data_2I6A
# 
_entry.id   2I6A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2I6A         
RCSB  RCSB039190   
WWPDB D_1000039190 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2I6B 
_pdbx_database_related.details        '2I6B is the structure of human adenosine kinase in complex with an acetylinic inhibitor' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2I6A 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Muchmore, S.W.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of human adenosine kinase inhibitor complexes reveal two distinct binding modes.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            49 
_citation.page_first                6726 
_citation.page_last                 6731 
_citation.year                      2006 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17154503 
_citation.pdbx_database_id_DOI      10.1021/jm060189a 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muchmore, S.W.'  1  
primary 'Smith, R.A.'     2  
primary 'Stewart, A.O.'   3  
primary 'Cowart, M.D.'    4  
primary 'Gomtsyan, A.'    5  
primary 'Matulenko, M.A.' 6  
primary 'Yu, H.'          7  
primary 'Severin, J.M.'   8  
primary 'Bhagwat, S.S.'   9  
primary 'Lee, C.H.'       10 
primary 'Kowaluk, E.A.'   11 
primary 'Jarvis, M.F.'    12 
primary 'Jakob, C.L.'     13 
# 
_cell.entry_id           2I6A 
_cell.length_a           61.850 
_cell.length_b           66.930 
_cell.length_c           87.140 
_cell.angle_alpha        97.76 
_cell.angle_beta         103.70 
_cell.angle_gamma        89.95 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2I6A 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Adenosine kinase'                                                           38755.219 4   ? ? ? ? 
2 non-polymer syn '7-(5-DEOXY-BETA-D-RIBOFURANOSYL)-5-IODO-7H-PYRROLO[2,3-D]PYRIMIDIN-4-AMINE' 376.150   4   ? ? ? ? 
3 water       nat water                                                                        18.015    510 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Adenylate kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTSVRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQP
HKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVE
KARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKD
IKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECI
RAGHYAASIIIRRTGCTFPEKPDFH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTSVRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQP
HKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVE
KARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKD
IKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECI
RAGHYAASIIIRRTGCTFPEKPDFH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   SER n 
1 4   VAL n 
1 5   ARG n 
1 6   GLU n 
1 7   ASN n 
1 8   ILE n 
1 9   LEU n 
1 10  PHE n 
1 11  GLY n 
1 12  MET n 
1 13  GLY n 
1 14  ASN n 
1 15  PRO n 
1 16  LEU n 
1 17  LEU n 
1 18  ASP n 
1 19  ILE n 
1 20  SER n 
1 21  ALA n 
1 22  VAL n 
1 23  VAL n 
1 24  ASP n 
1 25  LYS n 
1 26  ASP n 
1 27  PHE n 
1 28  LEU n 
1 29  ASP n 
1 30  LYS n 
1 31  TYR n 
1 32  SER n 
1 33  LEU n 
1 34  LYS n 
1 35  PRO n 
1 36  ASN n 
1 37  ASP n 
1 38  GLN n 
1 39  ILE n 
1 40  LEU n 
1 41  ALA n 
1 42  GLU n 
1 43  ASP n 
1 44  LYS n 
1 45  HIS n 
1 46  LYS n 
1 47  GLU n 
1 48  LEU n 
1 49  PHE n 
1 50  ASP n 
1 51  GLU n 
1 52  LEU n 
1 53  VAL n 
1 54  LYS n 
1 55  LYS n 
1 56  PHE n 
1 57  LYS n 
1 58  VAL n 
1 59  GLU n 
1 60  TYR n 
1 61  HIS n 
1 62  ALA n 
1 63  GLY n 
1 64  GLY n 
1 65  SER n 
1 66  THR n 
1 67  GLN n 
1 68  ASN n 
1 69  SER n 
1 70  ILE n 
1 71  LYS n 
1 72  VAL n 
1 73  ALA n 
1 74  GLN n 
1 75  TRP n 
1 76  MET n 
1 77  ILE n 
1 78  GLN n 
1 79  GLN n 
1 80  PRO n 
1 81  HIS n 
1 82  LYS n 
1 83  ALA n 
1 84  ALA n 
1 85  THR n 
1 86  PHE n 
1 87  PHE n 
1 88  GLY n 
1 89  CYS n 
1 90  ILE n 
1 91  GLY n 
1 92  ILE n 
1 93  ASP n 
1 94  LYS n 
1 95  PHE n 
1 96  GLY n 
1 97  GLU n 
1 98  ILE n 
1 99  LEU n 
1 100 LYS n 
1 101 ARG n 
1 102 LYS n 
1 103 ALA n 
1 104 ALA n 
1 105 GLU n 
1 106 ALA n 
1 107 HIS n 
1 108 VAL n 
1 109 ASP n 
1 110 ALA n 
1 111 HIS n 
1 112 TYR n 
1 113 TYR n 
1 114 GLU n 
1 115 GLN n 
1 116 ASN n 
1 117 GLU n 
1 118 GLN n 
1 119 PRO n 
1 120 THR n 
1 121 GLY n 
1 122 THR n 
1 123 CYS n 
1 124 ALA n 
1 125 ALA n 
1 126 CYS n 
1 127 ILE n 
1 128 THR n 
1 129 GLY n 
1 130 ASP n 
1 131 ASN n 
1 132 ARG n 
1 133 SER n 
1 134 LEU n 
1 135 ILE n 
1 136 ALA n 
1 137 ASN n 
1 138 LEU n 
1 139 ALA n 
1 140 ALA n 
1 141 ALA n 
1 142 ASN n 
1 143 CYS n 
1 144 TYR n 
1 145 LYS n 
1 146 LYS n 
1 147 GLU n 
1 148 LYS n 
1 149 HIS n 
1 150 LEU n 
1 151 ASP n 
1 152 LEU n 
1 153 GLU n 
1 154 LYS n 
1 155 ASN n 
1 156 TRP n 
1 157 MET n 
1 158 LEU n 
1 159 VAL n 
1 160 GLU n 
1 161 LYS n 
1 162 ALA n 
1 163 ARG n 
1 164 VAL n 
1 165 CYS n 
1 166 TYR n 
1 167 ILE n 
1 168 ALA n 
1 169 GLY n 
1 170 PHE n 
1 171 PHE n 
1 172 LEU n 
1 173 THR n 
1 174 VAL n 
1 175 SER n 
1 176 PRO n 
1 177 GLU n 
1 178 SER n 
1 179 VAL n 
1 180 LEU n 
1 181 LYS n 
1 182 VAL n 
1 183 ALA n 
1 184 HIS n 
1 185 HIS n 
1 186 ALA n 
1 187 SER n 
1 188 GLU n 
1 189 ASN n 
1 190 ASN n 
1 191 ARG n 
1 192 ILE n 
1 193 PHE n 
1 194 THR n 
1 195 LEU n 
1 196 ASN n 
1 197 LEU n 
1 198 SER n 
1 199 ALA n 
1 200 PRO n 
1 201 PHE n 
1 202 ILE n 
1 203 SER n 
1 204 GLN n 
1 205 PHE n 
1 206 TYR n 
1 207 LYS n 
1 208 GLU n 
1 209 SER n 
1 210 LEU n 
1 211 MET n 
1 212 LYS n 
1 213 VAL n 
1 214 MET n 
1 215 PRO n 
1 216 TYR n 
1 217 VAL n 
1 218 ASP n 
1 219 ILE n 
1 220 LEU n 
1 221 PHE n 
1 222 GLY n 
1 223 ASN n 
1 224 GLU n 
1 225 THR n 
1 226 GLU n 
1 227 ALA n 
1 228 ALA n 
1 229 THR n 
1 230 PHE n 
1 231 ALA n 
1 232 ARG n 
1 233 GLU n 
1 234 GLN n 
1 235 GLY n 
1 236 PHE n 
1 237 GLU n 
1 238 THR n 
1 239 LYS n 
1 240 ASP n 
1 241 ILE n 
1 242 LYS n 
1 243 GLU n 
1 244 ILE n 
1 245 ALA n 
1 246 LYS n 
1 247 LYS n 
1 248 THR n 
1 249 GLN n 
1 250 ALA n 
1 251 LEU n 
1 252 PRO n 
1 253 LYS n 
1 254 MET n 
1 255 ASN n 
1 256 SER n 
1 257 LYS n 
1 258 ARG n 
1 259 GLN n 
1 260 ARG n 
1 261 ILE n 
1 262 VAL n 
1 263 ILE n 
1 264 PHE n 
1 265 THR n 
1 266 GLN n 
1 267 GLY n 
1 268 ARG n 
1 269 ASP n 
1 270 ASP n 
1 271 THR n 
1 272 ILE n 
1 273 MET n 
1 274 ALA n 
1 275 THR n 
1 276 GLU n 
1 277 SER n 
1 278 GLU n 
1 279 VAL n 
1 280 THR n 
1 281 ALA n 
1 282 PHE n 
1 283 ALA n 
1 284 VAL n 
1 285 LEU n 
1 286 ASP n 
1 287 GLN n 
1 288 ASP n 
1 289 GLN n 
1 290 LYS n 
1 291 GLU n 
1 292 ILE n 
1 293 ILE n 
1 294 ASP n 
1 295 THR n 
1 296 ASN n 
1 297 GLY n 
1 298 ALA n 
1 299 GLY n 
1 300 ASP n 
1 301 ALA n 
1 302 PHE n 
1 303 VAL n 
1 304 GLY n 
1 305 GLY n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 GLN n 
1 310 LEU n 
1 311 VAL n 
1 312 SER n 
1 313 ASP n 
1 314 LYS n 
1 315 PRO n 
1 316 LEU n 
1 317 THR n 
1 318 GLU n 
1 319 CYS n 
1 320 ILE n 
1 321 ARG n 
1 322 ALA n 
1 323 GLY n 
1 324 HIS n 
1 325 TYR n 
1 326 ALA n 
1 327 ALA n 
1 328 SER n 
1 329 ILE n 
1 330 ILE n 
1 331 ILE n 
1 332 ARG n 
1 333 ARG n 
1 334 THR n 
1 335 GLY n 
1 336 CYS n 
1 337 THR n 
1 338 PHE n 
1 339 PRO n 
1 340 GLU n 
1 341 LYS n 
1 342 PRO n 
1 343 ASP n 
1 344 PHE n 
1 345 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ADK 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q5VXR3_HUMAN 
_struct_ref.pdbx_db_accession          Q5VXR3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTSVRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQP
HKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVE
KARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKD
IKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECI
RAGHYAASIIIRRTGCTFPEKPDFH
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2I6A A 1 ? 345 ? Q5VXR3 1 ? 345 ? 1 345 
2 1 2I6A B 1 ? 345 ? Q5VXR3 1 ? 345 ? 1 345 
3 1 2I6A C 1 ? 345 ? Q5VXR3 1 ? 345 ? 1 345 
4 1 2I6A D 1 ? 345 ? Q5VXR3 1 ? 345 ? 1 345 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5I5 non-polymer         . '7-(5-DEOXY-BETA-D-RIBOFURANOSYL)-5-IODO-7H-PYRROLO[2,3-D]PYRIMIDIN-4-AMINE' 
;5'-DEOXY-5-IODOTUBERCIDIN; (2R,3R,4S,5R)-2-(4-AMINO-5-IODO-7H-PYRROLO[2,3-D]PYRIMIDIN-7-YL)-5-(METHYL)TETRAHYDROFURAN-3,4-DIOL
;
'C11 H13 I N4 O3' 376.150 
ALA 'L-peptide linking' y ALANINE                                                                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                              ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                     ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                     ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2I6A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.24 
_exptl_crystal.density_percent_sol   45.05 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_details    'PEG 4000, 0.1 M MgCl2, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Silicon 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00000 
# 
_reflns.entry_id                     2I6A 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             50 
_reflns.number_all                   41591 
_reflns.number_obs                   35353 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 2I6A 
_refine.ls_d_res_high                            2.2 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          2 
_refine.ls_number_reflns_all                     41591 
_refine.ls_number_reflns_obs                     35353 
_refine.ls_number_reflns_R_free                  3516 
_refine.ls_percent_reflns_obs                    85.5 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.181 
_refine.ls_R_factor_R_free                       0.271 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10828 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         76 
_refine_hist.number_atoms_solvent             510 
_refine_hist.number_atoms_total               11414 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        50 
# 
_struct.entry_id                  2I6A 
_struct.title                     
;Human Adenosine Kinase in Complex With 5'-Deoxy-5-Iodotubercidin
;
_struct.pdbx_descriptor           'Adenosine kinase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2I6A 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;protein-ligand complex, 5'-deoxy-5-iodotubercidin, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 24  ? TYR A 31  ? ASP A 24  TYR A 31  1 ? 8  
HELX_P HELX_P2  2  GLU A 42  ? LYS A 44  ? GLU A 42  LYS A 44  5 ? 3  
HELX_P HELX_P3  3  HIS A 45  ? PHE A 56  ? HIS A 45  PHE A 56  1 ? 12 
HELX_P HELX_P4  4  GLY A 64  ? GLN A 78  ? GLY A 64  GLN A 78  1 ? 15 
HELX_P HELX_P5  5  ASP A 93  ? GLU A 105 ? ASP A 93  GLU A 105 1 ? 13 
HELX_P HELX_P6  6  LEU A 138 ? TYR A 144 ? LEU A 138 TYR A 144 5 ? 7  
HELX_P HELX_P7  7  LEU A 152 ? GLU A 160 ? LEU A 152 GLU A 160 1 ? 9  
HELX_P HELX_P8  8  PHE A 170 ? VAL A 174 ? PHE A 170 VAL A 174 5 ? 5  
HELX_P HELX_P9  9  SER A 175 ? ASN A 189 ? SER A 175 ASN A 189 1 ? 15 
HELX_P HELX_P10 10 ALA A 199 ? TYR A 206 ? ALA A 199 TYR A 206 1 ? 8  
HELX_P HELX_P11 11 TYR A 206 ? MET A 214 ? TYR A 206 MET A 214 1 ? 9  
HELX_P HELX_P12 12 PRO A 215 ? VAL A 217 ? PRO A 215 VAL A 217 5 ? 3  
HELX_P HELX_P13 13 GLU A 224 ? GLY A 235 ? GLU A 224 GLY A 235 1 ? 12 
HELX_P HELX_P14 14 ASP A 240 ? ALA A 250 ? ASP A 240 ALA A 250 1 ? 11 
HELX_P HELX_P15 15 ASP A 294 ? VAL A 311 ? ASP A 294 VAL A 311 1 ? 18 
HELX_P HELX_P16 16 PRO A 315 ? ILE A 330 ? PRO A 315 ILE A 330 1 ? 16 
HELX_P HELX_P17 17 ASP B 24  ? TYR B 31  ? ASP B 24  TYR B 31  1 ? 8  
HELX_P HELX_P18 18 GLU B 42  ? LYS B 44  ? GLU B 42  LYS B 44  5 ? 3  
HELX_P HELX_P19 19 HIS B 45  ? PHE B 56  ? HIS B 45  PHE B 56  1 ? 12 
HELX_P HELX_P20 20 GLY B 64  ? GLN B 78  ? GLY B 64  GLN B 78  1 ? 15 
HELX_P HELX_P21 21 ASP B 93  ? GLU B 105 ? ASP B 93  GLU B 105 1 ? 13 
HELX_P HELX_P22 22 ALA B 140 ? TYR B 144 ? ALA B 140 TYR B 144 5 ? 5  
HELX_P HELX_P23 23 LYS B 145 ? HIS B 149 ? LYS B 145 HIS B 149 5 ? 5  
HELX_P HELX_P24 24 LEU B 152 ? ALA B 162 ? LEU B 152 ALA B 162 1 ? 11 
HELX_P HELX_P25 25 PHE B 170 ? VAL B 174 ? PHE B 170 VAL B 174 5 ? 5  
HELX_P HELX_P26 26 SER B 175 ? ASN B 189 ? SER B 175 ASN B 189 1 ? 15 
HELX_P HELX_P27 27 ALA B 199 ? TYR B 206 ? ALA B 199 TYR B 206 1 ? 8  
HELX_P HELX_P28 28 TYR B 206 ? MET B 214 ? TYR B 206 MET B 214 1 ? 9  
HELX_P HELX_P29 29 PRO B 215 ? VAL B 217 ? PRO B 215 VAL B 217 5 ? 3  
HELX_P HELX_P30 30 GLU B 224 ? GLY B 235 ? GLU B 224 GLY B 235 1 ? 12 
HELX_P HELX_P31 31 ASP B 240 ? ALA B 250 ? ASP B 240 ALA B 250 1 ? 11 
HELX_P HELX_P32 32 ASP B 294 ? VAL B 311 ? ASP B 294 VAL B 311 1 ? 18 
HELX_P HELX_P33 33 PRO B 315 ? ILE B 330 ? PRO B 315 ILE B 330 1 ? 16 
HELX_P HELX_P34 34 ASP C 24  ? TYR C 31  ? ASP C 24  TYR C 31  1 ? 8  
HELX_P HELX_P35 35 HIS C 45  ? PHE C 56  ? HIS C 45  PHE C 56  1 ? 12 
HELX_P HELX_P36 36 GLY C 64  ? GLN C 78  ? GLY C 64  GLN C 78  1 ? 15 
HELX_P HELX_P37 37 ASP C 93  ? ALA C 106 ? ASP C 93  ALA C 106 1 ? 14 
HELX_P HELX_P38 38 LEU C 138 ? TYR C 144 ? LEU C 138 TYR C 144 5 ? 7  
HELX_P HELX_P39 39 LEU C 152 ? ALA C 162 ? LEU C 152 ALA C 162 1 ? 11 
HELX_P HELX_P40 40 PHE C 170 ? VAL C 174 ? PHE C 170 VAL C 174 5 ? 5  
HELX_P HELX_P41 41 SER C 175 ? ASN C 189 ? SER C 175 ASN C 189 1 ? 15 
HELX_P HELX_P42 42 ALA C 199 ? TYR C 206 ? ALA C 199 TYR C 206 1 ? 8  
HELX_P HELX_P43 43 TYR C 206 ? MET C 214 ? TYR C 206 MET C 214 1 ? 9  
HELX_P HELX_P44 44 PRO C 215 ? VAL C 217 ? PRO C 215 VAL C 217 5 ? 3  
HELX_P HELX_P45 45 GLU C 224 ? GLN C 234 ? GLU C 224 GLN C 234 1 ? 11 
HELX_P HELX_P46 46 ASP C 240 ? ALA C 250 ? ASP C 240 ALA C 250 1 ? 11 
HELX_P HELX_P47 47 ASP C 294 ? VAL C 311 ? ASP C 294 VAL C 311 1 ? 18 
HELX_P HELX_P48 48 PRO C 315 ? ILE C 330 ? PRO C 315 ILE C 330 1 ? 16 
HELX_P HELX_P49 49 ASP D 24  ? TYR D 31  ? ASP D 24  TYR D 31  1 ? 8  
HELX_P HELX_P50 50 GLU D 42  ? LYS D 44  ? GLU D 42  LYS D 44  5 ? 3  
HELX_P HELX_P51 51 HIS D 45  ? PHE D 56  ? HIS D 45  PHE D 56  1 ? 12 
HELX_P HELX_P52 52 GLY D 64  ? GLN D 78  ? GLY D 64  GLN D 78  1 ? 15 
HELX_P HELX_P53 53 ASP D 93  ? ALA D 106 ? ASP D 93  ALA D 106 1 ? 14 
HELX_P HELX_P54 54 LEU D 138 ? TYR D 144 ? LEU D 138 TYR D 144 5 ? 7  
HELX_P HELX_P55 55 LYS D 145 ? HIS D 149 ? LYS D 145 HIS D 149 5 ? 5  
HELX_P HELX_P56 56 LEU D 152 ? ALA D 162 ? LEU D 152 ALA D 162 1 ? 11 
HELX_P HELX_P57 57 PHE D 170 ? VAL D 174 ? PHE D 170 VAL D 174 5 ? 5  
HELX_P HELX_P58 58 SER D 175 ? ASN D 189 ? SER D 175 ASN D 189 1 ? 15 
HELX_P HELX_P59 59 ALA D 199 ? TYR D 206 ? ALA D 199 TYR D 206 1 ? 8  
HELX_P HELX_P60 60 TYR D 206 ? MET D 214 ? TYR D 206 MET D 214 1 ? 9  
HELX_P HELX_P61 61 PRO D 215 ? VAL D 217 ? PRO D 215 VAL D 217 5 ? 3  
HELX_P HELX_P62 62 GLU D 224 ? GLN D 234 ? GLU D 224 GLN D 234 1 ? 11 
HELX_P HELX_P63 63 ASP D 240 ? ALA D 250 ? ASP D 240 ALA D 250 1 ? 11 
HELX_P HELX_P64 64 ASP D 294 ? VAL D 311 ? ASP D 294 VAL D 311 1 ? 18 
HELX_P HELX_P65 65 PRO D 315 ? ILE D 330 ? PRO D 315 ILE D 330 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLN 
_struct_mon_prot_cis.label_seq_id           79 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLN 
_struct_mon_prot_cis.auth_seq_id            79 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    80 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     80 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.91 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 5 ? 
C ? 9 ? 
D ? 5 ? 
E ? 9 ? 
F ? 5 ? 
G ? 9 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
C 7 8 ? anti-parallel 
C 8 9 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
E 7 8 ? anti-parallel 
E 8 9 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
F 4 5 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
G 7 8 ? anti-parallel 
G 8 9 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 109 ? GLN A 115 ? ASP A 109 GLN A 115 
A 2 ALA A 84  ? GLY A 91  ? ALA A 84  GLY A 91  
A 3 LEU A 9   ? MET A 12  ? LEU A 9   MET A 12  
A 4 VAL A 164 ? ALA A 168 ? VAL A 164 ALA A 168 
A 5 ILE A 192 ? ASN A 196 ? ILE A 192 ASN A 196 
A 6 ILE A 219 ? ASN A 223 ? ILE A 219 ASN A 223 
A 7 ILE A 261 ? GLN A 266 ? ILE A 261 GLN A 266 
A 8 ASP A 269 ? ALA A 274 ? ASP A 269 ALA A 274 
A 9 VAL A 279 ? PHE A 282 ? VAL A 279 PHE A 282 
B 1 ASP A 37  ? LEU A 40  ? ASP A 37  LEU A 40  
B 2 ASN A 131 ? ASN A 137 ? ASN A 131 ASN A 137 
B 3 GLY A 121 ? THR A 128 ? GLY A 121 THR A 128 
B 4 LEU A 16  ? VAL A 22  ? LEU A 16  VAL A 22  
B 5 GLU A 59  ? ALA A 62  ? GLU A 59  ALA A 62  
C 1 ASP B 109 ? GLN B 115 ? ASP B 109 GLN B 115 
C 2 ALA B 84  ? GLY B 91  ? ALA B 84  GLY B 91  
C 3 LEU B 9   ? MET B 12  ? LEU B 9   MET B 12  
C 4 VAL B 164 ? ALA B 168 ? VAL B 164 ALA B 168 
C 5 ILE B 192 ? ASN B 196 ? ILE B 192 ASN B 196 
C 6 ILE B 219 ? ASN B 223 ? ILE B 219 ASN B 223 
C 7 ILE B 261 ? GLN B 266 ? ILE B 261 GLN B 266 
C 8 ASP B 269 ? ALA B 274 ? ASP B 269 ALA B 274 
C 9 VAL B 279 ? PHE B 282 ? VAL B 279 PHE B 282 
D 1 ASP B 37  ? LEU B 40  ? ASP B 37  LEU B 40  
D 2 ASN B 131 ? ASN B 137 ? ASN B 131 ASN B 137 
D 3 GLY B 121 ? THR B 128 ? GLY B 121 THR B 128 
D 4 LEU B 16  ? VAL B 22  ? LEU B 16  VAL B 22  
D 5 GLU B 59  ? ALA B 62  ? GLU B 59  ALA B 62  
E 1 ASP C 109 ? GLN C 115 ? ASP C 109 GLN C 115 
E 2 ALA C 84  ? GLY C 91  ? ALA C 84  GLY C 91  
E 3 LEU C 9   ? MET C 12  ? LEU C 9   MET C 12  
E 4 VAL C 164 ? ALA C 168 ? VAL C 164 ALA C 168 
E 5 ILE C 192 ? ASN C 196 ? ILE C 192 ASN C 196 
E 6 ILE C 219 ? ASN C 223 ? ILE C 219 ASN C 223 
E 7 ILE C 261 ? GLN C 266 ? ILE C 261 GLN C 266 
E 8 ASP C 269 ? ALA C 274 ? ASP C 269 ALA C 274 
E 9 VAL C 279 ? PHE C 282 ? VAL C 279 PHE C 282 
F 1 ASP C 37  ? LEU C 40  ? ASP C 37  LEU C 40  
F 2 ASN C 131 ? ASN C 137 ? ASN C 131 ASN C 137 
F 3 GLY C 121 ? THR C 128 ? GLY C 121 THR C 128 
F 4 LEU C 16  ? VAL C 22  ? LEU C 16  VAL C 22  
F 5 GLU C 59  ? GLY C 63  ? GLU C 59  GLY C 63  
G 1 ASP D 109 ? GLN D 115 ? ASP D 109 GLN D 115 
G 2 ALA D 84  ? GLY D 91  ? ALA D 84  GLY D 91  
G 3 LEU D 9   ? MET D 12  ? LEU D 9   MET D 12  
G 4 VAL D 164 ? ALA D 168 ? VAL D 164 ALA D 168 
G 5 ILE D 192 ? ASN D 196 ? ILE D 192 ASN D 196 
G 6 ILE D 219 ? ASN D 223 ? ILE D 219 ASN D 223 
G 7 ILE D 261 ? GLN D 266 ? ILE D 261 GLN D 266 
G 8 ASP D 269 ? ALA D 274 ? ASP D 269 ALA D 274 
G 9 VAL D 279 ? PHE D 282 ? VAL D 279 PHE D 282 
H 1 ASP D 37  ? LEU D 40  ? ASP D 37  LEU D 40  
H 2 ASN D 131 ? ASN D 137 ? ASN D 131 ASN D 137 
H 3 THR D 122 ? THR D 128 ? THR D 122 THR D 128 
H 4 LEU D 17  ? VAL D 22  ? LEU D 17  VAL D 22  
H 5 GLU D 59  ? ALA D 62  ? GLU D 59  ALA D 62  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 111 ? O HIS A 111 N PHE A 86  ? N PHE A 86  
A 2 3 O THR A 85  ? O THR A 85  N LEU A 9   ? N LEU A 9   
A 3 4 N PHE A 10  ? N PHE A 10  O TYR A 166 ? O TYR A 166 
A 4 5 N CYS A 165 ? N CYS A 165 O ILE A 192 ? O ILE A 192 
A 5 6 N LEU A 195 ? N LEU A 195 O ILE A 219 ? O ILE A 219 
A 6 7 N LEU A 220 ? N LEU A 220 O ILE A 261 ? O ILE A 261 
A 7 8 N PHE A 264 ? N PHE A 264 O ILE A 272 ? O ILE A 272 
A 8 9 N MET A 273 ? N MET A 273 O THR A 280 ? O THR A 280 
B 1 2 N ASP A 37  ? N ASP A 37  O LEU A 134 ? O LEU A 134 
B 2 3 O ASN A 137 ? O ASN A 137 N THR A 122 ? N THR A 122 
B 3 4 O CYS A 123 ? O CYS A 123 N ILE A 19  ? N ILE A 19  
B 4 5 N ASP A 18  ? N ASP A 18  O HIS A 61  ? O HIS A 61  
C 1 2 O TYR B 113 ? O TYR B 113 N GLY B 88  ? N GLY B 88  
C 2 3 O THR B 85  ? O THR B 85  N LEU B 9   ? N LEU B 9   
C 3 4 N PHE B 10  ? N PHE B 10  O VAL B 164 ? O VAL B 164 
C 4 5 N CYS B 165 ? N CYS B 165 O ILE B 192 ? O ILE B 192 
C 5 6 N LEU B 195 ? N LEU B 195 O PHE B 221 ? O PHE B 221 
C 6 7 N LEU B 220 ? N LEU B 220 O ILE B 263 ? O ILE B 263 
C 7 8 N PHE B 264 ? N PHE B 264 O ILE B 272 ? O ILE B 272 
C 8 9 N MET B 273 ? N MET B 273 O THR B 280 ? O THR B 280 
D 1 2 N ILE B 39  ? N ILE B 39  O LEU B 134 ? O LEU B 134 
D 2 3 O ASN B 137 ? O ASN B 137 N THR B 122 ? N THR B 122 
D 3 4 O CYS B 123 ? O CYS B 123 N ILE B 19  ? N ILE B 19  
D 4 5 N ASP B 18  ? N ASP B 18  O HIS B 61  ? O HIS B 61  
E 1 2 O TYR C 113 ? O TYR C 113 N GLY C 88  ? N GLY C 88  
E 2 3 O THR C 85  ? O THR C 85  N LEU C 9   ? N LEU C 9   
E 3 4 N PHE C 10  ? N PHE C 10  O TYR C 166 ? O TYR C 166 
E 4 5 N CYS C 165 ? N CYS C 165 O ILE C 192 ? O ILE C 192 
E 5 6 N LEU C 195 ? N LEU C 195 O PHE C 221 ? O PHE C 221 
E 6 7 N LEU C 220 ? N LEU C 220 O ILE C 263 ? O ILE C 263 
E 7 8 N PHE C 264 ? N PHE C 264 O ILE C 272 ? O ILE C 272 
E 8 9 N MET C 273 ? N MET C 273 O THR C 280 ? O THR C 280 
F 1 2 N ILE C 39  ? N ILE C 39  O LEU C 134 ? O LEU C 134 
F 2 3 O ASN C 131 ? O ASN C 131 N THR C 128 ? N THR C 128 
F 3 4 O CYS C 123 ? O CYS C 123 N ILE C 19  ? N ILE C 19  
F 4 5 N ASP C 18  ? N ASP C 18  O HIS C 61  ? O HIS C 61  
G 1 2 O HIS D 111 ? O HIS D 111 N PHE D 86  ? N PHE D 86  
G 2 3 O THR D 85  ? O THR D 85  N LEU D 9   ? N LEU D 9   
G 3 4 N PHE D 10  ? N PHE D 10  O TYR D 166 ? O TYR D 166 
G 4 5 N CYS D 165 ? N CYS D 165 O ILE D 192 ? O ILE D 192 
G 5 6 N LEU D 195 ? N LEU D 195 O PHE D 221 ? O PHE D 221 
G 6 7 N LEU D 220 ? N LEU D 220 O ILE D 261 ? O ILE D 261 
G 7 8 N PHE D 264 ? N PHE D 264 O ILE D 272 ? O ILE D 272 
G 8 9 N MET D 273 ? N MET D 273 O THR D 280 ? O THR D 280 
H 1 2 N ILE D 39  ? N ILE D 39  O LEU D 134 ? O LEU D 134 
H 2 3 O ASN D 137 ? O ASN D 137 N THR D 122 ? N THR D 122 
H 3 4 O ALA D 125 ? O ALA D 125 N ILE D 19  ? N ILE D 19  
H 4 5 N SER D 20  ? N SER D 20  O GLU D 59  ? O GLU D 59  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 5I5 A 500' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 5I5 B 500' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 5I5 C 500' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 5I5 D 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ASN A 14  ? ASN A 14  . ? 1_555 ? 
