP A N     1 
ATOM   1719 C CA    . ASP A 1 218 ? 3.852   21.660  9.108   1.00 31.18 ? 256 ASP A CA    1 
ATOM   1720 C C     . ASP A 1 218 ? 4.781   21.751  7.895   1.00 32.80 ? 256 ASP A C     1 
ATOM   1721 O O     . ASP A 1 218 ? 4.314   21.528  6.743   1.00 32.82 ? 256 ASP A O     1 
ATOM   1722 C CB    . ASP A 1 218 ? 3.577   20.214  9.468   1.00 30.89 ? 256 ASP A CB    1 
ATOM   1723 C CG    . ASP A 1 218 ? 4.834   19.465  9.828   1.00 33.82 ? 256 ASP A CG    1 
ATOM   1724 O OD1   . ASP A 1 218 ? 5.437   18.832  8.949   1.00 41.76 ? 256 ASP A OD1   1 
ATOM   1725 O OD2   . ASP A 1 218 ? 5.234   19.524  10.996  1.00 41.46 ? 256 ASP A OD2   1 
ATOM   1726 N N     . PRO A 1 219 ? 6.074   22.043  8.112   1.00 32.26 ? 257 PRO A N     1 
ATOM   1727 C CA    . PRO A 1 219 ? 6.954   22.159  6.937   1.00 33.48 ? 257 PRO A CA    1 
ATOM   1728 C C     . PRO A 1 219 ? 6.890   20.989  5.987   1.00 34.26 ? 257 PRO A C     1 
ATOM   1729 O O     . PRO A 1 219 ? 7.017   21.172  4.749   1.00 34.24 ? 257 PRO A O     1 
ATOM   1730 C CB    . PRO A 1 219 ? 8.343   22.225  7.552   1.00 33.04 ? 257 PRO A CB    1 
ATOM   1731 C CG    . PRO A 1 219 ? 8.099   22.926  8.886   1.00 33.36 ? 257 PRO A CG    1 
ATOM   1732 C CD    . PRO A 1 219 ? 6.788   22.371  9.372   1.00 33.69 ? 257 PRO A CD    1 
ATOM   1733 N N     . THR A 1 220 ? 6.732   19.774  6.517   1.00 34.52 ? 258 THR A N     1 
ATOM   1734 C CA    . THR A 1 220 ? 6.661   18.620  5.598   1.00 34.02 ? 258 THR A CA    1 
ATOM   1735 C C     . THR A 1 220 ? 5.356   18.594  4.780   1.00 34.39 ? 258 THR A C     1 
ATOM   1736 O O     . THR A 1 220 ? 5.337   18.100  3.607   1.00 33.69 ? 258 THR A O     1 
ATOM   1737 C CB    . THR A 1 220 ? 6.924   17.243  6.253   1.00 34.92 ? 258 THR A CB    1 
ATOM   1738 O OG1   . THR A 1 220 ? 5.817   16.832  7.066   1.00 34.75 ? 258 THR A OG1   1 
ATOM   1739 C CG2   . THR A 1 220 ? 8.249   17.197  7.026   1.00 35.16 ? 258 THR A CG2   1 
ATOM   1740 N N     . ILE A 1 221 ? 4.285   19.158  5.342   1.00 33.31 ? 259 ILE A N     1 
ATOM   1741 C CA    . ILE A 1 221 ? 3.016   19.300  4.599   1.00 34.02 ? 259 ILE A CA    1 
ATOM   1742 C C     . ILE A 1 221 ? 3.138   20.372  3.510   1.00 34.15 ? 259 ILE A C     1 
ATOM   1743 O O     . ILE A 1 221 ? 2.590   20.260  2.424   1.00 33.43 ? 259 ILE A O     1 
ATOM   1744 C CB    . ILE A 1 221 ? 1.837   19.636  5.545   1.00 32.52 ? 259 ILE A CB    1 
ATOM   1745 C CG1   . ILE A 1 221 ? 1.613   18.446  6.490   1.00 32.30 ? 259 ILE A CG1   1 
ATOM   1746 C CG2   . ILE A 1 221 ? 0.558   20.005  4.692   1.00 32.63 ? 259 ILE A CG2   1 
ATOM   1747 C CD1   . ILE A 1 221 ? 1.139   17.090  5.816   1.00 36.57 ? 259 ILE A CD1   1 
ATOM   1748 N N     . LYS A 1 222 ? 3.891   21.420  3.808   1.00 32.64 ? 260 LYS A N     1 
ATOM   1749 C CA    . LYS A 1 222 ? 4.117   22.420  2.798   1.00 33.57 ? 260 LYS A CA    1 
ATOM   1750 C C     . LYS A 1 222 ? 4.929   21.817  1.647   1.00 34.19 ? 260 LYS A C     1 
ATOM   1751 O O     . LYS A 1 222 ? 4.774   22.196  0.501   1.00 33.96 ? 260 LYS A O     1 
ATOM   1752 C CB    . LYS A 1 222 ? 4.802   23.632  3.418   1.00 34.50 ? 260 LYS A CB    1 
ATOM   1753 C CG    . LYS A 1 222 ? 3.860   24.370  4.350   1.00 36.35 ? 260 LYS A CG    1 
ATOM   1754 C CD    . LYS A 1 222 ? 2.616   24.827  3.620   1.00 42.45 ? 260 LYS A CD    1 
ATOM   1755 C CE    . LYS A 1 222 ? 2.016   26.104  4.171   1.00 48.42 ? 260 LYS A CE    1 
ATOM   1756 N NZ    . LYS A 1 222 ? 0.823   26.381  3.334   1.00 53.22 ? 260 LYS A NZ    1 
ATOM   1757 N N     . GLU A 1 223 ? 5.800   20.890  1.984   1.00 33.47 ? 261 GLU A N     1 
ATOM   1758 C CA    . GLU A 1 223 ? 6.624   20.228  0.990   1.00 33.96 ? 261 GLU A CA    1 
ATOM   1759 C C     . GLU A 1 223 ? 5.700   19.424  0.080   1.00 32.70 ? 261 GLU A C     1 
ATOM   1760 O O     . GLU A 1 223 ? 5.747   19.537  -1.159  1.00 32.05 ? 261 GLU A O     1 
ATOM   1761 C CB    . GLU A 1 223 ? 7.536   19.290  1.752   1.00 34.82 ? 261 GLU A CB    1 
ATOM   1762 C CG    . GLU A 1 223 ? 8.649   18.623  1.036   1.00 41.82 ? 261 GLU A CG    1 
ATOM   1763 C CD    . GLU A 1 223 ? 9.467   17.795  2.016   1.00 48.55 ? 261 GLU A CD    1 
ATOM   1764 O OE1   . GLU A 1 223 ? 8.992   16.705  2.420   1.00 52.88 ? 261 GLU A OE1   1 
ATOM   1765 O OE2   . GLU A 1 223 ? 10.551  18.256  2.441   1.00 53.08 ? 261 GLU A OE2   1 
ATOM   1766 N N     . LEU A 1 224 ? 4.844   18.643  0.702   1.00 31.61 ? 262 LEU A N     1 
ATOM   1767 C CA    . LEU A 1 224 ? 3.877   17.813  -0.077  1.00 31.18 ? 262 LEU A CA    1 
ATOM   1768 C C     . LEU A 1 224 ? 3.005   18.715  -0.940  1.00 31.24 ? 262 LEU A C     1 
ATOM   1769 O O     . LEU A 1 224 ? 2.734   18.413  -2.099  1.00 32.37 ? 262 LEU A O     1 
ATOM   1770 C CB    . LEU A 1 224 ? 2.964   17.026  0.865   1.00 30.16 ? 262 LEU A CB    1 
ATOM   1771 C CG    . LEU A 1 224 ? 1.778   16.250  0.256   1.00 30.89 ? 262 LEU A CG    1 
ATOM   1772 C CD1   . LEU A 1 224 ? 2.323   15.272  -0.810  1.00 32.76 ? 262 LEU A CD1   1 
ATOM   1773 C CD2   . LEU A 1 224 ? 0.982   15.477  1.316   1.00 30.85 ? 262 LEU A CD2   1 
ATOM   1774 N N     . GLU A 1 225 ? 2.545   19.838  -0.379  1.00 31.39 ? 263 GLU A N     1 
ATOM   1775 C CA    . GLU A 1 225 ? 1.754   20.769  -1.166  1.00 31.19 ? 263 GLU A CA    1 
ATOM   1776 C C     . GLU A 1 225 ? 2.496   21.261  -2.392  1.00 29.79 ? 263 GLU A C     1 
ATOM   1777 O O     . GLU A 1 225 ? 1.921   21.348  -3.516  1.00 32.44 ? 263 GLU A O     1 
ATOM   1778 C CB    . GLU A 1 225 ? 1.413   21.982  -0.288  1.00 31.00 ? 263 GLU A CB    1 
ATOM   1779 C CG    . GLU A 1 225 ? 0.626   23.025  -1.051  1.00 32.35 ? 263 GLU A CG    1 
ATOM   1780 C CD    . GLU A 1 225 ? 0.284   24.208  -0.169  1.00 37.87 ? 263 GLU A CD    1 
ATOM   1781 O OE1   . GLU A 1 225 ? 1.214   24.752  0.485   1.00 39.37 ? 263 GLU A OE1   1 
ATOM   1782 O OE2   . GLU A 1 225 ? -0.912  24.588  -0.152  1.00 41.15 ? 263 GLU A OE2   1 
ATOM   1783 N N     . SER A 1 226 ? 3.768   21.609  -2.213  1.00 30.43 ? 264 SER A N     1 
ATOM   1784 C CA    . SER A 1 226 ? 4.593   22.132  -3.305  1.00 31.26 ? 264 SER A CA    1 
ATOM   1785 C C     . SER A 1 226 ? 4.738   21.054  -4.365  1.00 30.93 ? 264 SER A C     1 
ATOM   1786 O O     . SER A 1 226 ? 4.588   21.321  -5.593  1.00 31.18 ? 264 SER A O     1 
ATOM   1787 C CB    . SER A 1 226 ? 5.986   22.451  -2.793  1.00 31.85 ? 264 SER A CB    1 
ATOM   1788 O OG    . SER A 1 226 ? 6.828   22.974  -3.801  1.00 34.89 ? 264 SER A OG    1 
ATOM   1789 N N     . ILE A 1 227 ? 5.075   19.850  -3.916  1.00 30.83 ? 265 ILE A N     1 
ATOM   1790 C CA    . ILE A 1 227 ? 5.285   18.744  -4.891  1.00 31.36 ? 265 ILE A CA    1 
ATOM   1791 C C     . ILE A 1 227 ? 4.011   18.527  -5.695  1.00 33.16 ? 265 ILE A C     1 
ATOM   1792 O O     . ILE A 1 227 ? 4.005   18.459  -6.958  1.00 31.85 ? 265 ILE A O     1 
ATOM   1793 C CB    . ILE A 1 227 ? 5.736   17.459  -4.198  1.00 30.92 ? 265 ILE A CB    1 
ATOM   1794 C CG1   . ILE A 1 227 ? 7.126   17.649  -3.551  1.00 31.07 ? 265 ILE A CG1   1 
ATOM   1795 C CG2   . ILE A 1 227 ? 5.659   16.214  -5.225  1.00 31.43 ? 265 ILE A CG2   1 
ATOM   1796 C CD1   . ILE A 1 227 ? 7.494   16.503  -2.554  1.00 32.87 ? 265 ILE A CD1   1 
ATOM   1797 N N     . ILE A 1 228 ? 2.902   18.444  -4.986  1.00 32.15 ? 266 ILE A N     1 
ATOM   1798 C CA    . ILE A 1 228 ? 1.719   18.069  -5.708  1.00 34.57 ? 266 ILE A CA    1 
ATOM   1799 C C     . ILE A 1 228 ? 1.209   19.203  -6.605  1.00 33.70 ? 266 ILE A C     1 
ATOM   1800 O O     . ILE A 1 228 ? 0.789   18.954  -7.763  1.00 33.05 ? 266 ILE A O     1 
ATOM   1801 C CB    . ILE A 1 228 ? 0.623   17.463  -4.833  1.00 35.85 ? 266 ILE A CB    1 
ATOM   1802 C CG1   . ILE A 1 228 ? -0.384  18.405  -4.404  1.00 40.84 ? 266 ILE A CG1   1 
ATOM   1803 C CG2   . ILE A 1 228 ? 1.033   16.301  -3.889  1.00 38.25 ? 266 ILE A CG2   1 
ATOM   1804 C CD1   . ILE A 1 228 ? -1.505  17.928  -5.130  1.00 42.42 ? 266 ILE A CD1   1 
ATOM   1805 N N     . SER A 1 229 ? 1.351   20.465  -6.145  1.00 32.92 ? 267 SER A N     1 
ATOM   1806 C CA    . SER A 1 229 ? 0.922   21.619  -6.922  1.00 34.11 ? 267 SER A CA    1 
ATOM   1807 C C     . SER A 1 229 ? 1.734   21.702  -8.208  1.00 32.96 ? 267 SER A C     1 
ATOM   1808 O O     . SER A 1 229 ? 1.215   22.041  -9.304  1.00 32.93 ? 267 SER A O     1 
ATOM   1809 C CB    . SER A 1 229 ? 1.115   22.911  -6.122  1.00 34.93 ? 267 SER A CB    1 
ATOM   1810 O OG    . SER A 1 229 ? 0.253   22.855  -4.989  1.00 41.42 ? 267 SER A OG    1 
ATOM   1811 N N     . LYS A 1 230 ? 3.020   21.369  -8.090  1.00 31.72 ? 268 LYS A N     1 
ATOM   1812 C CA    . LYS A 1 230 ? 3.896   21.443  -9.248  1.00 32.16 ? 268 LYS A CA    1 
ATOM   1813 C C     . LYS A 1 230 ? 3.614   20.309  -10.236 1.00 32.51 ? 268 LYS A C     1 
ATOM   1814 O O     . LYS A 1 230 ? 4.156   20.365  -11.353 1.00 33.24 ? 268 LYS A O     1 
ATOM   1815 C CB    . LYS A 1 230 ? 5.374   21.420  -8.852  1.00 31.60 ? 268 LYS A CB    1 
ATOM   1816 C CG    . LYS A 1 230 ? 5.907   22.784  -8.261  1.00 31.65 ? 268 LYS A CG    1 
ATOM   1817 C CD    . LYS A 1 230 ? 7.351   22.560  -7.671  1.00 37.43 ? 268 LYS A CD    1 
ATOM   1818 C CE    . LYS A 1 230 ? 8.351   23.637  -8.073  1.00 43.28 ? 268 LYS A CE    1 
ATOM   1819 N NZ    . LYS A 1 230 ? 8.665   23.627  -9.532  1.00 48.48 ? 268 LYS A NZ    1 
ATOM   1820 N N     . ARG A 1 231 ? 2.794   19.340  -9.847  1.00 32.98 ? 269 ARG A N     1 
ATOM   1821 C CA    . ARG A 1 231 ? 2.387   18.271  -10.790 1.00 33.60 ? 269 ARG A CA    1 
ATOM   1822 C C     . ARG A 1 231 ? 1.081   18.664  -11.492 1.00 33.72 ? 269 ARG A C     1 
ATOM   1823 O O     . ARG A 1 231 ? 0.558   17.872  -12.271 1.00 33.66 ? 269 ARG A O     1 
ATOM   1824 C CB    . ARG A 1 231 ? 2.220   16.909  -10.095 1.00 33.85 ? 269 ARG A CB    1 
ATOM   1825 C CG    . ARG A 1 231 ? 3.522   16.321  -9.461  1.00 32.54 ? 269 ARG A CG    1 
ATOM   1826 C CD    . ARG A 1 231 ? 3.428   14.785  -9.226  1.00 33.39 ? 269 ARG A CD    1 
ATOM   1827 N NE    . ARG A 1 231 ? 3.342   14.176  -10.551 1.00 34.37 ? 269 ARG A NE    1 
ATOM   1828 C CZ    . ARG A 1 231 ? 2.628   13.097  -10.868 1.00 36.82 ? 269 ARG A CZ    1 
ATOM   1829 N NH1   . ARG A 1 231 ? 2.618   12.679  -12.121 1.00 34.82 ? 269 ARG A NH1   1 
ATOM   1830 N NH2   . ARG A 1 231 ? 1.902   12.472  -9.967  1.00 37.48 ? 269 ARG A NH2   1 
ATOM   1831 N N     . ASN A 1 232 ? 0.569   19.857  -11.191 1.00 32.31 ? 270 ASN A N     1 
ATOM   1832 C CA    . ASN A 1 232 ? -0.729  20.355  -11.702 1.00 32.78 ? 270 ASN A CA    1 
ATOM   1833 C C     . ASN A 1 232 ? -1.927  19.638  -11.099 1.00 33.23 ? 270 ASN A C     1 
ATOM   1834 O O     . ASN A 1 232 ? -2.962  19.377  -11.769 1.00 35.05 ? 270 ASN A O     1 
ATOM   1835 C CB    . ASN A 1 232 ? -0.786  20.315  -13.251 1.00 33.96 ? 270 ASN A CB    1 
ATOM   1836 C CG    . ASN A 1 232 ? 0.238   21.232  -13.884 1.00 39.68 ? 270 ASN A CG    1 
ATOM   1837 O OD1   . ASN A 1 232 ? 0.563   22.285  -13.326 1.00 46.00 ? 270 ASN A OD1   1 
ATOM   1838 N ND2   . ASN A 1 232 ? 0.738   20.855  -15.054 1.00 46.15 ? 270 ASN A ND2   1 
ATOM   1839 N N     . ILE A 1 233 ? -1.784  19.282  -9.822  1.00 32.74 ? 271 ILE A N     1 
ATOM   1840 C CA    . ILE A 1 233 ? -2.877  18.731  -9.017  1.00 33.06 ? 271 ILE A CA    1 
ATOM   1841 C C     . ILE A 1 233 ? -3.127  19.671  -7.823  1.00 34.05 ? 271 ILE A C     1 
ATOM   1842 O O     . ILE A 1 233 ? -2.173  20.197  -7.266  1.00 34.62 ? 271 ILE A O     1 
ATOM   1843 C CB    . ILE A 1 233 ? -2.501  17.289  -8.547  1.00 32.45 ? 271 ILE A CB    1 
ATOM   1844 C CG1   . ILE A 1 233 ? -2.408  16.353  -9.760  1.00 33.90 ? 271 ILE A CG1   1 
ATOM   1845 C CG2   . ILE A 1 233 ? -3.508  16.705  -7.510  1.00 32.19 ? 271 ILE A CG2   1 
ATOM   1846 C CD1   . ILE A 1 233 ? -1.791  14.988  -9.440  1.00 33.58 ? 271 ILE A CD1   1 
ATOM   1847 N N     . GLN A 1 234 ? -4.385  19.912  -7.451  1.00 33.08 ? 272 GLN A N     1 
ATOM   1848 C CA    . GLN A 1 234 ? -4.678  20.812  -6.319  1.00 34.13 ? 272 GLN A CA    1 
ATOM   1849 C C     . GLN A 1 234 ? -4.416  20.073  -5.034  1.00 33.01 ? 272 GLN A C     1 
ATOM   1850 O O     . GLN A 1 234 ? -4.558  18.857  -4.965  1.00 33.83 ? 272 GLN A O     1 
ATOM   1851 C CB    . GLN A 1 234 ? -6.139  21.261  -6.354  1.00 34.16 ? 272 GLN A CB    1 
ATOM   1852 C CG    . GLN A 1 234 ? -6.420  22.094  -7.589  1.00 40.04 ? 272 GLN A CG    1 
ATOM   1853 C CD    . GLN A 1 234 ? -7.840  22.605  -7.652  1.00 48.95 ? 272 GLN A CD    1 
ATOM   1854 O OE1   . GLN A 1 234 ? -8.070  23.813  -7.691  1.00 55.12 ? 272 GLN A OE1   1 
ATOM   1855 N NE2   . GLN A 1 234 ? -8.803  21.692  -7.654  1.00 53.03 ? 272 GLN A NE2   1 
ATOM   1856 N N     . PHE A 1 235 ? -4.035  20.812  -4.004  1.00 32.91 ? 273 PHE A N     1 
ATOM   1857 C CA    . PHE A 1 235 ? -3.780  20.203  -2.710  1.00 32.43 ? 273 PHE A CA    1 
ATOM   1858 C C     . PHE A 1 235 ? -4.683  20.824  -1.668  1.00 33.22 ? 273 PHE A C     1 
ATOM   1859 O O     . PHE A 1 235 ? -4.797  22.073  -1.565  1.00 34.05 ? 273 PHE A O     1 
ATOM   1860 C CB    . PHE A 1 235 ? -2.332  20.453  -2.272  1.00 31.93 ? 273 PHE A CB    1 
ATOM   1861 C CG    . PHE A 1 235 ? -2.006  19.830  -0.947  1.00 30.42 ? 273 PHE A CG    1 
ATOM   1862 C CD1   . PHE A 1 235 ? -1.913  18.455  -0.818  1.00 30.96 ? 273 PHE A CD1   1 
ATOM   1863 C CD2   . PHE A 1 235 ? -1.849  20.631  0.179   1.00 32.65 ? 273 PHE A CD2   1 
ATOM   1864 C CE1   . PHE A 1 235 ? -1.630  17.854  0.401   1.00 33.52 ? 273 PHE A CE1   1 
ATOM   1865 C CE2   . PHE A 1 235 ? -1.573  20.031  1.399   1.00 32.57 ? 273 PHE A CE2   1 
ATOM   1866 C CZ    . PHE A 1 235 ? -1.448  18.673  1.519   1.00 33.58 ? 273 PHE A CZ    1 
ATOM   1867 N N     . SER A 1 236 ? -5.269  19.957  -0.863  1.00 33.99 ? 274 SER A N     1 
ATOM   1868 C CA    . SER A 1 236 ? -6.122  20.349  0.258   1.00 35.84 ? 274 SER A CA    1 
ATOM   1869 C C     . SER A 1 236 ? -5.626  19.622  1.503   1.00 34.72 ? 274 SER A C     1 
ATOM   1870 O O     . SER A 1 236 ? -5.127  18.512  1.448   1.00 32.73 ? 274 SER A O     1 
ATOM   1871 C CB    . SER A 1 236 ? -7.558  19.929  -0.083  1.00 37.05 ? 274 SER A CB    1 
ATOM   1872 O OG    . SER A 1 236 ? -8.472  20.210  0.954   1.00 46.39 ? 274 SER A OG    1 
ATOM   1873 N N     . CYS A 1 237 ? -5.763  20.252  2.662   1.00 35.28 ? 275 CYS A N     1 
ATOM   1874 C CA    . CYS A 1 237 ? -5.392  19.560  3.867   1.00 35.80 ? 275 CYS A CA    1 
ATOM   1875 C C     . CYS A 1 237 ? -6.388  19.890  4.964   1.00 34.83 ? 275 CYS A C     1 
ATOM   1876 O O     . CYS A 1 237 ? -6.912  21.014  5.024   1.00 33.57 ? 275 CYS A O     1 
ATOM   1877 C CB    . CYS A 1 237 ? -3.984  20.023  4.278   1.00 36.45 ? 275 CYS A CB    1 
ATOM   1878 S SG    . CYS A 1 237 ? -3.273  19.214  5.708   1.00 39.31 ? 275 CYS A SG    1 
ATOM   1879 N N     . LYS A 1 238 ? -6.669  18.888  5.788   1.00 34.09 ? 276 LYS A N     1 
ATOM   1880 C CA    . LYS A 1 238 ? -7.524  19.034  6.967   1.00 34.58 ? 276 LYS A CA    1 
ATOM   1881 C C     . LYS A 1 238 ? -6.891  18.380  8.181   1.00 33.48 ? 276 LYS A C     1 
ATOM   1882 O O     . LYS A 1 238 ? -6.247  17.353  8.054   1.00 33.72 ? 276 LYS A O     1 
ATOM   1883 C CB    . LYS A 1 238 ? -8.847  18.315  6.660   1.00 35.56 ? 276 LYS A CB    1 
ATOM   1884 C CG    . LYS A 1 238 ? -9.678  18.995  5.617   1.00 41.56 ? 276 LYS A CG    1 
ATOM   1885 C CD    . LYS A 1 238 ? -11.163 18.711  5.792   1.00 49.43 ? 276 LYS A CD    1 
ATOM   1886 C CE    . LYS A 1 238 ? -11.895 19.024  4.465   1.00 53.29 ? 276 LYS A CE    1 
ATOM   1887 N NZ    . LYS A 1 238 ? -12.004 20.500  4.192   1.00 55.54 ? 276 LYS A NZ    1 
ATOM   1888 N N     . ASN A 1 239 ? -7.054  18.977  9.380   1.00 32.86 ? 277 ASN A N     1 
ATOM   1889 C CA    . ASN A 1 239 ? -6.646  18.329  10.622  1.00 33.37 ? 277 ASN A CA    1 
ATOM   1890 C C     . ASN A 1 239 ? -7.772  17.422  11.055  1.00 33.75 ? 277 ASN A C     1 
ATOM   1891 O O     . ASN A 1 239 ? -8.936  17.845  11.012  1.00 36.67 ? 277 ASN A O     1 
ATOM   1892 C CB    . ASN A 1 239 ? -6.416  19.345  11.765  1.00 33.15 ? 277 ASN A CB    1 
ATOM   1893 C CG    . ASN A 1 239 ? -5.202  20.217  11.536  1.00 34.40 ? 277 ASN A CG    1 
ATOM   1894 O OD1   . ASN A 1 239 ? -4.074  19.871  11.930  1.00 34.28 ? 277 ASN A OD1   1 
ATOM   1895 N ND2   . ASN A 1 239 ? -5.416  21.342  10.858  1.00 34.93 ? 277 ASN A ND2   1 
ATOM   1896 N N     . ILE A 1 240 ? -7.437  16.223  11.526  1.00 32.53 ? 278 ILE A N     1 
ATOM   1897 C CA    . ILE A 1 240 ? -8.363  15.432  12.340  1.00 33.12 ? 278 ILE A CA    1 
ATOM   1898 C C     . ILE A 1 240 ? -7.825  15.426  13.773  1.00 31.85 ? 278 ILE A C     1 
ATOM   1899 O O     . ILE A 1 240 ? -6.872  14.710  14.104  1.00 31.44 ? 278 ILE A O     1 
ATOM   1900 C CB    . ILE A 1 240 ? -8.610  14.003  11.761  1.00 33.21 ? 278 ILE A CB    1 
ATOM   1901 C CG1   . ILE A 1 240 ? -9.256  14.134  10.354  1.00 34.18 ? 278 ILE A CG1   1 
ATOM   1902 C CG2   . ILE A 1 240 ? -9.426  13.151  12.750  1.00 34.03 ? 278 ILE A CG2   1 
ATOM   1903 C CD1   . ILE A 1 240 ? -9.701  12.760  9.732   1.00 36.45 ? 278 ILE A CD1   1 
ATOM   1904 N N     . TYR A 1 241 ? -8.397  16.295  14.581  1.00 32.95 ? 279 TYR A N     1 
ATOM   1905 C CA    . TYR A 1 241 ? -7.879  16.483  15.931  1.00 33.67 ? 279 TYR A CA    1 
ATOM   1906 C C     . TYR A 1 241 ? -8.105  15.276  16.868  1.00 34.47 ? 279 TYR A C     1 
ATOM   1907 O O     . TYR A 1 241 ? -7.232  14.908  17.682  1.00 33.28 ? 279 TYR A O     1 
ATOM   1908 C CB    . TYR A 1 241 ? -8.476  17.748  16.513  1.00 34.23 ? 279 TYR A CB    1 
ATOM   1909 C CG    . TYR A 1 241 ? -8.051  19.024  15.808  1.00 34.89 ? 279 TYR A CG    1 
ATOM   1910 C CD1   . TYR A 1 241 ? -6.809  19.605  16.067  1.00 34.83 ? 279 TYR A CD1   1 
ATOM   1911 C CD2   . TYR A 1 241 ? -8.899  19.651  14.897  1.00 35.94 ? 279 TYR A CD2   1 
ATOM   1912 C CE1   . TYR A 1 241 ? -6.420  20.796  15.441  1.00 36.74 ? 279 TYR A CE1   1 
ATOM   1913 C CE2   . TYR A 1 241 ? -8.519  20.836  14.241  1.00 36.92 ? 279 TYR A CE2   1 
ATOM   1914 C CZ    . TYR A 1 241 ? -7.274  21.404  14.532  1.00 38.60 ? 279 TYR A CZ    1 
ATOM   1915 O OH    . TYR A 1 241 ? -6.896  22.582  13.919  1.00 39.34 ? 279 TYR A OH    1 
ATOM   1916 N N     . ARG A 1 242 ? -9.268  14.651  16.737  1.00 34.85 ? 280 ARG A N     1 
ATOM   1917 C CA    . ARG A 1 242 ? -9.624  13.524  17.591  1.00 35.95 ? 280 ARG A CA    1 
ATOM   1918 C C     . ARG A 1 242 ? -10.122 12.363  16.725  1.00 35.37 ? 280 ARG A C     1 
ATOM   1919 O O     . ARG A 1 242 ? -11.300 12.305  16.408  1.00 34.98 ? 280 ARG A O     1 
ATOM   1920 C CB    . ARG A 1 242 ? -10.688 13.941  18.581  1.00 36.52 ? 280 ARG A CB    1 
ATOM   1921 C CG    . ARG A 1 242 ? -10.126 14.729  19.769  1.00 40.63 ? 280 ARG A CG    1 
ATOM   1922 C CD    . ARG A 1 242 ? -11.047 15.877  20.113  1.00 46.19 ? 280 ARG A CD    1 
ATOM   1923 N NE    . ARG A 1 242 ? -10.794 16.416  21.450  1.00 48.54 ? 280 ARG A NE    1 
ATOM   1924 C CZ    . ARG A 1 242 ? -11.471 16.073  22.548  1.00 49.30 ? 280 ARG A CZ    1 
ATOM   1925 N NH1   . ARG A 1 242 ? -12.455 15.182  22.482  1.00 47.95 ? 280 ARG A NH1   1 
ATOM   1926 N NH2   . ARG A 1 242 ? -11.158 16.621  23.721  1.00 50.08 ? 280 ARG A NH2   1 
ATOM   1927 N N     . PRO A 1 243 ? -9.223  11.450  16.365  1.00 35.77 ? 281 PRO A N     1 
ATOM   1928 C CA    . PRO A 1 243 ? -9.588  10.349  15.450  1.00 35.38 ? 281 PRO A CA    1 
ATOM   1929 C C     . PRO A 1 243 ? -10.637 9.426   16.077  1.00 34.52 ? 281 PRO A C     1 
ATOM   1930 O O     . PRO A 1 243 ? -11.423 8.820   15.354  1.00 33.38 ? 281 PRO A O     1 
ATOM   1931 C CB    . PRO A 1 243 ? -8.262  9.632   15.189  1.00 35.74 ? 281 PRO A CB    1 
ATOM   1932 C CG    . PRO A 1 243 ? -7.368  10.029  16.291  1.00 37.71 ? 281 PRO A CG    1 
ATOM   1933 C CD    . PRO A 1 243 ? -7.802  11.402  16.744  1.00 36.87 ? 281 PRO A CD    1 
ATOM   1934 N N     . ASP A 1 244 ? -10.682 9.341   17.417  1.00 32.09 ? 282 ASP A N     1 
ATOM   1935 C CA    . ASP A 1 244 ? -11.773 8.604   18.039  1.00 32.65 ? 282 ASP A CA    1 
ATOM   1936 C C     . ASP A 1 244 ? -13.142 9.249   17.776  1.00 32.77 ? 282 ASP A C     1 
ATOM   1937 O O     . ASP A 1 244 ? -14.121 8.530   17.550  1.00 34.43 ? 282 ASP A O     1 
ATOM   1938 C CB    . ASP A 1 244 ? -11.553 8.471   19.566  1.00 32.75 ? 282 ASP A CB    1 
ATOM   1939 C CG    . ASP A 1 244 ? -11.425 9.829   20.254  1.00 34.57 ? 282 ASP A CG    1 
ATOM   1940 O OD1   . ASP A 1 244 ? -10.666 10.677  19.734  1.00 38.96 ? 282 ASP A OD1   1 
ATOM   1941 O OD2   . ASP A 1 244 ? -12.040 10.043  21.325  1.00 38.37 ? 282 ASP A OD2   1 
ATOM   1942 N N     . LYS A 1 245 ? -13.248 10.572  17.878  1.00 32.87 ? 283 LYS A N     1 
ATOM   1943 C CA    . LYS A 1 245 ? -14.518 11.229  17.554  1.00 34.89 ? 283 LYS A CA    1 
ATOM   1944 C C     . LYS A 1 245 ? -14.798 11.113  16.038  1.00 34.23 ? 283 LYS A C     1 
ATOM   1945 O O     . LYS A 1 245 ? -15.939 10.884  15.617  1.00 34.96 ? 283 LYS A O     1 
ATOM   1946 C CB    . LYS A 1 245 ? -14.544 12.708  17.934  1.00 33.93 ? 283 LYS A CB    1 
ATOM   1947 C CG    . LYS A 1 245 ? -16.013 13.151  18.242  1.00 38.73 ? 283 LYS A CG    1 
ATOM   1948 C CD    . LYS A 1 245 ? -16.222 14.663  18.463  1.00 39.37 ? 283 LYS A CD    1 
ATOM   1949 C CE    . LYS A 1 245 ? -16.134 15.423  17.159  1.00 44.91 ? 283 LYS A CE    1 
ATOM   1950 N NZ    . LYS A 1 245 ? -17.134 16.535  17.077  1.00 46.50 ? 283 LYS A NZ    1 
ATOM   1951 N N     . PHE A 1 246 ? -13.762 11.269  15.234  1.00 34.13 ? 284 PHE A N     1 
ATOM   1952 C CA    . PHE A 1 246 ? -13.927 11.127  13.797  1.00 34.31 ? 284 PHE A CA    1 
ATOM   1953 C C     . PHE A 1 246 ? -14.620 9.801   13.496  1.00 33.93 ? 284 PHE A C     1 
ATOM   1954 O O     . PHE A 1 246 ? -15.632 9.776   12.792  1.00 35.29 ? 284 PHE A O     1 
ATOM   1955 C CB    . PHE A 1 246 ? -12.585 11.216  13.091  1.00 33.71 ? 284 PHE A CB    1 
ATOM   1956 C CG    . PHE A 1 246 ? -12.643 10.828  11.633  1.00 34.20 ? 284 PHE A CG    1 
ATOM   1957 C CD1   . PHE A 1 246 ? -13.419 11.567  10.766  1.00 34.99 ? 284 PHE A CD1   1 
ATOM   1958 C CD2   . PHE A 1 246 ? -11.959 9.719   11.184  1.00 34.77 ? 284 PHE A CD2   1 
ATOM   1959 C CE1   . PHE A 1 246 ? -13.475 11.217  9.385   1.00 35.07 ? 284 PHE A CE1   1 
ATOM   1960 C CE2   . PHE A 1 246 ? -12.016 9.353   9.818   1.00 35.01 ? 284 PHE A CE2   1 
ATOM   1961 C CZ    . PHE A 1 246 ? -12.796 10.114  8.954   1.00 35.65 ? 284 PHE A CZ    1 
ATOM   1962 N N     . LEU A 1 247 ? -14.086 8.710   14.023  1.00 34.11 ? 285 LEU A N     1 
ATOM   1963 C CA    . LEU A 1 247 ? -14.641 7.390   13.705  1.00 34.35 ? 285 LEU A CA    1 
ATOM   1964 C C     . LEU A 1 247 ? -16.058 7.257   14.205  1.00 35.42 ? 285 LEU A C     1 
ATOM   1965 O O     . LEU A 1 247 ? -16.898 6.649   13.537  1.00 36.62 ? 285 LEU A O     1 
ATOM   1966 C CB    . LEU A 1 247 ? -13.793 6.249   14.231  1.00 35.04 ? 285 LEU A CB    1 
ATOM   1967 C CG    . LEU A 1 247 ? -12.538 5.800   13.525  1.00 36.22 ? 285 LEU A CG    1 
ATOM   1968 C CD1   . LEU A 1 247 ? -12.003 4.613   14.311  1.00 38.80 ? 285 LEU A CD1   1 
ATOM   1969 C CD2   . LEU A 1 247 ? -12.847 5.405   12.060  1.00 40.70 ? 285 LEU A CD2   1 
ATOM   1970 N N     . GLN A 1 248 ? -16.343 7.832   15.375  1.00 34.94 ? 286 GLN A N     1 
ATOM   1971 C CA    . GLN A 1 248 ? -17.693 7.791   15.876  1.00 36.06 ? 286 GLN A CA    1 
ATOM   1972 C C     . GLN A 1 248 ? -18.656 8.540   14.971  1.00 36.76 ? 286 GLN A C     1 
ATOM   1973 O O     . GLN A 1 248 ? -19.798 8.120   14.780  1.00 37.05 ? 286 GLN A O     1 
ATOM   1974 C CB    . GLN A 1 248 ? -17.759 8.387   17.267  1.00 36.07 ? 286 GLN A CB    1 
ATOM   1975 C CG    . GLN A 1 248 ? -19.118 8.170   17.944  1.00 38.96 ? 286 GLN A CG    1 
ATOM   1976 C CD    . GLN A 1 248 ? -19.634 6.736   17.812  1.00 41.13 ? 286 GLN A CD    1 
ATOM   1977 O OE1   . GLN A 1 248 ? -18.873 5.746   17.880  1.00 46.58 ? 286 GLN A OE1   1 
ATOM   1978 N NE2   . GLN A 1 248 ? -20.935 6.618   17.630  1.00 44.53 ? 286 GLN A NE2   1 
ATOM   1979 N N     . CYS A 1 249 ? -18.203 9.672   14.457  1.00 36.90 ? 287 CYS A N     1 
ATOM   1980 C CA    . CYS A 1 249 ? -19.044 10.492  13.612  1.00 38.29 ? 287 CYS A CA    1 
ATOM   1981 C C     . CYS A 1 249 ? -19.283 9.784   12.276  1.00 38.04 ? 287 CYS A C     1 
ATOM   1982 O O     . CYS A 1 249 ? -20.325 9.969   11.654  1.00 39.12 ? 287 CYS A O     1 
ATOM   1983 C CB    . CYS A 1 249 ? -18.423 11.864  13.395  1.00 38.72 ? 287 CYS A CB    1 
ATOM   1984 S SG    . CYS A 1 249 ? -18.457 12.864  14.873  1.00 43.79 ? 287 CYS A SG    1 
ATOM   1985 N N     . VAL A 1 250 ? -18.332 8.959   11.864  1.00 37.65 ? 288 VAL A N     1 
ATOM   1986 C CA    . VAL A 1 250 ? -18.471 8.200   10.615  1.00 38.72 ? 288 VAL A CA    1 
ATOM   1987 C C     . VAL A 1 250 ? -19.564 7.129   10.827  1.00 40.03 ? 288 VAL A C     1 
ATOM   1988 O O     . VAL A 1 250 ? -20.405 6.931   9.948   1.00 41.16 ? 288 VAL A O     1 
ATOM   1989 C CB    . VAL A 1 250 ? -17.112 7.609   10.164  1.00 37.35 ? 288 VAL A CB    1 
ATOM   1990 C CG1   . VAL A 1 250 ? -17.251 6.679   8.905   1.00 38.36 ? 288 VAL A CG1   1 
ATOM   1991 C CG2   . VAL A 1 250 ? -16.123 8.751   9.895   1.00 35.68 ? 288 VAL A CG2   1 
ATOM   1992 N N     . LYS A 1 251 ? -19.586 6.490   11.996  1.00 40.39 ? 289 LYS A N     1 
ATOM   1993 C CA    . LYS A 1 251 ? -20.574 5.435   12.260  1.00 41.68 ? 289 LYS A CA    1 
ATOM   1994 C C     . LYS A 1 251 ? -21.954 6.032   12.546  1.00 43.53 ? 289 LYS A C     1 
ATOM   1995 O O     . LYS A 1 251 ? -22.974 5.438   12.214  1.00 44.28 ? 289 LYS A O     1 
ATOM   1996 C CB    . LYS A 1 251 ? -20.132 4.535   13.421  1.00 41.07 ? 289 LYS A CB    1 
ATOM   1997 C CG    . LYS A 1 251 ? -18.793 3.851   13.216  1.00 40.04 ? 289 LYS A CG    1 
ATOM   1998 C CD    . LYS A 1 251 ? -18.263 3.286   14.515  1.00 39.07 ? 289 LYS A CD    1 
ATOM   1999 C CE    . LYS A 1 251 ? -16.869 2.698   14.293  1.00 38.49 ? 289 LYS A CE    1 
ATOM   2000 N NZ    . LYS A 1 251 ? -16.446 1.904   15.509  1.00 39.61 ? 289 LYS A NZ    1 
ATOM   2001 N N     . ASN A 1 252 ? -21.972 7.215   13.158  1.00 45.43 ? 290 ASN A N     1 
ATOM   2002 C CA    . ASN A 1 252 ? -23.189 7.817   13.709  1.00 47.87 ? 290 ASN A CA    1 
ATOM   2003 C C     . ASN A 1 252 ? -23.167 9.330   13.505  1.00 49.08 ? 290 ASN A C     1 
ATOM   2004 O O     . ASN A 1 252 ? -22.948 10.084  14.457  1.00 48.97 ? 290 ASN A O     1 
ATOM   2005 C CB    . ASN A 1 252 ? -23.280 7.506   15.206  1.00 48.08 ? 290 ASN A CB    1 
ATOM   2006 C CG    . ASN A 1 252 ? -23.868 6.125   15.496  1.00 51.46 ? 290 ASN A CG    1 
ATOM   2007 O OD1   . ASN A 1 252 ? -25.085 5.914   15.381  1.00 56.42 ? 290 ASN A OD1   1 
ATOM   2008 N ND2   . ASN A 1 252 ? -23.022 5.199   15.939  1.00 53.55 ? 290 ASN A ND2   1 
ATOM   2009 N N     . PRO A 1 253 ? -23.391 9.787   12.261  1.00 50.85 ? 291 PRO A N     1 
ATOM   2010 C CA    . PRO A 1 253 ? -23.191 11.200  11.934  1.00 52.50 ? 291 PRO A CA    1 
ATOM   2011 C C     . PRO A 1 253 ? -24.299 12.133  12.408  1.00 54.54 ? 291 PRO A C     1 
ATOM   2012 O O     . PRO A 1 253 ? -25.360 11.690  12.868  1.00 54.74 ? 291 PRO A O     1 
ATOM   2013 C CB    . PRO A 1 253 ? -23.119 11.204  10.407  1.00 52.47 ? 291 PRO A CB    1 
ATOM   2014 C CG    . PRO A 1 253 ? -23.906 10.014  9.990   1.00 51.40 ? 291 PRO A CG    1 
ATOM   2015 C CD    . PRO A 1 253 ? -23.839 9.000   11.097  1.00 51.17 ? 291 PRO A CD    1 
ATOM   2016 N N     . GLU A 1 254 ? -23.982 13.422  12.338  1.00 56.82 ? 292 GLU A N     1 
ATOM   2017 C CA    . GLU A 1 254 ? -24.929 14.541  12.421  1.00 59.54 ? 292 GLU A CA    1 
ATOM   2018 C C     . GLU A 1 254 ? -25.875 14.644  13.628  1.00 60.13 ? 292 GLU A C     1 
ATOM   2019 O O     . GLU A 1 254 ? -26.279 15.762  13.972  1.00 61.18 ? 292 GLU A O     1 
ATOM   2020 C CB    . GLU A 1 254 ? -25.689 14.701  11.087  1.00 59.95 ? 292 GLU A CB    1 
ATOM   2021 C CG    . GLU A 1 254 ? -24.760 14.939  9.884   1.00 62.70 ? 292 GLU A CG    1 
ATOM   2022 C CD    . GLU A 1 254 ? -25.370 14.514  8.556   1.00 65.38 ? 292 GLU A CD    1 
ATOM   2023 O OE1   . GLU A 1 254 ? -26.520 14.911  8.265   1.00 67.18 ? 292 GLU A OE1   1 
ATOM   2024 O OE2   . GLU A 1 254 ? -24.688 13.795  7.796   1.00 66.58 ? 292 GLU A OE2   1 
ATOM   2025 N N     . ASP A 1 255 ? -26.233 13.530  14.274  1.00 60.93 ? 293 ASP A N     1 
ATOM   2026 C CA    . ASP A 1 255 ? -27.173 13.624  15.404  1.00 61.20 ? 293 ASP A CA    1 
ATOM   2027 C C     . ASP A 1 255 ? -26.498 14.042  16.700  1.00 61.45 ? 293 ASP A C     1 
ATOM   2028 O O     . ASP A 1 255 ? -27.129 14.676  17.564  1.00 61.56 ? 293 ASP A O     1 
ATOM   2029 C CB    . ASP A 1 255 ? -27.985 12.341  15.647  1.00 61.42 ? 293 ASP A CB    1 
ATOM   2030 C CG    . ASP A 1 255 ? -29.101 12.541  16.701  1.00 62.11 ? 293 ASP A CG    1 
ATOM   2031 O OD1   . ASP A 1 255 ? -29.804 13.582  16.645  1.00 62.81 ? 293 ASP A OD1   1 
ATOM   2032 O OD2   . ASP A 1 255 ? -29.263 11.673  17.598  1.00 61.76 ? 293 ASP A OD2   1 
ATOM   2033 N N     . SER A 1 256 ? -25.236 13.662  16.862  1.00 61.18 ? 294 SER A N     1 
ATOM   2034 C CA    . SER A 1 256 ? -24.514 14.103  18.043  1.00 60.62 ? 294 SER A CA    1 
ATOM   2035 C C     . SER A 1 256 ? -23.382 14.988  17.586  1.00 60.20 ? 294 SER A C     1 
ATOM   2036 O O     . SER A 1 256 ? -22.981 14.921  16.413  1.00 59.97 ? 294 SER A O     1 
ATOM   2037 C CB    . SER A 1 256 ? -24.007 12.925  18.891  1.00 60.63 ? 294 SER A CB    1 
ATOM   2038 O OG    . SER A 1 256 ? -22.915 12.255  18.288  1.00 60.59 ? 294 SER A OG    1 
ATOM   2039 N N     . SER A 1 257 ? -22.959 15.858  18.508  1.00 59.22 ? 295 SER A N     1 
ATOM   2040 C CA    . SER A 1 257 ? -21.695 16.618  18.507  1.00 58.19 ? 295 SER A CA    1 
ATOM   2041 C C     . SER A 1 257 ? -20.708 16.483  17.335  1.00 57.24 ? 295 SER A C     1 
ATOM   2042 O O     . SER A 1 257 ? -19.522 16.765  17.496  1.00 57.22 ? 295 SER A O     1 
ATOM   2043 C CB    . SER A 1 257 ? -20.944 16.271  19.793  1.00 58.36 ? 295 SER A CB    1 
ATOM   2044 O OG    . SER A 1 257 ? -20.464 14.933  19.729  1.00 58.81 ? 295 SER A OG    1 
ATOM   2045 N N     . CYS A 1 258 ? -21.009 16.168  16.187  1.00 55.96 ? 296 CYS A N     1 
ATOM   2046 C CA    . CYS A 1 258 ? -20.189 16.008  15.004  1.00 54.83 ? 296 CYS A CA    1 
ATOM   2047 C C     . CYS A 1 258 ? -20.322 17.210  14.084  1.00 55.04 ? 296 CYS A C     1 
ATOM   2048 O O     . CYS A 1 258 ? -19.584 17.315  13.104  1.00 55.21 ? 296 CYS A O     1 
ATOM   2049 C CB    . CYS A 1 258 ? -20.591 14.732  14.265  1.00 54.12 ? 296 CYS A CB    1 
ATOM   2050 S SG    . CYS A 1 258 ? -20.255 13.242  15.228  1.00 50.21 ? 296 CYS A SG    1 
ATOM   2051 N N     . ARG B 1 7   ? 26.400  16.762  4.452   1.00 45.58 ? 45  ARG B N     1 
ATOM   2052 C CA    . ARG B 1 7   ? 25.654  15.558  4.896   1.00 44.30 ? 45  ARG B CA    1 
ATOM   2053 C C     . ARG B 1 7   ? 26.060  14.254  4.187   1.00 42.42 ? 45  ARG B C     1 
ATOM   2054 O O     . ARG B 1 7   ? 26.674  14.252  3.115   1.00 41.74 ? 45  ARG B O     1 
ATOM   2055 C CB    . ARG B 1 7   ? 24.162  15.776  4.778   1.00 44.47 ? 45  ARG B CB    1 
ATOM   2056 C CG    . ARG B 1 7   ? 23.406  15.198  5.882   1.00 46.82 ? 45  ARG B CG    1 
ATOM   2057 C CD    . ARG B 1 7   ? 22.045  14.813  5.406   1.00 52.57 ? 45  ARG B CD    1 
ATOM   2058 N NE    . ARG B 1 7   ? 21.327  14.077  6.437   1.00 54.23 ? 45  ARG B NE    1 
ATOM   2059 C CZ    . ARG B 1 7   ? 20.022  13.832  6.405   1.00 57.95 ? 45  ARG B CZ    1 
ATOM   2060 N NH1   . ARG B 1 7   ? 19.276  14.275  5.400   1.00 60.61 ? 45  ARG B NH1   1 
ATOM   2061 N NH2   . ARG B 1 7   ? 19.454  13.152  7.384   1.00 58.15 ? 45  ARG B NH2   1 
ATOM   2062 N N     . TRP B 1 8   ? 25.697  13.151  4.833   1.00 40.50 ? 46  TRP B N     1 
ATOM   2063 C CA    . TRP B 1 8   ? 26.175  11.811  4.466   1.00 38.46 ? 46  TRP B CA    1 
ATOM   2064 C C     . TRP B 1 8   ? 25.186  11.002  3.592   1.00 38.39 ? 46  TRP B C     1 
ATOM   2065 O O     . TRP B 1 8   ? 25.495  9.875   3.188   1.00 36.96 ? 46  TRP B O     1 
ATOM   2066 C CB    . TRP B 1 8   ? 26.416  11.055  5.774   1.00 37.45 ? 46  TRP B CB    1 
ATOM   2067 C CG    . TRP B 1 8   ? 25.144  10.894  6.536   1.00 37.23 ? 46  TRP B CG    1 
ATOM   2068 C CD1   . TRP B 1 8   ? 24.206  9.902   6.385   1.00 34.50 ? 46  TRP B CD1   1 
ATOM   2069 C CD2   . TRP B 1 8   ? 24.643  11.767  7.572   1.00 36.42 ? 46  TRP B CD2   1 
ATOM   2070 N NE1   . TRP B 1 8   ? 23.151  10.111  7.251   1.00 36.95 ? 46  TRP B NE1   1 
ATOM   2071 C CE2   . TRP B 1 8   ? 23.401  11.237  7.998   1.00 35.57 ? 46  TRP B CE2   1 
ATOM   2072 C CE3   . TRP B 1 8   ? 25.111  12.948  8.147   1.00 37.69 ? 46  TRP B CE3   1 
ATOM   2073 C CZ2   . TRP B 1 8   ? 22.623  11.841  9.000   1.00 39.90 ? 46  TRP B CZ2   1 
ATOM   2074 C CZ3   . TRP B 1 8   ? 24.341  13.544  9.185   1.00 36.62 ? 46  TRP B CZ3   1 
ATOM   2075 C CH2   . TRP B 1 8   ? 23.115  12.986  9.586   1.00 36.99 ? 46  TRP B CH2   1 
ATOM   2076 N N     . ARG B 1 9   ? 24.002  11.560  3.326   1.00 37.53 ? 47  ARG B N     1 
ATOM   2077 C CA    . ARG B 1 9   ? 22.988  10.870  2.506   1.00 39.10 ? 47  ARG B CA    1 
ATOM   2078 C C     . ARG B 1 9   ? 22.901  11.462  1.100   1.00 38.71 ? 47  ARG B C     1 
ATOM   2079 O O     . ARG B 1 9   ? 23.131  12.668  0.900   1.00 40.11 ? 47  ARG B O     1 
ATOM   2080 C CB    . ARG B 1 9   ? 21.581  10.963  3.094   1.00 39.32 ? 47  ARG B CB    1 
ATOM   2081 C CG    . ARG B 1 9   ? 21.413  10.435  4.455   1.00 43.54 ? 47  ARG B CG    1 
ATOM   2082 C CD    . ARG B 1 9   ? 20.004  9.906   4.622   1.00 50.85 ? 47  ARG B CD    1 
ATOM   2083 N NE    . ARG B 1 9   ? 20.008  8.458   4.438   1.00 57.56 ? 47  ARG B NE    1 
ATOM   2084 C CZ    . ARG B 1 9   ? 19.357  7.803   3.484   1.00 58.74 ? 47  ARG B CZ    1 
ATOM   2085 N NH1   . ARG B 1 9   ? 18.597  8.451   2.618   1.00 60.58 ? 47  ARG B NH1   1 
ATOM   2086 N NH2   . ARG B 1 9   ? 19.456  6.481   3.419   1.00 61.27 ? 47  ARG B NH2   1 
ATOM   2087 N N     . GLN B 1 10  ? 22.578  10.626  0.130   1.00 38.24 ? 48  GLN B N     1 
ATOM   2088 C CA    . GLN B 1 10  ? 22.226  11.161  -1.176  1.00 38.36 ? 48  GLN B CA    1 
ATOM   2089 C C     . GLN B 1 10  ? 20.765  10.855  -1.432  1.00 38.24 ? 48  GLN B C     1 
ATOM   2090 O O     . GLN B 1 10  ? 20.227  9.876   -0.903  1.00 39.23 ? 48  GLN B O     1 
ATOM   2091 C CB    . GLN B 1 10  ? 23.081  10.571  -2.299  1.00 38.65 ? 48  GLN B CB    1 
ATOM   2092 C CG    . GLN B 1 10  ? 24.586  10.832  -2.091  1.00 37.72 ? 48  GLN B CG    1 
ATOM   2093 C CD    . GLN B 1 10  ? 25.443  10.246  -3.197  1.00 39.92 ? 48  GLN B CD    1 
ATOM   2094 O OE1   . GLN B 1 10  ? 24.960  9.487   -4.017  1.00 35.35 ? 48  GLN B OE1   1 
ATOM   2095 N NE2   . GLN B 1 10  ? 26.726  10.543  -3.175  1.00 41.63 ? 48  GLN B NE2   1 
ATOM   2096 N N     . THR B 1 11  ? 20.135  11.693  -2.234  1.00 38.77 ? 49  THR B N     1 
ATOM   2097 C CA    . THR B 1 11  ? 18.703  11.583  -2.455  1.00 39.13 ? 49  THR B CA    1 
ATOM   2098 C C     . THR B 1 11  ? 18.356  10.386  -3.310  1.00 38.02 ? 49  THR B C     1 
ATOM   2099 O O     . THR B 1 11  ? 17.337  9.730   -3.095  1.00 38.98 ? 49  THR B O     1 
ATOM   2100 C CB    . THR B 1 11  ? 18.194  12.877  -3.078  1.00 40.72 ? 49  THR B CB    1 
ATOM   2101 O OG1   . THR B 1 11  ? 18.678  13.979  -2.289  1.00 45.90 ? 49  THR B OG1   1 
ATOM   2102 C CG2   . THR B 1 11  ? 16.710  12.904  -3.099  1.00 42.84 ? 49  THR B CG2   1 
ATOM   2103 N N     . TRP B 1 12  ? 19.192  10.116  -4.321  1.00 36.08 ? 50  TRP B N     1 
ATOM   2104 C CA    . TRP B 1 12  ? 18.850  9.144   -5.355  1.00 34.17 ? 50  TRP B CA    1 
ATOM   2105 C C     . TRP B 1 12  ? 19.868  8.037   -5.509  1.00 33.96 ? 50  TRP B C     1 
ATOM   2106 O O     . TRP B 1 12  ? 20.976  8.150   -4.992  1.00 33.55 ? 50  TRP B O     1 
ATOM   2107 C CB    . TRP B 1 12  ? 18.747  9.881   -6.693  1.00 33.27 ? 50  TRP B CB    1 
ATOM   2108 C CG    . TRP B 1 12  ? 17.771  11.061  -6.623  1.00 32.48 ? 50  TRP B CG    1 
ATOM   2109 C CD1   . TRP B 1 12  ? 18.060  12.397  -6.751  1.00 34.30 ? 50  TRP B CD1   1 
ATOM   2110 C CD2   . TRP B 1 12  ? 16.355  10.971  -6.387  1.00 33.44 ? 50  TRP B CD2   1 
ATOM   2111 N NE1   . TRP B 1 12  ? 16.896  13.132  -6.629  1.00 33.60 ? 50  TRP B NE1   1 
ATOM   2112 C CE2   . TRP B 1 12  ? 15.848  12.282  -6.402  1.00 34.44 ? 50  TRP B CE2   1 
ATOM   2113 C CE3   . TRP B 1 12  ? 15.465  9.893   -6.186  1.00 36.99 ? 50  TRP B CE3   1 
ATOM   2114 C CZ2   . TRP B 1 12  ? 14.485  12.565  -6.203  1.00 32.08 ? 50  TRP B CZ2   1 
ATOM   2115 C CZ3   . TRP B 1 12  ? 14.097  10.183  -5.919  1.00 35.60 ? 50  TRP B CZ3   1 
ATOM   2116 C CH2   . TRP B 1 12  ? 13.636  11.522  -5.937  1.00 32.92 ? 50  TRP B CH2   1 
ATOM   2117 N N     . SER B 1 13  ? 19.502  6.994   -6.275  1.00 33.28 ? 51  SER B N     1 
ATOM   2118 C CA    . SER B 1 13  ? 20.367  5.797   -6.460  1.00 34.97 ? 51  SER B CA    1 
ATOM   2119 C C     . SER B 1 13  ? 21.336  5.886   -7.642  1.00 34.60 ? 51  SER B C     1 
ATOM   2120 O O     . SER B 1 13  ? 22.308  5.131   -7.705  1.00 35.53 ? 51  SER B O     1 
ATOM   2121 C CB    . SER B 1 13  ? 19.505  4.583   -6.757  1.00 35.35 ? 51  SER B CB    1 
ATOM   2122 O OG    . SER B 1 13  ? 18.666  4.300   -5.666  1.00 40.54 ? 51  SER B OG    1 
ATOM   2123 N N     . GLY B 1 14  ? 21.019  6.734   -8.612  1.00 33.87 ? 52  GLY B N     1 
ATOM   2124 C CA    . GLY B 1 14  ? 21.790  6.820   -9.850  1.00 33.52 ? 52  GLY B CA    1 
ATOM   2125 C C     . GLY B 1 14  ? 22.856  7.901   -9.797  1.00 33.46 ? 52  GLY B C     1 
ATOM   2126 O O     . GLY B 1 14  ? 22.831  8.761   -8.904  1.00 32.29 ? 52  GLY B O     1 
ATOM   2127 N N     . PRO B 1 15  ? 23.778  7.903   -10.789 1.00 33.65 ? 53  PRO B N     1 
ATOM   2128 C CA    . PRO B 1 15  ? 24.798  8.947   -10.868 1.00 33.20 ? 53  PRO B CA    1 
ATOM   2129 C C     . PRO B 1 15  ? 24.177  10.331  -10.907 1.00 32.44 ? 53  PRO B C     1 
ATOM   2130 O O     . PRO B 1 15  ? 23.048  10.518  -11.401 1.00 33.77 ? 53  PRO B O     1 
ATOM   2131 C CB    . PRO B 1 15  ? 25.518  8.644   -12.181 1.00 34.94 ? 53  PRO B CB    1 
ATOM   2132 C CG    . PRO B 1 15  ? 25.427  7.141   -12.249 1.00 35.84 ? 53  PRO B CG    1 
ATOM   2133 C CD    . PRO B 1 15  ? 23.986  6.863   -11.830 1.00 35.18 ? 53  PRO B CD    1 
ATOM   2134 N N     . GLY B 1 16  ? 24.915  11.299  -10.380 1.00 32.06 ? 54  GLY B N     1 
ATOM   2135 C CA    . GLY B 1 16  ? 24.439  12.664  -10.395 1.00 31.45 ? 54  GLY B CA    1 
ATOM   2136 C C     . GLY B 1 16  ? 24.723  13.364  -11.723 1.00 32.05 ? 54  GLY B C     1 
ATOM   2137 O O     . GLY B 1 16  ? 25.227  12.743  -12.703 1.00 31.56 ? 54  GLY B O     1 
ATOM   2138 N N     . THR B 1 17  ? 24.406  14.664  -11.749 1.00 30.19 ? 55  THR B N     1 
ATOM   2139 C CA    . THR B 1 17  ? 24.622  15.426  -12.988 1.00 31.08 ? 55  THR B CA    1 
ATOM   2140 C C     . THR B 1 17  ? 26.119  15.411  -13.351 1.00 31.43 ? 55  THR B C     1 
ATOM   2141 O O     . THR B 1 17  ? 27.007  15.576  -12.506 1.00 30.49 ? 55  THR B O     1 