2  AC1 12 ASP A 18  ? ASP A 18  . ? 1_555 ? 
3  AC1 12 ILE A 39  ? ILE A 39  . ? 1_555 ? 
4  AC1 12 LEU A 40  ? LEU A 40  . ? 1_555 ? 
5  AC1 12 GLY A 63  ? GLY A 63  . ? 1_555 ? 
6  AC1 12 GLY A 64  ? GLY A 64  . ? 1_555 ? 
7  AC1 12 SER A 65  ? SER A 65  . ? 1_555 ? 
8  AC1 12 ASN A 68  ? ASN A 68  . ? 1_555 ? 
9  AC1 12 CYS A 123 ? CYS A 123 . ? 1_555 ? 
10 AC1 12 PHE A 170 ? PHE A 170 . ? 1_555 ? 
11 AC1 12 ASN A 296 ? ASN A 296 . ? 1_555 ? 
12 AC1 12 ASP A 300 ? ASP A 300 . ? 1_555 ? 
13 AC2 12 ASN B 14  ? ASN B 14  . ? 1_555 ? 
14 AC2 12 ASP B 18  ? ASP B 18  . ? 1_555 ? 
15 AC2 12 ILE B 39  ? ILE B 39  . ? 1_555 ? 
16 AC2 12 LEU B 40  ? LEU B 40  . ? 1_555 ? 
17 AC2 12 GLY B 63  ? GLY B 63  . ? 1_555 ? 
18 AC2 12 GLY B 64  ? GLY B 64  . ? 1_555 ? 
19 AC2 12 SER B 65  ? SER B 65  . ? 1_555 ? 
20 AC2 12 ASN B 68  ? ASN B 68  . ? 1_555 ? 
21 AC2 12 ALA B 136 ? ALA B 136 . ? 1_555 ? 
22 AC2 12 PHE B 170 ? PHE B 170 . ? 1_555 ? 
23 AC2 12 ASN B 296 ? ASN B 296 . ? 1_555 ? 
24 AC2 12 ASP B 300 ? ASP B 300 . ? 1_555 ? 
25 AC3 13 ASN C 14  ? ASN C 14  . ? 1_555 ? 
26 AC3 13 ASP C 18  ? ASP C 18  . ? 1_555 ? 
27 AC3 13 ILE C 39  ? ILE C 39  . ? 1_555 ? 
28 AC3 13 LEU C 40  ? LEU C 40  . ? 1_555 ? 
29 AC3 13 GLY C 63  ? GLY C 63  . ? 1_555 ? 
30 AC3 13 GLY C 64  ? GLY C 64  . ? 1_555 ? 
31 AC3 13 SER C 65  ? SER C 65  . ? 1_555 ? 
32 AC3 13 ASN C 68  ? ASN C 68  . ? 1_555 ? 
33 AC3 13 ALA C 136 ? ALA C 136 . ? 1_555 ? 
34 AC3 13 LEU C 138 ? LEU C 138 . ? 1_555 ? 
35 AC3 13 PHE C 170 ? PHE C 170 . ? 1_555 ? 
36 AC3 13 ASN C 296 ? ASN C 296 . ? 1_555 ? 
37 AC3 13 ASP C 300 ? ASP C 300 . ? 1_555 ? 
38 AC4 13 ASN D 14  ? ASN D 14  . ? 1_555 ? 
39 AC4 13 ASP D 18  ? ASP D 18  . ? 1_555 ? 
40 AC4 13 ILE D 39  ? ILE D 39  . ? 1_555 ? 
41 AC4 13 LEU D 40  ? LEU D 40  . ? 1_555 ? 
42 AC4 13 GLY D 64  ? GLY D 64  . ? 1_555 ? 
43 AC4 13 SER D 65  ? SER D 65  . ? 1_555 ? 
44 AC4 13 ASN D 68  ? ASN D 68  . ? 1_555 ? 
45 AC4 13 CYS D 123 ? CYS D 123 . ? 1_555 ? 
46 AC4 13 ALA D 136 ? ALA D 136 . ? 1_555 ? 
47 AC4 13 PHE D 170 ? PHE D 170 . ? 1_555 ? 
48 AC4 13 ASN D 296 ? ASN D 296 . ? 1_555 ? 
49 AC4 13 ASP D 300 ? ASP D 300 . ? 1_555 ? 
50 AC4 13 HOH L .   ? HOH D 555 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2I6A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2I6A 
_atom_sites.fract_transf_matrix[1][1]   0.016168 
_atom_sites.fract_transf_matrix[1][2]   -0.000014 
_atom_sites.fract_transf_matrix[1][3]   0.003978 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014941 
_atom_sites.fract_transf_matrix[2][3]   0.002094 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011927 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A 1 3   ? 28.196  -3.435  4.504   1.00 66.95  ? 3   SER A N   1 
ATOM   2     C CA  . SER A 1 3   ? 29.277  -4.125  3.794   1.00 66.64  ? 3   SER A CA  1 
ATOM   3     C C   . SER A 1 3   ? 29.110  -5.646  3.815   1.00 68.24  ? 3   SER A C   1 
ATOM   4     O O   . SER A 1 3   ? 30.071  -6.398  3.579   1.00 67.85  ? 3   SER A O   1 
ATOM   5     C CB  . SER A 1 3   ? 30.640  -3.752  4.385   1.00 72.05  ? 3   SER A CB  1 
ATOM   6     O OG  . SER A 1 3   ? 30.816  -4.309  5.686   1.00 83.80  ? 3   SER A OG  1 
ATOM   7     N N   . VAL A 1 4   ? 27.895  -6.092  4.132   1.00 61.67  ? 4   VAL A N   1 
ATOM   8     C CA  . VAL A 1 4   ? 27.576  -7.518  4.152   1.00 59.48  ? 4   VAL A CA  1 
ATOM   9     C C   . VAL A 1 4   ? 26.440  -7.699  3.176   1.00 60.25  ? 4   VAL A C   1 
ATOM   10    O O   . VAL A 1 4   ? 25.482  -6.934  3.219   1.00 61.17  ? 4   VAL A O   1 
ATOM   11    C CB  . VAL A 1 4   ? 27.089  -7.983  5.543   1.00 62.08  ? 4   VAL A CB  1 
ATOM   12    C CG1 . VAL A 1 4   ? 28.228  -7.926  6.552   1.00 61.87  ? 4   VAL A CG1 1 
ATOM   13    C CG2 . VAL A 1 4   ? 25.919  -7.150  6.003   1.00 61.46  ? 4   VAL A CG2 1 
ATOM   14    N N   . ARG A 1 5   ? 26.538  -8.693  2.299   1.00 53.84  ? 5   ARG A N   1 
ATOM   15    C CA  . ARG A 1 5   ? 25.486  -8.917  1.311   1.00 53.37  ? 5   ARG A CA  1 
ATOM   16    C C   . ARG A 1 5   ? 24.269  -9.648  1.858   1.00 54.53  ? 5   ARG A C   1 
ATOM   17    O O   . ARG A 1 5   ? 24.260  -10.053 3.023   1.00 54.48  ? 5   ARG A O   1 
ATOM   18    C CB  . ARG A 1 5   ? 26.022  -9.563  0.031   1.00 56.28  ? 5   ARG A CB  1 
ATOM   19    C CG  . ARG A 1 5   ? 26.520  -10.967 0.204   1.00 70.51  ? 5   ARG A CG  1 
ATOM   20    C CD  . ARG A 1 5   ? 27.561  -11.026 1.303   1.00 80.31  ? 5   ARG A CD  1 
ATOM   21    N NE  . ARG A 1 5   ? 28.878  -11.409 0.811   1.00 85.41  ? 5   ARG A NE  1 
ATOM   22    C CZ  . ARG A 1 5   ? 29.844  -10.550 0.506   1.00 105.42 ? 5   ARG A CZ  1 
ATOM   23    N NH1 . ARG A 1 5   ? 29.652  -9.244  0.624   1.00 100.22 ? 5   ARG A NH1 1 
ATOM   24    N NH2 . ARG A 1 5   ? 31.017  -10.999 0.093   1.00 95.55  ? 5   ARG A NH2 1 
ATOM   25    N N   . GLU A 1 6   ? 23.223  -9.747  1.041   1.00 49.12  ? 6   GLU A N   1 
ATOM   26    C CA  . GLU A 1 6   ? 21.973  -10.344 1.499   1.00 48.79  ? 6   GLU A CA  1 
ATOM   27    C C   . GLU A 1 6   ? 22.109  -11.836 1.733   1.00 47.06  ? 6   GLU A C   1 
ATOM   28    O O   . GLU A 1 6   ? 22.938  -12.493 1.097   1.00 44.32  ? 6   GLU A O   1 
ATOM   29    C CB  . GLU A 1 6   ? 20.806  -10.030 0.549   1.00 50.87  ? 6   GLU A CB  1 
ATOM   30    C CG  . GLU A 1 6   ? 21.196  -9.889  -0.913  1.00 69.45  ? 6   GLU A CG  1 
ATOM   31    C CD  . GLU A 1 6   ? 20.193  -9.057  -1.690  1.00 104.68 ? 6   GLU A CD  1 
ATOM   32    O OE1 . GLU A 1 6   ? 20.014  -7.865  -1.341  1.00 96.94  ? 6   GLU A OE1 1 
ATOM   33    O OE2 . GLU A 1 6   ? 19.577  -9.597  -2.635  1.00 105.86 ? 6   GLU A OE2 1 
ATOM   34    N N   . ASN A 1 7   ? 21.327  -12.343 2.683   1.00 41.28  ? 7   ASN A N   1 
ATOM   35    C CA  . ASN A 1 7   ? 21.320  -13.771 2.972   1.00 40.28  ? 7   ASN A CA  1 
ATOM   36    C C   . ASN A 1 7   ? 22.614  -14.234 3.626   1.00 39.04  ? 7   ASN A C   1 
ATOM   37    O O   . ASN A 1 7   ? 23.005  -15.389 3.471   1.00 38.00  ? 7   ASN A O   1 
ATOM   38    C CB  . ASN A 1 7   ? 21.069  -14.571 1.683   1.00 41.97  ? 7   ASN A CB  1 
ATOM   39    C CG  . ASN A 1 7   ? 19.821  -14.130 0.963   1.00 49.12  ? 7   ASN A CG  1 
ATOM   40    O OD1 . ASN A 1 7   ? 19.873  -13.683 -0.181  1.00 46.90  ? 7   ASN A OD1 1 
ATOM   41    N ND2 . ASN A 1 7   ? 18.703  -14.167 1.665   1.00 37.01  ? 7   ASN A ND2 1 
ATOM   42    N N   . ILE A 1 8   ? 23.284  -13.318 4.321   1.00 33.86  ? 8   ILE A N   1 
ATOM   43    C CA  . ILE A 1 8   ? 24.551  -13.625 5.000   1.00 32.75  ? 8   ILE A CA  1 
ATOM   44    C C   . ILE A 1 8   ? 24.281  -14.395 6.274   1.00 31.12  ? 8   ILE A C   1 
ATOM   45    O O   . ILE A 1 8   ? 25.143  -15.133 6.786   1.00 29.88  ? 8   ILE A O   1 
ATOM   46    C CB  . ILE A 1 8   ? 25.365  -12.360 5.397   1.00 35.51  ? 8   ILE A CB  1 
ATOM   47    C CG1 . ILE A 1 8   ? 26.742  -12.783 5.944   1.00 36.27  ? 8   ILE A CG1 1 
ATOM   48    C CG2 . ILE A 1 8   ? 24.641  -11.546 6.482   1.00 33.61  ? 8   ILE A CG2 1 
ATOM   49    C CD1 . ILE A 1 8   ? 27.513  -11.647 6.582   1.00 45.04  ? 8   ILE A CD1 1 
ATOM   50    N N   . LEU A 1 9   ? 23.081  -14.186 6.797   1.00 23.18  ? 9   LEU A N   1 
ATOM   51    C CA  . LEU A 1 9   ? 22.639  -14.850 8.021   1.00 20.99  ? 9   LEU A CA  1 
ATOM   52    C C   . LEU A 1 9   ? 21.467  -15.742 7.673   1.00 20.56  ? 9   LEU A C   1 
ATOM   53    O O   . LEU A 1 9   ? 20.552  -15.284 7.035   1.00 17.93  ? 9   LEU A O   1 
ATOM   54    C CB  . LEU A 1 9   ? 22.206  -13.797 9.063   1.00 20.32  ? 9   LEU A CB  1 
ATOM   55    C CG  . LEU A 1 9   ? 22.228  -14.133 10.561  1.00 21.57  ? 9   LEU A CG  1 
ATOM   56    C CD1 . LEU A 1 9   ? 20.985  -13.619 11.130  1.00 19.77  ? 9   LEU A CD1 1 
ATOM   57    C CD2 . LEU A 1 9   ? 22.316  -15.632 10.834  1.00 22.26  ? 9   LEU A CD2 1 
ATOM   58    N N   . PHE A 1 10  ? 21.551  -17.026 8.002   1.00 19.59  ? 10  PHE A N   1 
ATOM   59    C CA  . PHE A 1 10  ? 20.460  -17.965 7.687   1.00 20.21  ? 10  PHE A CA  1 
ATOM   60    C C   . PHE A 1 10  ? 19.881  -18.570 8.953   1.00 23.86  ? 10  PHE A C   1 
ATOM   61    O O   . PHE A 1 10  ? 20.618  -19.034 9.822   1.00 24.42  ? 10  PHE A O   1 
ATOM   62    C CB  . PHE A 1 10  ? 20.894  -19.105 6.761   1.00 21.45  ? 10  PHE A CB  1 
ATOM   63    C CG  . PHE A 1 10  ? 19.847  -20.167 6.616   1.00 22.76  ? 10  PHE A CG  1 
ATOM   64    C CD1 . PHE A 1 10  ? 19.785  -21.220 7.529   1.00 25.49  ? 10  PHE A CD1 1 
ATOM   65    C CD2 . PHE A 1 10  ? 18.824  -20.035 5.655   1.00 24.97  ? 10  PHE A CD2 1 
ATOM   66    C CE1 . PHE A 1 10  ? 18.800  -22.203 7.431   1.00 26.36  ? 10  PHE A CE1 1 
ATOM   67    C CE2 . PHE A 1 10  ? 17.825  -20.980 5.560   1.00 28.19  ? 10  PHE A CE2 1 
ATOM   68    C CZ  . PHE A 1 10  ? 17.815  -22.089 6.453   1.00 26.43  ? 10  PHE A CZ  1 
ATOM   69    N N   . GLY A 1 11  ? 18.558  -18.550 9.047   1.00 20.02  ? 11  GLY A N   1 
ATOM   70    C CA  . GLY A 1 11  ? 17.827  -19.089 10.203  1.00 20.01  ? 11  GLY A CA  1 
ATOM   71    C C   . GLY A 1 11  ? 16.548  -19.836 9.751   1.00 21.58  ? 11  GLY A C   1 
ATOM   72    O O   . GLY A 1 11  ? 15.938  -19.511 8.727   1.00 19.53  ? 11  GLY A O   1 
ATOM   73    N N   . MET A 1 12  ? 16.187  -20.880 10.486  1.00 16.91  ? 12  MET A N   1 
ATOM   74    C CA  . MET A 1 12  ? 14.997  -21.653 10.175  1.00 15.94  ? 12  MET A CA  1 
ATOM   75    C C   . MET A 1 12  ? 14.470  -22.172 11.500  1.00 13.42  ? 12  MET A C   1 
ATOM   76    O O   . MET A 1 12  ? 15.241  -22.358 12.410  1.00 10.87  ? 12  MET A O   1 
ATOM   77    C CB  . MET A 1 12  ? 15.303  -22.792 9.192   1.00 19.29  ? 12  MET A CB  1 
ATOM   78    C CG  . MET A 1 12  ? 15.731  -24.081 9.855   1.00 24.73  ? 12  MET A CG  1 
ATOM   79    S SD  . MET A 1 12  ? 16.351  -25.403 8.764   1.00 30.13  ? 12  MET A SD  1 
ATOM   80    C CE  . MET A 1 12  ? 15.035  -25.430 7.523   1.00 24.51  ? 12  MET A CE  1 
ATOM   81    N N   . GLY A 1 13  ? 13.151  -22.271 11.650  1.00 9.64   ? 13  GLY A N   1 
ATOM   82    C CA  . GLY A 1 13  ? 12.607  -22.732 12.924  1.00 8.91   ? 13  GLY A CA  1 
ATOM   83    C C   . GLY A 1 13  ? 11.106  -22.855 12.860  1.00 12.17  ? 13  GLY A C   1 
ATOM   84    O O   . GLY A 1 13  ? 10.566  -23.060 11.810  1.00 12.11  ? 13  GLY A O   1 
ATOM   85    N N   . ASN A 1 14  ? 10.444  -22.680 13.997  1.00 10.25  ? 14  ASN A N   1 
ATOM   86    C CA  . ASN A 1 14  ? 8.986   -22.735 14.092  1.00 10.43  ? 14  ASN A CA  1 
ATOM   87    C C   . ASN A 1 14  ? 8.298   -21.365 13.990  1.00 17.25  ? 14  ASN A C   1 
ATOM   88    O O   . ASN A 1 14  ? 8.120   -20.676 14.985  1.00 17.47  ? 14  ASN A O   1 
ATOM   89    C CB  . ASN A 1 14  ? 8.579   -23.396 15.418  1.00 9.54   ? 14  ASN A CB  1 
ATOM   90    C CG  . ASN A 1 14  ? 9.153   -24.793 15.579  1.00 23.26  ? 14  ASN A CG  1 
ATOM   91    O OD1 . ASN A 1 14  ? 9.172   -25.595 14.632  1.00 20.15  ? 14  ASN A OD1 1 
ATOM   92    N ND2 . ASN A 1 14  ? 9.755   -25.035 16.736  1.00 10.58  ? 14  ASN A ND2 1 
ATOM   93    N N   . PRO A 1 15  ? 7.814   -21.009 12.808  1.00 15.37  ? 15  PRO A N   1 
ATOM   94    C CA  . PRO A 1 15  ? 7.078   -19.719 12.690  1.00 14.62  ? 15  PRO A CA  1 
ATOM   95    C C   . PRO A 1 15  ? 5.770   -19.789 13.490  1.00 18.57  ? 15  PRO A C   1 
ATOM   96    O O   . PRO A 1 15  ? 4.808   -20.376 13.018  1.00 18.22  ? 15  PRO A O   1 
ATOM   97    C CB  . PRO A 1 15  ? 6.761   -19.607 11.185  1.00 15.00  ? 15  PRO A CB  1 
ATOM   98    C CG  . PRO A 1 15  ? 7.484   -20.791 10.497  1.00 16.32  ? 15  PRO A CG  1 
ATOM   99    C CD  . PRO A 1 15  ? 7.904   -21.767 11.531  1.00 11.76  ? 15  PRO A CD  1 
ATOM   100   N N   . LEU A 1 16  ? 5.738   -19.168 14.675  1.00 15.07  ? 16  LEU A N   1 
ATOM   101   C CA  . LEU A 1 16  ? 4.541   -19.161 15.541  1.00 14.84  ? 16  LEU A CA  1 
ATOM   102   C C   . LEU A 1 16  ? 3.917   -17.776 15.759  1.00 24.26  ? 16  LEU A C   1 
ATOM   103   O O   . LEU A 1 16  ? 4.607   -16.764 15.624  1.00 24.75  ? 16  LEU A O   1 
ATOM   104   C CB  . LEU A 1 16  ? 4.888   -19.749 16.917  1.00 13.77  ? 16  LEU A CB  1 
ATOM   105   C CG  . LEU A 1 16  ? 5.516   -21.146 17.016  1.00 17.78  ? 16  LEU A CG  1 
ATOM   106   C CD1 . LEU A 1 16  ? 5.567   -21.526 18.452  1.00 17.64  ? 16  LEU A CD1 1 
ATOM   107   C CD2 . LEU A 1 16  ? 4.716   -22.214 16.207  1.00 19.98  ? 16  LEU A CD2 1 
ATOM   108   N N   . LEU A 1 17  ? 2.624   -17.739 16.117  1.00 22.27  ? 17  LEU A N   1 
ATOM   109   C CA  . LEU A 1 17  ? 1.935   -16.485 16.468  1.00 21.34  ? 17  LEU A CA  1 
ATOM   110   C C   . LEU A 1 17  ? 1.650   -16.500 17.988  1.00 28.77  ? 17  LEU A C   1 
ATOM   111   O O   . LEU A 1 17  ? 0.887   -17.338 18.501  1.00 30.61  ? 17  LEU A O   1 
ATOM   112   C CB  . LEU A 1 17  ? 0.616   -16.269 15.683  1.00 20.62  ? 17  LEU A CB  1 
ATOM   113   C CG  . LEU A 1 17  ? -0.239  -15.061 16.172  1.00 24.17  ? 17  LEU A CG  1 
ATOM   114   C CD1 . LEU A 1 17  ? 0.566   -13.779 16.275  1.00 22.88  ? 17  LEU A CD1 1 
ATOM   115   C CD2 . LEU A 1 17  ? -1.523  -14.783 15.373  1.00 26.60  ? 17  LEU A CD2 1 
ATOM   116   N N   . ASP A 1 18  ? 2.243   -15.559 18.710  1.00 24.85  ? 18  ASP A N   1 
ATOM   117   C CA  . ASP A 1 18  ? 2.062   -15.513 20.147  1.00 24.27  ? 18  ASP A CA  1 
ATOM   118   C C   . ASP A 1 18  ? 0.715   -14.953 20.566  1.00 29.39  ? 18  ASP A C   1 
ATOM   119   O O   . ASP A 1 18  ? 0.325   -13.846 20.183  1.00 28.03  ? 18  ASP A O   1 
ATOM   120   C CB  . ASP A 1 18  ? 3.211   -14.733 20.794  1.00 26.45  ? 18  ASP A CB  1 
ATOM   121   C CG  . ASP A 1 18  ? 4.596   -15.266 20.407  1.00 37.82  ? 18  ASP A CG  1 
ATOM   122   O OD1 . ASP A 1 18  ? 4.756   -16.475 20.127  1.00 38.68  ? 18  ASP A OD1 1 
ATOM   123   O OD2 . ASP A 1 18  ? 5.543   -14.463 20.373  1.00 45.79  ? 18  ASP A OD2 1 
ATOM   124   N N   . ILE A 1 19  ? 0.017   -15.729 21.385  1.00 29.13  ? 19  ILE A N   1 
ATOM   125   C CA  . ILE A 1 19  ? -1.306  -15.360 21.907  1.00 28.55  ? 19  ILE A CA  1 
ATOM   126   C C   . ILE A 1 19  ? -1.179  -15.134 23.400  1.00 32.16  ? 19  ILE A C   1 
ATOM   127   O O   . ILE A 1 19  ? -1.057  -16.069 24.184  1.00 32.25  ? 19  ILE A O   1 
ATOM   128   C CB  . ILE A 1 19  ? -2.341  -16.454 21.599  1.00 31.18  ? 19  ILE A CB  1 
ATOM   129   C CG1 . ILE A 1 19  ? -2.569  -16.525 20.074  1.00 30.64  ? 19  ILE A CG1 1 
ATOM   130   C CG2 . ILE A 1 19  ? -3.628  -16.204 22.391  1.00 31.89  ? 19  ILE A CG2 1 
ATOM   131   C CD1 . ILE A 1 19  ? -3.519  -17.623 19.625  1.00 27.62  ? 19  ILE A CD1 1 
ATOM   132   N N   . SER A 1 20  ? -1.082  -13.873 23.779  1.00 29.45  ? 20  SER A N   1 
ATOM   133   C CA  . SER A 1 20  ? -0.833  -13.536 25.181  1.00 30.10  ? 20  SER A CA  1 
ATOM   134   C C   . SER A 1 20  ? -1.934  -12.786 25.893  1.00 36.04  ? 20  SER A C   1 
ATOM   135   O O   . SER A 1 20  ? -2.595  -11.914 25.328  1.00 36.28  ? 20  SER A O   1 
ATOM   136   C CB  . SER A 1 20  ? 0.473   -12.764 25.345  1.00 30.76  ? 20  SER A CB  1 
ATOM   137   O OG  . SER A 1 20  ? 0.327   -11.488 24.776  1.00 36.65  ? 20  SER A OG  1 
ATOM   138   N N   . ALA A 1 21  ? -2.044  -13.078 27.181  1.00 33.39  ? 21  ALA A N   1 
ATOM   139   C CA  . ALA A 1 21  ? -3.053  -12.492 28.017  1.00 33.94  ? 21  ALA A CA  1 
ATOM   140   C C   . ALA A 1 21  ? -2.723  -12.741 29.479  1.00 38.91  ? 21  ALA A C   1 
ATOM   141   O O   . ALA A 1 21  ? -2.116  -13.746 29.828  1.00 38.21  ? 21  ALA A O   1 
ATOM   142   C CB  . ALA A 1 21  ? -4.416  -13.121 27.684  1.00 35.24  ? 21  ALA A CB  1 
ATOM   143   N N   . VAL A 1 22  ? -3.176  -11.832 30.336  1.00 37.32  ? 22  VAL A N   1 
ATOM   144   C CA  . VAL A 1 22  ? -3.049  -11.986 31.785  1.00 36.56  ? 22  VAL A CA  1 
ATOM   145   C C   . VAL A 1 22  ? -4.167  -12.924 32.283  1.00 41.33  ? 22  VAL A C   1 
ATOM   146   O O   . VAL A 1 22  ? -5.339  -12.756 31.931  1.00 40.17  ? 22  VAL A O   1 
ATOM   147   C CB  . VAL A 1 22  ? -3.142  -10.620 32.489  1.00 38.37  ? 22  VAL A CB  1 
ATOM   148   C CG1 . VAL A 1 22  ? -2.638  -10.723 33.888  1.00 38.08  ? 22  VAL A CG1 1 
ATOM   149   C CG2 . VAL A 1 22  ? -2.371  -9.572  31.714  1.00 37.34  ? 22  VAL A CG2 1 
ATOM   150   N N   . VAL A 1 23  ? -3.767  -13.964 33.011  1.00 40.00  ? 23  VAL A N   1 
ATOM   151   C CA  . VAL A 1 23  ? -4.676  -15.006 33.494  1.00 41.31  ? 23  VAL A CA  1 
ATOM   152   C C   . VAL A 1 23  ? -4.571  -15.138 35.002  1.00 50.51  ? 23  VAL A C   1 
ATOM   153   O O   . VAL A 1 23  ? -3.745  -14.481 35.655  1.00 51.69  ? 23  VAL A O   1 
ATOM   154   C CB  . VAL A 1 23  ? -4.373  -16.441 32.859  1.00 45.07  ? 23  VAL A CB  1 
ATOM   155   C CG1 . VAL A 1 23  ? -4.686  -16.500 31.344  1.00 43.74  ? 23  VAL A CG1 1 
ATOM   156   C CG2 . VAL A 1 23  ? -2.933  -16.880 33.121  1.00 44.98  ? 23  VAL A CG2 1 
ATOM   157   N N   . ASP A 1 24  ? -5.373  -16.039 35.549  1.00 50.21  ? 24  ASP A N   1 
ATOM   158   C CA  . ASP A 1 24  ? -5.429  -16.229 36.994  1.00 51.38  ? 24  ASP A CA  1 
ATOM   159   C C   . ASP A 1 24  ? -4.997  -17.621 37.408  1.00 56.98  ? 24  ASP A C   1 
ATOM   160   O O   . ASP A 1 24  ? -5.155  -18.575 36.639  1.00 57.89  ? 24  ASP A O   1 
ATOM   161   C CB  . ASP A 1 24  ? -6.853  -15.961 37.498  1.00 53.57  ? 24  ASP A CB  1 
ATOM   162   C CG  . ASP A 1 24  ? -7.856  -16.985 36.984  1.00 68.49  ? 24  ASP A CG  1 
ATOM   163   O OD1 . ASP A 1 24  ? -8.024  -17.091 35.748  1.00 68.68  ? 24  ASP A OD1 1 
ATOM   164   O OD2 . ASP A 1 24  ? -8.486  -17.680 37.810  1.00 77.43  ? 24  ASP A OD2 1 
ATOM   165   N N   . LYS A 1 25  ? -4.494  -17.741 38.638  1.00 54.13  ? 25  LYS A N   1 
ATOM   166   C CA  . LYS A 1 25  ? -4.031  -19.026 39.159  1.00 54.54  ? 25  LYS A CA  1 
ATOM   167   C C   . LYS A 1 25  ? -5.029  -20.173 38.997  1.00 57.47  ? 25  LYS A C   1 
ATOM   168   O O   . LYS A 1 25  ? -4.655  -21.341 39.108  1.00 57.30  ? 25  LYS A O   1 
ATOM   169   C CB  . LYS A 1 25  ? -3.557  -18.918 40.609  1.00 58.26  ? 25  LYS A CB  1 
ATOM   170   C CG  . LYS A 1 25  ? -3.232  -20.282 41.257  1.00 75.79  ? 25  LYS A CG  1 
ATOM   171   C CD  . LYS A 1 25  ? -2.285  -20.146 42.445  1.00 76.24  ? 25  LYS A CD  1 
ATOM   172   C CE  . LYS A 1 25  ? -1.586  -21.453 42.776  1.00 75.95  ? 25  LYS A CE  1 
ATOM   173   N NZ  . LYS A 1 25  ? -0.633  -21.294 43.913  1.00 73.71  ? 25  LYS A NZ  1 
ATOM   174   N N   . ASP A 1 26  ? -6.287  -19.855 38.701  1.00 53.14  ? 26  ASP A N   1 
ATOM   175   C CA  . ASP A 1 26  ? -7.273  -20.926 38.498  1.00 52.41  ? 26  ASP A CA  1 
ATOM   176   C C   . ASP A 1 26  ? -7.119  -21.489 37.090  1.00 49.16  ? 26  ASP A C   1 
ATOM   177   O O   . ASP A 1 26  ? -7.526  -22.628 36.813  1.00 45.96  ? 26  ASP A O   1 
ATOM   178   C CB  . ASP A 1 26  ? -8.722  -20.441 38.726  1.00 54.88  ? 26  ASP A CB  1 
ATOM   179   C CG  . ASP A 1 26  ? -8.980  -19.945 40.157  1.00 65.80  ? 26  ASP A CG  1 
ATOM   180   O OD1 . ASP A 1 26  ? -10.085 -19.410 40.381  1.00 67.26  ? 26  ASP A OD1 1 
ATOM   181   O OD2 . ASP A 1 26  ? -8.066  -19.965 41.013  1.00 69.65  ? 26  ASP A OD2 1 
ATOM   182   N N   . PHE A 1 27  ? -6.514  -20.679 36.217  1.00 43.34  ? 27  PHE A N   1 
ATOM   183   C CA  . PHE A 1 27  ? -6.291  -21.062 34.824  1.00 43.46  ? 27  PHE A CA  1 
ATOM   184   C C   . PHE A 1 27  ? -5.079  -21.971 34.694  1.00 48.46  ? 27  PHE A C   1 
ATOM   185   O O   . PHE A 1 27  ? -5.081  -22.964 33.960  1.00 46.52  ? 27  PHE A O   1 
ATOM   186   C CB  . PHE A 1 27  ? -6.060  -19.838 33.961  1.00 45.03  ? 27  PHE A CB  1 
ATOM   187   C CG  . PHE A 1 27  ? -6.100  -20.125 32.479  1.00 46.42  ? 27  PHE A CG  1 
ATOM   188   C CD1 . PHE A 1 27  ? -7.285  -20.031 31.778  1.00 48.57  ? 27  PHE A CD1 1 
ATOM   189   C CD2 . PHE A 1 27  ? -4.937  -20.426 31.776  1.00 47.00  ? 27  PHE A CD2 1 
ATOM   190   C CE1 . PHE A 1 27  ? -7.299  -20.201 30.410  1.00 49.09  ? 27  PHE A CE1 1 
ATOM   191   C CE2 . PHE A 1 27  ? -4.958  -20.590 30.421  1.00 48.72  ? 27  PHE A CE2 1 
ATOM   192   C CZ  . PHE A 1 27  ? -6.136  -20.475 29.739  1.00 47.03  ? 27  PHE A CZ  1 
ATOM   193   N N   . LEU A 1 28  ? -4.026  -21.592 35.402  1.00 45.72  ? 28  LEU A N   1 
ATOM   194   C CA  . LEU A 1 28  ? -2.804  -22.361 35.413  1.00 45.19  ? 28  LEU A CA  1 
ATOM   195   C C   . LEU A 1 28  ? -3.021  -23.731 36.060  1.00 50.38  ? 28  LEU A C   1 
ATOM   196   O O   . LEU A 1 28  ? -2.329  -24.703 35.736  1.00 50.68  ? 28  LEU A O   1 
ATOM   197   C CB  . LEU A 1 28  ? -1.752  -21.621 36.234  1.00 45.00  ? 28  LEU A CB  1 
ATOM   198   C CG  . LEU A 1 28  ? -1.247  -20.251 35.805  1.00 49.55  ? 28  LEU A CG  1 
ATOM   199   C CD1 . LEU A 1 28  ? 0.007   -20.031 36.625  1.00 49.28  ? 28  LEU A CD1 1 
ATOM   200   C CD2 . LEU A 1 28  ? -0.930  -20.196 34.317  1.00 53.33  ? 28  LEU A CD2 1 
ATOM   201   N N   . ASP A 1 29  ? -3.911  -23.783 37.044  1.00 47.18  ? 29  ASP A N   1 
ATOM   202   C CA  . ASP A 1 29  ? -4.152  -25.012 37.784  1.00 47.60  ? 29  ASP A CA  1 
ATOM   203   C C   . ASP A 1 29  ? -5.112  -25.910 37.033  1.00 51.36  ? 29  ASP A C   1 
ATOM   204   O O   . ASP A 1 29  ? -5.061  -27.133 37.147  1.00 52.55  ? 29  ASP A O   1 
ATOM   205   C CB  . ASP A 1 29  ? -4.665  -24.697 39.193  1.00 50.36  ? 29  ASP A CB  1 
ATOM   206   C CG  . ASP A 1 29  ? -3.542  -24.207 40.129  1.00 66.66  ? 29  ASP A CG  1 
ATOM   207   O OD1 . ASP A 1 29  ? -2.522  -23.689 39.622  1.00 67.87  ? 29  ASP A OD1 1 
ATOM   208   O OD2 . ASP A 1 29  ? -3.655  -24.369 41.366  1.00 72.71  ? 29  ASP A OD2 1 
ATOM   209   N N   . LYS A 1 30  ? -5.965  -25.313 36.222  1.00 46.55  ? 30  LYS A N   1 
ATOM   210   C CA  . LYS A 1 30  ? -6.918  -26.131 35.493  1.00 46.74  ? 30  LYS A CA  1 
ATOM   211   C C   . LYS A 1 30  ? -6.169  -26.987 34.479  1.00 49.59  ? 30  LYS A C   1 
ATOM   212   O O   . LYS A 1 30  ? -6.634  -28.071 34.083  1.00 50.18  ? 30  LYS A O   1 
ATOM   213   C CB  . LYS A 1 30  ? -7.973  -25.244 34.798  1.00 49.69  ? 30  LYS A CB  1 
ATOM   214   C CG  . LYS A 1 30  ? -9.329  -25.292 35.448  1.00 71.26  ? 30  LYS A CG  1 
ATOM   215   C CD  . LYS A 1 30  ? -9.288  -24.811 36.914  1.00 86.31  ? 30  LYS A CD  1 
ATOM   216   C CE  . LYS A 1 30  ? -10.429 -25.424 37.713  1.00 90.04  ? 30  LYS A CE  1 
ATOM   217   N NZ  . LYS A 1 30  ? -10.083 -26.774 38.243  1.00 99.04  ? 30  LYS A NZ  1 
ATOM   218   N N   . TYR A 1 31  ? -5.005  -26.477 34.079  1.00 42.55  ? 31  TYR A N   1 
ATOM   219   C CA  . TYR A 1 31  ? -4.198  -27.086 33.049  1.00 40.82  ? 31  TYR A CA  1 
ATOM   220   C C   . TYR A 1 31  ? -2.897  -27.628 33.629  1.00 43.62  ? 31  TYR A C   1 
ATOM   221   O O   . TYR A 1 31  ? -2.130  -28.325 32.957  1.00 43.77  ? 31  TYR A O   1 
ATOM   222   C CB  . TYR A 1 31  ? -3.976  -26.055 31.946  1.00 40.83  ? 31  TYR A CB  1 
ATOM   223   C CG  . TYR A 1 31  ? -5.252  -25.726 31.184  1.00 40.23  ? 31  TYR A CG  1 
ATOM   224   C CD1 . TYR A 1 31  ? -6.051  -24.671 31.563  1.00 41.21  ? 31  TYR A CD1 1 
ATOM   225   C CD2 . TYR A 1 31  ? -5.656  -26.494 30.099  1.00 41.57  ? 31  TYR A CD2 1 
ATOM   226   C CE1 . TYR A 1 31  ? -7.199  -24.340 30.848  1.00 41.18  ? 31  TYR A CE1 1 
ATOM   227   C CE2 . TYR A 1 31  ? -6.788  -26.171 29.378  1.00 42.99  ? 31  TYR A CE2 1 
ATOM   228   C CZ  . TYR A 1 31  ? -7.559  -25.101 29.759  1.00 48.64  ? 31  TYR A CZ  1 
ATOM   229   O OH  . TYR A 1 31  ? -8.685  -24.817 29.025  1.00 50.21  ? 31  TYR A OH  1 
ATOM   230   N N   . SER A 1 32  ? -2.746  -27.425 34.934  1.00 38.65  ? 32  SER A N   1 
ATOM   231   C CA  . SER A 1 32  ? -1.598  -27.900 35.696  1.00 38.06  ? 32  SER A CA  1 
ATOM   232   C C   . SER A 1 32  ? -0.291  -27.318 35.170  1.00 43.86  ? 32  SER A C   1 
ATOM   233   O O   . SER A 1 32  ? 0.740   -28.004 35.086  1.00 42.79  ? 32  SER A O   1 
ATOM   234   C CB  . SER A 1 32  ? -1.549  -29.424 35.769  1.00 40.71  ? 32  SER A CB  1 
ATOM   235   O OG  . SER A 1 32  ? -1.770  -30.015 34.499  1.00 50.02  ? 32  SER A OG  1 
ATOM   236   N N   . LEU A 1 33  ? -0.334  -26.016 34.900  1.00 40.18  ? 33  LEU A N   1 
ATOM   237   C CA  . LEU A 1 33  ? 0.799   -25.290 34.372  1.00 38.30  ? 33  LEU A CA  1 
ATOM   238   C C   . LEU A 1 33  ? 1.580   -24.668 35.507  1.00 42.43  ? 33  LEU A C   1 
ATOM   239   O O   . LEU A 1 33  ? 1.080   -24.567 36.632  1.00 42.63  ? 33  LEU A O   1 
ATOM   240   C CB  . LEU A 1 33  ? 0.294   -24.197 33.429  1.00 37.61  ? 33  LEU A CB  1 
ATOM   241   C CG  . LEU A 1 33  ? -0.489  -24.650 32.197  1.00 40.93  ? 33  LEU A CG  1 
ATOM   242   C CD1 . LEU A 1 33  ? -1.055  -23.427 31.528  1.00 40.76  ? 33  LEU A CD1 1 
ATOM   243   C CD2 . LEU A 1 33  ? 0.415   -25.423 31.232  1.00 42.53  ? 33  LEU A CD2 1 
ATOM   244   N N   . LYS A 1 34  ? 2.818   -24.281 35.209  1.00 38.30  ? 34  LYS A N   1 
ATOM   245   C CA  . LYS A 1 34  ? 3.685   -23.614 36.159  1.00 37.45  ? 34  LYS A CA  1 
ATOM   246   C C   . LYS A 1 34  ? 3.739   -22.156 35.740  1.00 42.80  ? 34  LYS A C   1 
ATOM   247   O O   . LYS A 1 34  ? 3.887   -21.862 34.553  1.00 43.45  ? 34  LYS A O   1 
ATOM   248   C CB  . LYS A 1 34  ? 5.095   -24.209 36.096  1.00 39.69  ? 34  LYS A CB  1 
ATOM   249   C CG  . LYS A 1 34  ? 5.186   -25.667 36.476  1.00 44.19  ? 34  LYS A CG  1 
ATOM   250   C CD  . LYS A 1 34  ? 6.602   -26.013 36.885  1.00 58.53  ? 34  LYS A CD  1 
ATOM   251   C CE  . LYS A 1 34  ? 7.430   -26.530 35.707  1.00 76.53  ? 34  LYS A CE  1 
ATOM   252   N NZ  . LYS A 1 34  ? 8.534   -27.437 36.140  1.00 83.78  ? 34  LYS A NZ  1 
ATOM   253   N N   . PRO A 1 35  ? 3.686   -21.251 36.721  1.00 39.31  ? 35  PRO A N   1 
ATOM   254   C CA  . PRO A 1 35  ? 3.732   -19.795 36.475  1.00 37.58  ? 35  PRO A CA  1 
ATOM   255   C C   . PRO A 1 35  ? 4.780   -19.290 35.461  1.00 38.50  ? 35  PRO A C   1 
ATOM   256   O O   . PRO A 1 35  ? 4.516   -18.377 34.691  1.00 39.77  ? 35  PRO A O   1 
ATOM   257   C CB  . PRO A 1 35  ? 4.004   -19.204 37.866  1.00 39.11  ? 35  PRO A CB  1 
ATOM   258   C CG  . PRO A 1 35  ? 4.596   -20.312 38.654  1.00 44.37  ? 35  PRO A CG  1 
ATOM   259   C CD  . PRO A 1 35  ? 3.994   -21.589 38.123  1.00 39.78  ? 35  PRO A CD  1 
ATOM   260   N N   . ASN A 1 36  ? 5.981   -19.849 35.482  1.00 32.03  ? 36  ASN A N   1 
ATOM   261   C CA  . ASN A 1 36  ? 7.029   -19.453 34.530  1.00 30.95  ? 36  ASN A CA  1 
ATOM   262   C C   . ASN A 1 36  ? 7.652   -20.722 33.953  1.00 34.40  ? 36  ASN A C   1 
ATOM   263   O O   . ASN A 1 36  ? 8.346   -21.456 34.674  1.00 35.79  ? 36  ASN A O   1 
ATOM   264   C CB  . ASN A 1 36  ? 8.109   -18.663 35.237  1.00 30.23  ? 36  ASN A CB  1 
ATOM   265   C CG  . ASN A 1 36  ? 8.579   -17.483 34.428  1.00 58.69  ? 36  ASN A CG  1 
ATOM   266   O OD1 . ASN A 1 36  ? 7.913   -16.451 34.387  1.00 48.84  ? 36  ASN A OD1 1 
ATOM   267   N ND2 . ASN A 1 36  ? 9.740   -17.618 33.785  1.00 51.56  ? 36  ASN A ND2 1 
ATOM   268   N N   . ASP A 1 37  ? 7.423   -20.975 32.659  1.00 25.67  ? 37  ASP A N   1 
ATOM   269   C CA  . ASP A 1 37  ? 7.844   -22.228 32.023  1.00 21.84  ? 37  ASP A CA  1 
ATOM   270   C C   . ASP A 1 37  ? 7.523   -22.169 30.530  1.00 25.10  ? 37  ASP A C   1 
ATOM   271   O O   . ASP A 1 37  ? 6.784   -21.291 30.053  1.00 23.35  ? 37  ASP A O   1 
ATOM   272   C CB  . ASP A 1 37  ? 7.051   -23.371 32.667  1.00 21.65  ? 37  ASP A CB  1 
ATOM   273   C CG  . ASP A 1 37  ? 7.559   -24.748 32.308  1.00 29.16  ? 37  ASP A CG  1 
ATOM   274   O OD1 . ASP A 1 37  ? 8.744   -24.937 31.968  1.00 32.31  ? 37  ASP A OD1 1 
ATOM   275   O OD2 . ASP A 1 37  ? 6.787   -25.702 32.528  1.00 37.31  ? 37  ASP A OD2 1 
ATOM   276   N N   . GLN A 1 38  ? 8.000   -23.180 29.814  1.00 22.10  ? 38  GLN A N   1 
ATOM   277   C CA  . GLN A 1 38  ? 7.831   -23.288 28.376  1.00 20.12  ? 38  GLN A CA  1 
ATOM   278   C C   . GLN A 1 38  ? 7.618   -24.755 28.136  1.00 24.69  ? 38  GLN A C   1 
ATOM   279   O O   . GLN A 1 38  ? 8.428   -25.604 28.592  1.00 25.10  ? 38  GLN A O   1 
ATOM   280   C CB  . GLN A 1 38  ? 9.141   -22.865 27.658  1.00 19.93  ? 38  GLN A CB  1 
ATOM   281   C CG  . GLN A 1 38  ? 9.371   -21.376 27.615  1.00 1.00   ? 38  GLN A CG  1 
ATOM   282   C CD  . GLN A 1 38  ? 10.706  -21.010 27.007  1.00 29.66  ? 38  GLN A CD  1 
ATOM   283   O OE1 . GLN A 1 38  ? 10.745  -20.390 25.918  1.00 26.00  ? 38  GLN A OE1 1 
ATOM   284   N NE2 . GLN A 1 38  ? 11.817  -21.315 27.721  1.00 10.33  ? 38  GLN A NE2 1 
ATOM   285   N N   . ILE A 1 39  ? 6.571   -25.070 27.388  1.00 19.24  ? 39  ILE A N   1 
ATOM   286   C CA  . ILE A 1 39  ? 6.322   -26.464 27.033  1.00 17.26  ? 39  ILE A CA  1 
ATOM   287   C C   . ILE A 1 39  ? 5.516   -26.623 25.759  1.00 17.42  ? 39  ILE A C   1 
ATOM   288   O O   . ILE A 1 39  ? 4.927   -25.660 25.246  1.00 17.70  ? 39  ILE A O   1 
ATOM   289   C CB  . ILE A 1 39  ? 5.630   -27.273 28.166  1.00 21.21  ? 39  ILE A CB  1 
ATOM   290   C CG1 . ILE A 1 39  ? 4.126   -27.052 28.200  1.00 22.76  ? 39  ILE A CG1 1 
ATOM   291   C CG2 . ILE A 1 39  ? 6.111   -26.888 29.523  1.00 22.62  ? 39  ILE A CG2 1 
ATOM   292   C CD1 . ILE A 1 39  ? 3.443   -27.828 29.308  1.00 20.93  ? 39  ILE A CD1 1 
ATOM   293   N N   . LEU A 1 40  ? 5.538   -27.827 25.208  1.00 10.53  ? 40  LEU A N   1 
ATOM   294   C CA  . LEU A 1 40  ? 4.734   -28.066 24.050  1.00 10.21  ? 40  LEU A CA  1 
ATOM   295   C C   . LEU A 1 40  ? 3.402   -28.608 24.551  1.00 18.01  ? 40  LEU A C   1 
ATOM   296   O O   . LEU A 1 40  ? 3.344   -29.340 25.558  1.00 16.32  ? 40  LEU A O   1 
ATOM   297   C CB  . LEU A 1 40  ? 5.381   -29.023 23.044  1.00 9.21   ? 40  LEU A CB  1 
ATOM   298   C CG  . LEU A 1 40  ? 6.729   -28.665 22.386  1.00 11.60  ? 40  LEU A CG  1 
ATOM   299   C CD1 . LEU A 1 40  ? 6.995   -29.740 21.358  1.00 10.53  ? 40  LEU A CD1 1 
ATOM   300   C CD2 . LEU A 1 40  ? 6.911   -27.195 21.791  1.00 1.00   ? 40  LEU A CD2 1 
ATOM   301   N N   . ALA A 1 41  ? 2.354   -28.229 23.821  1.00 16.55  ? 41  ALA A N   1 
ATOM   302   C CA  . ALA A 1 41  ? 0.983   -28.649 24.056  1.00 16.15  ? 41  ALA A CA  1 
ATOM   303   C C   . ALA A 1 41  ? 0.785   -30.160 23.964  1.00 22.87  ? 41  ALA A C   1 
ATOM   304   O O   . ALA A 1 41  ? 1.172   -30.790 22.993  1.00 22.88  ? 41  ALA A O   1 
ATOM   305   C CB  . ALA A 1 41  ? 0.063   -27.950 23.069  1.00 15.68  ? 41  ALA A CB  1 
ATOM   306   N N   . GLU A 1 42  ? 0.108   -30.724 24.950  1.00 22.18  ? 42  GLU A N   1 
ATOM   307   C CA  . GLU A 1 42  ? -0.295  -32.130 24.905  1.00 22.84  ? 42  GLU A CA  1 
ATOM   308   C C   . GLU A 1 42  ? -1.814  -32.144 24.795  1.00 23.38  ? 42  GLU A C   1 
ATOM   309   O O   . GLU A 1 42  ? -2.457  -31.111 24.772  1.00 21.68  ? 42  GLU A O   1 
ATOM   310   C CB  . GLU A 1 42  ? 0.130   -32.873 26.170  1.00 25.39  ? 42  GLU A CB  1 
ATOM   311   C CG  . GLU A 1 42  ? 1.264   -32.243 26.891  1.00 42.65  ? 42  GLU A CG  1 
ATOM   312   C CD  . GLU A 1 42  ? 2.506   -33.094 26.865  1.00 62.87  ? 42  GLU A CD  1 
ATOM   313   O OE1 . GLU A 1 42  ? 3.097   -33.294 25.774  1.00 84.62  ? 42  GLU A OE1 1 
ATOM   314   O OE2 . GLU A 1 42  ? 2.898   -33.510 27.974  1.00 37.07  ? 42  GLU A OE2 1 
ATOM   315   N N   . ASP A 1 43  ? -2.397  -33.318 24.745  1.00 21.99  ? 43  ASP A N   1 
ATOM   316   C CA  . ASP A 1 43  ? -3.831  -33.415 24.566  1.00 22.39  ? 43  ASP A CA  1 
ATOM   317   C C   . ASP A 1 43  ? -4.608  -32.696 25.645  1.00 26.81  ? 43  ASP A C   1 
ATOM   318   O O   . ASP A 1 43  ? -5.714  -32.243 25.444  1.00 28.34  ? 43  ASP A O   1 
ATOM   319   C CB  . ASP A 1 43  ? -4.241  -34.876 24.527  1.00 24.53  ? 43  ASP A CB  1 
ATOM   320   C CG  . ASP A 1 43  ? -4.441  -35.357 23.145  1.00 42.26  ? 43  ASP A CG  1 
ATOM   321   O OD1 . ASP A 1 43  ? -4.807  -34.510 22.315  1.00 42.59  ? 43  ASP A OD1 1 
ATOM   322   O OD2 . ASP A 1 43  ? -4.270  -36.562 22.889  1.00 58.17  ? 43  ASP A OD2 1 
ATOM   323   N N   . LYS A 1 44  ? -4.056  -32.654 26.831  1.00 26.07  ? 44  LYS A N   1 
ATOM   324   C CA  . LYS A 1 44  ? -4.744  -32.021 27.933  1.00 28.14  ? 44  LYS A CA  1 
ATOM   325   C C   . LYS A 1 44  ? -4.738  -30.503 27.834  1.00 39.78  ? 44  LYS A C   1 
ATOM   326   O O   . LYS A 1 44  ? -5.107  -29.807 28.784  1.00 42.31  ? 44  LYS A O   1 
ATOM   327   C CB  . LYS A 1 44  ? -4.072  -32.405 29.241  1.00 30.92  ? 44  LYS A CB  1 
ATOM   328   C CG  . LYS A 1 44  ? -2.615  -32.785 29.089  1.00 53.28  ? 44  LYS A CG  1 
ATOM   329   C CD  . LYS A 1 44  ? -2.071  -33.479 30.349  1.00 58.99  ? 44  LYS A CD  1 
ATOM   330   C CE  . LYS A 1 44  ? -2.079  -32.531 31.519  1.00 47.89  ? 44  LYS A CE  1 
ATOM   331   N NZ  . LYS A 1 44  ? -1.043  -31.482 31.322  1.00 49.19  ? 44  LYS A NZ  1 
ATOM   332   N N   . HIS A 1 45  ? -4.208  -29.979 26.738  1.00 37.99  ? 45  HIS A N   1 
ATOM   333   C CA  . HIS A 1 45  ? -4.064  -28.548 26.584  1.00 37.96  ? 45  HIS A CA  1 
ATOM   334   C C   . HIS A 1 45  ? -4.956  -27.987 25.502  1.00 45.78  ? 45  HIS A C   1 
ATOM   335   O O   . HIS A 1 45  ? -5.213  -26.774 25.496  1.00 47.20  ? 45  HIS A O   1 
ATOM   336   C CB  . HIS A 1 45  ? -2.611  -28.188 26.296  1.00 38.90  ? 45  HIS A CB  1 
ATOM   337   C CG  . HIS A 1 45  ? -1.654  -28.634 27.358  1.00 42.88  ? 45  HIS A CG  1 
ATOM   338   N ND1 . HIS A 1 45  ? -1.755  -28.203 28.663  1.00 44.98  ? 45  HIS A ND1 1 
ATOM   339   C CD2 . HIS A 1 45  ? -0.567  -29.449 27.313  1.00 44.62  ? 45  HIS A CD2 1 
ATOM   340   C CE1 . HIS A 1 45  ? -0.790  -28.753 29.380  1.00 44.36  ? 45  HIS A CE1 1 
ATOM   341   N NE2 . HIS A 1 45  ? -0.044  -29.499 28.581  1.00 44.39  ? 45  HIS A NE2 1 
ATOM   342   N N   . LYS A 1 46  ? -5.401  -28.847 24.582  1.00 43.17  ? 46  LYS A N   1 
ATOM   343   C CA  . LYS A 1 46  ? -6.271  -28.443 23.481  1.00 43.25  ? 46  LYS A CA  1 
ATOM   344   C C   . LYS A 1 46  ? -7.297  -27.390 23.924  1.00 47.81  ? 46  LYS A C   1 
ATOM   345   O O   . LYS A 1 46  ? -7.533  -26.395 23.229  1.00 48.00  ? 46  LYS A O   1 
ATOM   346   C CB  . LYS A 1 46  ? -7.009  -29.661 22.931  1.00 45.45  ? 46  LYS A CB  1 
ATOM   347   C CG  . LYS A 1 46  ? -6.289  -30.349 21.787  1.00 73.83  ? 46  LYS A CG  1 
ATOM   348   C CD  . LYS A 1 46  ? -7.228  -31.259 20.999  1.00 84.37  ? 46  LYS A CD  1 
ATOM   349   C CE  . LYS A 1 46  ? -6.583  -32.592 20.672  1.00 82.10  ? 46  LYS A CE  1 
ATOM   350   N NZ  . LYS A 1 46  ? -7.602  -33.670 20.739  1.00 86.21  ? 46  LYS A NZ  1 
ATOM   351   N N   . GLU A 1 47  ? -7.843  -27.601 25.116  1.00 43.51  ? 47  GLU A N   1 
ATOM   352   C CA  . GLU A 1 47  ? -8.905  -26.777 25.687  1.00 43.14  ? 47  GLU A CA  1 
ATOM   353   C C   . GLU A 1 47  ? -8.370  -25.469 26.283  1.00 46.50  ? 47  GLU A C   1 
ATOM   354   O O   . GLU A 1 47  ? -9.120  -24.563 26.656  1.00 47.67  ? 47  GLU A O   1 
ATOM   355   C CB  . GLU A 1 47  ? -9.585  -27.604 26.774  1.00 44.84  ? 47  GLU A CB  1 
ATOM   356   C CG  . GLU A 1 47  ? -10.921 -27.078 27.267  1.00 60.15  ? 47  GLU A CG  1 
ATOM   357   C CD  . GLU A 1 47  ? -11.450 -27.878 28.449  1.00 73.63  ? 47  GLU A CD  1 
ATOM   358   O OE1 . GLU A 1 47  ? -11.373 -29.127 28.408  1.00 66.76  ? 47  GLU A OE1 1 
ATOM   359   O OE2 . GLU A 1 47  ? -11.884 -27.246 29.448  1.00 55.28  ? 47  GLU A OE2 1 
ATOM   360   N N   . LEU A 1 48  ? -7.054  -25.389 26.397  1.00 40.17  ? 48  LEU A N   1 
ATOM   361   C CA  . LEU A 1 48  ? -6.433  -24.214 26.974  1.00 39.03  ? 48  LEU A CA  1 
ATOM   362   C C   . LEU A 1 48  ? -6.368  -23.051 25.987  1.00 42.35  ? 48  LEU A C   1 
ATOM   363   O O   . LEU A 1 48  ? -6.344  -21.875 26.388  1.00 42.11  ? 48  LEU A O   1 
ATOM   364   C CB  . LEU A 1 48  ? -5.038  -24.561 27.501  1.00 38.71  ? 48  LEU A CB  1 
ATOM   365   C CG  . LEU A 1 48  ? -4.042  -23.446 27.821  1.00 42.06  ? 48  LEU A CG  1 
ATOM   366   C CD1 . LEU A 1 48  ? -2.961  -24.060 28.654  1.00 42.91  ? 48  LEU A CD1 1 
ATOM   367   C CD2 . LEU A 1 48  ? -3.427  -22.856 26.553  1.00 41.99  ? 48  LEU A CD2 1 
ATOM   368   N N   . PHE A 1 49  ? -6.359  -23.362 24.697  1.00 36.85  ? 49  PHE A N   1 
ATOM   369   C CA  . PHE A 1 49  ? -6.308  -22.296 23.719  1.00 36.55  ? 49  PHE A CA  1 
ATOM   370   C C   . PHE A 1 49  ? -7.667  -21.670 23.467  1.00 43.96  ? 49  PHE A C   1 
ATOM   371   O O   . PHE A 1 49  ? -7.772  -20.439 23.441  1.00 42.15  ? 49  PHE A O   1 
ATOM   372   C CB  . PHE A 1 49  ? -5.610  -22.743 22.427  1.00 38.22  ? 49  PHE A CB  1 
ATOM   373   C CG  . PHE A 1 49  ? -4.154  -23.075 22.619  1.00 38.95  ? 49  PHE A CG  1 
ATOM   374   C CD1 . PHE A 1 49  ? -3.175  -22.157 22.286  1.00 41.68  ? 49  PHE A CD1 1 
ATOM   375   C CD2 . PHE A 1 49  ? -3.770  -24.268 23.227  1.00 40.42  ? 49  PHE A CD2 1 
ATOM   376   C CE1 . PHE A 1 49  ? -1.821  -22.449 22.500  1.00 42.19  ? 49  PHE A CE1 1 
ATOM   377   C CE2 . PHE A 1 49  ? -2.430  -24.560 23.453  1.00 42.23  ? 49  PHE A CE2 1 
ATOM   378   C CZ  . PHE A 1 49  ? -1.459  -23.644 23.092  1.00 40.28  ? 49  PHE A CZ  1 
ATOM   379   N N   . ASP A 1 50  ? -8.702  -22.500 23.319  1.00 44.29  ? 50  ASP A N   1 
ATOM   380   C CA  . ASP A 1 50  ? -10.055 -21.991 23.069  1.00 46.02  ? 50  ASP A CA  1 
ATOM   381   C C   . ASP A 1 50  ? -10.479 -21.045 24.194  1.00 51.15  ? 50  ASP A C   1 
ATOM   382   O O   . ASP A 1 50  ? -10.985 -19.938 23.949  1.00 51.74  ? 50  ASP A O   1 
ATOM   383   C CB  . ASP A 1 50  ? -11.092 -23.135 22.963  1.00 49.51  ? 50  ASP A CB  1 
ATOM   384   C CG  . ASP A 1 50  ? -11.155 -23.780 21.563  1.00 72.79  ? 50  ASP A CG  1 
ATOM   385   O OD1 . ASP A 1 50  ? -10.871 -23.085 20.560  1.00 77.07  ? 50  ASP A OD1 1 
ATOM   386   O OD2 . ASP A 1 50  ? -11.535 -24.979 21.467  1.00 78.52  ? 50  ASP A OD2 1 
ATOM   387   N N   . GLU A 1 51  ? -10.290 -21.493 25.429  1.00 45.98  ? 51  GLU A N   1 
ATOM   388   C CA  . GLU A 1 51  ? -10.774 -20.737 26.566  1.00 45.74  ? 51  GLU A CA  1 
ATOM   389   C C   . GLU A 1 51  ? -9.970  -19.520 26.941  1.00 49.61  ? 51  GLU A C   1 
ATOM   390   O O   . GLU A 1 51  ? -10.470 -18.627 27.618  1.00 51.64  ? 51  GLU A O   1 
ATOM   391   C CB  . GLU A 1 51  ? -11.014 -21.665 27.757  1.00 46.93  ? 51  GLU A CB  1 
ATOM   392   C CG  . GLU A 1 51  ? -9.966  -21.645 28.814  1.00 49.17  ? 51  GLU A CG  1 
ATOM   393   C CD  . GLU A 1 51  ? -10.387 -22.466 30.005  1.00 55.49  ? 51  GLU A CD  1 
ATOM   394   O OE1 . GLU A 1 51  ? -10.746 -23.648 29.815  1.00 62.32  ? 51  GLU A OE1 1 
ATOM   395   O OE2 . GLU A 1 51  ? -10.506 -21.890 31.111  1.00 36.53  ? 51  GLU A OE2 1 
ATOM   396   N N   . LEU A 1 52  ? -8.710  -19.510 26.523  1.00 43.34  ? 52  LEU A N   1 
ATOM   397   C CA  . LEU A 1 52  ? -7.808  -18.376 26.731  1.00 40.73  ? 52  LEU A CA  1 