ATOM   2142 C CB    . THR B 1 17  ? 24.123  16.909  -12.822 1.00 29.68 ? 55  THR B CB    1 
ATOM   2143 O OG1   . THR B 1 17  ? 22.704  16.927  -12.513 1.00 32.36 ? 55  THR B OG1   1 
ATOM   2144 C CG2   . THR B 1 17  ? 24.358  17.689  -14.110 1.00 30.88 ? 55  THR B CG2   1 
ATOM   2145 N N     . THR B 1 18  ? 26.404  15.202  -14.644 1.00 29.60 ? 56  THR B N     1 
ATOM   2146 C CA    . THR B 1 18  ? 27.767  15.246  -15.124 1.00 29.40 ? 56  THR B CA    1 
ATOM   2147 C C     . THR B 1 18  ? 28.476  16.534  -14.777 1.00 30.49 ? 56  THR B C     1 
ATOM   2148 O O     . THR B 1 18  ? 27.894  17.624  -14.866 1.00 31.42 ? 56  THR B O     1 
ATOM   2149 C CB    . THR B 1 18  ? 27.748  15.150  -16.655 1.00 30.38 ? 56  THR B CB    1 
ATOM   2150 O OG1   . THR B 1 18  ? 27.019  13.977  -16.981 1.00 31.47 ? 56  THR B OG1   1 
ATOM   2151 C CG2   . THR B 1 18  ? 29.150  15.041  -17.175 1.00 32.47 ? 56  THR B CG2   1 
ATOM   2152 N N     . LYS B 1 19  ? 29.722  16.395  -14.325 1.00 31.60 ? 57  LYS B N     1 
ATOM   2153 C CA    . LYS B 1 19  ? 30.599  17.535  -13.997 1.00 34.15 ? 57  LYS B CA    1 
ATOM   2154 C C     . LYS B 1 19  ? 30.509  18.626  -15.090 1.00 34.21 ? 57  LYS B C     1 
ATOM   2155 O O     . LYS B 1 19  ? 30.670  18.319  -16.285 1.00 33.61 ? 57  LYS B O     1 
ATOM   2156 C CB    . LYS B 1 19  ? 32.062  17.001  -13.965 1.00 34.89 ? 57  LYS B CB    1 
ATOM   2157 C CG    . LYS B 1 19  ? 32.993  17.948  -13.376 1.00 38.92 ? 57  LYS B CG    1 
ATOM   2158 C CD    . LYS B 1 19  ? 34.375  17.391  -13.427 1.00 32.78 ? 57  LYS B CD    1 
ATOM   2159 C CE    . LYS B 1 19  ? 35.250  18.465  -13.019 1.00 34.05 ? 57  LYS B CE    1 
ATOM   2160 N NZ    . LYS B 1 19  ? 36.601  17.967  -12.696 1.00 31.00 ? 57  LYS B NZ    1 
ATOM   2161 N N     . ARG B 1 20  ? 30.333  19.884  -14.680 1.00 34.97 ? 58  ARG B N     1 
ATOM   2162 C CA    . ARG B 1 20  ? 30.299  21.038  -15.604 1.00 35.55 ? 58  ARG B CA    1 
ATOM   2163 C C     . ARG B 1 20  ? 29.268  20.878  -16.759 1.00 35.07 ? 58  ARG B C     1 
ATOM   2164 O O     . ARG B 1 20  ? 29.500  21.308  -17.870 1.00 34.54 ? 58  ARG B O     1 
ATOM   2165 C CB    . ARG B 1 20  ? 31.712  21.323  -16.130 1.00 35.87 ? 58  ARG B CB    1 
ATOM   2166 C CG    . ARG B 1 20  ? 32.678  21.803  -15.027 1.00 38.13 ? 58  ARG B CG    1 
ATOM   2167 C CD    . ARG B 1 20  ? 34.135  21.921  -15.555 1.00 39.81 ? 58  ARG B CD    1 
ATOM   2168 N NE    . ARG B 1 20  ? 34.237  22.841  -16.693 1.00 47.93 ? 58  ARG B NE    1 
ATOM   2169 C CZ    . ARG B 1 20  ? 34.376  24.160  -16.580 1.00 50.19 ? 58  ARG B CZ    1 
ATOM   2170 N NH1   . ARG B 1 20  ? 34.467  24.730  -15.383 1.00 52.53 ? 58  ARG B NH1   1 
ATOM   2171 N NH2   . ARG B 1 20  ? 34.427  24.911  -17.671 1.00 51.73 ? 58  ARG B NH2   1 
ATOM   2172 N N     . PHE B 1 21  ? 28.129  20.295  -16.419 1.00 35.39 ? 59  PHE B N     1 
ATOM   2173 C CA    . PHE B 1 21  ? 26.987  20.113  -17.327 1.00 34.94 ? 59  PHE B CA    1 
ATOM   2174 C C     . PHE B 1 21  ? 26.614  21.416  -18.110 1.00 35.39 ? 59  PHE B C     1 
ATOM   2175 O O     . PHE B 1 21  ? 26.566  21.355  -19.331 1.00 33.67 ? 59  PHE B O     1 
ATOM   2176 C CB    . PHE B 1 21  ? 25.782  19.488  -16.565 1.00 34.41 ? 59  PHE B CB    1 
ATOM   2177 C CG    . PHE B 1 21  ? 24.603  19.193  -17.437 1.00 33.95 ? 59  PHE B CG    1 
ATOM   2178 C CD1   . PHE B 1 21  ? 24.662  18.181  -18.381 1.00 33.20 ? 59  PHE B CD1   1 
ATOM   2179 C CD2   . PHE B 1 21  ? 23.433  19.932  -17.303 1.00 35.34 ? 59  PHE B CD2   1 
ATOM   2180 C CE1   . PHE B 1 21  ? 23.563  17.903  -19.227 1.00 33.28 ? 59  PHE B CE1   1 
ATOM   2181 C CE2   . PHE B 1 21  ? 22.356  19.702  -18.116 1.00 34.35 ? 59  PHE B CE2   1 
ATOM   2182 C CZ    . PHE B 1 21  ? 22.404  18.677  -19.079 1.00 31.35 ? 59  PHE B CZ    1 
ATOM   2183 N N     . PRO B 1 22  ? 26.398  22.578  -17.440 1.00 35.08 ? 60  PRO B N     1 
ATOM   2184 C CA    . PRO B 1 22  ? 25.977  23.770  -18.187 1.00 35.08 ? 60  PRO B CA    1 
ATOM   2185 C C     . PRO B 1 22  ? 27.015  24.165  -19.246 1.00 34.44 ? 60  PRO B C     1 
ATOM   2186 O O     . PRO B 1 22  ? 26.709  24.356  -20.475 1.00 33.30 ? 60  PRO B O     1 
ATOM   2187 C CB    . PRO B 1 22  ? 25.885  24.849  -17.090 1.00 35.02 ? 60  PRO B CB    1 
ATOM   2188 C CG    . PRO B 1 22  ? 25.583  24.034  -15.816 1.00 36.13 ? 60  PRO B CG    1 
ATOM   2189 C CD    . PRO B 1 22  ? 26.514  22.871  -15.988 1.00 35.41 ? 60  PRO B CD    1 
ATOM   2190 N N     . GLU B 1 23  ? 28.269  24.220  -18.815 1.00 32.62 ? 61  GLU B N     1 
ATOM   2191 C CA    . GLU B 1 23  ? 29.366  24.554  -19.711 1.00 33.54 ? 61  GLU B CA    1 
ATOM   2192 C C     . GLU B 1 23  ? 29.479  23.597  -20.875 1.00 33.27 ? 61  GLU B C     1 
ATOM   2193 O O     . GLU B 1 23  ? 29.801  23.996  -22.009 1.00 34.16 ? 61  GLU B O     1 
ATOM   2194 C CB    . GLU B 1 23  ? 30.676  24.453  -18.993 1.00 35.51 ? 61  GLU B CB    1 
ATOM   2195 C CG    . GLU B 1 23  ? 30.858  25.554  -17.991 1.00 38.36 ? 61  GLU B CG    1 
ATOM   2196 C CD    . GLU B 1 23  ? 30.319  25.235  -16.584 1.00 47.54 ? 61  GLU B CD    1 
ATOM   2197 O OE1   . GLU B 1 23  ? 29.509  24.295  -16.368 1.00 46.57 ? 61  GLU B OE1   1 
ATOM   2198 O OE2   . GLU B 1 23  ? 30.735  25.956  -15.662 1.00 49.92 ? 61  GLU B OE2   1 
ATOM   2199 N N     . THR B 1 24  ? 29.314  22.334  -20.534 1.00 33.02 ? 62  THR B N     1 
ATOM   2200 C CA    . THR B 1 24  ? 29.426  21.252  -21.518 1.00 34.19 ? 62  THR B CA    1 
ATOM   2201 C C     . THR B 1 24  ? 28.329  21.336  -22.570 1.00 33.86 ? 62  THR B C     1 
ATOM   2202 O O     . THR B 1 24  ? 28.619  21.209  -23.759 1.00 34.58 ? 62  THR B O     1 
ATOM   2203 C CB    . THR B 1 24  ? 29.415  19.887  -20.848 1.00 34.98 ? 62  THR B CB    1 
ATOM   2204 O OG1   . THR B 1 24  ? 30.567  19.764  -19.987 1.00 37.74 ? 62  THR B OG1   1 
ATOM   2205 C CG2   . THR B 1 24  ? 29.447  18.759  -21.909 1.00 35.07 ? 62  THR B CG2   1 
ATOM   2206 N N     . VAL B 1 25  ? 27.082  21.530  -22.135 1.00 34.41 ? 63  VAL B N     1 
ATOM   2207 C CA    . VAL B 1 25  ? 25.941  21.637  -23.078 1.00 33.61 ? 63  VAL B CA    1 
ATOM   2208 C C     . VAL B 1 25  ? 26.154  22.856  -23.976 1.00 34.51 ? 63  VAL B C     1 
ATOM   2209 O O     . VAL B 1 25  ? 26.058  22.784  -25.201 1.00 32.99 ? 63  VAL B O     1 
ATOM   2210 C CB    . VAL B 1 25  ? 24.565  21.666  -22.358 1.00 34.31 ? 63  VAL B CB    1 
ATOM   2211 C CG1   . VAL B 1 25  ? 23.433  21.965  -23.404 1.00 34.52 ? 63  VAL B CG1   1 
ATOM   2212 C CG2   . VAL B 1 25  ? 24.334  20.289  -21.710 1.00 36.61 ? 63  VAL B CG2   1 
ATOM   2213 N N     . LEU B 1 26  ? 26.488  23.991  -23.370 1.00 32.46 ? 64  LEU B N     1 
ATOM   2214 C CA    . LEU B 1 26  ? 26.760  25.175  -24.204 1.00 34.01 ? 64  LEU B CA    1 
ATOM   2215 C C     . LEU B 1 26  ? 27.884  24.961  -25.224 1.00 33.87 ? 64  LEU B C     1 
ATOM   2216 O O     . LEU B 1 26  ? 27.731  25.312  -26.418 1.00 34.61 ? 64  LEU B O     1 
ATOM   2217 C CB    . LEU B 1 26  ? 27.064  26.372  -23.306 1.00 33.96 ? 64  LEU B CB    1 
ATOM   2218 C CG    . LEU B 1 26  ? 27.017  27.726  -24.025 1.00 37.00 ? 64  LEU B CG    1 
ATOM   2219 C CD1   . LEU B 1 26  ? 25.641  27.949  -24.664 1.00 41.02 ? 64  LEU B CD1   1 
ATOM   2220 C CD2   . LEU B 1 26  ? 27.344  28.823  -22.984 1.00 40.28 ? 64  LEU B CD2   1 
ATOM   2221 N N     . ALA B 1 27  ? 28.989  24.339  -24.788 1.00 33.89 ? 65  ALA B N     1 
ATOM   2222 C CA    . ALA B 1 27  ? 30.153  24.172  -25.653 1.00 35.02 ? 65  ALA B CA    1 
ATOM   2223 C C     . ALA B 1 27  ? 29.815  23.185  -26.765 1.00 34.61 ? 65  ALA B C     1 
ATOM   2224 O O     . ALA B 1 27  ? 30.254  23.336  -27.933 1.00 34.01 ? 65  ALA B O     1 
ATOM   2225 C CB    . ALA B 1 27  ? 31.377  23.724  -24.836 1.00 35.56 ? 65  ALA B CB    1 
ATOM   2226 N N     . ARG B 1 28  ? 28.971  22.209  -26.435 1.00 33.91 ? 66  ARG B N     1 
ATOM   2227 C CA    . ARG B 1 28  ? 28.491  21.266  -27.448 1.00 33.95 ? 66  ARG B CA    1 
ATOM   2228 C C     . ARG B 1 28  ? 27.606  21.949  -28.467 1.00 34.77 ? 66  ARG B C     1 
ATOM   2229 O O     . ARG B 1 28  ? 27.693  21.671  -29.668 1.00 34.89 ? 66  ARG B O     1 
ATOM   2230 C CB    . ARG B 1 28  ? 27.732  20.105  -26.814 1.00 33.01 ? 66  ARG B CB    1 
ATOM   2231 C CG    . ARG B 1 28  ? 28.671  19.009  -26.303 1.00 33.74 ? 66  ARG B CG    1 
ATOM   2232 C CD    . ARG B 1 28  ? 27.930  17.878  -25.635 1.00 32.59 ? 66  ARG B CD    1 
ATOM   2233 N NE    . ARG B 1 28  ? 28.808  16.845  -25.048 1.00 33.79 ? 66  ARG B NE    1 
ATOM   2234 C CZ    . ARG B 1 28  ? 28.368  15.625  -24.725 1.00 36.65 ? 66  ARG B CZ    1 
ATOM   2235 N NH1   . ARG B 1 28  ? 27.079  15.332  -24.922 1.00 36.66 ? 66  ARG B NH1   1 
ATOM   2236 N NH2   . ARG B 1 28  ? 29.200  14.700  -24.195 1.00 36.51 ? 66  ARG B NH2   1 
ATOM   2237 N N     . CYS B 1 29  ? 26.720  22.816  -27.999 1.00 34.58 ? 67  CYS B N     1 
ATOM   2238 C CA    . CYS B 1 29  ? 25.874  23.558  -28.925 1.00 35.47 ? 67  CYS B CA    1 
ATOM   2239 C C     . CYS B 1 29  ? 26.715  24.398  -29.913 1.00 35.66 ? 67  CYS B C     1 
ATOM   2240 O O     . CYS B 1 29  ? 26.499  24.381  -31.130 1.00 33.29 ? 67  CYS B O     1 
ATOM   2241 C CB    . CYS B 1 29  ? 24.908  24.426  -28.141 1.00 35.24 ? 67  CYS B CB    1 
ATOM   2242 S SG    . CYS B 1 29  ? 23.713  25.215  -29.208 1.00 38.74 ? 67  CYS B SG    1 
ATOM   2243 N N     . VAL B 1 30  ? 27.662  25.143  -29.372 1.00 35.10 ? 68  VAL B N     1 
ATOM   2244 C CA    . VAL B 1 30  ? 28.577  25.952  -30.193 1.00 35.59 ? 68  VAL B CA    1 
ATOM   2245 C C     . VAL B 1 30  ? 29.319  25.083  -31.207 1.00 35.39 ? 68  VAL B C     1 
ATOM   2246 O O     . VAL B 1 30  ? 29.353  25.406  -32.415 1.00 34.70 ? 68  VAL B O     1 
ATOM   2247 C CB    . VAL B 1 30  ? 29.560  26.801  -29.317 1.00 36.11 ? 68  VAL B CB    1 
ATOM   2248 C CG1   . VAL B 1 30  ? 30.546  27.551  -30.191 1.00 37.22 ? 68  VAL B CG1   1 
ATOM   2249 C CG2   . VAL B 1 30  ? 28.791  27.802  -28.475 1.00 37.27 ? 68  VAL B CG2   1 
ATOM   2250 N N     . LYS B 1 31  ? 29.902  23.984  -30.741 1.00 35.85 ? 69  LYS B N     1 
ATOM   2251 C CA    . LYS B 1 31  ? 30.640  23.075  -31.629 1.00 36.55 ? 69  LYS B CA    1 
ATOM   2252 C C     . LYS B 1 31  ? 29.751  22.481  -32.713 1.00 36.19 ? 69  LYS B C     1 
ATOM   2253 O O     . LYS B 1 31  ? 30.154  22.429  -33.876 1.00 36.49 ? 69  LYS B O     1 
ATOM   2254 C CB    . LYS B 1 31  ? 31.321  21.944  -30.844 1.00 37.77 ? 69  LYS B CB    1 
ATOM   2255 C CG    . LYS B 1 31  ? 32.343  21.215  -31.700 1.00 40.41 ? 69  LYS B CG    1 
ATOM   2256 C CD    . LYS B 1 31  ? 32.790  19.891  -31.087 1.00 49.06 ? 69  LYS B CD    1 
ATOM   2257 C CE    . LYS B 1 31  ? 34.262  19.580  -31.409 1.00 53.77 ? 69  LYS B CE    1 
ATOM   2258 N NZ    . LYS B 1 31  ? 34.788  18.407  -30.619 1.00 56.57 ? 69  LYS B NZ    1 
ATOM   2259 N N     . TYR B 1 32  ? 28.545  22.048  -32.353 1.00 35.89 ? 70  TYR B N     1 
ATOM   2260 C CA    . TYR B 1 32  ? 27.633  21.447  -33.323 1.00 35.40 ? 70  TYR B CA    1 
ATOM   2261 C C     . TYR B 1 32  ? 27.310  22.451  -34.439 1.00 35.90 ? 70  TYR B C     1 
ATOM   2262 O O     . TYR B 1 32  ? 27.297  22.103  -35.614 1.00 37.02 ? 70  TYR B O     1 
ATOM   2263 C CB    . TYR B 1 32  ? 26.327  20.966  -32.661 1.00 35.66 ? 70  TYR B CB    1 
ATOM   2264 C CG    . TYR B 1 32  ? 25.455  20.175  -33.608 1.00 34.38 ? 70  TYR B CG    1 
ATOM   2265 C CD1   . TYR B 1 32  ? 25.553  18.798  -33.669 1.00 34.32 ? 70  TYR B CD1   1 
ATOM   2266 C CD2   . TYR B 1 32  ? 24.557  20.812  -34.471 1.00 33.63 ? 70  TYR B CD2   1 
ATOM   2267 C CE1   . TYR B 1 32  ? 24.759  18.063  -34.535 1.00 34.36 ? 70  TYR B CE1   1 
ATOM   2268 C CE2   . TYR B 1 32  ? 23.790  20.099  -35.366 1.00 35.45 ? 70  TYR B CE2   1 
ATOM   2269 C CZ    . TYR B 1 32  ? 23.884  18.726  -35.392 1.00 35.78 ? 70  TYR B CZ    1 
ATOM   2270 O OH    . TYR B 1 32  ? 23.135  17.981  -36.286 1.00 33.38 ? 70  TYR B OH    1 
ATOM   2271 N N     . THR B 1 33  ? 27.065  23.702  -34.082 1.00 36.93 ? 71  THR B N     1 
ATOM   2272 C CA    . THR B 1 33  ? 26.655  24.665  -35.105 1.00 37.97 ? 71  THR B CA    1 
ATOM   2273 C C     . THR B 1 33  ? 27.838  25.047  -35.988 1.00 38.39 ? 71  THR B C     1 
ATOM   2274 O O     . THR B 1 33  ? 27.668  25.358  -37.167 1.00 36.90 ? 71  THR B O     1 
ATOM   2275 C CB    . THR B 1 33  ? 25.957  25.890  -34.511 1.00 38.95 ? 71  THR B CB    1 
ATOM   2276 O OG1   . THR B 1 33  ? 26.804  26.496  -33.537 1.00 40.51 ? 71  THR B OG1   1 
ATOM   2277 C CG2   . THR B 1 33  ? 24.648  25.479  -33.829 1.00 40.05 ? 71  THR B CG2   1 
ATOM   2278 N N     . GLU B 1 34  ? 29.033  24.995  -35.417 1.00 38.18 ? 72  GLU B N     1 
ATOM   2279 C CA    . GLU B 1 34  ? 30.258  25.264  -36.193 1.00 39.69 ? 72  GLU B CA    1 
ATOM   2280 C C     . GLU B 1 34  ? 30.440  24.206  -37.265 1.00 39.71 ? 72  GLU B C     1 
ATOM   2281 O O     . GLU B 1 34  ? 30.760  24.508  -38.432 1.00 39.65 ? 72  GLU B O     1 
ATOM   2282 C CB    . GLU B 1 34  ? 31.461  25.341  -35.249 1.00 39.90 ? 72  GLU B CB    1 
ATOM   2283 C CG    . GLU B 1 34  ? 31.441  26.618  -34.425 1.00 43.57 ? 72  GLU B CG    1 
ATOM   2284 C CD    . GLU B 1 34  ? 32.566  26.710  -33.421 1.00 47.80 ? 72  GLU B CD    1 
ATOM   2285 O OE1   . GLU B 1 34  ? 33.110  25.651  -33.057 1.00 49.78 ? 72  GLU B OE1   1 
ATOM   2286 O OE2   . GLU B 1 34  ? 32.903  27.846  -32.998 1.00 49.53 ? 72  GLU B OE2   1 
ATOM   2287 N N     . ILE B 1 35  ? 30.184  22.972  -36.879 1.00 40.30 ? 73  ILE B N     1 
ATOM   2288 C CA    . ILE B 1 35  ? 30.312  21.833  -37.764 1.00 40.34 ? 73  ILE B CA    1 
ATOM   2289 C C     . ILE B 1 35  ? 29.155  21.758  -38.743 1.00 40.88 ? 73  ILE B C     1 
ATOM   2290 O O     . ILE B 1 35  ? 29.381  21.516  -39.938 1.00 40.52 ? 73  ILE B O     1 
ATOM   2291 C CB    . ILE B 1 35  ? 30.473  20.519  -36.969 1.00 41.18 ? 73  ILE B CB    1 
ATOM   2292 C CG1   . ILE B 1 35  ? 31.810  20.539  -36.218 1.00 41.66 ? 73  ILE B CG1   1 
ATOM   2293 C CG2   . ILE B 1 35  ? 30.415  19.289  -37.887 1.00 41.41 ? 73  ILE B CG2   1 
ATOM   2294 C CD1   . ILE B 1 35  ? 31.887  19.550  -35.072 1.00 43.49 ? 73  ILE B CD1   1 
ATOM   2295 N N     . HIS B 1 36  ? 27.939  22.003  -38.269 1.00 39.94 ? 74  HIS B N     1 
ATOM   2296 C CA    . HIS B 1 36  ? 26.747  21.877  -39.109 1.00 40.47 ? 74  HIS B CA    1 
ATOM   2297 C C     . HIS B 1 36  ? 26.129  23.249  -39.378 1.00 39.67 ? 74  HIS B C     1 
ATOM   2298 O O     . HIS B 1 36  ? 25.210  23.683  -38.651 1.00 39.61 ? 74  HIS B O     1 
ATOM   2299 C CB    . HIS B 1 36  ? 25.702  20.939  -38.483 1.00 41.23 ? 74  HIS B CB    1 
ATOM   2300 C CG    . HIS B 1 36  ? 26.180  19.535  -38.274 1.00 42.90 ? 74  HIS B CG    1 
ATOM   2301 N ND1   . HIS B 1 36  ? 26.769  19.118  -37.100 1.00 46.89 ? 74  HIS B ND1   1 
ATOM   2302 C CD2   . HIS B 1 36  ? 26.139  18.448  -39.079 1.00 46.88 ? 74  HIS B CD2   1 
ATOM   2303 C CE1   . HIS B 1 36  ? 27.078  17.836  -37.192 1.00 45.31 ? 74  HIS B CE1   1 
ATOM   2304 N NE2   . HIS B 1 36  ? 26.701  17.405  -38.381 1.00 49.56 ? 74  HIS B NE2   1 
ATOM   2305 N N     . PRO B 1 37  ? 26.608  23.936  -40.429 1.00 38.11 ? 75  PRO B N     1 
ATOM   2306 C CA    . PRO B 1 37  ? 26.182  25.300  -40.713 1.00 37.54 ? 75  PRO B CA    1 
ATOM   2307 C C     . PRO B 1 37  ? 24.686  25.477  -40.899 1.00 37.22 ? 75  PRO B C     1 
ATOM   2308 O O     . PRO B 1 37  ? 24.191  26.585  -40.744 1.00 37.16 ? 75  PRO B O     1 
ATOM   2309 C CB    . PRO B 1 37  ? 26.931  25.633  -42.004 1.00 37.60 ? 75  PRO B CB    1 
ATOM   2310 C CG    . PRO B 1 37  ? 28.118  24.780  -41.944 1.00 38.14 ? 75  PRO B CG    1 
ATOM   2311 C CD    . PRO B 1 37  ? 27.625  23.495  -41.404 1.00 37.01 ? 75  PRO B CD    1 
ATOM   2312 N N     . GLU B 1 38  ? 23.967  24.404  -41.205 1.00 37.76 ? 76  GLU B N     1 
ATOM   2313 C CA    . GLU B 1 38  ? 22.516  24.516  -41.371 1.00 38.82 ? 76  GLU B CA    1 
ATOM   2314 C C     . GLU B 1 38  ? 21.796  24.741  -40.036 1.00 38.26 ? 76  GLU B C     1 
ATOM   2315 O O     . GLU B 1 38  ? 20.606  25.077  -40.011 1.00 38.36 ? 76  GLU B O     1 
ATOM   2316 C CB    . GLU B 1 38  ? 21.937  23.294  -42.102 1.00 39.15 ? 76  GLU B CB    1 
ATOM   2317 C CG    . GLU B 1 38  ? 21.887  22.025  -41.293 1.00 41.09 ? 76  GLU B CG    1 
ATOM   2318 C CD    . GLU B 1 38  ? 23.236  21.314  -41.199 1.00 43.40 ? 76  GLU B CD    1 
ATOM   2319 O OE1   . GLU B 1 38  ? 24.254  21.831  -41.728 1.00 44.50 ? 76  GLU B OE1   1 
ATOM   2320 O OE2   . GLU B 1 38  ? 23.266  20.233  -40.576 1.00 48.13 ? 76  GLU B OE2   1 
ATOM   2321 N N     . MET B 1 39  ? 22.509  24.565  -38.931 1.00 38.02 ? 77  MET B N     1 
ATOM   2322 C CA    . MET B 1 39  ? 21.891  24.809  -37.625 1.00 37.34 ? 77  MET B CA    1 
ATOM   2323 C C     . MET B 1 39  ? 22.381  26.080  -36.933 1.00 37.40 ? 77  MET B C     1 
ATOM   2324 O O     . MET B 1 39  ? 22.106  26.295  -35.756 1.00 36.47 ? 77  MET B O     1 
ATOM   2325 C CB    . MET B 1 39  ? 22.053  23.588  -36.729 1.00 37.77 ? 77  MET B CB    1 
ATOM   2326 C CG    . MET B 1 39  ? 21.231  22.394  -37.232 1.00 39.50 ? 77  MET B CG    1 
ATOM   2327 S SD    . MET B 1 39  ? 19.448  22.700  -37.125 1.00 40.71 ? 77  MET B SD    1 
ATOM   2328 C CE    . MET B 1 39  ? 19.136  22.697  -35.358 1.00 39.76 ? 77  MET B CE    1 
ATOM   2329 N N     . ARG B 1 40  ? 23.065  26.942  -37.681 1.00 37.65 ? 78  ARG B N     1 
ATOM   2330 C CA    . ARG B 1 40  ? 23.621  28.182  -37.111 1.00 38.00 ? 78  ARG B CA    1 
ATOM   2331 C C     . ARG B 1 40  ? 22.578  29.256  -36.789 1.00 38.30 ? 78  ARG B C     1 
ATOM   2332 O O     . ARG B 1 40  ? 22.899  30.256  -36.135 1.00 40.58 ? 78  ARG B O     1 
ATOM   2333 C CB    . ARG B 1 40  ? 24.722  28.746  -38.008 1.00 37.56 ? 78  ARG B CB    1 
ATOM   2334 C CG    . ARG B 1 40  ? 25.979  27.941  -37.920 1.00 36.05 ? 78  ARG B CG    1 
ATOM   2335 C CD    . ARG B 1 40  ? 26.951  28.326  -38.990 1.00 37.18 ? 78  ARG B CD    1 
ATOM   2336 N NE    . ARG B 1 40  ? 28.196  27.561  -38.898 1.00 35.12 ? 78  ARG B NE    1 
ATOM   2337 C CZ    . ARG B 1 40  ? 29.278  27.851  -39.607 1.00 33.46 ? 78  ARG B CZ    1 
ATOM   2338 N NH1   . ARG B 1 40  ? 29.239  28.853  -40.464 1.00 32.23 ? 78  ARG B NH1   1 
ATOM   2339 N NH2   . ARG B 1 40  ? 30.377  27.122  -39.475 1.00 33.91 ? 78  ARG B NH2   1 
ATOM   2340 N N     . HIS B 1 41  ? 21.340  29.042  -37.222 1.00 38.01 ? 79  HIS B N     1 
ATOM   2341 C CA    . HIS B 1 41  ? 20.217  29.900  -36.854 1.00 37.95 ? 79  HIS B CA    1 
ATOM   2342 C C     . HIS B 1 41  ? 19.831  29.776  -35.387 1.00 37.89 ? 79  HIS B C     1 
ATOM   2343 O O     . HIS B 1 41  ? 19.025  30.556  -34.873 1.00 38.16 ? 79  HIS B O     1 
ATOM   2344 C CB    . HIS B 1 41  ? 19.007  29.562  -37.713 1.00 39.14 ? 79  HIS B CB    1 
ATOM   2345 C CG    . HIS B 1 41  ? 18.508  28.153  -37.552 1.00 39.31 ? 79  HIS B CG    1 
ATOM   2346 N ND1   . HIS B 1 41  ? 18.957  27.109  -38.338 1.00 39.30 ? 79  HIS B ND1   1 
ATOM   2347 C CD2   . HIS B 1 41  ? 17.569  27.630  -36.728 1.00 39.57 ? 79  HIS B CD2   1 
ATOM   2348 C CE1   . HIS B 1 41  ? 18.319  26.002  -37.997 1.00 41.97 ? 79  HIS B CE1   1 
ATOM   2349 N NE2   . HIS B 1 41  ? 17.481  26.287  -37.010 1.00 43.09 ? 79  HIS B NE2   1 
ATOM   2350 N N     . VAL B 1 42  ? 20.374  28.758  -34.743 1.00 37.13 ? 80  VAL B N     1 
ATOM   2351 C CA    . VAL B 1 42  ? 20.110  28.460  -33.336 1.00 38.20 ? 80  VAL B CA    1 
ATOM   2352 C C     . VAL B 1 42  ? 20.864  29.464  -32.439 1.00 37.71 ? 80  VAL B C     1 
ATOM   2353 O O     . VAL B 1 42  ? 21.984  29.841  -32.751 1.00 38.12 ? 80  VAL B O     1 
ATOM   2354 C CB    . VAL B 1 42  ? 20.561  27.005  -33.094 1.00 39.01 ? 80  VAL B CB    1 
ATOM   2355 C CG1   . VAL B 1 42  ? 21.038  26.769  -31.710 1.00 40.15 ? 80  VAL B CG1   1 
ATOM   2356 C CG2   . VAL B 1 42  ? 19.452  26.024  -33.523 1.00 39.90 ? 80  VAL B CG2   1 
ATOM   2357 N N     . ASP B 1 43  ? 20.245  29.914  -31.348 1.00 37.72 ? 81  ASP B N     1 
ATOM   2358 C CA    . ASP B 1 43  ? 20.954  30.721  -30.346 1.00 38.04 ? 81  ASP B CA    1 
ATOM   2359 C C     . ASP B 1 43  ? 21.319  29.758  -29.218 1.00 36.93 ? 81  ASP B C     1 
ATOM   2360 O O     . ASP B 1 43  ? 20.436  29.270  -28.498 1.00 36.34 ? 81  ASP B O     1 
ATOM   2361 C CB    . ASP B 1 43  ? 20.068  31.868  -29.825 1.00 38.46 ? 81  ASP B CB    1 
ATOM   2362 C CG    . ASP B 1 43  ? 20.768  32.744  -28.772 1.00 41.33 ? 81  ASP B CG    1 
ATOM   2363 O OD1   . ASP B 1 43  ? 20.707  33.985  -28.882 1.00 46.91 ? 81  ASP B OD1   1 
ATOM   2364 O OD2   . ASP B 1 43  ? 21.371  32.234  -27.824 1.00 44.96 ? 81  ASP B OD2   1 
ATOM   2365 N N     . CYS B 1 44  ? 22.608  29.482  -29.049 1.00 37.12 ? 82  CYS B N     1 
ATOM   2366 C CA    . CYS B 1 44  ? 22.990  28.442  -28.098 1.00 37.49 ? 82  CYS B CA    1 
ATOM   2367 C C     . CYS B 1 44  ? 22.630  28.758  -26.656 1.00 37.08 ? 82  CYS B C     1 
ATOM   2368 O O     . CYS B 1 44  ? 22.252  27.848  -25.915 1.00 36.09 ? 82  CYS B O     1 
ATOM   2369 C CB    . CYS B 1 44  ? 24.451  28.067  -28.218 1.00 39.19 ? 82  CYS B CB    1 
ATOM   2370 S SG    . CYS B 1 44  ? 24.714  26.993  -29.689 1.00 46.23 ? 82  CYS B SG    1 
ATOM   2371 N N     . GLN B 1 45  ? 22.699  30.041  -26.285 1.00 35.76 ? 83  GLN B N     1 
ATOM   2372 C CA    . GLN B 1 45  ? 22.256  30.447  -24.927 1.00 36.44 ? 83  GLN B CA    1 
ATOM   2373 C C     . GLN B 1 45  ? 20.769  30.166  -24.734 1.00 35.42 ? 83  GLN B C     1 
ATOM   2374 O O     . GLN B 1 45  ? 20.373  29.687  -23.682 1.00 34.60 ? 83  GLN B O     1 
ATOM   2375 C CB    . GLN B 1 45  ? 22.564  31.925  -24.644 1.00 35.95 ? 83  GLN B CB    1 
ATOM   2376 C CG    . GLN B 1 45  ? 22.216  32.350  -23.212 1.00 39.12 ? 83  GLN B CG    1 
ATOM   2377 C CD    . GLN B 1 45  ? 23.062  31.682  -22.147 1.00 41.48 ? 83  GLN B CD    1 
ATOM   2378 O OE1   . GLN B 1 45  ? 22.535  31.208  -21.127 1.00 45.28 ? 83  GLN B OE1   1 
ATOM   2379 N NE2   . GLN B 1 45  ? 24.381  31.653  -22.360 1.00 41.45 ? 83  GLN B NE2   1 
ATOM   2380 N N     . SER B 1 46  ? 19.965  30.410  -25.772 1.00 35.03 ? 84  SER B N     1 
ATOM   2381 C CA    . SER B 1 46  ? 18.513  30.193  -25.699 1.00 34.46 ? 84  SER B CA    1 
ATOM   2382 C C     . SER B 1 46  ? 18.254  28.708  -25.599 1.00 34.29 ? 84  SER B C     1 
ATOM   2383 O O     . SER B 1 46  ? 17.406  28.267  -24.834 1.00 33.04 ? 84  SER B O     1 
ATOM   2384 C CB    . SER B 1 46  ? 17.785  30.787  -26.917 1.00 34.79 ? 84  SER B CB    1 
ATOM   2385 O OG    . SER B 1 46  ? 17.948  32.201  -27.036 1.00 38.39 ? 84  SER B OG    1 
ATOM   2386 N N     . VAL B 1 47  ? 19.023  27.926  -26.348 1.00 33.65 ? 85  VAL B N     1 
ATOM   2387 C CA    . VAL B 1 47  ? 18.933  26.476  -26.260 1.00 32.97 ? 85  VAL B CA    1 
ATOM   2388 C C     . VAL B 1 47  ? 19.222  25.984  -24.840 1.00 33.50 ? 85  VAL B C     1 
ATOM   2389 O O     . VAL B 1 47  ? 18.445  25.202  -24.260 1.00 34.48 ? 85  VAL B O     1 
ATOM   2390 C CB    . VAL B 1 47  ? 19.893  25.813  -27.253 1.00 33.56 ? 85  VAL B CB    1 
ATOM   2391 C CG1   . VAL B 1 47  ? 19.970  24.318  -26.965 1.00 33.41 ? 85  VAL B CG1   1 
ATOM   2392 C CG2   . VAL B 1 47  ? 19.379  26.005  -28.681 1.00 34.24 ? 85  VAL B CG2   1 
ATOM   2393 N N     . TRP B 1 48  ? 20.327  26.450  -24.261 1.00 33.58 ? 86  TRP B N     1 
ATOM   2394 C CA    . TRP B 1 48  ? 20.645  26.070  -22.877 1.00 33.86 ? 86  TRP B CA    1 
ATOM   2395 C C     . TRP B 1 48  ? 19.534  26.500  -21.906 1.00 33.96 ? 86  TRP B C     1 
ATOM   2396 O O     . TRP B 1 48  ? 19.129  25.720  -21.030 1.00 33.22 ? 86  TRP B O     1 
ATOM   2397 C CB    . TRP B 1 48  ? 22.011  26.614  -22.433 1.00 33.64 ? 86  TRP B CB    1 
ATOM   2398 C CG    . TRP B 1 48  ? 22.196  26.510  -20.917 1.00 33.97 ? 86  TRP B CG    1 
ATOM   2399 C CD1   . TRP B 1 48  ? 22.327  27.548  -20.042 1.00 35.62 ? 86  TRP B CD1   1 
ATOM   2400 C CD2   . TRP B 1 48  ? 22.229  25.314  -20.123 1.00 34.75 ? 86  TRP B CD2   1 
ATOM   2401 N NE1   . TRP B 1 48  ? 22.442  27.072  -18.746 1.00 34.85 ? 86  TRP B NE1   1 
ATOM   2402 C CE2   . TRP B 1 48  ? 22.373  25.702  -18.778 1.00 34.91 ? 86  TRP B CE2   1 
ATOM   2403 C CE3   . TRP B 1 48  ? 22.124  23.950  -20.413 1.00 34.61 ? 86  TRP B CE3   1 
ATOM   2404 C CZ2   . TRP B 1 48  ? 22.429  24.780  -17.734 1.00 33.45 ? 86  TRP B CZ2   1 
ATOM   2405 C CZ3   . TRP B 1 48  ? 22.191  23.029  -19.349 1.00 34.10 ? 86  TRP B CZ3   1 
ATOM   2406 C CH2   . TRP B 1 48  ? 22.348  23.460  -18.030 1.00 35.88 ? 86  TRP B CH2   1 
ATOM   2407 N N     . ASP B 1 49  ? 19.024  27.721  -22.062 1.00 34.64 ? 87  ASP B N     1 
ATOM   2408 C CA    . ASP B 1 49  ? 17.960  28.226  -21.167 1.00 34.26 ? 87  ASP B CA    1 
ATOM   2409 C C     . ASP B 1 49  ? 16.710  27.338  -21.256 1.00 33.75 ? 87  ASP B C     1 
ATOM   2410 O O     . ASP B 1 49  ? 16.070  27.030  -20.250 1.00 33.28 ? 87  ASP B O     1 
ATOM   2411 C CB    . ASP B 1 49  ? 17.614  29.689  -21.494 1.00 36.21 ? 87  ASP B CB    1 
ATOM   2412 C CG    . ASP B 1 49  ? 18.743  30.648  -21.131 1.00 38.10 ? 87  ASP B CG    1 
ATOM   2413 O OD1   . ASP B 1 49  ? 19.609  30.273  -20.322 1.00 44.02 ? 87  ASP B OD1   1 
ATOM   2414 O OD2   . ASP B 1 49  ? 18.749  31.778  -21.635 1.00 41.85 ? 87  ASP B OD2   1 
ATOM   2415 N N     . ALA B 1 50  ? 16.388  26.878  -22.456 1.00 32.07 ? 88  ALA B N     1 
ATOM   2416 C CA    . ALA B 1 50  ? 15.219  26.012  -22.638 1.00 32.33 ? 88  ALA B CA    1 
ATOM   2417 C C     . ALA B 1 50  ? 15.418  24.605  -22.073 1.00 31.16 ? 88  ALA B C     1 
ATOM   2418 O O     . ALA B 1 50  ? 14.501  23.970  -21.513 1.00 32.28 ? 88  ALA B O     1 
ATOM   2419 C CB    . ALA B 1 50  ? 14.884  25.935  -24.145 1.00 30.75 ? 88  ALA B CB    1 
ATOM   2420 N N     . PHE B 1 51  ? 16.641  24.107  -22.179 1.00 31.81 ? 89  PHE B N     1 
ATOM   2421 C CA    . PHE B 1 51  ? 17.021  22.798  -21.635 1.00 32.15 ? 89  PHE B CA    1 
ATOM   2422 C C     . PHE B 1 51  ? 16.941  22.843  -20.096 1.00 34.43 ? 89  PHE B C     1 
ATOM   2423 O O     . PHE B 1 51  ? 16.241  22.049  -19.442 1.00 33.75 ? 89  PHE B O     1 
ATOM   2424 C CB    . PHE B 1 51  ? 18.457  22.524  -22.091 1.00 33.25 ? 89  PHE B CB    1 
ATOM   2425 C CG    . PHE B 1 51  ? 18.882  21.082  -22.048 1.00 32.92 ? 89  PHE B CG    1 
ATOM   2426 C CD1   . PHE B 1 51  ? 18.358  20.178  -21.123 1.00 34.74 ? 89  PHE B CD1   1 
ATOM   2427 C CD2   . PHE B 1 51  ? 19.827  20.615  -22.964 1.00 36.99 ? 89  PHE B CD2   1 
ATOM   2428 C CE1   . PHE B 1 51  ? 18.792  18.816  -21.063 1.00 34.54 ? 89  PHE B CE1   1 
ATOM   2429 C CE2   . PHE B 1 51  ? 20.261  19.231  -22.891 1.00 37.51 ? 89  PHE B CE2   1 
ATOM   2430 C CZ    . PHE B 1 51  ? 19.732  18.368  -21.945 1.00 35.87 ? 89  PHE B CZ    1 
ATOM   2431 N N     . LYS B 1 52  ? 17.642  23.815  -19.527 1.00 35.02 ? 90  LYS B N     1 
ATOM   2432 C CA    . LYS B 1 52  ? 17.618  24.013  -18.069 1.00 36.63 ? 90  LYS B CA    1 
ATOM   2433 C C     . LYS B 1 52  ? 16.159  24.182  -17.551 1.00 35.56 ? 90  LYS B C     1 
ATOM   2434 O O     . LYS B 1 52  ? 15.777  23.618  -16.511 1.00 36.16 ? 90  LYS B O     1 
ATOM   2435 C CB    . LYS B 1 52  ? 18.474  25.259  -17.816 1.00 38.07 ? 90  LYS B CB    1 
ATOM   2436 C CG    . LYS B 1 52  ? 18.725  25.641  -16.416 1.00 42.43 ? 90  LYS B CG    1 
ATOM   2437 C CD    . LYS B 1 52  ? 19.763  26.753  -16.377 1.00 45.91 ? 90  LYS B CD    1 
ATOM   2438 C CE    . LYS B 1 52  ? 19.323  28.074  -17.017 1.00 50.98 ? 90  LYS B CE    1 
ATOM   2439 N NZ    . LYS B 1 52  ? 20.120  29.230  -16.431 1.00 54.13 ? 90  LYS B NZ    1 
ATOM   2440 N N     . GLY B 1 53  ? 15.356  24.950  -18.272 1.00 34.82 ? 91  GLY B N     1 
ATOM   2441 C CA    . GLY B 1 53  ? 13.938  25.182  -17.970 1.00 34.67 ? 91  GLY B CA    1 
ATOM   2442 C C     . GLY B 1 53  ? 13.086  23.930  -17.881 1.00 35.32 ? 91  GLY B C     1 
ATOM   2443 O O     . GLY B 1 53  ? 12.129  23.890  -17.136 1.00 34.58 ? 91  GLY B O     1 
ATOM   2444 N N     . ALA B 1 54  ? 13.437  22.903  -18.660 1.00 33.30 ? 92  ALA B N     1 
ATOM   2445 C CA    . ALA B 1 54  ? 12.739  21.621  -18.582 1.00 34.19 ? 92  ALA B CA    1 
ATOM   2446 C C     . ALA B 1 54  ? 12.805  20.925  -17.238 1.00 33.69 ? 92  ALA B C     1 
ATOM   2447 O O     . ALA B 1 54  ? 11.900  20.153  -16.898 1.00 33.68 ? 92  ALA B O     1 
ATOM   2448 C CB    . ALA B 1 54  ? 13.261  20.702  -19.622 1.00 34.88 ? 92  ALA B CB    1 
ATOM   2449 N N     . PHE B 1 55  ? 13.888  21.157  -16.486 1.00 33.26 ? 93  PHE B N     1 
ATOM   2450 C CA    . PHE B 1 55  ? 14.089  20.349  -15.266 1.00 33.07 ? 93  PHE B CA    1 
ATOM   2451 C C     . PHE B 1 55  ? 14.494  21.109  -14.008 1.00 33.79 ? 93  PHE B C     1 
ATOM   2452 O O     . PHE B 1 55  ? 14.336  20.593  -12.923 1.00 34.05 ? 93  PHE B O     1 
ATOM   2453 C CB    . PHE B 1 55  ? 15.073  19.212  -15.542 1.00 33.61 ? 93  PHE B CB    1 
ATOM   2454 C CG    . PHE B 1 55  ? 16.482  19.673  -15.721 1.00 34.50 ? 93  PHE B CG    1 
ATOM   2455 C CD1   . PHE B 1 55  ? 17.344  19.680  -14.628 1.00 35.38 ? 93  PHE B CD1   1 
ATOM   2456 C CD2   . PHE B 1 55  ? 16.944  20.128  -16.959 1.00 35.33 ? 93  PHE B CD2   1 
ATOM   2457 C CE1   . PHE B 1 55  ? 18.641  20.091  -14.727 1.00 35.66 ? 93  PHE B CE1   1 
ATOM   2458 C CE2   . PHE B 1 55  ? 18.271  20.578  -17.104 1.00 35.84 ? 93  PHE B CE2   1 
ATOM   2459 C CZ    . PHE B 1 55  ? 19.133  20.552  -15.948 1.00 33.46 ? 93  PHE B CZ    1 
ATOM   2460 N N     . ILE B 1 56  ? 15.007  22.329  -14.146 1.00 33.81 ? 94  ILE B N     1 
ATOM   2461 C CA    . ILE B 1 56  ? 15.417  23.033  -12.948 1.00 36.00 ? 94  ILE B CA    1 
ATOM   2462 C C     . ILE B 1 56  ? 14.175  23.348  -12.109 1.00 34.40 ? 94  ILE B C     1 
ATOM   2463 O O     . ILE B 1 56  ? 13.118  23.678  -12.655 1.00 35.15 ? 94  ILE B O     1 
ATOM   2464 C CB    . ILE B 1 56  ? 16.231  24.296  -13.353 1.00 37.91 ? 94  ILE B CB    1 
ATOM   2465 C CG1   . ILE B 1 56  ? 17.629  23.824  -13.775 1.00 40.98 ? 94  ILE B CG1   1 
ATOM   2466 C CG2   . ILE B 1 56  ? 16.379  25.265  -12.201 1.00 42.23 ? 94  ILE B CG2   1 
ATOM   2467 C CD1   . ILE B 1 56  ? 18.486  23.331  -12.565 1.00 43.71 ? 94  ILE B CD1   1 
ATOM   2468 N N     . SER B 1 57  ? 14.293  23.240  -10.788 1.00 34.10 ? 95  SER B N     1 
ATOM   2469 C CA    . SER B 1 57  ? 13.154  23.546  -9.895  1.00 35.87 ? 95  SER B CA    1 
ATOM   2470 C C     . SER B 1 57  ? 11.965  22.618  -10.114 1.00 36.19 ? 95  SER B C     1 
ATOM   2471 O O     . SER B 1 57  ? 10.803  23.025  -9.882  1.00 39.61 ? 95  SER B O     1 
ATOM   2472 C CB    . SER B 1 57  ? 12.617  24.985  -10.066 1.00 36.00 ? 95  SER B CB    1 
ATOM   2473 O OG    . SER B 1 57  ? 13.666  25.943  -9.917  1.00 38.95 ? 95  SER B OG    1 
ATOM   2474 N N     . LYS B 1 58  ? 12.217  21.423  -10.617 1.00 33.81 ? 96  LYS B N     1 
ATOM   2475 C CA    . LYS B 1 58  ? 11.133  20.453  -10.742 1.00 33.16 ? 96  LYS B CA    1 
ATOM   2476 C C     . LYS B 1 58  ? 11.587  19.212  -10.011 1.00 31.24 ? 96  LYS B C     1 
ATOM   2477 O O     . LYS B 1 58  ? 12.788  18.883  -9.930  1.00 31.98 ? 96  LYS B O     1 
ATOM   2478 C CB    . LYS B 1 58  ? 10.885  20.150  -12.241 1.00 33.03 ? 96  LYS B CB    1 
ATOM   2479 C CG    . LYS B 1 58  ? 10.322  21.343  -12.990 1.00 33.36 ? 96  LYS B CG    1 
ATOM   2480 C CD    . LYS B 1 58  ? 10.104  21.075  -14.489 1.00 35.82 ? 96  LYS B CD    1 
ATOM   2481 C CE    . LYS B 1 58  ? 9.535   22.349  -15.075 1.00 38.54 ? 96  LYS B CE    1 
ATOM   2482 N NZ    . LYS B 1 58  ? 9.409   22.350  -16.556 1.00 46.11 ? 96  LYS B NZ    1 
ATOM   2483 N N     . HIS B 1 59  ? 10.623  18.519  -9.439  1.00 30.82 ? 97  HIS B N     1 
ATOM   2484 C CA    . HIS B 1 59  ? 10.930  17.255  -8.810  1.00 31.10 ? 97  HIS B CA    1 
ATOM   2485 C C     . HIS B 1 59  ? 11.364  16.248  -9.864  1.00 31.97 ? 97  HIS B C     1 
ATOM   2486 O O     . HIS B 1 59  ? 10.688  16.117  -10.848 1.00 32.42 ? 97  HIS B O     1 
ATOM   2487 C CB    . HIS B 1 59  ? 9.710   16.738  -8.074  1.00 31.75 ? 97  HIS B CB    1 
ATOM   2488 C CG    . HIS B 1 59  ? 10.040  15.590  -7.189  1.00 33.64 ? 97  HIS B CG    1 
ATOM   2489 N ND1   . HIS B 1 59  ? 10.398  14.362  -7.698  1.00 33.81 ? 97  HIS B ND1   1 
ATOM   2490 C CD2   . HIS B 1 59  ? 10.143  15.496  -5.841  1.00 31.17 ? 97  HIS B CD2   1 
ATOM   2491 C CE1   . HIS B 1 59  ? 10.693  13.550  -6.695  1.00 34.90 ? 97  HIS B CE1   1 
ATOM   2492 N NE2   . HIS B 1 59  ? 10.546  14.213  -5.555  1.00 33.38 ? 97  HIS B NE2   1 
ATOM   2493 N N     . PRO B 1 60  ? 12.546  15.635  -9.698  1.00 32.98 ? 98  PRO B N     1 
ATOM   2494 C CA    . PRO B 1 60  ? 13.068  14.803  -10.775 1.00 32.89 ? 98  PRO B CA    1 
ATOM   2495 C C     . PRO B 1 60  ? 12.367  13.478  -11.001 1.00 33.58 ? 98  PRO B C     1 
ATOM   2496 O O     . PRO B 1 60  ? 12.855  12.687  -11.805 1.00 33.93 ? 98  PRO B O     1 
ATOM   2497 C CB    . PRO B 1 60  ? 14.544  14.626  -10.455 1.00 34.27 ? 98  PRO B CB    1 
ATOM   2498 C CG    . PRO B 1 60  ? 14.650  14.788  -8.919  1.00 32.33 ? 98  PRO B CG    1 
ATOM   2499 C CD    . PRO B 1 60  ? 13.497  15.772  -8.571  1.00 32.92 ? 98  PRO B CD    1 
ATOM   2500 N N     . CYS B 1 61  ? 11.261  13.242  -10.300 1.00 31.52 ? 99  CYS B N     1 
ATOM   2501 C CA    . CYS B 1 61  ? 10.375  12.118  -10.619 1.00 32.09 ? 99  CYS B CA    1 
ATOM   2502 C C     . CYS B 1 61  ? 9.102   12.554  -11.379 1.00 30.77 ? 99  CYS B C     1 
ATOM   2503 O O     . CYS B 1 61  ? 8.249   11.699  -11.722 1.00 31.72 ? 99  CYS B O     1 
ATOM   2504 C CB    . CYS B 1 61  ? 10.016  11.336  -9.366  1.00 33.06 ? 99  CYS B CB    1 
ATOM   2505 S SG    . CYS B 1 61  ? 11.522  10.464  -8.751  1.00 36.32 ? 99  CYS B SG    1 
ATOM   2506 N N     . ASP B 1 62  ? 8.981   13.867  -11.648 1.00 29.79 ? 100 ASP B N     1 
ATOM   2507 C CA    . ASP B 1 62  ? 7.716   14.460  -12.056 1.00 30.14 ? 100 ASP B CA    1 
ATOM   2508 C C     . ASP B 1 62  ? 7.851   15.153  -13.397 1.00 31.24 ? 100 ASP B C     1 
ATOM   2509 O O     . ASP B 1 62  ? 6.994   15.998  -13.749 1.00 31.87 ? 100 ASP B O     1 
ATOM   2510 C CB    . ASP B 1 62  ? 7.198   15.422  -11.010 1.00 31.42 ? 100 ASP B CB    1 
ATOM   2511 C CG    . ASP B 1 62  ? 6.765   14.710  -9.768  1.00 32.60 ? 100 ASP B CG    1 
ATOM   2512 O OD1   . ASP B 1 62  ? 6.399   13.507  -9.842  1.00 30.80 ? 100 ASP B OD1   1 
ATOM   2513 O OD2   . ASP B 1 62  ? 6.729   15.356  -8.714  1.00 32.41 ? 100 ASP B OD2   1 
ATOM   2514 N N     . ILE B 1 63  ? 8.862   14.761  -14.163 1.00 31.20 ? 101 ILE B N     1 
ATOM   2515 C CA    . ILE B 1 63  ? 9.163   15.417  -15.467 1.00 31.32 ? 101 ILE B CA    1 
ATOM   2516 C C     . ILE B 1 63  ? 8.212   14.884  -16.532 1.00 32.43 ? 101 ILE B C     1 
ATOM   2517 O O     . ILE B 1 63  ? 7.821   13.727  -16.469 1.00 31.80 ? 101 ILE B O     1 
ATOM   2518 C CB    . ILE B 1 63  ? 10.631  15.211  -15.924 1.00 30.22 ? 101 ILE B CB    1 
ATOM   2519 C CG1   . ILE B 1 63  ? 11.593  15.575  -14.768 1.00 32.39 ? 101 ILE B CG1   1 
ATOM   2520 C CG2   . ILE B 1 63  ? 10.911  16.053  -17.171 1.00 34.12 ? 101 ILE B CG2   1 
ATOM   2521 C CD1   . ILE B 1 63  ? 11.431  17.027  -14.336 1.00 32.52 ? 101 ILE B CD1   1 
ATOM   2522 N N     . THR B 1 64  ? 7.790   15.758  -17.455 1.00 32.46 ? 102 THR B N     1 
ATOM   2523 C CA    . THR B 1 64  ? 6.800   15.387  -18.495 1.00 33.95 ? 102 THR B CA    1 
ATOM   2524 C C     . THR B 1 64  ? 7.388   15.721  -19.849 1.00 33.54 ? 102 THR B C     1 
ATOM   2525 O O     . THR B 1 64  ? 8.322   16.510  -19.966 1.00 33.18 ? 102 THR B O     1 
ATOM   2526 C CB    . THR B 1 64  ? 5.491   16.200  -18.351 1.00 33.48 ? 102 THR B CB    1 
ATOM   2527 O OG1   . THR B 1 64  ? 5.782   17.600  -18.540 1.00 36.04 ? 102 THR B OG1   1 
ATOM   2528 C CG2   . THR B 1 64  ? 4.873   16.012  -16.955 1.00 34.46 ? 102 THR B CG2   1 
ATOM   2529 N N     . GLU B 1 65  ? 6.859   15.082  -20.883 1.00 34.33 ? 103 GLU B N     1 
ATOM   2530 C CA    . GLU B 1 65  ? 7.290   15.466  -22.236 1.00 34.88 ? 103 GLU B CA    1 
ATOM   2531 C C     . GLU B 1 65  ? 7.037   16.973  -22.519 1.00 34.31 ? 103 GLU B C     1 
ATOM   2532 O O     . GLU B 1 65  ? 7.870   17.649  -23.159 1.00 35.37 ? 103 GLU B O     1 
ATOM   2533 C CB    . GLU B 1 65  ? 6.617   14.522  -23.242 1.00 36.01 ? 103 GLU B CB    1 
ATOM   2534 C CG    . GLU B 1 65  ? 7.116   13.087  -23.017 1.00 40.72 ? 103 GLU B CG    1 
ATOM   2535 C CD    . GLU B 1 65  ? 6.717   12.083  -24.088 1.00 48.62 ? 103 GLU B CD    1 
ATOM   2536 O OE1   . GLU B 1 65  ? 5.559   12.127  -24.551 1.00 54.38 ? 103 GLU B OE1   1 
ATOM   2537 O OE2   . GLU B 1 65  ? 7.559   11.235  -24.454 1.00 51.45 ? 103 GLU B OE2   1 
ATOM   2538 N N     . GLU B 1 66  ? 5.935   17.499  -22.012 1.00 34.08 ? 104 GLU B N     1 
ATOM   2539 C CA    . GLU B 1 66  ? 5.632   18.906  -22.153 1.00 34.43 ? 104 GLU B CA    1 
ATOM   2540 C C     . GLU B 1 66  ? 6.722   19.816  -21.550 1.00 34.17 ? 104 GLU B C     1 
ATOM   2541 O O     . GLU B 1 66  ? 6.974   20.904  -22.086 1.00 34.75 ? 104 GLU B O     1 
ATOM   2542 C CB    . GLU B 1 66  ? 4.243   19.227  -21.621 1.00 35.06 ? 104 GLU B CB    1 
ATOM   2543 C CG    . GLU B 1 66  ? 3.112   18.373  -22.263 1.00 40.28 ? 104 GLU B CG    1 
ATOM   2544 C CD    . GLU B 1 66  ? 2.630   17.192  -21.368 1.00 48.28 ? 104 GLU B CD    1 
ATOM   2545 O OE1   . GLU B 1 66  ? 3.456   16.323  -20.959 1.00 44.33 ? 104 GLU B OE1   1 
ATOM   2546 O OE2   . GLU B 1 66  ? 1.395   17.141  -21.096 1.00 51.08 ? 104 GLU B OE2   1 
ATOM   2547 N N     . ASP B 1 67  ? 7.403   19.355  -20.497 1.00 33.27 ? 105 ASP B N     1 
ATOM   2548 C CA    . ASP B 1 67  ? 8.530   20.133  -19.938 1.00 32.63 ? 105 ASP B CA    1 
ATOM   2549 C C     . ASP B 1 67  ? 9.625   20.388  -20.971 1.00 33.71 ? 105 ASP B C     1 
ATOM   2550 O O     . ASP B 1 67  ? 10.310  21.408  -20.919 1.00 33.44 ? 105 ASP B O     1 
ATOM   2551 C CB    . ASP B 1 67  ? 9.134   19.461  -18.693 1.00 33.18 ? 105 ASP B CB    1 
ATOM   2552 C CG    . ASP B 1 67  ? 8.202   19.495  -17.515 1.00 32.29 ? 105 ASP B CG    1 
ATOM   2553 O OD1   . ASP B 1 67  ? 7.449   20.478  -17.352 1.00 36.05 ? 105 ASP B OD1   1 
ATOM   2554 O OD2   . ASP B 1 67  ? 8.191   18.527  -16.747 1.00 33.81 ? 105 ASP B OD2   1 
ATOM   2555 N N     . TYR B 1 68  ? 9.745   19.484  -21.946 1.00 33.09 ? 106 TYR B N     1 
ATOM   2556 C CA    . TYR B 1 68  ? 10.848  19.597  -22.932 1.00 32.78 ? 106 TYR B CA    1 
ATOM   2557 C C     . TYR B 1 68  ? 10.375  20.234  -24.240 1.00 33.56 ? 106 TYR B C     1 
ATOM   2558 O O     . TYR B 1 68  ? 11.170  20.418  -25.187 1.00 32.61 ? 106 TYR B O     1 
ATOM   2559 C CB    . TYR B 1 68  ? 11.440  18.214  -23.225 1.00 33.60 ? 106 TYR B CB    1 
ATOM   2560 C CG    . TYR B 1 68  ? 12.431  17.776  -22.209 1.00 32.10 ? 106 TYR B CG    1 
ATOM   2561 C CD1   . TYR B 1 68  ? 12.101  16.802  -21.276 1.00 32.12 ? 106 TYR B CD1   1 
ATOM   2562 C CD2   . TYR B 1 68  ? 13.694  18.359  -22.161 1.00 32.31 ? 106 TYR B CD2   1 
ATOM   2563 C CE1   . TYR B 1 68  ? 13.027  16.386  -20.293 1.00 31.47 ? 106 TYR B CE1   1 