ATOM   398   C C   . LEU A 1 52  ? -8.359  -17.172 25.967  1.00 44.08  ? 52  LEU A C   1 
ATOM   399   O O   . LEU A 1 52  ? -8.555  -16.112 26.544  1.00 42.02  ? 52  LEU A O   1 
ATOM   400   C CB  . LEU A 1 52  ? -6.406  -18.723 26.211  1.00 39.67  ? 52  LEU A CB  1 
ATOM   401   C CG  . LEU A 1 52  ? -5.321  -17.643 26.082  1.00 41.55  ? 52  LEU A CG  1 
ATOM   402   C CD1 . LEU A 1 52  ? -4.871  -17.125 27.458  1.00 41.43  ? 52  LEU A CD1 1 
ATOM   403   C CD2 . LEU A 1 52  ? -4.110  -18.173 25.286  1.00 38.06  ? 52  LEU A CD2 1 
ATOM   404   N N   . VAL A 1 53  ? -8.655  -17.363 24.681  1.00 42.93  ? 53  VAL A N   1 
ATOM   405   C CA  . VAL A 1 53  ? -9.199  -16.311 23.827  1.00 43.15  ? 53  VAL A CA  1 
ATOM   406   C C   . VAL A 1 53  ? -10.658 -15.963 24.115  1.00 46.13  ? 53  VAL A C   1 
ATOM   407   O O   . VAL A 1 53  ? -11.091 -14.840 23.854  1.00 45.57  ? 53  VAL A O   1 
ATOM   408   C CB  . VAL A 1 53  ? -9.074  -16.682 22.345  1.00 47.87  ? 53  VAL A CB  1 
ATOM   409   C CG1 . VAL A 1 53  ? -9.234  -15.446 21.467  1.00 47.71  ? 53  VAL A CG1 1 
ATOM   410   C CG2 . VAL A 1 53  ? -7.739  -17.406 22.087  1.00 47.68  ? 53  VAL A CG2 1 
ATOM   411   N N   . LYS A 1 54  ? -11.425 -16.904 24.660  1.00 42.12  ? 54  LYS A N   1 
ATOM   412   C CA  . LYS A 1 54  ? -12.831 -16.606 24.975  1.00 40.97  ? 54  LYS A CA  1 
ATOM   413   C C   . LYS A 1 54  ? -12.949 -15.912 26.332  1.00 44.08  ? 54  LYS A C   1 
ATOM   414   O O   . LYS A 1 54  ? -13.792 -15.015 26.539  1.00 44.61  ? 54  LYS A O   1 
ATOM   415   C CB  . LYS A 1 54  ? -13.728 -17.858 24.942  1.00 42.15  ? 54  LYS A CB  1 
ATOM   416   C CG  . LYS A 1 54  ? -13.757 -18.603 23.616  1.00 61.73  ? 54  LYS A CG  1 
ATOM   417   C CD  . LYS A 1 54  ? -14.277 -20.026 23.799  1.00 76.61  ? 54  LYS A CD  1 
ATOM   418   C CE  . LYS A 1 54  ? -14.447 -20.744 22.461  1.00 91.73  ? 54  LYS A CE  1 
ATOM   419   N NZ  . LYS A 1 54  ? -13.205 -21.501 22.140  1.00 99.81  ? 54  LYS A NZ  1 
ATOM   420   N N   . LYS A 1 55  ? -12.117 -16.332 27.276  1.00 36.96  ? 55  LYS A N   1 
ATOM   421   C CA  . LYS A 1 55  ? -12.225 -15.796 28.625  1.00 34.99  ? 55  LYS A CA  1 
ATOM   422   C C   . LYS A 1 55  ? -11.307 -14.677 29.022  1.00 37.02  ? 55  LYS A C   1 
ATOM   423   O O   . LYS A 1 55  ? -11.346 -14.265 30.181  1.00 36.79  ? 55  LYS A O   1 
ATOM   424   C CB  . LYS A 1 55  ? -12.103 -16.898 29.689  1.00 36.31  ? 55  LYS A CB  1 
ATOM   425   C CG  . LYS A 1 55  ? -13.330 -17.803 29.800  1.00 58.31  ? 55  LYS A CG  1 
ATOM   426   C CD  . LYS A 1 55  ? -13.104 -18.984 30.759  1.00 71.24  ? 55  LYS A CD  1 
ATOM   427   C CE  . LYS A 1 55  ? -14.115 -20.126 30.527  1.00 86.05  ? 55  LYS A CE  1 
ATOM   428   N NZ  . LYS A 1 55  ? -15.530 -19.678 30.240  1.00 91.67  ? 55  LYS A NZ  1 
ATOM   429   N N   . PHE A 1 56  ? -10.363 -14.291 28.170  1.00 32.32  ? 56  PHE A N   1 
ATOM   430   C CA  . PHE A 1 56  ? -9.373  -13.279 28.603  1.00 30.78  ? 56  PHE A CA  1 
ATOM   431   C C   . PHE A 1 56  ? -9.098  -12.243 27.520  1.00 36.77  ? 56  PHE A C   1 
ATOM   432   O O   . PHE A 1 56  ? -9.560  -12.367 26.389  1.00 36.56  ? 56  PHE A O   1 
ATOM   433   C CB  . PHE A 1 56  ? -8.049  -13.921 29.084  1.00 31.35  ? 56  PHE A CB  1 
ATOM   434   C CG  . PHE A 1 56  ? -8.192  -14.881 30.257  1.00 30.91  ? 56  PHE A CG  1 
ATOM   435   C CD1 . PHE A 1 56  ? -8.447  -16.231 30.042  1.00 33.35  ? 56  PHE A CD1 1 
ATOM   436   C CD2 . PHE A 1 56  ? -7.930  -14.471 31.553  1.00 30.71  ? 56  PHE A CD2 1 
ATOM   437   C CE1 . PHE A 1 56  ? -8.571  -17.127 31.120  1.00 32.79  ? 56  PHE A CE1 1 
ATOM   438   C CE2 . PHE A 1 56  ? -8.023  -15.358 32.636  1.00 32.44  ? 56  PHE A CE2 1 
ATOM   439   C CZ  . PHE A 1 56  ? -8.355  -16.684 32.420  1.00 30.90  ? 56  PHE A CZ  1 
ATOM   440   N N   . LYS A 1 57  ? -8.385  -11.190 27.889  1.00 37.60  ? 57  LYS A N   1 
ATOM   441   C CA  . LYS A 1 57  ? -8.068  -10.103 26.949  1.00 40.42  ? 57  LYS A CA  1 
ATOM   442   C C   . LYS A 1 57  ? -6.733  -10.361 26.253  1.00 47.27  ? 57  LYS A C   1 
ATOM   443   O O   . LYS A 1 57  ? -5.705  -9.782  26.604  1.00 48.15  ? 57  LYS A O   1 
ATOM   444   C CB  . LYS A 1 57  ? -8.037  -8.737  27.656  1.00 44.05  ? 57  LYS A CB  1 
ATOM   445   C CG  . LYS A 1 57  ? -9.345  -7.937  27.518  1.00 69.21  ? 57  LYS A CG  1 
ATOM   446   C CD  . LYS A 1 57  ? -9.299  -6.582  28.255  1.00 75.05  ? 57  LYS A CD  1 
ATOM   447   C CE  . LYS A 1 57  ? -10.665 -6.196  28.818  1.00 76.85  ? 57  LYS A CE  1 
ATOM   448   N NZ  . LYS A 1 57  ? -11.789 -6.842  28.077  1.00 83.62  ? 57  LYS A NZ  1 
ATOM   449   N N   . VAL A 1 58  ? -6.770  -11.247 25.267  1.00 42.92  ? 58  VAL A N   1 
ATOM   450   C CA  . VAL A 1 58  ? -5.602  -11.683 24.523  1.00 40.78  ? 58  VAL A CA  1 
ATOM   451   C C   . VAL A 1 58  ? -5.107  -10.715 23.440  1.00 44.61  ? 58  VAL A C   1 
ATOM   452   O O   . VAL A 1 58  ? -5.896  -9.985  22.825  1.00 45.75  ? 58  VAL A O   1 
ATOM   453   C CB  . VAL A 1 58  ? -5.944  -13.003 23.858  1.00 44.10  ? 58  VAL A CB  1 
ATOM   454   C CG1 . VAL A 1 58  ? -6.857  -12.772 22.708  1.00 43.34  ? 58  VAL A CG1 1 
ATOM   455   C CG2 . VAL A 1 58  ? -4.720  -13.671 23.389  1.00 45.19  ? 58  VAL A CG2 1 
ATOM   456   N N   . GLU A 1 59  ? -3.798  -10.766 23.175  1.00 39.45  ? 59  GLU A N   1 
ATOM   457   C CA  . GLU A 1 59  ? -3.156  -9.988  22.100  1.00 38.76  ? 59  GLU A CA  1 
ATOM   458   C C   . GLU A 1 59  ? -2.309  -10.884 21.182  1.00 41.71  ? 59  GLU A C   1 
ATOM   459   O O   . GLU A 1 59  ? -1.784  -11.908 21.623  1.00 41.66  ? 59  GLU A O   1 
ATOM   460   C CB  . GLU A 1 59  ? -2.273  -8.886  22.676  1.00 40.08  ? 59  GLU A CB  1 
ATOM   461   C CG  . GLU A 1 59  ? -3.020  -7.618  22.979  1.00 49.87  ? 59  GLU A CG  1 
ATOM   462   C CD  . GLU A 1 59  ? -2.165  -6.605  23.664  1.00 78.11  ? 59  GLU A CD  1 
ATOM   463   O OE1 . GLU A 1 59  ? -1.149  -6.192  23.055  1.00 80.97  ? 59  GLU A OE1 1 
ATOM   464   O OE2 . GLU A 1 59  ? -2.531  -6.202  24.791  1.00 79.67  ? 59  GLU A OE2 1 
ATOM   465   N N   . TYR A 1 60  ? -2.127  -10.460 19.927  1.00 36.91  ? 60  TYR A N   1 
ATOM   466   C CA  . TYR A 1 60  ? -1.399  -11.241 18.914  1.00 35.30  ? 60  TYR A CA  1 
ATOM   467   C C   . TYR A 1 60  ? -0.103  -10.626 18.431  1.00 37.40  ? 60  TYR A C   1 
ATOM   468   O O   . TYR A 1 60  ? -0.122  -9.504  17.912  1.00 37.13  ? 60  TYR A O   1 
ATOM   469   C CB  . TYR A 1 60  ? -2.287  -11.497 17.704  1.00 35.83  ? 60  TYR A CB  1 
ATOM   470   C CG  . TYR A 1 60  ? -3.591  -12.150 18.059  1.00 36.67  ? 60  TYR A CG  1 
ATOM   471   C CD1 . TYR A 1 60  ? -3.663  -13.524 18.250  1.00 38.22  ? 60  TYR A CD1 1 
ATOM   472   C CD2 . TYR A 1 60  ? -4.750  -11.390 18.221  1.00 37.08  ? 60  TYR A CD2 1 
ATOM   473   C CE1 . TYR A 1 60  ? -4.857  -14.128 18.598  1.00 39.20  ? 60  TYR A CE1 1 
ATOM   474   C CE2 . TYR A 1 60  ? -5.955  -11.994 18.549  1.00 37.74  ? 60  TYR A CE2 1 
ATOM   475   C CZ  . TYR A 1 60  ? -6.003  -13.363 18.747  1.00 42.77  ? 60  TYR A CZ  1 
ATOM   476   O OH  . TYR A 1 60  ? -7.188  -13.983 19.075  1.00 41.39  ? 60  TYR A OH  1 
ATOM   477   N N   . HIS A 1 61  ? 0.993   -11.395 18.545  1.00 31.70  ? 61  HIS A N   1 
ATOM   478   C CA  . HIS A 1 61  ? 2.340   -10.960 18.128  1.00 30.58  ? 61  HIS A CA  1 
ATOM   479   C C   . HIS A 1 61  ? 3.066   -12.063 17.354  1.00 33.81  ? 61  HIS A C   1 
ATOM   480   O O   . HIS A 1 61  ? 3.183   -13.198 17.841  1.00 34.35  ? 61  HIS A O   1 
ATOM   481   C CB  . HIS A 1 61  ? 3.213   -10.582 19.363  1.00 30.53  ? 61  HIS A CB  1 
ATOM   482   C CG  . HIS A 1 61  ? 2.712   -9.398  20.112  1.00 35.23  ? 61  HIS A CG  1 
ATOM   483   N ND1 . HIS A 1 61  ? 2.893   -8.106  19.666  1.00 38.17  ? 61  HIS A ND1 1 
ATOM   484   C CD2 . HIS A 1 61  ? 1.978   -9.308  21.246  1.00 38.35  ? 61  HIS A CD2 1 
ATOM   485   C CE1 . HIS A 1 61  ? 2.282   -7.270  20.491  1.00 38.11  ? 61  HIS A CE1 1 
ATOM   486   N NE2 . HIS A 1 61  ? 1.719   -7.974  21.458  1.00 38.43  ? 61  HIS A NE2 1 
ATOM   487   N N   . ALA A 1 62  ? 3.640   -11.722 16.205  1.00 27.51  ? 62  ALA A N   1 
ATOM   488   C CA  . ALA A 1 62  ? 4.392   -12.729 15.477  1.00 27.12  ? 62  ALA A CA  1 
ATOM   489   C C   . ALA A 1 62  ? 5.545   -13.214 16.381  1.00 31.12  ? 62  ALA A C   1 
ATOM   490   O O   . ALA A 1 62  ? 6.264   -12.404 16.973  1.00 31.10  ? 62  ALA A O   1 
ATOM   491   C CB  . ALA A 1 62  ? 4.902   -12.190 14.130  1.00 27.75  ? 62  ALA A CB  1 
ATOM   492   N N   . GLY A 1 63  ? 5.645   -14.537 16.555  1.00 25.68  ? 63  GLY A N   1 
ATOM   493   C CA  . GLY A 1 63  ? 6.623   -15.152 17.444  1.00 23.22  ? 63  GLY A CA  1 
ATOM   494   C C   . GLY A 1 63  ? 7.466   -16.246 16.766  1.00 25.92  ? 63  GLY A C   1 
ATOM   495   O O   . GLY A 1 63  ? 7.688   -16.238 15.537  1.00 26.25  ? 63  GLY A O   1 
ATOM   496   N N   . GLY A 1 64  ? 7.933   -17.190 17.584  1.00 18.65  ? 64  GLY A N   1 
ATOM   497   C CA  . GLY A 1 64  ? 8.806   -18.250 17.117  1.00 16.69  ? 64  GLY A CA  1 
ATOM   498   C C   . GLY A 1 64  ? 10.166  -17.704 17.507  1.00 21.09  ? 64  GLY A C   1 
ATOM   499   O O   . GLY A 1 64  ? 10.521  -16.595 17.073  1.00 20.14  ? 64  GLY A O   1 
ATOM   500   N N   . SER A 1 65  ? 10.862  -18.415 18.409  1.00 14.51  ? 65  SER A N   1 
ATOM   501   C CA  . SER A 1 65  ? 12.173  -18.028 18.884  1.00 11.36  ? 65  SER A CA  1 
ATOM   502   C C   . SER A 1 65  ? 13.166  -17.657 17.766  1.00 16.09  ? 65  SER A C   1 
ATOM   503   O O   . SER A 1 65  ? 13.577  -16.473 17.627  1.00 19.66  ? 65  SER A O   1 
ATOM   504   C CB  . SER A 1 65  ? 12.709  -19.089 19.852  1.00 14.13  ? 65  SER A CB  1 
ATOM   505   O OG  . SER A 1 65  ? 14.103  -18.996 20.061  1.00 25.16  ? 65  SER A OG  1 
ATOM   506   N N   . THR A 1 66  ? 13.573  -18.629 16.967  1.00 9.71   ? 66  THR A N   1 
ATOM   507   C CA  . THR A 1 66  ? 14.527  -18.334 15.890  1.00 11.04  ? 66  THR A CA  1 
ATOM   508   C C   . THR A 1 66  ? 14.046  -17.174 15.012  1.00 21.15  ? 66  THR A C   1 
ATOM   509   O O   . THR A 1 66  ? 14.869  -16.347 14.608  1.00 20.92  ? 66  THR A O   1 
ATOM   510   C CB  . THR A 1 66  ? 14.820  -19.559 14.991  1.00 13.79  ? 66  THR A CB  1 
ATOM   511   O OG1 . THR A 1 66  ? 15.522  -20.558 15.738  1.00 10.82  ? 66  THR A OG1 1 
ATOM   512   C CG2 . THR A 1 66  ? 15.623  -19.136 13.790  1.00 8.09   ? 66  THR A CG2 1 
ATOM   513   N N   . GLN A 1 67  ? 12.740  -17.131 14.690  1.00 18.89  ? 67  GLN A N   1 
ATOM   514   C CA  . GLN A 1 67  ? 12.200  -16.035 13.876  1.00 18.50  ? 67  GLN A CA  1 
ATOM   515   C C   . GLN A 1 67  ? 12.539  -14.708 14.554  1.00 26.24  ? 67  GLN A C   1 
ATOM   516   O O   . GLN A 1 67  ? 13.048  -13.803 13.913  1.00 29.25  ? 67  GLN A O   1 
ATOM   517   C CB  . GLN A 1 67  ? 10.674  -16.138 13.645  1.00 18.30  ? 67  GLN A CB  1 
ATOM   518   C CG  . GLN A 1 67  ? 10.314  -15.704 12.234  1.00 20.36  ? 67  GLN A CG  1 
ATOM   519   C CD  . GLN A 1 67  ? 8.819   -15.680 11.943  1.00 40.59  ? 67  GLN A CD  1 
ATOM   520   O OE1 . GLN A 1 67  ? 8.396   -15.328 10.826  1.00 18.84  ? 67  GLN A OE1 1 
ATOM   521   N NE2 . GLN A 1 67  ? 8.004   -15.979 12.957  1.00 41.75  ? 67  GLN A NE2 1 
ATOM   522   N N   . ASN A 1 68  ? 12.238  -14.596 15.843  1.00 20.17  ? 68  ASN A N   1 
ATOM   523   C CA  . ASN A 1 68  ? 12.489  -13.368 16.590  1.00 21.45  ? 68  ASN A CA  1 
ATOM   524   C C   . ASN A 1 68  ? 13.970  -12.931 16.520  1.00 26.36  ? 68  ASN A C   1 
ATOM   525   O O   . ASN A 1 68  ? 14.305  -11.756 16.367  1.00 24.16  ? 68  ASN A O   1 
ATOM   526   C CB  . ASN A 1 68  ? 12.104  -13.554 18.071  1.00 19.08  ? 68  ASN A CB  1 
ATOM   527   C CG  . ASN A 1 68  ? 10.670  -13.847 18.247  1.00 13.35  ? 68  ASN A CG  1 
ATOM   528   O OD1 . ASN A 1 68  ? 9.855   -13.318 17.543  1.00 12.28  ? 68  ASN A OD1 1 
ATOM   529   N ND2 . ASN A 1 68  ? 10.344  -14.563 19.297  1.00 16.74  ? 68  ASN A ND2 1 
ATOM   530   N N   . SER A 1 69  ? 14.867  -13.884 16.707  1.00 23.07  ? 69  SER A N   1 
ATOM   531   C CA  . SER A 1 69  ? 16.268  -13.537 16.632  1.00 20.86  ? 69  SER A CA  1 
ATOM   532   C C   . SER A 1 69  ? 16.537  -12.979 15.234  1.00 24.01  ? 69  SER A C   1 
ATOM   533   O O   . SER A 1 69  ? 16.972  -11.862 15.083  1.00 25.49  ? 69  SER A O   1 
ATOM   534   C CB  . SER A 1 69  ? 17.115  -14.759 16.965  1.00 19.18  ? 69  SER A CB  1 
ATOM   535   O OG  . SER A 1 69  ? 16.779  -15.186 18.282  1.00 18.06  ? 69  SER A OG  1 
ATOM   536   N N   . ILE A 1 70  ? 16.150  -13.718 14.215  1.00 18.67  ? 70  ILE A N   1 
ATOM   537   C CA  . ILE A 1 70  ? 16.358  -13.304 12.830  1.00 18.13  ? 70  ILE A CA  1 
ATOM   538   C C   . ILE A 1 70  ? 15.864  -11.862 12.597  1.00 22.67  ? 70  ILE A C   1 
ATOM   539   O O   . ILE A 1 70  ? 16.579  -11.015 12.099  1.00 24.85  ? 70  ILE A O   1 
ATOM   540   C CB  . ILE A 1 70  ? 15.799  -14.429 11.809  1.00 19.45  ? 70  ILE A CB  1 
ATOM   541   C CG1 . ILE A 1 70  ? 16.680  -15.671 11.851  1.00 16.77  ? 70  ILE A CG1 1 
ATOM   542   C CG2 . ILE A 1 70  ? 15.734  -13.962 10.398  1.00 20.69  ? 70  ILE A CG2 1 
ATOM   543   C CD1 . ILE A 1 70  ? 18.032  -15.481 11.259  1.00 12.74  ? 70  ILE A CD1 1 
ATOM   544   N N   . LYS A 1 71  ? 14.688  -11.551 13.090  1.00 19.48  ? 71  LYS A N   1 
ATOM   545   C CA  . LYS A 1 71  ? 14.159  -10.224 12.951  1.00 19.79  ? 71  LYS A CA  1 
ATOM   546   C C   . LYS A 1 71  ? 15.015  -9.199  13.722  1.00 28.85  ? 71  LYS A C   1 
ATOM   547   O O   . LYS A 1 71  ? 15.254  -8.090  13.211  1.00 32.16  ? 71  LYS A O   1 
ATOM   548   C CB  . LYS A 1 71  ? 12.754  -10.209 13.495  1.00 22.57  ? 71  LYS A CB  1 
ATOM   549   C CG  . LYS A 1 71  ? 11.778  -11.129 12.795  1.00 32.76  ? 71  LYS A CG  1 
ATOM   550   C CD  . LYS A 1 71  ? 10.356  -10.608 13.001  1.00 29.94  ? 71  LYS A CD  1 
ATOM   551   C CE  . LYS A 1 71  ? 9.360   -11.309 12.108  1.00 23.00  ? 71  LYS A CE  1 
ATOM   552   N NZ  . LYS A 1 71  ? 8.267   -11.864 12.927  1.00 24.12  ? 71  LYS A NZ  1 
ATOM   553   N N   . VAL A 1 72  ? 15.446  -9.536  14.950  1.00 21.47  ? 72  VAL A N   1 
ATOM   554   C CA  . VAL A 1 72  ? 16.270  -8.630  15.743  1.00 18.86  ? 72  VAL A CA  1 
ATOM   555   C C   . VAL A 1 72  ? 17.621  -8.377  15.083  1.00 25.93  ? 72  VAL A C   1 
ATOM   556   O O   . VAL A 1 72  ? 18.031  -7.209  14.931  1.00 25.45  ? 72  VAL A O   1 
ATOM   557   C CB  . VAL A 1 72  ? 16.426  -9.062  17.212  1.00 20.23  ? 72  VAL A CB  1 
ATOM   558   C CG1 . VAL A 1 72  ? 17.412  -8.150  17.929  1.00 21.00  ? 72  VAL A CG1 1 
ATOM   559   C CG2 . VAL A 1 72  ? 15.104  -8.971  17.932  1.00 18.19  ? 72  VAL A CG2 1 
ATOM   560   N N   . ALA A 1 73  ? 18.260  -9.464  14.645  1.00 24.81  ? 73  ALA A N   1 
ATOM   561   C CA  . ALA A 1 73  ? 19.509  -9.444  13.891  1.00 25.75  ? 73  ALA A CA  1 
ATOM   562   C C   . ALA A 1 73  ? 19.392  -8.510  12.670  1.00 33.92  ? 73  ALA A C   1 
ATOM   563   O O   . ALA A 1 73  ? 20.148  -7.531  12.570  1.00 34.61  ? 73  ALA A O   1 
ATOM   564   C CB  . ALA A 1 73  ? 19.879  -10.884 13.437  1.00 26.36  ? 73  ALA A CB  1 
ATOM   565   N N   . GLN A 1 74  ? 18.448  -8.793  11.763  1.00 30.80  ? 74  GLN A N   1 
ATOM   566   C CA  . GLN A 1 74  ? 18.231  -7.932  10.585  1.00 30.51  ? 74  GLN A CA  1 
ATOM   567   C C   . GLN A 1 74  ? 17.982  -6.455  10.995  1.00 34.63  ? 74  GLN A C   1 
ATOM   568   O O   . GLN A 1 74  ? 18.439  -5.527  10.347  1.00 33.69  ? 74  GLN A O   1 
ATOM   569   C CB  . GLN A 1 74  ? 17.083  -8.476  9.717   1.00 31.22  ? 74  GLN A CB  1 
ATOM   570   C CG  . GLN A 1 74  ? 16.586  -7.532  8.615   1.00 23.18  ? 74  GLN A CG  1 
ATOM   571   C CD  . GLN A 1 74  ? 17.600  -7.413  7.506   1.00 37.95  ? 74  GLN A CD  1 
ATOM   572   O OE1 . GLN A 1 74  ? 18.224  -8.419  7.081   1.00 20.23  ? 74  GLN A OE1 1 
ATOM   573   N NE2 . GLN A 1 74  ? 17.816  -6.172  7.055   1.00 24.13  ? 74  GLN A NE2 1 
ATOM   574   N N   . TRP A 1 75  ? 17.301  -6.234  12.105  1.00 32.70  ? 75  TRP A N   1 
ATOM   575   C CA  . TRP A 1 75  ? 17.131  -4.869  12.558  1.00 33.82  ? 75  TRP A CA  1 
ATOM   576   C C   . TRP A 1 75  ? 18.505  -4.270  12.836  1.00 36.73  ? 75  TRP A C   1 
ATOM   577   O O   . TRP A 1 75  ? 18.867  -3.250  12.253  1.00 36.16  ? 75  TRP A O   1 
ATOM   578   C CB  . TRP A 1 75  ? 16.327  -4.828  13.832  1.00 33.26  ? 75  TRP A CB  1 
ATOM   579   C CG  . TRP A 1 75  ? 16.116  -3.456  14.359  1.00 34.96  ? 75  TRP A CG  1 
ATOM   580   C CD1 . TRP A 1 75  ? 15.356  -2.467  13.792  1.00 38.28  ? 75  TRP A CD1 1 
ATOM   581   C CD2 . TRP A 1 75  ? 16.548  -2.951  15.633  1.00 34.56  ? 75  TRP A CD2 1 
ATOM   582   N NE1 . TRP A 1 75  ? 15.272  -1.395  14.647  1.00 37.99  ? 75  TRP A NE1 1 
ATOM   583   C CE2 . TRP A 1 75  ? 15.988  -1.670  15.784  1.00 38.61  ? 75  TRP A CE2 1 
ATOM   584   C CE3 . TRP A 1 75  ? 17.388  -3.446  16.643  1.00 35.02  ? 75  TRP A CE3 1 
ATOM   585   C CZ2 . TRP A 1 75  ? 16.191  -0.906  16.922  1.00 37.28  ? 75  TRP A CZ2 1 
ATOM   586   C CZ3 . TRP A 1 75  ? 17.597  -2.697  17.751  1.00 35.76  ? 75  TRP A CZ3 1 
ATOM   587   C CH2 . TRP A 1 75  ? 16.991  -1.443  17.900  1.00 36.84  ? 75  TRP A CH2 1 
ATOM   588   N N   . MET A 1 76  ? 19.284  -4.933  13.696  1.00 31.69  ? 76  MET A N   1 
ATOM   589   C CA  . MET A 1 76  ? 20.660  -4.484  14.024  1.00 29.96  ? 76  MET A CA  1 
ATOM   590   C C   . MET A 1 76  ? 21.508  -4.313  12.753  1.00 36.38  ? 76  MET A C   1 
ATOM   591   O O   . MET A 1 76  ? 22.132  -3.290  12.567  1.00 37.21  ? 76  MET A O   1 
ATOM   592   C CB  . MET A 1 76  ? 21.347  -5.449  14.994  1.00 30.66  ? 76  MET A CB  1 
ATOM   593   C CG  . MET A 1 76  ? 20.715  -5.517  16.375  1.00 32.71  ? 76  MET A CG  1 
ATOM   594   S SD  . MET A 1 76  ? 21.145  -4.110  17.465  1.00 34.99  ? 76  MET A SD  1 
ATOM   595   C CE  . MET A 1 76  ? 22.800  -4.510  17.929  1.00 31.10  ? 76  MET A CE  1 
ATOM   596   N N   . ILE A 1 77  ? 21.487  -5.294  11.854  1.00 33.87  ? 77  ILE A N   1 
ATOM   597   C CA  . ILE A 1 77  ? 22.162  -5.161  10.571  1.00 32.99  ? 77  ILE A CA  1 
ATOM   598   C C   . ILE A 1 77  ? 21.669  -3.916  9.819   1.00 41.46  ? 77  ILE A C   1 
ATOM   599   O O   . ILE A 1 77  ? 22.464  -3.130  9.313   1.00 40.55  ? 77  ILE A O   1 
ATOM   600   C CB  . ILE A 1 77  ? 21.937  -6.372  9.690   1.00 34.77  ? 77  ILE A CB  1 
ATOM   601   C CG1 . ILE A 1 77  ? 22.874  -7.507  10.103  1.00 34.36  ? 77  ILE A CG1 1 
ATOM   602   C CG2 . ILE A 1 77  ? 22.183  -5.997  8.251   1.00 36.97  ? 77  ILE A CG2 1 
ATOM   603   C CD1 . ILE A 1 77  ? 22.466  -8.905  9.636   1.00 31.53  ? 77  ILE A CD1 1 
ATOM   604   N N   . GLN A 1 78  ? 20.353  -3.738  9.746   1.00 41.83  ? 78  GLN A N   1 
ATOM   605   C CA  . GLN A 1 78  ? 19.788  -2.567  9.091   1.00 43.21  ? 78  GLN A CA  1 
ATOM   606   C C   . GLN A 1 78  ? 20.200  -2.444  7.628   1.00 50.62  ? 78  GLN A C   1 
ATOM   607   O O   . GLN A 1 78  ? 19.335  -2.397  6.739   1.00 50.33  ? 78  GLN A O   1 
ATOM   608   C CB  . GLN A 1 78  ? 20.200  -1.299  9.861   1.00 44.85  ? 78  GLN A CB  1 
ATOM   609   C CG  . GLN A 1 78  ? 19.399  -0.063  9.528   1.00 71.98  ? 78  GLN A CG  1 
ATOM   610   C CD  . GLN A 1 78  ? 17.915  -0.222  9.821   1.00 100.47 ? 78  GLN A CD  1 