ATOM   2564 C CE2   . TYR B 1 68  ? 14.624  17.959  -21.226 1.00 34.62 ? 106 TYR B CE2   1 
ATOM   2565 C CZ    . TYR B 1 68  ? 14.281  16.968  -20.287 1.00 33.84 ? 106 TYR B CZ    1 
ATOM   2566 O OH    . TYR B 1 68  ? 15.211  16.571  -19.345 1.00 33.80 ? 106 TYR B OH    1 
ATOM   2567 N N     . GLN B 1 69  ? 9.097   20.579  -24.314 1.00 32.51 ? 107 GLN B N     1 
ATOM   2568 C CA    . GLN B 1 69  ? 8.579   21.208  -25.537 1.00 34.78 ? 107 GLN B CA    1 
ATOM   2569 C C     . GLN B 1 69  ? 9.349   22.457  -26.024 1.00 33.86 ? 107 GLN B C     1 
ATOM   2570 O O     . GLN B 1 69  ? 9.712   22.550  -27.231 1.00 34.07 ? 107 GLN B O     1 
ATOM   2571 C CB    . GLN B 1 69  ? 7.070   21.442  -25.427 1.00 35.30 ? 107 GLN B CB    1 
ATOM   2572 C CG    . GLN B 1 69  ? 6.257   20.470  -26.285 1.00 42.70 ? 107 GLN B CG    1 
ATOM   2573 C CD    . GLN B 1 69  ? 6.887   20.179  -27.670 1.00 46.19 ? 107 GLN B CD    1 
ATOM   2574 O OE1   . GLN B 1 69  ? 6.966   21.050  -28.545 1.00 52.49 ? 107 GLN B OE1   1 
ATOM   2575 N NE2   . GLN B 1 69  ? 7.298   18.939  -27.868 1.00 46.25 ? 107 GLN B NE2   1 
ATOM   2576 N N     . PRO B 1 70  ? 9.638   23.410  -25.121 1.00 34.03 ? 108 PRO B N     1 
ATOM   2577 C CA    . PRO B 1 70  ? 10.410  24.587  -25.532 1.00 34.37 ? 108 PRO B CA    1 
ATOM   2578 C C     . PRO B 1 70  ? 11.773  24.216  -26.149 1.00 33.79 ? 108 PRO B C     1 
ATOM   2579 O O     . PRO B 1 70  ? 12.132  24.763  -27.221 1.00 33.05 ? 108 PRO B O     1 
ATOM   2580 C CB    . PRO B 1 70  ? 10.607  25.347  -24.225 1.00 34.59 ? 108 PRO B CB    1 
ATOM   2581 C CG    . PRO B 1 70  ? 9.392   24.981  -23.403 1.00 35.70 ? 108 PRO B CG    1 
ATOM   2582 C CD    . PRO B 1 70  ? 9.238   23.503  -23.696 1.00 34.74 ? 108 PRO B CD    1 
ATOM   2583 N N     . LEU B 1 71  ? 12.498  23.315  -25.487 1.00 32.84 ? 109 LEU B N     1 
ATOM   2584 C CA    . LEU B 1 71  ? 13.734  22.806  -26.074 1.00 33.10 ? 109 LEU B CA    1 
ATOM   2585 C C     . LEU B 1 71  ? 13.519  22.146  -27.457 1.00 33.14 ? 109 LEU B C     1 
ATOM   2586 O O     . LEU B 1 71  ? 14.301  22.382  -28.372 1.00 33.82 ? 109 LEU B O     1 
ATOM   2587 C CB    . LEU B 1 71  ? 14.356  21.777  -25.172 1.00 32.06 ? 109 LEU B CB    1 
ATOM   2588 C CG    . LEU B 1 71  ? 15.699  21.203  -25.662 1.00 32.39 ? 109 LEU B CG    1 
ATOM   2589 C CD1   . LEU B 1 71  ? 16.751  22.337  -25.830 1.00 31.94 ? 109 LEU B CD1   1 
ATOM   2590 C CD2   . LEU B 1 71  ? 16.189  20.133  -24.695 1.00 31.61 ? 109 LEU B CD2   1 
ATOM   2591 N N     . MET B 1 72  ? 12.494  21.296  -27.571 1.00 32.85 ? 110 MET B N     1 
ATOM   2592 C CA    . MET B 1 72  ? 12.207  20.606  -28.834 1.00 33.08 ? 110 MET B CA    1 
ATOM   2593 C C     . MET B 1 72  ? 11.953  21.616  -29.947 1.00 34.81 ? 110 MET B C     1 
ATOM   2594 O O     . MET B 1 72  ? 12.428  21.439  -31.074 1.00 34.74 ? 110 MET B O     1 
ATOM   2595 C CB    . MET B 1 72  ? 10.967  19.709  -28.699 1.00 33.95 ? 110 MET B CB    1 
ATOM   2596 C CG    . MET B 1 72  ? 11.092  18.442  -27.833 1.00 35.64 ? 110 MET B CG    1 
ATOM   2597 S SD    . MET B 1 72  ? 12.470  17.389  -28.227 1.00 41.07 ? 110 MET B SD    1 
ATOM   2598 C CE    . MET B 1 72  ? 13.592  17.861  -26.871 1.00 42.67 ? 110 MET B CE    1 
ATOM   2599 N N     . LYS B 1 73  ? 11.175  22.652  -29.651 1.00 34.50 ? 111 LYS B N     1 
ATOM   2600 C CA    . LYS B 1 73  ? 10.906  23.711  -30.628 1.00 36.57 ? 111 LYS B CA    1 
ATOM   2601 C C     . LYS B 1 73  ? 12.183  24.432  -31.068 1.00 35.73 ? 111 LYS B C     1 
ATOM   2602 O O     . LYS B 1 73  ? 12.416  24.598  -32.237 1.00 34.00 ? 111 LYS B O     1 
ATOM   2603 C CB    . LYS B 1 73  ? 9.868   24.673  -30.060 1.00 37.07 ? 111 LYS B CB    1 
ATOM   2604 C CG    . LYS B 1 73  ? 8.424   24.097  -30.101 1.00 40.83 ? 111 LYS B CG    1 
ATOM   2605 C CD    . LYS B 1 73  ? 7.353   25.006  -29.404 1.00 41.04 ? 111 LYS B CD    1 
ATOM   2606 C CE    . LYS B 1 73  ? 6.694   24.371  -28.140 1.00 46.12 ? 111 LYS B CE    1 
ATOM   2607 N NZ    . LYS B 1 73  ? 7.111   24.904  -26.764 1.00 49.53 ? 111 LYS B NZ    1 
ATOM   2608 N N     . LEU B 1 74  ? 13.031  24.849  -30.134 1.00 34.64 ? 112 LEU B N     1 
ATOM   2609 C CA    . LEU B 1 74  ? 14.298  25.503  -30.526 1.00 34.95 ? 112 LEU B CA    1 
ATOM   2610 C C     . LEU B 1 74  ? 15.261  24.584  -31.278 1.00 34.87 ? 112 LEU B C     1 
ATOM   2611 O O     . LEU B 1 74  ? 15.956  25.030  -32.208 1.00 34.10 ? 112 LEU B O     1 
ATOM   2612 C CB    . LEU B 1 74  ? 15.014  26.126  -29.314 1.00 34.52 ? 112 LEU B CB    1 
ATOM   2613 C CG    . LEU B 1 74  ? 14.300  27.276  -28.617 1.00 36.54 ? 112 LEU B CG    1 
ATOM   2614 C CD1   . LEU B 1 74  ? 15.108  27.625  -27.365 1.00 37.61 ? 112 LEU B CD1   1 
ATOM   2615 C CD2   . LEU B 1 74  ? 14.130  28.498  -29.485 1.00 37.48 ? 112 LEU B CD2   1 
ATOM   2616 N N     . GLY B 1 75  ? 15.262  23.304  -30.923 1.00 34.59 ? 113 GLY B N     1 
ATOM   2617 C CA    . GLY B 1 75  ? 16.145  22.313  -31.551 1.00 36.00 ? 113 GLY B CA    1 
ATOM   2618 C C     . GLY B 1 75  ? 15.569  21.649  -32.798 1.00 37.36 ? 113 GLY B C     1 
ATOM   2619 O O     . GLY B 1 75  ? 16.172  20.714  -33.279 1.00 39.13 ? 113 GLY B O     1 
ATOM   2620 N N     . THR B 1 76  ? 14.428  22.135  -33.303 1.00 38.65 ? 114 THR B N     1 
ATOM   2621 C CA    . THR B 1 76  ? 13.809  21.660  -34.555 1.00 38.90 ? 114 THR B CA    1 
ATOM   2622 C C     . THR B 1 76  ? 14.853  21.514  -35.665 1.00 38.79 ? 114 THR B C     1 
ATOM   2623 O O     . THR B 1 76  ? 15.573  22.458  -35.997 1.00 37.20 ? 114 THR B O     1 
ATOM   2624 C CB    . THR B 1 76  ? 12.642  22.588  -35.045 1.00 39.61 ? 114 THR B CB    1 
ATOM   2625 O OG1   . THR B 1 76  ? 11.547  22.494  -34.130 1.00 41.87 ? 114 THR B OG1   1 
ATOM   2626 C CG2   . THR B 1 76  ? 12.138  22.186  -36.437 1.00 40.54 ? 114 THR B CG2   1 
ATOM   2627 N N     . GLN B 1 77  ? 14.907  20.310  -36.233 1.00 39.99 ? 115 GLN B N     1 
ATOM   2628 C CA    . GLN B 1 77  ? 15.879  19.969  -37.254 1.00 39.92 ? 115 GLN B CA    1 
ATOM   2629 C C     . GLN B 1 77  ? 15.315  18.866  -38.112 1.00 42.08 ? 115 GLN B C     1 
ATOM   2630 O O     . GLN B 1 77  ? 14.867  17.820  -37.606 1.00 43.30 ? 115 GLN B O     1 
ATOM   2631 C CB    . GLN B 1 77  ? 17.164  19.477  -36.612 1.00 39.28 ? 115 GLN B CB    1 
ATOM   2632 C CG    . GLN B 1 77  ? 18.194  19.024  -37.574 1.00 37.79 ? 115 GLN B CG    1 
ATOM   2633 C CD    . GLN B 1 77  ? 19.506  18.786  -36.946 1.00 36.19 ? 115 GLN B CD    1 
ATOM   2634 O OE1   . GLN B 1 77  ? 20.512  18.641  -37.628 1.00 38.81 ? 115 GLN B OE1   1 
ATOM   2635 N NE2   . GLN B 1 77  ? 19.526  18.735  -35.623 1.00 32.06 ? 115 GLN B NE2   1 
ATOM   2636 N N     . THR B 1 78  ? 15.362  19.108  -39.400 1.00 43.18 ? 116 THR B N     1 
ATOM   2637 C CA    . THR B 1 78  ? 14.952  18.121  -40.365 1.00 44.19 ? 116 THR B CA    1 
ATOM   2638 C C     . THR B 1 78  ? 16.215  17.530  -40.964 1.00 43.43 ? 116 THR B C     1 
ATOM   2639 O O     . THR B 1 78  ? 17.043  18.255  -41.530 1.00 45.13 ? 116 THR B O     1 
ATOM   2640 C CB    . THR B 1 78  ? 14.027  18.765  -41.396 1.00 44.89 ? 116 THR B CB    1 
ATOM   2641 O OG1   . THR B 1 78  ? 12.775  19.033  -40.753 1.00 47.99 ? 116 THR B OG1   1 
ATOM   2642 C CG2   . THR B 1 78  ? 13.782  17.854  -42.590 1.00 45.63 ? 116 THR B CG2   1 
ATOM   2643 N N     . VAL B 1 79  ? 16.381  16.224  -40.777 1.00 41.29 ? 117 VAL B N     1 
ATOM   2644 C CA    . VAL B 1 79  ? 17.405  15.471  -41.464 1.00 39.59 ? 117 VAL B CA    1 
ATOM   2645 C C     . VAL B 1 79  ? 16.666  14.704  -42.549 1.00 38.53 ? 117 VAL B C     1 
ATOM   2646 O O     . VAL B 1 79  ? 15.462  14.487  -42.446 1.00 37.25 ? 117 VAL B O     1 
ATOM   2647 C CB    . VAL B 1 79  ? 18.208  14.514  -40.528 1.00 40.54 ? 117 VAL B CB    1 
ATOM   2648 C CG1   . VAL B 1 79  ? 18.808  15.313  -39.335 1.00 38.95 ? 117 VAL B CG1   1 
ATOM   2649 C CG2   . VAL B 1 79  ? 17.358  13.358  -40.029 1.00 41.33 ? 117 VAL B CG2   1 
ATOM   2650 N N     . PRO B 1 80  ? 17.375  14.331  -43.608 1.00 37.48 ? 118 PRO B N     1 
ATOM   2651 C CA    . PRO B 1 80  ? 16.716  13.583  -44.673 1.00 36.47 ? 118 PRO B CA    1 
ATOM   2652 C C     . PRO B 1 80  ? 16.053  12.331  -44.109 1.00 35.49 ? 118 PRO B C     1 
ATOM   2653 O O     . PRO B 1 80  ? 16.751  11.492  -43.535 1.00 35.33 ? 118 PRO B O     1 
ATOM   2654 C CB    . PRO B 1 80  ? 17.880  13.187  -45.555 1.00 36.27 ? 118 PRO B CB    1 
ATOM   2655 C CG    . PRO B 1 80  ? 18.876  14.275  -45.356 1.00 37.36 ? 118 PRO B CG    1 
ATOM   2656 C CD    . PRO B 1 80  ? 18.800  14.569  -43.901 1.00 37.22 ? 118 PRO B CD    1 
ATOM   2657 N N     . CYS B 1 81  ? 14.734  12.193  -44.280 1.00 34.59 ? 119 CYS B N     1 
ATOM   2658 C CA    . CYS B 1 81  ? 13.979  11.133  -43.559 1.00 34.28 ? 119 CYS B CA    1 
ATOM   2659 C C     . CYS B 1 81  ? 14.292  9.688   -43.968 1.00 32.62 ? 119 CYS B C     1 
ATOM   2660 O O     . CYS B 1 81  ? 14.021  8.761   -43.195 1.00 31.21 ? 119 CYS B O     1 
ATOM   2661 C CB    . CYS B 1 81  ? 12.452  11.355  -43.623 1.00 34.20 ? 119 CYS B CB    1 
ATOM   2662 S SG    . CYS B 1 81  ? 11.692  11.300  -45.225 1.00 40.13 ? 119 CYS B SG    1 
ATOM   2663 N N     . ASN B 1 82  ? 14.821  9.530   -45.184 1.00 31.65 ? 120 ASN B N     1 
ATOM   2664 C CA    . ASN B 1 82  ? 15.186  8.229   -45.777 1.00 30.29 ? 120 ASN B CA    1 
ATOM   2665 C C     . ASN B 1 82  ? 16.616  7.804   -45.418 1.00 29.93 ? 120 ASN B C     1 
ATOM   2666 O O     . ASN B 1 82  ? 17.100  6.780   -45.903 1.00 28.96 ? 120 ASN B O     1 
ATOM   2667 C CB    . ASN B 1 82  ? 14.986  8.227   -47.312 1.00 30.59 ? 120 ASN B CB    1 
ATOM   2668 C CG    . ASN B 1 82  ? 15.885  9.226   -48.024 1.00 31.25 ? 120 ASN B CG    1 
ATOM   2669 O OD1   . ASN B 1 82  ? 16.167  10.312  -47.496 1.00 32.13 ? 120 ASN B OD1   1 
ATOM   2670 N ND2   . ASN B 1 82  ? 16.327  8.874   -49.223 1.00 32.78 ? 120 ASN B ND2   1 
ATOM   2671 N N     . LYS B 1 83  ? 17.257  8.565   -44.518 1.00 28.58 ? 121 LYS B N     1 
ATOM   2672 C CA    . LYS B 1 83  ? 18.671  8.332   -44.167 1.00 29.02 ? 121 LYS B CA    1 
ATOM   2673 C C     . LYS B 1 83  ? 18.883  8.180   -42.669 1.00 29.70 ? 121 LYS B C     1 
ATOM   2674 O O     . LYS B 1 83  ? 19.894  8.655   -42.133 1.00 30.15 ? 121 LYS B O     1 
ATOM   2675 C CB    . LYS B 1 83  ? 19.547  9.488   -44.657 1.00 30.01 ? 121 LYS B CB    1 
ATOM   2676 C CG    . LYS B 1 83  ? 19.572  9.644   -46.189 1.00 31.26 ? 121 LYS B CG    1 
ATOM   2677 C CD    . LYS B 1 83  ? 20.380  8.547   -46.857 1.00 34.58 ? 121 LYS B CD    1 
ATOM   2678 C CE    . LYS B 1 83  ? 20.255  8.694   -48.355 1.00 36.50 ? 121 LYS B CE    1 
ATOM   2679 N NZ    . LYS B 1 83  ? 20.483  7.451   -49.169 1.00 39.80 ? 121 LYS B NZ    1 
ATOM   2680 N N     . ILE B 1 84  ? 17.946  7.512   -42.020 1.00 27.11 ? 122 ILE B N     1 
ATOM   2681 C CA    . ILE B 1 84  ? 17.982  7.437   -40.555 1.00 29.81 ? 122 ILE B CA    1 
ATOM   2682 C C     . ILE B 1 84  ? 18.516  6.089   -40.109 1.00 30.12 ? 122 ILE B C     1 
ATOM   2683 O O     . ILE B 1 84  ? 18.122  5.039   -40.672 1.00 29.75 ? 122 ILE B O     1 
ATOM   2684 C CB    . ILE B 1 84  ? 16.601  7.761   -40.011 1.00 30.24 ? 122 ILE B CB    1 
ATOM   2685 C CG1   . ILE B 1 84  ? 16.450  9.304   -40.050 1.00 34.10 ? 122 ILE B CG1   1 
ATOM   2686 C CG2   . ILE B 1 84  ? 16.489  7.305   -38.535 1.00 30.08 ? 122 ILE B CG2   1 
ATOM   2687 C CD1   . ILE B 1 84  ? 15.077  9.840   -39.671 1.00 39.79 ? 122 ILE B CD1   1 
ATOM   2688 N N     . LEU B 1 85  ? 19.454  6.128   -39.153 1.00 30.06 ? 123 LEU B N     1 
ATOM   2689 C CA    . LEU B 1 85  ? 20.048  4.946   -38.573 1.00 30.11 ? 123 LEU B CA    1 
ATOM   2690 C C     . LEU B 1 85  ? 19.662  4.906   -37.121 1.00 30.80 ? 123 LEU B C     1 
ATOM   2691 O O     . LEU B 1 85  ? 20.033  5.798   -36.323 1.00 31.73 ? 123 LEU B O     1 
ATOM   2692 C CB    . LEU B 1 85  ? 21.573  4.965   -38.646 1.00 29.64 ? 123 LEU B CB    1 
ATOM   2693 C CG    . LEU B 1 85  ? 22.286  3.700   -38.101 1.00 30.65 ? 123 LEU B CG    1 
ATOM   2694 C CD1   . LEU B 1 85  ? 21.796  2.423   -38.815 1.00 29.59 ? 123 LEU B CD1   1 
ATOM   2695 C CD2   . LEU B 1 85  ? 23.812  3.800   -38.284 1.00 28.75 ? 123 LEU B CD2   1 
ATOM   2696 N N     . LEU B 1 86  ? 18.920  3.873   -36.758 1.00 29.90 ? 124 LEU B N     1 
ATOM   2697 C CA    . LEU B 1 86  ? 18.559  3.643   -35.362 1.00 30.87 ? 124 LEU B CA    1 
ATOM   2698 C C     . LEU B 1 86  ? 19.540  2.629   -34.779 1.00 31.28 ? 124 LEU B C     1 
ATOM   2699 O O     . LEU B 1 86  ? 20.276  2.000   -35.502 1.00 29.74 ? 124 LEU B O     1 
ATOM   2700 C CB    . LEU B 1 86  ? 17.110  3.134   -35.289 1.00 31.31 ? 124 LEU B CB    1 
ATOM   2701 C CG    . LEU B 1 86  ? 16.031  4.069   -35.874 1.00 31.23 ? 124 LEU B CG    1 
ATOM   2702 C CD1   . LEU B 1 86  ? 14.613  3.581   -35.570 1.00 30.36 ? 124 LEU B CD1   1 
ATOM   2703 C CD2   . LEU B 1 86  ? 16.189  5.459   -35.254 1.00 27.16 ? 124 LEU B CD2   1 
ATOM   2704 N N     . TRP B 1 87  ? 19.611  2.490   -33.450 1.00 31.66 ? 125 TRP B N     1 
ATOM   2705 C CA    . TRP B 1 87  ? 20.530  1.500   -32.900 1.00 32.37 ? 125 TRP B CA    1 
ATOM   2706 C C     . TRP B 1 87  ? 20.027  1.059   -31.520 1.00 34.25 ? 125 TRP B C     1 
ATOM   2707 O O     . TRP B 1 87  ? 19.250  1.750   -30.870 1.00 33.64 ? 125 TRP B O     1 
ATOM   2708 C CB    . TRP B 1 87  ? 21.981  2.051   -32.838 1.00 31.97 ? 125 TRP B CB    1 
ATOM   2709 C CG    . TRP B 1 87  ? 22.071  3.362   -32.064 1.00 30.87 ? 125 TRP B CG    1 
ATOM   2710 C CD1   . TRP B 1 87  ? 22.026  4.622   -32.579 1.00 30.15 ? 125 TRP B CD1   1 
ATOM   2711 C CD2   . TRP B 1 87  ? 22.175  3.512   -30.630 1.00 30.11 ? 125 TRP B CD2   1 
ATOM   2712 N NE1   . TRP B 1 87  ? 22.109  5.572   -31.544 1.00 30.72 ? 125 TRP B NE1   1 
ATOM   2713 C CE2   . TRP B 1 87  ? 22.209  4.895   -30.355 1.00 31.35 ? 125 TRP B CE2   1 
ATOM   2714 C CE3   . TRP B 1 87  ? 22.256  2.593   -29.558 1.00 32.83 ? 125 TRP B CE3   1 
ATOM   2715 C CZ2   . TRP B 1 87  ? 22.282  5.394   -29.047 1.00 32.26 ? 125 TRP B CZ2   1 
ATOM   2716 C CZ3   . TRP B 1 87  ? 22.337  3.093   -28.261 1.00 33.17 ? 125 TRP B CZ3   1 
ATOM   2717 C CH2   . TRP B 1 87  ? 22.358  4.477   -28.029 1.00 33.05 ? 125 TRP B CH2   1 
ATOM   2718 N N     . SER B 1 88  ? 20.450  -0.123  -31.100 1.00 37.26 ? 126 SER B N     1 
ATOM   2719 C CA    . SER B 1 88  ? 20.146  -0.591  -29.750 1.00 40.83 ? 126 SER B CA    1 
ATOM   2720 C C     . SER B 1 88  ? 21.376  -1.284  -29.182 1.00 40.83 ? 126 SER B C     1 
ATOM   2721 O O     . SER B 1 88  ? 21.851  -2.272  -29.743 1.00 40.69 ? 126 SER B O     1 
ATOM   2722 C CB    . SER B 1 88  ? 18.928  -1.544  -29.773 1.00 41.39 ? 126 SER B CB    1 
ATOM   2723 O OG    . SER B 1 88  ? 18.307  -1.546  -28.469 1.00 46.31 ? 126 SER B OG    1 
ATOM   2724 N N     . ARG B 1 89  ? 21.909  -0.739  -28.089 1.00 42.00 ? 127 ARG B N     1 
ATOM   2725 C CA    . ARG B 1 89  ? 23.066  -1.332  -27.392 1.00 43.79 ? 127 ARG B CA    1 
ATOM   2726 C C     . ARG B 1 89  ? 24.341  -1.416  -28.226 1.00 43.58 ? 127 ARG B C     1 
ATOM   2727 O O     . ARG B 1 89  ? 25.202  -2.277  -27.967 1.00 44.71 ? 127 ARG B O     1 
ATOM   2728 C CB    . ARG B 1 89  ? 22.701  -2.728  -26.840 1.00 44.20 ? 127 ARG B CB    1 
ATOM   2729 C CG    . ARG B 1 89  ? 21.711  -2.661  -25.681 1.00 48.73 ? 127 ARG B CG    1 
ATOM   2730 C CD    . ARG B 1 89  ? 22.458  -2.736  -24.377 1.00 55.30 ? 127 ARG B CD    1 
ATOM   2731 N NE    . ARG B 1 89  ? 22.035  -1.740  -23.396 1.00 60.69 ? 127 ARG B NE    1 
ATOM   2732 C CZ    . ARG B 1 89  ? 21.511  -2.023  -22.205 1.00 63.36 ? 127 ARG B CZ    1 
ATOM   2733 N NH1   . ARG B 1 89  ? 21.329  -3.283  -21.815 1.00 64.81 ? 127 ARG B NH1   1 
ATOM   2734 N NH2   . ARG B 1 89  ? 21.163  -1.033  -21.396 1.00 64.29 ? 127 ARG B NH2   1 
ATOM   2735 N N     . ILE B 1 90  ? 24.465  -0.558  -29.245 1.00 42.73 ? 128 ILE B N     1 
ATOM   2736 C CA    . ILE B 1 90  ? 25.651  -0.582  -30.106 1.00 41.88 ? 128 ILE B CA    1 
ATOM   2737 C C     . ILE B 1 90  ? 25.932  0.809   -30.686 1.00 41.01 ? 128 ILE B C     1 
ATOM   2738 O O     . ILE B 1 90  ? 26.303  0.995   -31.864 1.00 40.45 ? 128 ILE B O     1 
ATOM   2739 C CB    . ILE B 1 90  ? 25.570  -1.735  -31.169 1.00 42.13 ? 128 ILE B CB    1 
ATOM   2740 C CG1   . ILE B 1 90  ? 26.879  -1.868  -31.956 1.00 42.02 ? 128 ILE B CG1   1 
ATOM   2741 C CG2   . ILE B 1 90  ? 24.330  -1.586  -32.044 1.00 41.63 ? 128 ILE B CG2   1 
ATOM   2742 C CD1   . ILE B 1 90  ? 27.196  -3.283  -32.365 1.00 43.37 ? 128 ILE B CD1   1 
ATOM   2743 N N     . LYS B 1 91  ? 25.786  1.780   -29.794 1.00 40.79 ? 129 LYS B N     1 
ATOM   2744 C CA    . LYS B 1 91  ? 25.931  3.179   -30.127 1.00 40.55 ? 129 LYS B CA    1 
ATOM   2745 C C     . LYS B 1 91  ? 27.279  3.474   -30.749 1.00 39.76 ? 129 LYS B C     1 
ATOM   2746 O O     . LYS B 1 91  ? 27.357  4.252   -31.690 1.00 39.50 ? 129 LYS B O     1 
ATOM   2747 C CB    . LYS B 1 91  ? 25.719  4.024   -28.848 1.00 40.72 ? 129 LYS B CB    1 
ATOM   2748 C CG    . LYS B 1 91  ? 25.678  5.507   -29.111 1.00 42.95 ? 129 LYS B CG    1 
ATOM   2749 C CD    . LYS B 1 91  ? 25.294  6.279   -27.841 1.00 41.36 ? 129 LYS B CD    1 
ATOM   2750 C CE    . LYS B 1 91  ? 26.369  6.239   -26.796 1.00 43.87 ? 129 LYS B CE    1 
ATOM   2751 N NZ    . LYS B 1 91  ? 25.880  7.037   -25.630 1.00 43.77 ? 129 LYS B NZ    1 
ATOM   2752 N N     . ASP B 1 92  ? 28.348  2.873   -30.229 1.00 40.05 ? 130 ASP B N     1 
ATOM   2753 C CA    . ASP B 1 92  ? 29.688  3.232   -30.701 1.00 41.38 ? 130 ASP B CA    1 
ATOM   2754 C C     . ASP B 1 92  ? 29.905  2.887   -32.172 1.00 40.09 ? 130 ASP B C     1 
ATOM   2755 O O     . ASP B 1 92  ? 30.403  3.715   -32.936 1.00 41.06 ? 130 ASP B O     1 
ATOM   2756 C CB    . ASP B 1 92  ? 30.799  2.654   -29.799 1.00 42.95 ? 130 ASP B CB    1 
ATOM   2757 C CG    . ASP B 1 92  ? 31.084  3.546   -28.562 1.00 47.04 ? 130 ASP B CG    1 
ATOM   2758 O OD1   . ASP B 1 92  ? 30.490  4.644   -28.423 1.00 52.02 ? 130 ASP B OD1   1 
ATOM   2759 O OD2   . ASP B 1 92  ? 31.918  3.142   -27.709 1.00 53.60 ? 130 ASP B OD2   1 
ATOM   2760 N N     . LEU B 1 93  ? 29.524  1.684   -32.586 1.00 39.09 ? 131 LEU B N     1 
ATOM   2761 C CA    . LEU B 1 93  ? 29.628  1.342   -34.017 1.00 37.31 ? 131 LEU B CA    1 
ATOM   2762 C C     . LEU B 1 93  ? 28.688  2.187   -34.898 1.00 35.80 ? 131 LEU B C     1 
ATOM   2763 O O     . LEU B 1 93  ? 29.046  2.562   -36.039 1.00 34.82 ? 131 LEU B O     1 
ATOM   2764 C CB    . LEU B 1 93  ? 29.417  -0.165  -34.285 1.00 38.50 ? 131 LEU B CB    1 
ATOM   2765 C CG    . LEU B 1 93  ? 30.066  -0.887  -35.481 1.00 40.11 ? 131 LEU B CG    1 
ATOM   2766 C CD1   . LEU B 1 93  ? 29.150  -1.983  -36.065 1.00 40.33 ? 131 LEU B CD1   1 
ATOM   2767 C CD2   . LEU B 1 93  ? 30.609  0.008   -36.621 1.00 40.82 ? 131 LEU B CD2   1 
ATOM   2768 N N     . ALA B 1 94  ? 27.491  2.482   -34.393 1.00 34.63 ? 132 ALA B N     1 
ATOM   2769 C CA    . ALA B 1 94  ? 26.523  3.248   -35.177 1.00 34.05 ? 132 ALA B CA    1 
ATOM   2770 C C     . ALA B 1 94  ? 27.109  4.614   -35.464 1.00 34.36 ? 132 ALA B C     1 
ATOM   2771 O O     . ALA B 1 94  ? 27.030  5.117   -36.553 1.00 33.93 ? 132 ALA B O     1 
ATOM   2772 C CB    . ALA B 1 94  ? 25.189  3.366   -34.433 1.00 33.95 ? 132 ALA B CB    1 
ATOM   2773 N N     . HIS B 1 95  ? 27.755  5.205   -34.458 1.00 33.92 ? 133 HIS B N     1 
ATOM   2774 C CA    . HIS B 1 95  ? 28.377  6.490   -34.650 1.00 34.44 ? 133 HIS B CA    1 
ATOM   2775 C C     . HIS B 1 95  ? 29.620  6.480   -35.542 1.00 35.10 ? 133 HIS B C     1 
ATOM   2776 O O     . HIS B 1 95  ? 29.804  7.394   -36.347 1.00 36.58 ? 133 HIS B O     1 
ATOM   2777 C CB    . HIS B 1 95  ? 28.702  7.081   -33.282 1.00 34.03 ? 133 HIS B CB    1 
ATOM   2778 C CG    . HIS B 1 95  ? 27.494  7.462   -32.486 1.00 35.85 ? 133 HIS B CG    1 
ATOM   2779 N ND1   . HIS B 1 95  ? 27.570  7.768   -31.151 1.00 35.62 ? 133 HIS B ND1   1 
ATOM   2780 C CD2   . HIS B 1 95  ? 26.198  7.641   -32.838 1.00 34.92 ? 133 HIS B CD2   1 
ATOM   2781 C CE1   . HIS B 1 95  ? 26.367  8.088   -30.703 1.00 37.36 ? 133 HIS B CE1   1 
ATOM   2782 N NE2   . HIS B 1 95  ? 25.520  8.018   -31.711 1.00 37.98 ? 133 HIS B NE2   1 
ATOM   2783 N N     . GLN B 1 96  ? 30.447  5.444   -35.448 1.00 35.65 ? 134 GLN B N     1 
ATOM   2784 C CA    . GLN B 1 96  ? 31.610  5.346   -36.320 1.00 36.63 ? 134 GLN B CA    1 
ATOM   2785 C C     . GLN B 1 96  ? 31.103  5.252   -37.760 1.00 35.04 ? 134 GLN B C     1 
ATOM   2786 O O     . GLN B 1 96  ? 31.718  5.770   -38.677 1.00 34.31 ? 134 GLN B O     1 
ATOM   2787 C CB    . GLN B 1 96  ? 32.433  4.097   -36.006 1.00 37.13 ? 134 GLN B CB    1 
ATOM   2788 C CG    . GLN B 1 96  ? 33.038  4.033   -34.602 1.00 40.18 ? 134 GLN B CG    1 
ATOM   2789 C CD    . GLN B 1 96  ? 33.976  2.848   -34.443 1.00 41.36 ? 134 GLN B CD    1 
ATOM   2790 O OE1   . GLN B 1 96  ? 35.197  2.998   -34.527 1.00 49.30 ? 134 GLN B OE1   1 
ATOM   2791 N NE2   . GLN B 1 96  ? 33.409  1.648   -34.254 1.00 47.13 ? 134 GLN B NE2   1 
ATOM   2792 N N     . PHE B 1 97  ? 29.941  4.629   -37.933 1.00 34.80 ? 135 PHE B N     1 
ATOM   2793 C CA    . PHE B 1 97  ? 29.425  4.389   -39.295 1.00 34.55 ? 135 PHE B CA    1 
ATOM   2794 C C     . PHE B 1 97  ? 29.020  5.734   -39.893 1.00 34.46 ? 135 PHE B C     1 
ATOM   2795 O O     . PHE B 1 97  ? 29.446  6.054   -40.963 1.00 34.76 ? 135 PHE B O     1 
ATOM   2796 C CB    . PHE B 1 97  ? 28.246  3.409   -39.269 1.00 34.29 ? 135 PHE B CB    1 
ATOM   2797 C CG    . PHE B 1 97  ? 27.529  3.297   -40.597 1.00 35.49 ? 135 PHE B CG    1 
ATOM   2798 C CD1   . PHE B 1 97  ? 26.468  4.134   -40.888 1.00 36.97 ? 135 PHE B CD1   1 
ATOM   2799 C CD2   . PHE B 1 97  ? 27.926  2.371   -41.544 1.00 33.07 ? 135 PHE B CD2   1 
ATOM   2800 C CE1   . PHE B 1 97  ? 25.818  4.064   -42.096 1.00 34.86 ? 135 PHE B CE1   1 
ATOM   2801 C CE2   . PHE B 1 97  ? 27.263  2.282   -42.779 1.00 34.07 ? 135 PHE B CE2   1 
ATOM   2802 C CZ    . PHE B 1 97  ? 26.201  3.127   -43.049 1.00 34.12 ? 135 PHE B CZ    1 
ATOM   2803 N N     . THR B 1 98  ? 28.196  6.516   -39.179 1.00 35.54 ? 136 THR B N     1 
ATOM   2804 C CA    . THR B 1 98  ? 27.802  7.871   -39.624 1.00 37.06 ? 136 THR B CA    1 
ATOM   2805 C C     . THR B 1 98  ? 28.900  8.945   -39.674 1.00 38.89 ? 136 THR B C     1 
ATOM   2806 O O     . THR B 1 98  ? 28.738  9.998   -40.322 1.00 39.57 ? 136 THR B O     1 
ATOM   2807 C CB    . THR B 1 98  ? 26.591  8.432   -38.862 1.00 36.41 ? 136 THR B CB    1 
ATOM   2808 O OG1   . THR B 1 98  ? 26.924  8.713   -37.495 1.00 35.98 ? 136 THR B OG1   1 
ATOM   2809 C CG2   . THR B 1 98  ? 25.409  7.450   -38.963 1.00 35.38 ? 136 THR B CG2   1 
ATOM   2810 N N     . GLN B 1 99  ? 30.008  8.687   -39.001 1.00 40.22 ? 137 GLN B N     1 
ATOM   2811 C CA    . GLN B 1 99  ? 31.185  9.515   -39.198 1.00 42.81 ? 137 GLN B CA    1 
ATOM   2812 C C     . GLN B 1 99  ? 31.788  9.283   -40.598 1.00 43.96 ? 137 GLN B C     1 
ATOM   2813 O O     . GLN B 1 99  ? 32.332  10.213  -41.229 1.00 44.61 ? 137 GLN B O     1 
ATOM   2814 C CB    . GLN B 1 99  ? 32.195  9.264   -38.073 1.00 42.29 ? 137 GLN B CB    1 
ATOM   2815 C CG    . GLN B 1 99  ? 31.894  10.072  -36.800 1.00 46.88 ? 137 GLN B CG    1 
ATOM   2816 C CD    . GLN B 1 99  ? 31.708  11.576  -37.061 1.00 48.95 ? 137 GLN B CD    1 
ATOM   2817 O OE1   . GLN B 1 99  ? 30.670  12.155  -36.718 1.00 52.66 ? 137 GLN B OE1   1 
ATOM   2818 N NE2   . GLN B 1 99  ? 32.713  12.207  -37.659 1.00 48.81 ? 137 GLN B NE2   1 
ATOM   2819 N N     . VAL B 1 100 ? 31.673  8.044   -41.080 1.00 44.34 ? 138 VAL B N     1 
ATOM   2820 C CA    . VAL B 1 100 ? 32.202  7.647   -42.384 1.00 45.88 ? 138 VAL B CA    1 
ATOM   2821 C C     . VAL B 1 100 ? 31.159  7.816   -43.486 1.00 46.47 ? 138 VAL B C     1 
ATOM   2822 O O     . VAL B 1 100 ? 31.433  8.419   -44.524 1.00 47.30 ? 138 VAL B O     1 
ATOM   2823 C CB    . VAL B 1 100 ? 32.688  6.181   -42.381 1.00 45.55 ? 138 VAL B CB    1 
ATOM   2824 C CG1   . VAL B 1 100 ? 33.088  5.769   -43.773 1.00 47.02 ? 138 VAL B CG1   1 
ATOM   2825 C CG2   . VAL B 1 100 ? 33.859  6.009   -41.449 1.00 46.86 ? 138 VAL B CG2   1 
ATOM   2826 N N     . GLN B 1 101 ? 29.972  7.256   -43.260 1.00 47.01 ? 139 GLN B N     1 
ATOM   2827 C CA    . GLN B 1 101 ? 28.858  7.348   -44.189 1.00 47.25 ? 139 GLN B CA    1 
ATOM   2828 C C     . GLN B 1 101 ? 28.070  8.608   -43.832 1.00 47.52 ? 139 GLN B C     1 
ATOM   2829 O O     . GLN B 1 101 ? 26.993  8.551   -43.211 1.00 46.84 ? 139 GLN B O     1 
ATOM   2830 C CB    . GLN B 1 101 ? 28.001  6.087   -44.077 1.00 47.30 ? 139 GLN B CB    1 
ATOM   2831 C CG    . GLN B 1 101 ? 26.818  6.017   -45.024 1.00 49.99 ? 139 GLN B CG    1 
ATOM   2832 C CD    . GLN B 1 101 ? 27.190  5.604   -46.404 1.00 51.10 ? 139 GLN B CD    1 
ATOM   2833 O OE1   . GLN B 1 101 ? 28.141  4.847   -46.604 1.00 53.07 ? 139 GLN B OE1   1 
ATOM   2834 N NE2   . GLN B 1 101 ? 26.439  6.091   -47.387 1.00 52.26 ? 139 GLN B NE2   1 
ATOM   2835 N N     . ARG B 1 102 ? 28.624  9.751   -44.227 1.00 47.68 ? 140 ARG B N     1 
ATOM   2836 C CA    . ARG B 1 102 ? 28.153  11.051  -43.761 1.00 48.48 ? 140 ARG B CA    1 
ATOM   2837 C C     . ARG B 1 102 ? 26.796  11.425  -44.342 1.00 48.16 ? 140 ARG B C     1 
ATOM   2838 O O     . ARG B 1 102 ? 26.289  12.534  -44.139 1.00 48.65 ? 140 ARG B O     1 
ATOM   2839 C CB    . ARG B 1 102 ? 29.203  12.126  -44.055 1.00 49.27 ? 140 ARG B CB    1 
ATOM   2840 C CG    . ARG B 1 102 ? 30.334  12.119  -43.054 1.00 50.23 ? 140 ARG B CG    1 
ATOM   2841 C CD    . ARG B 1 102 ? 30.146  13.211  -42.047 1.00 57.10 ? 140 ARG B CD    1 
ATOM   2842 N NE    . ARG B 1 102 ? 31.143  14.258  -42.226 1.00 60.89 ? 140 ARG B NE    1 
ATOM   2843 C CZ    . ARG B 1 102 ? 32.131  14.495  -41.365 1.00 63.16 ? 140 ARG B CZ    1 
ATOM   2844 N NH1   . ARG B 1 102 ? 32.242  13.766  -40.254 1.00 64.24 ? 140 ARG B NH1   1 
ATOM   2845 N NH2   . ARG B 1 102 ? 33.003  15.475  -41.603 1.00 63.94 ? 140 ARG B NH2   1 
ATOM   2846 N N     . ASP B 1 103 ? 26.199  10.464  -45.025 1.00 46.86 ? 141 ASP B N     1 
ATOM   2847 C CA    . ASP B 1 103 ? 24.909  10.644  -45.650 1.00 46.00 ? 141 ASP B CA    1 
ATOM   2848 C C     . ASP B 1 103 ? 23.782  10.245  -44.691 1.00 44.45 ? 141 ASP B C     1 
ATOM   2849 O O     . ASP B 1 103 ? 22.601  10.522  -44.945 1.00 44.77 ? 141 ASP B O     1 
ATOM   2850 C CB    . ASP B 1 103 ? 24.853  9.805   -46.917 1.00 46.42 ? 141 ASP B CB    1 
ATOM   2851 C CG    . ASP B 1 103 ? 23.907  10.373  -47.925 1.00 49.30 ? 141 ASP B CG    1 
ATOM   2852 O OD1   . ASP B 1 103 ? 23.903  9.904   -49.088 1.00 50.52 ? 141 ASP B OD1   1 
ATOM   2853 O OD2   . ASP B 1 103 ? 23.160  11.303  -47.551 1.00 53.34 ? 141 ASP B OD2   1 
ATOM   2854 N N     . MET B 1 104 ? 24.170  9.605   -43.590 1.00 40.85 ? 142 MET B N     1 
ATOM   2855 C CA    . MET B 1 104 ? 23.263  8.897   -42.715 1.00 38.83 ? 142 MET B CA    1 
ATOM   2856 C C     . MET B 1 104 ? 23.318  9.554   -41.344 1.00 36.90 ? 142 MET B C     1 
ATOM   2857 O O     . MET B 1 104 ? 24.352  10.119  -40.948 1.00 36.04 ? 142 MET B O     1 
ATOM   2858 C CB    . MET B 1 104 ? 23.732  7.457   -42.560 1.00 38.43 ? 142 MET B CB    1 
ATOM   2859 C CG    . MET B 1 104 ? 23.821  6.698   -43.874 1.00 42.26 ? 142 MET B CG    1 
ATOM   2860 S SD    . MET B 1 104 ? 22.181  6.145   -44.214 1.00 46.72 ? 142 MET B SD    1 
ATOM   2861 C CE    . MET B 1 104 ? 22.075  4.668   -43.180 1.00 45.61 ? 142 MET B CE    1 
ATOM   2862 N N     . PHE B 1 105 ? 22.203  9.468   -40.631 1.00 35.61 ? 143 PHE B N     1 
ATOM   2863 C CA    . PHE B 1 105 ? 22.097  10.133  -39.331 1.00 33.90 ? 143 PHE B CA    1 
ATOM   2864 C C     . PHE B 1 105 ? 21.565  9.214   -38.274 1.00 32.35 ? 143 PHE B C     1 
ATOM   2865 O O     . PHE B 1 105 ? 20.560  8.544   -38.471 1.00 30.20 ? 143 PHE B O     1 
ATOM   2866 C CB    . PHE B 1 105 ? 21.168  11.353  -39.417 1.00 36.56 ? 143 PHE B CB    1 
ATOM   2867 C CG    . PHE B 1 105 ? 21.579  12.340  -40.460 1.00 40.34 ? 143 PHE B CG    1 
ATOM   2868 C CD1   . PHE B 1 105 ? 22.377  13.418  -40.134 1.00 45.60 ? 143 PHE B CD1   1 
ATOM   2869 C CD2   . PHE B 1 105 ? 21.161  12.187  -41.772 1.00 41.76 ? 143 PHE B CD2   1 
ATOM   2870 C CE1   . PHE B 1 105 ? 22.766  14.337  -41.126 1.00 45.52 ? 143 PHE B CE1   1 
ATOM   2871 C CE2   . PHE B 1 105 ? 21.541  13.088  -42.757 1.00 46.82 ? 143 PHE B CE2   1 
ATOM   2872 C CZ    . PHE B 1 105 ? 22.338  14.174  -42.419 1.00 44.79 ? 143 PHE B CZ    1 
ATOM   2873 N N     . THR B 1 106 ? 22.231  9.221   -37.113 1.00 29.38 ? 144 THR B N     1 
ATOM   2874 C CA    . THR B 1 106 ? 21.651  8.670   -35.900 1.00 30.53 ? 144 THR B CA    1 
ATOM   2875 C C     . THR B 1 106 ? 21.055  9.855   -35.124 1.00 31.19 ? 144 THR B C     1 
ATOM   2876 O O     . THR B 1 106 ? 21.308  11.047  -35.425 1.00 31.88 ? 144 THR B O     1 
ATOM   2877 C CB    . THR B 1 106 ? 22.735  7.984   -34.965 1.00 31.06 ? 144 THR B CB    1 
ATOM   2878 O OG1   . THR B 1 106 ? 23.616  8.996   -34.442 1.00 34.01 ? 144 THR B OG1   1 
ATOM   2879 C CG2   . THR B 1 106 ? 23.563  6.909   -35.669 1.00 28.34 ? 144 THR B CG2   1 
ATOM   2880 N N     . LEU B 1 107 ? 20.357  9.531   -34.050 1.00 31.90 ? 145 LEU B N     1 
ATOM   2881 C CA    . LEU B 1 107 ? 19.755  10.577  -33.189 1.00 31.60 ? 145 LEU B CA    1 
ATOM   2882 C C     . LEU B 1 107 ? 20.821  11.545  -32.650 1.00 33.28 ? 145 LEU B C     1 
ATOM   2883 O O     . LEU B 1 107 ? 20.606  12.745  -32.551 1.00 33.38 ? 145 LEU B O     1 
ATOM   2884 C CB    . LEU B 1 107 ? 18.953  9.903   -32.099 1.00 32.06 ? 145 LEU B CB    1 
ATOM   2885 C CG    . LEU B 1 107 ? 18.297  10.830  -31.042 1.00 31.96 ? 145 LEU B CG    1 
ATOM   2886 C CD1   . LEU B 1 107 ? 17.309  11.835  -31.685 1.00 32.69 ? 145 LEU B CD1   1 
ATOM   2887 C CD2   . LEU B 1 107 ? 17.602  9.991   -29.950 1.00 36.43 ? 145 LEU B CD2   1 
ATOM   2888 N N     . GLU B 1 108 ? 21.983  10.994  -32.339 1.00 33.22 ? 146 GLU B N     1 
ATOM   2889 C CA    . GLU B 1 108 ? 23.075  11.793  -31.811 1.00 34.35 ? 146 GLU B CA    1 
ATOM   2890 C C     . GLU B 1 108 ? 23.798  12.633  -32.851 1.00 34.18 ? 146 GLU B C     1 
ATOM   2891 O O     . GLU B 1 108 ? 24.675  13.405  -32.495 1.00 34.96 ? 146 GLU B O     1 
ATOM   2892 C CB    . GLU B 1 108 ? 24.052  10.883  -31.061 1.00 34.32 ? 146 GLU B CB    1 
ATOM   2893 C CG    . GLU B 1 108 ? 23.402  10.150  -29.889 1.00 35.98 ? 146 GLU B CG    1 
ATOM   2894 C CD    . GLU B 1 108 ? 22.505  9.002   -30.304 1.00 36.24 ? 146 GLU B CD    1 
ATOM   2895 O OE1   . GLU B 1 108 ? 22.768  8.400   -31.361 1.00 33.61 ? 146 GLU B OE1   1 
ATOM   2896 O OE2   . GLU B 1 108 ? 21.561  8.690   -29.560 1.00 36.90 ? 146 GLU B OE2   1 
ATOM   2897 N N     . ASP B 1 109 ? 23.448  12.479  -34.128 1.00 33.01 ? 147 ASP B N     1 
ATOM   2898 C CA    . ASP B 1 109 ? 23.953  13.366  -35.167 1.00 34.28 ? 147 ASP B CA    1 
ATOM   2899 C C     . ASP B 1 109 ? 23.071  14.617  -35.352 1.00 33.22 ? 147 ASP B C     1 
ATOM   2900 O O     . ASP B 1 109 ? 23.407  15.483  -36.157 1.00 35.03 ? 147 ASP B O     1 
ATOM   2901 C CB    . ASP B 1 109 ? 24.082  12.579  -36.478 1.00 34.28 ? 147 ASP B CB    1 
ATOM   2902 C CG    . ASP B 1 109 ? 25.132  11.483  -36.369 1.00 39.06 ? 147 ASP B CG    1 
ATOM   2903 O OD1   . ASP B 1 109 ? 24.838  10.305  -36.681 1.00 37.53 ? 147 ASP B OD1   1 
ATOM   2904 O OD2   . ASP B 1 109 ? 26.274  11.797  -35.948 1.00 39.55 ? 147 ASP B OD2   1 
ATOM   2905 N N     . THR B 1 110 ? 21.942  14.667  -34.653 1.00 33.31 ? 148 THR B N     1 
ATOM   2906 C CA    . THR B 1 110 ? 21.063  15.831  -34.611 1.00 31.97 ? 148 THR B CA    1 
ATOM   2907 C C     . THR B 1 110 ? 21.532  16.740  -33.454 1.00 32.53 ? 148 THR B C     1 
ATOM   2908 O O     . THR B 1 110 ? 22.153  16.250  -32.510 1.00 33.53 ? 148 THR B O     1 
ATOM   2909 C CB    . THR B 1 110 ? 19.560  15.461  -34.378 1.00 32.38 ? 148 THR B CB    1 
ATOM   2910 O OG1   . THR B 1 110 ? 19.345  14.964  -33.051 1.00 32.63 ? 148 THR B OG1   1 
ATOM   2911 C CG2   . THR B 1 110 ? 19.099  14.385  -35.384 1.00 31.97 ? 148 THR B CG2   1 
ATOM   2912 N N     . LEU B 1 111 ? 21.192  18.023  -33.501 1.00 31.89 ? 149 LEU B N     1 
ATOM   2913 C CA    . LEU B 1 111 ? 21.636  18.938  -32.432 1.00 33.24 ? 149 LEU B CA    1 
ATOM   2914 C C     . LEU B 1 111 ? 21.239  18.385  -31.071 1.00 32.55 ? 149 LEU B C     1 
ATOM   2915 O O     . LEU B 1 111 ? 22.072  18.234  -30.192 1.00 32.79 ? 149 LEU B O     1 
ATOM   2916 C CB    . LEU B 1 111 ? 21.067  20.355  -32.610 1.00 32.13 ? 149 LEU B CB    1 
ATOM   2917 C CG    . LEU B 1 111 ? 21.352  21.365  -31.464 1.00 34.00 ? 149 LEU B CG    1 
ATOM   2918 C CD1   . LEU B 1 111 ? 22.879  21.501  -31.222 1.00 35.46 ? 149 LEU B CD1   1 
ATOM   2919 C CD2   . LEU B 1 111 ? 20.718  22.720  -31.811 1.00 34.42 ? 149 LEU B CD2   1 
ATOM   2920 N N     . LEU B 1 112 ? 19.966  18.071  -30.884 1.00 32.87 ? 150 LEU B N     1 
ATOM   2921 C CA    . LEU B 1 112 ? 19.525  17.700  -29.543 1.00 32.71 ? 150 LEU B CA    1 
ATOM   2922 C C     . LEU B 1 112 ? 20.195  16.429  -29.022 1.00 33.04 ? 150 LEU B C     1 
ATOM   2923 O O     . LEU B 1 112 ? 20.581  16.339  -27.851 1.00 31.08 ? 150 LEU B O     1 
ATOM   2924 C CB    . LEU B 1 112 ? 17.996  17.609  -29.486 1.00 33.33 ? 150 LEU B CB    1 
ATOM   2925 C CG    . LEU B 1 112 ? 17.287  18.973  -29.734 1.00 37.45 ? 150 LEU B CG    1 
ATOM   2926 C CD1   . LEU B 1 112 ? 15.783  18.788  -29.826 1.00 41.21 ? 150 LEU B CD1   1 
ATOM   2927 C CD2   . LEU B 1 112 ? 17.613  20.010  -28.652 1.00 37.92 ? 150 LEU B CD2   1 
ATOM   2928 N N     . GLY B 1 113 ? 20.315  15.409  -29.859 1.00 32.10 ? 151 GLY B N     1 
ATOM   2929 C CA    . GLY B 1 113 ? 20.946  14.180  -29.401 1.00 31.93 ? 151 GLY B CA    1 
ATOM   2930 C C     . GLY B 1 113 ? 22.427  14.409  -29.108 1.00 32.04 ? 151 GLY B C     1 
ATOM   2931 O O     . GLY B 1 113 ? 22.991  13.784  -28.210 1.00 31.52 ? 151 GLY B O     1 
ATOM   2932 N N     . TYR B 1 114 ? 23.070  15.247  -29.912 1.00 31.66 ? 152 TYR B N     1 
ATOM   2933 C CA    . TYR B 1 114 ? 24.483  15.564  -29.731 1.00 31.67 ? 152 TYR B CA    1 
ATOM   2934 C C     . TYR B 1 114 ? 24.698  16.280  -28.383 1.00 31.63 ? 152 TYR B C     1 
ATOM   2935 O O     . TYR B 1 114 ? 25.676  15.986  -27.673 1.00 32.39 ? 152 TYR B O     1 
ATOM   2936 C CB    . TYR B 1 114 ? 24.905  16.462  -30.869 1.00 32.88 ? 152 TYR B CB    1 
ATOM   2937 C CG    . TYR B 1 114 ? 26.348  16.814  -30.899 1.00 34.69 ? 152 TYR B CG    1 
ATOM   2938 C CD1   . TYR B 1 114 ? 26.812  17.945  -30.229 1.00 30.46 ? 152 TYR B CD1   1 
ATOM   2939 C CD2   . TYR B 1 114 ? 27.257  16.069  -31.652 1.00 37.19 ? 152 TYR B CD2   1 
ATOM   2940 C CE1   . TYR B 1 114 ? 28.167  18.310  -30.304 1.00 34.69 ? 152 TYR B CE1   1 
ATOM   2941 C CE2   . TYR B 1 114 ? 28.620  16.424  -31.716 1.00 38.17 ? 152 TYR B CE2   1 
ATOM   2942 C CZ    . TYR B 1 114 ? 29.059  17.535  -31.041 1.00 38.73 ? 152 TYR B CZ    1 
ATOM   2943 O OH    . TYR B 1 114 ? 30.398  17.882  -31.115 1.00 40.23 ? 152 TYR B OH    1 
ATOM   2944 N N     . LEU B 1 115 ? 23.786  17.208  -28.060 1.00 31.36 ? 153 LEU B N     1 
ATOM   2945 C CA    . LEU B 1 115 ? 23.901  17.955  -26.782 1.00 32.43 ? 153 LEU B CA    1 
ATOM   2946 C C     . LEU B 1 115 ? 23.923  17.005  -25.603 1.00 32.83 ? 153 LEU B C     1 
ATOM   2947 O O     . LEU B 1 115 ? 24.674  17.221  -24.616 1.00 34.90 ? 153 LEU B O     1 
ATOM   2948 C CB    . LEU B 1 115 ? 22.736  18.954  -26.594 1.00 32.23 ? 153 LEU B CB    1 
ATOM   2949 C CG    . LEU B 1 115 ? 22.715  20.132  -27.572 1.00 36.03 ? 153 LEU B CG    1 
ATOM   2950 C CD1   . LEU B 1 115 ? 21.593  21.034  -27.167 1.00 34.22 ? 153 LEU B CD1   1 
ATOM   2951 C CD2   . LEU B 1 115 ? 24.048  20.886  -27.669 1.00 35.97 ? 153 LEU B CD2   1 
ATOM   2952 N N     . ALA B 1 116 ? 23.051  16.005  -25.623 1.00 32.27 ? 154 ALA B N     1 
ATOM   2953 C CA    . ALA B 1 116 ? 22.759  15.198  -24.420 1.00 31.89 ? 154 ALA B CA    1 
ATOM   2954 C C     . ALA B 1 116 ? 23.529  13.877  -24.308 1.00 31.76 ? 154 ALA B C     1 
ATOM   2955 O O     . ALA B 1 116 ? 23.533  13.218  -23.249 1.00 31.89 ? 154 ALA B O     1 
ATOM   2956 C CB    . ALA B 1 116 ? 21.254  14.916  -24.362 1.00 31.62 ? 154 ALA B CB    1 
ATOM   2957 N N     . ASP B 1 117 ? 24.114  13.412  -25.422 1.00 31.51 ? 155 ASP B N     1 
ATOM   2958 C CA    . ASP B 1 117 ? 24.702  12.052  -25.417 1.00 32.04 ? 155 ASP B CA    1 
ATOM   2959 C C     . ASP B 1 117 ? 25.731  11.868  -24.310 1.00 32.25 ? 155 ASP B C     1 
ATOM   2960 O O     . ASP B 1 117 ? 26.593  12.705  -24.139 1.00 32.70 ? 155 ASP B O     1 
ATOM   2961 C CB    . ASP B 1 117 ? 25.413  11.839  -26.735 1.00 32.93 ? 155 ASP B CB    1 
ATOM   2962 C CG    . ASP B 1 117 ? 25.739  10.380  -27.006 1.00 33.78 ? 155 ASP B CG    1 
ATOM   2963 O OD1   . ASP B 1 117 ? 26.645  10.163  -27.841 1.00 38.75 ? 155 ASP B OD1   1 
ATOM   2964 O OD2   . ASP B 1 117 ? 25.089  9.486   -26.449 1.00 35.18 ? 155 ASP B OD2   1 
ATOM   2965 N N     . ASP B 1 118 ? 25.591  10.771  -23.581 1.00 33.66 ? 156 ASP B N     1 
ATOM   2966 C CA    . ASP B 1 118 ? 26.499  10.345  -22.522 1.00 33.48 ? 156 ASP B CA    1 
ATOM   2967 C C     . ASP B 1 118 ? 26.447  11.259  -21.286 1.00 33.86 ? 156 ASP B C     1 
ATOM   2968 O O     . ASP B 1 118 ? 27.316  11.105  -20.415 1.00 36.33 ? 156 ASP B O     1 
ATOM   2969 C CB    . ASP B 1 118 ? 27.952  10.233  -22.993 1.00 33.31 ? 156 ASP B CB    1 
ATOM   2970 C CG    . ASP B 1 118 ? 28.205  8.995   -23.900 1.00 38.32 ? 156 ASP B CG    1 
ATOM   2971 O OD1   . ASP B 1 118 ? 27.530  7.965   -23.732 1.00 42.91 ? 156 ASP B OD1   1 
ATOM   2972 O OD2   . ASP B 1 118 ? 29.118  9.069   -24.731 1.00 45.60 ? 156 ASP B OD2   1 
ATOM   2973 N N     . LEU B 1 119 ? 25.474  12.166  -21.204 1.00 32.35 ? 157 LEU B N     1 
ATOM   2974 C CA    . LEU B 1 119 ? 25.392  13.050  -20.025 1.00 32.44 ? 157 LEU B CA    1 
ATOM   2975 C C     . LEU B 1 119 ? 24.257  12.623  -19.124 1.00 31.36 ? 157 LEU B C     1 
ATOM   2976 O O     . LEU B 1 119 ? 23.328  11.922  -19.553 1.00 31.59 ? 157 LEU B O     1 
ATOM   2977 C CB    . LEU B 1 119 ? 25.201  14.529  -20.448 1.00 32.32 ? 157 LEU B CB    1 
ATOM   2978 C CG    . LEU B 1 119 ? 26.274  15.107  -21.386 1.00 33.44 ? 157 LEU B CG    1 
ATOM   2979 C CD1   . LEU B 1 119 ? 25.940  16.580  -21.683 1.00 35.77 ? 157 LEU B CD1   1 
ATOM   2980 C CD2   . LEU B 1 119 ? 27.696  14.932  -20.771 1.00 33.50 ? 157 LEU B CD2   1 
ATOM   2981 N N     . THR B 1 120 ? 24.327  13.042  -17.856 1.00 30.60 ? 158 THR B N     1 
ATOM   2982 C CA    . THR B 1 120 ? 23.246  12.850  -16.908 1.00 30.93 ? 158 THR B CA    1 
ATOM   2983 C C     . THR B 1 120 ? 22.965  14.235  -16.302 1.00 30.58 ? 158 THR B C     1 
ATOM   2984 O O     . THR B 1 120 ? 23.870  15.004  -16.179 1.00 31.37 ? 158 THR B O     1 
ATOM   2985 C CB    . THR B 1 120 ? 23.755  11.946  -15.743 1.00 32.91 ? 158 THR B CB    1 
ATOM   2986 O OG1   . THR B 1 120 ? 24.126  10.670  -16.305 1.00 36.29 ? 158 THR B OG1   1 
ATOM   2987 C CG2   . THR B 1 120 ? 22.676  11.692  -14.712 1.00 34.41 ? 158 THR B CG2   1 
ATOM   2988 N N     . TRP B 1 121 ? 21.709  14.493  -15.956 1.00 31.41 ? 159 TRP B N     1 
ATOM   2989 C CA    . TRP B 1 121 ? 21.379  15.781  -15.245 1.00 30.53 ? 159 TRP B CA    1 
ATOM   2990 C C     . TRP B 1 121 ? 20.081  15.617  -14.472 1.00 32.95 ? 159 TRP B C     1 
ATOM   2991 O O     . TRP B 1 121 ? 19.224  14.786  -14.812 1.00 30.63 ? 159 TRP B O     1 
ATOM   2992 C CB    . TRP B 1 121 ? 21.198  16.885  -16.282 1.00 32.36 ? 159 TRP B CB    1 
ATOM   2993 C CG    . TRP B 1 121 ? 20.081  16.623  -17.313 1.00 31.81 ? 159 TRP B CG    1 
ATOM   2994 C CD1   . TRP B 1 121 ? 18.795  17.060  -17.268 1.00 31.46 ? 159 TRP B CD1   1 
ATOM   2995 C CD2   . TRP B 1 121 ? 20.208  15.863  -18.539 1.00 32.75 ? 159 TRP B CD2   1 
ATOM   2996 N NE1   . TRP B 1 121 ? 18.085  16.617  -18.396 1.00 34.32 ? 159 TRP B NE1   1 
ATOM   2997 C CE2   . TRP B 1 121 ? 18.937  15.897  -19.186 1.00 33.64 ? 159 TRP B CE2   1 
ATOM   2998 C CE3   . TRP B 1 121 ? 21.278  15.203  -19.155 1.00 32.95 ? 159 TRP B CE3   1 
ATOM   2999 C CZ2   . TRP B 1 121 ? 18.691  15.247  -20.443 1.00 34.69 ? 159 TRP B CZ2   1 
ATOM   3000 C CZ3   . TRP B 1 121 ? 21.027  14.528  -20.418 1.00 29.88 ? 159 TRP B CZ3   1 
ATOM   3001 C CH2   . TRP B 1 121 ? 19.748  14.580  -21.019 1.00 31.93 ? 159 TRP B CH2   1 
ATOM   3002 N N     . CYS B 1 122 ? 19.935  16.407  -13.406 1.00 33.12 ? 160 CYS B N     1 
ATOM   3003 C CA    . CYS B 1 122 ? 18.637  16.530  -12.739 1.00 33.72 ? 160 CYS B CA    1 
ATOM   3004 C C     . CYS B 1 122 ? 18.708  17.740  -11.820 1.00 34.70 ? 160 CYS B C     1 
ATOM   3005 O O     . CYS B 1 122 ? 19.798  18.250  -11.587 1.00 33.82 ? 160 CYS B O     1 
ATOM   3006 C CB    . CYS B 1 122 ? 18.259  15.285  -11.954 1.00 36.03 ? 160 CYS B CB    1 
ATOM   3007 S SG    . CYS B 1 122 ? 19.410  14.835  -10.599 1.00 40.04 ? 160 CYS B SG    1 
ATOM   3008 N N     . GLY B 1 123 ? 17.534  18.202  -11.382 1.00 34.50 ? 161 GLY B N     1 
ATOM   3009 C CA    . GLY B 1 123 ? 17.469  19.344  -10.484 1.00 36.61 ? 161 GLY B CA    1 
ATOM   3010 C C     . GLY B 1 123 ? 16.750  18.862  -9.231  1.00 37.87 ? 161 GLY B C     1 
ATOM   3011 O O     . GLY B 1 123 ? 16.816  17.703  -8.881  1.00 38.10 ? 161 GLY B O     1 
ATOM   3012 N N     . GLU B 1 124 ? 16.039  19.794  -8.598  1.00 39.13 ? 162 GLU B N     1 
ATOM   3013 C CA    . GLU B 1 124 ? 15.447  19.633  -7.241  1.00 40.45 ? 162 GLU B CA    1 
ATOM   3014 C C     . GLU B 1 124 ? 14.113  20.351  -7.252  1.00 40.36 ? 162 GLU B C     1 
ATOM   3015 O O     . GLU B 1 124 ? 14.007  21.338  -7.973  1.00 40.13 ? 162 GLU B O     1 
ATOM   3016 C CB    . GLU B 1 124 ? 16.414  20.272  -6.257  1.00 40.37 ? 162 GLU B CB    1 
ATOM   3017 C CG    . GLU B 1 124 ? 17.711  19.482  -6.200  1.00 45.16 ? 162 GLU B CG    1 
ATOM   3018 C CD    . GLU B 1 124 ? 18.897  20.155  -5.525  1.00 53.58 ? 162 GLU B CD    1 
ATOM   3019 O OE1   . GLU B 1 124 ? 20.037  19.763  -5.885  1.00 58.15 ? 162 GLU B OE1   1 
ATOM   3020 O OE2   . GLU B 1 124 ? 18.720  21.029  -4.633  1.00 54.28 ? 162 GLU B OE2   1 
ATOM   3021 N N     . PHE B 1 125 ? 13.081  19.896  -6.512  1.00 38.64 ? 163 PHE B N     1 
ATOM   3022 C CA    . PHE B 1 125 ? 11.796  20.602  -6.634  1.00 40.14 ? 163 PHE B CA    1 
ATOM   3023 C C     . PHE B 1 125 ? 11.925  21.895  -5.888  1.00 40.84 ? 163 PHE B C     1 
ATOM   3024 O O     . PHE B 1 125 ? 11.195  22.859  -6.126  1.00 42.72 ? 163 PHE B O     1 
ATOM   3025 C CB    . PHE B 1 125 ? 10.550  19.804  -6.152  1.00 38.68 ? 163 PHE B CB    1 
ATOM   3026 C CG    . PHE B 1 125 ? 10.446  19.631  -4.676  1.00 40.57 ? 163 PHE B CG    1 
ATOM   3027 C CD1   . PHE B 1 125 ? 9.547   20.396  -3.941  1.00 38.20 ? 163 PHE B CD1   1 
ATOM   3028 C CD2   . PHE B 1 125 ? 11.172  18.643  -4.035  1.00 44.28 ? 163 PHE B CD2   1 
ATOM   3029 C CE1   . PHE B 1 125 ? 9.422   20.232  -2.564  1.00 42.34 ? 163 PHE B CE1   1 
ATOM   3030 C CE2   . PHE B 1 125 ? 11.054  18.462  -2.655  1.00 42.02 ? 163 PHE B CE2   1 
ATOM   3031 C CZ    . PHE B 1 125 ? 10.175  19.271  -1.921  1.00 41.72 ? 163 PHE B CZ    1 
ATOM   3032 N N     . ASP B 1 126 ? 12.937  21.855  -5.049  1.00 41.07 ? 164 ASP B N     1 
ATOM   3033 C CA    . ASP B 1 126 ? 13.138  22.634  -3.868  1.00 42.86 ? 164 ASP B CA    1 
ATOM   3034 C C     . ASP B 1 126 ? 13.751  24.042  -4.205  1.00 42.23 ? 164 ASP B C     1 
ATOM   3035 O O     . ASP B 1 126 ? 13.580  25.055  -3.459  1.00 41.10 ? 164 ASP B O     1 
ATOM   3036 C CB    . ASP B 1 126 ? 14.147  21.749  -3.083  1.00 44.26 ? 164 ASP B CB    1 
ATOM   3037 C CG    . ASP B 1 126 ? 13.780  21.571  -1.617  1.00 48.84 ? 164 ASP B CG    1 
ATOM   3038 O OD1   . ASP B 1 126 ? 14.021  22.485  -0.791  1.00 56.08 ? 164 ASP B OD1   1 
ATOM   3039 O OD2   . ASP B 1 126 ? 13.278  20.488  -1.262  1.00 55.96 ? 164 ASP B OD2   1 
ATOM   3040 N N     . THR B 1 127 ? 14.470  24.102  -5.320  1.00 39.57 ? 165 THR B N     1 
ATOM   3041 C CA    . THR B 1 127 ? 15.499  25.118  -5.524  1.00 39.69 ? 165 THR B CA    1 
ATOM   3042 C C     . THR B 1 127 ? 15.872  25.210  -6.981  1.00 40.24 ? 165 THR B C     1 
ATOM   3043 O O     . THR B 1 127 ? 15.445  24.364  -7.760  1.00 39.89 ? 165 THR B O     1 
ATOM   3044 C CB    . THR B 1 127 ? 16.767  24.758  -4.723  1.00 41.50 ? 165 THR B CB    1 
ATOM   3045 O OG1   . THR B 1 127 ? 17.596  25.917  -4.613  1.00 47.23 ? 165 THR B OG1   1 
ATOM   3046 C CG2   . THR B 1 127 ? 17.539  23.684  -5.404  1.00 36.87 ? 165 THR B CG2   1 
ATOM   3047 N N     . SER B 1 128 ? 16.726  26.162  -7.350  1.00 39.11 ? 166 SER B N     1 
ATOM   3048 C CA    . SER B 1 128 ? 17.155  26.236  -8.750  1.00 41.15 ? 166 SER B CA    1 
ATOM   3049 C C     . SER B 1 128 ? 18.502  25.554  -8.983  1.00 40.68 ? 166 SER B C     1 
ATOM   3050 O O     . SER B 1 128 ? 19.138  25.785  -10.018 1.00 43.10 ? 166 SER B O     1 
ATOM   3051 C CB    . SER B 1 128 ? 17.283  27.695  -9.174  1.00 40.96 ? 166 SER B CB    1 
ATOM   3052 O OG    . SER B 1 128 ? 18.195  28.320  -8.294  1.00 44.58 ? 166 SER B OG    1 
ATOM   3053 N N     . LYS B 1 129 ? 18.958  24.761  -8.014  1.00 39.54 ? 167 LYS B N     1 
ATOM   3054 C CA    . LYS B 1 129 ? 20.271  24.124  -8.112  1.00 38.93 ? 167 LYS B CA    1 
ATOM   3055 C C     . LYS B 1 129 ? 20.219  22.861  -8.957  1.00 38.49 ? 167 LYS B C     1 
ATOM   3056 O O     . LYS B 1 129 ? 19.230  22.128  -8.963  1.00 38.58 ? 167 LYS B O     1 
ATOM   3057 C CB    . LYS B 1 129 ? 20.793  23.750  -6.742  1.00 40.15 ? 167 LYS B CB    1 
ATOM   3058 C CG    . LYS B 1 129 ? 21.389  24.958  -5.995  1.00 42.16 ? 167 LYS B CG    1 
ATOM   3059 C CD    . LYS B 1 129 ? 21.393  24.745  -4.513  1.00 50.25 ? 167 LYS B CD    1 
ATOM   3060 C CE    . LYS B 1 129 ? 21.375  26.109  -3.789  1.00 53.66 ? 167 LYS B CE    1 
ATOM   3061 N NZ    . LYS B 1 129 ? 22.001  27.221  -4.595  1.00 55.30 ? 167 LYS B NZ    1 
ATOM   3062 N N     . ILE B 1 130 ? 21.326  22.621  -9.644  1.00 36.51 ? 168 ILE B N     1 
ATOM   3063 C CA    . ILE B 1 130 ? 21.526  21.339  -10.347 1.00 36.32 ? 168 ILE B CA    1 
ATOM   3064 C C     . ILE B 1 130 ? 22.036  20.339  -9.319  1.00 35.36 ? 168 ILE B C     1 
ATOM   3065 O O     . ILE B 1 130 ? 22.853  20.717  -8.451  1.00 35.49 ? 168 ILE B O     1 
ATOM   3066 C CB    . ILE B 1 130 ? 22.518  21.536  -11.505 1.00 36.83 ? 168 ILE B CB    1 
ATOM   3067 C CG1   . ILE B 1 130 ? 21.819  22.303  -12.638 1.00 37.24 ? 168 ILE B CG1   1 
ATOM   3068 C CG2   . ILE B 1 130 ? 23.012  20.135  -12.011 1.00 38.67 ? 168 ILE B CG2   1 
ATOM   3069 C CD1   . ILE B 1 130 ? 22.667  22.572  -13.879 1.00 39.92 ? 168 ILE B CD1   1 
ATOM   3070 N N     . ASN B 1 131 ? 21.566  19.077  -9.376  1.00 34.40 ? 169 ASN B N     1 
ATOM   3071 C CA    . ASN B 1 131 ? 22.009  18.079  -8.398  1.00 33.38 ? 169 ASN B CA    1 
ATOM   3072 C C     . ASN B 1 131 ? 23.224  17.344  -8.933  1.00 35.20 ? 169 ASN B C     1 
ATOM   3073 O O     . ASN B 1 131 ? 23.100  16.513  -9.846  1.00 33.48 ? 169 ASN B O     1 
ATOM   3074 C CB    . ASN B 1 131 ? 20.873  17.140  -8.001  1.00 34.15 ? 169 ASN B CB    1 
ATOM   3075 C CG    . ASN B 1 131 ? 21.253  16.156  -6.867  1.00 33.09 ? 169 ASN B CG    1 
ATOM   3076 O OD1   . ASN B 1 131 ? 22.418  15.885  -6.613  1.00 34.82 ? 169 ASN B OD1   1 
ATOM   3077 N ND2   . ASN B 1 131 ? 20.249  15.570  -6.255  1.00 36.08 ? 169 ASN B ND2   1 
ATOM   3078 N N     . TYR B 1 132 ? 24.389  17.648  -8.382  1.00 34.02 ? 170 TYR B N     1 
ATOM   3079 C CA    . TYR B 1 132 ? 25.599  16.999  -8.884  1.00 34.04 ? 170 TYR B CA    1 
ATOM   3080 C C     . TYR B 1 132 ? 26.022  15.737  -8.132  1.00 33.43 ? 170 TYR B C     1 
ATOM   3081 O O     . TYR B 1 132 ? 27.065  15.149  -8.418  1.00 33.87 ? 170 TYR B O     1 
ATOM   3082 C CB    . TYR B 1 132 ? 26.748  17.988  -8.897  1.00 33.75 ? 170 TYR B CB    1 
ATOM   3083 C CG    . TYR B 1 132 ? 26.666  19.078  -9.930  1.00 32.63 ? 170 TYR B CG    1 
ATOM   3084 C CD1   . TYR B 1 132 ? 26.249  20.366  -9.576  1.00 29.82 ? 170 TYR B CD1   1 
ATOM   3085 C CD2   . TYR B 1 132 ? 26.970  18.833  -11.276 1.00 32.44 ? 170 TYR B CD2   1 
ATOM   3086 C CE1   . TYR B 1 132 ? 26.171  21.413  -10.495 1.00 32.31 ? 170 TYR B CE1   1 
ATOM   3087 C CE2   . TYR B 1 132 ? 26.926  19.862  -12.200 1.00 33.36 ? 170 TYR B CE2   1 
ATOM   3088 C CZ    . TYR B 1 132 ? 26.498  21.151  -11.816 1.00 34.89 ? 170 TYR B CZ    1 
ATOM   3089 O OH    . TYR B 1 132 ? 26.410  22.146  -12.765 1.00 38.32 ? 170 TYR B OH    1 
ATOM   3090 N N     . GLN B 1 133 ? 25.252  15.362  -7.127  1.00 33.01 ? 171 GLN B N     1 
ATOM   3091 C CA    . GLN B 1 133 ? 25.592  14.191  -6.323  1.00 34.84 ? 171 GLN B CA    1 
ATOM   3092 C C     . GLN B 1 133 ? 24.895  12.913  -6.711  1.00 32.11 ? 171 GLN B C     1 
ATOM   3093 O O     . GLN B 1 133 ? 25.534  11.863  -6.677  1.00 32.42 ? 171 GLN B O     1 
ATOM   3094 C CB    . GLN B 1 133 ? 25.387  14.465  -4.819  1.00 35.56 ? 171 GLN B CB    1 
ATOM   3095 C CG    . GLN B 1 133 ? 26.509  15.321  -4.256  1.00 41.15 ? 171 GLN B CG    1 
ATOM   3096 C CD    . GLN B 1 133 ? 26.897  15.066  -2.737  1.00 42.21 ? 171 GLN B CD    1 
ATOM   3097 O OE1   . GLN B 1 133 ? 27.141  16.029  -2.002  1.00 51.90 ? 171 GLN B OE1   1 
ATOM   3098 N NE2   . GLN B 1 133 ? 26.987  13.772  -2.288  1.00 48.79 ? 171 GLN B NE2   1 
ATOM   3099 N N     . SER B 1 134 ? 23.590  12.987  -7.022  1.00 31.98 ? 172 SER B N     1 
ATOM   3100 C CA    . SER B 1 134 ? 22.836  11.811  -7.466  1.00 32.44 ? 172 SER B CA    1 
ATOM   3101 C C     . SER B 1 134 ? 21.612  12.247  -8.220  1.00 32.47 ? 172 SER B C     1 
ATOM   3102 O O     . SER B 1 134 ? 21.190  13.398  -8.087  1.00 32.50 ? 172 SER B O     1 
ATOM   3103 C CB    . SER B 1 134 ? 22.432  10.934  -6.288  1.00 32.27 ? 172 SER B CB    1 
ATOM   3104 O OG    . SER B 1 134 ? 21.443  11.628  -5.491  1.00 32.65 ? 172 SER B OG    1 
ATOM   3105 N N     . CYS B 1 135 ? 21.142  11.368  -9.112  1.00 32.83 ? 173 CYS B N     1 
ATOM   3106 C CA    . CYS B 1 135 ? 19.907  11.579  -9.874  1.00 32.40 ? 173 CYS B CA    1 
ATOM   3107 C C     . CYS B 1 135 ? 19.143  10.244  -9.916  1.00 33.62 ? 173 CYS B C     1 
ATOM   3108 O O     . CYS B 1 135 ? 19.741  9.208   -9.744  1.00 33.16 ? 173 CYS B O     1 
ATOM   3109 C CB    . CYS B 1 135 ? 20.262  11.979  -11.320 1.00 33.36 ? 173 CYS B CB    1 
ATOM   3110 S SG    . CYS B 1 135 ? 20.928  13.623  -11.534 1.00 36.97 ? 173 CYS B SG    1 
ATOM   3111 N N     . PRO B 1 136 ? 17.815  10.275  -10.149 1.00 32.61 ? 174 PRO B N     1 
ATOM   3112 C CA    . PRO B 1 136 ? 16.990  9.044   -10.110 1.00 34.00 ? 174 PRO B CA    1 
ATOM   3113 C C     . PRO B 1 136 ? 17.446  7.990   -11.099 1.00 34.19 ? 174 PRO B C     1 
ATOM   3114 O O     . PRO B 1 136 ? 17.718  8.292   -12.236 1.00 35.14 ? 174 PRO B O     1 
ATOM   3115 C CB    . PRO B 1 136 ? 15.610  9.550   -10.548 1.00 33.25 ? 174 PRO B CB    1 
ATOM   3116 C CG    . PRO B 1 136 ? 15.612  10.978  -10.129 1.00 34.47 ? 174 PRO B CG    1 
ATOM   3117 C CD    . PRO B 1 136 ? 16.995  11.471  -10.368 1.00 33.24 ? 174 PRO B CD    1 
ATOM   3118 N N     . ASP B 1 137 ? 17.529  6.759   -10.628 1.00 35.25 ? 175 ASP B N     1 
ATOM   3119 C CA    . ASP B 1 137 ? 17.790  5.631   -11.472 1.00 36.06 ? 175 ASP B CA    1 
ATOM   3120 C C     . ASP B 1 137 ? 16.435  5.186   -12.041 1.00 36.37 ? 175 ASP B C     1 
ATOM   3121 O O     . ASP B 1 137 ? 15.447  5.070   -11.308 1.00 36.60 ? 175 ASP B O     1 
ATOM   3122 C CB    . ASP B 1 137 ? 18.413  4.495   -10.654 1.00 35.74 ? 175 ASP B CB    1 
ATOM   3123 C CG    . ASP B 1 137 ? 18.600  3.227   -11.515 1.00 41.74 ? 175 ASP B CG    1 
ATOM   3124 O OD1   . ASP B 1 137 ? 17.705  2.373   -11.553 1.00 41.55 ? 175 ASP B OD1   1 
ATOM   3125 O OD2   . ASP B 1 137 ? 19.609  3.148   -12.229 1.00 44.50 ? 175 ASP B OD2   1 
ATOM   3126 N N     . TRP B 1 138 ? 16.387  4.956   -13.347 1.00 38.53 ? 176 TRP B N     1 
ATOM   3127 C CA    . TRP B 1 138 ? 15.130  4.701   -14.039 1.00 42.29 ? 176 TRP B CA    1 
ATOM   3128 C C     . TRP B 1 138 ? 14.381  3.497   -13.479 1.00 42.25 ? 176 TRP B C     1 
ATOM   3129 O O     . TRP B 1 138 ? 13.161  3.502   -13.421 1.00 42.89 ? 176 TRP B O     1 
ATOM   3130 C CB    . TRP B 1 138 ? 15.431  4.526   -15.538 1.00 45.88 ? 176 TRP B CB    1 
ATOM   3131 C CG    . TRP B 1 138 ? 14.295  4.134   -16.365 1.00 50.56 ? 176 TRP B CG    1 
ATOM   3132 C CD1   . TRP B 1 138 ? 13.268  4.931   -16.785 1.00 52.39 ? 176 TRP B CD1   1 
ATOM   3133 C CD2   . TRP B 1 138 ? 14.065  2.840   -16.936 1.00 53.59 ? 176 TRP B CD2   1 
ATOM   3134 N NE1   . TRP B 1 138 ? 12.393  4.201   -17.563 1.00 53.96 ? 176 TRP B NE1   1 
ATOM   3135 C CE2   . TRP B 1 138 ? 12.861  2.914   -17.666 1.00 54.65 ? 176 TRP B CE2   1 
ATOM   3136 C CE3   . TRP B 1 138 ? 14.756  1.623   -16.890 1.00 54.90 ? 176 TRP B CE3   1 
ATOM   3137 C CZ2   . TRP B 1 138 ? 12.330  1.809   -18.347 1.00 53.49 ? 176 TRP B CZ2   1 
ATOM   3138 C CZ3   . TRP B 1 138 ? 14.225  0.523   -17.559 1.00 53.30 ? 176 TRP B CZ3   1 
ATOM   3139 C CH2   . TRP B 1 138 ? 13.023  0.628   -18.282 1.00 52.81 ? 176 TRP B CH2   1 
ATOM   3140 N N     . ARG B 1 139 ? 15.106  2.484   -13.031 1.00 41.88 ? 177 ARG B N     1 
ATOM   3141 C CA    . ARG B 1 139 ? 14.470  1.272   -12.490 1.00 42.80 ? 177 ARG B CA    1 
ATOM   3142 C C     . ARG B 1 139 ? 14.241  1.321   -10.987 1.00 42.22 ? 177 ARG B C     1 
ATOM   3143 O O     . ARG B 1 139 ? 13.150  0.967   -10.502 1.00 43.51 ? 177 ARG B O     1 
ATOM   3144 C CB    . ARG B 1 139 ? 15.301  0.040   -12.818 1.00 43.93 ? 177 ARG B CB    1 
ATOM   3145 C CG    . ARG B 1 139 ? 15.444  -0.249  -14.326 1.00 48.06 ? 177 ARG B CG    1 
ATOM   3146 C CD    . ARG B 1 139 ? 15.735  -1.741  -14.595 1.00 53.75 ? 177 ARG B CD    1 
ATOM   3147 N NE    . ARG B 1 139 ? 14.498  -2.517  -14.689 1.00 58.83 ? 177 ARG B NE    1 
ATOM   3148 C CZ    . ARG B 1 139 ? 13.822  -2.997  -13.642 1.00 60.86 ? 177 ARG B CZ    1 
ATOM   3149 N NH1   . ARG B 1 139 ? 14.260  -2.801  -12.402 1.00 63.03 ? 177 ARG B NH1   1 
ATOM   3150 N NH2   . ARG B 1 139 ? 12.700  -3.673  -13.829 1.00 60.70 ? 177 ARG B NH2   1 
ATOM   3151 N N     . LYS B 1 140 ? 15.267  1.735   -10.248 1.00 41.03 ? 178 LYS B N     1 
ATOM   3152 C CA    . LYS B 1 140 ? 15.264  1.758   -8.786  1.00 40.72 ? 178 LYS B CA    1 
ATOM   3153 C C     . LYS B 1 140 ? 14.467  2.910   -8.173  1.00 39.50 ? 178 LYS B C     1 
ATOM   3154 O O     . LYS B 1 140 ? 13.920  2.765   -7.068  1.00 39.43 ? 178 LYS B O     1 
ATOM   3155 C CB    . LYS B 1 140 ? 16.700  1.851   -8.225  1.00 42.24 ? 178 LYS B CB    1 
ATOM   3156 C CG    . LYS B 1 140 ? 17.486  0.552   -8.002  1.00 44.33 ? 178 LYS B CG    1 
ATOM   3157 C CD    . LYS B 1 140 ? 18.743  0.856   -7.127  1.00 44.94 ? 178 LYS B CD    1 
ATOM   3158 C CE    . LYS B 1 140 ? 19.484  -0.393  -6.602  1.00 48.06 ? 178 LYS B CE    1 
ATOM   3159 N NZ    . LYS B 1 140 ? 20.036  -1.267  -7.695  1.00 53.81 ? 178 LYS B NZ    1 
ATOM   3160 N N     . ASP B 1 141 ? 14.461  4.067   -8.834  1.00 37.36 ? 179 ASP B N     1 
ATOM   3161 C CA    . ASP B 1 141 ? 13.824  5.266   -8.269  1.00 36.35 ? 179 ASP B CA    1 
ATOM   3162 C C     . ASP B 1 141 ? 12.519  5.599   -9.015  1.00 35.18 ? 179 ASP B C     1 
ATOM   3163 O O     . ASP B 1 141 ? 11.428  5.299   -8.528  1.00 35.65 ? 179 ASP B O     1 
ATOM   3164 C CB    . ASP B 1 141 ? 14.783  6.467   -8.244  1.00 35.61 ? 179 ASP B CB    1 
ATOM   3165 C CG    . ASP B 1 141 ? 16.008  6.240   -7.340  1.00 37.37 ? 179 ASP B CG    1 
ATOM   3166 O OD1   . ASP B 1 141 ? 15.845  5.773   -6.195  1.00 41.55 ? 179 ASP B OD1   1 
ATOM   3167 O OD2   . ASP B 1 141 ? 17.133  6.562   -7.765  1.00 35.79 ? 179 ASP B OD2   1 
ATOM   3168 N N     . CYS B 1 142 ? 12.611  6.182   -10.194 1.00 34.23 ? 180 CYS B N     1 
ATOM   3169 C CA    . CYS B 1 142 ? 11.399  6.582   -10.906 1.00 34.31 ? 180 CYS B CA    1 
ATOM   3170 C C     . CYS B 1 142 ? 11.695  6.733   -12.392 1.00 34.06 ? 180 CYS B C     1 
ATOM   3171 O O     . CYS B 1 142 ? 12.806  7.116   -12.786 1.00 35.39 ? 180 CYS B O     1 
ATOM   3172 C CB    . CYS B 1 142 ? 10.854  7.890   -10.324 1.00 36.17 ? 180 CYS B CB    1 
ATOM   3173 S SG    . CYS B 1 142 ? 12.019  9.228   -10.375 1.00 40.97 ? 180 CYS B SG    1 
ATOM   3174 N N     . SER B 1 143 ? 10.724  6.416   -13.226 1.00 35.16 ? 181 SER B N     1 
ATOM   3175 C CA    . SER B 1 143 ? 11.029  6.500   -14.649 1.00 33.90 ? 181 SER B CA    1 
ATOM   3176 C C     . SER B 1 143 ? 10.848  7.892   -15.246 1.00 32.67 ? 181 SER B C     1 
ATOM   3177 O O     . SER B 1 143 ? 11.340  8.142   -16.345 1.00 33.12 ? 181 SER B O     1 
ATOM   3178 C CB    . SER B 1 143 ? 10.219  5.463   -15.447 1.00 35.84 ? 181 SER B CB    1 
ATOM   3179 O OG    . SER B 1 143 ? 8.844   5.629   -15.250 1.00 39.12 ? 181 SER B OG    1 
ATOM   3180 N N     . ASN B 1 144 ? 10.055  8.775   -14.610 1.00 33.37 ? 182 ASN B N     1 
ATOM   3181 C CA    . ASN B 1 144 ? 9.792   10.086  -15.233 1.00 33.24 ? 182 ASN B CA    1 
ATOM   3182 C C     . ASN B 1 144 ? 10.818  11.112  -14.757 1.00 33.46 ? 182 ASN B C     1 
ATOM   3183 O O     . ASN B 1 144 ? 10.481  12.197  -14.202 1.00 33.00 ? 182 ASN B O     1 
ATOM   3184 C CB    . ASN B 1 144 ? 8.348   10.579  -14.989 1.00 32.42 ? 182 ASN B CB    1 
ATOM   3185 C CG    . ASN B 1 144 ? 7.327   9.659   -15.610 1.00 36.27 ? 182 ASN B CG    1 
ATOM   3186 O OD1   . ASN B 1 144 ? 7.583   9.126   -16.674 1.00 35.47 ? 182 ASN B OD1   1 
ATOM   3187 N ND2   . ASN B 1 144 ? 6.199   9.437   -14.944 1.00 35.05 ? 182 ASN B ND2   1 
ATOM   3188 N N     . ASN B 1 145 ? 12.073  10.768  -15.002 1.00 33.27 ? 183 ASN B N     1 
ATOM   3189 C CA    . ASN B 1 145 ? 13.196  11.617  -14.609 1.00 31.31 ? 183 ASN B CA    1 
ATOM   3190 C C     . ASN B 1 145 ? 13.752  12.432  -15.789 1.00 31.29 ? 183 ASN B C     1 
ATOM   3191 O O     . ASN B 1 145 ? 13.453  12.134  -16.989 1.00 31.63 ? 183 ASN B O     1 
ATOM   3192 C CB    . ASN B 1 145 ? 14.252  10.744  -13.925 1.00 32.48 ? 183 ASN B CB    1 
ATOM   3193 C CG    . ASN B 1 145 ? 14.815  9.670   -14.860 1.00 32.36 ? 183 ASN B CG    1 
ATOM   3194 O OD1   . ASN B 1 145 ? 14.523  8.469   -14.723 1.00 37.85 ? 183 ASN B OD1   1 
ATOM   3195 N ND2   . ASN B 1 145 ? 15.637  10.095  -15.763 1.00 30.31 ? 183 ASN B ND2   1 
ATOM   3196 N N     . PRO B 1 146 ? 14.556  13.478  -15.500 1.00 30.68 ? 184 PRO B N     1 
ATOM   3197 C CA    . PRO B 1 146 ? 14.933  14.380  -16.560 1.00 32.07 ? 184 PRO B CA    1 
ATOM   3198 C C     . PRO B 1 146 ? 15.595  13.655  -17.759 1.00 31.73 ? 184 PRO B C     1 
ATOM   3199 O O     . PRO B 1 146 ? 15.278  13.952  -18.947 1.00 33.22 ? 184 PRO B O     1 
ATOM   3200 C CB    . PRO B 1 146 ? 15.894  15.346  -15.881 1.00 31.39 ? 184 PRO B CB    1 
ATOM   3201 C CG    . PRO B 1 146 ? 15.335  15.395  -14.419 1.00 32.04 ? 184 PRO B CG    1 
ATOM   3202 C CD    . PRO B 1 146 ? 14.978  13.931  -14.146 1.00 32.01 ? 184 PRO B CD    1 
ATOM   3203 N N     . VAL B 1 147 ? 16.485  12.711  -17.472 1.00 32.34 ? 185 VAL B N     1 
ATOM   3204 C CA    . VAL B 1 147 ? 17.225  12.104  -18.577 1.00 32.94 ? 185 VAL B CA    1 
ATOM   3205 C C     . VAL B 1 147 ? 16.308  11.144  -19.327 1.00 33.59 ? 185 VAL B C     1 
ATOM   3206 O O     . VAL B 1 147 ? 16.283  11.156  -20.579 1.00 32.85 ? 185 VAL B O     1 
ATOM   3207 C CB    . VAL B 1 147 ? 18.451  11.343  -18.056 1.00 32.43 ? 185 VAL B CB    1 
ATOM   3208 C CG1   . VAL B 1 147 ? 19.062  10.475  -19.150 1.00 32.37 ? 185 VAL B CG1   1 
ATOM   3209 C CG2   . VAL B 1 147 ? 19.509  12.303  -17.557 1.00 33.62 ? 185 VAL B CG2   1 
ATOM   3210 N N     . SER B 1 148 ? 15.569  10.300  -18.607 1.00 33.95 ? 186 SER B N     1 
ATOM   3211 C CA    . SER B 1 148 ? 14.686  9.305   -19.306 1.00 33.05 ? 186 SER B CA    1 
ATOM   3212 C C     . SER B 1 148 ? 13.621  9.971   -20.171 1.00 33.40 ? 186 SER B C     1 
ATOM   3213 O O     . SER B 1 148 ? 13.335  9.533   -21.294 1.00 33.13 ? 186 SER B O     1 
ATOM   3214 C CB    . SER B 1 148 ? 14.038  8.353   -18.274 1.00 33.19 ? 186 SER B CB    1 
ATOM   3215 O OG    . SER B 1 148 ? 15.036  7.559   -17.638 1.00 36.74 ? 186 SER B OG    1 
ATOM   3216 N N     . VAL B 1 149 ? 13.013  11.035  -19.642 1.00 33.97 ? 187 VAL B N     1 
ATOM   3217 C CA    . VAL B 1 149 ? 11.916  11.676  -20.355 1.00 32.79 ? 187 VAL B CA    1 
ATOM   3218 C C     . VAL B 1 149 ? 12.502  12.380  -21.567 1.00 33.05 ? 187 VAL B C     1 
ATOM   3219 O O     . VAL B 1 149 ? 11.886  12.392  -22.624 1.00 33.94 ? 187 VAL B O     1 
ATOM   3220 C CB    . VAL B 1 149 ? 11.140  12.671  -19.420 1.00 32.33 ? 187 VAL B CB    1 
ATOM   3221 C CG1   . VAL B 1 149 ? 10.182  13.513  -20.209 1.00 31.66 ? 187 VAL B CG1   1 
ATOM   3222 C CG2   . VAL B 1 149 ? 10.432  11.913  -18.303 1.00 29.86 ? 187 VAL B CG2   1 
ATOM   3223 N N     . PHE B 1 150 ? 13.713  12.943  -21.438 1.00 31.84 ? 188 PHE B N     1 
ATOM   3224 C CA    . PHE B 1 150 ? 14.334  13.608  -22.589 1.00 31.51 ? 188 PHE B CA    1 
ATOM   3225 C C     . PHE B 1 150 ? 14.472  12.605  -23.717 1.00 31.89 ? 188 PHE B C     1 
ATOM   3226 O O     . PHE B 1 150 ? 14.038  12.871  -24.854 1.00 32.72 ? 188 PHE B O     1 
ATOM   3227 C CB    . PHE B 1 150 ? 15.721  14.124  -22.233 1.00 32.19 ? 188 PHE B CB    1 
ATOM   3228 C CG    . PHE B 1 150 ? 16.491  14.631  -23.430 1.00 32.04 ? 188 PHE B CG    1 
ATOM   3229 C CD1   . PHE B 1 150 ? 16.300  15.932  -23.902 1.00 32.49 ? 188 PHE B CD1   1 
ATOM   3230 C CD2   . PHE B 1 150 ? 17.378  13.781  -24.107 1.00 32.77 ? 188 PHE B CD2   1 
ATOM   3231 C CE1   . PHE B 1 150 ? 17.013  16.420  -25.054 1.00 36.69 ? 188 PHE B CE1   1 
ATOM   3232 C CE2   . PHE B 1 150 ? 18.109  14.287  -25.247 1.00 32.67 ? 188 PHE B CE2   1 
ATOM   3233 C CZ    . PHE B 1 150 ? 17.899  15.583  -25.699 1.00 34.27 ? 188 PHE B CZ    1 
ATOM   3234 N N     . TRP B 1 151 ? 15.069  11.476  -23.404 1.00 32.73 ? 189 TRP B N     1 
ATOM   3235 C CA    . TRP B 1 151 ? 15.346  10.507  -24.515 1.00 32.93 ? 189 TRP B CA    1 
ATOM   3236 C C     . TRP B 1 151 ? 14.063  9.958   -25.113 1.00 34.28 ? 189 TRP B C     1 
ATOM   3237 O O     . TRP B 1 151 ? 13.985  9.737   -26.340 1.00 33.04 ? 189 TRP B O     1 
ATOM   3238 C CB    . TRP B 1 151 ? 16.309  9.396   -24.093 1.00 32.27 ? 189 TRP B CB    1 
ATOM   3239 C CG    . TRP B 1 151 ? 17.686  9.915   -23.916 1.00 34.37 ? 189 TRP B CG    1 
ATOM   3240 C CD1   . TRP B 1 151 ? 18.370  10.038  -22.726 1.00 34.49 ? 189 TRP B CD1   1 
ATOM   3241 C CD2   . TRP B 1 151 ? 18.549  10.449  -24.926 1.00 34.17 ? 189 TRP B CD2   1 
ATOM   3242 N NE1   . TRP B 1 151 ? 19.632  10.580  -22.946 1.00 34.98 ? 189 TRP B NE1   1 
ATOM   3243 C CE2   . TRP B 1 151 ? 19.759  10.851  -24.290 1.00 32.99 ? 189 TRP B CE2   1 
ATOM   3244 C CE3   . TRP B 1 151 ? 18.429  10.614  -26.320 1.00 33.29 ? 189 TRP B CE3   1 
ATOM   3245 C CZ2   . TRP B 1 151 ? 20.836  11.420  -25.000 1.00 33.97 ? 189 TRP B CZ2   1 
ATOM   3246 C CZ3   . TRP B 1 151 ? 19.501  11.187  -27.025 1.00 33.65 ? 189 TRP B CZ3   1 
ATOM   3247 C CH2   . TRP B 1 151 ? 20.689  11.572  -26.385 1.00 32.91 ? 189 TRP B CH2   1 
ATOM   3248 N N     . LYS B 1 152 ? 13.052  9.715   -24.269 1.00 35.17 ? 190 LYS B N     1 
ATOM   3249 C CA    . LYS B 1 152 ? 11.747  9.214   -24.801 1.00 36.64 ? 190 LYS B CA    1 
ATOM   3250 C C     . LYS B 1 152 ? 11.135  10.247  -25.744 1.00 35.75 ? 190 LYS B C     1 
ATOM   3251 O O     . LYS B 1 152 ? 10.597  9.904   -26.797 1.00 34.92 ? 190 LYS B O     1 
ATOM   3252 C CB    . LYS B 1 152 ? 10.786  8.937   -23.618 1.00 37.39 ? 190 LYS B CB    1 
ATOM   3253 C CG    . LYS B 1 152 ? 9.434   8.299   -24.024 1.00 40.67 ? 190 LYS B CG    1 
ATOM   3254 C CD    . LYS B 1 152 ? 8.510   8.296   -22.789 1.00 42.32 ? 190 LYS B CD    1 
ATOM   3255 C CE    . LYS B 1 152 ? 7.774   6.969   -22.629 1.00 50.85 ? 190 LYS B CE    1 
ATOM   3256 N NZ    . LYS B 1 152 ? 6.688   6.740   -23.619 1.00 52.72 ? 190 LYS B NZ    1 
ATOM   3257 N N     . THR B 1 153 ? 11.242  11.533  -25.394 1.00 33.64 ? 191 THR B N     1 
ATOM   3258 C CA    . THR B 1 153 ? 10.633  12.585  -26.179 1.00 34.62 ? 191 THR B CA    1 
ATOM   3259 C C     . THR B 1 153 ? 11.347  12.791  -27.499 1.00 34.53 ? 191 THR B C     1 
ATOM   3260 O O     . THR B 1 153 ? 10.695  12.881  -28.556 1.00 35.12 ? 191 THR B O     1 
ATOM   3261 C CB    . THR B 1 153 ? 10.614  13.909  -25.399 1.00 36.35 ? 191 THR B CB    1 
ATOM   3262 O OG1   . THR B 1 153 ? 9.940   13.662  -24.154 1.00 37.93 ? 191 THR B OG1   1 
ATOM   3263 C CG2   . THR B 1 153 ? 9.846   14.919  -26.192 1.00 39.60 ? 191 THR B CG2   1 
ATOM   3264 N N     . VAL B 1 154 ? 12.665  12.839  -27.459 1.00 33.35 ? 192 VAL B N     1 
ATOM   3265 C CA    . VAL B 1 154 ? 13.432  13.179  -28.685 1.00 34.24 ? 192 VAL B CA    1 
ATOM   3266 C C     . VAL B 1 154 ? 13.439  11.977  -29.601 1.00 33.95 ? 192 VAL B C     1 
ATOM   3267 O O     . VAL B 1 154 ? 13.366  12.130  -30.848 1.00 34.91 ? 192 VAL B O     1 
ATOM   3268 C CB    . VAL B 1 154 ? 14.867  13.657  -28.426 1.00 35.98 ? 192 VAL B CB    1 
ATOM   3269 C CG1   . VAL B 1 154 ? 14.833  14.900  -27.551 1.00 36.31 ? 192 VAL B CG1   1 
ATOM   3270 C CG2   . VAL B 1 154 ? 15.717  12.575  -27.772 1.00 37.60 ? 192 VAL B CG2   1 
ATOM   3271 N N     . SER B 1 155 ? 13.516  10.784  -29.016 1.00 32.82 ? 193 SER B N     1 
ATOM   3272 C CA    . SER B 1 155 ? 13.517  9.584   -29.898 1.00 35.34 ? 193 SER B CA    1 
ATOM   3273 C C     . SER B 1 155 ? 12.158  9.352   -30.537 1.00 35.90 ? 193 SER B C     1 
ATOM   3274 O O     . SER B 1 155 ? 12.094  8.893   -31.710 1.00 33.74 ? 193 SER B O     1 
ATOM   3275 C CB    . SER B 1 155 ? 14.014  8.370   -29.139 1.00 35.76 ? 193 SER B CB    1 
ATOM   3276 O OG    . SER B 1 155 ? 13.033  7.972   -28.228 1.00 40.20 ? 193 SER B OG    1 
ATOM   3277 N N     . ARG B 1 156 ? 11.065  9.681   -29.831 1.00 36.16 ? 194 ARG B N     1 
ATOM   3278 C CA    . ARG B 1 156 ? 9.753   9.606   -30.480 1.00 37.20 ? 194 ARG B CA    1 
ATOM   3279 C C     . ARG B 1 156 ? 9.673   10.506  -31.701 1.00 37.47 ? 194 ARG B C     1 
ATOM   3280 O O     . ARG B 1 156 ? 9.218   10.070  -32.776 1.00 35.11 ? 194 ARG B O     1 
ATOM   3281 C CB    . ARG B 1 156 ? 8.576   9.942   -29.554 1.00 38.37 ? 194 ARG B CB    1 
ATOM   3282 C CG    . ARG B 1 156 ? 7.250   9.967   -30.353 1.00 38.96 ? 194 ARG B CG    1 
ATOM   3283 C CD    . ARG B 1 156 ? 6.008   10.228  -29.486 1.00 41.27 ? 194 ARG B CD    1 
ATOM   3284 N NE    . ARG B 1 156 ? 6.244   11.351  -28.584 1.00 50.13 ? 194 ARG B NE    1 
ATOM   3285 C CZ    . ARG B 1 156 ? 6.590   11.235  -27.309 1.00 53.15 ? 194 ARG B CZ    1 
ATOM   3286 N NH1   . ARG B 1 156 ? 6.736   10.033  -26.744 1.00 55.99 ? 194 ARG B NH1   1 
ATOM   3287 N NH2   . ARG B 1 156 ? 6.803   12.337  -26.589 1.00 58.53 ? 194 ARG B NH2   1 
ATOM   3288 N N     . ARG B 1 157 ? 10.057  11.766  -31.524 1.00 36.69 ? 195 ARG B N     1 
ATOM   3289 C CA    . ARG B 1 157 ? 10.053  12.718  -32.622 1.00 37.40 ? 195 ARG B CA    1 
ATOM   3290 C C     . ARG B 1 157 ? 10.922  12.220  -33.800 1.00 35.71 ? 195 ARG B C     1 
ATOM   3291 O O     . ARG B 1 157 ? 10.515  12.341  -34.959 1.00 35.64 ? 195 ARG B O     1 
ATOM   3292 C CB    . ARG B 1 157 ? 10.517  14.100  -32.175 1.00 36.79 ? 195 ARG B CB    1 
ATOM   3293 C CG    . ARG B 1 157 ? 9.685   14.689  -30.992 1.00 41.59 ? 195 ARG B CG    1 
ATOM   3294 C CD    . ARG B 1 157 ? 9.942   16.208  -30.818 1.00 40.32 ? 195 ARG B CD    1 
ATOM   3295 N NE    . ARG B 1 157 ? 8.924   17.037  -31.491 1.00 51.46 ? 195 ARG B NE    1 
ATOM   3296 C CZ    . ARG B 1 157 ? 9.172   18.196  -32.097 1.00 52.32 ? 195 ARG B CZ    1 
ATOM   3297 N NH1   . ARG B 1 157 ? 10.410  18.682  -32.155 1.00 54.86 ? 195 ARG B NH1   1 
ATOM   3298 N NH2   . ARG B 1 157 ? 8.179   18.857  -32.670 1.00 55.86 ? 195 ARG B NH2   1 
ATOM   3299 N N     . PHE B 1 158 ? 12.094  11.673  -33.493 1.00 34.35 ? 196 PHE B N     1 
ATOM   3300 C CA    . PHE B 1 158 ? 13.049  11.219  -34.511 1.00 33.92 ? 196 PHE B CA    1 
ATOM   3301 C C     . PHE B 1 158 ? 12.431  10.068  -35.266 1.00 34.35 ? 196 PHE B C     1 
ATOM   3302 O O     . PHE B 1 158 ? 12.481  10.041  -36.521 1.00 34.42 ? 196 PHE B O     1 
ATOM   3303 C CB    . PHE B 1 158 ? 14.343  10.760  -33.834 1.00 34.14 ? 196 PHE B CB    1 
ATOM   3304 C CG    . PHE B 1 158 ? 15.524  10.516  -34.777 1.00 32.18 ? 196 PHE B CG    1 
ATOM   3305 C CD1   . PHE B 1 158 ? 16.041  11.533  -35.571 1.00 32.91 ? 196 PHE B CD1   1 
ATOM   3306 C CD2   . PHE B 1 158 ? 16.200  9.296   -34.744 1.00 30.98 ? 196 PHE B CD2   1 
ATOM   3307 C CE1   . PHE B 1 158 ? 17.195  11.329  -36.357 1.00 30.72 ? 196 PHE B CE1   1 
ATOM   3308 C CE2   . PHE B 1 158 ? 17.323  9.068   -35.535 1.00 31.83 ? 196 PHE B CE2   1 
ATOM   3309 C CZ    . PHE B 1 158 ? 17.817  10.087  -36.354 1.00 32.98 ? 196 PHE B CZ    1 
ATOM   3310 N N     . ALA B 1 159 ? 11.832  9.115   -34.551 1.00 33.89 ? 197 ALA B N     1 
ATOM   3311 C CA    . ALA B 1 159 ? 11.180  7.957   -35.241 1.00 34.11 ? 197 ALA B CA    1 
ATOM   3312 C C     . ALA B 1 159 ? 10.009  8.370   -36.149 1.00 34.85 ? 197 ALA B C     1 
ATOM   3313 O O     . ALA B 1 159 ? 9.868   7.861   -37.299 1.00 34.07 ? 197 ALA B O     1 
ATOM   3314 C CB    . ALA B 1 159 ? 10.715  6.919   -34.216 1.00 35.27 ? 197 ALA B CB    1 
ATOM   3315 N N     . GLU B 1 160 ? 9.184   9.296   -35.654 1.00 35.47 ? 198 GLU B N     1 
ATOM   3316 C CA    . GLU B 1 160 ? 8.018   9.829   -36.375 1.00 37.44 ? 198 GLU B CA    1 
ATOM   3317 C C     . GLU B 1 160 ? 8.358   10.495  -37.693 1.00 36.33 ? 198 GLU B C     1 
ATOM   3318 O O     . GLU B 1 160 ? 7.503   10.583  -38.593 1.00 36.73 ? 198 GLU B O     1 
ATOM   3319 C CB    . GLU B 1 160 ? 7.286   10.860  -35.512 1.00 36.76 ? 198 GLU B CB    1 
ATOM   3320 C CG    . GLU B 1 160 ? 6.448   10.246  -34.409 1.00 41.51 ? 198 GLU B CG    1 
ATOM   3321 C CD    . GLU B 1 160 ? 5.858   11.277  -33.427 1.00 42.94 ? 198 GLU B CD    1 
ATOM   3322 O OE1   . GLU B 1 160 ? 6.365   12.442  -33.352 1.00 48.96 ? 198 GLU B OE1   1 
ATOM   3323 O OE2   . GLU B 1 160 ? 4.898   10.894  -32.701 1.00 47.72 ? 198 GLU B OE2   1 
ATOM   3324 N N     . ALA B 1 161 ? 9.589   10.976  -37.804 1.00 35.15 ? 199 ALA B N     1 
ATOM   3325 C CA    . ALA B 1 161 ? 10.016  11.738  -38.966 1.00 36.20 ? 199 ALA B CA    1 
ATOM   3326 C C     . ALA B 1 161 ? 10.576  10.828  -40.048 1.00 34.90 ? 199 ALA B C     1 
ATOM   3327 O O     . ALA B 1 161 ? 10.703  11.252  -41.182 1.00 36.65 ? 199 ALA B O     1 
ATOM   3328 C CB    . ALA B 1 161 ? 11.048  12.762  -38.583 1.00 36.39 ? 199 ALA B CB    1 
ATOM   3329 N N     . ALA B 1 162 ? 10.927  9.599   -39.667 1.00 34.17 ? 200 ALA B N     1 
ATOM   3330 C CA    . ALA B 1 162 ? 11.603  8.653   -40.559 1.00 32.53 ? 200 ALA B CA    1 
ATOM   3331 C C     . ALA B 1 162 ? 10.700  8.202   -41.678 1.00 32.87 ? 200 ALA B C     1 
ATOM   3332 O O     . ALA B 1 162 ? 9.481   8.086   -41.512 1.00 32.50 ? 200 ALA B O     1 
ATOM   3333 C CB    . ALA B 1 162 ? 12.071  7.445   -39.798 1.00 33.06 ? 200 ALA B CB    1 
ATOM   3334 N N     . CYS B 1 163 ? 11.329  7.927   -42.808 1.00 30.86 ? 201 CYS B N     1 
ATOM   3335 C CA    . CYS B 1 163 ? 10.604  7.453   -43.985 1.00 31.88 ? 201 CYS B CA    1 
ATOM   3336 C C     . CYS B 1 163 ? 11.381  6.411   -44.763 1.00 31.26 ? 201 CYS B C     1 
ATOM   3337 O O     . CYS B 1 163 ? 12.566  6.185   -44.516 1.00 30.48 ? 201 CYS B O     1 
ATOM   3338 C CB    . CYS B 1 163 ? 10.238  8.636   -44.877 1.00 32.82 ? 201 CYS B CB    1 
ATOM   3339 S SG    . CYS B 1 163 ? 11.605  9.348   -45.865 1.00 37.25 ? 201 CYS B SG    1 
ATOM   3340 N N     . ASP B 1 164 ? 10.688  5.800   -45.720 1.00 30.26 ? 202 ASP B N     1 
ATOM   3341 C CA    . ASP B 1 164 ? 11.265  4.852   -46.694 1.00 31.89 ? 202 ASP B CA    1 
ATOM   3342 C C     . ASP B 1 164 ? 11.925  3.648   -46.012 1.00 31.03 ? 202 ASP B C     1 
ATOM   3343 O O     . ASP B 1 164 ? 11.213  2.835   -45.416 1.00 31.89 ? 202 ASP B O     1 
ATOM   3344 C CB    . ASP B 1 164 ? 12.173  5.582   -47.692 1.00 31.48 ? 202 ASP B CB    1 
ATOM   3345 C CG    . ASP B 1 164 ? 11.402  6.549   -48.575 1.00 37.02 ? 202 ASP B CG    1 
ATOM   3346 O OD1   . ASP B 1 164 ? 10.146  6.607   -48.470 1.00 42.79 ? 202 ASP B OD1   1 
ATOM   3347 O OD2   . ASP B 1 164 ? 12.034  7.205   -49.450 1.00 42.54 ? 202 ASP B OD2   1 
ATOM   3348 N N     . VAL B 1 165 ? 13.257  3.527   -46.087 1.00 30.04 ? 203 VAL B N     1 
ATOM   3349 C CA    . VAL B 1 165 ? 13.939  2.433   -45.406 1.00 27.95 ? 203 VAL B CA    1 
ATOM   3350 C C     . VAL B 1 165 ? 14.663  3.037   -44.222 1.00 28.94 ? 203 VAL B C     1 
ATOM   3351 O O     . VAL B 1 165 ? 15.409  4.007   -44.365 1.00 27.36 ? 203 VAL B O     1 
ATOM   3352 C CB    . VAL B 1 165 ? 14.911  1.630   -46.307 1.00 29.33 ? 203 VAL B CB    1 
ATOM   3353 C CG1   . VAL B 1 165 ? 15.540  0.494   -45.497 1.00 28.52 ? 203 VAL B CG1   1 
ATOM   3354 C CG2   . VAL B 1 165 ? 14.181  1.072   -47.522 1.00 29.11 ? 203 VAL B CG2   1 
ATOM   3355 N N     . VAL B 1 166 ? 14.365  2.472   -43.066 1.00 27.14 ? 204 VAL B N     1 
ATOM   3356 C CA    . VAL B 1 166 ? 14.980  2.907   -41.810 1.00 28.51 ? 204 VAL B CA    1 
ATOM   3357 C C     . VAL B 1 166 ? 15.844  1.720   -41.453 1.00 28.94 ? 204 VAL B C     1 
ATOM   3358 O O     . VAL B 1 166 ? 15.403  0.572   -41.568 1.00 31.20 ? 204 VAL B O     1 
ATOM   3359 C CB    . VAL B 1 166 ? 13.883  3.144   -40.773 1.00 28.02 ? 204 VAL B CB    1 
ATOM   3360 C CG1   . VAL B 1 166 ? 14.467  3.540   -39.395 1.00 27.31 ? 204 VAL B CG1   1 
ATOM   3361 C CG2   . VAL B 1 166 ? 12.922  4.206   -41.265 1.00 29.61 ? 204 VAL B CG2   1 
ATOM   3362 N N     . HIS B 1 167 ? 17.094  1.989   -41.092 1.00 30.20 ? 205 HIS B N     1 
ATOM   3363 C CA    . HIS B 1 167 ? 17.989  0.928   -40.657 1.00 30.67 ? 205 HIS B CA    1 
ATOM   3364 C C     . HIS B 1 167 ? 18.177  0.997   -39.146 1.00 29.63 ? 205 HIS B C     1 
ATOM   3365 O O     . HIS B 1 167 ? 18.185  2.083   -38.551 1.00 29.66 ? 205 HIS B O     1 
ATOM   3366 C CB    . HIS B 1 167 ? 19.334  1.045   -41.364 1.00 30.60 ? 205 HIS B CB    1 
ATOM   3367 C CG    . HIS B 1 167 ? 19.239  0.904   -42.848 1.00 32.11 ? 205 HIS B CG    1 
ATOM   3368 N ND1   . HIS B 1 167 ? 18.981  1.968   -43.681 1.00 33.43 ? 205 HIS B ND1   1 
ATOM   3369 C CD2   . HIS B 1 167 ? 19.348  -0.183  -43.646 1.00 29.63 ? 205 HIS B CD2   1 
ATOM   3370 C CE1   . HIS B 1 167 ? 18.954  1.549   -44.933 1.00 31.37 ? 205 HIS B CE1   1 
ATOM   3371 N NE2   . HIS B 1 167 ? 19.160  0.241   -44.943 1.00 32.72 ? 205 HIS B NE2   1 
ATOM   3372 N N     . VAL B 1 168 ? 18.331  -0.179  -38.537 1.00 29.88 ? 206 VAL B N     1 
ATOM   3373 C CA    . VAL B 1 168 ? 18.623  -0.292  -37.116 1.00 30.78 ? 206 VAL B CA    1 
ATOM   3374 C C     . VAL B 1 168 ? 19.803  -1.216  -36.924 1.00 30.72 ? 206 VAL B C     1 
ATOM   3375 O O     . VAL B 1 168 ? 19.837  -2.327  -37.438 1.00 31.04 ? 206 VAL B O     1 
ATOM   3376 C CB    . VAL B 1 168 ? 17.393  -0.732  -36.252 1.00 30.08 ? 206 VAL B CB    1 
ATOM   3377 C CG1   . VAL B 1 168 ? 16.891  -2.138  -36.601 1.00 31.61 ? 206 VAL B CG1   1 
ATOM   3378 C CG2   . VAL B 1 168 ? 17.763  -0.687  -34.789 1.00 32.78 ? 206 VAL B CG2   1 
ATOM   3379 N N     . MET B 1 169 ? 20.787  -0.741  -36.174 1.00 31.30 ? 207 MET B N     1 
ATOM   3380 C CA    . MET B 1 169 ? 21.936  -1.552  -35.830 1.00 34.00 ? 207 MET B CA    1 
ATOM   3381 C C     . MET B 1 169 ? 21.681  -2.162  -34.452 1.00 33.05 ? 207 MET B C     1 
ATOM   3382 O O     . MET B 1 169 ? 21.323  -1.443  -33.510 1.00 32.54 ? 207 MET B O     1 
ATOM   3383 C CB    . MET B 1 169 ? 23.165  -0.665  -35.762 1.00 32.83 ? 207 MET B CB    1 
ATOM   3384 C CG    . MET B 1 169 ? 24.446  -1.389  -35.889 1.00 36.46 ? 207 MET B CG    1 
ATOM   3385 S SD    . MET B 1 169 ? 25.749  -0.178  -36.090 1.00 41.53 ? 207 MET B SD    1 
ATOM   3386 C CE    . MET B 1 169 ? 25.798  0.129   -37.828 1.00 40.49 ? 207 MET B CE    1 
ATOM   3387 N N     . LEU B 1 170 ? 21.927  -3.464  -34.351 1.00 35.00 ? 208 LEU B N     1 
ATOM   3388 C CA    . LEU B 1 170 ? 21.642  -4.255  -33.167 1.00 36.21 ? 208 LEU B CA    1 
ATOM   3389 C C     . LEU B 1 170 ? 22.862  -5.097  -32.767 1.00 37.03 ? 208 LEU B C     1 
ATOM   3390 O O     . LEU B 1 170 ? 23.591  -5.594  -33.608 1.00 38.29 ? 208 LEU B O     1 
ATOM   3391 C CB    . LEU B 1 170 ? 20.417  -5.137  -33.392 1.00 35.56 ? 208 LEU B CB    1 
ATOM   3392 C CG    . LEU B 1 170 ? 19.043  -4.499  -33.639 1.00 36.00 ? 208 LEU B CG    1 
ATOM   3393 C CD1   . LEU B 1 170 ? 18.140  -5.523  -34.254 1.00 33.36 ? 208 LEU B CD1   1 
ATOM   3394 C CD2   . LEU B 1 170 ? 18.403  -3.982  -32.393 1.00 36.23 ? 208 LEU B CD2   1 
ATOM   3395 N N     . ASP B 1 171 ? 23.097  -5.228  -31.463 1.00 39.85 ? 209 ASP B N     1 
ATOM   3396 C CA    . ASP B 1 171 ? 24.243  -5.997  -30.986 1.00 41.14 ? 209 ASP B CA    1 
ATOM   3397 C C     . ASP B 1 171 ? 23.921  -7.499  -30.917 1.00 42.09 ? 209 ASP B C     1 
ATOM   3398 O O     . ASP B 1 171 ? 23.169  -7.955  -30.051 1.00 41.98 ? 209 ASP B O     1 
ATOM   3399 C CB    . ASP B 1 171 ? 24.709  -5.451  -29.634 1.00 42.34 ? 209 ASP B CB    1 
ATOM   3400 C CG    . ASP B 1 171 ? 25.890  -6.207  -29.075 1.00 42.50 ? 209 ASP B CG    1 
ATOM   3401 O OD1   . ASP B 1 171 ? 26.535  -6.992  -29.806 1.00 46.53 ? 209 ASP B OD1   1 
ATOM   3402 O OD2   . ASP B 1 171 ? 26.157  -5.999  -27.870 1.00 48.83 ? 209 ASP B OD2   1 
ATOM   3403 N N     . GLY B 1 172 ? 24.508  -8.259  -31.830 1.00 42.77 ? 210 GLY B N     1 
ATOM   3404 C CA    . GLY B 1 172 ? 24.197  -9.672  -31.974 1.00 44.17 ? 210 GLY B CA    1 
ATOM   3405 C C     . GLY B 1 172 ? 24.928  -10.598 -31.028 1.00 45.50 ? 210 GLY B C     1 
ATOM   3406 O O     . GLY B 1 172 ? 24.857  -11.816 -31.175 1.00 45.39 ? 210 GLY B O     1 
ATOM   3407 N N     . SER B 1 173 ? 25.658  -10.037 -30.075 1.00 47.21 ? 211 SER B N     1 
ATOM   3408 C CA    . SER B 1 173 ? 26.230  -10.847 -28.996 1.00 49.25 ? 211 SER B CA    1 
ATOM   3409 C C     . SER B 1 173 ? 25.587  -10.511 -27.644 1.00 50.49 ? 211 SER B C     1 