ATOM   611   O OE1 . GLN A 1 78  ? 17.480  -0.167  10.977  1.00 94.20  ? 78  GLN A OE1 1 
ATOM   612   N NE2 . GLN A 1 78  ? 17.126  -0.388  8.768   1.00 99.97  ? 78  GLN A NE2 1 
ATOM   613   N N   . GLN A 1 79  ? 21.517  -2.468  7.382   1.00 49.31  ? 79  GLN A N   1 
ATOM   614   C CA  . GLN A 1 79  ? 22.087  -2.229  6.063   1.00 50.44  ? 79  GLN A CA  1 
ATOM   615   C C   . GLN A 1 79  ? 21.360  -2.697  4.839   1.00 55.00  ? 79  GLN A C   1 
ATOM   616   O O   . GLN A 1 79  ? 20.474  -1.977  4.364   1.00 56.76  ? 79  GLN A O   1 
ATOM   617   C CB  . GLN A 1 79  ? 23.607  -2.384  5.994   1.00 53.28  ? 79  GLN A CB  1 
ATOM   618   C CG  . GLN A 1 79  ? 24.357  -1.040  5.926   1.00 76.19  ? 79  GLN A CG  1 
ATOM   619   C CD  . GLN A 1 79  ? 24.616  -0.441  7.304   1.00 98.79  ? 79  GLN A CD  1 
ATOM   620   O OE1 . GLN A 1 79  ? 23.737  0.196   7.903   1.00 88.05  ? 79  GLN A OE1 1 
ATOM   621   N NE2 . GLN A 1 79  ? 25.838  -0.629  7.798   1.00 97.82  ? 79  GLN A NE2 1 
ATOM   622   N N   . PRO A 1 80  ? 21.746  -3.855  4.289   1.00 49.36  ? 80  PRO A N   1 
ATOM   623   C CA  . PRO A 1 80  ? 21.037  -4.389  3.126   1.00 47.33  ? 80  PRO A CA  1 
ATOM   624   C C   . PRO A 1 80  ? 19.865  -5.136  3.680   1.00 51.16  ? 80  PRO A C   1 
ATOM   625   O O   . PRO A 1 80  ? 20.016  -5.927  4.609   1.00 49.51  ? 80  PRO A O   1 
ATOM   626   C CB  . PRO A 1 80  ? 22.018  -5.401  2.526   1.00 49.04  ? 80  PRO A CB  1 
ATOM   627   C CG  . PRO A 1 80  ? 23.027  -5.696  3.592   1.00 53.84  ? 80  PRO A CG  1 
ATOM   628   C CD  . PRO A 1 80  ? 22.762  -4.800  4.787   1.00 49.56  ? 80  PRO A CD  1 
ATOM   629   N N   . HIS A 1 81  ? 18.688  -4.850  3.144   1.00 50.04  ? 81  HIS A N   1 
ATOM   630   C CA  . HIS A 1 81  ? 17.478  -5.517  3.574   1.00 49.52  ? 81  HIS A CA  1 
ATOM   631   C C   . HIS A 1 81  ? 17.735  -6.947  3.160   1.00 50.03  ? 81  HIS A C   1 
ATOM   632   O O   . HIS A 1 81  ? 18.540  -7.177  2.257   1.00 48.17  ? 81  HIS A O   1 
ATOM   633   C CB  . HIS A 1 81  ? 16.299  -4.974  2.775   1.00 51.28  ? 81  HIS A CB  1 
ATOM   634   C CG  . HIS A 1 81  ? 15.868  -3.609  3.193   1.00 55.74  ? 81  HIS A CG  1 
ATOM   635   N ND1 . HIS A 1 81  ? 16.166  -3.089  4.434   1.00 58.19  ? 81  HIS A ND1 1 
ATOM   636   C CD2 . HIS A 1 81  ? 15.120  -2.672  2.560   1.00 58.71  ? 81  HIS A CD2 1 
ATOM   637   C CE1 . HIS A 1 81  ? 15.627  -1.886  4.548   1.00 58.04  ? 81  HIS A CE1 1 
ATOM   638   N NE2 . HIS A 1 81  ? 14.998  -1.604  3.420   1.00 58.63  ? 81  HIS A NE2 1 
ATOM   639   N N   . LYS A 1 82  ? 17.034  -7.897  3.782   1.00 45.03  ? 82  LYS A N   1 
ATOM   640   C CA  . LYS A 1 82  ? 17.174  -9.315  3.433   1.00 42.61  ? 82  LYS A CA  1 
ATOM   641   C C   . LYS A 1 82  ? 18.585  -9.838  3.643   1.00 42.48  ? 82  LYS A C   1 
ATOM   642   O O   . LYS A 1 82  ? 19.048  -10.713 2.905   1.00 42.00  ? 82  LYS A O   1 
ATOM   643   C CB  . LYS A 1 82  ? 16.664  -9.604  2.015   1.00 44.13  ? 82  LYS A CB  1 
ATOM   644   C CG  . LYS A 1 82  ? 15.250  -9.051  1.742   1.00 46.02  ? 82  LYS A CG  1 
ATOM   645   C CD  . LYS A 1 82  ? 14.759  -9.463  0.365   1.00 59.30  ? 82  LYS A CD  1 
ATOM   646   C CE  . LYS A 1 82  ? 13.562  -8.623  -0.099  1.00 69.37  ? 82  LYS A CE  1 
ATOM   647   N NZ  . LYS A 1 82  ? 13.094  -9.001  -1.467  1.00 80.41  ? 82  LYS A NZ  1 
ATOM   648   N N   . ALA A 1 83  ? 19.233  -9.322  4.696   1.00 36.06  ? 83  ALA A N   1 
ATOM   649   C CA  . ALA A 1 83  ? 20.556  -9.782  5.154   1.00 32.85  ? 83  ALA A CA  1 
ATOM   650   C C   . ALA A 1 83  ? 20.369  -11.142 5.826   1.00 31.00  ? 83  ALA A C   1 
ATOM   651   O O   . ALA A 1 83  ? 21.200  -12.033 5.662   1.00 27.74  ? 83  ALA A O   1 
ATOM   652   C CB  . ALA A 1 83  ? 21.137  -8.793  6.167   1.00 32.91  ? 83  ALA A CB  1 
ATOM   653   N N   . ALA A 1 84  ? 19.238  -11.278 6.536   1.00 25.70  ? 84  ALA A N   1 
ATOM   654   C CA  . ALA A 1 84  ? 18.861  -12.468 7.294   1.00 24.29  ? 84  ALA A CA  1 
ATOM   655   C C   . ALA A 1 84  ? 17.764  -13.265 6.578   1.00 27.83  ? 84  ALA A C   1 
ATOM   656   O O   . ALA A 1 84  ? 16.756  -12.700 6.153   1.00 27.79  ? 84  ALA A O   1 
ATOM   657   C CB  . ALA A 1 84  ? 18.387  -12.046 8.695   1.00 24.71  ? 84  ALA A CB  1 
ATOM   658   N N   . THR A 1 85  ? 17.979  -14.572 6.430   1.00 24.54  ? 85  THR A N   1 
ATOM   659   C CA  . THR A 1 85  ? 17.043  -15.480 5.749   1.00 23.97  ? 85  THR A CA  1 
ATOM   660   C C   . THR A 1 85  ? 16.295  -16.291 6.810   1.00 25.57  ? 85  THR A C   1 
ATOM   661   O O   . THR A 1 85  ? 16.817  -16.496 7.889   1.00 25.36  ? 85  THR A O   1 
ATOM   662   C CB  . THR A 1 85  ? 17.815  -16.457 4.805   1.00 32.52  ? 85  THR A CB  1 
ATOM   663   O OG1 . THR A 1 85  ? 18.374  -15.741 3.696   1.00 31.11  ? 85  THR A OG1 1 
ATOM   664   C CG2 . THR A 1 85  ? 16.914  -17.572 4.301   1.00 27.95  ? 85  THR A CG2 1 
ATOM   665   N N   . PHE A 1 86  ? 15.082  -16.742 6.512   1.00 20.81  ? 86  PHE A N   1 
ATOM   666   C CA  . PHE A 1 86  ? 14.313  -17.557 7.469   1.00 20.17  ? 86  PHE A CA  1 
ATOM   667   C C   . PHE A 1 86  ? 13.361  -18.524 6.741   1.00 27.22  ? 86  PHE A C   1 
ATOM   668   O O   . PHE A 1 86  ? 12.526  -18.085 5.912   1.00 26.99  ? 86  PHE A O   1 
ATOM   669   C CB  . PHE A 1 86  ? 13.536  -16.678 8.483   1.00 20.45  ? 86  PHE A CB  1 
ATOM   670   C CG  . PHE A 1 86  ? 12.760  -17.466 9.505   1.00 19.97  ? 86  PHE A CG  1 
ATOM   671   C CD1 . PHE A 1 86  ? 13.398  -18.002 10.620  1.00 19.99  ? 86  PHE A CD1 1 
ATOM   672   C CD2 . PHE A 1 86  ? 11.386  -17.700 9.340   1.00 23.08  ? 86  PHE A CD2 1 
ATOM   673   C CE1 . PHE A 1 86  ? 12.702  -18.771 11.555  1.00 20.72  ? 86  PHE A CE1 1 
ATOM   674   C CE2 . PHE A 1 86  ? 10.642  -18.419 10.313  1.00 24.62  ? 86  PHE A CE2 1 
ATOM   675   C CZ  . PHE A 1 86  ? 11.317  -18.995 11.396  1.00 21.79  ? 86  PHE A CZ  1 
ATOM   676   N N   . PHE A 1 87  ? 13.488  -19.824 7.064   1.00 23.27  ? 87  PHE A N   1 
ATOM   677   C CA  . PHE A 1 87  ? 12.611  -20.870 6.517   1.00 22.14  ? 87  PHE A CA  1 
ATOM   678   C C   . PHE A 1 87  ? 11.692  -21.409 7.603   1.00 22.70  ? 87  PHE A C   1 
ATOM   679   O O   . PHE A 1 87  ? 12.066  -21.465 8.772   1.00 23.07  ? 87  PHE A O   1 
ATOM   680   C CB  . PHE A 1 87  ? 13.431  -22.044 5.933   1.00 24.06  ? 87  PHE A CB  1 
ATOM   681   C CG  . PHE A 1 87  ? 14.248  -21.688 4.712   1.00 24.58  ? 87  PHE A CG  1 
ATOM   682   C CD1 . PHE A 1 87  ? 14.087  -20.453 4.073   1.00 26.69  ? 87  PHE A CD1 1 
ATOM   683   C CD2 . PHE A 1 87  ? 15.220  -22.554 4.254   1.00 26.46  ? 87  PHE A CD2 1 
ATOM   684   C CE1 . PHE A 1 87  ? 14.859  -20.098 2.981   1.00 27.33  ? 87  PHE A CE1 1 
ATOM   685   C CE2 . PHE A 1 87  ? 16.012  -22.222 3.148   1.00 30.12  ? 87  PHE A CE2 1 
ATOM   686   C CZ  . PHE A 1 87  ? 15.836  -20.992 2.509   1.00 28.11  ? 87  PHE A CZ  1 
ATOM   687   N N   . GLY A 1 88  ? 10.537  -21.910 7.202   1.00 16.07  ? 88  GLY A N   1 
ATOM   688   C CA  . GLY A 1 88  ? 9.654   -22.529 8.150   1.00 14.92  ? 88  GLY A CA  1 
ATOM   689   C C   . GLY A 1 88  ? 8.316   -22.850 7.538   1.00 21.21  ? 88  GLY A C   1 
ATOM   690   O O   . GLY A 1 88  ? 7.974   -22.366 6.483   1.00 20.11  ? 88  GLY A O   1 
ATOM   691   N N   . CYS A 1 89  ? 7.517   -23.617 8.249   1.00 22.33  ? 89  CYS A N   1 
ATOM   692   C CA  . CYS A 1 89  ? 6.229   -24.015 7.742   1.00 22.94  ? 89  CYS A CA  1 
ATOM   693   C C   . CYS A 1 89  ? 5.094   -23.275 8.403   1.00 27.72  ? 89  CYS A C   1 
ATOM   694   O O   . CYS A 1 89  ? 5.015   -23.158 9.635   1.00 26.39  ? 89  CYS A O   1 
ATOM   695   C CB  . CYS A 1 89  ? 6.058   -25.520 7.896   1.00 24.13  ? 89  CYS A CB  1 
ATOM   696   S SG  . CYS A 1 89  ? 4.532   -26.199 7.184   1.00 28.96  ? 89  CYS A SG  1 
ATOM   697   N N   . ILE A 1 90  ? 4.180   -22.810 7.565   1.00 25.83  ? 90  ILE A N   1 
ATOM   698   C CA  . ILE A 1 90  ? 2.995   -22.161 8.057   1.00 24.69  ? 90  ILE A CA  1 
ATOM   699   C C   . ILE A 1 90  ? 1.765   -22.741 7.355   1.00 30.63  ? 90  ILE A C   1 
ATOM   700   O O   . ILE A 1 90  ? 1.879   -23.496 6.392   1.00 30.44  ? 90  ILE A O   1 
ATOM   701   C CB  . ILE A 1 90  ? 3.101   -20.647 7.893   1.00 26.14  ? 90  ILE A CB  1 
ATOM   702   C CG1 . ILE A 1 90  ? 3.592   -20.292 6.479   1.00 25.47  ? 90  ILE A CG1 1 
ATOM   703   C CG2 . ILE A 1 90  ? 4.035   -20.124 8.946   1.00 24.81  ? 90  ILE A CG2 1 
ATOM   704   C CD1 . ILE A 1 90  ? 3.206   -18.885 6.037   1.00 25.74  ? 90  ILE A CD1 1 
ATOM   705   N N   . GLY A 1 91  ? 0.589   -22.382 7.845   1.00 28.61  ? 91  GLY A N   1 
ATOM   706   C CA  . GLY A 1 91  ? -0.638  -22.826 7.213   1.00 28.19  ? 91  GLY A CA  1 
ATOM   707   C C   . GLY A 1 91  ? -1.055  -21.740 6.257   1.00 27.80  ? 91  GLY A C   1 
ATOM   708   O O   . GLY A 1 91  ? -0.437  -20.677 6.210   1.00 25.48  ? 91  GLY A O   1 
ATOM   709   N N   . ILE A 1 92  ? -2.074  -22.041 5.463   1.00 23.32  ? 92  ILE A N   1 
ATOM   710   C CA  . ILE A 1 92  ? -2.605  -21.086 4.521   1.00 21.65  ? 92  ILE A CA  1 
ATOM   711   C C   . ILE A 1 92  ? -3.860  -20.567 5.207   1.00 25.61  ? 92  ILE A C   1 
ATOM   712   O O   . ILE A 1 92  ? -4.902  -21.225 5.183   1.00 26.98  ? 92  ILE A O   1 
ATOM   713   C CB  . ILE A 1 92  ? -2.884  -21.724 3.166   1.00 24.18  ? 92  ILE A CB  1 
ATOM   714   C CG1 . ILE A 1 92  ? -1.571  -22.213 2.554   1.00 24.40  ? 92  ILE A CG1 1 
ATOM   715   C CG2 . ILE A 1 92  ? -3.558  -20.722 2.244   1.00 23.55  ? 92  ILE A CG2 1 
ATOM   716   C CD1 . ILE A 1 92  ? -1.773  -23.110 1.368   1.00 40.25  ? 92  ILE A CD1 1 
ATOM   717   N N   . ASP A 1 93  ? -3.678  -19.524 6.016   1.00 19.13  ? 93  ASP A N   1 
ATOM   718   C CA  . ASP A 1 93  ? -4.743  -18.941 6.783   1.00 17.75  ? 93  ASP A CA  1 
ATOM   719   C C   . ASP A 1 93  ? -4.380  -17.531 7.268   1.00 25.55  ? 93  ASP A C   1 
ATOM   720   O O   . ASP A 1 93  ? -3.337  -17.005 6.911   1.00 24.24  ? 93  ASP A O   1 
ATOM   721   C CB  . ASP A 1 93  ? -5.125  -19.847 7.963   1.00 19.00  ? 93  ASP A CB  1 
ATOM   722   C CG  . ASP A 1 93  ? -3.966  -20.102 8.937   1.00 29.20  ? 93  ASP A CG  1 
ATOM   723   O OD1 . ASP A 1 93  ? -4.223  -20.811 9.932   1.00 30.62  ? 93  ASP A OD1 1 
ATOM   724   O OD2 . ASP A 1 93  ? -2.851  -19.551 8.751   1.00 28.42  ? 93  ASP A OD2 1 
ATOM   725   N N   . LYS A 1 94  ? -5.287  -16.930 8.045   1.00 25.44  ? 94  LYS A N   1 
ATOM   726   C CA  . LYS A 1 94  ? -5.145  -15.593 8.605   1.00 25.22  ? 94  LYS A CA  1 
ATOM   727   C C   . LYS A 1 94  ? -3.820  -15.362 9.314   1.00 31.57  ? 94  LYS A C   1 
ATOM   728   O O   . LYS A 1 94  ? -3.075  -14.435 8.970   1.00 33.11  ? 94  LYS A O   1 
ATOM   729   C CB  . LYS A 1 94  ? -6.296  -15.296 9.568   1.00 26.19  ? 94  LYS A CB  1 
ATOM   730   C CG  . LYS A 1 94  ? -6.334  -13.844 10.033  1.00 36.05  ? 94  LYS A CG  1 
ATOM   731   C CD  . LYS A 1 94  ? -7.312  -13.621 11.185  1.00 38.46  ? 94  LYS A CD  1 
ATOM   732   C CE  . LYS A 1 94  ? -7.657  -12.133 11.342  1.00 38.38  ? 94  LYS A CE  1 
ATOM   733   N NZ  . LYS A 1 94  ? -9.075  -11.924 11.759  1.00 41.02  ? 94  LYS A NZ  1 
ATOM   734   N N   . PHE A 1 95  ? -3.545  -16.170 10.334  1.00 27.30  ? 95  PHE A N   1 
ATOM   735   C CA  . PHE A 1 95  ? -2.287  -16.038 11.077  1.00 26.87  ? 95  PHE A CA  1 
ATOM   736   C C   . PHE A 1 95  ? -1.079  -16.198 10.144  1.00 30.48  ? 95  PHE A C   1 
ATOM   737   O O   . PHE A 1 95  ? -0.050  -15.555 10.317  1.00 30.03  ? 95  PHE A O   1 
ATOM   738   C CB  . PHE A 1 95  ? -2.206  -17.091 12.171  1.00 28.35  ? 95  PHE A CB  1 
ATOM   739   C CG  . PHE A 1 95  ? -3.269  -16.955 13.223  1.00 29.62  ? 95  PHE A CG  1 
ATOM   740   C CD1 . PHE A 1 95  ? -4.124  -15.864 13.229  1.00 31.30  ? 95  PHE A CD1 1 
ATOM   741   C CD2 . PHE A 1 95  ? -3.342  -17.862 14.270  1.00 30.14  ? 95  PHE A CD2 1 
ATOM   742   C CE1 . PHE A 1 95  ? -5.062  -15.724 14.208  1.00 31.59  ? 95  PHE A CE1 1 
ATOM   743   C CE2 . PHE A 1 95  ? -4.289  -17.720 15.245  1.00 31.81  ? 95  PHE A CE2 1 
ATOM   744   C CZ  . PHE A 1 95  ? -5.132  -16.638 15.229  1.00 30.13  ? 95  PHE A CZ  1 
ATOM   745   N N   . GLY A 1 96  ? -1.184  -17.124 9.201   1.00 26.22  ? 96  GLY A N   1 
ATOM   746   C CA  . GLY A 1 96  ? -0.133  -17.346 8.235   1.00 25.64  ? 96  GLY A CA  1 
ATOM   747   C C   . GLY A 1 96  ? 0.146   -16.028 7.538   1.00 32.35  ? 96  GLY A C   1 
ATOM   748   O O   . GLY A 1 96  ? 1.279   -15.548 7.515   1.00 33.73  ? 96  GLY A O   1 
ATOM   749   N N   . GLU A 1 97  ? -0.896  -15.449 6.955   1.00 30.73  ? 97  GLU A N   1 
ATOM   750   C CA  . GLU A 1 97  ? -0.791  -14.154 6.277   1.00 31.93  ? 97  GLU A CA  1 
ATOM   751   C C   . GLU A 1 97  ? -0.144  -13.027 7.138   1.00 32.97  ? 97  GLU A C   1 
ATOM   752   O O   . GLU A 1 97  ? 0.647   -12.213 6.636   1.00 31.95  ? 97  GLU A O   1 
ATOM   753   C CB  . GLU A 1 97  ? -2.161  -13.707 5.740   1.00 33.27  ? 97  GLU A CB  1 
ATOM   754   C CG  . GLU A 1 97  ? -2.073  -12.739 4.559   1.00 45.52  ? 97  GLU A CG  1 
ATOM   755   C CD  . GLU A 1 97  ? -1.371  -13.336 3.328   1.00 75.52  ? 97  GLU A CD  1 
ATOM   756   O OE1 . GLU A 1 97  ? -1.838  -14.389 2.815   1.00 45.38  ? 97  GLU A OE1 1 
ATOM   757   O OE2 . GLU A 1 97  ? -0.383  -12.722 2.842   1.00 77.91  ? 97  GLU A OE2 1 
ATOM   758   N N   . ILE A 1 98  ? -0.455  -13.032 8.430   1.00 24.46  ? 98  ILE A N   1 
ATOM   759   C CA  . ILE A 1 98  ? 0.097   -12.070 9.350   1.00 22.98  ? 98  ILE A CA  1 
ATOM   760   C C   . ILE A 1 98  ? 1.599   -12.270 9.525   1.00 28.15  ? 98  ILE A C   1 
ATOM   761   O O   . ILE A 1 98  ? 2.347   -11.290 9.504   1.00 29.60  ? 98  ILE A O   1 
ATOM   762   C CB  . ILE A 1 98  ? -0.610  -12.164 10.748  1.00 24.51  ? 98  ILE A CB  1 
ATOM   763   C CG1 . ILE A 1 98  ? -2.104  -11.860 10.612  1.00 23.48  ? 98  ILE A CG1 1 
ATOM   764   C CG2 . ILE A 1 98  ? 0.080   -11.283 11.800  1.00 21.64  ? 98  ILE A CG2 1 
ATOM   765   C CD1 . ILE A 1 98  ? -2.859  -11.906 11.924  1.00 28.21  ? 98  ILE A CD1 1 
ATOM   766   N N   . LEU A 1 99  ? 2.036   -13.517 9.746   1.00 23.38  ? 99  LEU A N   1 
ATOM   767   C CA  . LEU A 1 99  ? 3.464   -13.810 9.980   1.00 21.31  ? 99  LEU A CA  1 
ATOM   768   C C   . LEU A 1 99  ? 4.261   -13.407 8.787   1.00 24.65  ? 99  LEU A C   1 
ATOM   769   O O   . LEU A 1 99  ? 5.278   -12.764 8.927   1.00 23.99  ? 99  LEU A O   1 
ATOM   770   C CB  . LEU A 1 99  ? 3.735   -15.273 10.339  1.00 20.67  ? 99  LEU A CB  1 
ATOM   771   C CG  . LEU A 1 99  ? 3.093   -15.981 11.549  1.00 22.42  ? 99  LEU A CG  1 
ATOM   772   C CD1 . LEU A 1 99  ? 3.363   -17.461 11.542  1.00 20.23  ? 99  LEU A CD1 1 
ATOM   773   C CD2 . LEU A 1 99  ? 3.442   -15.367 12.886  1.00 21.32  ? 99  LEU A CD2 1 
ATOM   774   N N   . LYS A 1 100 ? 3.778   -13.726 7.601   1.00 26.01  ? 100 LYS A N   1 
ATOM   775   C CA  . LYS A 1 100 ? 4.490   -13.311 6.381   1.00 28.41  ? 100 LYS A CA  1 
ATOM   776   C C   . LYS A 1 100 ? 4.638   -11.775 6.340   1.00 34.75  ? 100 LYS A C   1 
ATOM   777   O O   . LYS A 1 100 ? 5.727   -11.250 6.069   1.00 32.91  ? 100 LYS A O   1 
ATOM   778   C CB  . LYS A 1 100 ? 3.779   -13.824 5.110   1.00 31.24  ? 100 LYS A CB  1 
ATOM   779   C CG  . LYS A 1 100 ? 3.630   -15.371 5.029   1.00 38.48  ? 100 LYS A CG  1 
ATOM   780   C CD  . LYS A 1 100 ? 2.500   -15.815 4.096   1.00 36.66  ? 100 LYS A CD  1 
ATOM   781   C CE  . LYS A 1 100 ? 2.934   -15.620 2.673   1.00 31.95  ? 100 LYS A CE  1 
ATOM   782   N NZ  . LYS A 1 100 ? 1.906   -15.930 1.664   1.00 35.10  ? 100 LYS A NZ  1 
ATOM   783   N N   . ARG A 1 101 ? 3.538   -11.068 6.618   1.00 33.63  ? 101 ARG A N   1 
ATOM   784   C CA  . ARG A 1 101 ? 3.503   -9.597  6.609   1.00 33.71  ? 101 ARG A CA  1 
ATOM   785   C C   . ARG A 1 101 ? 4.477   -9.007  7.607   1.00 35.37  ? 101 ARG A C   1 
ATOM   786   O O   . ARG A 1 101 ? 5.264   -8.110  7.268   1.00 35.97  ? 101 ARG A O   1 
ATOM   787   C CB  . ARG A 1 101 ? 2.096   -9.079  6.928   1.00 36.96  ? 101 ARG A CB  1 
ATOM   788   C CG  . ARG A 1 101 ? 2.029   -7.585  7.143   1.00 48.21  ? 101 ARG A CG  1 
ATOM   789   C CD  . ARG A 1 101 ? 0.641   -7.072  6.862   1.00 49.01  ? 101 ARG A CD  1 
ATOM   790   N NE  . ARG A 1 101 ? -0.299  -7.496  7.891   1.00 56.02  ? 101 ARG A NE  1 
ATOM   791   C CZ  . ARG A 1 101 ? -0.202  -7.179  9.180   1.00 55.01  ? 101 ARG A CZ  1 
ATOM   792   N NH1 . ARG A 1 101 ? 0.822   -6.430  9.617   1.00 30.53  ? 101 ARG A NH1 1 
ATOM   793   N NH2 . ARG A 1 101 ? -1.130  -7.604  10.035  1.00 24.65  ? 101 ARG A NH2 1 
ATOM   794   N N   . LYS A 1 102 ? 4.392   -9.475  8.853   1.00 29.02  ? 102 LYS A N   1 
ATOM   795   C CA  . LYS A 1 102 ? 5.319   -9.029  9.903   1.00 27.37  ? 102 LYS A CA  1 
ATOM   796   C C   . LYS A 1 102 ? 6.775   -9.329  9.534   1.00 33.92  ? 102 LYS A C   1 
ATOM   797   O O   . LYS A 1 102 ? 7.675   -8.623  9.959   1.00 35.40  ? 102 LYS A O   1 
ATOM   798   C CB  . LYS A 1 102 ? 4.962   -9.675  11.235  1.00 26.24  ? 102 LYS A CB  1 
ATOM   799   C CG  . LYS A 1 102 ? 3.580   -9.308  11.720  1.00 23.37  ? 102 LYS A CG  1 
ATOM   800   C CD  . LYS A 1 102 ? 3.601   -8.152  12.735  1.00 24.40  ? 102 LYS A CD  1 
ATOM   801   C CE  . LYS A 1 102 ? 2.917   -6.930  12.166  1.00 30.13  ? 102 LYS A CE  1 
ATOM   802   N NZ  . LYS A 1 102 ? 3.589   -5.646  12.534  1.00 37.86  ? 102 LYS A NZ  1 
ATOM   803   N N   . ALA A 1 103 ? 6.983   -10.342 8.698   1.00 31.77  ? 103 ALA A N   1 
ATOM   804   C CA  . ALA A 1 103 ? 8.311   -10.743 8.237   1.00 31.78  ? 103 ALA A CA  1 
ATOM   805   C C   . ALA A 1 103 ? 8.864   -9.795  7.160   1.00 32.36  ? 103 ALA A C   1 
ATOM   806   O O   . ALA A 1 103 ? 10.077  -9.593  7.060   1.00 31.15  ? 103 ALA A O   1 
ATOM   807   C CB  . ALA A 1 103 ? 8.299   -12.209 7.719   1.00 32.35  ? 103 ALA A CB  1 
ATOM   808   N N   . ALA A 1 104 ? 7.974   -9.260  6.334   1.00 26.69  ? 104 ALA A N   1 
ATOM   809   C CA  . ALA A 1 104 ? 8.368   -8.342  5.274   1.00 26.97  ? 104 ALA A CA  1 
ATOM   810   C C   . ALA A 1 104 ? 8.724   -6.991  5.902   1.00 31.02  ? 104 ALA A C   1 
ATOM   811   O O   . ALA A 1 104 ? 9.706   -6.344  5.523   1.00 30.21  ? 104 ALA A O   1 
ATOM   812   C CB  . ALA A 1 104 ? 7.211   -8.169  4.295   1.00 27.97  ? 104 ALA A CB  1 
ATOM   813   N N   . GLU A 1 105 ? 7.926   -6.588  6.879   1.00 27.78  ? 105 GLU A N   1 
ATOM   814   C CA  . GLU A 1 105 ? 8.138   -5.335  7.585   1.00 29.61  ? 105 GLU A CA  1 
ATOM   815   C C   . GLU A 1 105 ? 9.405   -5.361  8.448   1.00 34.92  ? 105 GLU A C   1 
ATOM   816   O O   . GLU A 1 105 ? 9.910   -4.312  8.917   1.00 34.59  ? 105 GLU A O   1 
ATOM   817   C CB  . GLU A 1 105 ? 6.907   -4.947  8.438   1.00 31.40  ? 105 GLU A CB  1 
ATOM   818   C CG  . GLU A 1 105 ? 5.579   -5.056  7.722   1.00 37.93  ? 105 GLU A CG  1 
ATOM   819   C CD  . GLU A 1 105 ? 4.453   -4.726  8.639   1.00 51.00  ? 105 GLU A CD  1 
ATOM   820   O OE1 . GLU A 1 105 ? 4.766   -4.435  9.817   1.00 30.30  ? 105 GLU A OE1 1 
ATOM   821   O OE2 . GLU A 1 105 ? 3.283   -4.755  8.182   1.00 39.58  ? 105 GLU A OE2 1 
ATOM   822   N N   . ALA A 1 106 ? 9.921   -6.564  8.645   1.00 33.18  ? 106 ALA A N   1 
ATOM   823   C CA  . ALA A 1 106 ? 11.197  -6.794  9.345   1.00 33.21  ? 106 ALA A CA  1 
ATOM   824   C C   . ALA A 1 106 ? 12.353  -6.706  8.342   1.00 36.18  ? 106 ALA A C   1 
ATOM   825   O O   . ALA A 1 106 ? 13.518  -6.638  8.729   1.00 36.18  ? 106 ALA A O   1 
ATOM   826   C CB  . ALA A 1 106 ? 11.191  -8.202  10.014  1.00 33.81  ? 106 ALA A CB  1 
ATOM   827   N N   . HIS A 1 107 ? 12.002  -6.745  7.053   1.00 32.07  ? 107 HIS A N   1 
ATOM   828   C CA  . HIS A 1 107 ? 12.944  -6.736  5.937   1.00 31.91  ? 107 HIS A CA  1 
ATOM   829   C C   . HIS A 1 107 ? 13.703  -8.029  5.906   1.00 34.02  ? 107 HIS A C   1 
ATOM   830   O O   . HIS A 1 107 ? 14.829  -8.093  5.366   1.00 34.94  ? 107 HIS A O   1 
ATOM   831   C CB  . HIS A 1 107 ? 13.927  -5.542  5.985   1.00 33.69  ? 107 HIS A CB  1 
ATOM   832   C CG  . HIS A 1 107 ? 13.257  -4.205  5.999   1.00 38.03  ? 107 HIS A CG  1 
ATOM   833   N ND1 . HIS A 1 107 ? 12.389  -3.791  5.011   1.00 40.50  ? 107 HIS A ND1 1 
ATOM   834   C CD2 . HIS A 1 107 ? 13.303  -3.201  6.902   1.00 40.68  ? 107 HIS A CD2 1 
ATOM   835   C CE1 . HIS A 1 107 ? 11.917  -2.595  5.311   1.00 39.82  ? 107 HIS A CE1 1 
ATOM   836   N NE2 . HIS A 1 107 ? 12.459  -2.214  6.453   1.00 40.53  ? 107 HIS A NE2 1 
ATOM   837   N N   . VAL A 1 108 ? 13.080  -9.072  6.460   1.00 28.24  ? 108 VAL A N   1 
ATOM   838   C CA  . VAL A 1 108 ? 13.694  -10.408 6.474   1.00 26.19  ? 108 VAL A CA  1 
ATOM   839   C C   . VAL A 1 108 ? 13.287  -11.101 5.203   1.00 25.75  ? 108 VAL A C   1 
ATOM   840   O O   . VAL A 1 108 ? 12.187  -10.889 4.713   1.00 24.35  ? 108 VAL A O   1 
ATOM   841   C CB  . VAL A 1 108 ? 13.292  -11.266 7.712   1.00 30.43  ? 108 VAL A CB  1 
ATOM   842   C CG1 . VAL A 1 108 ? 14.162  -12.519 7.784   1.00 30.35  ? 108 VAL A CG1 1 
ATOM   843   C CG2 . VAL A 1 108 ? 13.479  -10.476 9.003   1.00 30.30  ? 108 VAL A CG2 1 
ATOM   844   N N   . ASP A 1 109 ? 14.223  -11.820 4.617   1.00 21.70  ? 109 ASP A N   1 
ATOM   845   C CA  . ASP A 1 109 ? 13.969  -12.542 3.393   1.00 22.18  ? 109 ASP A CA  1 
ATOM   846   C C   . ASP A 1 109 ? 13.399  -13.904 3.761   1.00 26.24  ? 109 ASP A C   1 
ATOM   847   O O   . ASP A 1 109 ? 14.104  -14.919 3.749   1.00 25.10  ? 109 ASP A O   1 
ATOM   848   C CB  . ASP A 1 109 ? 15.271  -12.723 2.600   1.00 24.96  ? 109 ASP A CB  1 
ATOM   849   C CG  . ASP A 1 109 ? 15.019  -13.247 1.209   1.00 36.82  ? 109 ASP A CG  1 
ATOM   850   O OD1 . ASP A 1 109 ? 13.837  -13.473 0.844   1.00 39.84  ? 109 ASP A OD1 1 
ATOM   851   O OD2 . ASP A 1 109 ? 15.997  -13.456 0.483   1.00 39.15  ? 109 ASP A OD2 1 
ATOM   852   N N   . ALA A 1 110 ? 12.127  -13.905 4.143   1.00 24.68  ? 110 ALA A N   1 
ATOM   853   C CA  . ALA A 1 110 ? 11.420  -15.120 4.533   1.00 25.32  ? 110 ALA A CA  1 
ATOM   854   C C   . ALA A 1 110 ? 10.980  -15.985 3.349   1.00 33.53  ? 110 ALA A C   1 
ATOM   855   O O   . ALA A 1 110 ? 10.662  -15.489 2.264   1.00 33.26  ? 110 ALA A O   1 
ATOM   856   C CB  . ALA A 1 110 ? 10.248  -14.793 5.389   1.00 25.55  ? 110 ALA A CB  1 
ATOM   857   N N   . HIS A 1 111 ? 11.005  -17.294 3.569   1.00 31.58  ? 111 HIS A N   1 
ATOM   858   C CA  . HIS A 1 111 ? 10.544  -18.266 2.596   1.00 29.96  ? 111 HIS A CA  1 
ATOM   859   C C   . HIS A 1 111 ? 9.917   -19.330 3.456   1.00 28.90  ? 111 HIS A C   1 
ATOM   860   O O   . HIS A 1 111 ? 10.554  -19.869 4.349   1.00 30.54  ? 111 HIS A O   1 
ATOM   861   C CB  . HIS A 1 111 ? 11.727  -18.801 1.783   1.00 31.94  ? 111 HIS A CB  1 
ATOM   862   C CG  . HIS A 1 111 ? 12.424  -17.744 0.985   1.00 35.96  ? 111 HIS A CG  1 
ATOM   863   N ND1 . HIS A 1 111 ? 11.915  -17.250 -0.195  1.00 37.88  ? 111 HIS A ND1 1 
ATOM   864   C CD2 . HIS A 1 111 ? 13.553  -17.038 1.229   1.00 38.56  ? 111 HIS A CD2 1 
ATOM   865   C CE1 . HIS A 1 111 ? 12.713  -16.306 -0.660  1.00 37.26  ? 111 HIS A CE1 1 
ATOM   866   N NE2 . HIS A 1 111 ? 13.716  -16.159 0.183   1.00 38.07  ? 111 HIS A NE2 1 
ATOM   867   N N   . TYR A 1 112 ? 8.617   -19.476 3.326   1.00 23.81  ? 112 TYR A N   1 
ATOM   868   C CA  . TYR A 1 112 ? 7.870   -20.439 4.118   1.00 22.77  ? 112 TYR A CA  1 
ATOM   869   C C   . TYR A 1 112 ? 7.385   -21.551 3.233   1.00 26.70  ? 112 TYR A C   1 
ATOM   870   O O   . TYR A 1 112 ? 7.248   -21.365 2.012   1.00 25.63  ? 112 TYR A O   1 
ATOM   871   C CB  . TYR A 1 112 ? 6.643   -19.764 4.750   1.00 23.01  ? 112 TYR A CB  1 
ATOM   872   C CG  . TYR A 1 112 ? 6.971   -18.611 5.682   1.00 23.99  ? 112 TYR A CG  1 
ATOM   873   C CD1 . TYR A 1 112 ? 6.905   -17.284 5.244   1.00 25.15  ? 112 TYR A CD1 1 
ATOM   874   C CD2 . TYR A 1 112 ? 7.345   -18.849 7.017   1.00 23.92  ? 112 TYR A CD2 1 
ATOM   875   C CE1 . TYR A 1 112 ? 7.118   -16.232 6.135   1.00 24.99  ? 112 TYR A CE1 1 
ATOM   876   C CE2 . TYR A 1 112 ? 7.598   -17.804 7.888   1.00 24.41  ? 112 TYR A CE2 1 
ATOM   877   C CZ  . TYR A 1 112 ? 7.516   -16.503 7.439   1.00 26.68  ? 112 TYR A CZ  1 
ATOM   878   O OH  . TYR A 1 112 ? 7.793   -15.493 8.329   1.00 18.89  ? 112 TYR A OH  1 
ATOM   879   N N   . TYR A 1 113 ? 7.112   -22.695 3.859   1.00 24.61  ? 113 TYR A N   1 
ATOM   880   C CA  . TYR A 1 113 ? 6.449   -23.820 3.196   1.00 24.81  ? 113 TYR A CA  1 
ATOM   881   C C   . TYR A 1 113 ? 4.994   -23.696 3.629   1.00 24.23  ? 113 TYR A C   1 
ATOM   882   O O   . TYR A 1 113 ? 4.662   -23.872 4.806   1.00 22.41  ? 113 TYR A O   1 
ATOM   883   C CB  . TYR A 1 113 ? 6.997   -25.196 3.640   1.00 27.75  ? 113 TYR A CB  1 
ATOM   884   C CG  . TYR A 1 113 ? 6.241   -26.372 2.971   1.00 33.02  ? 113 TYR A CG  1 
ATOM   885   C CD1 . TYR A 1 113 ? 6.583   -26.811 1.683   1.00 34.76  ? 113 TYR A CD1 1 
ATOM   886   C CD2 . TYR A 1 113 ? 5.131   -26.975 3.581   1.00 34.15  ? 113 TYR A CD2 1 
ATOM   887   C CE1 . TYR A 1 113 ? 5.869   -27.809 1.053   1.00 33.57  ? 113 TYR A CE1 1 
ATOM   888   C CE2 . TYR A 1 113 ? 4.426   -28.007 2.944   1.00 34.07  ? 113 TYR A CE2 1 
ATOM   889   C CZ  . TYR A 1 113 ? 4.811   -28.418 1.693   1.00 39.52  ? 113 TYR A CZ  1 
ATOM   890   O OH  . TYR A 1 113 ? 4.160   -29.470 1.065   1.00 39.74  ? 113 TYR A OH  1 
ATOM   891   N N   . GLU A 1 114 ? 4.123   -23.329 2.706   1.00 19.82  ? 114 GLU A N   1 
ATOM   892   C CA  . GLU A 1 114 ? 2.724   -23.178 3.066   1.00 19.33  ? 114 GLU A CA  1 
ATOM   893   C C   . GLU A 1 114 ? 1.927   -24.396 2.622   1.00 22.71  ? 114 GLU A C   1 
ATOM   894   O O   . GLU A 1 114 ? 2.185   -24.954 1.536   1.00 22.19  ? 114 GLU A O   1 
ATOM   895   C CB  . GLU A 1 114 ? 2.166   -21.911 2.431   1.00 21.04  ? 114 GLU A CB  1 
ATOM   896   C CG  . GLU A 1 114 ? 3.181   -20.744 2.341   1.00 29.48  ? 114 GLU A CG  1 
ATOM   897   C CD  . GLU A 1 114 ? 2.528   -19.405 2.031   1.00 37.24  ? 114 GLU A CD  1 
ATOM   898   O OE1 . GLU A 1 114 ? 1.520   -19.041 2.663   1.00 43.85  ? 114 GLU A OE1 1 
ATOM   899   O OE2 . GLU A 1 114 ? 3.015   -18.723 1.127   1.00 36.21  ? 114 GLU A OE2 1 
ATOM   900   N N   . GLN A 1 115 ? 0.982   -24.815 3.468   1.00 18.22  ? 115 GLN A N   1 
ATOM   901   C CA  . GLN A 1 115 ? 0.095   -25.948 3.193   1.00 17.37  ? 115 GLN A CA  1 
ATOM   902   C C   . GLN A 1 115 ? -1.321  -25.767 3.823   1.00 23.26  ? 115 GLN A C   1 
ATOM   903   O O   . GLN A 1 115 ? -1.523  -24.874 4.647   1.00 22.81  ? 115 GLN A O   1 
ATOM   904   C CB  . GLN A 1 115 ? 0.758   -27.262 3.617   1.00 17.58  ? 115 GLN A CB  1 
ATOM   905   C CG  . GLN A 1 115 ? 1.438   -27.232 4.980   1.00 12.36  ? 115 GLN A CG  1 
ATOM   906   C CD  . GLN A 1 115 ? 0.459   -26.910 6.096   1.00 29.87  ? 115 GLN A CD  1 
ATOM   907   O OE1 . GLN A 1 115 ? 0.431   -25.783 6.634   1.00 18.19  ? 115 GLN A OE1 1 
ATOM   908   N NE2 . GLN A 1 115 ? -0.476  -27.828 6.323   1.00 28.34  ? 115 GLN A NE2 1 
ATOM   909   N N   . ASN A 1 116 ? -2.300  -26.569 3.391   1.00 22.02  ? 116 ASN A N   1 
ATOM   910   C CA  . ASN A 1 116 ? -3.675  -26.465 3.895   1.00 22.66  ? 116 ASN A CA  1 
ATOM   911   C C   . ASN A 1 116 ? -4.092  -27.475 4.988   1.00 29.00  ? 116 ASN A C   1 
ATOM   912   O O   . ASN A 1 116 ? -5.031  -27.237 5.755   1.00 28.45  ? 116 ASN A O   1 
ATOM   913   C CB  . ASN A 1 116 ? -4.680  -26.468 2.748   1.00 23.34  ? 116 ASN A CB  1 
ATOM   914   C CG  . ASN A 1 116 ? -4.261  -25.585 1.588   1.00 22.33  ? 116 ASN A CG  1 
ATOM   915   O OD1 . ASN A 1 116 ? -4.623  -24.422 1.539   1.00 13.06  ? 116 ASN A OD1 1 
ATOM   916   N ND2 . ASN A 1 116 ? -3.717  -26.200 0.556   1.00 12.74  ? 116 ASN A ND2 1 
ATOM   917   N N   . GLU A 1 117 ? -3.335  -28.555 5.121   1.00 26.96  ? 117 GLU A N   1 
ATOM   918   C CA  . GLU A 1 117 ? -3.630  -29.542 6.142   1.00 26.16  ? 117 GLU A CA  1 
ATOM   919   C C   . GLU A 1 117 ? -3.587  -28.970 7.572   1.00 27.00  ? 117 GLU A C   1 
ATOM   920   O O   . GLU A 1 117 ? -4.541  -29.091 8.336   1.00 25.75  ? 117 GLU A O   1 
ATOM   921   C CB  . GLU A 1 117 ? -2.705  -30.733 5.961   1.00 27.08  ? 117 GLU A CB  1 
ATOM   922   C CG  . GLU A 1 117 ? -2.943  -31.451 4.656   1.00 29.36  ? 117 GLU A CG  1 
ATOM   923   C CD  . GLU A 1 117 ? -2.601  -30.614 3.418   1.00 47.32  ? 117 GLU A CD  1 
ATOM   924   O OE1 . GLU A 1 117 ? -3.065  -30.961 2.300   1.00 38.18  ? 117 GLU A OE1 1 
ATOM   925   O OE2 . GLU A 1 117 ? -1.819  -29.651 3.530   1.00 44.43  ? 117 GLU A OE2 1 
ATOM   926   N N   . GLN A 1 118 ? -2.497  -28.306 7.909   1.00 21.94  ? 118 GLN A N   1 
ATOM   927   C CA  . GLN A 1 118 ? -2.352  -27.771 9.247   1.00 20.53  ? 118 GLN A CA  1 
ATOM   928   C C   . GLN A 1 118 ? -2.422  -26.263 9.247   1.00 21.64  ? 118 GLN A C   1 
ATOM   929   O O   . GLN A 1 118 ? -1.926  -25.605 8.317   1.00 22.18  ? 118 GLN A O   1 
ATOM   930   C CB  . GLN A 1 118 ? -1.024  -28.214 9.850   1.00 22.73  ? 118 GLN A CB  1 
ATOM   931   C CG  . GLN A 1 118 ? -0.938  -29.703 10.211  1.00 36.11  ? 118 GLN A CG  1 
ATOM   932   C CD  . GLN A 1 118 ? -1.438  -29.974 11.623  1.00 59.10  ? 118 GLN A CD  1 
ATOM   933   O OE1 . GLN A 1 118 ? -2.591  -29.698 11.940  1.00 49.92  ? 118 GLN A OE1 1 
ATOM   934   N NE2 . GLN A 1 118 ? -0.545  -30.418 12.502  1.00 58.30  ? 118 GLN A NE2 1 
ATOM   935   N N   . PRO A 1 119 ? -3.032  -25.725 10.306  1.00 14.76  ? 119 PRO A N   1 
ATOM   936   C CA  . PRO A 1 119 ? -3.125  -24.297 10.477  1.00 13.84  ? 119 PRO A CA  1 
ATOM   937   C C   . PRO A 1 119 ? -1.807  -23.759 11.067  1.00 19.38  ? 119 PRO A C   1 
ATOM   938   O O   . PRO A 1 119 ? -1.102  -24.477 11.788  1.00 19.61  ? 119 PRO A O   1 
ATOM   939   C CB  . PRO A 1 119 ? -4.234  -24.182 11.548  1.00 13.95  ? 119 PRO A CB  1 
ATOM   940   C CG  . PRO A 1 119 ? -4.059  -25.358 12.395  1.00 14.76  ? 119 PRO A CG  1 
ATOM   941   C CD  . PRO A 1 119 ? -3.569  -26.433 11.495  1.00 12.38  ? 119 PRO A CD  1 
ATOM   942   N N   . THR A 1 120 ? -1.486  -22.503 10.759  1.00 15.88  ? 120 THR A N   1 
ATOM   943   C CA  . THR A 1 120 ? -0.349  -21.828 11.361  1.00 16.04  ? 120 THR A CA  1 
ATOM   944   C C   . THR A 1 120 ? -0.257  -22.147 12.863  1.00 21.86  ? 120 THR A C   1 
ATOM   945   O O   . THR A 1 120 ? -1.251  -22.485 13.492  1.00 21.72  ? 120 THR A O   1 
ATOM   946   C CB  . THR A 1 120 ? -0.419  -20.304 11.136  1.00 22.74  ? 120 THR A CB  1 
ATOM   947   O OG1 . THR A 1 120 ? -0.369  -20.052 9.728   1.00 27.45  ? 120 THR A OG1 1 
ATOM   948   C CG2 . THR A 1 120 ? 0.773   -19.605 11.789  1.00 12.98  ? 120 THR A CG2 1 
ATOM   949   N N   . GLY A 1 121 ? 0.961   -22.206 13.388  1.00 20.37  ? 121 GLY A N   1 
ATOM   950   C CA  . GLY A 1 121 ? 1.158   -22.640 14.768  1.00 19.99  ? 121 GLY A CA  1 
ATOM   951   C C   . GLY A 1 121 ? 1.088   -21.482 15.737  1.00 25.35  ? 121 GLY A C   1 
ATOM   952   O O   . GLY A 1 121 ? 1.292   -20.319 15.383  1.00 26.17  ? 121 GLY A O   1 
ATOM   953   N N   . THR A 1 122 ? 0.782   -21.770 16.984  1.00 22.07  ? 122 THR A N   1 
ATOM   954   C CA  . THR A 1 122 ? 0.660   -20.668 17.924  1.00 22.25  ? 122 THR A CA  1 
ATOM   955   C C   . THR A 1 122 ? 1.375   -21.034 19.202  1.00 27.28  ? 122 THR A C   1 
ATOM   956   O O   . THR A 1 122 ? 1.681   -22.209 19.445  1.00 28.92  ? 122 THR A O   1 
ATOM   957   C CB  . THR A 1 122 ? -0.831  -20.357 18.300  1.00 27.86  ? 122 THR A CB  1 
ATOM   958   O OG1 . THR A 1 122 ? -1.463  -21.550 18.784  1.00 30.93  ? 122 THR A OG1 1 
ATOM   959   C CG2 . THR A 1 122 ? -1.642  -19.799 17.103  1.00 19.14  ? 122 THR A CG2 1 
ATOM   960   N N   . CYS A 1 123 ? 1.629   -20.006 20.008  1.00 21.46  ? 123 CYS A N   1 
ATOM   961   C CA  . CYS A 1 123 ? 2.185   -20.139 21.352  1.00 20.82  ? 123 CYS A CA  1 
ATOM   962   C C   . CYS A 1 123 ? 1.365   -19.265 22.284  1.00 23.36  ? 123 CYS A C   1 
ATOM   963   O O   . CYS A 1 123 ? 1.048   -18.122 21.969  1.00 20.13  ? 123 CYS A O   1 
ATOM   964   C CB  . CYS A 1 123 ? 3.653   -19.714 21.438  1.00 20.52  ? 123 CYS A CB  1 
ATOM   965   S SG  . CYS A 1 123 ? 4.467   -20.274 22.975  1.00 23.81  ? 123 CYS A SG  1 
ATOM   966   N N   . ALA A 1 124 ? 0.925   -19.866 23.379  1.00 23.82  ? 124 ALA A N   1 
ATOM   967   C CA  . ALA A 1 124 ? 0.142   -19.181 24.387  1.00 23.65  ? 124 ALA A CA  1 
ATOM   968   C C   . ALA A 1 124 ? 1.099   -18.703 25.454  1.00 29.63  ? 124 ALA A C   1 
ATOM   969   O O   . ALA A 1 124 ? 1.962   -19.457 25.929  1.00 29.86  ? 124 ALA A O   1 
ATOM   970   C CB  . ALA A 1 124 ? -0.899  -20.113 25.006  1.00 24.10  ? 124 ALA A CB  1 
ATOM   971   N N   . ALA A 1 125 ? 0.962   -17.431 25.812  1.00 28.63  ? 125 ALA A N   1 
ATOM   972   C CA  . ALA A 1 125 ? 1.787   -16.837 26.859  1.00 28.62  ? 125 ALA A CA  1 
ATOM   973   C C   . ALA A 1 125 ? 0.830   -16.412 27.973  1.00 33.07  ? 125 ALA A C   1 
ATOM   974   O O   . ALA A 1 125 ? 0.261   -15.309 27.987  1.00 31.44  ? 125 ALA A O   1 
ATOM   975   C CB  . ALA A 1 125 ? 2.594   -15.651 26.317  1.00 29.34  ? 125 ALA A CB  1 
ATOM   976   N N   . CYS A 1 126 ? 0.578   -17.353 28.866  1.00 30.69  ? 126 CYS A N   1 
ATOM   977   C CA  . CYS A 1 126 ? -0.348  -17.121 29.960  1.00 30.71  ? 126 CYS A CA  1 
ATOM   978   C C   . CYS A 1 126 ? 0.373   -16.407 31.059  1.00 37.89  ? 126 CYS A C   1 
ATOM   979   O O   . CYS A 1 126 ? 1.180   -17.001 31.755  1.00 38.85  ? 126 CYS A O   1 
ATOM   980   C CB  . CYS A 1 126 ? -0.917  -18.454 30.430  1.00 31.04  ? 126 CYS A CB  1 
ATOM   981   S SG  . CYS A 1 126 ? -1.387  -19.500 28.985  1.00 35.10  ? 126 CYS A SG  1 
ATOM   982   N N   . ILE A 1 127 ? 0.143   -15.102 31.150  1.00 36.95  ? 127 ILE A N   1 
ATOM   983   C CA  . ILE A 1 127 ? 0.805   -14.262 32.152  1.00 36.55  ? 127 ILE A CA  1 
ATOM   984   C C   . ILE A 1 127 ? 0.091   -14.175 33.488  1.00 45.63  ? 127 ILE A C   1 
ATOM   985   O O   . ILE A 1 127 ? -1.141  -14.109 33.567  1.00 47.59  ? 127 ILE A O   1 
ATOM   986   C CB  . ILE A 1 127 ? 1.025   -12.801 31.699  1.00 37.83  ? 127 ILE A CB  1 
ATOM   987   C CG1 . ILE A 1 127 ? 1.360   -12.699 30.206  1.00 37.88  ? 127 ILE A CG1 1 
ATOM   988   C CG2 . ILE A 1 127 ? 2.126   -12.214 32.524  1.00 37.30  ? 127 ILE A CG2 1 
ATOM   989   C CD1 . ILE A 1 127 ? 1.926   -11.319 29.781  1.00 37.38  ? 127 ILE A CD1 1 
ATOM   990   N N   . THR A 1 128 ? 0.897   -14.072 34.534  1.00 42.49  ? 128 THR A N   1 
ATOM   991   C CA  . THR A 1 128 ? 0.409   -13.870 35.892  1.00 42.02  ? 128 THR A CA  1 
ATOM   992   C C   . THR A 1 128 ? 1.463   -13.068 36.663  1.00 47.47  ? 128 THR A C   1 
ATOM   993   O O   . THR A 1 128 ? 2.512   -13.601 37.056  1.00 46.12  ? 128 THR A O   1 
ATOM   994   C CB  . THR A 1 128 ? 0.137   -15.197 36.619  1.00 45.66  ? 128 THR A CB  1 
ATOM   995   O OG1 . THR A 1 128 ? 1.368   -15.843 37.000  1.00 38.58  ? 128 THR A OG1 1 
ATOM   996   C CG2 . THR A 1 128 ? -0.747  -16.114 35.774  1.00 41.77  ? 128 THR A CG2 1 
ATOM   997   N N   . GLY A 1 129 ? 1.200   -11.779 36.837  1.00 45.07  ? 129 GLY A N   1 
ATOM   998   C CA  . GLY A 1 129 ? 2.154   -10.922 37.500  1.00 45.74  ? 129 GLY A CA  1 
ATOM   999   C C   . GLY A 1 129 ? 3.358   -10.753 36.568  1.00 52.27  ? 129 GLY A C   1 
ATOM   1000  O O   . GLY A 1 129 ? 3.249   -10.192 35.469  1.00 52.79  ? 129 GLY A O   1 
ATOM   1001  N N   . ASP A 1 130 ? 4.514   -11.225 37.018  1.00 48.62  ? 130 ASP A N   1 
ATOM   1002  C CA  . ASP A 1 130 ? 5.726   -11.089 36.231  1.00 48.31  ? 130 ASP A CA  1 
ATOM   1003  C C   . ASP A 1 130 ? 6.133   -12.409 35.613  1.00 48.69  ? 130 ASP A C   1 
ATOM   1004  O O   . ASP A 1 130 ? 7.167   -12.516 34.963  1.00 48.26  ? 130 ASP A O   1 
ATOM   1005  C CB  . ASP A 1 130 ? 6.830   -10.563 37.118  1.00 51.07  ? 130 ASP A CB  1 
ATOM   1006  C CG  . ASP A 1 130 ? 6.823   -9.088  37.187  1.00 74.70  ? 130 ASP A CG  1 
ATOM   1007  O OD1 . ASP A 1 130 ? 7.838   -8.528  37.645  1.00 77.20  ? 130 ASP A OD1 1 
ATOM   1008  O OD2 . ASP A 1 130 ? 5.819   -8.492  36.730  1.00 88.86  ? 130 ASP A OD2 1 
ATOM   1009  N N   . ASN A 1 131 ? 5.294   -13.403 35.843  1.00 42.41  ? 131 ASN A N   1 
ATOM   1010  C CA  . ASN A 1 131 ? 5.501   -14.743 35.356  1.00 41.04  ? 131 ASN A CA  1 
ATOM   1011  C C   . ASN A 1 131 ? 4.902   -14.908 33.940  1.00 40.29  ? 131 ASN A C   1 
ATOM   1012  O O   . ASN A 1 131 ? 4.024   -14.124 33.513  1.00 38.81  ? 131 ASN A O   1 
ATOM   1013  C CB  . ASN A 1 131 ? 4.883   -15.730 36.362  1.00 44.17  ? 131 ASN A CB  1 
ATOM   1014  C CG  . ASN A 1 131 ? 5.492   -15.602 37.751  1.00 67.71  ? 131 ASN A CG  1 
ATOM   1015  O OD1 . ASN A 1 131 ? 4.856   -15.116 38.675  1.00 66.56  ? 131 ASN A OD1 1 
ATOM   1016  N ND2 . ASN A 1 131 ? 6.741   -16.015 37.891  1.00 63.22  ? 131 ASN A ND2 1 
ATOM   1017  N N   . ARG A 1 132 ? 5.450   -15.886 33.208  1.00 32.77  ? 132 ARG A N   1 
ATOM   1018  C CA  . ARG A 1 132 ? 5.079   -16.183 31.819  1.00 30.29  ? 132 ARG A CA  1 
ATOM   1019  C C   . ARG A 1 132 ? 5.190   -17.672 31.532  1.00 28.94  ? 132 ARG A C   1 
ATOM   1020  O O   . ARG A 1 132 ? 6.279   -18.248 31.466  1.00 26.71  ? 132 ARG A O   1 
ATOM   1021  C CB  . ARG A 1 132 ? 5.983   -15.437 30.839  1.00 28.51  ? 132 ARG A CB  1 
ATOM   1022  C CG  . ARG A 1 132 ? 5.767   -13.949 30.847  1.00 45.20  ? 132 ARG A CG  1 
ATOM   1023  C CD  . ARG A 1 132 ? 6.749   -13.248 29.946  1.00 51.04  ? 132 ARG A CD  1 
ATOM   1024  N NE  . ARG A 1 132 ? 6.278   -13.270 28.573  1.00 55.81  ? 132 ARG A NE  1 
ATOM   1025  C CZ  . ARG A 1 132 ? 5.223   -12.591 28.139  1.00 64.26  ? 132 ARG A CZ  1 
ATOM   1026  N NH1 . ARG A 1 132 ? 4.537   -11.828 28.976  1.00 49.05  ? 132 ARG A NH1 1 
ATOM   1027  N NH2 . ARG A 1 132 ? 4.835   -12.691 26.871  1.00 49.92  ? 132 ARG A NH2 1 
ATOM   1028  N N   . SER A 1 133 ? 4.039   -18.294 31.384  1.00 22.94  ? 133 SER A N   1 
ATOM   1029  C CA  . SER A 1 133 ? 3.968   -19.711 31.133  1.00 21.32  ? 133 SER A CA  1 
ATOM   1030  C C   . SER A 1 133 ? 3.652   -19.897 29.652  1.00 28.55  ? 133 SER A C   1 
ATOM   1031  O O   . SER A 1 133 ? 2.539   -19.565 29.202  1.00 29.59  ? 133 SER A O   1 
ATOM   1032  C CB  . SER A 1 133 ? 2.825   -20.273 31.958  1.00 18.75  ? 133 SER A CB  1 
ATOM   1033  O OG  . SER A 1 133 ? 2.985   -21.626 32.217  1.00 11.56  ? 133 SER A OG  1 
ATOM   1034  N N   . LEU A 1 134 ? 4.617   -20.421 28.891  1.00 22.92  ? 134 LEU A N   1 
ATOM   1035  C CA  . LEU A 1 134 ? 4.405   -20.615 27.450  1.00 20.10  ? 134 LEU A CA  1 
ATOM   1036  C C   . LEU A 1 134 ? 4.053   -22.045 27.116  1.00 23.28  ? 134 LEU A C   1 
ATOM   1037  O O   . LEU A 1 134 ? 4.692   -22.973 27.595  1.00 24.53  ? 134 LEU A O   1 