ATOM   3410 O O     . SER B 1 173 ? 26.190  -10.709 -26.588 1.00 51.32 ? 211 SER B O     1 
ATOM   3411 C CB    . SER B 1 173 ? 27.761  -10.724 -28.951 1.00 49.34 ? 211 SER B CB    1 
ATOM   3412 O OG    . SER B 1 173 ? 28.177  -9.373  -28.851 1.00 49.35 ? 211 SER B OG    1 
ATOM   3413 N N     . ARG B 1 174 ? 24.356  -10.001 -27.685 1.00 51.49 ? 212 ARG B N     1 
ATOM   3414 C CA    . ARG B 1 174 ? 23.608  -9.704  -26.467 1.00 52.57 ? 212 ARG B CA    1 
ATOM   3415 C C     . ARG B 1 174 ? 22.778  -10.901 -25.991 1.00 52.65 ? 212 ARG B C     1 
ATOM   3416 O O     . ARG B 1 174 ? 22.518  -11.042 -24.797 1.00 53.30 ? 212 ARG B O     1 
ATOM   3417 C CB    . ARG B 1 174 ? 22.698  -8.468  -26.653 1.00 52.97 ? 212 ARG B CB    1 
ATOM   3418 C CG    . ARG B 1 174 ? 23.394  -7.101  -26.583 1.00 55.06 ? 212 ARG B CG    1 
ATOM   3419 C CD    . ARG B 1 174 ? 24.096  -6.878  -25.247 1.00 58.85 ? 212 ARG B CD    1 
ATOM   3420 N NE    . ARG B 1 174 ? 25.094  -5.804  -25.296 1.00 62.80 ? 212 ARG B NE    1 
ATOM   3421 C CZ    . ARG B 1 174 ? 25.213  -4.826  -24.395 1.00 64.64 ? 212 ARG B CZ    1 
ATOM   3422 N NH1   . ARG B 1 174 ? 24.405  -4.765  -23.345 1.00 64.80 ? 212 ARG B NH1   1 
ATOM   3423 N NH2   . ARG B 1 174 ? 26.161  -3.908  -24.536 1.00 65.67 ? 212 ARG B NH2   1 
ATOM   3424 N N     . SER B 1 175 ? 22.345  -11.753 -26.916 1.00 52.79 ? 213 SER B N     1 
ATOM   3425 C CA    . SER B 1 175 ? 21.412  -12.851 -26.585 1.00 52.74 ? 213 SER B CA    1 
ATOM   3426 C C     . SER B 1 175 ? 20.105  -12.292 -25.997 1.00 51.93 ? 213 SER B C     1 
ATOM   3427 O O     . SER B 1 175 ? 19.251  -13.033 -25.482 1.00 52.17 ? 213 SER B O     1 
ATOM   3428 C CB    . SER B 1 175 ? 22.053  -13.903 -25.656 1.00 53.08 ? 213 SER B CB    1 
ATOM   3429 O OG    . SER B 1 175 ? 22.133  -13.429 -24.320 1.00 54.12 ? 213 SER B OG    1 
ATOM   3430 N N     . LYS B 1 176 ? 19.996  -10.969 -26.067 1.00 50.64 ? 214 LYS B N     1 
ATOM   3431 C CA    . LYS B 1 176 ? 18.742  -10.249 -26.004 1.00 49.19 ? 214 LYS B CA    1 
ATOM   3432 C C     . LYS B 1 176 ? 18.848  -9.233  -27.143 1.00 47.88 ? 214 LYS B C     1 
ATOM   3433 O O     . LYS B 1 176 ? 18.725  -8.024  -26.921 1.00 47.59 ? 214 LYS B O     1 
ATOM   3434 C CB    . LYS B 1 176 ? 18.607  -9.535  -24.658 1.00 49.93 ? 214 LYS B CB    1 
ATOM   3435 C CG    . LYS B 1 176 ? 17.225  -9.637  -24.026 1.00 50.79 ? 214 LYS B CG    1 
ATOM   3436 C CD    . LYS B 1 176 ? 17.019  -8.505  -23.005 1.00 52.22 ? 214 LYS B CD    1 
ATOM   3437 C CE    . LYS B 1 176 ? 16.140  -8.945  -21.838 1.00 54.31 ? 214 LYS B CE    1 
ATOM   3438 N NZ    . LYS B 1 176 ? 14.805  -9.462  -22.281 1.00 53.47 ? 214 LYS B NZ    1 
ATOM   3439 N N     . ILE B 1 177 ? 19.104  -9.733  -28.358 1.00 45.86 ? 215 ILE B N     1 
ATOM   3440 C CA    . ILE B 1 177 ? 19.492  -8.879  -29.485 1.00 44.10 ? 215 ILE B CA    1 
ATOM   3441 C C     . ILE B 1 177 ? 18.485  -7.762  -29.747 1.00 43.48 ? 215 ILE B C     1 
ATOM   3442 O O     . ILE B 1 177 ? 18.869  -6.600  -29.909 1.00 42.32 ? 215 ILE B O     1 
ATOM   3443 C CB    . ILE B 1 177 ? 19.756  -9.669  -30.782 1.00 44.13 ? 215 ILE B CB    1 
ATOM   3444 C CG1   . ILE B 1 177 ? 20.721  -10.835 -30.518 1.00 43.54 ? 215 ILE B CG1   1 
ATOM   3445 C CG2   . ILE B 1 177 ? 20.318  -8.731  -31.847 1.00 44.05 ? 215 ILE B CG2   1 
ATOM   3446 C CD1   . ILE B 1 177 ? 20.990  -11.734 -31.738 1.00 42.90 ? 215 ILE B CD1   1 
ATOM   3447 N N     . PHE B 1 178 ? 17.209  -8.118  -29.814 1.00 42.67 ? 216 PHE B N     1 
ATOM   3448 C CA    . PHE B 1 178 ? 16.175  -7.113  -29.745 1.00 43.64 ? 216 PHE B CA    1 
ATOM   3449 C C     . PHE B 1 178 ? 15.606  -7.182  -28.347 1.00 44.66 ? 216 PHE B C     1 
ATOM   3450 O O     . PHE B 1 178 ? 15.307  -8.267  -27.846 1.00 44.23 ? 216 PHE B O     1 
ATOM   3451 C CB    . PHE B 1 178 ? 15.089  -7.327  -30.780 1.00 42.40 ? 216 PHE B CB    1 
ATOM   3452 C CG    . PHE B 1 178 ? 13.861  -6.494  -30.548 1.00 43.00 ? 216 PHE B CG    1 
ATOM   3453 C CD1   . PHE B 1 178 ? 13.858  -5.130  -30.833 1.00 40.80 ? 216 PHE B CD1   1 
ATOM   3454 C CD2   . PHE B 1 178 ? 12.693  -7.075  -30.041 1.00 42.98 ? 216 PHE B CD2   1 
ATOM   3455 C CE1   . PHE B 1 178 ? 12.718  -4.352  -30.612 1.00 40.02 ? 216 PHE B CE1   1 
ATOM   3456 C CE2   . PHE B 1 178 ? 11.546  -6.297  -29.809 1.00 42.34 ? 216 PHE B CE2   1 
ATOM   3457 C CZ    . PHE B 1 178 ? 11.555  -4.943  -30.108 1.00 39.68 ? 216 PHE B CZ    1 
ATOM   3458 N N     . ASP B 1 179 ? 15.467  -6.013  -27.739 1.00 46.37 ? 217 ASP B N     1 
ATOM   3459 C CA    . ASP B 1 179 ? 15.032  -5.874  -26.370 1.00 48.79 ? 217 ASP B CA    1 
ATOM   3460 C C     . ASP B 1 179 ? 13.858  -4.932  -26.364 1.00 49.34 ? 217 ASP B C     1 
ATOM   3461 O O     . ASP B 1 179 ? 13.986  -3.751  -26.679 1.00 49.36 ? 217 ASP B O     1 
ATOM   3462 C CB    . ASP B 1 179 ? 16.163  -5.299  -25.518 1.00 49.23 ? 217 ASP B CB    1 
ATOM   3463 C CG    . ASP B 1 179 ? 15.731  -4.979  -24.110 1.00 52.16 ? 217 ASP B CG    1 
ATOM   3464 O OD1   . ASP B 1 179 ? 14.551  -5.223  -23.750 1.00 55.30 ? 217 ASP B OD1   1 
ATOM   3465 O OD2   . ASP B 1 179 ? 16.580  -4.459  -23.356 1.00 56.11 ? 217 ASP B OD2   1 
ATOM   3466 N N     . LYS B 1 180 ? 12.714  -5.472  -25.978 1.00 50.77 ? 218 LYS B N     1 
ATOM   3467 C CA    . LYS B 1 180 ? 11.443  -4.766  -26.032 1.00 52.08 ? 218 LYS B CA    1 
ATOM   3468 C C     . LYS B 1 180 ? 11.445  -3.545  -25.128 1.00 52.23 ? 218 LYS B C     1 
ATOM   3469 O O     . LYS B 1 180 ? 10.585  -2.668  -25.246 1.00 53.26 ? 218 LYS B O     1 
ATOM   3470 C CB    . LYS B 1 180 ? 10.329  -5.723  -25.613 1.00 52.16 ? 218 LYS B CB    1 
ATOM   3471 C CG    . LYS B 1 180 ? 9.026   -5.562  -26.364 1.00 53.67 ? 218 LYS B CG    1 
ATOM   3472 C CD    . LYS B 1 180 ? 7.888   -6.262  -25.625 1.00 54.88 ? 218 LYS B CD    1 
ATOM   3473 C CE    . LYS B 1 180 ? 8.298   -7.642  -25.112 1.00 56.36 ? 218 LYS B CE    1 
ATOM   3474 N NZ    . LYS B 1 180 ? 7.419   -8.119  -23.998 1.00 58.18 ? 218 LYS B NZ    1 
ATOM   3475 N N     . ASP B 1 181 ? 12.440  -3.478  -24.248 1.00 52.34 ? 219 ASP B N     1 
ATOM   3476 C CA    . ASP B 1 181 ? 12.488  -2.481  -23.187 1.00 52.15 ? 219 ASP B CA    1 
ATOM   3477 C C     . ASP B 1 181 ? 13.454  -1.332  -23.470 1.00 50.99 ? 219 ASP B C     1 
ATOM   3478 O O     . ASP B 1 181 ? 13.460  -0.335  -22.741 1.00 51.00 ? 219 ASP B O     1 
ATOM   3479 C CB    . ASP B 1 181 ? 12.805  -3.155  -21.837 1.00 53.01 ? 219 ASP B CB    1 
ATOM   3480 C CG    . ASP B 1 181 ? 11.710  -4.131  -21.393 1.00 55.94 ? 219 ASP B CG    1 
ATOM   3481 O OD1   . ASP B 1 181 ? 10.507  -3.774  -21.484 1.00 59.04 ? 219 ASP B OD1   1 
ATOM   3482 O OD2   . ASP B 1 181 ? 12.042  -5.267  -20.967 1.00 58.58 ? 219 ASP B OD2   1 
ATOM   3483 N N     . SER B 1 182 ? 14.259  -1.459  -24.530 1.00 48.55 ? 220 SER B N     1 
ATOM   3484 C CA    . SER B 1 182 ? 15.180  -0.408  -24.941 1.00 46.17 ? 220 SER B CA    1 
ATOM   3485 C C     . SER B 1 182 ? 14.413  0.790   -25.519 1.00 45.35 ? 220 SER B C     1 
ATOM   3486 O O     . SER B 1 182 ? 13.215  0.691   -25.781 1.00 46.37 ? 220 SER B O     1 
ATOM   3487 C CB    . SER B 1 182 ? 16.149  -0.949  -25.980 1.00 46.76 ? 220 SER B CB    1 
ATOM   3488 O OG    . SER B 1 182 ? 15.419  -1.419  -27.106 1.00 42.35 ? 220 SER B OG    1 
ATOM   3489 N N     . THR B 1 183 ? 15.096  1.915   -25.706 1.00 44.71 ? 221 THR B N     1 
ATOM   3490 C CA    . THR B 1 183 ? 14.457  3.087   -26.300 1.00 43.50 ? 221 THR B CA    1 
ATOM   3491 C C     . THR B 1 183 ? 14.028  2.729   -27.726 1.00 42.13 ? 221 THR B C     1 
ATOM   3492 O O     . THR B 1 183 ? 12.964  3.136   -28.159 1.00 42.50 ? 221 THR B O     1 
ATOM   3493 C CB    . THR B 1 183 ? 15.360  4.322   -26.306 1.00 44.33 ? 221 THR B CB    1 
ATOM   3494 O OG1   . THR B 1 183 ? 15.662  4.736   -24.948 1.00 44.36 ? 221 THR B OG1   1 
ATOM   3495 C CG2   . THR B 1 183 ? 14.689  5.461   -27.057 1.00 44.63 ? 221 THR B CG2   1 
ATOM   3496 N N     . PHE B 1 184 ? 14.844  1.948   -28.417 1.00 40.10 ? 222 PHE B N     1 
ATOM   3497 C CA    . PHE B 1 184 ? 14.477  1.475   -29.746 1.00 39.33 ? 222 PHE B CA    1 
ATOM   3498 C C     . PHE B 1 184 ? 13.203  0.640   -29.673 1.00 38.95 ? 222 PHE B C     1 
ATOM   3499 O O     . PHE B 1 184 ? 12.244  0.906   -30.396 1.00 39.96 ? 222 PHE B O     1 
ATOM   3500 C CB    . PHE B 1 184 ? 15.592  0.666   -30.413 1.00 38.89 ? 222 PHE B CB    1 
ATOM   3501 C CG    . PHE B 1 184 ? 15.141  0.015   -31.705 1.00 37.48 ? 222 PHE B CG    1 
ATOM   3502 C CD1   . PHE B 1 184 ? 14.862  0.805   -32.818 1.00 35.46 ? 222 PHE B CD1   1 
ATOM   3503 C CD2   . PHE B 1 184 ? 14.936  -1.367  -31.791 1.00 37.60 ? 222 PHE B CD2   1 
ATOM   3504 C CE1   . PHE B 1 184 ? 14.390  0.232   -34.015 1.00 35.11 ? 222 PHE B CE1   1 
ATOM   3505 C CE2   . PHE B 1 184 ? 14.492  -1.945  -32.962 1.00 38.46 ? 222 PHE B CE2   1 
ATOM   3506 C CZ    . PHE B 1 184 ? 14.209  -1.145  -34.091 1.00 38.17 ? 222 PHE B CZ    1 
ATOM   3507 N N     . GLY B 1 185 ? 13.184  -0.363  -28.796 1.00 39.56 ? 223 GLY B N     1 
ATOM   3508 C CA    . GLY B 1 185 ? 12.072  -1.329  -28.742 1.00 39.52 ? 223 GLY B CA    1 
ATOM   3509 C C     . GLY B 1 185 ? 10.740  -0.837  -28.206 1.00 40.99 ? 223 GLY B C     1 
ATOM   3510 O O     . GLY B 1 185 ? 9.679   -1.373  -28.544 1.00 41.06 ? 223 GLY B O     1 
ATOM   3511 N N     . SER B 1 186 ? 10.800  0.195   -27.375 1.00 41.55 ? 224 SER B N     1 
ATOM   3512 C CA    . SER B 1 186 ? 9.645   0.699   -26.629 1.00 42.87 ? 224 SER B CA    1 
ATOM   3513 C C     . SER B 1 186 ? 9.072   2.044   -27.113 1.00 42.37 ? 224 SER B C     1 
ATOM   3514 O O     . SER B 1 186 ? 7.875   2.327   -26.919 1.00 42.99 ? 224 SER B O     1 
ATOM   3515 C CB    . SER B 1 186 ? 9.995   0.801   -25.150 1.00 42.76 ? 224 SER B CB    1 
ATOM   3516 O OG    . SER B 1 186 ? 10.975  1.812   -24.917 1.00 46.81 ? 224 SER B OG    1 
ATOM   3517 N N     . VAL B 1 187 ? 9.913   2.875   -27.723 1.00 41.19 ? 225 VAL B N     1 
ATOM   3518 C CA    . VAL B 1 187 ? 9.439   4.117   -28.298 1.00 40.48 ? 225 VAL B CA    1 
ATOM   3519 C C     . VAL B 1 187 ? 9.599   4.108   -29.813 1.00 39.44 ? 225 VAL B C     1 
ATOM   3520 O O     . VAL B 1 187 ? 8.648   4.398   -30.527 1.00 40.21 ? 225 VAL B O     1 
ATOM   3521 C CB    . VAL B 1 187 ? 10.157  5.354   -27.698 1.00 40.60 ? 225 VAL B CB    1 
ATOM   3522 C CG1   . VAL B 1 187 ? 11.632  5.258   -27.852 1.00 43.92 ? 225 VAL B CG1   1 
ATOM   3523 C CG2   . VAL B 1 187 ? 9.678   6.638   -28.339 1.00 40.09 ? 225 VAL B CG2   1 
ATOM   3524 N N     . GLU B 1 188 ? 10.792  3.792   -30.303 1.00 37.70 ? 226 GLU B N     1 
ATOM   3525 C CA    . GLU B 1 188 ? 11.042  4.021   -31.729 1.00 36.23 ? 226 GLU B CA    1 
ATOM   3526 C C     . GLU B 1 188 ? 10.266  3.106   -32.673 1.00 35.61 ? 226 GLU B C     1 
ATOM   3527 O O     . GLU B 1 188 ? 9.612   3.582   -33.607 1.00 34.89 ? 226 GLU B O     1 
ATOM   3528 C CB    . GLU B 1 188 ? 12.542  4.041   -32.047 1.00 35.16 ? 226 GLU B CB    1 
ATOM   3529 C CG    . GLU B 1 188 ? 13.237  5.230   -31.345 1.00 33.61 ? 226 GLU B CG    1 
ATOM   3530 C CD    . GLU B 1 188 ? 14.727  5.272   -31.540 1.00 35.64 ? 226 GLU B CD    1 
ATOM   3531 O OE1   . GLU B 1 188 ? 15.360  4.207   -31.658 1.00 38.01 ? 226 GLU B OE1   1 
ATOM   3532 O OE2   . GLU B 1 188 ? 15.292  6.387   -31.559 1.00 44.30 ? 226 GLU B OE2   1 
ATOM   3533 N N     . VAL B 1 189 ? 10.329  1.804   -32.440 1.00 35.58 ? 227 VAL B N     1 
ATOM   3534 C CA    . VAL B 1 189 ? 9.717   0.862   -33.377 1.00 37.04 ? 227 VAL B CA    1 
ATOM   3535 C C     . VAL B 1 189 ? 8.214   1.188   -33.460 1.00 37.16 ? 227 VAL B C     1 
ATOM   3536 O O     . VAL B 1 189 ? 7.610   1.135   -34.534 1.00 36.45 ? 227 VAL B O     1 
ATOM   3537 C CB    . VAL B 1 189 ? 10.093  -0.627  -33.039 1.00 36.37 ? 227 VAL B CB    1 
ATOM   3538 C CG1   . VAL B 1 189 ? 9.509   -1.061  -31.726 1.00 39.77 ? 227 VAL B CG1   1 
ATOM   3539 C CG2   . VAL B 1 189 ? 9.661   -1.609  -34.162 1.00 39.05 ? 227 VAL B CG2   1 
ATOM   3540 N N     . HIS B 1 190 ? 7.658   1.647   -32.342 1.00 37.46 ? 228 HIS B N     1 
ATOM   3541 C CA    . HIS B 1 190 ? 6.234   1.923   -32.222 1.00 37.74 ? 228 HIS B CA    1 
ATOM   3542 C C     . HIS B 1 190 ? 5.849   3.305   -32.734 1.00 37.43 ? 228 HIS B C     1 
ATOM   3543 O O     . HIS B 1 190 ? 4.662   3.664   -32.789 1.00 38.25 ? 228 HIS B O     1 
ATOM   3544 C CB    . HIS B 1 190 ? 5.808   1.755   -30.757 1.00 39.94 ? 228 HIS B CB    1 
ATOM   3545 C CG    . HIS B 1 190 ? 5.879   0.336   -30.291 1.00 41.13 ? 228 HIS B CG    1 
ATOM   3546 N ND1   . HIS B 1 190 ? 6.718   -0.071  -29.278 1.00 43.42 ? 228 HIS B ND1   1 
ATOM   3547 C CD2   . HIS B 1 190 ? 5.252   -0.779  -30.738 1.00 42.37 ? 228 HIS B CD2   1 
ATOM   3548 C CE1   . HIS B 1 190 ? 6.583   -1.374  -29.098 1.00 45.05 ? 228 HIS B CE1   1 
ATOM   3549 N NE2   . HIS B 1 190 ? 5.706   -1.829  -29.977 1.00 44.49 ? 228 HIS B NE2   1 
ATOM   3550 N N     . ASN B 1 191 ? 6.836   4.089   -33.131 1.00 36.79 ? 229 ASN B N     1 
ATOM   3551 C CA    . ASN B 1 191 ? 6.507   5.353   -33.743 1.00 35.85 ? 229 ASN B CA    1 
ATOM   3552 C C     . ASN B 1 191 ? 6.918   5.489   -35.182 1.00 35.74 ? 229 ASN B C     1 
ATOM   3553 O O     . ASN B 1 191 ? 6.813   6.577   -35.750 1.00 37.05 ? 229 ASN B O     1 
ATOM   3554 C CB    . ASN B 1 191 ? 7.009   6.490   -32.875 1.00 36.01 ? 229 ASN B CB    1 
ATOM   3555 C CG    . ASN B 1 191 ? 6.097   6.706   -31.733 1.00 37.37 ? 229 ASN B CG    1 
ATOM   3556 O OD1   . ASN B 1 191 ? 5.007   7.242   -31.909 1.00 38.94 ? 229 ASN B OD1   1 
ATOM   3557 N ND2   . ASN B 1 191 ? 6.487   6.222   -30.556 1.00 40.39 ? 229 ASN B ND2   1 
ATOM   3558 N N     . LEU B 1 192 ? 7.341   4.376   -35.774 1.00 34.88 ? 230 LEU B N     1 
ATOM   3559 C CA    . LEU B 1 192 ? 7.560   4.314   -37.225 1.00 34.68 ? 230 LEU B CA    1 
ATOM   3560 C C     . LEU B 1 192 ? 6.213   4.313   -37.923 1.00 35.05 ? 230 LEU B C     1 
ATOM   3561 O O     . LEU B 1 192 ? 5.397   3.403   -37.729 1.00 35.21 ? 230 LEU B O     1 
ATOM   3562 C CB    . LEU B 1 192 ? 8.387   3.076   -37.599 1.00 33.53 ? 230 LEU B CB    1 
ATOM   3563 C CG    . LEU B 1 192 ? 9.781   3.044   -36.947 1.00 35.47 ? 230 LEU B CG    1 
ATOM   3564 C CD1   . LEU B 1 192 ? 10.459  1.697   -37.224 1.00 34.16 ? 230 LEU B CD1   1 
ATOM   3565 C CD2   . LEU B 1 192 ? 10.637  4.221   -37.398 1.00 32.10 ? 230 LEU B CD2   1 
ATOM   3566 N N     . GLN B 1 193 ? 5.987   5.336   -38.745 1.00 35.49 ? 231 GLN B N     1 
ATOM   3567 C CA    . GLN B 1 193 ? 4.692   5.548   -39.410 1.00 35.40 ? 231 GLN B CA    1 
ATOM   3568 C C     . GLN B 1 193 ? 4.643   4.814   -40.735 1.00 35.23 ? 231 GLN B C     1 
ATOM   3569 O O     . GLN B 1 193 ? 5.406   5.148   -41.631 1.00 35.16 ? 231 GLN B O     1 
ATOM   3570 C CB    . GLN B 1 193 ? 4.480   7.046   -39.660 1.00 36.12 ? 231 GLN B CB    1 
ATOM   3571 C CG    . GLN B 1 193 ? 4.515   7.934   -38.391 1.00 38.94 ? 231 GLN B CG    1 
ATOM   3572 C CD    . GLN B 1 193 ? 3.619   7.428   -37.290 1.00 44.33 ? 231 GLN B CD    1 
ATOM   3573 O OE1   . GLN B 1 193 ? 2.445   7.113   -37.521 1.00 49.75 ? 231 GLN B OE1   1 
ATOM   3574 N NE2   . GLN B 1 193 ? 4.158   7.359   -36.068 1.00 48.84 ? 231 GLN B NE2   1 
ATOM   3575 N N     . PRO B 1 194 ? 3.732   3.831   -40.874 1.00 35.42 ? 232 PRO B N     1 
ATOM   3576 C CA    . PRO B 1 194 ? 3.675   3.033   -42.100 1.00 35.28 ? 232 PRO B CA    1 
ATOM   3577 C C     . PRO B 1 194 ? 3.250   3.798   -43.383 1.00 35.48 ? 232 PRO B C     1 
ATOM   3578 O O     . PRO B 1 194 ? 3.463   3.317   -44.497 1.00 36.13 ? 232 PRO B O     1 
ATOM   3579 C CB    . PRO B 1 194 ? 2.658   1.945   -41.746 1.00 36.09 ? 232 PRO B CB    1 
ATOM   3580 C CG    . PRO B 1 194 ? 1.781   2.567   -40.765 1.00 35.99 ? 232 PRO B CG    1 
ATOM   3581 C CD    . PRO B 1 194 ? 2.712   3.384   -39.904 1.00 34.38 ? 232 PRO B CD    1 
ATOM   3582 N N     . GLU B 1 195 ? 2.652   4.972   -43.217 1.00 35.57 ? 233 GLU B N     1 
ATOM   3583 C CA    . GLU B 1 195 ? 2.403   5.901   -44.322 1.00 36.57 ? 233 GLU B CA    1 
ATOM   3584 C C     . GLU B 1 195 ? 3.713   6.418   -44.936 1.00 35.71 ? 233 GLU B C     1 
ATOM   3585 O O     . GLU B 1 195 ? 3.758   6.790   -46.127 1.00 37.32 ? 233 GLU B O     1 
ATOM   3586 C CB    . GLU B 1 195 ? 1.575   7.101   -43.833 1.00 37.39 ? 233 GLU B CB    1 
ATOM   3587 C CG    . GLU B 1 195 ? 0.126   6.793   -43.418 1.00 39.73 ? 233 GLU B CG    1 
ATOM   3588 C CD    . GLU B 1 195 ? 0.019   6.070   -42.083 1.00 43.37 ? 233 GLU B CD    1 
ATOM   3589 O OE1   . GLU B 1 195 ? 0.973   6.148   -41.286 1.00 41.45 ? 233 GLU B OE1   1 
ATOM   3590 O OE2   . GLU B 1 195 ? -1.023  5.413   -41.849 1.00 45.63 ? 233 GLU B OE2   1 
ATOM   3591 N N     . LYS B 1 196 ? 4.766   6.417   -44.121 1.00 34.76 ? 234 LYS B N     1 
ATOM   3592 C CA    . LYS B 1 196 ? 6.039   7.033   -44.463 1.00 33.34 ? 234 LYS B CA    1 
ATOM   3593 C C     . LYS B 1 196 ? 7.123   5.997   -44.641 1.00 32.06 ? 234 LYS B C     1 
ATOM   3594 O O     . LYS B 1 196 ? 7.944   6.117   -45.547 1.00 31.82 ? 234 LYS B O     1 
ATOM   3595 C CB    . LYS B 1 196 ? 6.459   7.974   -43.327 1.00 33.22 ? 234 LYS B CB    1 
ATOM   3596 C CG    . LYS B 1 196 ? 5.450   9.068   -43.099 1.00 35.92 ? 234 LYS B CG    1 
ATOM   3597 C CD    . LYS B 1 196 ? 5.865   9.973   -41.982 1.00 37.46 ? 234 LYS B CD    1 
ATOM   3598 C CE    . LYS B 1 196 ? 7.049   10.831  -42.390 1.00 39.08 ? 234 LYS B CE    1 
ATOM   3599 N NZ    . LYS B 1 196 ? 7.438   11.586  -41.168 1.00 40.05 ? 234 LYS B NZ    1 
ATOM   3600 N N     . VAL B 1 197 ? 7.111   4.999   -43.747 1.00 30.99 ? 235 VAL B N     1 
ATOM   3601 C CA    . VAL B 1 197 ? 8.135   3.965   -43.678 1.00 30.08 ? 235 VAL B CA    1 
ATOM   3602 C C     . VAL B 1 197 ? 7.685   2.750   -44.451 1.00 31.35 ? 235 VAL B C     1 
ATOM   3603 O O     . VAL B 1 197 ? 6.588   2.218   -44.246 1.00 31.85 ? 235 VAL B O     1 
ATOM   3604 C CB    . VAL B 1 197 ? 8.491   3.572   -42.205 1.00 29.80 ? 235 VAL B CB    1 
ATOM   3605 C CG1   . VAL B 1 197 ? 9.573   2.474   -42.181 1.00 27.88 ? 235 VAL B CG1   1 
ATOM   3606 C CG2   . VAL B 1 197 ? 8.983   4.825   -41.445 1.00 28.51 ? 235 VAL B CG2   1 
ATOM   3607 N N     . GLN B 1 198 ? 8.532   2.336   -45.378 1.00 31.56 ? 236 GLN B N     1 
ATOM   3608 C CA    . GLN B 1 198 ? 8.266   1.140   -46.147 1.00 31.98 ? 236 GLN B CA    1 
ATOM   3609 C C     . GLN B 1 198 ? 8.905   -0.107  -45.507 1.00 31.57 ? 236 GLN B C     1 
ATOM   3610 O O     . GLN B 1 198 ? 8.304   -1.188  -45.498 1.00 31.19 ? 236 GLN B O     1 
ATOM   3611 C CB    . GLN B 1 198 ? 8.712   1.340   -47.622 1.00 33.48 ? 236 GLN B CB    1 
ATOM   3612 C CG    . GLN B 1 198 ? 8.386   2.743   -48.198 1.00 35.12 ? 236 GLN B CG    1 
ATOM   3613 C CD    . GLN B 1 198 ? 6.880   3.027   -48.241 1.00 39.59 ? 236 GLN B CD    1 
ATOM   3614 O OE1   . GLN B 1 198 ? 6.167   2.507   -49.097 1.00 44.32 ? 236 GLN B OE1   1 
ATOM   3615 N NE2   . GLN B 1 198 ? 6.398   3.864   -47.322 1.00 39.16 ? 236 GLN B NE2   1 
ATOM   3616 N N     . THR B 1 199 ? 10.113  0.051   -44.957 1.00 31.24 ? 237 THR B N     1 
ATOM   3617 C CA    . THR B 1 199 ? 10.905  -1.075  -44.467 1.00 31.07 ? 237 THR B CA    1 
ATOM   3618 C C     . THR B 1 199 ? 11.725  -0.676  -43.274 1.00 31.36 ? 237 THR B C     1 
ATOM   3619 O O     . THR B 1 199 ? 12.226  0.449   -43.212 1.00 30.88 ? 237 THR B O     1 
ATOM   3620 C CB    . THR B 1 199 ? 11.899  -1.588  -45.543 1.00 31.74 ? 237 THR B CB    1 
ATOM   3621 O OG1   . THR B 1 199 ? 11.200  -1.857  -46.749 1.00 29.59 ? 237 THR B OG1   1 
ATOM   3622 C CG2   . THR B 1 199 ? 12.607  -2.865  -45.095 1.00 32.37 ? 237 THR B CG2   1 
ATOM   3623 N N     . LEU B 1 200 ? 11.799  -1.588  -42.307 1.00 30.68 ? 238 LEU B N     1 
ATOM   3624 C CA    . LEU B 1 200 ? 12.819  -1.544  -41.281 1.00 30.27 ? 238 LEU B CA    1 
ATOM   3625 C C     . LEU B 1 200 ? 13.826  -2.644  -41.598 1.00 29.79 ? 238 LEU B C     1 
ATOM   3626 O O     . LEU B 1 200 ? 13.459  -3.811  -41.815 1.00 30.99 ? 238 LEU B O     1 
ATOM   3627 C CB    . LEU B 1 200 ? 12.229  -1.707  -39.874 1.00 29.04 ? 238 LEU B CB    1 
ATOM   3628 C CG    . LEU B 1 200 ? 13.319  -1.878  -38.825 1.00 30.63 ? 238 LEU B CG    1 
ATOM   3629 C CD1   . LEU B 1 200 ? 13.867  -0.490  -38.500 1.00 28.67 ? 238 LEU B CD1   1 
ATOM   3630 C CD2   . LEU B 1 200 ? 12.733  -2.479  -37.572 1.00 34.52 ? 238 LEU B CD2   1 
ATOM   3631 N N     . GLU B 1 201 ? 15.091  -2.268  -41.746 1.00 29.34 ? 239 GLU B N     1 
ATOM   3632 C CA    . GLU B 1 201 ? 16.103  -3.270  -42.045 1.00 29.23 ? 239 GLU B CA    1 
ATOM   3633 C C     . GLU B 1 201 ? 17.044  -3.346  -40.879 1.00 30.29 ? 239 GLU B C     1 
ATOM   3634 O O     . GLU B 1 201 ? 17.672  -2.347  -40.533 1.00 27.65 ? 239 GLU B O     1 
ATOM   3635 C CB    . GLU B 1 201 ? 16.867  -2.951  -43.328 1.00 30.79 ? 239 GLU B CB    1 
ATOM   3636 C CG    . GLU B 1 201 ? 18.011  -3.908  -43.576 1.00 31.30 ? 239 GLU B CG    1 
ATOM   3637 C CD    . GLU B 1 201 ? 18.485  -3.898  -45.012 1.00 34.24 ? 239 GLU B CD    1 
ATOM   3638 O OE1   . GLU B 1 201 ? 19.597  -3.374  -45.238 1.00 36.21 ? 239 GLU B OE1   1 
ATOM   3639 O OE2   . GLU B 1 201 ? 17.744  -4.384  -45.905 1.00 34.87 ? 239 GLU B OE2   1 
ATOM   3640 N N     . ALA B 1 202 ? 17.139  -4.516  -40.266 1.00 29.64 ? 240 ALA B N     1 
ATOM   3641 C CA    . ALA B 1 202 ? 18.044  -4.643  -39.144 1.00 31.53 ? 240 ALA B CA    1 
ATOM   3642 C C     . ALA B 1 202 ? 19.409  -5.128  -39.632 1.00 31.24 ? 240 ALA B C     1 
ATOM   3643 O O     . ALA B 1 202 ? 19.503  -5.975  -40.506 1.00 31.66 ? 240 ALA B O     1 
ATOM   3644 C CB    . ALA B 1 202 ? 17.446  -5.562  -38.077 1.00 31.88 ? 240 ALA B CB    1 
ATOM   3645 N N     . TRP B 1 203 ? 20.462  -4.520  -39.096 1.00 31.87 ? 241 TRP B N     1 
ATOM   3646 C CA    . TRP B 1 203 ? 21.819  -4.976  -39.311 1.00 32.22 ? 241 TRP B CA    1 
ATOM   3647 C C     . TRP B 1 203 ? 22.320  -5.584  -38.013 1.00 33.37 ? 241 TRP B C     1 
ATOM   3648 O O     . TRP B 1 203 ? 22.653  -4.863  -37.076 1.00 33.49 ? 241 TRP B O     1 
ATOM   3649 C CB    . TRP B 1 203 ? 22.725  -3.819  -39.713 1.00 32.14 ? 241 TRP B CB    1 
ATOM   3650 C CG    . TRP B 1 203 ? 22.408  -3.186  -41.014 1.00 30.95 ? 241 TRP B CG    1 
ATOM   3651 C CD1   . TRP B 1 203 ? 21.639  -3.713  -42.030 1.00 29.37 ? 241 TRP B CD1   1 
ATOM   3652 C CD2   . TRP B 1 203 ? 22.932  -1.947  -41.507 1.00 27.81 ? 241 TRP B CD2   1 
ATOM   3653 N NE1   . TRP B 1 203 ? 21.613  -2.837  -43.080 1.00 31.29 ? 241 TRP B NE1   1 
ATOM   3654 C CE2   . TRP B 1 203 ? 22.392  -1.746  -42.785 1.00 31.87 ? 241 TRP B CE2   1 
ATOM   3655 C CE3   . TRP B 1 203 ? 23.790  -0.975  -40.978 1.00 32.29 ? 241 TRP B CE3   1 
ATOM   3656 C CZ2   . TRP B 1 203 ? 22.700  -0.618  -43.550 1.00 33.26 ? 241 TRP B CZ2   1 
ATOM   3657 C CZ3   . TRP B 1 203 ? 24.078  0.140   -41.731 1.00 31.61 ? 241 TRP B CZ3   1 
ATOM   3658 C CH2   . TRP B 1 203 ? 23.535  0.321   -42.987 1.00 32.11 ? 241 TRP B CH2   1 
ATOM   3659 N N     . VAL B 1 204 ? 22.378  -6.912  -37.961 1.00 34.78 ? 242 VAL B N     1 
ATOM   3660 C CA    . VAL B 1 204 ? 22.721  -7.582  -36.706 1.00 36.18 ? 242 VAL B CA    1 
ATOM   3661 C C     . VAL B 1 204 ? 24.222  -7.837  -36.627 1.00 37.27 ? 242 VAL B C     1 
ATOM   3662 O O     . VAL B 1 204 ? 24.764  -8.697  -37.338 1.00 37.69 ? 242 VAL B O     1 
ATOM   3663 C CB    . VAL B 1 204 ? 21.933  -8.881  -36.506 1.00 35.86 ? 242 VAL B CB    1 
ATOM   3664 C CG1   . VAL B 1 204 ? 22.273  -9.479  -35.155 1.00 36.47 ? 242 VAL B CG1   1 
ATOM   3665 C CG2   . VAL B 1 204 ? 20.450  -8.619  -36.594 1.00 36.07 ? 242 VAL B CG2   1 
ATOM   3666 N N     . ILE B 1 205 ? 24.870  -7.079  -35.745 1.00 39.00 ? 243 ILE B N     1 
ATOM   3667 C CA    . ILE B 1 205 ? 26.328  -7.058  -35.646 1.00 40.86 ? 243 ILE B CA    1 
ATOM   3668 C C     . ILE B 1 205 ? 26.843  -8.182  -34.773 1.00 42.28 ? 243 ILE B C     1 
ATOM   3669 O O     . ILE B 1 205 ? 26.550  -8.228  -33.564 1.00 41.45 ? 243 ILE B O     1 
ATOM   3670 C CB    . ILE B 1 205 ? 26.853  -5.717  -35.050 1.00 40.66 ? 243 ILE B CB    1 
ATOM   3671 C CG1   . ILE B 1 205 ? 26.140  -4.498  -35.666 1.00 40.56 ? 243 ILE B CG1   1 
ATOM   3672 C CG2   . ILE B 1 205 ? 28.370  -5.622  -35.211 1.00 40.32 ? 243 ILE B CG2   1 
ATOM   3673 C CD1   . ILE B 1 205 ? 26.170  -4.462  -37.191 1.00 37.27 ? 243 ILE B CD1   1 
ATOM   3674 N N     . HIS B 1 206 ? 27.632  -9.051  -35.387 1.00 44.50 ? 244 HIS B N     1 
ATOM   3675 C CA    . HIS B 1 206 ? 28.262  -10.187 -34.715 1.00 46.90 ? 244 HIS B CA    1 
ATOM   3676 C C     . HIS B 1 206 ? 29.370  -9.733  -33.773 1.00 48.63 ? 244 HIS B C     1 
ATOM   3677 O O     . HIS B 1 206 ? 30.075  -8.754  -34.046 1.00 48.94 ? 244 HIS B O     1 
ATOM   3678 C CB    . HIS B 1 206 ? 28.811  -11.172 -35.739 1.00 46.66 ? 244 HIS B CB    1 
ATOM   3679 C CG    . HIS B 1 206 ? 27.767  -12.057 -36.343 1.00 46.56 ? 244 HIS B CG    1 
ATOM   3680 N ND1   . HIS B 1 206 ? 26.698  -11.569 -37.063 1.00 46.67 ? 244 HIS B ND1   1 
ATOM   3681 C CD2   . HIS B 1 206 ? 27.632  -13.404 -36.336 1.00 45.51 ? 244 HIS B CD2   1 
ATOM   3682 C CE1   . HIS B 1 206 ? 25.953  -12.578 -37.479 1.00 45.29 ? 244 HIS B CE1   1 
ATOM   3683 N NE2   . HIS B 1 206 ? 26.494  -13.702 -37.044 1.00 45.63 ? 244 HIS B NE2   1 
ATOM   3684 N N     . GLY B 1 207 ? 29.519  -10.451 -32.664 1.00 50.41 ? 245 GLY B N     1 
ATOM   3685 C CA    . GLY B 1 207 ? 30.462  -10.056 -31.621 1.00 52.73 ? 245 GLY B CA    1 
ATOM   3686 C C     . GLY B 1 207 ? 31.901  -10.359 -31.989 1.00 54.22 ? 245 GLY B C     1 
ATOM   3687 O O     . GLY B 1 207 ? 32.770  -10.432 -31.109 1.00 54.74 ? 245 GLY B O     1 
ATOM   3688 N N     . GLY B 1 208 ? 32.148  -10.523 -33.291 1.00 55.19 ? 246 GLY B N     1 
ATOM   3689 C CA    . GLY B 1 208 ? 33.450  -10.907 -33.807 1.00 56.65 ? 246 GLY B CA    1 
ATOM   3690 C C     . GLY B 1 208 ? 33.444  -12.400 -34.055 1.00 57.69 ? 246 GLY B C     1 
ATOM   3691 O O     . GLY B 1 208 ? 32.594  -12.901 -34.801 1.00 57.99 ? 246 GLY B O     1 
ATOM   3692 N N     . ARG B 1 209 ? 34.394  -13.104 -33.432 1.00 58.31 ? 247 ARG B N     1 
ATOM   3693 C CA    . ARG B 1 209 ? 34.445  -14.577 -33.419 1.00 58.83 ? 247 ARG B CA    1 
ATOM   3694 C C     . ARG B 1 209 ? 34.315  -15.238 -34.792 1.00 58.81 ? 247 ARG B C     1 
ATOM   3695 O O     . ARG B 1 209 ? 34.229  -16.469 -34.895 1.00 58.92 ? 247 ARG B O     1 
ATOM   3696 C CB    . ARG B 1 209 ? 33.412  -15.146 -32.431 1.00 59.16 ? 247 ARG B CB    1 
ATOM   3697 C CG    . ARG B 1 209 ? 33.804  -14.966 -30.964 1.00 60.21 ? 247 ARG B CG    1 
ATOM   3698 C CD    . ARG B 1 209 ? 35.001  -15.856 -30.613 1.00 62.27 ? 247 ARG B CD    1 
ATOM   3699 N NE    . ARG B 1 209 ? 35.955  -15.185 -29.729 1.00 63.34 ? 247 ARG B NE    1 
ATOM   3700 C CZ    . ARG B 1 209 ? 37.165  -15.654 -29.421 1.00 64.17 ? 247 ARG B CZ    1 
ATOM   3701 N NH1   . ARG B 1 209 ? 37.596  -16.809 -29.918 1.00 64.01 ? 247 ARG B NH1   1 
ATOM   3702 N NH2   . ARG B 1 209 ? 37.949  -14.959 -28.607 1.00 65.14 ? 247 ARG B NH2   1 
ATOM   3703 N N     . GLU B 1 210 ? 34.317  -14.404 -35.833 1.00 58.81 ? 248 GLU B N     1 
ATOM   3704 C CA    . GLU B 1 210 ? 34.240  -14.831 -37.238 1.00 58.65 ? 248 GLU B CA    1 
ATOM   3705 C C     . GLU B 1 210 ? 33.197  -15.937 -37.485 1.00 58.29 ? 248 GLU B C     1 
ATOM   3706 O O     . GLU B 1 210 ? 32.020  -15.632 -37.737 1.00 58.49 ? 248 GLU B O     1 
ATOM   3707 C CB    . GLU B 1 210 ? 35.634  -15.183 -37.786 1.00 58.78 ? 248 GLU B CB    1 
ATOM   3708 C CG    . GLU B 1 210 ? 36.629  -14.014 -37.736 1.00 59.10 ? 248 GLU B CG    1 
ATOM   3709 C CD    . GLU B 1 210 ? 37.642  -14.039 -38.873 1.00 59.95 ? 248 GLU B CD    1 
ATOM   3710 O OE1   . GLU B 1 210 ? 38.598  -14.844 -38.822 1.00 60.15 ? 248 GLU B OE1   1 
ATOM   3711 O OE2   . GLU B 1 210 ? 37.487  -13.237 -39.818 1.00 60.06 ? 248 GLU B OE2   1 
ATOM   3712 N N     . ASP B 1 211 ? 33.628  -17.201 -37.401 1.00 57.46 ? 249 ASP B N     1 
ATOM   3713 C CA    . ASP B 1 211 ? 32.733  -18.364 -37.483 1.00 56.62 ? 249 ASP B CA    1 
ATOM   3714 C C     . ASP B 1 211 ? 31.438  -18.131 -36.711 1.00 55.74 ? 249 ASP B C     1 
ATOM   3715 O O     . ASP B 1 211 ? 31.479  -17.832 -35.508 1.00 55.69 ? 249 ASP B O     1 
ATOM   3716 C CB    . ASP B 1 211 ? 33.427  -19.620 -36.935 1.00 56.92 ? 249 ASP B CB    1 
ATOM   3717 C CG    . ASP B 1 211 ? 34.299  -20.313 -37.965 1.00 57.23 ? 249 ASP B CG    1 
ATOM   3718 O OD1   . ASP B 1 211 ? 33.988  -20.226 -39.171 1.00 58.49 ? 249 ASP B OD1   1 
ATOM   3719 O OD2   . ASP B 1 211 ? 35.290  -20.964 -37.566 1.00 57.60 ? 249 ASP B OD2   1 
ATOM   3720 N N     . SER B 1 212 ? 30.299  -18.247 -37.401 1.00 54.41 ? 250 SER B N     1 
ATOM   3721 C CA    . SER B 1 212 ? 28.998  -17.978 -36.775 1.00 53.38 ? 250 SER B CA    1 
ATOM   3722 C C     . SER B 1 212 ? 27.734  -18.387 -37.553 1.00 52.29 ? 250 SER B C     1 
ATOM   3723 O O     . SER B 1 212 ? 27.796  -18.960 -38.654 1.00 52.39 ? 250 SER B O     1 
ATOM   3724 C CB    . SER B 1 212 ? 28.894  -16.502 -36.364 1.00 53.29 ? 250 SER B CB    1 
ATOM   3725 O OG    . SER B 1 212 ? 29.589  -16.262 -35.155 1.00 53.87 ? 250 SER B OG    1 
ATOM   3726 N N     . ARG B 1 213 ? 26.597  -18.053 -36.936 1.00 50.94 ? 251 ARG B N     1 
ATOM   3727 C CA    . ARG B 1 213 ? 25.257  -18.445 -37.365 1.00 49.25 ? 251 ARG B CA    1 
ATOM   3728 C C     . ARG B 1 213 ? 24.393  -17.277 -37.869 1.00 48.23 ? 251 ARG B C     1 
ATOM   3729 O O     . ARG B 1 213 ? 24.809  -16.114 -37.843 1.00 47.66 ? 251 ARG B O     1 
ATOM   3730 C CB    . ARG B 1 213 ? 24.545  -19.132 -36.199 1.00 49.33 ? 251 ARG B CB    1 
ATOM   3731 C CG    . ARG B 1 213 ? 24.458  -18.280 -34.960 1.00 48.31 ? 251 ARG B CG    1 
ATOM   3732 C CD    . ARG B 1 213 ? 24.273  -19.110 -33.707 1.00 47.63 ? 251 ARG B CD    1 
ATOM   3733 N NE    . ARG B 1 213 ? 24.162  -18.247 -32.539 1.00 49.17 ? 251 ARG B NE    1 
ATOM   3734 C CZ    . ARG B 1 213 ? 25.196  -17.700 -31.908 1.00 48.77 ? 251 ARG B CZ    1 
ATOM   3735 N NH1   . ARG B 1 213 ? 26.438  -17.939 -32.310 1.00 49.77 ? 251 ARG B NH1   1 
ATOM   3736 N NH2   . ARG B 1 213 ? 24.986  -16.920 -30.867 1.00 46.55 ? 251 ARG B NH2   1 
ATOM   3737 N N     . ASP B 1 214 ? 23.188  -17.616 -38.323 1.00 47.01 ? 252 ASP B N     1 
ATOM   3738 C CA    . ASP B 1 214 ? 22.256  -16.653 -38.883 1.00 46.17 ? 252 ASP B CA    1 
ATOM   3739 C C     . ASP B 1 214 ? 21.450  -16.032 -37.764 1.00 45.53 ? 252 ASP B C     1 
ATOM   3740 O O     . ASP B 1 214 ? 20.414  -16.558 -37.358 1.00 45.17 ? 252 ASP B O     1 
ATOM   3741 C CB    . ASP B 1 214 ? 21.326  -17.314 -39.905 1.00 45.95 ? 252 ASP B CB    1 
ATOM   3742 C CG    . ASP B 1 214 ? 20.451  -16.309 -40.644 1.00 46.11 ? 252 ASP B CG    1 
ATOM   3743 O OD1   . ASP B 1 214 ? 20.529  -15.098 -40.350 1.00 46.50 ? 252 ASP B OD1   1 
ATOM   3744 O OD2   . ASP B 1 214 ? 19.675  -16.729 -41.521 1.00 46.54 ? 252 ASP B OD2   1 
ATOM   3745 N N     . LEU B 1 215 ? 21.934  -14.902 -37.273 1.00 45.06 ? 253 LEU B N     1 
ATOM   3746 C CA    . LEU B 1 215 ? 21.318  -14.262 -36.119 1.00 44.72 ? 253 LEU B CA    1 
ATOM   3747 C C     . LEU B 1 215 ? 19.973  -13.635 -36.470 1.00 44.62 ? 253 LEU B C     1 
ATOM   3748 O O     . LEU B 1 215 ? 19.154  -13.380 -35.588 1.00 44.91 ? 253 LEU B O     1 
ATOM   3749 C CB    . LEU B 1 215 ? 22.277  -13.266 -35.473 1.00 44.70 ? 253 LEU B CB    1 
ATOM   3750 C CG    . LEU B 1 215 ? 23.475  -13.899 -34.748 1.00 44.50 ? 253 LEU B CG    1 
ATOM   3751 C CD1   . LEU B 1 215 ? 24.538  -12.861 -34.451 1.00 43.46 ? 253 LEU B CD1   1 
ATOM   3752 C CD2   . LEU B 1 215 ? 23.061  -14.627 -33.463 1.00 44.86 ? 253 LEU B CD2   1 
ATOM   3753 N N     . CYS B 1 216 ? 19.728  -13.436 -37.762 1.00 44.39 ? 254 CYS B N     1 
ATOM   3754 C CA    . CYS B 1 216 ? 18.417  -12.999 -38.226 1.00 44.79 ? 254 CYS B CA    1 
ATOM   3755 C C     . CYS B 1 216 ? 17.347  -14.051 -37.919 1.00 44.73 ? 254 CYS B C     1 
ATOM   3756 O O     . CYS B 1 216 ? 16.148  -13.808 -38.094 1.00 45.06 ? 254 CYS B O     1 
ATOM   3757 C CB    . CYS B 1 216 ? 18.462  -12.683 -39.725 1.00 44.72 ? 254 CYS B CB    1 
ATOM   3758 S SG    . CYS B 1 216 ? 19.439  -11.198 -40.099 1.00 46.15 ? 254 CYS B SG    1 
ATOM   3759 N N     . GLN B 1 217 ? 17.787  -15.216 -37.453 1.00 44.37 ? 255 GLN B N     1 
ATOM   3760 C CA    . GLN B 1 217 ? 16.870  -16.266 -37.034 1.00 44.24 ? 255 GLN B CA    1 
ATOM   3761 C C     . GLN B 1 217 ? 16.680  -16.311 -35.525 1.00 44.00 ? 255 GLN B C     1 
ATOM   3762 O O     . GLN B 1 217 ? 15.945  -17.158 -35.020 1.00 44.13 ? 255 GLN B O     1 
ATOM   3763 C CB    . GLN B 1 217 ? 17.335  -17.629 -37.545 1.00 44.33 ? 255 GLN B CB    1 
ATOM   3764 C CG    . GLN B 1 217 ? 17.487  -17.684 -39.051 1.00 44.90 ? 255 GLN B CG    1 
ATOM   3765 C CD    . GLN B 1 217 ? 16.269  -17.147 -39.782 1.00 46.44 ? 255 GLN B CD    1 
ATOM   3766 O OE1   . GLN B 1 217 ? 15.141  -17.545 -39.498 1.00 47.22 ? 255 GLN B OE1   1 
ATOM   3767 N NE2   . GLN B 1 217 ? 16.493  -16.240 -40.733 1.00 46.78 ? 255 GLN B NE2   1 
ATOM   3768 N N     . ASP B 1 218 ? 17.345  -15.412 -34.810 1.00 43.56 ? 256 ASP B N     1 
ATOM   3769 C CA    . ASP B 1 218 ? 17.210  -15.359 -33.359 1.00 43.47 ? 256 ASP B CA    1 
ATOM   3770 C C     . ASP B 1 218 ? 15.761  -15.042 -32.990 1.00 43.43 ? 256 ASP B C     1 
ATOM   3771 O O     . ASP B 1 218 ? 15.131  -14.193 -33.624 1.00 43.00 ? 256 ASP B O     1 
ATOM   3772 C CB    . ASP B 1 218 ? 18.174  -14.335 -32.746 1.00 43.79 ? 256 ASP B CB    1 
ATOM   3773 C CG    . ASP B 1 218 ? 17.993  -14.181 -31.244 1.00 44.76 ? 256 ASP B CG    1 
ATOM   3774 O OD1   . ASP B 1 218 ? 17.122  -13.393 -30.831 1.00 46.65 ? 256 ASP B OD1   1 
ATOM   3775 O OD2   . ASP B 1 218 ? 18.730  -14.831 -30.474 1.00 46.70 ? 256 ASP B OD2   1 
ATOM   3776 N N     . PRO B 1 219 ? 15.210  -15.766 -31.998 1.00 43.55 ? 257 PRO B N     1 
ATOM   3777 C CA    . PRO B 1 219 ? 13.889  -15.509 -31.439 1.00 43.51 ? 257 PRO B CA    1 
ATOM   3778 C C     . PRO B 1 219 ? 13.519  -14.039 -31.241 1.00 42.99 ? 257 PRO B C     1 
ATOM   3779 O O     . PRO B 1 219 ? 12.413  -13.657 -31.608 1.00 42.96 ? 257 PRO B O     1 
ATOM   3780 C CB    . PRO B 1 219 ? 13.942  -16.257 -30.106 1.00 43.47 ? 257 PRO B CB    1 
ATOM   3781 C CG    . PRO B 1 219 ? 14.713  -17.494 -30.473 1.00 43.62 ? 257 PRO B CG    1 
ATOM   3782 C CD    . PRO B 1 219 ? 15.813  -16.971 -31.388 1.00 43.76 ? 257 PRO B CD    1 
ATOM   3783 N N     . THR B 1 220 ? 14.415  -13.223 -30.682 1.00 42.92 ? 258 THR B N     1 
ATOM   3784 C CA    . THR B 1 220 ? 14.110  -11.798 -30.439 1.00 42.60 ? 258 THR B CA    1 
ATOM   3785 C C     . THR B 1 220 ? 13.964  -11.004 -31.743 1.00 42.11 ? 258 THR B C     1 
ATOM   3786 O O     . THR B 1 220 ? 13.193  -10.044 -31.814 1.00 41.57 ? 258 THR B O     1 
ATOM   3787 C CB    . THR B 1 220 ? 15.129  -11.106 -29.497 1.00 43.15 ? 258 THR B CB    1 
ATOM   3788 O OG1   . THR B 1 220 ? 16.385  -10.923 -30.166 1.00 43.96 ? 258 THR B OG1   1 
ATOM   3789 C CG2   . THR B 1 220 ? 15.329  -11.918 -28.205 1.00 43.60 ? 258 THR B CG2   1 
ATOM   3790 N N     . ILE B 1 221 ? 14.703  -11.430 -32.769 1.00 42.02 ? 259 ILE B N     1 
ATOM   3791 C CA    . ILE B 1 221 ? 14.601  -10.859 -34.119 1.00 41.19 ? 259 ILE B CA    1 
ATOM   3792 C C     . ILE B 1 221 ? 13.274  -11.247 -34.751 1.00 40.51 ? 259 ILE B C     1 
ATOM   3793 O O     . ILE B 1 221 ? 12.641  -10.431 -35.426 1.00 40.26 ? 259 ILE B O     1 
ATOM   3794 C CB    . ILE B 1 221 ? 15.792  -11.282 -35.049 1.00 40.90 ? 259 ILE B CB    1 
ATOM   3795 C CG1   . ILE B 1 221 ? 17.142  -10.740 -34.540 1.00 40.15 ? 259 ILE B CG1   1 
ATOM   3796 C CG2   . ILE B 1 221 ? 15.552  -10.856 -36.522 1.00 40.20 ? 259 ILE B CG2   1 
ATOM   3797 C CD1   . ILE B 1 221 ? 17.217  -9.197  -34.316 1.00 41.22 ? 259 ILE B CD1   1 
ATOM   3798 N N     . LYS B 1 222 ? 12.840  -12.486 -34.532 1.00 40.18 ? 260 LYS B N     1 
ATOM   3799 C CA    . LYS B 1 222 ? 11.539  -12.899 -35.036 1.00 39.51 ? 260 LYS B CA    1 
ATOM   3800 C C     . LYS B 1 222 ? 10.363  -12.182 -34.368 1.00 39.52 ? 260 LYS B C     1 
ATOM   3801 O O     . LYS B 1 222 ? 9.313   -12.021 -34.986 1.00 39.53 ? 260 LYS B O     1 
ATOM   3802 C CB    . LYS B 1 222 ? 11.385  -14.426 -35.003 1.00 39.54 ? 260 LYS B CB    1 
ATOM   3803 C CG    . LYS B 1 222 ? 12.240  -15.114 -36.055 1.00 40.53 ? 260 LYS B CG    1 
ATOM   3804 C CD    . LYS B 1 222 ? 11.561  -15.129 -37.427 1.00 41.06 ? 260 LYS B CD    1 
ATOM   3805 C CE    . LYS B 1 222 ? 12.530  -15.527 -38.524 1.00 40.91 ? 260 LYS B CE    1 
ATOM   3806 N NZ    . LYS B 1 222 ? 12.782  -17.000 -38.526 1.00 40.76 ? 260 LYS B NZ    1 
ATOM   3807 N N     . GLU B 1 223 ? 10.546  -11.732 -33.125 1.00 39.30 ? 261 GLU B N     1 
ATOM   3808 C CA    . GLU B 1 223 ? 9.538   -10.905 -32.455 1.00 39.67 ? 261 GLU B CA    1 
ATOM   3809 C C     . GLU B 1 223 ? 9.599   -9.478  -32.954 1.00 38.48 ? 261 GLU B C     1 
ATOM   3810 O O     . GLU B 1 223 ? 8.563   -8.843  -33.159 1.00 37.93 ? 261 GLU B O     1 
ATOM   3811 C CB    . GLU B 1 223 ? 9.704   -10.903 -30.940 1.00 39.97 ? 261 GLU B CB    1 
ATOM   3812 C CG    . GLU B 1 223 ? 8.656   -10.031 -30.198 1.00 44.01 ? 261 GLU B CG    1 
ATOM   3813 C CD    . GLU B 1 223 ? 7.373   -10.798 -29.816 1.00 48.58 ? 261 GLU B CD    1 
ATOM   3814 O OE1   . GLU B 1 223 ? 6.761   -11.473 -30.686 1.00 48.31 ? 261 GLU B OE1   1 
ATOM   3815 O OE2   . GLU B 1 223 ? 6.975   -10.715 -28.622 1.00 51.91 ? 261 GLU B OE2   1 
ATOM   3816 N N     . LEU B 1 224 ? 10.814  -8.976  -33.148 1.00 37.93 ? 262 LEU B N     1 
ATOM   3817 C CA    . LEU B 1 224 ? 10.977  -7.671  -33.763 1.00 38.01 ? 262 LEU B CA    1 
ATOM   3818 C C     . LEU B 1 224 ? 10.254  -7.760  -35.110 1.00 36.83 ? 262 LEU B C     1 
ATOM   3819 O O     . LEU B 1 224 ? 9.458   -6.887  -35.442 1.00 35.72 ? 262 LEU B O     1 
ATOM   3820 C CB    . LEU B 1 224 ? 12.461  -7.292  -33.944 1.00 37.81 ? 262 LEU B CB    1 
ATOM   3821 C CG    . LEU B 1 224 ? 12.823  -6.033  -34.752 1.00 37.48 ? 262 LEU B CG    1 
ATOM   3822 C CD1   . LEU B 1 224 ? 12.000  -4.810  -34.360 1.00 32.95 ? 262 LEU B CD1   1 
ATOM   3823 C CD2   . LEU B 1 224 ? 14.318  -5.692  -34.643 1.00 35.97 ? 262 LEU B CD2   1 
ATOM   3824 N N     . GLU B 1 225 ? 10.481  -8.840  -35.856 1.00 38.09 ? 263 GLU B N     1 
ATOM   3825 C CA    . GLU B 1 225 ? 9.811   -8.996  -37.130 1.00 39.02 ? 263 GLU B CA    1 
ATOM   3826 C C     . GLU B 1 225 ? 8.285   -9.041  -36.963 1.00 39.53 ? 263 GLU B C     1 
ATOM   3827 O O     . GLU B 1 225 ? 7.554   -8.545  -37.820 1.00 40.30 ? 263 GLU B O     1 
ATOM   3828 C CB    . GLU B 1 225 ? 10.294  -10.252 -37.863 1.00 38.83 ? 263 GLU B CB    1 
ATOM   3829 C CG    . GLU B 1 225 ? 9.781   -10.344 -39.303 1.00 40.30 ? 263 GLU B CG    1 
ATOM   3830 C CD    . GLU B 1 225 ? 10.313  -11.558 -40.044 1.00 40.31 ? 263 GLU B CD    1 
ATOM   3831 O OE1   . GLU B 1 225 ? 10.826  -12.485 -39.374 1.00 41.88 ? 263 GLU B OE1   1 
ATOM   3832 O OE2   . GLU B 1 225 ? 10.203  -11.595 -41.302 1.00 44.31 ? 263 GLU B OE2   1 
ATOM   3833 N N     . SER B 1 226 ? 7.801   -9.642  -35.880 1.00 39.38 ? 264 SER B N     1 
ATOM   3834 C CA    . SER B 1 226 ? 6.356   -9.712  -35.656 1.00 40.12 ? 264 SER B CA    1 
ATOM   3835 C C     . SER B 1 226 ? 5.755   -8.314  -35.426 1.00 39.41 ? 264 SER B C     1 
ATOM   3836 O O     . SER B 1 226 ? 4.719   -7.986  -36.002 1.00 39.99 ? 264 SER B O     1 
ATOM   3837 C CB    . SER B 1 226 ? 6.005   -10.677 -34.502 1.00 39.86 ? 264 SER B CB    1 
ATOM   3838 O OG    . SER B 1 226 ? 6.351   -10.096 -33.240 1.00 43.21 ? 264 SER B OG    1 
ATOM   3839 N N     . ILE B 1 227 ? 6.409   -7.502  -34.594 1.00 39.21 ? 265 ILE B N     1 
ATOM   3840 C CA    . ILE B 1 227 ? 5.951   -6.143  -34.293 1.00 38.47 ? 265 ILE B CA    1 
ATOM   3841 C C     . ILE B 1 227 ? 5.905   -5.234  -35.532 1.00 39.14 ? 265 ILE B C     1 
ATOM   3842 O O     . ILE B 1 227 ? 4.953   -4.462  -35.713 1.00 39.32 ? 265 ILE B O     1 
ATOM   3843 C CB    . ILE B 1 227 ? 6.849   -5.484  -33.220 1.00 38.35 ? 265 ILE B CB    1 
ATOM   3844 C CG1   . ILE B 1 227 ? 6.692   -6.214  -31.885 1.00 37.72 ? 265 ILE B CG1   1 
ATOM   3845 C CG2   . ILE B 1 227 ? 6.520   -4.012  -33.081 1.00 38.67 ? 265 ILE B CG2   1 
ATOM   3846 C CD1   . ILE B 1 227 ? 7.791   -5.891  -30.905 1.00 39.52 ? 265 ILE B CD1   1 
ATOM   3847 N N     . ILE B 1 228 ? 6.935   -5.328  -36.374 1.00 38.94 ? 266 ILE B N     1 
ATOM   3848 C CA    . ILE B 1 228 ? 7.048   -4.498  -37.570 1.00 39.21 ? 266 ILE B CA    1 
ATOM   3849 C C     . ILE B 1 228 ? 6.021   -4.926  -38.610 1.00 39.72 ? 266 ILE B C     1 
ATOM   3850 O O     . ILE B 1 228 ? 5.428   -4.093  -39.307 1.00 39.42 ? 266 ILE B O     1 
ATOM   3851 C CB    . ILE B 1 228 ? 8.503   -4.544  -38.140 1.00 39.40 ? 266 ILE B CB    1 
ATOM   3852 C CG1   . ILE B 1 228 ? 9.426   -3.675  -37.294 1.00 39.98 ? 266 ILE B CG1   1 
ATOM   3853 C CG2   . ILE B 1 228 ? 8.577   -4.068  -39.576 1.00 39.17 ? 266 ILE B CG2   1 
ATOM   3854 C CD1   . ILE B 1 228 ? 8.962   -2.213  -37.145 1.00 42.14 ? 266 ILE B CD1   1 
ATOM   3855 N N     . SER B 1 229 ? 5.804   -6.232  -38.695 1.00 40.60 ? 267 SER B N     1 
ATOM   3856 C CA    . SER B 1 229 ? 4.787   -6.776  -39.585 1.00 41.40 ? 267 SER B CA    1 
ATOM   3857 C C     . SER B 1 229 ? 3.430   -6.177  -39.246 1.00 41.74 ? 267 SER B C     1 
ATOM   3858 O O     . SER B 1 229 ? 2.741   -5.660  -40.116 1.00 41.63 ? 267 SER B O     1 
ATOM   3859 C CB    . SER B 1 229 ? 4.720   -8.298  -39.470 1.00 41.71 ? 267 SER B CB    1 
ATOM   3860 O OG    . SER B 1 229 ? 5.986   -8.892  -39.709 1.00 43.59 ? 267 SER B OG    1 
ATOM   3861 N N     . LYS B 1 230 ? 3.067   -6.214  -37.967 1.00 42.21 ? 268 LYS B N     1 
ATOM   3862 C CA    . LYS B 1 230 ? 1.724   -5.805  -37.543 1.00 42.67 ? 268 LYS B CA    1 
ATOM   3863 C C     . LYS B 1 230 ? 1.531   -4.269  -37.620 1.00 42.52 ? 268 LYS B C     1 
ATOM   3864 O O     . LYS B 1 230 ? 0.403   -3.770  -37.545 1.00 43.27 ? 268 LYS B O     1 
ATOM   3865 C CB    . LYS B 1 230 ? 1.391   -6.415  -36.160 1.00 43.21 ? 268 LYS B CB    1 
ATOM   3866 C CG    . LYS B 1 230 ? 0.116   -5.929  -35.468 1.00 44.28 ? 268 LYS B CG    1 
ATOM   3867 C CD    . LYS B 1 230 ? -1.168  -6.399  -36.150 1.00 46.15 ? 268 LYS B CD    1 
ATOM   3868 C CE    . LYS B 1 230 ? -2.397  -5.865  -35.421 1.00 46.82 ? 268 LYS B CE    1 
ATOM   3869 N NZ    . LYS B 1 230 ? -2.305  -4.390  -35.138 1.00 46.45 ? 268 LYS B NZ    1 
ATOM   3870 N N     . ARG B 1 231 ? 2.619   -3.533  -37.830 1.00 41.27 ? 269 ARG B N     1 
ATOM   3871 C CA    . ARG B 1 231 ? 2.534   -2.094  -38.112 1.00 40.73 ? 269 ARG B CA    1 
ATOM   3872 C C     . ARG B 1 231 ? 2.368   -1.833  -39.620 1.00 39.99 ? 269 ARG B C     1 
ATOM   3873 O O     . ARG B 1 231 ? 2.351   -0.679  -40.066 1.00 39.58 ? 269 ARG B O     1 
ATOM   3874 C CB    . ARG B 1 231 ? 3.775   -1.346  -37.598 1.00 40.51 ? 269 ARG B CB    1 
ATOM   3875 C CG    . ARG B 1 231 ? 3.908   -1.214  -36.082 1.00 40.38 ? 269 ARG B CG    1 
ATOM   3876 C CD    . ARG B 1 231 ? 4.867   -0.055  -35.695 1.00 40.87 ? 269 ARG B CD    1 
ATOM   3877 N NE    . ARG B 1 231 ? 4.147   1.148   -35.256 1.00 41.59 ? 269 ARG B NE    1 
ATOM   3878 C CZ    . ARG B 1 231 ? 3.645   2.070   -36.074 1.00 43.63 ? 269 ARG B CZ    1 
ATOM   3879 N NH1   . ARG B 1 231 ? 3.746   1.922   -37.392 1.00 47.80 ? 269 ARG B NH1   1 
ATOM   3880 N NH2   . ARG B 1 231 ? 3.007   3.123   -35.596 1.00 42.45 ? 269 ARG B NH2   1 
ATOM   3881 N N     . ASN B 1 232 ? 2.252   -2.907  -40.398 1.00 39.39 ? 270 ASN B N     1 
ATOM   3882 C CA    . ASN B 1 232 ? 2.133   -2.815  -41.856 1.00 39.27 ? 270 ASN B CA    1 
ATOM   3883 C C     . ASN B 1 232 ? 3.408   -2.295  -42.529 1.00 38.86 ? 270 ASN B C     1 
ATOM   3884 O O     . ASN B 1 232 ? 3.348   -1.572  -43.553 1.00 39.24 ? 270 ASN B O     1 
ATOM   3885 C CB    . ASN B 1 232 ? 0.910   -1.992  -42.266 1.00 39.04 ? 270 ASN B CB    1 
ATOM   3886 C CG    . ASN B 1 232 ? 0.545   -2.186  -43.719 1.00 41.26 ? 270 ASN B CG    1 
ATOM   3887 O OD1   . ASN B 1 232 ? 0.161   -1.237  -44.403 1.00 44.74 ? 270 ASN B OD1   1 
ATOM   3888 N ND2   . ASN B 1 232 ? 0.665   -3.418  -44.206 1.00 41.72 ? 270 ASN B ND2   1 
ATOM   3889 N N     . ILE B 1 233 ? 4.562   -2.711  -41.952 1.00 37.66 ? 271 ILE B N     1 
ATOM   3890 C CA    . ILE B 1 233 ? 5.879   -2.331  -42.463 1.00 37.23 ? 271 ILE B CA    1 
ATOM   3891 C C     . ILE B 1 233 ? 6.688   -3.598  -42.758 1.00 37.12 ? 271 ILE B C     1 
ATOM   3892 O O     . ILE B 1 233 ? 6.629   -4.567  -41.989 1.00 37.53 ? 271 ILE B O     1 
ATOM   3893 C CB    . ILE B 1 233 ? 6.610   -1.439  -41.422 1.00 36.95 ? 271 ILE B CB    1 
ATOM   3894 C CG1   . ILE B 1 233 ? 5.840   -0.135  -41.248 1.00 38.08 ? 271 ILE B CG1   1 
ATOM   3895 C CG2   . ILE B 1 233 ? 8.058   -1.134  -41.828 1.00 37.66 ? 271 ILE B CG2   1 
ATOM   3896 C CD1   . ILE B 1 233 ? 6.394   0.770   -40.205 1.00 34.71 ? 271 ILE B CD1   1 
ATOM   3897 N N     . GLN B 1 234 ? 7.432   -3.596  -43.876 1.00 36.35 ? 272 GLN B N     1 
ATOM   3898 C CA    . GLN B 1 234 ? 8.297   -4.716  -44.220 1.00 35.59 ? 272 GLN B CA    1 
ATOM   3899 C C     . GLN B 1 234 ? 9.495   -4.831  -43.273 1.00 34.89 ? 272 GLN B C     1 
ATOM   3900 O O     . GLN B 1 234 ? 10.032  -3.820  -42.802 1.00 35.35 ? 272 GLN B O     1 
ATOM   3901 C CB    . GLN B 1 234 ? 8.813   -4.558  -45.643 1.00 35.76 ? 272 GLN B CB    1 
ATOM   3902 C CG    . GLN B 1 234 ? 7.731   -4.414  -46.703 1.00 38.48 ? 272 GLN B CG    1 
ATOM   3903 C CD    . GLN B 1 234 ? 8.351   -4.207  -48.071 1.00 39.69 ? 272 GLN B CD    1 
ATOM   3904 O OE1   . GLN B 1 234 ? 8.722   -3.074  -48.444 1.00 44.34 ? 272 GLN B OE1   1 
ATOM   3905 N NE2   . GLN B 1 234 ? 8.515   -5.302  -48.805 1.00 38.98 ? 272 GLN B NE2   1 
ATOM   3906 N N     . PHE B 1 235 ? 9.911   -6.061  -42.980 1.00 34.04 ? 273 PHE B N     1 
ATOM   3907 C CA    . PHE B 1 235 ? 11.106  -6.271  -42.163 1.00 33.43 ? 273 PHE B CA    1 
ATOM   3908 C C     . PHE B 1 235 ? 12.200  -6.920  -42.985 1.00 33.60 ? 273 PHE B C     1 
ATOM   3909 O O     . PHE B 1 235 ? 11.954  -7.899  -43.691 1.00 31.46 ? 273 PHE B O     1 
ATOM   3910 C CB    . PHE B 1 235 ? 10.795  -7.102  -40.912 1.00 33.84 ? 273 PHE B CB    1 
ATOM   3911 C CG    . PHE B 1 235 ? 11.998  -7.326  -40.007 1.00 34.37 ? 273 PHE B CG    1 
ATOM   3912 C CD1   . PHE B 1 235 ? 12.471  -6.323  -39.162 1.00 37.05 ? 273 PHE B CD1   1 
ATOM   3913 C CD2   . PHE B 1 235 ? 12.661  -8.554  -40.028 1.00 34.83 ? 273 PHE B CD2   1 
ATOM   3914 C CE1   . PHE B 1 235 ? 13.588  -6.549  -38.355 1.00 32.80 ? 273 PHE B CE1   1 
ATOM   3915 C CE2   . PHE B 1 235 ? 13.761  -8.793  -39.220 1.00 35.01 ? 273 PHE B CE2   1 
ATOM   3916 C CZ    . PHE B 1 235 ? 14.230  -7.802  -38.391 1.00 31.87 ? 273 PHE B CZ    1 
ATOM   3917 N N     . SER B 1 236 ? 13.400  -6.354  -42.927 1.00 33.03 ? 274 SER B N     1 
ATOM   3918 C CA    . SER B 1 236 ? 14.574  -6.966  -43.544 1.00 33.94 ? 274 SER B CA    1 
ATOM   3919 C C     . SER B 1 236 ? 15.633  -7.136  -42.482 1.00 34.42 ? 274 SER B C     1 
ATOM   3920 O O     . SER B 1 236 ? 15.717  -6.331  -41.555 1.00 32.89 ? 274 SER B O     1 
ATOM   3921 C CB    . SER B 1 236 ? 15.148  -6.070  -44.632 1.00 33.82 ? 274 SER B CB    1 
ATOM   3922 O OG    . SER B 1 236 ? 16.087  -6.804  -45.415 1.00 36.93 ? 274 SER B OG    1 
ATOM   3923 N N     . CYS B 1 237 ? 16.463  -8.161  -42.623 1.00 36.09 ? 275 CYS B N     1 
ATOM   3924 C CA    . CYS B 1 237 ? 17.550  -8.363  -41.667 1.00 36.52 ? 275 CYS B CA    1 
ATOM   3925 C C     . CYS B 1 237 ? 18.804  -8.859  -42.368 1.00 36.52 ? 275 CYS B C     1 
ATOM   3926 O O     . CYS B 1 237 ? 18.738  -9.724  -43.254 1.00 35.68 ? 275 CYS B O     1 
ATOM   3927 C CB    . CYS B 1 237 ? 17.120  -9.315  -40.542 1.00 36.60 ? 275 CYS B CB    1 
ATOM   3928 S SG    . CYS B 1 237 ? 18.386  -9.627  -39.288 1.00 40.53 ? 275 CYS B SG    1 
ATOM   3929 N N     . LYS B 1 238 ? 19.939  -8.291  -41.978 1.00 36.57 ? 276 LYS B N     1 
ATOM   3930 C CA    . LYS B 1 238 ? 21.237  -8.684  -42.505 1.00 37.15 ? 276 LYS B CA    1 
ATOM   3931 C C     . LYS B 1 238 ? 22.188  -9.022  -41.370 1.00 37.91 ? 276 LYS B C     1 
ATOM   3932 O O     . LYS B 1 238 ? 22.222  -8.322  -40.349 1.00 37.44 ? 276 LYS B O     1 
ATOM   3933 C CB    . LYS B 1 238 ? 21.847  -7.556  -43.336 1.00 37.50 ? 276 LYS B CB    1 
ATOM   3934 C CG    . LYS B 1 238 ? 20.942  -6.928  -44.391 1.00 38.29 ? 276 LYS B CG    1 
ATOM   3935 C CD    . LYS B 1 238 ? 20.882  -7.767  -45.639 1.00 40.94 ? 276 LYS B CD    1 
ATOM   3936 C CE    . LYS B 1 238 ? 20.050  -7.104  -46.715 1.00 42.48 ? 276 LYS B CE    1 
ATOM   3937 N NZ    . LYS B 1 238 ? 19.768  -8.085  -47.789 1.00 43.62 ? 276 LYS B NZ    1 
ATOM   3938 N N     . ASN B 1 239 ? 22.954  -10.095 -41.551 1.00 38.67 ? 277 ASN B N     1 
ATOM   3939 C CA    . ASN B 1 239 ? 24.049  -10.424 -40.642 1.00 39.33 ? 277 ASN B CA    1 
ATOM   3940 C C     . ASN B 1 239 ? 25.284  -9.643  -41.053 1.00 40.22 ? 277 ASN B C     1 
ATOM   3941 O O     . ASN B 1 239 ? 25.665  -9.651  -42.224 1.00 39.44 ? 277 ASN B O     1 
ATOM   3942 C CB    . ASN B 1 239 ? 24.387  -11.914 -40.722 1.00 39.07 ? 277 ASN B CB    1 
ATOM   3943 C CG    . ASN B 1 239 ? 23.328  -12.791 -40.106 1.00 38.29 ? 277 ASN B CG    1 
ATOM   3944 O OD1   . ASN B 1 239 ? 23.174  -12.828 -38.881 1.00 39.52 ? 277 ASN B OD1   1 
ATOM   3945 N ND2   . ASN B 1 239 ? 22.590  -13.516 -40.955 1.00 36.75 ? 277 ASN B ND2   1 
ATOM   3946 N N     . ILE B 1 240 ? 25.912  -8.979  -40.096 1.00 40.97 ? 278 ILE B N     1 
ATOM   3947 C CA    . ILE B 1 240 ? 27.230  -8.400  -40.307 1.00 42.32 ? 278 ILE B CA    1 
ATOM   3948 C C     . ILE B 1 240 ? 28.226  -9.194  -39.474 1.00 43.48 ? 278 ILE B C     1 
ATOM   3949 O O     . ILE B 1 240 ? 28.373  -8.976  -38.260 1.00 44.02 ? 278 ILE B O     1 
ATOM   3950 C CB    . ILE B 1 240 ? 27.266  -6.897  -39.988 1.00 42.04 ? 278 ILE B CB    1 
ATOM   3951 C CG1   . ILE B 1 240 ? 26.328  -6.142  -40.936 1.00 41.02 ? 278 ILE B CG1   1 
ATOM   3952 C CG2   . ILE B 1 240 ? 28.699  -6.349  -40.070 1.00 42.63 ? 278 ILE B CG2   1 
ATOM   3953 C CD1   . ILE B 1 240 ? 26.261  -4.656  -40.686 1.00 41.09 ? 278 ILE B CD1   1 
ATOM   3954 N N     . TYR B 1 241 ? 28.897  -10.122 -40.142 1.00 45.15 ? 279 TYR B N     1 
ATOM   3955 C CA    . TYR B 1 241 ? 29.776  -11.069 -39.472 1.00 46.59 ? 279 TYR B CA    1 
ATOM   3956 C C     . TYR B 1 241 ? 31.038  -10.419 -38.906 1.00 47.32 ? 279 TYR B C     1 
ATOM   3957 O O     . TYR B 1 241 ? 31.458  -10.753 -37.789 1.00 48.08 ? 279 TYR B O     1 
ATOM   3958 C CB    . TYR B 1 241 ? 30.081  -12.262 -40.380 1.00 46.92 ? 279 TYR B CB    1 
ATOM   3959 C CG    . TYR B 1 241 ? 28.843  -13.081 -40.704 1.00 47.56 ? 279 TYR B CG    1 
ATOM   3960 C CD1   . TYR B 1 241 ? 28.335  -14.006 -39.787 1.00 47.87 ? 279 TYR B CD1   1 
ATOM   3961 C CD2   . TYR B 1 241 ? 28.168  -12.915 -41.914 1.00 47.83 ? 279 TYR B CD2   1 
ATOM   3962 C CE1   . TYR B 1 241 ? 27.193  -14.747 -40.067 1.00 47.07 ? 279 TYR B CE1   1 
ATOM   3963 C CE2   . TYR B 1 241 ? 27.023  -13.655 -42.205 1.00 48.26 ? 279 TYR B CE2   1 
ATOM   3964 C CZ    . TYR B 1 241 ? 26.541  -14.566 -41.272 1.00 47.89 ? 279 TYR B CZ    1 
ATOM   3965 O OH    . TYR B 1 241 ? 25.414  -15.307 -41.548 1.00 48.45 ? 279 TYR B OH    1 
ATOM   3966 N N     . ARG B 1 242 ? 31.613  -9.462  -39.637 1.00 47.53 ? 280 ARG B N     1 
ATOM   3967 C CA    . ARG B 1 242 ? 32.796  -8.756  -39.140 1.00 47.85 ? 280 ARG B CA    1 
ATOM   3968 C C     . ARG B 1 242 ? 32.688  -7.233  -39.198 1.00 47.53 ? 280 ARG B C     1 
ATOM   3969 O O     . ARG B 1 242 ? 32.873  -6.648  -40.273 1.00 48.30 ? 280 ARG B O     1 
ATOM   3970 C CB    . ARG B 1 242 ? 34.038  -9.228  -39.889 1.00 47.57 ? 280 ARG B CB    1 
ATOM   3971 C CG    . ARG B 1 242 ? 34.258  -10.734 -39.792 1.00 49.46 ? 280 ARG B CG    1 
ATOM   3972 C CD    . ARG B 1 242 ? 35.028  -11.251 -40.983 1.00 49.69 ? 280 ARG B CD    1 
ATOM   3973 N NE    . ARG B 1 242 ? 36.428  -10.847 -40.906 1.00 51.72 ? 280 ARG B NE    1 
ATOM   3974 C CZ    . ARG B 1 242 ? 37.262  -10.796 -41.940 1.00 52.14 ? 280 ARG B CZ    1 
ATOM   3975 N NH1   . ARG B 1 242 ? 36.851  -11.124 -43.168 1.00 51.76 ? 280 ARG B NH1   1 
ATOM   3976 N NH2   . ARG B 1 242 ? 38.516  -10.402 -41.741 1.00 53.23 ? 280 ARG B NH2   1 
ATOM   3977 N N     . PRO B 1 243 ? 32.411  -6.593  -38.043 1.00 47.39 ? 281 PRO B N     1 
ATOM   3978 C CA    . PRO B 1 243 ? 32.282  -5.138  -37.855 1.00 47.07 ? 281 PRO B CA    1 
ATOM   3979 C C     . PRO B 1 243 ? 33.517  -4.353  -38.298 1.00 46.63 ? 281 PRO B C     1 
ATOM   3980 O O     . PRO B 1 243 ? 33.405  -3.233  -38.807 1.00 46.05 ? 281 PRO B O     1 
ATOM   3981 C CB    . PRO B 1 243 ? 32.135  -4.987  -36.336 1.00 46.96 ? 281 PRO B CB    1 
ATOM   3982 C CG    . PRO B 1 243 ? 31.683  -6.293  -35.857 1.00 47.61 ? 281 PRO B CG    1 
ATOM   3983 C CD    . PRO B 1 243 ? 32.201  -7.324  -36.780 1.00 47.00 ? 281 PRO B CD    1 
ATOM   3984 N N     . ASP B 1 244 ? 34.679  -4.950  -38.069 1.00 46.33 ? 282 ASP B N     1 
ATOM   3985 C CA    . ASP B 1 244 ? 35.966  -4.366  -38.394 1.00 46.10 ? 282 ASP B CA    1 
ATOM   3986 C C     . ASP B 1 244 ? 36.116  -4.221  -39.901 1.00 45.48 ? 282 ASP B C     1 
ATOM   3987 O O     . ASP B 1 244 ? 36.468  -3.144  -40.399 1.00 44.96 ? 282 ASP B O     1 
ATOM   3988 C CB    . ASP B 1 244 ? 37.063  -5.278  -37.861 1.00 47.01 ? 282 ASP B CB    1 
ATOM   3989 C CG    . ASP B 1 244 ? 36.634  -6.748  -37.822 1.00 48.39 ? 282 ASP B CG    1 
ATOM   3990 O OD1   . ASP B 1 244 ? 35.775  -7.087  -36.970 1.00 51.54 ? 282 ASP B OD1   1 
ATOM   3991 O OD2   . ASP B 1 244 ? 37.145  -7.553  -38.630 1.00 47.57 ? 282 ASP B OD2   1 
ATOM   3992 N N     . LYS B 1 245 ? 35.847  -5.313  -40.617 1.00 44.35 ? 283 LYS B N     1 
ATOM   3993 C CA    . LYS B 1 245 ? 35.823  -5.295  -42.075 1.00 44.03 ? 283 LYS B CA    1 
ATOM   3994 C C     . LYS B 1 245 ? 34.669  -4.432  -42.608 1.00 43.55 ? 283 LYS B C     1 
ATOM   3995 O O     . LYS B 1 245 ? 34.850  -3.666  -43.552 1.00 43.43 ? 283 LYS B O     1 
ATOM   3996 C CB    . LYS B 1 245 ? 35.761  -6.719  -42.641 1.00 44.14 ? 283 LYS B CB    1 
ATOM   3997 C CG    . LYS B 1 245 ? 36.248  -6.796  -44.058 1.00 45.02 ? 283 LYS B CG    1 
ATOM   3998 C CD    . LYS B 1 245 ? 35.790  -8.061  -44.780 1.00 47.93 ? 283 LYS B CD    1 
ATOM   3999 C CE    . LYS B 1 245 ? 35.802  -7.820  -46.278 1.00 47.92 ? 283 LYS B CE    1 
ATOM   4000 N NZ    . LYS B 1 245 ? 35.352  -8.994  -47.066 1.00 49.85 ? 283 LYS B NZ    1 
ATOM   4001 N N     . PHE B 1 246 ? 33.493  -4.549  -41.988 1.00 42.87 ? 284 PHE B N     1 
ATOM   4002 C CA    . PHE B 1 246 ? 32.340  -3.750  -42.363 1.00 42.64 ? 284 PHE B CA    1 
ATOM   4003 C C     . PHE B 1 246 ? 32.760  -2.291  -42.445 1.00 42.77 ? 284 PHE B C     1 
ATOM   4004 O O     . PHE B 1 246 ? 32.674  -1.673  -43.506 1.00 41.90 ? 284 PHE B O     1 
ATOM   4005 C CB    . PHE B 1 246 ? 31.213  -3.919  -41.334 1.00 42.90 ? 284 PHE B CB    1 
ATOM   4006 C CG    . PHE B 1 246 ? 30.023  -3.021  -41.565 1.00 42.48 ? 284 PHE B CG    1 
ATOM   4007 C CD1   . PHE B 1 246 ? 29.206  -3.200  -42.672 1.00 44.62 ? 284 PHE B CD1   1 
ATOM   4008 C CD2   . PHE B 1 246 ? 29.707  -2.011  -40.654 1.00 44.71 ? 284 PHE B CD2   1 
ATOM   4009 C CE1   . PHE B 1 246 ? 28.101  -2.371  -42.889 1.00 44.87 ? 284 PHE B CE1   1 
ATOM   4010 C CE2   . PHE B 1 246 ? 28.601  -1.177  -40.865 1.00 44.44 ? 284 PHE B CE2   1 
ATOM   4011 C CZ    . PHE B 1 246 ? 27.800  -1.369  -41.996 1.00 42.64 ? 284 PHE B CZ    1 
ATOM   4012 N N     . LEU B 1 247 ? 33.252  -1.768  -41.320 1.00 43.25 ? 285 LEU B N     1 
ATOM   4013 C CA    . LEU B 1 247 ? 33.670  -0.368  -41.209 1.00 44.36 ? 285 LEU B CA    1 
ATOM   4014 C C     . LEU B 1 247 ? 34.752  0.047   -42.188 1.00 45.16 ? 285 LEU B C     1 
ATOM   4015 O O     . LEU B 1 247 ? 34.756  1.182   -42.671 1.00 44.95 ? 285 LEU B O     1 
ATOM   4016 C CB    . LEU B 1 247 ? 34.149  -0.041  -39.796 1.00 44.65 ? 285 LEU B CB    1 
ATOM   4017 C CG    . LEU B 1 247 ? 33.249  0.855   -38.956 1.00 45.82 ? 285 LEU B CG    1 
ATOM   4018 C CD1   . LEU B 1 247 ? 34.075  1.420   -37.795 1.00 45.28 ? 285 LEU B CD1   1 
ATOM   4019 C CD2   . LEU B 1 247 ? 32.591  1.997   -39.750 1.00 46.97 ? 285 LEU B CD2   1 
ATOM   4020 N N     . GLN B 1 248 ? 35.676  -0.862  -42.468 1.00 46.24 ? 286 GLN B N     1 
ATOM   4021 C CA    . GLN B 1 248 ? 36.731  -0.532  -43.408 1.00 47.68 ? 286 GLN B CA    1 
ATOM   4022 C C     . GLN B 1 248 ? 36.202  -0.512  -44.833 1.00 48.34 ? 286 GLN B C     1 
ATOM   4023 O O     . GLN B 1 248 ? 36.623  0.319   -45.631 1.00 48.71 ? 286 GLN B O     1 
ATOM   4024 C CB    . GLN B 1 248 ? 37.948  -1.432  -43.246 1.00 47.87 ? 286 GLN B CB    1 
ATOM   4025 C CG    . GLN B 1 248 ? 39.244  -0.748  -43.700 1.00 49.75 ? 286 GLN B CG    1 
ATOM   4026 C CD    . GLN B 1 248 ? 39.679  0.440   -42.807 1.00 50.82 ? 286 GLN B CD    1 
ATOM   4027 O OE1   . GLN B 1 248 ? 40.400  1.344   -43.253 1.00 50.39 ? 286 GLN B OE1   1 
ATOM   4028 N NE2   . GLN B 1 248 ? 39.253  0.427   -41.553 1.00 50.91 ? 286 GLN B NE2   1 
ATOM   4029 N N     . CYS B 1 249 ? 35.266  -1.412  -45.137 1.00 49.70 ? 287 CYS B N     1 
ATOM   4030 C CA    . CYS B 1 249 ? 34.554  -1.393  -46.413 1.00 50.92 ? 287 CYS B CA    1 
ATOM   4031 C C     . CYS B 1 249 ? 33.765  -0.104  -46.582 1.00 50.81 ? 287 CYS B C     1 
ATOM   4032 O O     . CYS B 1 249 ? 33.690  0.438   -47.683 1.00 50.86 ? 287 CYS B O     1 
ATOM   4033 C CB    . CYS B 1 249 ? 33.605  -2.586  -46.548 1.00 51.59 ? 287 CYS B CB    1 
ATOM   4034 S SG    . CYS B 1 249 ? 34.402  -4.195  -46.812 1.00 56.02 ? 287 CYS B SG    1 
ATOM   4035 N N     . VAL B 1 250 ? 33.168  0.382   -45.496 1.00 50.76 ? 288 VAL B N     1 
ATOM   4036 C CA    . VAL B 1 250 ? 32.413  1.627   -45.553 1.00 51.18 ? 288 VAL B CA    1 
ATOM   4037 C C     . VAL B 1 250 ? 33.370  2.803   -45.797 1.00 52.22 ? 288 VAL B C     1 
ATOM   4038 O O     . VAL B 1 250 ? 33.085  3.685   -46.613 1.00 51.90 ? 288 VAL B O     1 
ATOM   4039 C CB    . VAL B 1 250 ? 31.546  1.841   -44.271 1.00 50.66 ? 288 VAL B CB    1 
ATOM   4040 C CG1   . VAL B 1 250 ? 30.703  3.085   -44.395 1.00 50.79 ? 288 VAL B CG1   1 
ATOM   4041 C CG2   . VAL B 1 250 ? 30.638  0.647   -44.041 1.00 49.49 ? 288 VAL B CG2   1 
ATOM   4042 N N     . LYS B 1 251 ? 34.506  2.788   -45.096 1.00 53.58 ? 289 LYS B N     1 
ATOM   4043 C CA    . LYS B 1 251 ? 35.558  3.791   -45.267 1.00 54.89 ? 289 LYS B CA    1 
ATOM   4044 C C     . LYS B 1 251 ? 36.137  3.748   -46.672 1.00 55.41 ? 289 LYS B C     1 
ATOM   4045 O O     . LYS B 1 251 ? 36.460  4.793   -47.225 1.00 56.02 ? 289 LYS B O     1 
ATOM   4046 C CB    . LYS B 1 251 ? 36.691  3.592   -44.249 1.00 54.95 ? 289 LYS B CB    1 
ATOM   4047 C CG    . LYS B 1 251 ? 36.319  3.830   -42.791 1.00 55.25 ? 289 LYS B CG    1 
ATOM   4048 C CD    . LYS B 1 251 ? 37.393  3.282   -41.850 1.00 55.75 ? 289 LYS B CD    1 
ATOM   4049 C CE    . LYS B 1 251 ? 36.913  3.230   -40.404 1.00 58.77 ? 289 LYS B CE    1 
ATOM   4050 N NZ    . LYS B 1 251 ? 37.904  2.538   -39.521 1.00 59.52 ? 289 LYS B NZ    1 
ATOM   4051 N N     . ASN B 1 252 ? 36.255  2.540   -47.232 1.00 55.89 ? 290 ASN B N     1 
ATOM   4052 C CA    . ASN B 1 252 ? 36.849  2.302   -48.552 1.00 56.49 ? 290 ASN B CA    1 
ATOM   4053 C C     . ASN B 1 252 ? 35.919  1.603   -49.540 1.00 56.77 ? 290 ASN B C     1 
ATOM   4054 O O     . ASN B 1 252 ? 36.038  0.393   -49.758 1.00 56.30 ? 290 ASN B O     1 
ATOM   4055 C CB    . ASN B 1 252 ? 38.138  1.487   -48.425 1.00 56.48 ? 290 ASN B CB    1 
ATOM   4056 C CG    . ASN B 1 252 ? 39.326  2.339   -48.077 1.00 57.39 ? 290 ASN B CG    1 
ATOM   4057 O OD1   . ASN B 1 252 ? 39.531  2.701   -46.914 1.00 58.03 ? 290 ASN B OD1   1 
ATOM   4058 N ND2   . ASN B 1 252 ? 40.130  2.667   -49.087 1.00 58.41 ? 290 ASN B ND2   1 
ATOM   4059 N N     . PRO B 1 253 ? 34.988  2.361   -50.146 1.00 57.49 ? 291 PRO B N     1 
ATOM   4060 C CA    . PRO B 1 253 ? 34.179  1.784   -51.208 1.00 58.26 ? 291 PRO B CA    1 
ATOM   4061 C C     . PRO B 1 253 ? 35.095  1.468   -52.383 1.00 58.86 ? 291 PRO B C     1 
ATOM   4062 O O     . PRO B 1 253 ? 36.218  1.985   -52.435 1.00 59.15 ? 291 PRO B O     1 
ATOM   4063 C CB    . PRO B 1 253 ? 33.211  2.918   -51.569 1.00 58.05 ? 291 PRO B CB    1 
ATOM   4064 C CG    . PRO B 1 253 ? 33.891  4.161   -51.134 1.00 58.42 ? 291 PRO B CG    1 
ATOM   4065 C CD    . PRO B 1 253 ? 34.642  3.776   -49.898 1.00 57.57 ? 291 PRO B CD    1 
ATOM   4066 N N     . GLU B 1 254 ? 34.626  0.642   -53.315 1.00 59.89 ? 292 GLU B N     1 
ATOM   4067 C CA    . GLU B 1 254 ? 35.473  0.132   -54.398 1.00 60.44 ? 292 GLU B CA    1 
ATOM   4068 C C     . GLU B 1 254 ? 36.605  -0.704  -53.780 1.00 61.02 ? 292 GLU B C     1 
ATOM   4069 O O     . GLU B 1 254 ? 37.695  -0.192  -53.471 1.00 61.03 ? 292 GLU B O     1 
ATOM   4070 C CB    . GLU B 1 254 ? 36.033  1.263   -55.282 1.00 60.51 ? 292 GLU B CB    1 
ATOM   4071 C CG    . GLU B 1 254 ? 35.006  2.262   -55.826 1.00 59.91 ? 292 GLU B CG    1 
ATOM   4072 C CD    . GLU B 1 254 ? 35.433  2.860   -57.165 1.00 58.96 ? 292 GLU B CD    1 
ATOM   4073 O OE1   . GLU B 1 254 ? 35.527  2.097   -58.150 1.00 57.81 ? 292 GLU B OE1   1 
ATOM   4074 O OE2   . GLU B 1 254 ? 35.661  4.089   -57.236 1.00 58.03 ? 292 GLU B OE2   1 
ATOM   4075 N N     . ASP B 1 255 ? 36.310  -1.988  -53.579 1.00 61.50 ? 293 ASP B N     1 
ATOM   4076 C CA    . ASP B 1 255 ? 37.191  -2.923  -52.883 1.00 61.79 ? 293 ASP B CA    1 
ATOM   4077 C C     . ASP B 1 255 ? 36.631  -4.329  -53.057 1.00 61.97 ? 293 ASP B C     1 
ATOM   4078 O O     . ASP B 1 255 ? 35.520  -4.621  -52.599 1.00 61.90 ? 293 ASP B O     1 
ATOM   4079 C CB    . ASP B 1 255 ? 37.277  -2.573  -51.394 1.00 61.75 ? 293 ASP B CB    1 
ATOM   4080 C CG    . ASP B 1 255 ? 38.573  -3.031  -50.760 1.00 61.99 ? 293 ASP B CG    1 
ATOM   4081 O OD1   . ASP B 1 255 ? 39.351  -2.155  -50.327 1.00 62.06 ? 293 ASP B OD1   1 
ATOM   4082 O OD2   . ASP B 1 255 ? 38.820  -4.257  -50.698 1.00 62.65 ? 293 ASP B OD2   1 
ATOM   4083 N N     . SER B 1 256 ? 37.401  -5.188  -53.725 1.00 62.23 ? 294 SER B N     1 
ATOM   4084 C CA    . SER B 1 256 ? 36.961  -6.543  -54.066 1.00 62.53 ? 294 SER B CA    1 
ATOM   4085 C C     . SER B 1 256 ? 36.353  -7.278  -52.870 1.00 62.61 ? 294 SER B C     1 
ATOM   4086 O O     . SER B 1 256 ? 35.164  -7.614  -52.885 1.00 62.53 ? 294 SER B O     1 
ATOM   4087 C CB    . SER B 1 256 ? 38.116  -7.353  -54.676 1.00 62.61 ? 294 SER B CB    1 
ATOM   4088 O OG    . SER B 1 256 ? 39.168  -7.539  -53.741 1.00 63.00 ? 294 SER B OG    1 
ATOM   4089 N N     . SER B 1 257 ? 37.170  -7.490  -51.836 1.00 62.81 ? 295 SER B N     1 
ATOM   4090 C CA    . SER B 1 257 ? 36.771  -8.194  -50.609 1.00 62.98 ? 295 SER B CA    1 
ATOM   4091 C C     . SER B 1 257 ? 35.322  -7.925  -50.190 1.00 62.96 ? 295 SER B C     1 
ATOM   4092 O O     . SER B 1 257 ? 34.600  -8.842  -49.795 1.00 63.05 ? 295 SER B O     1 
ATOM   4093 C CB    . SER B 1 257 ? 37.724  -7.840  -49.459 1.00 63.13 ? 295 SER B CB    1 
ATOM   4094 O OG    . SER B 1 257 ? 37.502  -6.518  -48.981 1.00 63.45 ? 295 SER B OG    1 
ATOM   4095 N N     . CYS B 1 258 ? 34.915  -6.663  -50.289 1.00 62.80 ? 296 CYS B N     1 
ATOM   4096 C CA    . CYS B 1 258 ? 33.575  -6.231  -49.925 1.00 62.59 ? 296 CYS B CA    1 
ATOM   4097 C C     . CYS B 1 258 ? 32.554  -6.590  -51.004 1.00 62.84 ? 296 CYS B C     1 
ATOM   4098 O O     . CYS B 1 258 ? 31.343  -6.480  -50.790 1.00 62.98 ? 296 CYS B O     1 
ATOM   4099 C CB    . CYS B 1 258 ? 33.579  -4.725  -49.685 1.00 62.31 ? 296 CYS B CB    1 
ATOM   4100 S SG    . CYS B 1 258 ? 35.025  -4.161  -48.753 1.00 61.27 ? 296 CYS B SG    1 
HETATM 4101 O O6    . G1R C 2 .   ? 7.013   -5.599  10.114  1.00 81.23 ? 301 G1R A O6    1 
HETATM 4102 C C6    . G1R C 2 .   ? 7.549   -4.488  10.070  1.00 81.50 ? 301 G1R A C6    1 
HETATM 4103 N N1    . G1R C 2 .   ? 8.436   -4.062  11.081  1.00 81.36 ? 301 G1R A N1    1 
HETATM 4104 C C2    . G1R C 2 .   ? 9.025   -2.783  10.979  1.00 81.49 ? 301 G1R A C2    1 
HETATM 4105 N N2    . G1R C 2 .   ? 9.869   -2.367  11.931  1.00 81.42 ? 301 G1R A N2    1 
HETATM 4106 N N3    . G1R C 2 .   ? 8.738   -1.981  9.927   1.00 81.70 ? 301 G1R A N3    1 
HETATM 4107 C C4    . G1R C 2 .   ? 7.889   -2.365  8.946   1.00 81.74 ? 301 G1R A C4    1 
HETATM 4108 C C5    . G1R C 2 .   ? 7.284   -3.626  9.008   1.00 81.86 ? 301 G1R A C5    1 
HETATM 4109 N N7    . G1R C 2 .   ? 6.506   -3.755  7.940   1.00 82.09 ? 301 G1R A N7    1 
HETATM 4110 C C8    . G1R C 2 .   ? 6.600   -2.632  7.233   1.00 81.47 ? 301 G1R A C8    1 
HETATM 4111 N N9    . G1R C 2 .   ? 7.437   -1.782  7.821   1.00 80.66 ? 301 G1R A N9    1 
HETATM 4112 C "C1'" . G1R C 2 .   ? 7.769   -0.567  7.362   1.00 79.10 ? 301 G1R A "C1'" 1 
HETATM 4113 O "O4'" . G1R C 2 .   ? 6.884   0.306   6.792   1.00 74.22 ? 301 G1R A "O4'" 1 
HETATM 4114 C "C2'" . G1R C 2 .   ? 9.190   0.001   7.330   1.00 75.74 ? 301 G1R A "C2'" 1 
HETATM 4115 O "O2'" . G1R C 2 .   ? 9.667   0.162   8.665   1.00 76.70 ? 301 G1R A "O2'" 1 
HETATM 4116 C "C3'" . G1R C 2 .   ? 8.980   1.373   6.703   1.00 73.47 ? 301 G1R A "C3'" 1 
HETATM 4117 O "O3'" . G1R C 2 .   ? 9.766   2.359   7.398   1.00 74.03 ? 301 G1R A "O3'" 1 
HETATM 4118 C "C4'" . G1R C 2 .   ? 7.484   1.626   6.926   1.00 70.21 ? 301 G1R A "C4'" 1 
HETATM 4119 C "C5'" . G1R C 2 .   ? 7.022   2.653   5.855   1.00 62.83 ? 301 G1R A "C5'" 1 
HETATM 4120 O "O5'" . G1R C 2 .   ? 5.867   3.447   6.252   1.00 51.21 ? 301 G1R A "O5'" 1 
HETATM 4121 P PA    . G1R C 2 .   ? 4.315   2.955   6.031   1.00 44.47 ? 301 G1R A PA    1 
HETATM 4122 O O1A   . G1R C 2 .   ? 3.558   3.097   7.293   1.00 45.78 ? 301 G1R A O1A   1 
HETATM 4123 O O2A   . G1R C 2 .   ? 4.296   1.638   5.283   1.00 43.88 ? 301 G1R A O2A   1 
HETATM 4124 O O3A   . G1R C 2 .   ? 3.736   4.079   5.054   1.00 38.64 ? 301 G1R A O3A   1 
HETATM 4125 P PB    . G1R C 2 .   ? 4.124   4.032   3.465   1.00 38.74 ? 301 G1R A PB    1 
HETATM 4126 O O2B   . G1R C 2 .   ? 3.591   5.377   2.903   1.00 29.07 ? 301 G1R A O2B   1 
HETATM 4127 O O1B   . G1R C 2 .   ? 5.566   3.532   3.338   1.00 35.61 ? 301 G1R A O1B   1 
HETATM 4128 O O5X   . G1R C 2 .   ? 3.125   2.838   2.889   1.00 38.15 ? 301 G1R A O5X   1 
HETATM 4129 C C5X   . G1R C 2 .   ? 1.647   3.046   2.876   1.00 32.93 ? 301 G1R A C5X   1 
HETATM 4130 C C4X   . G1R C 2 .   ? 1.037   3.556   1.538   1.00 31.73 ? 301 G1R A C4X   1 
HETATM 4131 O O4X   . G1R C 2 .   ? 1.562   2.830   0.425   1.00 33.63 ? 301 G1R A O4X   1 
HETATM 4132 C C1X   . G1R C 2 .   ? 0.741   1.630   0.255   1.00 33.20 ? 301 G1R A C1X   1 
HETATM 4133 C C2X   . G1R C 2 .   ? -0.657  1.993   0.702   1.00 30.76 ? 301 G1R A C2X   1 
HETATM 4134 O O2X   . G1R C 2 .   ? -1.338  2.319   -0.514  1.00 28.94 ? 301 G1R A O2X   1 
HETATM 4135 C C3X   . G1R C 2 .   ? -0.481  3.330   1.417   1.00 31.86 ? 301 G1R A C3X   1 
HETATM 4136 O O3X   . G1R C 2 .   ? -1.026  4.386   0.613   1.00 25.90 ? 301 G1R A O3X   1 
HETATM 4137 O O6    . G1R D 2 .   ? 1.650   0.316   0.722   1.00 32.36 ? 302 G1R A O6    1 
HETATM 4138 C C6    . G1R D 2 .   ? 1.749   -0.530  1.625   1.00 33.91 ? 302 G1R A C6    1 
HETATM 4139 N N1    . G1R D 2 .   ? 0.755   -1.235  2.145   1.00 33.63 ? 302 G1R A N1    1 
HETATM 4140 C C2    . G1R D 2 .   ? 0.997   -2.180  3.095   1.00 32.64 ? 302 G1R A C2    1 
HETATM 4141 N N2    . G1R D 2 .   ? -0.025  -2.822  3.621   1.00 29.26 ? 302 G1R A N2    1 
HETATM 4142 N N3    . G1R D 2 .   ? 2.225   -2.484  3.511   1.00 31.50 ? 302 G1R A N3    1 
HETATM 4143 C C4    . G1R D 2 .   ? 3.269   -1.818  2.973   1.00 33.19 ? 302 G1R A C4    1 
HETATM 4144 C C5    . G1R D 2 .   ? 3.042   -0.845  2.010   1.00 29.28 ? 302 G1R A C5    1 
HETATM 4145 N N7    . G1R D 2 .   ? 4.205   -0.358  1.630   1.00 31.30 ? 302 G1R A N7    1 
HETATM 4146 C C8    . G1R D 2 .   ? 5.147   -0.992  2.331   1.00 33.20 ? 302 G1R A C8    1 
HETATM 4147 N N9    . G1R D 2 .   ? 4.590   -1.915  3.146   1.00 35.26 ? 302 G1R A N9    1 
HETATM 4148 C "C1'" . G1R D 2 .   ? 5.309   -2.845  4.180   1.00 38.26 ? 302 G1R A "C1'" 1 
HETATM 4149 O "O4'" . G1R D 2 .   ? 6.109   -1.746  4.732   1.00 49.57 ? 302 G1R A "O4'" 1 
HETATM 4150 C "C2'" . G1R D 2 .   ? 6.411   -3.957  4.020   1.00 46.04 ? 302 G1R A "C2'" 1 
HETATM 4151 O "O2'" . G1R D 2 .   ? 6.250   -4.994  4.991   1.00 45.41 ? 302 G1R A "O2'" 1 
HETATM 4152 C "C3'" . G1R D 2 .   ? 7.716   -3.284  4.461   1.00 50.12 ? 302 G1R A "C3'" 1 
HETATM 4153 O "O3'" . G1R D 2 .   ? 8.900   -3.777  3.775   1.00 53.71 ? 302 G1R A "O3'" 1 
HETATM 4154 C "C4'" . G1R D 2 .   ? 7.420   -1.887  4.058   1.00 52.47 ? 302 G1R A "C4'" 1 
HETATM 4155 C "C5'" . G1R D 2 .   ? 7.466   -2.129  2.494   1.00 57.00 ? 302 G1R A "C5'" 1 
HETATM 4156 O "O5'" . G1R D 2 .   ? 8.386   -1.286  1.782   1.00 62.64 ? 302 G1R A "O5'" 1 
HETATM 4157 P PA    . G1R D 2 .   ? 9.947   -1.286  2.158   1.00 65.15 ? 302 G1R A PA    1 
HETATM 4158 O O1A   . G1R D 2 .   ? 10.707  -0.773  0.983   1.00 63.73 ? 302 G1R A O1A   1 
HETATM 4159 O O2A   . G1R D 2 .   ? 10.321  -2.585  2.780   1.00 64.53 ? 302 G1R A O2A   1 
HETATM 4160 O O3A   . G1R D 2 .   ? 9.944   -0.149  3.321   1.00 68.93 ? 302 G1R A O3A   1 
HETATM 4161 P PB    . G1R D 2 .   ? 9.338   1.300   2.980   1.00 72.33 ? 302 G1R A PB    1 
HETATM 4162 O O2B   . G1R D 2 .   ? 7.869   1.270   3.192   1.00 72.09 ? 302 G1R A O2B   1 
HETATM 4163 O O1B   . G1R D 2 .   ? 10.162  2.331   3.673   1.00 73.83 ? 302 G1R A O1B   1 
HETATM 4164 O O5X   . G1R D 2 .   ? 9.627   1.429   1.379   1.00 72.83 ? 302 G1R A O5X   1 
HETATM 4165 C C5X   . G1R D 2 .   ? 9.861   2.698   0.742   1.00 74.72 ? 302 G1R A C5X   1 
HETATM 4166 C C4X   . G1R D 2 .   ? 10.384  2.482   -0.683  1.00 76.55 ? 302 G1R A C4X   1 
HETATM 4167 O O4X   . G1R D 2 .   ? 9.378   1.823   -1.505  1.00 76.65 ? 302 G1R A O4X   1 
HETATM 4168 C C1X   . G1R D 2 .   ? 9.897   1.939   -2.850  1.00 76.90 ? 302 G1R A C1X   1 
HETATM 4169 O O1X   . G1R D 2 .   ? 10.939  0.940   -3.084  1.00 76.21 ? 302 G1R A O1X   1 
HETATM 4170 C C2X   . G1R D 2 .   ? 10.319  3.424   -2.925  1.00 76.96 ? 302 G1R A C2X   1 
HETATM 4171 O O2X   . G1R D 2 .   ? 11.396  3.665   -3.878  1.00 77.44 ? 302 G1R A O2X   1 
HETATM 4172 C C3X   . G1R D 2 .   ? 10.621  3.797   -1.431  1.00 77.02 ? 302 G1R A C3X   1 
HETATM 4173 O O3X   . G1R D 2 .   ? 11.952  4.293   -1.180  1.00 77.40 ? 302 G1R A O3X   1 
HETATM 4174 O O6    . G1R E 2 .   ? 18.263  6.977   -27.506 1.00 33.34 ? 301 G1R B O6    1 
HETATM 4175 C C6    . G1R E 2 .   ? 19.206  7.204   -26.750 1.00 35.78 ? 301 G1R B C6    1 
HETATM 4176 N N1    . G1R E 2 .   ? 20.361  7.784   -27.184 1.00 34.52 ? 301 G1R B N1    1 
HETATM 4177 C C2    . G1R E 2 .   ? 21.421  8.019   -26.313 1.00 33.36 ? 301 G1R B C2    1 
HETATM 4178 N N2    . G1R E 2 .   ? 22.467  8.588   -26.847 1.00 30.78 ? 301 G1R B N2    1 
HETATM 4179 N N3    . G1R E 2 .   ? 21.341  7.698   -24.989 1.00 30.22 ? 301 G1R B N3    1 
HETATM 4180 C C4    . G1R E 2 .   ? 20.180  7.125   -24.573 1.00 32.71 ? 301 G1R B C4    1 
HETATM 4181 C C5    . G1R E 2 .   ? 19.110  6.870   -25.431 1.00 31.69 ? 301 G1R B C5    1 
HETATM 4182 N N7    . G1R E 2 .   ? 18.118  6.300   -24.762 1.00 32.74 ? 301 G1R B N7    1 
HETATM 4183 C C8    . G1R E 2 .   ? 18.544  6.175   -23.497 1.00 34.67 ? 301 G1R B C8    1 
HETATM 4184 N N9    . G1R E 2 .   ? 19.787  6.680   -23.395 1.00 34.50 ? 301 G1R B N9    1 
HETATM 4185 C "C1'" . G1R E 2 .   ? 20.632  6.787   -22.220 1.00 37.61 ? 301 G1R B "C1'" 1 
HETATM 4186 O "O4'" . G1R E 2 .   ? 21.714  5.880   -22.376 1.00 44.21 ? 301 G1R B "O4'" 1 
HETATM 4187 C "C2'" . G1R E 2 .   ? 19.839  6.265   -21.030 1.00 44.69 ? 301 G1R B "C2'" 1 
HETATM 4188 O "O2'" . G1R E 2 .   ? 19.431  7.392   -20.256 1.00 47.39 ? 301 G1R B "O2'" 1 
HETATM 4189 C "C3'" . G1R E 2 .   ? 20.829  5.398   -20.261 1.00 48.36 ? 301 G1R B "C3'" 1 
HETATM 4190 O "O3'" . G1R E 2 .   ? 20.381  4.030   -20.356 1.00 49.09 ? 301 G1R B "O3'" 1 
HETATM 4191 C "C4'" . G1R E 2 .   ? 22.142  5.580   -21.025 1.00 49.76 ? 301 G1R B "C4'" 1 
HETATM 4192 C "C5'" . G1R E 2 .   ? 22.896  4.283   -21.138 1.00 57.33 ? 301 G1R B "C5'" 1 
HETATM 4193 O "O5'" . G1R E 2 .   ? 22.039  3.312   -21.756 1.00 66.96 ? 301 G1R B "O5'" 1 
HETATM 4194 P PA    . G1R E 2 .   ? 21.701  1.915   -21.018 1.00 73.69 ? 301 G1R B PA    1 
HETATM 4195 O O1A   . G1R E 2 .   ? 20.235  1.739   -21.014 1.00 73.21 ? 301 G1R B O1A   1 
HETATM 4196 O O2A   . G1R E 2 .   ? 22.429  1.826   -19.727 1.00 74.19 ? 301 G1R B O2A   1 
HETATM 4197 O O3A   . G1R E 2 .   ? 22.366  0.868   -22.084 1.00 76.82 ? 301 G1R B O3A   1 
HETATM 4198 P PB    . G1R E 2 .   ? 23.862  1.112   -22.694 1.00 80.93 ? 301 G1R B PB    1 
HETATM 4199 O O2B   . G1R E 2 .   ? 23.780  2.099   -23.813 1.00 80.30 ? 301 G1R B O2B   1 
HETATM 4200 O O1B   . G1R E 2 .   ? 24.794  1.351   -21.559 1.00 79.75 ? 301 G1R B O1B   1 
HETATM 4201 O O5X   . G1R E 2 .   ? 24.200  -0.339  -23.356 1.00 81.02 ? 301 G1R B O5X   1 
HETATM 4202 C C5X   . G1R E 2 .   ? 25.486  -0.979  -23.183 1.00 83.34 ? 301 G1R B C5X   1 
HETATM 4203 C C4X   . G1R E 2 .   ? 26.591  -0.368  -24.081 1.00 84.39 ? 301 G1R B C4X   1 
HETATM 4204 O O4X   . G1R E 2 .   ? 27.782  -1.180  -23.938 1.00 84.70 ? 301 G1R B O4X   1 
HETATM 4205 C C1X   . G1R E 2 .   ? 28.613  -0.923  -25.123 1.00 84.94 ? 301 G1R B C1X   1 
HETATM 4206 O O1X   . G1R E 2 .   ? 29.628  0.052   -24.819 1.00 85.10 ? 301 G1R B O1X   1 
HETATM 4207 C C2X   . G1R E 2 .   ? 27.649  -0.487  -26.258 1.00 84.89 ? 301 G1R B C2X   1 
HETATM 4208 O O2X   . G1R E 2 .   ? 28.000  0.803   -26.804 1.00 84.70 ? 301 G1R B O2X   1 
HETATM 4209 C C3X   . G1R E 2 .   ? 26.267  -0.446  -25.583 1.00 84.83 ? 301 G1R B C3X   1 
HETATM 4210 O O3X   . G1R E 2 .   ? 25.502  0.692   -26.029 1.00 84.61 ? 301 G1R B O3X   1 
HETATM 4211 O O6    . G2R F 3 .   ? 13.114  5.355   -20.173 1.00 86.36 ? 302 G2R B O6    1 
HETATM 4212 C C6    . G2R F 3 .   ? 14.254  4.894   -20.093 1.00 86.14 ? 302 G2R B C6    1 
HETATM 4213 N N1    . G2R F 3 .   ? 15.285  5.647   -19.528 1.00 85.98 ? 302 G2R B N1    1 
HETATM 4214 C C2    . G2R F 3 .   ? 16.568  5.106   -19.451 1.00 86.01 ? 302 G2R B C2    1 
HETATM 4215 N N2    . G2R F 3 .   ? 17.527  5.843   -18.905 1.00 85.91 ? 302 G2R B N2    1 
HETATM 4216 N N3    . G2R F 3 .   ? 16.808  3.860   -19.921 1.00 86.40 ? 302 G2R B N3    1 
HETATM 4217 C C4    . G2R F 3 .   ? 15.824  3.111   -20.478 1.00 86.22 ? 302 G2R B C4    1 
HETATM 4218 C C5    . G2R F 3 .   ? 14.533  3.621   -20.571 1.00 86.24 ? 302 G2R B C5    1 
HETATM 4219 N N7    . G2R F 3 .   ? 13.767  2.704   -21.150 1.00 86.34 ? 302 G2R B N7    1 
HETATM 4220 C C8    . G2R F 3 .   ? 14.531  1.653   -21.412 1.00 86.11 ? 302 G2R B C8    1 
HETATM 4221 N N9    . G2R F 3 .   ? 15.780  1.884   -21.013 1.00 85.97 ? 302 G2R B N9    1 
HETATM 4222 C "C1'" . G2R F 3 .   ? 16.917  0.903   -21.142 1.00 85.62 ? 302 G2R B "C1'" 1 
HETATM 4223 O "O4'" . G2R F 3 .   ? 17.582  1.027   -22.394 1.00 83.84 ? 302 G2R B "O4'" 1 
HETATM 4224 C "C2'" . G2R F 3 .   ? 16.515  -0.591  -21.166 1.00 84.89 ? 302 G2R B "C2'" 1 
HETATM 4225 O "O2'" . G2R F 3 .   ? 16.298  -1.076  -19.835 1.00 85.64 ? 302 G2R B "O2'" 1 
HETATM 4226 C "C3'" . G2R F 3 .   ? 17.767  -1.252  -21.756 1.00 83.74 ? 302 G2R B "C3'" 1 
HETATM 4227 O "O3'" . G2R F 3 .   ? 17.420  -2.174  -22.786 1.00 84.02 ? 302 G2R B "O3'" 1 
HETATM 4228 C "C4'" . G2R F 3 .   ? 18.544  -0.050  -22.332 1.00 82.28 ? 302 G2R B "C4'" 1 
HETATM 4229 C "C5'" . G2R F 3 .   ? 19.187  -0.089  -23.724 1.00 79.28 ? 302 G2R B "C5'" 1 
HETATM 4230 O "O5'" . G2R F 3 .   ? 19.667  1.242   -23.953 1.00 74.59 ? 302 G2R B "O5'" 1 
HETATM 4231 P PA    . G2R F 3 .   ? 20.686  1.687   -25.102 1.00 71.37 ? 302 G2R B PA    1 
HETATM 4232 O O1A   . G2R F 3 .   ? 21.766  0.689   -25.247 1.00 71.52 ? 302 G2R B O1A   1 
HETATM 4233 O O2A   . G2R F 3 .   ? 21.032  3.109   -24.824 1.00 70.36 ? 302 G2R B O2A   1 
HETATM 4234 O O3A   . G2R F 3 .   ? 19.793  1.563   -26.437 1.00 66.66 ? 302 G2R B O3A   1 
HETATM 4235 P PB    . G2R F 3 .   ? 18.253  2.058   -26.485 1.00 63.97 ? 302 G2R B PB    1 
HETATM 4236 O O2B   . G2R F 3 .   ? 17.549  1.244   -27.515 1.00 61.66 ? 302 G2R B O2B   1 
HETATM 4237 O O1B   . G2R F 3 .   ? 17.703  2.154   -25.101 1.00 61.41 ? 302 G2R B O1B   1 
HETATM 4238 O O5X   . G2R F 3 .   ? 18.405  3.567   -27.075 1.00 60.11 ? 302 G2R B O5X   1 
HETATM 4239 C C5X   . G2R F 3 .   ? 19.059  3.813   -28.357 1.00 55.62 ? 302 G2R B C5X   1 
HETATM 4240 C C4X   . G2R F 3 .   ? 18.088  4.168   -29.502 1.00 52.35 ? 302 G2R B C4X   1 
HETATM 4241 O O4X   . G2R F 3 .   ? 17.057  5.043   -29.046 1.00 52.77 ? 302 G2R B O4X   1 
HETATM 4242 C C1X   . G2R F 3 .   ? 17.355  6.399   -29.444 1.00 51.78 ? 302 G2R B C1X   1 
HETATM 4243 C C2X   . G2R F 3 .   ? 18.458  6.360   -30.490 1.00 49.80 ? 302 G2R B C2X   1 
HETATM 4244 O O2X   . G2R F 3 .   ? 17.911  6.931   -31.684 1.00 50.30 ? 302 G2R B O2X   1 
HETATM 4245 C C3X   . G2R F 3 .   ? 18.728  4.882   -30.708 1.00 50.31 ? 302 G2R B C3X   1 
HETATM 4246 O O3X   . G2R F 3 .   ? 18.066  4.471   -31.918 1.00 43.05 ? 302 G2R B O3X   1 
HETATM 4247 O O     . HOH G 4 .   ? -9.772  8.765   -5.525  1.00 16.78 ? 303 HOH A O     1 
HETATM 4248 O O     . HOH G 4 .   ? -4.116  2.607   0.369   1.00 19.23 ? 304 HOH A O     1 
HETATM 4249 O O     . HOH G 4 .   ? -4.001  8.499   -10.999 1.00 18.40 ? 305 HOH A O     1 
HETATM 4250 O O     . HOH G 4 .   ? -10.820 9.571   -2.426  1.00 18.10 ? 306 HOH A O     1 
HETATM 4251 O O     . HOH G 4 .   ? 2.389   17.116  -14.369 1.00 20.49 ? 307 HOH A O     1 
HETATM 4252 O O     . HOH G 4 .   ? 13.819  -14.678 -3.373  1.00 24.19 ? 308 HOH A O     1 
HETATM 4253 O O     . HOH G 4 .   ? -16.697 3.893   5.572   1.00 25.60 ? 309 HOH A O     1 
HETATM 4254 O O     . HOH G 4 .   ? -14.001 12.008  -13.476 1.00 26.92 ? 310 HOH A O     1 