ATOM   1038  C CB  . LEU A 1 134 ? 5.654   -20.196 26.659  1.00 18.80  ? 134 LEU A CB  1 
ATOM   1039  C CG  . LEU A 1 134 ? 6.208   -18.768 26.761  1.00 21.83  ? 134 LEU A CG  1 
ATOM   1040  C CD1 . LEU A 1 134 ? 7.231   -18.462 25.659  1.00 19.89  ? 134 LEU A CD1 1 
ATOM   1041  C CD2 . LEU A 1 134 ? 5.085   -17.796 26.642  1.00 25.21  ? 134 LEU A CD2 1 
ATOM   1042  N N   . ILE A 1 135 ? 3.070   -22.214 26.244  1.00 20.07  ? 135 ILE A N   1 
ATOM   1043  C CA  . ILE A 1 135 ? 2.672   -23.537 25.729  1.00 18.27  ? 135 ILE A CA  1 
ATOM   1044  C C   . ILE A 1 135 ? 2.467   -23.392 24.210  1.00 20.19  ? 135 ILE A C   1 
ATOM   1045  O O   . ILE A 1 135 ? 1.549   -22.703 23.749  1.00 17.01  ? 135 ILE A O   1 
ATOM   1046  C CB  . ILE A 1 135 ? 1.324   -24.050 26.323  1.00 20.25  ? 135 ILE A CB  1 
ATOM   1047  C CG1 . ILE A 1 135 ? 1.251   -23.830 27.846  1.00 19.25  ? 135 ILE A CG1 1 
ATOM   1048  C CG2 . ILE A 1 135 ? 1.059   -25.509 25.871  1.00 20.38  ? 135 ILE A CG2 1 
ATOM   1049  C CD1 . ILE A 1 135 ? 0.698   -22.461 28.241  1.00 21.45  ? 135 ILE A CD1 1 
ATOM   1050  N N   . ALA A 1 136 ? 3.350   -24.025 23.437  1.00 16.72  ? 136 ALA A N   1 
ATOM   1051  C CA  . ALA A 1 136 ? 3.251   -23.967 21.984  1.00 16.32  ? 136 ALA A CA  1 
ATOM   1052  C C   . ALA A 1 136 ? 2.371   -25.071 21.396  1.00 22.60  ? 136 ALA A C   1 
ATOM   1053  O O   . ALA A 1 136 ? 2.485   -26.230 21.771  1.00 23.58  ? 136 ALA A O   1 
ATOM   1054  C CB  . ALA A 1 136 ? 4.630   -24.050 21.346  1.00 16.25  ? 136 ALA A CB  1 
ATOM   1055  N N   . ASN A 1 137 ? 1.588   -24.697 20.383  1.00 18.77  ? 137 ASN A N   1 
ATOM   1056  C CA  . ASN A 1 137 ? 0.818   -25.606 19.547  1.00 18.26  ? 137 ASN A CA  1 
ATOM   1057  C C   . ASN A 1 137 ? 1.458   -25.426 18.180  1.00 22.75  ? 137 ASN A C   1 
ATOM   1058  O O   . ASN A 1 137 ? 1.032   -24.597 17.394  1.00 24.69  ? 137 ASN A O   1 
ATOM   1059  C CB  . ASN A 1 137 ? -0.655  -25.188 19.461  1.00 20.94  ? 137 ASN A CB  1 
ATOM   1060  C CG  . ASN A 1 137 ? -1.517  -26.239 18.791  1.00 28.14  ? 137 ASN A CG  1 
ATOM   1061  O OD1 . ASN A 1 137 ? -1.814  -27.286 19.363  1.00 17.23  ? 137 ASN A OD1 1 
ATOM   1062  N ND2 . ASN A 1 137 ? -1.973  -25.946 17.582  1.00 17.78  ? 137 ASN A ND2 1 
ATOM   1063  N N   . LEU A 1 138 ? 2.572   -26.120 17.959  1.00 17.36  ? 138 LEU A N   1 
ATOM   1064  C CA  . LEU A 1 138 ? 3.296   -26.057 16.708  1.00 15.81  ? 138 LEU A CA  1 
ATOM   1065  C C   . LEU A 1 138 ? 2.385   -26.176 15.490  1.00 18.51  ? 138 LEU A C   1 
ATOM   1066  O O   . LEU A 1 138 ? 2.532   -25.421 14.534  1.00 18.19  ? 138 LEU A O   1 
ATOM   1067  C CB  . LEU A 1 138 ? 4.369   -27.145 16.712  1.00 15.90  ? 138 LEU A CB  1 
ATOM   1068  C CG  . LEU A 1 138 ? 5.449   -26.881 17.772  1.00 19.37  ? 138 LEU A CG  1 
ATOM   1069  C CD1 . LEU A 1 138 ? 6.649   -27.834 17.562  1.00 18.49  ? 138 LEU A CD1 1 
ATOM   1070  C CD2 . LEU A 1 138 ? 5.884   -25.395 17.723  1.00 17.65  ? 138 LEU A CD2 1 
ATOM   1071  N N   . ALA A 1 139 ? 1.471   -27.151 15.524  1.00 15.92  ? 139 ALA A N   1 
ATOM   1072  C CA  . ALA A 1 139 ? 0.525   -27.400 14.424  1.00 14.99  ? 139 ALA A CA  1 
ATOM   1073  C C   . ALA A 1 139 ? 1.271   -27.396 13.095  1.00 19.91  ? 139 ALA A C   1 
ATOM   1074  O O   . ALA A 1 139 ? 2.091   -28.279 12.860  1.00 20.80  ? 139 ALA A O   1 
ATOM   1075  C CB  . ALA A 1 139 ? -0.678  -26.364 14.451  1.00 15.00  ? 139 ALA A CB  1 
ATOM   1076  N N   . ALA A 1 140 ? 1.043   -26.389 12.252  1.00 16.46  ? 140 ALA A N   1 
ATOM   1077  C CA  . ALA A 1 140 ? 1.791   -26.287 10.991  1.00 15.70  ? 140 ALA A CA  1 
ATOM   1078  C C   . ALA A 1 140 ? 3.337   -26.158 11.103  1.00 23.92  ? 140 ALA A C   1 
ATOM   1079  O O   . ALA A 1 140 ? 4.031   -26.502 10.137  1.00 24.01  ? 140 ALA A O   1 
ATOM   1080  C CB  . ALA A 1 140 ? 1.216   -25.158 10.088  1.00 15.17  ? 140 ALA A CB  1 
ATOM   1081  N N   . ALA A 1 141 ? 3.883   -25.514 12.149  1.00 20.17  ? 141 ALA A N   1 
ATOM   1082  C CA  . ALA A 1 141 ? 5.345   -25.347 12.191  1.00 17.87  ? 141 ALA A CA  1 
ATOM   1083  C C   . ALA A 1 141 ? 6.005   -26.720 12.229  1.00 22.26  ? 141 ALA A C   1 
ATOM   1084  O O   . ALA A 1 141 ? 7.122   -26.898 11.750  1.00 21.39  ? 141 ALA A O   1 
ATOM   1085  C CB  . ALA A 1 141 ? 5.800   -24.488 13.372  1.00 17.91  ? 141 ALA A CB  1 
ATOM   1086  N N   . ASN A 1 142 ? 5.241   -27.700 12.696  1.00 21.57  ? 142 ASN A N   1 
ATOM   1087  C CA  . ASN A 1 142 ? 5.664   -29.110 12.761  1.00 22.83  ? 142 ASN A CA  1 
ATOM   1088  C C   . ASN A 1 142 ? 5.671   -29.847 11.410  1.00 30.23  ? 142 ASN A C   1 
ATOM   1089  O O   . ASN A 1 142 ? 6.213   -30.943 11.333  1.00 29.90  ? 142 ASN A O   1 
ATOM   1090  C CB  . ASN A 1 142 ? 4.772   -29.859 13.770  1.00 23.44  ? 142 ASN A CB  1 
ATOM   1091  C CG  . ASN A 1 142 ? 5.230   -31.267 14.056  1.00 45.58  ? 142 ASN A CG  1 
ATOM   1092  O OD1 . ASN A 1 142 ? 4.424   -32.205 13.960  1.00 44.46  ? 142 ASN A OD1 1 
ATOM   1093  N ND2 . ASN A 1 142 ? 6.414   -31.387 14.666  1.00 33.66  ? 142 ASN A ND2 1 
ATOM   1094  N N   . CYS A 1 143 ? 5.158   -29.229 10.345  1.00 31.19  ? 143 CYS A N   1 
ATOM   1095  C CA  . CYS A 1 143 ? 5.106   -29.876 9.028   1.00 35.51  ? 143 CYS A CA  1 
ATOM   1096  C C   . CYS A 1 143 ? 6.343   -29.790 8.172   1.00 37.18  ? 143 CYS A C   1 
ATOM   1097  O O   . CYS A 1 143 ? 6.364   -30.334 7.069   1.00 39.05  ? 143 CYS A O   1 
ATOM   1098  C CB  . CYS A 1 143 ? 3.963   -29.369 8.158   1.00 40.22  ? 143 CYS A CB  1 
ATOM   1099  S SG  . CYS A 1 143 ? 2.678   -28.379 8.972   1.00 47.83  ? 143 CYS A SG  1 
ATOM   1100  N N   . TYR A 1 144 ? 7.381   -29.132 8.663   1.00 27.95  ? 144 TYR A N   1 
ATOM   1101  C CA  . TYR A 1 144 ? 8.561   -28.945 7.859   1.00 24.51  ? 144 TYR A CA  1 
ATOM   1102  C C   . TYR A 1 144 ? 9.323   -30.216 7.520   1.00 28.39  ? 144 TYR A C   1 
ATOM   1103  O O   . TYR A 1 144 ? 9.745   -30.966 8.405   1.00 27.85  ? 144 TYR A O   1 
ATOM   1104  C CB  . TYR A 1 144 ? 9.453   -27.881 8.470   1.00 24.48  ? 144 TYR A CB  1 
ATOM   1105  C CG  . TYR A 1 144 ? 10.451  -27.300 7.513   1.00 22.81  ? 144 TYR A CG  1 
ATOM   1106  C CD1 . TYR A 1 144 ? 10.153  -26.171 6.767   1.00 21.43  ? 144 TYR A CD1 1 
ATOM   1107  C CD2 . TYR A 1 144 ? 11.710  -27.893 7.354   1.00 24.01  ? 144 TYR A CD2 1 
ATOM   1108  C CE1 . TYR A 1 144 ? 11.078  -25.639 5.881   1.00 17.84  ? 144 TYR A CE1 1 
ATOM   1109  C CE2 . TYR A 1 144 ? 12.626  -27.394 6.429   1.00 23.98  ? 144 TYR A CE2 1 
ATOM   1110  C CZ  . TYR A 1 144 ? 12.312  -26.250 5.718   1.00 21.08  ? 144 TYR A CZ  1 
ATOM   1111  O OH  . TYR A 1 144 ? 13.245  -25.746 4.840   1.00 16.26  ? 144 TYR A OH  1 
ATOM   1112  N N   . LYS A 1 145 ? 9.474   -30.453 6.217   1.00 24.59  ? 145 LYS A N   1 
ATOM   1113  C CA  . LYS A 1 145 ? 10.195  -31.603 5.676   1.00 23.93  ? 145 LYS A CA  1 
ATOM   1114  C C   . LYS A 1 145 ? 11.332  -31.043 4.819   1.00 27.97  ? 145 LYS A C   1 
ATOM   1115  O O   . LYS A 1 145 ? 11.135  -30.127 4.023   1.00 29.14  ? 145 LYS A O   1 
ATOM   1116  C CB  . LYS A 1 145 ? 9.253   -32.441 4.800   1.00 25.71  ? 145 LYS A CB  1 
ATOM   1117  C CG  . LYS A 1 145 ? 8.021   -32.983 5.515   1.00 10.84  ? 145 LYS A CG  1 
ATOM   1118  C CD  . LYS A 1 145 ? 8.445   -34.029 6.539   1.00 26.39  ? 145 LYS A CD  1 
ATOM   1119  C CE  . LYS A 1 145 ? 7.240   -34.593 7.352   1.00 47.21  ? 145 LYS A CE  1 
ATOM   1120  N NZ  . LYS A 1 145 ? 7.526   -35.934 7.978   1.00 53.28  ? 145 LYS A NZ  1 
ATOM   1121  N N   . LYS A 1 146 ? 12.543  -31.523 5.010   1.00 24.32  ? 146 LYS A N   1 
ATOM   1122  C CA  . LYS A 1 146 ? 13.606  -30.957 4.209   1.00 25.74  ? 146 LYS A CA  1 
ATOM   1123  C C   . LYS A 1 146 ? 13.356  -31.267 2.736   1.00 36.11  ? 146 LYS A C   1 
ATOM   1124  O O   . LYS A 1 146 ? 13.544  -30.415 1.849   1.00 37.30  ? 146 LYS A O   1 
ATOM   1125  C CB  . LYS A 1 146 ? 15.006  -31.446 4.646   1.00 27.18  ? 146 LYS A CB  1 
ATOM   1126  C CG  . LYS A 1 146 ? 15.350  -32.885 4.302   1.00 13.93  ? 146 LYS A CG  1 
ATOM   1127  C CD  . LYS A 1 146 ? 16.782  -33.179 4.720   1.00 32.71  ? 146 LYS A CD  1 
ATOM   1128  C CE  . LYS A 1 146 ? 17.457  -34.165 3.769   1.00 49.39  ? 146 LYS A CE  1 
ATOM   1129  N NZ  . LYS A 1 146 ? 16.879  -34.168 2.394   1.00 52.39  ? 146 LYS A NZ  1 
ATOM   1130  N N   . GLU A 1 147 ? 12.959  -32.509 2.476   1.00 33.00  ? 147 GLU A N   1 
ATOM   1131  C CA  . GLU A 1 147 ? 12.815  -32.992 1.122   1.00 32.17  ? 147 GLU A CA  1 
ATOM   1132  C C   . GLU A 1 147 ? 11.908  -32.107 0.274   1.00 32.90  ? 147 GLU A C   1 
ATOM   1133  O O   . GLU A 1 147 ? 12.065  -32.034 -0.956  1.00 31.67  ? 147 GLU A O   1 
ATOM   1134  C CB  . GLU A 1 147 ? 12.299  -34.426 1.157   1.00 33.97  ? 147 GLU A CB  1 
ATOM   1135  C CG  . GLU A 1 147 ? 11.039  -34.577 2.001   1.00 48.81  ? 147 GLU A CG  1 
ATOM   1136  C CD  . GLU A 1 147 ? 11.277  -35.433 3.227   1.00 73.48  ? 147 GLU A CD  1 
ATOM   1137  O OE1 . GLU A 1 147 ? 12.469  -35.528 3.640   1.00 41.52  ? 147 GLU A OE1 1 
ATOM   1138  O OE2 . GLU A 1 147 ? 10.288  -36.040 3.720   1.00 71.60  ? 147 GLU A OE2 1 
ATOM   1139  N N   . LYS A 1 148 ? 10.936  -31.468 0.924   1.00 27.73  ? 148 LYS A N   1 
ATOM   1140  C CA  . LYS A 1 148 ? 9.941   -30.663 0.196   1.00 26.89  ? 148 LYS A CA  1 
ATOM   1141  C C   . LYS A 1 148 ? 10.058  -29.171 0.376   1.00 27.44  ? 148 LYS A C   1 
ATOM   1142  O O   . LYS A 1 148 ? 9.125   -28.435 0.073   1.00 23.32  ? 148 LYS A O   1 
ATOM   1143  C CB  . LYS A 1 148 ? 8.498   -31.102 0.514   1.00 30.23  ? 148 LYS A CB  1 
ATOM   1144  C CG  . LYS A 1 148 ? 8.122   -31.015 1.973   1.00 40.07  ? 148 LYS A CG  1 
ATOM   1145  C CD  . LYS A 1 148 ? 6.749   -31.628 2.207   1.00 46.09  ? 148 LYS A CD  1 
ATOM   1146  C CE  . LYS A 1 148 ? 6.325   -32.524 1.053   1.00 53.54  ? 148 LYS A CE  1 
ATOM   1147  N NZ  . LYS A 1 148 ? 5.043   -33.239 1.359   1.00 66.12  ? 148 LYS A NZ  1 
ATOM   1148  N N   . HIS A 1 149 ? 11.212  -28.717 0.864   1.00 26.56  ? 149 HIS A N   1 
ATOM   1149  C CA  . HIS A 1 149 ? 11.464  -27.284 0.989   1.00 25.06  ? 149 HIS A CA  1 
ATOM   1150  C C   . HIS A 1 149 ? 12.915  -26.910 0.983   1.00 29.04  ? 149 HIS A C   1 
ATOM   1151  O O   . HIS A 1 149 ? 13.376  -26.218 0.068   1.00 30.81  ? 149 HIS A O   1 
ATOM   1152  C CB  . HIS A 1 149 ? 10.758  -26.667 2.202   1.00 25.32  ? 149 HIS A CB  1 
ATOM   1153  C CG  . HIS A 1 149 ? 10.838  -25.175 2.240   1.00 28.39  ? 149 HIS A CG  1 
ATOM   1154  N ND1 . HIS A 1 149 ? 11.950  -24.514 2.712   1.00 31.37  ? 149 HIS A ND1 1 
ATOM   1155  C CD2 . HIS A 1 149 ? 10.013  -24.211 1.761   1.00 29.90  ? 149 HIS A CD2 1 
ATOM   1156  C CE1 . HIS A 1 149 ? 11.798  -23.207 2.557   1.00 29.75  ? 149 HIS A CE1 1 
ATOM   1157  N NE2 . HIS A 1 149 ? 10.631  -22.995 1.977   1.00 29.39  ? 149 HIS A NE2 1 
ATOM   1158  N N   . LEU A 1 150 ? 13.605  -27.302 2.052   1.00 24.75  ? 150 LEU A N   1 
ATOM   1159  C CA  . LEU A 1 150 ? 15.016  -26.989 2.240   1.00 23.72  ? 150 LEU A CA  1 
ATOM   1160  C C   . LEU A 1 150 ? 15.865  -27.620 1.154   1.00 28.60  ? 150 LEU A C   1 
ATOM   1161  O O   . LEU A 1 150 ? 16.904  -27.069 0.806   1.00 27.78  ? 150 LEU A O   1 
ATOM   1162  C CB  . LEU A 1 150 ? 15.502  -27.443 3.621   1.00 23.37  ? 150 LEU A CB  1 
ATOM   1163  C CG  . LEU A 1 150 ? 17.032  -27.510 3.909   1.00 25.49  ? 150 LEU A CG  1 
ATOM   1164  C CD1 . LEU A 1 150 ? 17.658  -26.141 4.237   1.00 24.08  ? 150 LEU A CD1 1 
ATOM   1165  C CD2 . LEU A 1 150 ? 17.342  -28.470 5.041   1.00 24.23  ? 150 LEU A CD2 1 
ATOM   1166  N N   . ASP A 1 151 ? 15.391  -28.725 0.573   1.00 26.67  ? 151 ASP A N   1 
ATOM   1167  C CA  . ASP A 1 151 ? 16.144  -29.381 -0.506  1.00 26.81  ? 151 ASP A CA  1 
ATOM   1168  C C   . ASP A 1 151 ? 15.943  -28.717 -1.873  1.00 30.72  ? 151 ASP A C   1 
ATOM   1169  O O   . ASP A 1 151 ? 16.811  -28.788 -2.742  1.00 30.00  ? 151 ASP A O   1 
ATOM   1170  C CB  . ASP A 1 151 ? 15.856  -30.881 -0.569  1.00 28.86  ? 151 ASP A CB  1 
ATOM   1171  C CG  . ASP A 1 151 ? 16.457  -31.660 0.618   1.00 37.33  ? 151 ASP A CG  1 
ATOM   1172  O OD1 . ASP A 1 151 ? 17.394  -31.140 1.272   1.00 34.13  ? 151 ASP A OD1 1 
ATOM   1173  O OD2 . ASP A 1 151 ? 16.011  -32.812 0.858   1.00 42.28  ? 151 ASP A OD2 1 
ATOM   1174  N N   . LEU A 1 152 ? 14.801  -28.056 -2.060  1.00 29.26  ? 152 LEU A N   1 
ATOM   1175  C CA  . LEU A 1 152 ? 14.530  -27.334 -3.320  1.00 29.01  ? 152 LEU A CA  1 
ATOM   1176  C C   . LEU A 1 152 ? 15.720  -26.443 -3.652  1.00 33.47  ? 152 LEU A C   1 
ATOM   1177  O O   . LEU A 1 152 ? 16.326  -25.862 -2.780  1.00 35.13  ? 152 LEU A O   1 
ATOM   1178  C CB  . LEU A 1 152 ? 13.240  -26.492 -3.219  1.00 28.36  ? 152 LEU A CB  1 
ATOM   1179  C CG  . LEU A 1 152 ? 11.955  -27.272 -2.915  1.00 31.37  ? 152 LEU A CG  1 
ATOM   1180  C CD1 . LEU A 1 152 ? 10.732  -26.418 -3.116  1.00 30.49  ? 152 LEU A CD1 1 
ATOM   1181  C CD2 . LEU A 1 152 ? 11.879  -28.547 -3.703  1.00 28.39  ? 152 LEU A CD2 1 
ATOM   1182  N N   . GLU A 1 153 ? 16.086  -26.364 -4.911  1.00 32.10  ? 153 GLU A N   1 
ATOM   1183  C CA  . GLU A 1 153 ? 17.290  -25.630 -5.263  1.00 33.55  ? 153 GLU A CA  1 
ATOM   1184  C C   . GLU A 1 153 ? 17.217  -24.148 -4.968  1.00 36.43  ? 153 GLU A C   1 
ATOM   1185  O O   . GLU A 1 153 ? 18.197  -23.557 -4.477  1.00 31.55  ? 153 GLU A O   1 
ATOM   1186  C CB  . GLU A 1 153 ? 17.732  -25.885 -6.715  1.00 35.63  ? 153 GLU A CB  1 
ATOM   1187  C CG  . GLU A 1 153 ? 18.938  -25.025 -7.150  1.00 56.87  ? 153 GLU A CG  1 
ATOM   1188  C CD  . GLU A 1 153 ? 19.190  -25.062 -8.655  1.00 109.44 ? 153 GLU A CD  1 
ATOM   1189  O OE1 . GLU A 1 153 ? 19.064  -26.161 -9.253  1.00 126.72 ? 153 GLU A OE1 1 
ATOM   1190  O OE2 . GLU A 1 153 ? 19.517  -23.999 -9.235  1.00 110.91 ? 153 GLU A OE2 1 
ATOM   1191  N N   . LYS A 1 154 ? 16.100  -23.518 -5.332  1.00 35.13  ? 154 LYS A N   1 
ATOM   1192  C CA  . LYS A 1 154 ? 15.982  -22.087 -5.057  1.00 35.96  ? 154 LYS A CA  1 
ATOM   1193  C C   . LYS A 1 154 ? 16.144  -21.783 -3.560  1.00 39.79  ? 154 LYS A C   1 
ATOM   1194  O O   . LYS A 1 154 ? 16.723  -20.757 -3.200  1.00 40.11  ? 154 LYS A O   1 
ATOM   1195  C CB  . LYS A 1 154 ? 14.674  -21.505 -5.585  1.00 40.14  ? 154 LYS A CB  1 
ATOM   1196  C CG  . LYS A 1 154 ? 13.416  -22.351 -5.320  1.00 56.52  ? 154 LYS A CG  1 
ATOM   1197  C CD  . LYS A 1 154 ? 12.165  -21.490 -5.425  1.00 62.22  ? 154 LYS A CD  1 
ATOM   1198  C CE  . LYS A 1 154 ? 10.982  -22.177 -4.789  1.00 76.56  ? 154 LYS A CE  1 
ATOM   1199  N NZ  . LYS A 1 154 ? 10.670  -23.440 -5.503  1.00 88.66  ? 154 LYS A NZ  1 
ATOM   1200  N N   . ASN A 1 155 ? 15.681  -22.702 -2.704  1.00 34.45  ? 155 ASN A N   1 
ATOM   1201  C CA  . ASN A 1 155 ? 15.787  -22.549 -1.253  1.00 34.20  ? 155 ASN A CA  1 
ATOM   1202  C C   . ASN A 1 155 ? 17.174  -22.906 -0.703  1.00 38.71  ? 155 ASN A C   1 
ATOM   1203  O O   . ASN A 1 155 ? 17.730  -22.169 0.114   1.00 38.64  ? 155 ASN A O   1 
ATOM   1204  C CB  . ASN A 1 155 ? 14.765  -23.421 -0.535  1.00 34.01  ? 155 ASN A CB  1 
ATOM   1205  C CG  . ASN A 1 155 ? 13.362  -23.066 -0.871  1.00 48.29  ? 155 ASN A CG  1 
ATOM   1206  O OD1 . ASN A 1 155 ? 12.472  -23.894 -0.744  1.00 47.64  ? 155 ASN A OD1 1 
ATOM   1207  N ND2 . ASN A 1 155 ? 13.154  -21.852 -1.346  1.00 39.67  ? 155 ASN A ND2 1 
ATOM   1208  N N   . TRP A 1 156 ? 17.662  -24.101 -1.037  1.00 33.22  ? 156 TRP A N   1 
ATOM   1209  C CA  . TRP A 1 156 ? 18.958  -24.548 -0.533  1.00 32.70  ? 156 TRP A CA  1 
ATOM   1210  C C   . TRP A 1 156 ? 20.070  -23.622 -0.994  1.00 38.51  ? 156 TRP A C   1 
ATOM   1211  O O   . TRP A 1 156 ? 21.144  -23.567 -0.395  1.00 36.75  ? 156 TRP A O   1 
ATOM   1212  C CB  . TRP A 1 156 ? 19.269  -25.989 -0.970  1.00 31.02  ? 156 TRP A CB  1 
ATOM   1213  C CG  . TRP A 1 156 ? 20.637  -26.380 -0.532  1.00 31.45  ? 156 TRP A CG  1 
ATOM   1214  C CD1 . TRP A 1 156 ? 21.804  -26.297 -1.264  1.00 33.60  ? 156 TRP A CD1 1 
ATOM   1215  C CD2 . TRP A 1 156 ? 21.034  -26.699 0.813   1.00 31.30  ? 156 TRP A CD2 1 
ATOM   1216  N NE1 . TRP A 1 156 ? 22.887  -26.588 -0.464  1.00 32.14  ? 156 TRP A NE1 1 
ATOM   1217  C CE2 . TRP A 1 156 ? 22.441  -26.843 0.812   1.00 34.59  ? 156 TRP A CE2 1 
ATOM   1218  C CE3 . TRP A 1 156 ? 20.330  -26.943 2.004   1.00 32.01  ? 156 TRP A CE3 1 
ATOM   1219  C CZ2 . TRP A 1 156 ? 23.146  -27.185 1.964   1.00 33.73  ? 156 TRP A CZ2 1 
ATOM   1220  C CZ3 . TRP A 1 156 ? 21.036  -27.261 3.139   1.00 33.33  ? 156 TRP A CZ3 1 
ATOM   1221  C CH2 . TRP A 1 156 ? 22.412  -27.427 3.097   1.00 34.17  ? 156 TRP A CH2 1 
ATOM   1222  N N   . MET A 1 157 ? 19.766  -22.886 -2.057  1.00 38.86  ? 157 MET A N   1 
ATOM   1223  C CA  . MET A 1 157 ? 20.648  -21.922 -2.700  1.00 39.46  ? 157 MET A CA  1 
ATOM   1224  C C   . MET A 1 157 ? 20.891  -20.737 -1.758  1.00 41.59  ? 157 MET A C   1 
ATOM   1225  O O   . MET A 1 157 ? 22.002  -20.218 -1.664  1.00 41.84  ? 157 MET A O   1 
ATOM   1226  C CB  . MET A 1 157 ? 19.963  -21.443 -3.999  1.00 42.81  ? 157 MET A CB  1 
ATOM   1227  C CG  . MET A 1 157 ? 20.564  -20.203 -4.671  1.00 47.59  ? 157 MET A CG  1 
ATOM   1228  S SD  . MET A 1 157 ? 20.277  -20.130 -6.484  1.00 53.54  ? 157 MET A SD  1 
ATOM   1229  C CE  . MET A 1 157 ? 19.334  -21.686 -6.809  1.00 49.97  ? 157 MET A CE  1 
ATOM   1230  N N   . LEU A 1 158 ? 19.842  -20.296 -1.075  1.00 36.13  ? 158 LEU A N   1 
ATOM   1231  C CA  . LEU A 1 158 ? 19.968  -19.183 -0.122  1.00 34.17  ? 158 LEU A CA  1 
ATOM   1232  C C   . LEU A 1 158 ? 20.772  -19.591 1.109   1.00 35.37  ? 158 LEU A C   1 
ATOM   1233  O O   . LEU A 1 158 ? 21.456  -18.767 1.699   1.00 36.24  ? 158 LEU A O   1 
ATOM   1234  C CB  . LEU A 1 158 ? 18.593  -18.675 0.292   1.00 33.71  ? 158 LEU A CB  1 
ATOM   1235  C CG  . LEU A 1 158 ? 17.764  -18.063 -0.848  1.00 39.11  ? 158 LEU A CG  1 
ATOM   1236  C CD1 . LEU A 1 158 ? 16.595  -17.299 -0.229  1.00 39.39  ? 158 LEU A CD1 1 
ATOM   1237  C CD2 . LEU A 1 158 ? 18.626  -17.120 -1.714  1.00 43.17  ? 158 LEU A CD2 1 
ATOM   1238  N N   . VAL A 1 159 ? 20.686  -20.866 1.491   1.00 28.83  ? 159 VAL A N   1 
ATOM   1239  C CA  . VAL A 1 159 ? 21.435  -21.406 2.637   1.00 27.44  ? 159 VAL A CA  1 
ATOM   1240  C C   . VAL A 1 159 ? 22.930  -21.383 2.273   1.00 34.11  ? 159 VAL A C   1 
ATOM   1241  O O   . VAL A 1 159 ? 23.805  -21.019 3.077   1.00 34.80  ? 159 VAL A O   1 
ATOM   1242  C CB  . VAL A 1 159 ? 21.021  -22.890 2.954   1.00 27.85  ? 159 VAL A CB  1 
ATOM   1243  C CG1 . VAL A 1 159 ? 22.096  -23.610 3.762   1.00 26.08  ? 159 VAL A CG1 1 
ATOM   1244  C CG2 . VAL A 1 159 ? 19.661  -22.957 3.616   1.00 26.68  ? 159 VAL A CG2 1 
ATOM   1245  N N   . GLU A 1 160 ? 23.215  -21.717 1.025   1.00 30.96  ? 160 GLU A N   1 
ATOM   1246  C CA  . GLU A 1 160 ? 24.592  -21.699 0.533   1.00 29.82  ? 160 GLU A CA  1 
ATOM   1247  C C   . GLU A 1 160 ? 25.238  -20.290 0.512   1.00 32.56  ? 160 GLU A C   1 
ATOM   1248  O O   . GLU A 1 160 ? 26.432  -20.161 0.311   1.00 35.64  ? 160 GLU A O   1 
ATOM   1249  C CB  . GLU A 1 160 ? 24.667  -22.384 -0.841  1.00 30.07  ? 160 GLU A CB  1 
ATOM   1250  C CG  . GLU A 1 160 ? 24.260  -23.861 -0.784  1.00 40.50  ? 160 GLU A CG  1 