HETATM 4255 O O     . HOH G 4 .   ? 2.490   -5.041  5.089   1.00 27.98 ? 311 HOH A O     1 
HETATM 4256 O O     . HOH G 4 .   ? 6.801   20.191  -12.285 1.00 24.39 ? 312 HOH A O     1 
HETATM 4257 O O     . HOH G 4 .   ? -10.920 13.926  -13.444 1.00 28.46 ? 313 HOH A O     1 
HETATM 4258 O O     . HOH G 4 .   ? 4.389   -12.813 -10.567 1.00 30.26 ? 314 HOH A O     1 
HETATM 4259 O O     . HOH G 4 .   ? 11.665  -9.779  1.300   1.00 27.14 ? 315 HOH A O     1 
HETATM 4260 O O     . HOH G 4 .   ? -16.919 5.248   -8.883  1.00 25.63 ? 316 HOH A O     1 
HETATM 4261 O O     . HOH G 4 .   ? 8.300   12.882  -2.959  1.00 26.89 ? 317 HOH A O     1 
HETATM 4262 O O     . HOH G 4 .   ? 2.681   10.100  8.339   1.00 28.07 ? 318 HOH A O     1 
HETATM 4263 O O     . HOH G 4 .   ? 12.223  -8.478  3.529   1.00 32.18 ? 319 HOH A O     1 
HETATM 4264 O O     . HOH G 4 .   ? -5.935  -6.796  -6.986  1.00 28.75 ? 320 HOH A O     1 
HETATM 4265 O O     . HOH G 4 .   ? -6.165  20.025  -10.523 1.00 27.37 ? 321 HOH A O     1 
HETATM 4266 O O     . HOH G 4 .   ? 13.943  -20.145 -3.347  1.00 28.69 ? 322 HOH A O     1 
HETATM 4267 O O     . HOH G 4 .   ? 4.121   -6.960  3.681   1.00 31.42 ? 323 HOH A O     1 
HETATM 4268 O O     . HOH G 4 .   ? -13.944 -0.284  1.355   1.00 33.28 ? 324 HOH A O     1 
HETATM 4269 O O     . HOH G 4 .   ? 3.741   24.689  -0.180  1.00 27.76 ? 325 HOH A O     1 
HETATM 4270 O O     . HOH G 4 .   ? -5.077  -8.996  4.714   1.00 32.56 ? 326 HOH A O     1 
HETATM 4271 O O     . HOH G 4 .   ? -5.561  -6.380  5.092   1.00 36.04 ? 327 HOH A O     1 
HETATM 4272 O O     . HOH G 4 .   ? -16.186 3.599   -10.788 1.00 32.90 ? 328 HOH A O     1 
HETATM 4273 O O     . HOH G 4 .   ? -6.486  23.045  2.386   1.00 36.48 ? 329 HOH A O     1 
HETATM 4274 O O     . HOH G 4 .   ? 4.039   19.286  -14.998 1.00 27.71 ? 330 HOH A O     1 
HETATM 4275 O O     . HOH G 4 .   ? 19.186  -16.881 7.739   1.00 37.67 ? 331 HOH A O     1 
HETATM 4276 O O     . HOH G 4 .   ? -2.323  -2.579  -7.632  1.00 35.09 ? 332 HOH A O     1 
HETATM 4277 O O     . HOH G 4 .   ? -13.637 3.921   -11.585 1.00 31.88 ? 333 HOH A O     1 
HETATM 4278 O O     . HOH G 4 .   ? 0.957   16.565  -16.607 1.00 32.38 ? 334 HOH A O     1 
HETATM 4279 O O     . HOH G 4 .   ? 3.548   25.561  -2.875  1.00 37.72 ? 335 HOH A O     1 
HETATM 4280 O O     . HOH G 4 .   ? -14.414 -0.053  11.721  1.00 30.10 ? 336 HOH A O     1 
HETATM 4281 O O     . HOH G 4 .   ? -2.872  -5.612  -11.129 1.00 41.81 ? 337 HOH A O     1 
HETATM 4282 O O     . HOH G 4 .   ? 20.324  -16.120 -1.498  1.00 38.10 ? 338 HOH A O     1 
HETATM 4283 O O     . HOH G 4 .   ? 24.767  -3.251  5.738   1.00 33.16 ? 339 HOH A O     1 
HETATM 4284 O O     . HOH G 4 .   ? -13.009 15.383  1.074   1.00 37.54 ? 340 HOH A O     1 
HETATM 4285 O O     . HOH G 4 .   ? 6.438   6.799   -12.711 1.00 31.40 ? 341 HOH A O     1 
HETATM 4286 O O     . HOH G 4 .   ? -4.787  -1.303  -8.619  1.00 36.81 ? 342 HOH A O     1 
HETATM 4287 O O     . HOH G 4 .   ? -3.776  -4.351  -6.102  1.00 34.05 ? 343 HOH A O     1 
HETATM 4288 O O     . HOH G 4 .   ? -3.666  1.178   -12.575 1.00 36.85 ? 344 HOH A O     1 
HETATM 4289 O O     . HOH G 4 .   ? 8.621   -0.771  -1.009  1.00 35.25 ? 345 HOH A O     1 
HETATM 4290 O O     . HOH G 4 .   ? -11.291 16.360  14.839  1.00 49.64 ? 346 HOH A O     1 
HETATM 4291 O O     . HOH G 4 .   ? 11.204  -5.634  3.019   1.00 35.04 ? 347 HOH A O     1 
HETATM 4292 O O     . HOH G 4 .   ? 4.435   10.083  4.524   1.00 32.64 ? 348 HOH A O     1 
HETATM 4293 O O     . HOH G 4 .   ? -2.833  23.394  -4.698  1.00 31.39 ? 349 HOH A O     1 
HETATM 4294 O O     . HOH G 4 .   ? -11.783 11.239  -14.708 1.00 42.07 ? 350 HOH A O     1 
HETATM 4295 O O     . HOH G 4 .   ? -1.545  23.008  3.727   1.00 37.39 ? 351 HOH A O     1 
HETATM 4296 O O     . HOH G 4 .   ? 10.228  -27.378 -4.977  1.00 33.01 ? 352 HOH A O     1 
HETATM 4297 O O     . HOH G 4 .   ? 1.920   10.582  -13.740 1.00 40.86 ? 353 HOH A O     1 
HETATM 4298 O O     . HOH G 4 .   ? 10.220  -24.138 1.550   1.00 33.39 ? 354 HOH A O     1 
HETATM 4299 O O     . HOH G 4 .   ? -4.256  21.954  -10.563 1.00 33.22 ? 355 HOH A O     1 
HETATM 4300 O O     . HOH G 4 .   ? -13.332 19.026  -5.803  1.00 38.01 ? 356 HOH A O     1 
HETATM 4301 O O     . HOH G 4 .   ? 7.775   -14.184 -12.343 1.00 40.09 ? 357 HOH A O     1 
HETATM 4302 O O     . HOH G 4 .   ? -1.112  18.256  -16.420 1.00 40.48 ? 358 HOH A O     1 
HETATM 4303 O O     . HOH G 4 .   ? -14.149 5.746   17.745  1.00 32.79 ? 359 HOH A O     1 
HETATM 4304 O O     . HOH G 4 .   ? -4.373  -14.427 7.524   1.00 42.18 ? 360 HOH A O     1 
HETATM 4305 O O     . HOH G 4 .   ? 14.072  -21.648 6.075   1.00 37.67 ? 361 HOH A O     1 
HETATM 4306 O O     . HOH G 4 .   ? 7.569   4.908   -9.502  1.00 35.83 ? 362 HOH A O     1 
HETATM 4307 O O     . HOH G 4 .   ? -8.233  21.632  9.433   1.00 36.81 ? 363 HOH A O     1 
HETATM 4308 O O     . HOH G 4 .   ? 17.777  -16.023 1.202   1.00 29.99 ? 364 HOH A O     1 
HETATM 4309 O O     . HOH G 4 .   ? 5.430   -20.978 -9.942  1.00 43.75 ? 365 HOH A O     1 
HETATM 4310 O O     . HOH G 4 .   ? 0.688   2.351   10.078  1.00 42.42 ? 366 HOH A O     1 
HETATM 4311 O O     . HOH G 4 .   ? 10.817  -26.473 0.280   1.00 33.52 ? 367 HOH A O     1 
HETATM 4312 O O     . HOH G 4 .   ? 6.778   23.023  -12.369 1.00 37.79 ? 368 HOH A O     1 
HETATM 4313 O O     . HOH G 4 .   ? 9.100   24.119  -2.954  1.00 34.15 ? 369 HOH A O     1 
HETATM 4314 O O     . HOH G 4 .   ? -10.025 -19.094 3.166   1.00 39.35 ? 370 HOH A O     1 
HETATM 4315 O O     . HOH G 4 .   ? -12.375 -6.044  -11.446 1.00 41.31 ? 371 HOH A O     1 
HETATM 4316 O O     . HOH G 4 .   ? -6.443  -10.604 6.577   1.00 50.80 ? 372 HOH A O     1 
HETATM 4317 O O     . HOH G 4 .   ? -18.152 6.863   -1.165  1.00 38.05 ? 373 HOH A O     1 
HETATM 4318 O O     . HOH G 4 .   ? 8.478   23.305  3.805   1.00 31.19 ? 374 HOH A O     1 
HETATM 4319 O O     . HOH G 4 .   ? 14.222  -29.528 -0.530  1.00 36.63 ? 375 HOH A O     1 
HETATM 4320 O O     . HOH G 4 .   ? 12.755  -28.484 1.260   1.00 39.90 ? 376 HOH A O     1 
HETATM 4321 O O     . HOH G 4 .   ? 5.760   9.528   8.717   1.00 39.44 ? 377 HOH A O     1 
HETATM 4322 O O     . HOH G 4 .   ? -9.642  -2.561  5.130   1.00 44.53 ? 378 HOH A O     1 
HETATM 4323 O O     . HOH G 4 .   ? 5.599   -15.877 -11.789 1.00 41.33 ? 379 HOH A O     1 
HETATM 4324 O O     . HOH G 4 .   ? -0.394  -27.433 7.780   1.00 48.93 ? 380 HOH A O     1 
HETATM 4325 O O     . HOH G 4 .   ? 11.405  7.648   -6.063  1.00 50.24 ? 381 HOH A O     1 
HETATM 4326 O O     . HOH G 4 .   ? 7.035   1.748   -9.357  1.00 51.77 ? 382 HOH A O     1 
HETATM 4327 O O     . HOH G 4 .   ? 9.658   14.110  3.904   1.00 46.16 ? 383 HOH A O     1 
HETATM 4328 O O     . HOH G 4 .   ? 21.840  -23.517 16.126  1.00 51.74 ? 384 HOH A O     1 
HETATM 4329 O O     . HOH G 4 .   ? -0.159  -18.763 -12.320 1.00 39.89 ? 385 HOH A O     1 
HETATM 4330 O O     . HOH G 4 .   ? -19.570 7.740   0.714   1.00 41.79 ? 386 HOH A O     1 
HETATM 4331 O O     . HOH G 4 .   ? -14.913 -3.346  4.141   1.00 34.43 ? 387 HOH A O     1 
HETATM 4332 O O     . HOH G 4 .   ? 13.964  -16.456 12.170  1.00 38.78 ? 388 HOH A O     1 
HETATM 4333 O O     . HOH G 4 .   ? 3.912   21.737  -13.815 1.00 37.49 ? 389 HOH A O     1 
HETATM 4334 O O     . HOH G 4 .   ? 12.080  -26.499 -2.171  1.00 39.46 ? 390 HOH A O     1 
HETATM 4335 O O     . HOH G 4 .   ? -13.733 0.994   14.335  1.00 41.49 ? 391 HOH A O     1 
HETATM 4336 O O     . HOH G 4 .   ? 2.205   23.097  12.733  1.00 48.27 ? 392 HOH A O     1 
HETATM 4337 O O     . HOH G 4 .   ? 12.013  -1.917  -3.786  1.00 38.26 ? 393 HOH A O     1 
HETATM 4338 O O     . HOH G 4 .   ? 15.198  11.000  0.405   1.00 45.27 ? 394 HOH A O     1 
HETATM 4339 O O     . HOH G 4 .   ? 14.964  -26.915 -4.829  1.00 41.21 ? 395 HOH A O     1 
HETATM 4340 O O     . HOH G 4 .   ? 7.572   -23.844 1.892   1.00 42.34 ? 396 HOH A O     1 
HETATM 4341 O O     . HOH G 4 .   ? 8.455   -13.282 9.946   1.00 41.61 ? 397 HOH A O     1 
HETATM 4342 O O     . HOH G 4 .   ? 2.847   12.719  -15.632 1.00 42.90 ? 398 HOH A O     1 
HETATM 4343 O O     . HOH G 4 .   ? -21.201 8.526   7.894   1.00 43.93 ? 399 HOH A O     1 
HETATM 4344 O O     . HOH G 4 .   ? 2.636   6.308   -13.862 1.00 50.78 ? 400 HOH A O     1 
HETATM 4345 O O     . HOH G 4 .   ? -3.511  3.655   12.757  1.00 45.03 ? 401 HOH A O     1 
HETATM 4346 O O     . HOH G 4 .   ? -2.510  24.566  -2.291  1.00 49.70 ? 402 HOH A O     1 
HETATM 4347 O O     . HOH G 4 .   ? 11.600  10.321  -2.825  1.00 50.22 ? 403 HOH A O     1 
HETATM 4348 O O     . HOH G 4 .   ? -21.182 0.250   9.820   1.00 49.74 ? 404 HOH A O     1 
HETATM 4349 O O     . HOH G 4 .   ? -7.942  -5.251  4.739   1.00 47.14 ? 405 HOH A O     1 
HETATM 4350 O O     . HOH G 4 .   ? -0.166  10.552  -16.226 1.00 41.56 ? 406 HOH A O     1 
HETATM 4351 O O     . HOH G 4 .   ? 12.314  -8.971  6.355   1.00 41.61 ? 407 HOH A O     1 
HETATM 4352 O O     . HOH G 4 .   ? 10.501  -18.499 -9.876  1.00 42.48 ? 408 HOH A O     1 
HETATM 4353 O O     . HOH G 4 .   ? 18.746  -19.387 5.597   1.00 54.52 ? 409 HOH A O     1 
HETATM 4354 O O     . HOH G 4 .   ? -7.366  -13.951 -12.657 1.00 44.88 ? 410 HOH A O     1 
HETATM 4355 O O     . HOH G 4 .   ? 6.711   16.630  10.271  1.00 42.98 ? 411 HOH A O     1 
HETATM 4356 O O     . HOH G 4 .   ? 2.184   -1.832  6.904   1.00 44.35 ? 412 HOH A O     1 
HETATM 4357 O O     . HOH G 4 .   ? 18.163  -14.371 -9.030  1.00 41.53 ? 413 HOH A O     1 
HETATM 4358 O O     . HOH G 4 .   ? 16.591  -5.962  -9.211  1.00 43.05 ? 414 HOH A O     1 
HETATM 4359 O O     . HOH G 4 .   ? 5.737   -16.040 11.247  1.00 45.23 ? 415 HOH A O     1 
HETATM 4360 O O     . HOH G 4 .   ? 6.894   1.219   -1.737  1.00 51.26 ? 416 HOH A O     1 
HETATM 4361 O O     . HOH G 4 .   ? -21.866 -2.066  -2.717  1.00 45.17 ? 417 HOH A O     1 
HETATM 4362 O O     . HOH G 4 .   ? -21.674 2.646   17.419  1.00 54.20 ? 418 HOH A O     1 
HETATM 4363 O O     . HOH G 4 .   ? 4.376   -17.287 -13.816 1.00 51.22 ? 419 HOH A O     1 
HETATM 4364 O O     . HOH G 4 .   ? 16.075  -23.681 -8.183  1.00 54.35 ? 420 HOH A O     1 
HETATM 4365 O O     . HOH G 4 .   ? -12.912 -1.439  3.586   1.00 35.51 ? 421 HOH A O     1 
HETATM 4366 O O     . HOH G 4 .   ? 8.892   -23.960 -2.718  1.00 44.65 ? 422 HOH A O     1 
HETATM 4367 O O     . HOH G 4 .   ? -2.765  24.542  -7.063  1.00 47.87 ? 423 HOH A O     1 
HETATM 4368 O O     . HOH G 4 .   ? -0.308  -14.269 -14.962 1.00 47.11 ? 424 HOH A O     1 
HETATM 4369 O O     . HOH G 4 .   ? -1.679  1.830   12.184  1.00 55.14 ? 425 HOH A O     1 
HETATM 4370 O O     . HOH G 4 .   ? -18.146 2.478   -1.655  1.00 55.76 ? 426 HOH A O     1 
HETATM 4371 O O     . HOH G 4 .   ? 5.704   -9.818  8.160   1.00 49.86 ? 427 HOH A O     1 
HETATM 4372 O O     . HOH G 4 .   ? 15.500  -6.978  11.858  1.00 49.46 ? 428 HOH A O     1 
HETATM 4373 O O     . HOH G 4 .   ? -3.599  -8.396  7.379   1.00 50.00 ? 429 HOH A O     1 
HETATM 4374 O O     . HOH G 4 .   ? -8.129  -10.305 -12.446 1.00 43.94 ? 430 HOH A O     1 
HETATM 4375 O O     . HOH G 4 .   ? -5.088  -2.574  9.790   1.00 45.59 ? 431 HOH A O     1 
HETATM 4376 O O     . HOH G 4 .   ? 11.686  -24.057 3.576   1.00 50.25 ? 432 HOH A O     1 
HETATM 4377 O O     . HOH G 4 .   ? 21.791  -12.928 12.977  1.00 57.00 ? 433 HOH A O     1 
HETATM 4378 O O     . HOH G 4 .   ? -0.071  15.280  16.859  1.00 49.61 ? 434 HOH A O     1 
HETATM 4379 O O     . HOH G 4 .   ? -12.878 -18.552 3.211   1.00 45.53 ? 435 HOH A O     1 
HETATM 4380 O O     . HOH G 4 .   ? -11.287 -7.632  -13.138 1.00 55.32 ? 436 HOH A O     1 
HETATM 4381 O O     . HOH G 4 .   ? 1.349   13.875  -17.276 1.00 40.81 ? 437 HOH A O     1 
HETATM 4382 O O     . HOH G 4 .   ? -7.261  16.567  -17.765 1.00 36.69 ? 438 HOH A O     1 
HETATM 4383 O O     . HOH G 4 .   ? 9.452   -6.147  4.922   1.00 52.28 ? 439 HOH A O     1 
HETATM 4384 O O     . HOH G 4 .   ? 12.747  -4.602  4.814   1.00 41.36 ? 440 HOH A O     1 
HETATM 4385 O O     . HOH G 4 .   ? 22.546  -16.566 0.900   1.00 55.70 ? 441 HOH A O     1 
HETATM 4386 O O     . HOH G 4 .   ? 7.051   -23.308 -1.189  1.00 54.73 ? 442 HOH A O     1 
HETATM 4387 O O     . HOH G 4 .   ? 4.228   20.739  13.083  1.00 46.42 ? 443 HOH A O     1 
HETATM 4388 O O     . HOH G 4 .   ? -1.954  23.087  -9.017  1.00 48.38 ? 444 HOH A O     1 
HETATM 4389 O O     . HOH G 4 .   ? 23.649  -7.977  3.281   1.00 48.86 ? 445 HOH A O     1 
HETATM 4390 O O     . HOH G 4 .   ? 3.436   -1.197  -11.210 1.00 41.19 ? 446 HOH A O     1 
HETATM 4391 O O     . HOH G 4 .   ? -2.460  -3.270  -11.628 1.00 53.77 ? 447 HOH A O     1 
HETATM 4392 O O     . HOH G 4 .   ? -26.582 8.392   13.319  1.00 54.00 ? 448 HOH A O     1 
HETATM 4393 O O     . HOH G 4 .   ? -16.272 4.292   17.241  1.00 40.48 ? 449 HOH A O     1 
HETATM 4394 O O     . HOH G 4 .   ? -3.035  19.618  22.643  1.00 56.13 ? 450 HOH A O     1 
HETATM 4395 O O     . HOH G 4 .   ? 3.876   16.156  14.909  1.00 60.01 ? 451 HOH A O     1 
HETATM 4396 O O     . HOH G 4 .   ? -14.811 -2.318  -0.011  1.00 52.72 ? 452 HOH A O     1 
HETATM 4397 O O     . HOH G 4 .   ? -6.612  -1.049  -10.423 1.00 55.46 ? 453 HOH A O     1 
HETATM 4398 O O     . HOH G 4 .   ? -15.607 -4.404  1.702   1.00 45.97 ? 454 HOH A O     1 
HETATM 4399 O O     . HOH G 4 .   ? -14.974 1.232   -11.701 1.00 60.10 ? 455 HOH A O     1 
HETATM 4400 O O     . HOH G 4 .   ? 0.628   25.825  -3.972  1.00 56.51 ? 456 HOH A O     1 
HETATM 4401 O O     . HOH G 4 .   ? -0.817  25.900  14.896  1.00 53.63 ? 457 HOH A O     1 
HETATM 4402 O O     . HOH G 4 .   ? -4.567  -22.588 2.626   1.00 42.80 ? 458 HOH A O     1 
HETATM 4403 O O     . HOH G 4 .   ? -5.520  -3.799  -11.994 1.00 51.65 ? 459 HOH A O     1 
HETATM 4404 O O     . HOH G 4 .   ? -6.428  13.100  19.704  1.00 53.02 ? 460 HOH A O     1 
HETATM 4405 O O     . HOH G 4 .   ? 4.618   -23.813 -1.726  1.00 42.60 ? 461 HOH A O     1 
HETATM 4406 O O     . HOH G 4 .   ? -13.419 5.339   -14.103 1.00 44.80 ? 462 HOH A O     1 
HETATM 4407 O O     . HOH G 4 .   ? 4.607   24.340  -11.691 1.00 55.95 ? 463 HOH A O     1 
HETATM 4408 O O     . HOH G 4 .   ? -7.164  -22.492 1.338   1.00 44.01 ? 464 HOH A O     1 
HETATM 4409 O O     . HOH G 4 .   ? 1.667   -12.732 -17.848 1.00 65.65 ? 465 HOH A O     1 
HETATM 4410 O O     . HOH G 4 .   ? -1.569  27.377  0.358   1.00 46.51 ? 466 HOH A O     1 
HETATM 4411 O O     . HOH G 4 .   ? 9.464   -17.810 9.830   1.00 45.00 ? 467 HOH A O     1 
HETATM 4412 O O     . HOH G 4 .   ? -4.350  9.200   16.957  1.00 53.98 ? 468 HOH A O     1 
HETATM 4413 O O     . HOH G 4 .   ? 12.969  -6.428  6.831   1.00 53.89 ? 469 HOH A O     1 
HETATM 4414 O O     . HOH G 4 .   ? 18.958  -5.091  -4.080  1.00 65.80 ? 470 HOH A O     1 
HETATM 4415 O O     . HOH G 4 .   ? -7.498  23.694  -4.704  1.00 68.23 ? 471 HOH A O     1 
HETATM 4416 O O     . HOH G 4 .   ? -18.325 -7.726  -0.792  1.00 49.08 ? 472 HOH A O     1 
HETATM 4417 O O     . HOH G 4 .   ? -3.143  -24.688 2.399   1.00 47.17 ? 473 HOH A O     1 
HETATM 4418 O O     . HOH G 4 .   ? 10.592  28.248  -10.687 1.00 51.68 ? 474 HOH A O     1 
HETATM 4419 O O     . HOH G 4 .   ? 7.431   3.775   9.244   1.00 75.52 ? 475 HOH A O     1 
HETATM 4420 O O     . HOH G 4 .   ? 3.523   -4.477  7.496   1.00 50.51 ? 476 HOH A O     1 
HETATM 4421 O O     . HOH G 4 .   ? 8.359   -20.313 10.621  1.00 56.10 ? 477 HOH A O     1 
HETATM 4422 O O     . HOH G 4 .   ? -12.780 -5.021  1.186   1.00 56.63 ? 478 HOH A O     1 
HETATM 4423 O O     . HOH G 4 .   ? 0.952   -16.595 -14.943 1.00 51.62 ? 479 HOH A O     1 
HETATM 4424 O O     . HOH G 4 .   ? -1.096  15.432  -20.190 1.00 55.79 ? 480 HOH A O     1 
HETATM 4425 O O     . HOH G 4 .   ? -17.262 -0.918  11.934  1.00 45.69 ? 481 HOH A O     1 
HETATM 4426 O O     . HOH G 4 .   ? -3.314  23.832  0.029   1.00 54.19 ? 482 HOH A O     1 
HETATM 4427 O O     . HOH G 4 .   ? 6.068   25.389  7.596   1.00 48.35 ? 483 HOH A O     1 
HETATM 4428 O O     . HOH G 4 .   ? -10.252 -5.447  -14.342 1.00 71.11 ? 484 HOH A O     1 
HETATM 4429 O O     . HOH G 4 .   ? 20.109  -15.706 15.527  1.00 65.47 ? 485 HOH A O     1 
HETATM 4430 O O     . HOH G 4 .   ? 19.704  -18.145 1.387   1.00 48.08 ? 486 HOH A O     1 
HETATM 4431 O O     . HOH G 4 .   ? 8.005   -12.843 -15.152 1.00 56.53 ? 487 HOH A O     1 
HETATM 4432 O O     . HOH G 4 .   ? -1.546  -4.293  -9.288  1.00 56.12 ? 488 HOH A O     1 
HETATM 4433 O O     . HOH G 4 .   ? 7.770   -21.230 -8.486  1.00 50.70 ? 489 HOH A O     1 
HETATM 4434 O O     . HOH G 4 .   ? -9.700  21.480  3.476   1.00 58.37 ? 490 HOH A O     1 
HETATM 4435 O O     . HOH G 4 .   ? -18.848 -17.257 -3.091  1.00 58.08 ? 491 HOH A O     1 
HETATM 4436 O O     . HOH G 4 .   ? 11.902  -22.728 -9.148  1.00 59.65 ? 492 HOH A O     1 
HETATM 4437 O O     . HOH G 4 .   ? -13.014 -3.713  -1.800  1.00 40.26 ? 493 HOH A O     1 
HETATM 4438 O O     . HOH G 4 .   ? 13.041  11.229  4.892   1.00 63.08 ? 494 HOH A O     1 
HETATM 4439 O O     . HOH G 4 .   ? -0.853  -2.017  -16.369 1.00 67.25 ? 495 HOH A O     1 
HETATM 4440 O O     . HOH G 4 .   ? -13.061 -3.514  -6.741  1.00 50.91 ? 496 HOH A O     1 
HETATM 4441 O O     . HOH G 4 .   ? 0.178   -25.207 -2.509  1.00 62.57 ? 497 HOH A O     1 
HETATM 4442 O O     . HOH G 4 .   ? -9.992  -2.515  10.630  1.00 54.23 ? 498 HOH A O     1 
HETATM 4443 O O     . HOH G 4 .   ? 23.802  -6.223  1.228   1.00 48.81 ? 499 HOH A O     1 
HETATM 4444 O O     . HOH G 4 .   ? 15.829  -13.389 11.172  1.00 52.84 ? 500 HOH A O     1 
HETATM 4445 O O     . HOH G 4 .   ? 9.899   -21.112 -9.783  1.00 51.23 ? 501 HOH A O     1 
HETATM 4446 O O     . HOH G 4 .   ? 17.754  -16.381 -10.740 1.00 58.31 ? 502 HOH A O     1 
HETATM 4447 O O     . HOH G 4 .   ? -16.296 0.596   -9.739  1.00 55.33 ? 503 HOH A O     1 
HETATM 4448 O O     . HOH G 4 .   ? -9.986  -20.710 -5.680  1.00 47.24 ? 504 HOH A O     1 
HETATM 4449 O O     . HOH G 4 .   ? -18.203 0.598   16.713  1.00 49.99 ? 505 HOH A O     1 
HETATM 4450 O O     . HOH G 4 .   ? -9.633  -21.684 2.866   1.00 56.18 ? 506 HOH A O     1 
HETATM 4451 O O     . HOH G 4 .   ? 17.790  -19.763 -10.345 1.00 62.95 ? 507 HOH A O     1 
HETATM 4452 O O     . HOH G 4 .   ? -2.458  23.021  -12.270 1.00 61.89 ? 508 HOH A O     1 
HETATM 4453 O O     . HOH G 4 .   ? 17.947  -2.404  -9.888  1.00 57.78 ? 509 HOH A O     1 
HETATM 4454 O O     . HOH G 4 .   ? -4.922  23.997  15.145  1.00 67.92 ? 510 HOH A O     1 
HETATM 4455 O O     . HOH G 4 .   ? 3.258   -24.798 -3.559  1.00 60.25 ? 511 HOH A O     1 
HETATM 4456 O O     . HOH G 4 .   ? 9.114   4.046   12.529  1.00 64.11 ? 512 HOH A O     1 
HETATM 4457 O O     . HOH G 4 .   ? 2.813   -19.721 -11.810 1.00 59.85 ? 513 HOH A O     1 
HETATM 4458 O O     . HOH G 4 .   ? 19.232  -21.520 15.667  1.00 58.01 ? 514 HOH A O     1 
HETATM 4459 O O     . HOH G 4 .   ? 17.142  -2.180  13.730  1.00 69.61 ? 515 HOH A O     1 
HETATM 4460 O O     . HOH G 4 .   ? -11.648 -23.142 1.368   1.00 54.09 ? 516 HOH A O     1 
HETATM 4461 O O     . HOH G 4 .   ? -25.306 5.143   5.580   1.00 53.92 ? 517 HOH A O     1 
HETATM 4462 O O     . HOH G 4 .   ? -12.797 -18.382 -5.210  1.00 72.53 ? 518 HOH A O     1 
HETATM 4463 O O     . HOH G 4 .   ? -6.434  2.699   15.170  1.00 61.66 ? 519 HOH A O     1 
HETATM 4464 O O     . HOH G 4 .   ? -1.244  -22.221 -12.055 1.00 68.95 ? 520 HOH A O     1 
HETATM 4465 O O     . HOH G 4 .   ? -6.643  24.950  10.085  1.00 59.45 ? 521 HOH A O     1 
HETATM 4466 O O     . HOH G 4 .   ? -7.501  -23.870 -0.619  1.00 61.42 ? 522 HOH A O     1 
HETATM 4467 O O     . HOH G 4 .   ? -12.802 1.988   -12.947 1.00 60.52 ? 523 HOH A O     1 
HETATM 4468 O O     . HOH G 4 .   ? 14.912  -11.819 -10.137 1.00 53.34 ? 524 HOH A O     1 
HETATM 4469 O O     . HOH G 4 .   ? 9.171   26.788  -9.372  1.00 50.67 ? 525 HOH A O     1 
HETATM 4470 O O     . HOH G 4 .   ? -5.404  16.739  18.878  1.00 46.79 ? 526 HOH A O     1 
HETATM 4471 O O     . HOH G 4 .   ? -1.121  -1.714  12.123  1.00 60.86 ? 527 HOH A O     1 
HETATM 4472 O O     . HOH G 4 .   ? 2.798   1.167   8.919   1.00 60.64 ? 528 HOH A O     1 
HETATM 4473 O O     . HOH G 4 .   ? 18.611  -21.827 12.895  1.00 64.41 ? 529 HOH A O     1 
HETATM 4474 O O     . HOH G 4 .   ? -11.214 19.245  -1.717  1.00 58.03 ? 530 HOH A O     1 
HETATM 4475 O O     . HOH G 4 .   ? 5.502   -12.274 9.326   1.00 48.77 ? 531 HOH A O     1 
HETATM 4476 O O     . HOH G 4 .   ? -27.669 10.901  13.137  1.00 62.24 ? 532 HOH A O     1 
HETATM 4477 O O     . HOH G 4 .   ? 16.695  -20.923 4.747   1.00 59.23 ? 533 HOH A O     1 
HETATM 4478 O O     . HOH G 4 .   ? -17.257 -2.514  -1.828  1.00 53.96 ? 534 HOH A O     1 
HETATM 4479 O O     . HOH G 4 .   ? -3.250  6.543   -15.234 1.00 48.00 ? 535 HOH A O     1 
HETATM 4480 O O     . HOH G 4 .   ? 10.312  9.572   -5.464  1.00 40.93 ? 536 HOH A O     1 
HETATM 4481 O O     . HOH G 4 .   ? 11.688  -1.417  5.306   1.00 61.12 ? 537 HOH A O     1 
HETATM 4482 O O     . HOH H 4 .   ? 14.725  18.010  -11.900 1.00 18.76 ? 303 HOH B O     1 
HETATM 4483 O O     . HOH H 4 .   ? 28.248  12.054  -5.768  1.00 18.44 ? 304 HOH B O     1 
HETATM 4484 O O     . HOH H 4 .   ? 6.390   17.939  -8.349  1.00 20.05 ? 305 HOH B O     1 
HETATM 4485 O O     . HOH H 4 .   ? 17.711  12.350  -14.539 1.00 17.59 ? 306 HOH B O     1 
HETATM 4486 O O     . HOH H 4 .   ? 16.703  22.527  -9.328  1.00 21.75 ? 307 HOH B O     1 
HETATM 4487 O O     . HOH H 4 .   ? 7.989   19.398  -9.963  1.00 22.88 ? 308 HOH B O     1 
HETATM 4488 O O     . HOH H 4 .   ? 21.918  13.759  -3.618  1.00 25.66 ? 309 HOH B O     1 
HETATM 4489 O O     . HOH H 4 .   ? 8.493   8.844   -12.140 1.00 25.89 ? 310 HOH B O     1 
HETATM 4490 O O     . HOH H 4 .   ? 4.257   15.342  -13.160 1.00 22.15 ? 311 HOH B O     1 
HETATM 4491 O O     . HOH H 4 .   ? 23.363  8.970   -23.319 1.00 22.61 ? 312 HOH B O     1 
HETATM 4492 O O     . HOH H 4 .   ? 21.420  8.884   -13.018 1.00 22.61 ? 313 HOH B O     1 
HETATM 4493 O O     . HOH H 4 .   ? 18.787  9.823   -14.148 1.00 23.25 ? 314 HOH B O     1 
HETATM 4494 O O     . HOH H 4 .   ? 6.798   18.541  -14.515 1.00 23.02 ? 315 HOH B O     1 
HETATM 4495 O O     . HOH H 4 .   ? 17.883  18.689  -33.080 1.00 25.30 ? 316 HOH B O     1 
HETATM 4496 O O     . HOH H 4 .   ? 19.625  6.844   -33.785 1.00 26.38 ? 317 HOH B O     1 
HETATM 4497 O O     . HOH H 4 .   ? 17.296  16.084  -6.741  1.00 21.97 ? 318 HOH B O     1 
HETATM 4498 O O     . HOH H 4 .   ? 5.685   11.193  -12.570 1.00 22.69 ? 319 HOH B O     1 
HETATM 4499 O O     . HOH H 4 .   ? 15.466  6.299   -42.968 1.00 28.50 ? 320 HOH B O     1 
HETATM 4500 O O     . HOH H 4 .   ? 12.297  22.674  -22.623 1.00 23.62 ? 321 HOH B O     1 
HETATM 4501 O O     . HOH H 4 .   ? 18.585  5.899   -14.962 1.00 25.17 ? 322 HOH B O     1 
HETATM 4502 O O     . HOH H 4 .   ? 22.145  10.328  -21.254 1.00 27.68 ? 323 HOH B O     1 
HETATM 4503 O O     . HOH H 4 .   ? 24.783  19.112  -6.038  1.00 32.01 ? 324 HOH B O     1 
HETATM 4504 O O     . HOH H 4 .   ? 31.630  17.525  -24.562 1.00 32.79 ? 325 HOH B O     1 
HETATM 4505 O O     . HOH H 4 .   ? 29.125  15.625  -10.702 1.00 23.83 ? 326 HOH B O     1 
HETATM 4506 O O     . HOH H 4 .   ? 12.035  25.116  -14.763 1.00 29.98 ? 327 HOH B O     1 
HETATM 4507 O O     . HOH H 4 .   ? 20.524  19.147  -40.338 1.00 33.93 ? 328 HOH B O     1 
HETATM 4508 O O     . HOH H 4 .   ? 23.471  24.685  -9.688  1.00 29.60 ? 329 HOH B O     1 
HETATM 4509 O O     . HOH H 4 .   ? 9.699   23.891  -19.710 1.00 29.13 ? 330 HOH B O     1 
HETATM 4510 O O     . HOH H 4 .   ? 15.099  29.763  -24.311 1.00 32.69 ? 331 HOH B O     1 
HETATM 4511 O O     . HOH H 4 .   ? 30.704  26.566  -22.316 1.00 30.52 ? 332 HOH B O     1 
HETATM 4512 O O     . HOH H 4 .   ? 17.908  8.229   -16.178 1.00 27.38 ? 333 HOH B O     1 
HETATM 4513 O O     . HOH H 4 .   ? 5.371   13.122  -14.707 1.00 30.33 ? 334 HOH B O     1 
HETATM 4514 O O     . HOH H 4 .   ? 15.652  4.812   -47.285 1.00 34.67 ? 335 HOH B O     1 
HETATM 4515 O O     . HOH H 4 .   ? 32.577  24.532  -28.193 1.00 35.11 ? 336 HOH B O     1 
HETATM 4516 O O     . HOH H 4 .   ? 26.399  10.096  -17.658 1.00 31.11 ? 337 HOH B O     1 
HETATM 4517 O O     . HOH H 4 .   ? 12.154  25.408  -20.795 1.00 29.99 ? 338 HOH B O     1 
HETATM 4518 O O     . HOH H 4 .   ? 30.490  27.498  -25.024 1.00 36.14 ? 339 HOH B O     1 
HETATM 4519 O O     . HOH H 4 .   ? 27.880  14.551  -28.186 1.00 31.37 ? 340 HOH B O     1 
HETATM 4520 O O     . HOH H 4 .   ? 30.555  20.751  -11.933 1.00 29.25 ? 341 HOH B O     1 
HETATM 4521 O O     . HOH H 4 .   ? 3.818   19.338  -17.833 1.00 29.43 ? 342 HOH B O     1 
HETATM 4522 O O     . HOH H 4 .   ? 25.134  24.510  -11.832 1.00 30.90 ? 343 HOH B O     1 
HETATM 4523 O O     . HOH H 4 .   ? 7.915   7.304   -39.300 1.00 34.63 ? 344 HOH B O     1 
HETATM 4524 O O     . HOH H 4 .   ? 15.867  24.732  -34.902 1.00 34.99 ? 345 HOH B O     1 
HETATM 4525 O O     . HOH H 4 .   ? 12.203  -3.425  -11.096 1.00 42.16 ? 346 HOH B O     1 
HETATM 4526 O O     . HOH H 4 .   ? 28.476  10.124  -35.661 1.00 29.33 ? 347 HOH B O     1 
HETATM 4527 O O     . HOH H 4 .   ? 6.634   23.442  -21.248 1.00 42.26 ? 348 HOH B O     1 
HETATM 4528 O O     . HOH H 4 .   ? 21.054  -5.198  -29.458 1.00 34.18 ? 349 HOH B O     1 
HETATM 4529 O O     . HOH H 4 .   ? 14.056  7.080   -21.908 1.00 40.47 ? 350 HOH B O     1 
HETATM 4530 O O     . HOH H 4 .   ? 13.653  28.027  -11.548 1.00 37.10 ? 351 HOH B O     1 
HETATM 4531 O O     . HOH H 4 .   ? 11.157  12.964  -3.022  1.00 37.26 ? 352 HOH B O     1 
HETATM 4532 O O     . HOH H 4 .   ? 9.041   5.872   -7.530  1.00 33.74 ? 353 HOH B O     1 
HETATM 4533 O O     . HOH H 4 .   ? 33.808  25.090  -30.762 1.00 44.95 ? 354 HOH B O     1 
HETATM 4534 O O     . HOH H 4 .   ? 11.723  27.739  -21.867 1.00 44.39 ? 355 HOH B O     1 
HETATM 4535 O O     . HOH H 4 .   ? 4.133   7.940   -16.185 1.00 43.29 ? 356 HOH B O     1 
HETATM 4536 O O     . HOH H 4 .   ? 15.431  28.536  -18.132 1.00 40.50 ? 357 HOH B O     1 
HETATM 4537 O O     . HOH H 4 .   ? 18.043  4.402   -43.307 1.00 36.87 ? 358 HOH B O     1 
HETATM 4538 O O     . HOH H 4 .   ? 5.029   12.975  -20.316 1.00 35.35 ? 359 HOH B O     1 
HETATM 4539 O O     . HOH H 4 .   ? 24.410  22.567  -7.229  1.00 37.59 ? 360 HOH B O     1 
HETATM 4540 O O     . HOH H 4 .   ? 21.976  4.083   -12.044 1.00 39.14 ? 361 HOH B O     1 
HETATM 4541 O O     . HOH H 4 .   ? 10.613  8.161   -19.015 1.00 34.05 ? 362 HOH B O     1 
HETATM 4542 O O     . HOH H 4 .   ? 22.782  28.304  -16.342 1.00 43.63 ? 363 HOH B O     1 
HETATM 4543 O O     . HOH H 4 .   ? 31.530  18.455  -28.591 1.00 37.28 ? 364 HOH B O     1 
HETATM 4544 O O     . HOH H 4 .   ? 16.742  -3.689  -28.804 1.00 41.97 ? 365 HOH B O     1 
HETATM 4545 O O     . HOH H 4 .   ? 32.101  20.551  -27.229 1.00 42.46 ? 366 HOH B O     1 
HETATM 4546 O O     . HOH H 4 .   ? 20.600  6.390   -13.480 1.00 39.07 ? 367 HOH B O     1 
HETATM 4547 O O     . HOH H 4 .   ? 26.407  12.911  0.723   1.00 40.40 ? 368 HOH B O     1 
HETATM 4548 O O     . HOH H 4 .   ? 13.370  6.637   -4.656  1.00 39.77 ? 369 HOH B O     1 
HETATM 4549 O O     . HOH H 4 .   ? 6.333   21.842  -15.276 1.00 34.51 ? 370 HOH B O     1 
HETATM 4550 O O     . HOH H 4 .   ? 8.118   27.468  -26.312 1.00 40.90 ? 371 HOH B O     1 
HETATM 4551 O O     . HOH H 4 .   ? 29.377  16.144  -8.352  1.00 34.57 ? 372 HOH B O     1 
HETATM 4552 O O     . HOH H 4 .   ? 13.994  5.358   -49.640 1.00 42.04 ? 373 HOH B O     1 
HETATM 4553 O O     . HOH H 4 .   ? 33.336  21.417  -11.616 1.00 33.68 ? 374 HOH B O     1 
HETATM 4554 O O     . HOH H 4 .   ? 10.652  -0.912  -13.615 1.00 56.89 ? 375 HOH B O     1 
HETATM 4555 O O     . HOH H 4 .   ? 27.530  12.128  -29.479 1.00 40.79 ? 376 HOH B O     1 
HETATM 4556 O O     . HOH H 4 .   ? 22.860  8.335   -15.542 1.00 33.95 ? 377 HOH B O     1 
HETATM 4557 O O     . HOH H 4 .   ? 22.805  -11.769 -43.752 1.00 46.78 ? 378 HOH B O     1 
HETATM 4558 O O     . HOH H 4 .   ? 2.034   17.993  -18.884 1.00 43.75 ? 379 HOH B O     1 
HETATM 4559 O O     . HOH H 4 .   ? 8.752   24.803  -17.208 1.00 41.58 ? 380 HOH B O     1 
HETATM 4560 O O     . HOH H 4 .   ? 29.848  17.728  -18.730 1.00 39.14 ? 381 HOH B O     1 
HETATM 4561 O O     . HOH H 4 .   ? 20.735  7.828   -17.239 1.00 41.52 ? 382 HOH B O     1 
HETATM 4562 O O     . HOH H 4 .   ? 29.148  23.090  -12.908 1.00 45.64 ? 383 HOH B O     1 
HETATM 4563 O O     . HOH H 4 .   ? 37.845  18.488  -15.133 1.00 43.53 ? 384 HOH B O     1 
HETATM 4564 O O     . HOH H 4 .   ? 28.072  11.671  -16.320 1.00 38.87 ? 385 HOH B O     1 
HETATM 4565 O O     . HOH H 4 .   ? 22.993  2.833   -6.485  1.00 43.25 ? 386 HOH B O     1 
HETATM 4566 O O     . HOH H 4 .   ? 17.235  5.621   -3.987  1.00 41.18 ? 387 HOH B O     1 
HETATM 4567 O O     . HOH H 4 .   ? 30.171  28.288  -20.599 1.00 41.19 ? 388 HOH B O     1 
HETATM 4568 O O     . HOH H 4 .   ? 13.580  29.344  -21.760 1.00 49.47 ? 389 HOH B O     1 
HETATM 4569 O O     . HOH H 4 .   ? 22.962  26.139  -14.075 1.00 47.29 ? 390 HOH B O     1 
HETATM 4570 O O     . HOH H 4 .   ? 7.759   17.482  -25.850 1.00 48.53 ? 391 HOH B O     1 
HETATM 4571 O O     . HOH H 4 .   ? 11.096  27.501  -27.292 1.00 37.30 ? 392 HOH B O     1 
HETATM 4572 O O     . HOH H 4 .   ? 31.917  16.892  -32.561 1.00 44.53 ? 393 HOH B O     1 
HETATM 4573 O O     . HOH H 4 .   ? 32.706  26.775  -26.773 1.00 39.16 ? 394 HOH B O     1 
HETATM 4574 O O     . HOH H 4 .   ? 19.380  -1.213  -47.192 1.00 48.96 ? 395 HOH B O     1 
HETATM 4575 O O     . HOH H 4 .   ? 29.815  -9.889  -42.835 1.00 56.88 ? 396 HOH B O     1 
HETATM 4576 O O     . HOH H 4 .   ? 38.215  -11.534 -46.039 1.00 51.22 ? 397 HOH B O     1 
HETATM 4577 O O     . HOH H 4 .   ? 24.462  30.553  -30.923 1.00 42.68 ? 398 HOH B O     1 
HETATM 4578 O O     . HOH H 4 .   ? 30.520  15.379  -28.234 1.00 39.19 ? 399 HOH B O     1 
HETATM 4579 O O     . HOH H 4 .   ? 29.602  30.041  -25.379 1.00 51.17 ? 400 HOH B O     1 
HETATM 4580 O O     . HOH H 4 .   ? 13.111  26.994  -7.433  1.00 49.97 ? 401 HOH B O     1 
HETATM 4581 O O     . HOH H 4 .   ? 16.328  27.587  -32.643 1.00 38.85 ? 402 HOH B O     1 
HETATM 4582 O O     . HOH H 4 .   ? 23.841  5.560   -24.348 1.00 40.00 ? 403 HOH B O     1 
HETATM 4583 O O     . HOH H 4 .   ? 6.924   11.755  -18.709 1.00 48.57 ? 404 HOH B O     1 
HETATM 4584 O O     . HOH H 4 .   ? 13.450  13.665  -2.505  1.00 45.22 ? 405 HOH B O     1 
HETATM 4585 O O     . HOH H 4 .   ? 7.874   9.515   -19.905 1.00 44.11 ? 406 HOH B O     1 
HETATM 4586 O O     . HOH H 4 .   ? 39.961  -11.751 -43.997 1.00 56.61 ? 407 HOH B O     1 
HETATM 4587 O O     . HOH H 4 .   ? 13.032  18.017  -35.152 1.00 43.22 ? 408 HOH B O     1 
HETATM 4588 O O     . HOH H 4 .   ? 33.439  21.098  -19.873 1.00 51.02 ? 409 HOH B O     1 
HETATM 4589 O O     . HOH H 4 .   ? 21.572  12.737  -46.285 1.00 47.61 ? 410 HOH B O     1 
HETATM 4590 O O     . HOH H 4 .   ? 17.733  29.334  -30.829 1.00 45.39 ? 411 HOH B O     1 
HETATM 4591 O O     . HOH H 4 .   ? 35.635  18.776  -17.025 1.00 44.32 ? 412 HOH B O     1 
HETATM 4592 O O     . HOH H 4 .   ? 32.062  20.368  -24.475 1.00 47.47 ? 413 HOH B O     1 
HETATM 4593 O O     . HOH H 4 .   ? 22.046  8.248   -19.420 1.00 52.91 ? 414 HOH B O     1 
HETATM 4594 O O     . HOH H 4 .   ? 4.637   0.466   -45.060 1.00 46.44 ? 415 HOH B O     1 
HETATM 4595 O O     . HOH H 4 .   ? 28.218  12.077  -31.911 1.00 49.26 ? 416 HOH B O     1 
HETATM 4596 O O     . HOH H 4 .   ? 15.771  31.511  -29.993 1.00 55.94 ? 417 HOH B O     1 
HETATM 4597 O O     . HOH H 4 .   ? 13.103  5.931   -24.159 1.00 42.06 ? 418 HOH B O     1 
HETATM 4598 O O     . HOH H 4 .   ? 16.515  6.190   -49.917 1.00 42.60 ? 419 HOH B O     1 
HETATM 4599 O O     . HOH H 4 .   ? 10.761  26.215  -7.074  1.00 46.55 ? 420 HOH B O     1 
HETATM 4600 O O     . HOH H 4 .   ? 13.382  8.424   -2.813  1.00 54.89 ? 421 HOH B O     1 
HETATM 4601 O O     . HOH H 4 .   ? 17.606  2.615   -48.588 1.00 56.08 ? 422 HOH B O     1 
HETATM 4602 O O     . HOH H 4 .   ? 9.234   13.163  -42.377 1.00 43.49 ? 423 HOH B O     1 
HETATM 4603 O O     . HOH H 4 .   ? 17.709  9.474   6.027   1.00 59.65 ? 424 HOH B O     1 
HETATM 4604 O O     . HOH H 4 .   ? 34.462  6.665   -38.139 1.00 46.35 ? 425 HOH B O     1 
HETATM 4605 O O     . HOH H 4 .   ? 26.003  9.297   0.788   1.00 39.52 ? 426 HOH B O     1 
HETATM 4606 O O     . HOH H 4 .   ? 16.346  21.948  -40.425 1.00 54.67 ? 427 HOH B O     1 
HETATM 4607 O O     . HOH H 4 .   ? 18.483  -12.870 -28.457 1.00 64.75 ? 428 HOH B O     1 
HETATM 4608 O O     . HOH H 4 .   ? 21.213  3.833   -2.900  1.00 46.51 ? 429 HOH B O     1 
HETATM 4609 O O     . HOH H 4 .   ? 15.700  23.930  -38.664 1.00 55.08 ? 430 HOH B O     1 
HETATM 4610 O O     . HOH H 4 .   ? 25.391  8.239   -19.357 1.00 59.09 ? 431 HOH B O     1 
HETATM 4611 O O     . HOH H 4 .   ? 31.367  15.627  -19.873 1.00 41.95 ? 432 HOH B O     1 
HETATM 4612 O O     . HOH H 4 .   ? 8.494   -8.480  -44.210 1.00 54.33 ? 433 HOH B O     1 
HETATM 4613 O O     . HOH H 4 .   ? 11.833  22.230  0.814   1.00 51.88 ? 434 HOH B O     1 
HETATM 4614 O O     . HOH H 4 .   ? 24.235  32.279  -27.702 1.00 52.93 ? 435 HOH B O     1 
HETATM 4615 O O     . HOH H 4 .   ? 13.913  -12.487 -39.392 1.00 58.24 ? 436 HOH B O     1 
HETATM 4616 O O     . HOH H 4 .   ? 34.555  28.121  -30.963 1.00 56.89 ? 437 HOH B O     1 
HETATM 4617 O O     . HOH H 4 .   ? 14.892  10.678  -2.435  1.00 53.87 ? 438 HOH B O     1 
HETATM 4618 O O     . HOH H 4 .   ? 27.745  14.015  -34.606 1.00 50.46 ? 439 HOH B O     1 
HETATM 4619 O O     . HOH H 4 .   ? 14.030  14.343  -32.189 1.00 41.65 ? 440 HOH B O     1 
HETATM 4620 O O     . HOH H 4 .   ? 13.165  27.575  -14.702 1.00 42.01 ? 441 HOH B O     1 
HETATM 4621 O O     . HOH H 4 .   ? 34.151  22.168  -27.356 1.00 46.83 ? 442 HOH B O     1 
HETATM 4622 O O     . HOH H 4 .   ? 27.299  7.926   -15.407 1.00 68.43 ? 443 HOH B O     1 
HETATM 4623 O O     . HOH H 4 .   ? 34.207  -1.536  -49.692 1.00 48.74 ? 444 HOH B O     1 
HETATM 4624 O O     . HOH H 4 .   ? 19.700  6.449   -1.597  1.00 54.61 ? 445 HOH B O     1 
HETATM 4625 O O     . HOH H 4 .   ? 15.779  27.494  -15.723 1.00 47.84 ? 446 HOH B O     1 
HETATM 4626 O O     . HOH H 4 .   ? 8.512   9.239   -48.241 1.00 62.15 ? 447 HOH B O     1 
HETATM 4627 O O     . HOH H 4 .   ? 33.320  25.995  -22.164 1.00 51.97 ? 448 HOH B O     1 
HETATM 4628 O O     . HOH H 4 .   ? 24.432  -4.229  -44.418 1.00 56.64 ? 449 HOH B O     1 
HETATM 4629 O O     . HOH H 4 .   ? 32.029  5.826   -31.936 1.00 50.05 ? 450 HOH B O     1 
HETATM 4630 O O     . HOH H 4 .   ? 8.412   28.531  -24.039 1.00 60.10 ? 451 HOH B O     1 
HETATM 4631 O O     . HOH H 4 .   ? 28.638  -7.516  -31.537 1.00 66.25 ? 452 HOH B O     1 
HETATM 4632 O O     . HOH H 4 .   ? 23.314  17.782  7.193   1.00 61.06 ? 453 HOH B O     1 
HETATM 4633 O O     . HOH H 4 .   ? 25.039  7.107   -21.783 1.00 54.61 ? 454 HOH B O     1 
HETATM 4634 O O     . HOH H 4 .   ? 2.637   13.506  -19.761 1.00 47.33 ? 455 HOH B O     1 
HETATM 4635 O O     . HOH H 4 .   ? 35.973  4.111   -36.804 1.00 56.87 ? 456 HOH B O     1 
HETATM 4636 O O     . HOH H 4 .   ? 29.309  12.319  -27.185 1.00 52.27 ? 457 HOH B O     1 
HETATM 4637 O O     . HOH H 4 .   ? 12.341  28.985  -25.364 1.00 50.05 ? 458 HOH B O     1 
HETATM 4638 O O     . HOH H 4 .   ? 32.911  -4.146  -53.256 1.00 70.56 ? 459 HOH B O     1 
HETATM 4639 O O     . HOH H 4 .   ? -3.568  6.665   -43.078 1.00 68.03 ? 460 HOH B O     1 
HETATM 4640 O O     . HOH H 4 .   ? 21.320  28.361  -1.532  1.00 56.17 ? 461 HOH B O     1 
HETATM 4641 O O     . HOH H 4 .   ? 17.612  10.649  1.385   1.00 48.68 ? 462 HOH B O     1 
HETATM 4642 O O     . HOH H 4 .   ? 34.752  7.991   -35.865 1.00 56.47 ? 463 HOH B O     1 
HETATM 4643 O O     . HOH H 4 .   ? 33.569  29.153  -27.842 1.00 57.36 ? 464 HOH B O     1 
HETATM 4644 O O     . HOH H 4 .   ? 5.699   22.631  -18.643 1.00 51.08 ? 465 HOH B O     1 
HETATM 4645 O O     . HOH H 4 .   ? 9.811   6.886   -51.340 1.00 71.41 ? 466 HOH B O     1 
HETATM 4646 O O     . HOH H 4 .   ? 34.766  25.968  -24.657 1.00 49.61 ? 467 HOH B O     1 
HETATM 4647 O O     . HOH H 4 .   ? 16.561  15.490  -32.020 1.00 41.38 ? 468 HOH B O     1 
HETATM 4648 O O     . HOH H 4 .   ? 26.622  12.727  -40.037 1.00 60.99 ? 469 HOH B O     1 
HETATM 4649 O O     . HOH H 4 .   ? 32.390  29.054  -18.779 1.00 55.34 ? 470 HOH B O     1 
HETATM 4650 O O     . HOH H 4 .   ? 38.950  -3.720  -56.034 1.00 60.42 ? 471 HOH B O     1 
HETATM 4651 O O     . HOH H 4 .   ? 23.274  12.355  -51.001 1.00 67.29 ? 472 HOH B O     1 
HETATM 4652 O O     . HOH H 4 .   ? 10.744  -14.664 -41.998 1.00 64.87 ? 473 HOH B O     1 
HETATM 4653 O O     . HOH H 4 .   ? 29.312  16.559  -41.309 1.00 54.73 ? 474 HOH B O     1 
HETATM 4654 O O     . HOH H 4 .   ? 10.132  0.102   -50.150 1.00 56.60 ? 475 HOH B O     1 
HETATM 4655 O O     . HOH H 4 .   ? 18.592  20.621  -41.202 1.00 63.47 ? 476 HOH B O     1 
HETATM 4656 O O     . HOH H 4 .   ? 42.108  3.597   -46.922 1.00 55.67 ? 477 HOH B O     1 
HETATM 4657 O O     . HOH H 4 .   ? 13.228  -7.352  -22.456 1.00 61.74 ? 478 HOH B O     1 
HETATM 4658 O O     . HOH H 4 .   ? 21.760  27.926  -39.991 1.00 50.21 ? 479 HOH B O     1 
HETATM 4659 O O     . HOH H 4 .   ? 32.113  28.264  -16.055 1.00 58.83 ? 480 HOH B O     1 
HETATM 4660 O O     . HOH H 4 .   ? 30.523  3.654   -47.801 1.00 54.09 ? 481 HOH B O     1 
HETATM 4661 O O     . HOH H 4 .   ? 22.915  18.340  -4.108  1.00 53.22 ? 482 HOH B O     1 
HETATM 4662 O O     . HOH H 4 .   ? 5.891   24.504  -24.361 1.00 72.22 ? 483 HOH B O     1 
HETATM 4663 O O     . HOH H 4 .   ? 13.996  0.749   -4.891  1.00 56.60 ? 484 HOH B O     1 
HETATM 4664 O O     . HOH H 4 .   ? 28.422  25.553  -13.942 1.00 60.03 ? 485 HOH B O     1 
HETATM 4665 O O     . HOH H 4 .   ? 40.805  3.521   -44.697 1.00 76.29 ? 486 HOH B O     1 
HETATM 4666 O O     . HOH H 4 .   ? 32.420  24.271  -40.386 1.00 55.71 ? 487 HOH B O     1 
HETATM 4667 O O     . HOH H 4 .   ? 17.323  28.117  -5.420  1.00 43.28 ? 488 HOH B O     1 
HETATM 4668 O O     . HOH H 4 .   ? 27.439  15.950  8.421   1.00 44.58 ? 489 HOH B O     1 
HETATM 4669 O O     . HOH H 4 .   ? 28.472  14.727  6.632   1.00 47.68 ? 490 HOH B O     1 
HETATM 4670 O O     . HOH H 4 .   ? 12.758  -1.272  -49.409 1.00 52.81 ? 491 HOH B O     1 
HETATM 4671 O O     . HOH H 4 .   ? 28.999  8.750   -27.355 1.00 55.13 ? 492 HOH B O     1 
HETATM 4672 O O     . HOH H 4 .   ? 29.590  -17.877 -40.491 1.00 71.23 ? 493 HOH B O     1 
HETATM 4673 O O     . HOH H 4 .   ? 20.576  14.607  2.082   1.00 50.68 ? 494 HOH B O     1 
HETATM 4674 O O     . HOH H 4 .   ? 21.735  18.080  5.144   1.00 85.57 ? 495 HOH B O     1 
HETATM 4675 O O     . HOH H 4 .   ? 4.135   9.568   -46.528 1.00 63.27 ? 496 HOH B O     1 
HETATM 4676 O O     . HOH H 4 .   ? 19.951  27.483  -12.170 1.00 63.78 ? 497 HOH B O     1 
HETATM 4677 O O     . HOH H 4 .   ? 29.953  7.926   -29.697 1.00 64.09 ? 498 HOH B O     1 
HETATM 4678 O O     . HOH H 4 .   ? 2.494   1.647   -46.671 1.00 62.93 ? 499 HOH B O     1 
HETATM 4679 O O     . HOH H 4 .   ? 20.786  28.100  -8.372  1.00 56.85 ? 500 HOH B O     1 
HETATM 4680 O O     . HOH H 4 .   ? 12.036  -8.271  -24.668 1.00 67.73 ? 501 HOH B O     1 
HETATM 4681 O O     . HOH H 4 .   ? 10.490  28.996  -29.641 1.00 54.44 ? 502 HOH B O     1 
HETATM 4682 O O     . HOH H 4 .   ? 34.126  17.171  -33.716 1.00 57.96 ? 503 HOH B O     1 
HETATM 4683 O O     . HOH H 4 .   ? 10.244  -15.220 -31.231 1.00 57.65 ? 504 HOH B O     1 
HETATM 4684 O O     . HOH H 4 .   ? 7.545   13.628  -28.780 1.00 61.44 ? 505 HOH B O     1 
HETATM 4685 O O     . HOH H 4 .   ? 33.797  3.461   -31.435 1.00 85.85 ? 506 HOH B O     1 
HETATM 4686 O O     . HOH H 4 .   ? -0.041  18.079  -23.324 1.00 81.80 ? 507 HOH B O     1 
HETATM 4687 O O     . HOH H 4 .   ? 11.696  0.263   -8.342  1.00 76.42 ? 508 HOH B O     1 
HETATM 4688 O O     . HOH H 4 .   ? 20.246  -12.109 -44.729 1.00 64.72 ? 509 HOH B O     1 
HETATM 4689 O O     . HOH H 4 .   ? 34.897  22.826  -24.993 1.00 66.68 ? 510 HOH B O     1 
HETATM 4690 O O     . HOH H 4 .   ? 17.147  2.781   -17.294 1.00 62.84 ? 511 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   39  ?   ?   ?   A . n 
A 1 2   ARG 2   40  ?   ?   ?   A . n 
A 1 3   GLU 3   41  ?   ?   ?   A . n 
A 1 4   ALA 4   42  ?   ?   ?   A . n 
A 1 5   GLU 5   43  ?   ?   ?   A . n 
A 1 6   ALA 6   44  ?   ?   ?   A . n 
A 1 7   ARG 7   45  45  ARG ARG A . n 
A 1 8   TRP 8   46  46  TRP TRP A . n 
A 1 9   ARG 9   47  47  ARG ARG A . n 
A 1 10  GLN 10  48  48  GLN GLN A . n 
A 1 11  THR 11  49  49  THR THR A . n 
A 1 12  TRP 12  50  50  TRP TRP A . n 
A 1 13  SER 13  51  51  SER SER A . n 
A 1 14  GLY 14  52  52  GLY GLY A . n 
A 1 15  PRO 15  53  53  PRO PRO A . n 
A 1 16  GLY 16  54  54  GLY GLY A . n 
A 1 17  THR 17  55  55  THR THR A . n 
A 1 18  THR 18  56  56  THR THR A . n 
A 1 19  LYS 19  57  57  LYS LYS A . n 
A 1 20  ARG 20  58  58  ARG ARG A . n 
A 1 21  PHE 21  59  59  PHE PHE A . n 
A 1 22  PRO 22  60  60  PRO PRO A . n 
A 1 23  GLU 23  61  61  GLU GLU A . n 
A 1 24  THR 24  62  62  THR THR A . n 
A 1 25  VAL 25  63  63  VAL VAL A . n 
A 1 26  LEU 26  64  64  LEU LEU A . n 
A 1 27  ALA 27  65  65  ALA ALA A . n 
A 1 28  ARG 28  66  66  ARG ARG A . n 
A 1 29  CYS 29  67  67  CYS CYS A . n 
A 1 30  VAL 30  68  68  VAL VAL A . n 
A 1 31  LYS 31  69  69  LYS LYS A . n 
A 1 32  TYR 32  70  70  TYR TYR A . n 
A 1 33  THR 33  71  71  THR THR A . n 
A 1 34  GLU 34  72  72  GLU GLU A . n 
A 1 35  ILE 35  73  73  ILE ILE A . n 
A 1 36  HIS 36  74  74  HIS HIS A . n 
A 1 37  PRO 37  75  75  PRO PRO A . n 
A 1 38  GLU 38  76  76  GLU GLU A . n 
A 1 39  MET 39  77  77  MET MET A . n 
A 1 40  ARG 40  78  78  ARG ARG A . n 
A 1 41  HIS 41  79  79  HIS HIS A . n 
A 1 42  VAL 42  80  80  VAL VAL A . n 
A 1 43  ASP 43  81  81  ASP ASP A . n 
A 1 44  CYS 44  82  82  CYS CYS A . n 
A 1 45  GLN 45  83  83  GLN GLN A . n 
A 1 46  SER 46  84  84  SER SER A . n 
A 1 47  VAL 47  85  85  VAL VAL A . n 
A 1 48  TRP 48  86  86  TRP TRP A . n 
A 1 49  ASP 49  87  87  ASP ASP A . n 
A 1 50  ALA 50  88  88  ALA ALA A . n 
A 1 51  PHE 51  89  89  PHE PHE A . n 
A 1 52  LYS 52  90  90  LYS LYS A . n 
A 1 53  GLY 53  91  91  GLY GLY A . n 
A 1 54  ALA 54  92  92  ALA ALA A . n 
A 1 55  PHE 55  93  93  PHE PHE A . n 
A 1 56  ILE 56  94  94  ILE ILE A . n 
A 1 57  SER 57  95  95  SER SER A . n 
A 1 58  LYS 58  96  96  LYS LYS A . n 
A 1 59  HIS 59  97  97  HIS HIS A . n 
A 1 60  PRO 60  98  98  PRO PRO A . n 
A 1 61  CYS 61  99  99  CYS CYS A . n 
A 1 62  ASP 62  100 100 ASP ASP A . n 
A 1 63  ILE 63  101 101 ILE ILE A . n 
A 1 64  THR 64  102 102 THR THR A . n 
A 1 65  GLU 65  103 103 GLU GLU A . n 
A 1 66  GLU 66  104 104 GLU GLU A . n 
A 1 67  ASP 67  105 105 ASP ASP A . n 
A 1 68  TYR 68  106 106 TYR TYR A . n 
A 1 69  GLN 69  107 107 GLN GLN A . n 
A 1 70  PRO 70  108 108 PRO PRO A . n 
A 1 71  LEU 71  109 109 LEU LEU A . n 
A 1 72  MET 72  110 110 MET MET A . n 
A 1 73  LYS 73  111 111 LYS LYS A . n 
A 1 74  LEU 74  112 112 LEU LEU A . n 
A 1 75  GLY 75  113 113 GLY GLY A . n 
A 1 76  THR 76  114 114 THR THR A . n 
A 1 77  GLN 77  115 115 GLN GLN A . n 
A 1 78  THR 78  116 116 THR THR A . n 
A 1 79  VAL 79  117 117 VAL VAL A . n 
A 1 80  PRO 80  118 118 PRO PRO A . n 
A 1 81  CYS 81  119 119 CYS CYS A . n 
A 1 82  ASN 82  120 120 ASN ASN A . n 
A 1 83  LYS 83  121 121 LYS LYS A . n 
A 1 84  ILE 84  122 122 ILE ILE A . n 
A 1 85  LEU 85  123 123 LEU LEU A . n 
A 1 86  LEU 86  124 124 LEU LEU A . n 
A 1 87  TRP 87  125 125 TRP TRP A . n 
A 1 88  SER 88  126 126 SER SER A . n 
A 1 89  ARG 89  127 127 ARG ARG A . n 
A 1 90  ILE 90  128 128 ILE ILE A . n 
A 1 91  LYS 91  129 129 LYS LYS A . n 
A 1 92  ASP 92  130 130 ASP ASP A . n 
A 1 93  LEU 93  131 131 LEU LEU A . n 
A 1 94  ALA 94  132 132 ALA ALA A . n 
A 1 95  HIS 95  133 133 HIS HIS A . n 
A 1 96  GLN 96  134 134 GLN GLN A . n 
A 1 97  PHE 97  135 135 PHE PHE A . n 
A 1 98  THR 98  136 136 THR THR A . n 
A 1 99  GLN 99  137 137 GLN GLN A . n 
A 1 100 VAL 100 138 138 VAL VAL A . n 
A 1 101 GLN 101 139 139 GLN GLN A . n 
A 1 102 ARG 102 140 140 ARG ARG A . n 
A 1 103 ASP 103 141 141 ASP ASP A . n 
A 1 104 MET 104 142 142 MET MET A . n 
A 1 105 PHE 105 143 143 PHE PHE A . n 
A 1 106 THR 106 144 144 THR THR A . n 
A 1 107 LEU 107 145 145 LEU LEU A . n 
A 1 108 GLU 108 146 146 GLU GLU A . n 
A 1 109 ASP 109 147 147 ASP ASP A . n 
A 1 110 THR 110 148 148 THR THR A . n 
A 1 111 LEU 111 149 149 LEU LEU A . n 
A 1 112 LEU 112 150 150 LEU LEU A . n 
A 1 113 GLY 113 151 151 GLY GLY A . n 
A 1 114 TYR 114 152 152 TYR TYR A . n 
A 1 115 LEU 115 153 153 LEU LEU A . n 
A 1 116 ALA 116 154 154 ALA ALA A . n 
A 1 117 ASP 117 155 155 ASP ASP A . n 
A 1 118 ASP 118 156 156 ASP ASP A . n 
A 1 119 LEU 119 157 157 LEU LEU A . n 
A 1 120 THR 120 158 158 THR THR A . n 
A 1 121 TRP 121 159 159 TRP TRP A . n 
A 1 122 CYS 122 160 160 CYS CYS A . n 
A 1 123 GLY 123 161 161 GLY GLY A . n 
A 1 124 GLU 124 162 162 GLU GLU A . n 
A 1 125 PHE 125 163 163 PHE PHE A . n 
A 1 126 ASP 126 164 164 ASP ASP A . n 
A 1 127 THR 127 165 165 THR THR A . n 
A 1 128 SER 128 166 166 SER SER A . n 
A 1 129 LYS 129 167 167 LYS LYS A . n 
A 1 130 ILE 130 168 168 ILE ILE A . n 
A 1 131 ASN 131 169 169 ASN ASN A . n 
A 1 132 TYR 132 170 170 TYR TYR A . n 
A 1 133 GLN 133 171 171 GLN GLN A . n 
A 1 134 SER 134 172 172 SER SER A . n 
A 1 135 CYS 135 173 173 CYS CYS A . n 
A 1 136 PRO 136 174 174 PRO PRO A . n 
A 1 137 ASP 137 175 175 ASP ASP A . n 
A 1 138 TRP 138 176 176 TRP TRP A . n 
A 1 139 ARG 139 177 177 ARG ARG A . n 
A 1 140 LYS 140 178 178 LYS LYS A . n 
A 1 141 ASP 141 179 179 ASP ASP A . n 
A 1 142 CYS 142 180 180 CYS CYS A . n 
A 1 143 SER 143 181 181 SER SER A . n 
A 1 144 ASN 144 182 182 ASN ASN A . n 
A 1 145 ASN 145 183 183 ASN ASN A . n 
A 1 146 PRO 146 184 184 PRO PRO A . n 
A 1 147 VAL 147 185 185 VAL VAL A . n 
A 1 148 SER 148 186 186 SER SER A . n 
A 1 149 VAL 149 187 187 VAL VAL A . n 
A 1 150 PHE 150 188 188 PHE PHE A . n 
A 1 151 TRP 151 189 189 TRP TRP A . n 
A 1 152 LYS 152 190 190 LYS LYS A . n 
A 1 153 THR 153 191 191 THR THR A . n 
A 1 154 VAL 154 192 192 VAL VAL A . n 
A 1 155 SER 155 193 193 SER SER A . n 
A 1 156 ARG 156 194 194 ARG ARG A . n 
A 1 157 ARG 157 195 195 ARG ARG A . n 
A 1 158 PHE 158 196 196 PHE PHE A . n 
A 1 159 ALA 159 197 197 ALA ALA A . n 
A 1 160 GLU 160 198 198 GLU GLU A . n 
A 1 161 ALA 161 199 199 ALA ALA A . n 
A 1 162 ALA 162 200 200 ALA ALA A . n 
A 1 163 CYS 163 201 201 CYS CYS A . n 
A 1 164 ASP 164 202 202 ASP ASP A . n 
A 1 165 VAL 165 203 203 VAL VAL A . n 
A 1 166 VAL 166 204 204 VAL VAL A . n 
A 1 167 HIS 167 205 205 HIS HIS A . n 
A 1 168 VAL 168 206 206 VAL VAL A . n 
A 1 169 MET 169 207 207 MET MET A . n 
A 1 170 LEU 170 208 208 LEU LEU A . n 
A 1 171 ASP 171 209 209 ASP ASP A . n 
A 1 172 GLY 172 210 210 GLY GLY A . n 
A 1 173 SER 173 211 211 SER SER A . n 
A 1 174 ARG 174 212 212 ARG ARG A . n 
A 1 175 SER 175 213 213 SER SER A . n 
A 1 176 LYS 176 214 214 LYS LYS A . n 
A 1 177 ILE 177 215 215 ILE ILE A . n 
A 1 178 PHE 178 216 216 PHE PHE A . n 
A 1 179 ASP 179 217 217 ASP ASP A . n 
A 1 180 LYS 180 218 218 LYS LYS A . n 
A 1 181 ASP 181 219 219 ASP ASP A . n 
A 1 182 SER 182 220 220 SER SER A . n 
A 1 183 THR 183 221 221 THR THR A . n 
A 1 184 PHE 184 222 222 PHE PHE A . n 
A 1 185 GLY 185 223 223 GLY GLY A . n 
A 1 186 SER 186 224 224 SER SER A . n 
A 1 187 VAL 187 225 225 VAL VAL A . n 
A 1 188 GLU 188 226 226 GLU GLU A . n 
A 1 189 VAL 189 227 227 VAL VAL A . n 
A 1 190 HIS 190 228 228 HIS HIS A . n 
A 1 191 ASN 191 229 229 ASN ASN A . n 
A 1 192 LEU 192 230 230 LEU LEU A . n 
A 1 193 GLN 193 231 231 GLN GLN A . n 
A 1 194 PRO 194 232 232 PRO PRO A . n 
A 1 195 GLU 195 233 233 GLU GLU A . n 
A 1 196 LYS 196 234 234 LYS LYS A . n 
A 1 197 VAL 197 235 235 VAL VAL A . n 
A 1 198 GLN 198 236 236 GLN GLN A . n 
A 1 199 THR 199 237 237 THR THR A . n 
A 1 200 LEU 200 238 238 LEU LEU A . n 
A 1 201 GLU 201 239 239 GLU GLU A . n 
A 1 202 ALA 202 240 240 ALA ALA A . n 
A 1 203 TRP 203 241 241 TRP TRP A . n 
A 1 204 VAL 204 242 242 VAL VAL A . n 
A 1 205 ILE 205 243 243 ILE ILE A . n 
A 1 206 HIS 206 244 244 HIS HIS A . n 
A 1 207 GLY 207 245 245 GLY GLY A . n 
A 1 208 GLY 208 246 246 GLY GLY A . n 
A 1 209 ARG 209 247 247 ARG ARG A . n 
A 1 210 GLU 210 248 248 GLU GLU A . n 
A 1 211 ASP 211 249 249 ASP ASP A . n 
A 1 212 SER 212 250 250 SER SER A . n 
A 1 213 ARG 213 251 251 ARG ARG A . n 
A 1 214 ASP 214 252 252 ASP ASP A . n 
A 1 215 LEU 215 253 253 LEU LEU A . n 
A 1 216 CYS 216 254 254 CYS CYS A . n 
A 1 217 GLN 217 255 255 GLN GLN A . n 
A 1 218 ASP 218 256 256 ASP ASP A . n 
A 1 219 PRO 219 257 257 PRO PRO A . n 
A 1 220 THR 220 258 258 THR THR A . n 
A 1 221 ILE 221 259 259 ILE ILE A . n 
A 1 222 LYS 222 260 260 LYS LYS A . n 
A 1 223 GLU 223 261 261 GLU GLU A . n 
A 1 224 LEU 224 262 262 LEU LEU A . n 
A 1 225 GLU 225 263 263 GLU GLU A . n 
A 1 226 SER 226 264 264 SER SER A . n 
A 1 227 ILE 227 265 265 ILE ILE A . n 
A 1 228 ILE 228 266 266 ILE ILE A . n 
A 1 229 SER 229 267 267 SER SER A . n 
A 1 230 LYS 230 268 268 LYS LYS A . n 
A 1 231 ARG 231 269 269 ARG ARG A . n 
A 1 232 ASN 232 270 270 ASN ASN A . n 
A 1 233 ILE 233 271 271 ILE ILE A . n 
A 1 234 GLN 234 272 272 GLN GLN A . n 
A 1 235 PHE 235 273 273 PHE PHE A . n 
A 1 236 SER 236 274 274 SER SER A . n 
A 1 237 CYS 237 275 275 CYS CYS A . n 
A 1 238 LYS 238 276 276 LYS LYS A . n 
A 1 239 ASN 239 277 277 ASN ASN A . n 
A 1 240 ILE 240 278 278 ILE ILE A . n 
A 1 241 TYR 241 279 279 TYR TYR A . n 
A 1 242 ARG 242 280 280 ARG ARG A . n 
A 1 243 PRO 243 281 281 PRO PRO A . n 
A 1 244 ASP 244 282 282 ASP ASP A . n 
A 1 245 LYS 245 283 283 LYS LYS A . n 
A 1 246 PHE 246 284 284 PHE PHE A . n 
A 1 247 LEU 247 285 285 LEU LEU A . n 
A 1 248 GLN 248 286 286 GLN GLN A . n 
A 1 249 CYS 249 287 287 CYS CYS A . n 
A 1 250 VAL 250 288 288 VAL VAL A . n 
A 1 251 LYS 251 289 289 LYS LYS A . n 
A 1 252 ASN 252 290 290 ASN ASN A . n 
A 1 253 PRO 253 291 291 PRO PRO A . n 
A 1 254 GLU 254 292 292 GLU GLU A . n 
A 1 255 ASP 255 293 293 ASP ASP A . n 
A 1 256 SER 256 294 294 SER SER A . n 
A 1 257 SER 257 295 295 SER SER A . n 
A 1 258 CYS 258 296 296 CYS CYS A . n 
A 1 259 THR 259 297 ?   ?   ?   A . n 
A 1 260 SER 260 298 ?   ?   ?   A . n 
A 1 261 GLU 261 299 ?   ?   ?   A . n 
A 1 262 ILE 262 300 ?   ?   ?   A . n 
B 1 1   LYS 1   39  ?   ?   ?   B . n 
B 1 2   ARG 2   40  ?   ?   ?   B . n 
B 1 3   GLU 3   41  ?   ?   ?   B . n 
B 1 4   ALA 4   42  ?   ?   ?   B . n 
B 1 5   GLU 5   43  ?   ?   ?   B . n 
B 1 6   ALA 6   44  ?   ?   ?   B . n 
B 1 7   ARG 7   45  45  ARG ARG B . n 
B 1 8   TRP 8   46  46  TRP TRP B . n 
B 1 9   ARG 9   47  47  ARG ARG B . n 
B 1 10  GLN 10  48  48  GLN GLN B . n 
B 1 11  THR 11  49  49  THR THR B . n 
B 1 12  TRP 12  50  50  TRP TRP B . n 
B 1 13  SER 13  51  51  SER SER B . n 
B 1 14  GLY 14  52  52  GLY GLY B . n 
B 1 15  PRO 15  53  53  PRO PRO B . n 
B 1 16  GLY 16  54  54  GLY GLY B . n 
B 1 17  THR 17  55  55  THR THR B . n 
B 1 18  THR 18  56  56  THR THR B . n 
B 1 19  LYS 19  57  57  LYS LYS B . n 
B 1 20  ARG 20  58  58  ARG ARG B . n 
B 1 21  PHE 21  59  59  PHE PHE B . n 
B 1 22  PRO 22  60  60  PRO PRO B . n 
B 1 23  GLU 23  61  61  GLU GLU B . n 
B 1 24  THR 24  62  62  THR THR B . n 
B 1 25  VAL 25  63  63  VAL VAL B . n 
B 1 26  LEU 26  64  64  LEU LEU B . n 
B 1 27  ALA 27  65  65  ALA ALA B . n 
B 1 28  ARG 28  66  66  ARG ARG B . n 
B 1 29  CYS 29  67  67  CYS CYS B . n 
B 1 30  VAL 30  68  68  VAL VAL B . n 
B 1 31  LYS 31  69  69  LYS LYS B . n 
B 1 32  TYR 32  70  70  TYR TYR B . n 
B 1 33  THR 33  71  71  THR THR B . n 
B 1 34  GLU 34  72  72  GLU GLU B . n 
B 1 35  ILE 35  73  73  ILE ILE B . n 
B 1 36  HIS 36  74  74  HIS HIS B . n 
B 1 37  PRO 37  75  75  PRO PRO B . n 
B 1 38  GLU 38  76  76  GLU GLU B . n 
B 1 39  MET 39  77  77  MET MET B . n 
B 1 40  ARG 40  78  78  ARG ARG B . n 
B 1 41  HIS 41  79  79  HIS HIS B . n 
B 1 42  VAL 42  80  80  VAL VAL B . n 
B 1 43  ASP 43  81  81  ASP ASP B . n 
B 1 44  CYS 44  82  82  CYS CYS B . n 
B 1 45  GLN 45  83  83  GLN GLN B . n 
B 1 46  SER 46  84  84  SER SER B . n 
B 1 47  VAL 47  85  85  VAL VAL B . n 
B 1 48  TRP 48  86  86  TRP TRP B . n 
B 1 49  ASP 49  87  87  ASP ASP B . n 
B 1 50  ALA 50  88  88  ALA ALA B . n 
B 1 51  PHE 51  89  89  PHE PHE B . n 
B 1 52  LYS 52  90  90  LYS LYS B . n 
B 1 53  GLY 53  91  91  GLY GLY B . n 
B 1 54  ALA 54  92  92  ALA ALA B . n 
B 1 55  PHE 55  93  93  PHE PHE B . n 
B 1 56  ILE 56  94  94  ILE ILE B . n 
B 1 57  SER 57  95  95  SER SER B . n 
B 1 58  LYS 58  96  96  LYS LYS B . n 
B 1 59  HIS 59  97  97  HIS HIS B . n 
B 1 60  PRO 60  98  98  PRO PRO B . n 
B 1 61  CYS 61  99  99  CYS CYS B . n 
B 1 62  ASP 62  100 100 ASP ASP B . n 
B 1 63  ILE 63  101 101 ILE ILE B . n 
B 1 64  THR 64  102 102 THR THR B . n 
B 1 65  GLU 65  103 103 GLU GLU B . n 
B 1 66  GLU 66  104 104 GLU GLU B . n 
B 1 67  ASP 67  105 105 ASP ASP B . n 
B 1 68  TYR 68  106 106 TYR TYR B . n 
B 1 69  GLN 69  107 107 GLN GLN B . n 
B 1 70  PRO 70  108 108 PRO PRO B . n 
B 1 71  LEU 71  109 109 LEU LEU B . n 
B 1 72  MET 72  110 110 MET MET B . n 
B 1 73  LYS 73  111 111 LYS LYS B . n 
B 1 74  LEU 74  112 112 LEU LEU B . n 
B 1 75  GLY 75  113 113 GLY GLY B . n 
B 1 76  THR 76  114 114 THR THR B . n 
B 1 77  GLN 77  115 115 GLN GLN B . n 
B 1 78  THR 78  116 116 THR THR B . n 
B 1 79  VAL 79  117 117 VAL VAL B . n 
B 1 80  PRO 80  118 118 PRO PRO B . n 
B 1 81  CYS 81  119 119 CYS CYS B . n 
B 1 82  ASN 82  120 120 ASN ASN B . n 
B 1 83  LYS 83  121 121 LYS LYS B . n 
B 1 84  ILE 84  122 122 ILE ILE B . n 
B 1 85  LEU 85  123 123 LEU LEU B . n 
B 1 86  LEU 86  124 124 LEU LEU B . n 
B 1 87  TRP 87  125 125 TRP TRP B . n 
B 1 88  SER 88  126 126 SER SER B . n 
B 1 89  ARG 89  127 127 ARG ARG B . n 
B 1 90  ILE 90  128 128 ILE ILE B . n 
B 1 91  LYS 91  129 129 LYS LYS B . n 
B 1 92  ASP 92  130 130 ASP ASP B . n 
B 1 93  LEU 93  131 131 LEU LEU B . n 
B 1 94  ALA 94  132 132 ALA ALA B . n 
B 1 95  HIS 95  133 133 HIS HIS B . n 
B 1 96  GLN 96  134 134 GLN GLN B . n 
B 1 97  PHE 97  135 135 PHE PHE B . n 
B 1 98  THR 98  136 136 THR THR B . n 
B 1 99  GLN 99  137 137 GLN GLN B . n 
B 1 100 VAL 100 138 138 VAL VAL B . n 
B 1 101 GLN 101 139 139 GLN GLN B . n 
B 1 102 ARG 102 140 140 ARG ARG B . n 
B 1 103 ASP 103 141 141 ASP ASP B . n 
B 1 104 MET 104 142 142 MET MET B . n 
B 1 105 PHE 105 143 143 PHE PHE B . n 
B 1 106 THR 106 144 144 THR THR B . n 
B 1 107 LEU 107 145 145 LEU LEU B . n 
B 1 108 GLU 108 146 146 GLU GLU B . n 
B 1 109 ASP 109 147 147 ASP ASP B . n 
B 1 110 THR 110 148 148 THR THR B . n 
B 1 111 LEU 111 149 149 LEU LEU B . n 
B 1 112 LEU 112 150 150 LEU LEU B . n 
B 1 113 GLY 113 151 151 GLY GLY B . n 
B 1 114 TYR 114 152 152 TYR TYR B . n 
B 1 115 LEU 115 153 153 LEU LEU B . n 
B 1 116 ALA 116 154 154 ALA ALA B . n 
B 1 117 ASP 117 155 155 ASP ASP B . n 
B 1 118 ASP 118 156 156 ASP ASP B . n 
B 1 119 LEU 119 157 157 LEU LEU B . n 
B 1 120 THR 120 158 158 THR THR B . n 
B 1 121 TRP 121 159 159 TRP TRP B . n 
B 1 122 CYS 122 160 160 CYS CYS B . n 
B 1 123 GLY 123 161 161 GLY GLY B . n 
B 1 124 GLU 124 162 162 GLU GLU B . n 
B 1 125 PHE 125 163 163 PHE PHE B . n 
B 1 126 ASP 126 164 164 ASP ASP B . n 
B 1 127 THR 127 165 165 THR THR B . n 
B 1 128 SER 128 166 166 SER SER B . n 
B 1 129 LYS 129 167 167 LYS LYS B . n 
B 1 130 ILE 130 168 168 ILE ILE B . n 
B 1 131 ASN 131 169 169 ASN ASN B . n 
B 1 132 TYR 132 170 170 TYR TYR B . n 
B 1 133 GLN 133 171 171 GLN GLN B . n 
B 1 134 SER 134 172 172 SER SER B . n 
B 1 135 CYS 135 173 173 CYS CYS B . n 
B 1 136 PRO 136 174 174 PRO PRO B . n 
B 1 137 ASP 137 175 175 ASP ASP B . n 
B 1 138 TRP 138 176 176 TRP TRP B . n 
B 1 139 ARG 139 177 177 ARG ARG B . n 
B 1 140 LYS 140 178 178 LYS LYS B . n 
B 1 141 ASP 141 179 179 ASP ASP B . n 
B 1 142 CYS 142 180 180 CYS CYS B . n 
B 1 143 SER 143 181 181 SER SER B . n 
B 1 144 ASN 144 182 182 ASN ASN B . n 
B 1 145 ASN 145 183 183 ASN ASN B . n 
B 1 146 PRO 146 184 184 PRO PRO B . n 
B 1 147 VAL 147 185 185 VAL VAL B . n 
B 1 148 SER 148 186 186 SER SER B . n 
B 1 149 VAL 149 187 187 VAL VAL B . n 
B 1 150 PHE 150 188 188 PHE PHE B . n 
B 1 151 TRP 151 189 189 TRP TRP B . n 
B 1 152 LYS 152 190 190 LYS LYS B . n 
B 1 153 THR 153 191 191 THR THR B . n 
B 1 154 VAL 154 192 192 VAL VAL B . n 
B 1 155 SER 155 193 193 SER SER B . n 
B 1 156 ARG 156 194 194 ARG ARG B . n 
B 1 157 ARG 157 195 195 ARG ARG B . n 
B 1 158 PHE 158 196 196 PHE PHE B . n 
B 1 159 ALA 159 197 197 ALA ALA B . n 
B 1 160 GLU 160 198 198 GLU GLU B . n 
B 1 161 ALA 161 199 199 ALA ALA B . n 
B 1 162 ALA 162 200 200 ALA ALA B . n 
B 1 163 CYS 163 201 201 CYS CYS B . n 
B 1 164 ASP 164 202 202 ASP ASP B . n 
B 1 165 VAL 165 203 203 VAL VAL B . n 
B 1 166 VAL 166 204 204 VAL VAL B . n 
B 1 167 HIS 167 205 205 HIS HIS B . n 
B 1 168 VAL 168 206 206 VAL VAL B . n 
B 1 169 MET 169 207 207 MET MET B . n 
B 1 170 LEU 170 208 208 LEU LEU B . n 
B 1 171 ASP 171 209 209 ASP ASP B . n 
B 1 172 GLY 172 210 210 GLY GLY B . n 
B 1 173 SER 173 211 211 SER SER B . n 
B 1 174 ARG 174 212 212 ARG ARG B . n 
B 1 175 SER 175 213 213 SER SER B . n 
B 1 176 LYS 176 214 214 LYS LYS B . n 
B 1 177 ILE 177 215 215 ILE ILE B . n 
B 1 178 PHE 178 216 216 PHE PHE B . n 
B 1 179 ASP 179 217 217 ASP ASP B . n 
B 1 180 LYS 180 218 218 LYS LYS B . n 
B 1 181 ASP 181 219 219 ASP ASP B . n 
B 1 182 SER 182 220 220 SER SER B . n 
B 1 183 THR 183 221 221 THR THR B . n 
B 1 184 PHE 184 222 222 PHE PHE B . n 
B 1 185 GLY 185 223 223 GLY GLY B . n 
B 1 186 SER 186 224 224 SER SER B . n 
B 1 187 VAL 187 225 225 VAL VAL B . n 
B 1 188 GLU 188 226 226 GLU GLU B . n 
B 1 189 VAL 189 227 227 VAL VAL B . n 
B 1 190 HIS 190 228 228 HIS HIS B . n 
B 1 191 ASN 191 229 229 ASN ASN B . n 
B 1 192 LEU 192 230 230 LEU LEU B . n 
B 1 193 GLN 193 231 231 GLN GLN B . n 
B 1 194 PRO 194 232 232 PRO PRO B . n 
B 1 195 GLU 195 233 233 GLU GLU B . n 
B 1 196 LYS 196 234 234 LYS LYS B . n 
B 1 197 VAL 197 235 235 VAL VAL B . n 
B 1 198 GLN 198 236 236 GLN GLN B . n 
B 1 199 THR 199 237 237 THR THR B . n 
B 1 200 LEU 200 238 238 LEU LEU B . n 
B 1 201 GLU 201 239 239 GLU GLU B . n 
B 1 202 ALA 202 240 240 ALA ALA B . n 
B 1 203 TRP 203 241 241 TRP TRP B . n 
B 1 204 VAL 204 242 242 VAL VAL B . n 
B 1 205 ILE 205 243 243 ILE ILE B . n 
B 1 206 HIS 206 244 244 HIS HIS B . n 
B 1 207 GLY 207 245 245 GLY GLY B . n 
B 1 208 GLY 208 246 246 GLY GLY B . n 
B 1 209 ARG 209 247 247 ARG ARG B . n 
B 1 210 GLU 210 248 248 GLU GLU B . n 
B 1 211 ASP 211 249 249 ASP ASP B . n 
B 1 212 SER 212 250 250 SER SER B . n 
B 1 213 ARG 213 251 251 ARG ARG B . n 
B 1 214 ASP 214 252 252 ASP ASP B . n 
B 1 215 LEU 215 253 253 LEU LEU B . n 
B 1 216 CYS 216 254 254 CYS CYS B . n 
B 1 217 GLN 217 255 255 GLN GLN B . n 
B 1 218 ASP 218 256 256 ASP ASP B . n 
B 1 219 PRO 219 257 257 PRO PRO B . n 
B 1 220 THR 220 258 258 THR THR B . n 
B 1 221 ILE 221 259 259 ILE ILE B . n 
B 1 222 LYS 222 260 260 LYS LYS B . n 
B 1 223 GLU 223 261 261 GLU GLU B . n 
B 1 224 LEU 224 262 262 LEU LEU B . n 
B 1 225 GLU 225 263 263 GLU GLU B . n 
B 1 226 SER 226 264 264 SER SER B . n 
B 1 227 ILE 227 265 265 ILE ILE B . n 
B 1 228 ILE 228 266 266 ILE ILE B . n 
B 1 229 SER 229 267 267 SER SER B . n 
B 1 230 LYS 230 268 268 LYS LYS B . n 
B 1 231 ARG 231 269 269 ARG ARG B . n 
B 1 232 ASN 232 270 270 ASN ASN B . n 
B 1 233 ILE 233 271 271 ILE ILE B . n 
B 1 234 GLN 234 272 272 GLN GLN B . n 
B 1 235 PHE 235 273 273 PHE PHE B . n 
B 1 236 SER 236 274 274 SER SER B . n 
B 1 237 CYS 237 275 275 CYS CYS B . n 
B 1 238 LYS 238 276 276 LYS LYS B . n 
B 1 239 ASN 239 277 277 ASN ASN B . n 
B 1 240 ILE 240 278 278 ILE ILE B . n 
B 1 241 TYR 241 279 279 TYR TYR B . n 
B 1 242 ARG 242 280 280 ARG ARG B . n 
B 1 243 PRO 243 281 281 PRO PRO B . n 
B 1 244 ASP 244 282 282 ASP ASP B . n 
B 1 245 LYS 245 283 283 LYS LYS B . n 
B 1 246 PHE 246 284 284 PHE PHE B . n 
B 1 247 LEU 247 285 285 LEU LEU B . n 
B 1 248 GLN 248 286 286 GLN GLN B . n 
B 1 249 CYS 249 287 287 CYS CYS B . n 
B 1 250 VAL 250 288 288 VAL VAL B . n 
B 1 251 LYS 251 289 289 LYS LYS B . n 
B 1 252 ASN 252 290 290 ASN ASN B . n 
B 1 253 PRO 253 291 291 PRO PRO B . n 
B 1 254 GLU 254 292 292 GLU GLU B . n 
B 1 255 ASP 255 293 293 ASP ASP B . n 
B 1 256 SER 256 294 294 SER SER B . n 
B 1 257 SER 257 295 295 SER SER B . n 
B 1 258 CYS 258 296 296 CYS CYS B . n 
B 1 259 THR 259 297 ?   ?   ?   B . n 
B 1 260 SER 260 298 ?   ?   ?   B . n 
B 1 261 GLU 261 299 ?   ?   ?   B . n 
B 1 262 ILE 262 300 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 G1R 1   301 301 G1R G1R A . 
D 2 G1R 1   302 302 G1R G1R A . 
E 2 G1R 1   301 301 G1R G1R B . 
F 3 G2R 1   302 302 G2R G2R B . 
G 4 HOH 1   303 1   HOH HOH A . 
G 4 HOH 2   304 2   HOH HOH A . 
G 4 HOH 3   305 3   HOH HOH A . 
G 4 HOH 4   306 8   HOH HOH A . 
G 4 HOH 5   307 10  HOH HOH A . 
G 4 HOH 6   308 13  HOH HOH A . 
G 4 HOH 7   309 14  HOH HOH A . 
G 4 HOH 8   310 18  HOH HOH A . 
G 4 HOH 9   311 21  HOH HOH A . 
G 4 HOH 10  312 24  HOH HOH A . 
G 4 HOH 11  313 27  HOH HOH A . 
G 4 HOH 12  314 29  HOH HOH A . 
G 4 HOH 13  315 30  HOH HOH A . 
G 4 HOH 14  316 31  HOH HOH A . 
G 4 HOH 15  317 39  HOH HOH A . 
G 4 HOH 16  318 41  HOH HOH A . 
G 4 HOH 17  319 42  HOH HOH A . 
G 4 HOH 18  320 43  HOH HOH A . 
G 4 HOH 19  321 44  HOH HOH A . 
G 4 HOH 20  322 46  HOH HOH A . 
G 4 HOH 21  323 48  HOH HOH A . 
G 4 HOH 22  324 49  HOH HOH A . 
G 4 HOH 23  325 52  HOH HOH A . 
G 4 HOH 24  326 56  HOH HOH A . 
G 4 HOH 25  327 57  HOH HOH A . 
G 4 HOH 26  328 62  HOH HOH A . 
G 4 HOH 27  329 63  HOH HOH A . 
G 4 HOH 28  330 64  HOH HOH A . 
G 4 HOH 29  331 65  HOH HOH A . 
G 4 HOH 30  332 66  HOH HOH A . 
G 4 HOH 31  333 67  HOH HOH A . 
G 4 HOH 32  334 69  HOH HOH A . 
G 4 HOH 33  335 70  HOH HOH A . 
G 4 HOH 34  336 72  HOH HOH A . 
G 4 HOH 35  337 74  HOH HOH A . 
G 4 HOH 36  338 76  HOH HOH A . 
G 4 HOH 37  339 77  HOH HOH A . 
G 4 HOH 38  340 78  HOH HOH A . 
G 4 HOH 39  341 80  HOH HOH A . 
G 4 HOH 40  342 82  HOH HOH A . 
G 4 HOH 41  343 84  HOH HOH A . 
G 4 HOH 42  344 85  HOH HOH A . 
G 4 HOH 43  345 86  HOH HOH A . 
G 4 HOH 44  346 87  HOH HOH A . 
G 4 HOH 45  347 88  HOH HOH A . 
G 4 HOH 46  348 90  HOH HOH A . 
G 4 HOH 47  349 91  HOH HOH A . 
G 4 HOH 48  350 92  HOH HOH A . 
G 4 HOH 49  351 94  HOH HOH A . 
G 4 HOH 50  352 95  HOH HOH A . 
G 4 HOH 51  353 97  HOH HOH A . 
G 4 HOH 52  354 98  HOH HOH A . 
G 4 HOH 53  355 99  HOH HOH A . 
G 4 HOH 54  356 100 HOH HOH A . 
G 4 HOH 55  357 101 HOH HOH A . 
G 4 HOH 56  358 102 HOH HOH A . 
G 4 HOH 57  359 103 HOH HOH A . 
G 4 HOH 58  360 104 HOH HOH A . 
G 4 HOH 59  361 107 HOH HOH A . 
G 4 HOH 60  362 110 HOH HOH A . 
G 4 HOH 61  363 114 HOH HOH A . 
G 4 HOH 62  364 115 HOH HOH A . 
G 4 HOH 63  365 116 HOH HOH A . 
G 4 HOH 64  366 119 HOH HOH A . 
G 4 HOH 65  367 120 HOH HOH A . 
G 4 HOH 66  368 122 HOH HOH A . 
G 4 HOH 67  369 124 HOH HOH A . 
G 4 HOH 68  370 126 HOH HOH A . 
G 4 HOH 69  371 127 HOH HOH A . 
G 4 HOH 70  372 128 HOH HOH A . 
G 4 HOH 71  373 129 HOH HOH A . 
G 4 HOH 72  374 131 HOH HOH A . 
G 4 HOH 73  375 135 HOH HOH A . 
G 4 HOH 74  376 136 HOH HOH A . 
G 4 HOH 75  377 137 HOH HOH A . 
G 4 HOH 76  378 138 HOH HOH A . 
G 4 HOH 77  379 139 HOH HOH A . 
G 4 HOH 78  380 140 HOH HOH A . 
G 4 HOH 79  381 144 HOH HOH A . 
G 4 HOH 80  382 151 HOH HOH A . 
G 4 HOH 81  383 154 HOH HOH A . 
G 4 HOH 82  384 156 HOH HOH A . 
G 4 HOH 83  385 159 HOH HOH A . 
G 4 HOH 84  386 162 HOH HOH A . 
G 4 HOH 85  387 163 HOH HOH A . 
G 4 HOH 86  388 164 HOH HOH A . 
G 4 HOH 87  389 165 HOH HOH A . 
G 4 HOH 88  390 166 HOH HOH A . 
G 4 HOH 89  391 167 HOH HOH A . 
G 4 HOH 90  392 174 HOH HOH A . 
G 4 HOH 91  393 175 HOH HOH A . 
G 4 HOH 92  394 180 HOH HOH A . 
G 4 HOH 93  395 181 HOH HOH A . 
G 4 HOH 94  396 182 HOH HOH A . 
G 4 HOH 95  397 185 HOH HOH A . 
G 4 HOH 96  398 187 HOH HOH A . 
G 4 HOH 97  399 189 HOH HOH A . 
G 4 HOH 98  400 190 HOH HOH A . 
G 4 HOH 99  401 193 HOH HOH A . 
G 4 HOH 100 402 195 HOH HOH A . 
G 4 HOH 101 403 197 HOH HOH A . 
G 4 HOH 102 404 199 HOH HOH A . 
G 4 HOH 103 405 200 HOH HOH A . 
G 4 HOH 104 406 201 HOH HOH A . 
G 4 HOH 105 407 202 HOH HOH A . 
G 4 HOH 106 408 203 HOH HOH A . 
G 4 HOH 107 409 204 HOH HOH A . 
G 4 HOH 108 410 206 HOH HOH A . 
G 4 HOH 109 411 211 HOH HOH A . 
G 4 HOH 110 412 212 HOH HOH A . 
G 4 HOH 111 413 213 HOH HOH A . 
G 4 HOH 112 414 214 HOH HOH A . 
G 4 HOH 113 415 215 HOH HOH A . 
G 4 HOH 114 416 219 HOH HOH A . 
G 4 HOH 115 417 220 HOH HOH A . 
G 4 HOH 116 418 222 HOH HOH A . 
G 4 HOH 117 419 226 HOH HOH A . 
G 4 HOH 118 420 236 HOH HOH A . 
G 4 HOH 119 421 237 HOH HOH A . 
G 4 HOH 120 422 238 HOH HOH A . 
G 4 HOH 121 423 239 HOH HOH A . 
G 4 HOH 122 424 240 HOH HOH A . 
G 4 HOH 123 425 241 HOH HOH A . 
G 4 HOH 124 426 244 HOH HOH A . 
G 4 HOH 125 427 245 HOH HOH A . 
G 4 HOH 126 428 246 HOH HOH A . 
G 4 HOH 127 429 248 HOH HOH A . 
G 4 HOH 128 430 250 HOH HOH A . 
G 4 HOH 129 431 251 HOH HOH A . 
G 4 HOH 130 432 252 HOH HOH A . 
G 4 HOH 131 433 254 HOH HOH A . 
G 4 HOH 132 434 255 HOH HOH A . 
G 4 HOH 133 435 257 HOH HOH A . 
G 4 HOH 134 436 258 HOH HOH A . 
G 4 HOH 135 437 261 HOH HOH A . 
G 4 HOH 136 438 263 HOH HOH A . 
G 4 HOH 137 439 264 HOH HOH A . 
G 4 HOH 138 440 267 HOH HOH A . 
G 4 HOH 139 441 268 HOH HOH A . 
G 4 HOH 140 442 269 HOH HOH A . 
G 4 HOH 141 443 270 HOH HOH A . 
G 4 HOH 142 444 271 HOH HOH A . 
G 4 HOH 143 445 275 HOH HOH A . 
G 4 HOH 144 446 276 HOH HOH A . 
G 4 HOH 145 447 277 HOH HOH A . 
G 4 HOH 146 448 278 HOH HOH A . 
G 4 HOH 147 449 282 HOH HOH A . 
G 4 HOH 148 450 283 HOH HOH A . 
G 4 HOH 149 451 285 HOH HOH A . 
G 4 HOH 150 452 289 HOH HOH A . 
G 4 HOH 151 453 291 HOH HOH A . 
G 4 HOH 152 454 294 HOH HOH A . 
G 4 HOH 153 455 297 HOH HOH A . 
G 4 HOH 154 456 298 HOH HOH A . 
G 4 HOH 155 457 300 HOH HOH A . 
G 4 HOH 156 458 301 HOH HOH A . 
G 4 HOH 157 459 303 HOH HOH A . 
G 4 HOH 158 460 305 HOH HOH A . 
G 4 HOH 159 461 307 HOH HOH A . 
G 4 HOH 160 462 312 HOH HOH A . 
G 4 HOH 161 463 314 HOH HOH A . 
G 4 HOH 162 464 316 HOH HOH A . 
G 4 HOH 163 465 318 HOH HOH A . 
G 4 HOH 164 466 320 HOH HOH A . 
G 4 HOH 165 467 321 HOH HOH A . 
G 4 HOH 166 468 322 HOH HOH A . 
G 4 HOH 167 469 323 HOH HOH A . 
G 4 HOH 168 470 324 HOH HOH A . 
G 4 HOH 169 471 326 HOH HOH A . 
G 4 HOH 170 472 328 HOH HOH A . 
G 4 HOH 171 473 329 HOH HOH A . 
G 4 HOH 172 474 336 HOH HOH A . 
G 4 HOH 173 475 338 HOH HOH A . 
G 4 HOH 174 476 339 HOH HOH A . 
G 4 HOH 175 477 340 HOH HOH A . 
G 4 HOH 176 478 341 HOH HOH A . 
G 4 HOH 177 479 342 HOH HOH A . 
G 4 HOH 178 480 344 HOH HOH A . 
G 4 HOH 179 481 346 HOH HOH A . 
G 4 HOH 180 482 347 HOH HOH A . 
G 4 HOH 181 483 348 HOH HOH A . 
G 4 HOH 182 484 349 HOH HOH A . 
G 4 HOH 183 485 351 HOH HOH A . 
G 4 HOH 184 486 352 HOH HOH A . 
G 4 HOH 185 487 356 HOH HOH A . 
G 4 HOH 186 488 357 HOH HOH A . 
G 4 HOH 187 489 362 HOH HOH A . 
G 4 HOH 188 490 364 HOH HOH A . 
G 4 HOH 189 491 368 HOH HOH A . 
G 4 HOH 190 492 369 HOH HOH A . 
G 4 HOH 191 493 371 HOH HOH A . 
G 4 HOH 192 494 372 HOH HOH A . 
G 4 HOH 193 495 373 HOH HOH A . 
G 4 HOH 194 496 374 HOH HOH A . 
G 4 HOH 195 497 375 HOH HOH A . 
G 4 HOH 196 498 376 HOH HOH A . 
G 4 HOH 197 499 377 HOH HOH A . 
G 4 HOH 198 500 378 HOH HOH A . 
G 4 HOH 199 501 379 HOH HOH A . 
G 4 HOH 200 502 381 HOH HOH A . 
G 4 HOH 201 503 383 HOH HOH A . 
G 4 HOH 202 504 384 HOH HOH A . 
G 4 HOH 203 505 385 HOH HOH A . 
G 4 HOH 204 506 386 HOH HOH A . 
G 4 HOH 205 507 396 HOH HOH A . 
G 4 HOH 206 508 397 HOH HOH A . 
G 4 HOH 207 509 399 HOH HOH A . 
G 4 HOH 208 510 401 HOH HOH A . 
G 4 HOH 209 511 402 HOH HOH A . 
G 4 HOH 210 512 404 HOH HOH A . 
G 4 HOH 211 513 405 HOH HOH A . 
G 4 HOH 212 514 407 HOH HOH A . 
G 4 HOH 213 515 408 HOH HOH A . 
G 4 HOH 214 516 409 HOH HOH A . 
G 4 HOH 215 517 410 HOH HOH A . 
G 4 HOH 216 518 411 HOH HOH A . 
G 4 HOH 217 519 412 HOH HOH A . 
G 4 HOH 218 520 413 HOH HOH A . 
G 4 HOH 219 521 415 HOH HOH A . 
G 4 HOH 220 522 418 HOH HOH A . 
G 4 HOH 221 523 419 HOH HOH A . 
G 4 HOH 222 524 423 HOH HOH A . 
G 4 HOH 223 525 425 HOH HOH A . 
G 4 HOH 224 526 429 HOH HOH A . 
G 4 HOH 225 527 430 HOH HOH A . 
G 4 HOH 226 528 433 HOH HOH A . 
G 4 HOH 227 529 436 HOH HOH A . 
G 4 HOH 228 530 438 HOH HOH A . 
G 4 HOH 229 531 441 HOH HOH A . 
G 4 HOH 230 532 442 HOH HOH A . 
G 4 HOH 231 533 446 HOH HOH A . 
G 4 HOH 232 534 447 HOH HOH A . 
G 4 HOH 233 535 451 HOH HOH A . 
G 4 HOH 234 536 452 HOH HOH A . 
G 4 HOH 235 537 453 HOH HOH A . 
H 4 HOH 1   303 4   HOH HOH B . 
H 4 HOH 2   304 5   HOH HOH B . 
H 4 HOH 3   305 6   HOH HOH B . 
H 4 HOH 4   306 7   HOH HOH B . 
H 4 HOH 5   307 9   HOH HOH B . 
H 4 HOH 6   308 11  HOH HOH B . 
H 4 HOH 7   309 12  HOH HOH B . 
H 4 HOH 8   310 15  HOH HOH B . 
H 4 HOH 9   311 16  HOH HOH B . 
H 4 HOH 10  312 17  HOH HOH B . 
H 4 HOH 11  313 19  HOH HOH B . 
H 4 HOH 12  314 20  HOH HOH B . 
H 4 HOH 13  315 22  HOH HOH B . 
H 4 HOH 14  316 23  HOH HOH B . 
H 4 HOH 15  317 25  HOH HOH B . 
H 4 HOH 16  318 26  HOH HOH B . 
H 4 HOH 17  319 28  HOH HOH B . 
H 4 HOH 18  320 32  HOH HOH B . 
H 4 HOH 19  321 33  HOH HOH B . 
H 4 HOH 20  322 34  HOH HOH B . 
H 4 HOH 21  323 35  HOH HOH B . 
H 4 HOH 22  324 36  HOH HOH B . 
H 4 HOH 23  325 37  HOH HOH B . 
H 4 HOH 24  326 38  HOH HOH B . 
H 4 HOH 25  327 40  HOH HOH B . 
H 4 HOH 26  328 45  HOH HOH B . 
H 4 HOH 27  329 47  HOH HOH B . 
H 4 HOH 28  330 50  HOH HOH B . 
H 4 HOH 29  331 51  HOH HOH B . 
H 4 HOH 30  332 53  HOH HOH B . 
H 4 HOH 31  333 54  HOH HOH B . 
H 4 HOH 32  334 55  HOH HOH B . 
H 4 HOH 33  335 58  HOH HOH B . 
H 4 HOH 34  336 59  HOH HOH B . 
H 4 HOH 35  337 60  HOH HOH B . 
H 4 HOH 36  338 61  HOH HOH B . 
H 4 HOH 37  339 68  HOH HOH B . 
H 4 HOH 38  340 71  HOH HOH B . 
H 4 HOH 39  341 73  HOH HOH B . 
H 4 HOH 40  342 75  HOH HOH B . 
H 4 HOH 41  343 79  HOH HOH B . 
H 4 HOH 42  344 81  HOH HOH B . 
H 4 HOH 43  345 83  HOH HOH B . 
H 4 HOH 44  346 89  HOH HOH B . 
H 4 HOH 45  347 93  HOH HOH B . 
H 4 HOH 46  348 96  HOH HOH B . 
H 4 HOH 47  349 105 HOH HOH B . 
H 4 HOH 48  350 106 HOH HOH B . 
H 4 HOH 49  351 108 HOH HOH B . 
H 4 HOH 50  352 109 HOH HOH B . 
H 4 HOH 51  353 111 HOH HOH B . 
H 4 HOH 52  354 112 HOH HOH B . 
H 4 HOH 53  355 113 HOH HOH B . 
H 4 HOH 54  356 117 HOH HOH B . 
H 4 HOH 55  357 118 HOH HOH B . 
H 4 HOH 56  358 121 HOH HOH B . 
H 4 HOH 57  359 123 HOH HOH B . 
H 4 HOH 58  360 125 HOH HOH B . 
H 4 HOH 59  361 130 HOH HOH B . 
H 4 HOH 60  362 132 HOH HOH B . 
H 4 HOH 61  363 133 HOH HOH B . 
H 4 HOH 62  364 134 HOH HOH B . 
H 4 HOH 63  365 141 HOH HOH B . 
H 4 HOH 64  366 142 HOH HOH B . 
H 4 HOH 65  367 143 HOH HOH B . 
H 4 HOH 66  368 145 HOH HOH B . 
H 4 HOH 67  369 146 HOH HOH B . 
H 4 HOH 68  370 147 HOH HOH B . 
H 4 HOH 69  371 148 HOH HOH B . 
H 4 HOH 70  372 149 HOH HOH B . 
H 4 HOH 71  373 150 HOH HOH B . 
H 4 HOH 72  374 152 HOH HOH B . 
H 4 HOH 73  375 153 HOH HOH B . 
H 4 HOH 74  376 155 HOH HOH B . 
H 4 HOH 75  377 157 HOH HOH B . 
H 4 HOH 76  378 158 HOH HOH B . 
H 4 HOH 77  379 160 HOH HOH B . 
H 4 HOH 78  380 161 HOH HOH B . 
H 4 HOH 79  381 168 HOH HOH B . 
H 4 HOH 80  382 169 HOH HOH B . 
H 4 HOH 81  383 170 HOH HOH B . 
H 4 HOH 82  384 171 HOH HOH B . 
H 4 HOH 83  385 172 HOH HOH B . 
H 4 HOH 84  386 173 HOH HOH B . 
H 4 HOH 85  387 176 HOH HOH B . 
H 4 HOH 86  388 177 HOH HOH B . 
H 4 HOH 87  389 178 HOH HOH B . 
H 4 HOH 88  390 179 HOH HOH B . 
H 4 HOH 89  391 183 HOH HOH B . 
H 4 HOH 90  392 184 HOH HOH B . 
H 4 HOH 91  393 186 HOH HOH B . 
H 4 HOH 92  394 188 HOH HOH B . 
H 4 HOH 93  395 191 HOH HOH B . 
H 4 HOH 94  396 192 HOH HOH B . 
H 4 HOH 95  397 194 HOH HOH B . 
H 4 HOH 96  398 196 HOH HOH B . 
H 4 HOH 97  399 198 HOH HOH B . 
H 4 HOH 98  400 205 HOH HOH B . 
H 4 HOH 99  401 207 HOH HOH B . 
H 4 HOH 100 402 208 HOH HOH B . 
H 4 HOH 101 403 209 HOH HOH B . 
H 4 HOH 102 404 210 HOH HOH B . 
H 4 HOH 103 405 216 HOH HOH B . 
H 4 HOH 104 406 217 HOH HOH B . 
H 4 HOH 105 407 218 HOH HOH B . 
H 4 HOH 106 408 221 HOH HOH B . 
H 4 HOH 107 409 223 HOH HOH B . 
H 4 HOH 108 410 224 HOH HOH B . 
H 4 HOH 109 411 225 HOH HOH B . 
H 4 HOH 110 412 227 HOH HOH B . 
H 4 HOH 111 413 228 HOH HOH B . 
H 4 HOH 112 414 229 HOH HOH B . 
H 4 HOH 113 415 230 HOH HOH B . 
H 4 HOH 114 416 231 HOH HOH B . 
H 4 HOH 115 417 232 HOH HOH B . 
H 4 HOH 116 418 233 HOH HOH B . 
H 4 HOH 117 419 234 HOH HOH B . 
H 4 HOH 118 420 235 HOH HOH B . 
H 4 HOH 119 421 242 HOH HOH B . 
H 4 HOH 120 422 243 HOH HOH B . 
H 4 HOH 121 423 247 HOH HOH B . 
H 4 HOH 122 424 249 HOH HOH B . 
H 4 HOH 123 425 253 HOH HOH B . 
H 4 HOH 124 426 256 HOH HOH B . 
H 4 HOH 125 427 259 HOH HOH B . 
H 4 HOH 126 428 260 HOH HOH B . 
H 4 HOH 127 429 262 HOH HOH B . 
H 4 HOH 128 430 265 HOH HOH B . 
H 4 HOH 129 431 266 HOH HOH B . 
H 4 HOH 130 432 272 HOH HOH B . 
H 4 HOH 131 433 273 HOH HOH B . 
H 4 HOH 132 434 274 HOH HOH B . 
H 4 HOH 133 435 279 HOH HOH B . 
H 4 HOH 134 436 280 HOH HOH B . 
H 4 HOH 135 437 281 HOH HOH B . 
H 4 HOH 136 438 284 HOH HOH B . 
H 4 HOH 137 439 286 HOH HOH B . 
H 4 HOH 138 440 287 HOH HOH B . 
H 4 HOH 139 441 288 HOH HOH B . 
H 4 HOH 140 442 290 HOH HOH B . 
H 4 HOH 141 443 292 HOH HOH B . 
H 4 HOH 142 444 293 HOH HOH B . 
H 4 HOH 143 445 295 HOH HOH B . 
H 4 HOH 144 446 296 HOH HOH B . 
H 4 HOH 145 447 299 HOH HOH B . 
H 4 HOH 146 448 302 HOH HOH B . 
H 4 HOH 147 449 304 HOH HOH B . 
H 4 HOH 148 450 306 HOH HOH B . 
H 4 HOH 149 451 308 HOH HOH B . 
H 4 HOH 150 452 309 HOH HOH B . 
H 4 HOH 151 453 310 HOH HOH B . 
H 4 HOH 152 454 311 HOH HOH B . 
H 4 HOH 153 455 313 HOH HOH B . 
H 4 HOH 154 456 315 HOH HOH B . 
H 4 HOH 155 457 317 HOH HOH B . 
H 4 HOH 156 458 319 HOH HOH B . 
H 4 HOH 157 459 325 HOH HOH B . 
H 4 HOH 158 460 327 HOH HOH B . 
H 4 HOH 159 461 330 HOH HOH B . 
H 4 HOH 160 462 331 HOH HOH B . 
H 4 HOH 161 463 332 HOH HOH B . 
H 4 HOH 162 464 333 HOH HOH B . 
H 4 HOH 163 465 334 HOH HOH B . 
H 4 HOH 164 466 335 HOH HOH B . 
H 4 HOH 165 467 337 HOH HOH B . 
H 4 HOH 166 468 343 HOH HOH B . 
H 4 HOH 167 469 350 HOH HOH B . 
H 4 HOH 168 470 354 HOH HOH B . 
H 4 HOH 169 471 355 HOH HOH B . 
H 4 HOH 170 472 358 HOH HOH B . 
H 4 HOH 171 473 359 HOH HOH B . 
H 4 HOH 172 474 360 HOH HOH B . 
H 4 HOH 173 475 361 HOH HOH B . 
H 4 HOH 174 476 363 HOH HOH B . 
H 4 HOH 175 477 365 HOH HOH B . 
H 4 HOH 176 478 366 HOH HOH B . 
H 4 HOH 177 479 367 HOH HOH B . 
H 4 HOH 178 480 370 HOH HOH B . 
H 4 HOH 179 481 380 HOH HOH B . 
H 4 HOH 180 482 382 HOH HOH B . 
H 4 HOH 181 483 387 HOH HOH B . 
H 4 HOH 182 484 388 HOH HOH B . 
H 4 HOH 183 485 389 HOH HOH B . 
H 4 HOH 184 486 390 HOH HOH B . 
H 4 HOH 185 487 391 HOH HOH B . 
H 4 HOH 186 488 392 HOH HOH B . 
H 4 HOH 187 489 393 HOH HOH B . 
H 4 HOH 188 490 394 HOH HOH B . 
H 4 HOH 189 491 395 HOH HOH B . 
H 4 HOH 190 492 398 HOH HOH B . 
H 4 HOH 191 493 400 HOH HOH B . 
H 4 HOH 192 494 403 HOH HOH B . 
H 4 HOH 193 495 406 HOH HOH B . 
H 4 HOH 194 496 414 HOH HOH B . 
H 4 HOH 195 497 416 HOH HOH B . 
H 4 HOH 196 498 420 HOH HOH B . 
H 4 HOH 197 499 421 HOH HOH B . 
H 4 HOH 198 500 422 HOH HOH B . 
H 4 HOH 199 501 424 HOH HOH B . 
H 4 HOH 200 502 426 HOH HOH B . 
H 4 HOH 201 503 428 HOH HOH B . 
H 4 HOH 202 504 434 HOH HOH B . 
H 4 HOH 203 505 440 HOH HOH B . 
H 4 HOH 204 506 443 HOH HOH B . 
H 4 HOH 205 507 444 HOH HOH B . 
H 4 HOH 206 508 445 HOH HOH B . 
H 4 HOH 207 509 448 HOH HOH B . 
H 4 HOH 208 510 449 HOH HOH B . 
H 4 HOH 209 511 450 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-09-05 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
ADSC     'data collection' QUANTUM  ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
MOLREP   phasing           .        ? 5 
# 
_pdbx_database_remark.id     600 
_pdbx_database_remark.text   
;HETEROGEN
Het group G1R 301 A and G1R 302 A form a guanosine 
diphosphoribose dimer
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 118 ? ? -56.71  107.86  
2  1 ILE A 128 ? ? -144.36 40.34   
3  1 GLN A 139 ? ? -155.61 20.16   
4  1 ASP A 179 ? ? -109.71 -63.86  
5  1 CYS A 180 ? ? -171.71 143.98  
6  1 ASP A 202 ? ? 59.91   -121.40 
7  1 VAL A 225 ? ? -120.06 -60.06  
8  1 GLU A 248 ? ? 87.01   -114.73 
9  1 ASN A 270 ? ? 70.75   35.25   
10 1 GLU A 292 ? ? 54.60   -27.16  
11 1 SER A 295 ? ? 1.71    25.95   
12 1 ILE B 128 ? ? -151.41 42.51   
13 1 ASP B 179 ? ? -107.98 -77.31  
14 1 ASN B 182 ? ? -91.63  57.46   
15 1 ASP B 202 ? ? 58.55   -111.89 
16 1 SER B 213 ? ? 59.27   8.49    
17 1 ARG B 247 ? ? 50.00   6.89    
18 1 GLU B 248 ? ? 43.59   -91.30  
19 1 GLU B 292 ? ? 62.47   87.46   
20 1 ASP B 293 ? ? -170.48 116.74  
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 "C1'" ? A G1R 301 ? PLANAR       . 
2 1 "C3'" ? A G1R 301 ? 'WRONG HAND' . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 39  ? A LYS 1   
2  1 Y 1 A ARG 40  ? A ARG 2   
3  1 Y 1 A GLU 41  ? A GLU 3   
4  1 Y 1 A ALA 42  ? A ALA 4   
5  1 Y 1 A GLU 43  ? A GLU 5   
6  1 Y 1 A ALA 44  ? A ALA 6   
7  1 Y 1 A THR 297 ? A THR 259 
8  1 Y 1 A SER 298 ? A SER 260 
9  1 Y 1 A GLU 299 ? A GLU 261 
10 1 Y 1 A ILE 300 ? A ILE 262 
11 1 Y 1 B LYS 39  ? B LYS 1   
12 1 Y 1 B ARG 40  ? B ARG 2   
13 1 Y 1 B GLU 41  ? B GLU 3   
14 1 Y 1 B ALA 42  ? B ALA 4   
15 1 Y 1 B GLU 43  ? B GLU 5   
16 1 Y 1 B ALA 44  ? B ALA 6   
17 1 Y 1 B THR 297 ? B THR 259 
18 1 Y 1 B SER 298 ? B SER 260 
19 1 Y 1 B GLU 299 ? B GLU 261 
20 1 Y 1 B ILE 300 ? B ILE 262 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;[(2R,3R,4R,5R)-5-(2-AMINO-6-OXO-1,6-DIHYDRO-9H-PURIN-9-YL)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL [(2R,3S,4R,5S)-3,4,5-TRIHYDROXYTETRAHYDROFURAN-2-YL]METHYL DIHYDROGEN DIPHOSPHATE
;
G1R 
3 
;[(2R,3R,4R,5R)-5-(2-AMINO-6-OXO-1,6-DIHYDRO-9H-PURIN-9-YL)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL [(2R,3S,4S)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL DIHYDROGEN DIPHOSPHATE
;
G2R 
4 water HOH 
#