ATOM   1251  C CD  . GLU A 1 160 ? 25.169  -24.794 -1.607  1.00 63.78  ? 160 GLU A CD  1 
ATOM   1252  O OE1 . GLU A 1 160 ? 25.074  -24.728 -2.857  1.00 48.17  ? 160 GLU A OE1 1 
ATOM   1253  O OE2 . GLU A 1 160 ? 25.912  -25.641 -1.023  1.00 48.22  ? 160 GLU A OE2 1 
ATOM   1254  N N   . LYS A 1 161 ? 24.460  -19.243 0.723   1.00 25.69  ? 161 LYS A N   1 
ATOM   1255  C CA  . LYS A 1 161 ? 25.002  -17.886 0.729   1.00 27.11  ? 161 LYS A CA  1 
ATOM   1256  C C   . LYS A 1 161 ? 25.430  -17.405 2.140   1.00 36.75  ? 161 LYS A C   1 
ATOM   1257  O O   . LYS A 1 161 ? 26.136  -16.393 2.276   1.00 36.92  ? 161 LYS A O   1 
ATOM   1258  C CB  . LYS A 1 161 ? 23.949  -16.886 0.213   1.00 28.26  ? 161 LYS A CB  1 
ATOM   1259  C CG  . LYS A 1 161 ? 23.902  -16.729 -1.280  1.00 42.76  ? 161 LYS A CG  1 
ATOM   1260  C CD  . LYS A 1 161 ? 22.665  -15.996 -1.738  1.00 46.47  ? 161 LYS A CD  1 
ATOM   1261  C CE  . LYS A 1 161 ? 22.635  -14.630 -1.136  1.00 40.52  ? 161 LYS A CE  1 
ATOM   1262  N NZ  . LYS A 1 161 ? 21.696  -13.742 -1.854  1.00 39.89  ? 161 LYS A NZ  1 
ATOM   1263  N N   . ALA A 1 162 ? 24.894  -18.031 3.182   1.00 34.94  ? 162 ALA A N   1 
ATOM   1264  C CA  . ALA A 1 162 ? 25.130  -17.561 4.541   1.00 35.47  ? 162 ALA A CA  1 
ATOM   1265  C C   . ALA A 1 162 ? 26.493  -17.955 5.155   1.00 40.19  ? 162 ALA A C   1 
ATOM   1266  O O   . ALA A 1 162 ? 27.074  -19.004 4.839   1.00 39.13  ? 162 ALA A O   1 
ATOM   1267  C CB  . ALA A 1 162 ? 23.936  -17.929 5.470   1.00 36.00  ? 162 ALA A CB  1 
ATOM   1268  N N   . ARG A 1 163 ? 27.028  -17.048 5.966   1.00 37.09  ? 163 ARG A N   1 
ATOM   1269  C CA  . ARG A 1 163 ? 28.319  -17.237 6.629   1.00 36.44  ? 163 ARG A CA  1 
ATOM   1270  C C   . ARG A 1 163 ? 27.976  -17.780 8.000   1.00 35.49  ? 163 ARG A C   1 
ATOM   1271  O O   . ARG A 1 163 ? 28.734  -18.534 8.593   1.00 35.28  ? 163 ARG A O   1 
ATOM   1272  C CB  . ARG A 1 163 ? 29.042  -15.888 6.811   1.00 40.25  ? 163 ARG A CB  1 
ATOM   1273  C CG  . ARG A 1 163 ? 29.553  -15.248 5.531   1.00 55.81  ? 163 ARG A CG  1 
ATOM   1274  C CD  . ARG A 1 163 ? 30.712  -16.059 4.989   1.00 84.62  ? 163 ARG A CD  1 
ATOM   1275  N NE  . ARG A 1 163 ? 31.718  -15.225 4.340   1.00 106.64 ? 163 ARG A NE  1 
ATOM   1276  C CZ  . ARG A 1 163 ? 33.005  -15.202 4.676   1.00 123.68 ? 163 ARG A CZ  1 
ATOM   1277  N NH1 . ARG A 1 163 ? 33.847  -14.410 4.021   1.00 107.23 ? 163 ARG A NH1 1 
ATOM   1278  N NH2 . ARG A 1 163 ? 33.455  -15.953 5.676   1.00 112.84 ? 163 ARG A NH2 1 
ATOM   1279  N N   . VAL A 1 164 ? 26.827  -17.351 8.513   1.00 27.81  ? 164 VAL A N   1 
ATOM   1280  C CA  . VAL A 1 164 ? 26.371  -17.801 9.818   1.00 24.98  ? 164 VAL A CA  1 
ATOM   1281  C C   . VAL A 1 164 ? 24.998  -18.400 9.698   1.00 24.35  ? 164 VAL A C   1 
ATOM   1282  O O   . VAL A 1 164 ? 24.142  -17.823 9.048   1.00 22.26  ? 164 VAL A O   1 
ATOM   1283  C CB  . VAL A 1 164 ? 26.328  -16.656 10.886  1.00 26.58  ? 164 VAL A CB  1 
ATOM   1284  C CG1 . VAL A 1 164 ? 26.092  -17.226 12.230  1.00 25.61  ? 164 VAL A CG1 1 
ATOM   1285  C CG2 . VAL A 1 164 ? 27.596  -15.849 10.891  1.00 25.70  ? 164 VAL A CG2 1 
ATOM   1286  N N   . CYS A 1 165 ? 24.801  -19.544 10.347  1.00 21.22  ? 165 CYS A N   1 
ATOM   1287  C CA  . CYS A 1 165 ? 23.500  -20.192 10.412  1.00 21.78  ? 165 CYS A CA  1 
ATOM   1288  C C   . CYS A 1 165 ? 23.047  -20.281 11.885  1.00 25.51  ? 165 CYS A C   1 
ATOM   1289  O O   . CYS A 1 165 ? 23.860  -20.480 12.791  1.00 23.83  ? 165 CYS A O   1 
ATOM   1290  C CB  . CYS A 1 165 ? 23.580  -21.575 9.788   1.00 22.99  ? 165 CYS A CB  1 
ATOM   1291  S SG  . CYS A 1 165 ? 24.027  -21.551 8.014   1.00 27.74  ? 165 CYS A SG  1 
ATOM   1292  N N   . TYR A 1 166 ? 21.752  -20.115 12.130  1.00 21.18  ? 166 TYR A N   1 
ATOM   1293  C CA  . TYR A 1 166 ? 21.245  -20.219 13.486  1.00 19.68  ? 166 TYR A CA  1 
ATOM   1294  C C   . TYR A 1 166 ? 19.909  -20.894 13.462  1.00 23.73  ? 166 TYR A C   1 
ATOM   1295  O O   . TYR A 1 166 ? 19.026  -20.475 12.705  1.00 25.19  ? 166 TYR A O   1 
ATOM   1296  C CB  . TYR A 1 166 ? 21.077  -18.842 14.141  1.00 18.54  ? 166 TYR A CB  1 
ATOM   1297  C CG  . TYR A 1 166 ? 20.449  -18.914 15.516  1.00 14.56  ? 166 TYR A CG  1 
ATOM   1298  C CD1 . TYR A 1 166 ? 21.094  -19.557 16.562  1.00 15.14  ? 166 TYR A CD1 1 
ATOM   1299  C CD2 . TYR A 1 166 ? 19.201  -18.374 15.755  1.00 13.74  ? 166 TYR A CD2 1 
ATOM   1300  C CE1 . TYR A 1 166 ? 20.516  -19.623 17.813  1.00 14.53  ? 166 TYR A CE1 1 
ATOM   1301  C CE2 . TYR A 1 166 ? 18.621  -18.428 17.004  1.00 13.50  ? 166 TYR A CE2 1 
ATOM   1302  C CZ  . TYR A 1 166 ? 19.250  -19.103 18.014  1.00 20.47  ? 166 TYR A CZ  1 
ATOM   1303  O OH  . TYR A 1 166 ? 18.624  -19.206 19.252  1.00 22.41  ? 166 TYR A OH  1 
ATOM   1304  N N   . ILE A 1 167 ? 19.761  -21.889 14.340  1.00 17.69  ? 167 ILE A N   1 
ATOM   1305  C CA  . ILE A 1 167 ? 18.521  -22.625 14.530  1.00 14.73  ? 167 ILE A CA  1 
ATOM   1306  C C   . ILE A 1 167 ? 18.384  -22.861 16.043  1.00 19.29  ? 167 ILE A C   1 
ATOM   1307  O O   . ILE A 1 167 ? 19.290  -23.427 16.690  1.00 18.87  ? 167 ILE A O   1 
ATOM   1308  C CB  . ILE A 1 167 ? 18.556  -24.031 13.786  1.00 16.02  ? 167 ILE A CB  1 
ATOM   1309  C CG1 . ILE A 1 167 ? 18.738  -23.841 12.273  1.00 14.72  ? 167 ILE A CG1 1 
ATOM   1310  C CG2 . ILE A 1 167 ? 17.208  -24.805 13.989  1.00 15.19  ? 167 ILE A CG2 1 
ATOM   1311  C CD1 . ILE A 1 167 ? 19.248  -25.095 11.512  1.00 18.81  ? 167 ILE A CD1 1 
ATOM   1312  N N   . ALA A 1 168 ? 17.287  -22.365 16.604  1.00 14.23  ? 168 ALA A N   1 
ATOM   1313  C CA  . ALA A 1 168 ? 16.947  -22.625 17.980  1.00 13.03  ? 168 ALA A CA  1 
ATOM   1314  C C   . ALA A 1 168 ? 16.703  -24.121 18.106  1.00 16.64  ? 168 ALA A C   1 
ATOM   1315  O O   . ALA A 1 168 ? 16.171  -24.763 17.190  1.00 15.81  ? 168 ALA A O   1 
ATOM   1316  C CB  . ALA A 1 168 ? 15.692  -21.903 18.294  1.00 14.06  ? 168 ALA A CB  1 
ATOM   1317  N N   . GLY A 1 169 ? 17.028  -24.685 19.259  1.00 13.06  ? 169 GLY A N   1 
ATOM   1318  C CA  . GLY A 1 169 ? 16.884  -26.137 19.438  1.00 11.35  ? 169 GLY A CA  1 
ATOM   1319  C C   . GLY A 1 169 ? 15.427  -26.554 19.359  1.00 12.71  ? 169 GLY A C   1 
ATOM   1320  O O   . GLY A 1 169 ? 15.107  -27.750 19.200  1.00 10.03  ? 169 GLY A O   1 
ATOM   1321  N N   . PHE A 1 170 ? 14.540  -25.579 19.542  1.00 8.92   ? 170 PHE A N   1 
ATOM   1322  C CA  . PHE A 1 170 ? 13.105  -25.851 19.441  1.00 8.57   ? 170 PHE A CA  1 
ATOM   1323  C C   . PHE A 1 170 ? 12.765  -26.634 18.189  1.00 16.29  ? 170 PHE A C   1 
ATOM   1324  O O   . PHE A 1 170 ? 11.738  -27.276 18.139  1.00 19.33  ? 170 PHE A O   1 
ATOM   1325  C CB  . PHE A 1 170 ? 12.291  -24.567 19.378  1.00 8.16   ? 170 PHE A CB  1 
ATOM   1326  C CG  . PHE A 1 170 ? 12.029  -23.940 20.722  1.00 6.59   ? 170 PHE A CG  1 
ATOM   1327  C CD1 . PHE A 1 170 ? 12.260  -22.567 20.909  1.00 5.08   ? 170 PHE A CD1 1 
ATOM   1328  C CD2 . PHE A 1 170 ? 11.478  -24.688 21.764  1.00 4.53   ? 170 PHE A CD2 1 
ATOM   1329  C CE1 . PHE A 1 170 ? 12.038  -21.971 22.126  1.00 4.31   ? 170 PHE A CE1 1 
ATOM   1330  C CE2 . PHE A 1 170 ? 11.280  -24.097 23.023  1.00 7.67   ? 170 PHE A CE2 1 
ATOM   1331  C CZ  . PHE A 1 170 ? 11.567  -22.738 23.206  1.00 4.33   ? 170 PHE A CZ  1 
ATOM   1332  N N   . PHE A 1 171 ? 13.580  -26.512 17.153  1.00 12.93  ? 171 PHE A N   1 
ATOM   1333  C CA  . PHE A 1 171 ? 13.229  -27.091 15.857  1.00 12.27  ? 171 PHE A CA  1 
ATOM   1334  C C   . PHE A 1 171 ? 13.581  -28.550 15.801  1.00 17.09  ? 171 PHE A C   1 
ATOM   1335  O O   . PHE A 1 171 ? 13.078  -29.281 14.961  1.00 19.99  ? 171 PHE A O   1 
ATOM   1336  C CB  . PHE A 1 171 ? 13.904  -26.305 14.750  1.00 13.86  ? 171 PHE A CB  1 
ATOM   1337  C CG  . PHE A 1 171 ? 13.343  -26.545 13.397  1.00 16.33  ? 171 PHE A CG  1 
ATOM   1338  C CD1 . PHE A 1 171 ? 12.024  -26.247 13.127  1.00 18.85  ? 171 PHE A CD1 1 
ATOM   1339  C CD2 . PHE A 1 171 ? 14.155  -27.009 12.360  1.00 19.54  ? 171 PHE A CD2 1 
ATOM   1340  C CE1 . PHE A 1 171 ? 11.498  -26.480 11.892  1.00 18.32  ? 171 PHE A CE1 1 
ATOM   1341  C CE2 . PHE A 1 171 ? 13.631  -27.225 11.111  1.00 21.89  ? 171 PHE A CE2 1 
ATOM   1342  C CZ  . PHE A 1 171 ? 12.287  -26.968 10.886  1.00 18.81  ? 171 PHE A CZ  1 
ATOM   1343  N N   . LEU A 1 172 ? 14.396  -28.988 16.744  1.00 12.92  ? 172 LEU A N   1 
ATOM   1344  C CA  . LEU A 1 172 ? 14.810  -30.400 16.817  1.00 12.48  ? 172 LEU A CA  1 
ATOM   1345  C C   . LEU A 1 172 ? 13.594  -31.282 17.025  1.00 14.63  ? 172 LEU A C   1 
ATOM   1346  O O   . LEU A 1 172 ? 13.643  -32.470 16.745  1.00 13.86  ? 172 LEU A O   1 
ATOM   1347  C CB  . LEU A 1 172 ? 15.817  -30.661 17.959  1.00 11.80  ? 172 LEU A CB  1 
ATOM   1348  C CG  . LEU A 1 172 ? 17.219  -30.090 17.718  1.00 14.58  ? 172 LEU A CG  1 
ATOM   1349  C CD1 . LEU A 1 172 ? 18.092  -30.154 18.983  1.00 13.97  ? 172 LEU A CD1 1 
ATOM   1350  C CD2 . LEU A 1 172 ? 17.835  -30.849 16.603  1.00 11.89  ? 172 LEU A CD2 1 
ATOM   1351  N N   . THR A 1 173 ? 12.516  -30.724 17.560  1.00 10.89  ? 173 THR A N   1 
ATOM   1352  C CA  . THR A 1 173 ? 11.345  -31.561 17.806  1.00 10.22  ? 173 THR A CA  1 
ATOM   1353  C C   . THR A 1 173 ? 10.593  -31.697 16.515  1.00 14.32  ? 173 THR A C   1 
ATOM   1354  O O   . THR A 1 173 ? 9.665   -32.464 16.427  1.00 13.32  ? 173 THR A O   1 
ATOM   1355  C CB  . THR A 1 173 ? 10.383  -30.997 18.908  1.00 14.03  ? 173 THR A CB  1 
ATOM   1356  O OG1 . THR A 1 173 ? 9.579   -29.952 18.371  1.00 9.49   ? 173 THR A OG1 1 
ATOM   1357  C CG2 . THR A 1 173 ? 11.116  -30.507 20.140  1.00 6.33   ? 173 THR A CG2 1 
ATOM   1358  N N   . VAL A 1 174 ? 11.008  -30.946 15.498  1.00 14.50  ? 174 VAL A N   1 
ATOM   1359  C CA  . VAL A 1 174 ? 10.270  -30.926 14.231  1.00 14.14  ? 174 VAL A CA  1 
ATOM   1360  C C   . VAL A 1 174 ? 11.016  -31.633 13.126  1.00 19.88  ? 174 VAL A C   1 
ATOM   1361  O O   . VAL A 1 174 ? 10.475  -32.566 12.528  1.00 21.70  ? 174 VAL A O   1 
ATOM   1362  C CB  . VAL A 1 174 ? 9.891   -29.483 13.747  1.00 14.80  ? 174 VAL A CB  1 
ATOM   1363  C CG1 . VAL A 1 174 ? 9.365   -29.522 12.309  1.00 14.44  ? 174 VAL A CG1 1 
ATOM   1364  C CG2 . VAL A 1 174 ? 8.923   -28.840 14.663  1.00 12.71  ? 174 VAL A CG2 1 
ATOM   1365  N N   . SER A 1 175 ? 12.247  -31.198 12.867  1.00 14.91  ? 175 SER A N   1 
ATOM   1366  C CA  . SER A 1 175 ? 13.048  -31.771 11.807  1.00 13.19  ? 175 SER A CA  1 
ATOM   1367  C C   . SER A 1 175 ? 14.543  -31.797 12.157  1.00 20.78  ? 175 SER A C   1 
ATOM   1368  O O   . SER A 1 175 ? 15.316  -31.035 11.602  1.00 20.33  ? 175 SER A O   1 
ATOM   1369  C CB  . SER A 1 175 ? 12.854  -30.933 10.539  1.00 13.40  ? 175 SER A CB  1 
ATOM   1370  O OG  . SER A 1 175 ? 13.104  -31.655 9.358   1.00 15.55  ? 175 SER A OG  1 
ATOM   1371  N N   . PRO A 1 176 ? 14.983  -32.812 12.893  1.00 19.91  ? 176 PRO A N   1 
ATOM   1372  C CA  . PRO A 1 176 ? 16.427  -33.010 13.127  1.00 20.03  ? 176 PRO A CA  1 
ATOM   1373  C C   . PRO A 1 176 ? 17.207  -33.211 11.795  1.00 24.58  ? 176 PRO A C   1 
ATOM   1374  O O   . PRO A 1 176 ? 18.427  -32.903 11.694  1.00 22.56  ? 176 PRO A O   1 
ATOM   1375  C CB  . PRO A 1 176 ? 16.492  -34.296 13.959  1.00 20.99  ? 176 PRO A CB  1 
ATOM   1376  C CG  . PRO A 1 176 ? 15.120  -34.460 14.515  1.00 25.25  ? 176 PRO A CG  1 
ATOM   1377  C CD  . PRO A 1 176 ? 14.142  -33.771 13.627  1.00 19.78  ? 176 PRO A CD  1 
ATOM   1378  N N   . GLU A 1 177 ? 16.515  -33.779 10.801  1.00 20.07  ? 177 GLU A N   1 
ATOM   1379  C CA  . GLU A 1 177 ? 17.101  -34.046 9.477   1.00 19.13  ? 177 GLU A CA  1 
ATOM   1380  C C   . GLU A 1 177 ? 17.496  -32.749 8.769   1.00 23.47  ? 177 GLU A C   1 
ATOM   1381  O O   . GLU A 1 177 ? 18.603  -32.611 8.253   1.00 20.76  ? 177 GLU A O   1 
ATOM   1382  C CB  . GLU A 1 177 ? 16.104  -34.821 8.622   1.00 19.55  ? 177 GLU A CB  1 
ATOM   1383  C CG  . GLU A 1 177 ? 15.781  -36.162 9.167   1.00 18.02  ? 177 GLU A CG  1 
ATOM   1384  C CD  . GLU A 1 177 ? 14.804  -36.085 10.329  1.00 48.12  ? 177 GLU A CD  1 
ATOM   1385  O OE1 . GLU A 1 177 ? 13.830  -35.295 10.259  1.00 23.37  ? 177 GLU A OE1 1 
ATOM   1386  O OE2 . GLU A 1 177 ? 15.019  -36.814 11.325  1.00 53.49  ? 177 GLU A OE2 1 
ATOM   1387  N N   . SER A 1 178 ? 16.594  -31.773 8.829   1.00 21.74  ? 178 SER A N   1 
ATOM   1388  C CA  . SER A 1 178 ? 16.850  -30.441 8.288   1.00 20.06  ? 178 SER A CA  1 
ATOM   1389  C C   . SER A 1 178 ? 18.005  -29.758 9.016   1.00 22.39  ? 178 SER A C   1 
ATOM   1390  O O   . SER A 1 178 ? 18.836  -29.128 8.390   1.00 23.97  ? 178 SER A O   1 
ATOM   1391  C CB  . SER A 1 178 ? 15.597  -29.595 8.485   1.00 19.38  ? 178 SER A CB  1 
ATOM   1392  O OG  . SER A 1 178 ? 14.566  -30.029 7.656   1.00 6.32   ? 178 SER A OG  1 
ATOM   1393  N N   . VAL A 1 179 ? 18.015  -29.808 10.344  1.00 17.07  ? 179 VAL A N   1 
ATOM   1394  C CA  . VAL A 1 179 ? 19.095  -29.179 11.086  1.00 16.93  ? 179 VAL A CA  1 
ATOM   1395  C C   . VAL A 1 179 ? 20.428  -29.820 10.748  1.00 25.80  ? 179 VAL A C   1 
ATOM   1396  O O   . VAL A 1 179 ? 21.365  -29.126 10.339  1.00 29.20  ? 179 VAL A O   1 
ATOM   1397  C CB  . VAL A 1 179 ? 18.832  -29.210 12.593  1.00 18.46  ? 179 VAL A CB  1 
ATOM   1398  C CG1 . VAL A 1 179 ? 19.986  -28.501 13.362  1.00 15.87  ? 179 VAL A CG1 1 
ATOM   1399  C CG2 . VAL A 1 179 ? 17.429  -28.609 12.870  1.00 16.81  ? 179 VAL A CG2 1 
ATOM   1400  N N   . LEU A 1 180 ? 20.485  -31.152 10.793  1.00 21.89  ? 180 LEU A N   1 
ATOM   1401  C CA  . LEU A 1 180 ? 21.733  -31.845 10.471  1.00 21.52  ? 180 LEU A CA  1 
ATOM   1402  C C   . LEU A 1 180 ? 22.285  -31.466 9.138   1.00 23.48  ? 180 LEU A C   1 
ATOM   1403  O O   . LEU A 1 180 ? 23.466  -31.130 9.039   1.00 27.08  ? 180 LEU A O   1 
ATOM   1404  C CB  . LEU A 1 180 ? 21.620  -33.346 10.555  1.00 22.51  ? 180 LEU A CB  1 
ATOM   1405  C CG  . LEU A 1 180 ? 22.026  -33.962 11.902  1.00 29.87  ? 180 LEU A CG  1 
ATOM   1406  C CD1 . LEU A 1 180 ? 21.587  -35.477 11.960  1.00 31.89  ? 180 LEU A CD1 1 
ATOM   1407  C CD2 . LEU A 1 180 ? 23.542  -33.807 12.165  1.00 29.66  ? 180 LEU A CD2 1 
ATOM   1408  N N   . LYS A 1 181 ? 21.452  -31.515 8.110   1.00 15.80  ? 181 LYS A N   1 
ATOM   1409  C CA  . LYS A 1 181 ? 21.861  -31.116 6.754   1.00 14.95  ? 181 LYS A CA  1 
ATOM   1410  C C   . LYS A 1 181 ? 22.519  -29.728 6.809   1.00 23.54  ? 181 LYS A C   1 
ATOM   1411  O O   . LYS A 1 181 ? 23.640  -29.512 6.266   1.00 22.39  ? 181 LYS A O   1 
ATOM   1412  C CB  . LYS A 1 181 ? 20.624  -31.033 5.843   1.00 15.71  ? 181 LYS A CB  1 
ATOM   1413  C CG  . LYS A 1 181 ? 20.888  -31.080 4.345   1.00 14.30  ? 181 LYS A CG  1 
ATOM   1414  C CD  . LYS A 1 181 ? 19.804  -30.272 3.594   1.00 23.89  ? 181 LYS A CD  1 
ATOM   1415  C CE  . LYS A 1 181 ? 20.071  -30.109 2.080   1.00 16.93  ? 181 LYS A CE  1 
ATOM   1416  N NZ  . LYS A 1 181 ? 20.191  -31.412 1.398   1.00 28.27  ? 181 LYS A NZ  1 
ATOM   1417  N N   . VAL A 1 182 ? 21.835  -28.780 7.466   1.00 19.86  ? 182 VAL A N   1 
ATOM   1418  C CA  . VAL A 1 182 ? 22.406  -27.445 7.573   1.00 19.65  ? 182 VAL A CA  1 
ATOM   1419  C C   . VAL A 1 182 ? 23.692  -27.497 8.367   1.00 26.02  ? 182 VAL A C   1 
ATOM   1420  O O   . VAL A 1 182 ? 24.739  -27.057 7.893   1.00 25.74  ? 182 VAL A O   1 
ATOM   1421  C CB  . VAL A 1 182 ? 21.420  -26.417 8.115   1.00 21.45  ? 182 VAL A CB  1 
ATOM   1422  C CG1 . VAL A 1 182 ? 21.897  -25.031 7.860   1.00 19.99  ? 182 VAL A CG1 1 
ATOM   1423  C CG2 . VAL A 1 182 ? 20.055  -26.623 7.473   1.00 21.50  ? 182 VAL A CG2 1 
ATOM   1424  N N   . ALA A 1 183 ? 23.648  -28.178 9.504   1.00 24.48  ? 183 ALA A N   1 
ATOM   1425  C CA  . ALA A 1 183 ? 24.843  -28.297 10.341  1.00 25.96  ? 183 ALA A CA  1 
ATOM   1426  C C   . ALA A 1 183 ? 26.017  -28.912 9.588   1.00 29.97  ? 183 ALA A C   1 
ATOM   1427  O O   . ALA A 1 183 ? 27.096  -28.346 9.540   1.00 27.75  ? 183 ALA A O   1 
ATOM   1428  C CB  . ALA A 1 183 ? 24.539  -29.077 11.630  1.00 27.04  ? 183 ALA A CB  1 
ATOM   1429  N N   . HIS A 1 184 ? 25.784  -30.059 8.970   1.00 30.89  ? 184 HIS A N   1 
ATOM   1430  C CA  . HIS A 1 184 ? 26.828  -30.726 8.217   1.00 33.89  ? 184 HIS A CA  1 
ATOM   1431  C C   . HIS A 1 184 ? 27.447  -29.878 7.097   1.00 36.42  ? 184 HIS A C   1 
ATOM   1432  O O   . HIS A 1 184 ? 28.648  -29.943 6.849   1.00 38.12  ? 184 HIS A O   1 
ATOM   1433  C CB  . HIS A 1 184 ? 26.318  -32.043 7.665   1.00 38.16  ? 184 HIS A CB  1 
ATOM   1434  C CG  . HIS A 1 184 ? 27.403  -32.918 7.122   1.00 44.97  ? 184 HIS A CG  1 
ATOM   1435  N ND1 . HIS A 1 184 ? 28.121  -32.599 5.984   1.00 48.81  ? 184 HIS A ND1 1 
ATOM   1436  C CD2 . HIS A 1 184 ? 27.953  -34.067 7.598   1.00 48.26  ? 184 HIS A CD2 1 
ATOM   1437  C CE1 . HIS A 1 184 ? 29.019  -33.542 5.746   1.00 48.71  ? 184 HIS A CE1 1 
ATOM   1438  N NE2 . HIS A 1 184 ? 28.935  -34.444 6.711   1.00 48.97  ? 184 HIS A NE2 1 
ATOM   1439  N N   . HIS A 1 185 ? 26.621  -29.072 6.435   1.00 31.43  ? 185 HIS A N   1 
ATOM   1440  C CA  . HIS A 1 185 ? 27.041  -28.127 5.387   1.00 28.88  ? 185 HIS A CA  1 
ATOM   1441  C C   . HIS A 1 185 ? 27.963  -27.017 5.924   1.00 31.62  ? 185 HIS A C   1 
ATOM   1442  O O   . HIS A 1 185 ? 28.924  -26.601 5.255   1.00 29.47  ? 185 HIS A O   1 
ATOM   1443  C CB  . HIS A 1 185 ? 25.784  -27.457 4.746   1.00 28.71  ? 185 HIS A CB  1 
ATOM   1444  C CG  . HIS A 1 185 ? 26.125  -26.381 3.768   1.00 32.28  ? 185 HIS A CG  1 
ATOM   1445  N ND1 . HIS A 1 185 ? 26.519  -26.670 2.476   1.00 34.78  ? 185 HIS A ND1 1 
ATOM   1446  C CD2 . HIS A 1 185 ? 26.337  -25.048 3.932   1.00 33.35  ? 185 HIS A CD2 1 
ATOM   1447  C CE1 . HIS A 1 185 ? 26.853  -25.549 1.858   1.00 33.68  ? 185 HIS A CE1 1 
ATOM   1448  N NE2 . HIS A 1 185 ? 26.757  -24.550 2.723   1.00 33.32  ? 185 HIS A NE2 1 
ATOM   1449  N N   . ALA A 1 186 ? 27.627  -26.478 7.102   1.00 29.48  ? 186 ALA A N   1 
ATOM   1450  C CA  . ALA A 1 186 ? 28.486  -25.451 7.723   1.00 28.85  ? 186 ALA A CA  1 
ATOM   1451  C C   . ALA A 1 186 ? 29.899  -26.051 7.942   1.00 29.10  ? 186 ALA A C   1 
ATOM   1452  O O   . ALA A 1 186 ? 30.919  -25.414 7.667   1.00 25.08  ? 186 ALA A O   1 
ATOM   1453  C CB  . ALA A 1 186 ? 27.887  -24.972 9.054   1.00 28.92  ? 186 ALA A CB  1 
ATOM   1454  N N   . SER A 1 187 ? 29.919  -27.294 8.422   1.00 26.74  ? 187 SER A N   1 
ATOM   1455  C CA  . SER A 1 187 ? 31.148  -28.005 8.749   1.00 27.55  ? 187 SER A CA  1 
ATOM   1456  C C   . SER A 1 187 ? 32.023  -28.163 7.505   1.00 35.02  ? 187 SER A C   1 
ATOM   1457  O O   . SER A 1 187 ? 33.195  -27.728 7.472   1.00 34.40  ? 187 SER A O   1 
ATOM   1458  C CB  . SER A 1 187 ? 30.814  -29.382 9.330   1.00 30.17  ? 187 SER A CB  1 
ATOM   1459  O OG  . SER A 1 187 ? 31.600  -29.671 10.474  1.00 42.15  ? 187 SER A OG  1 
ATOM   1460  N N   . GLU A 1 188 ? 31.447  -28.795 6.487   1.00 31.05  ? 188 GLU A N   1 
ATOM   1461  C CA  . GLU A 1 188 ? 32.171  -29.036 5.256   1.00 30.86  ? 188 GLU A CA  1 
ATOM   1462  C C   . GLU A 1 188 ? 32.683  -27.766 4.577   1.00 35.23  ? 188 GLU A C   1 
ATOM   1463  O O   . GLU A 1 188 ? 33.634  -27.816 3.824   1.00 35.86  ? 188 GLU A O   1 
ATOM   1464  C CB  . GLU A 1 188 ? 31.315  -29.847 4.288   1.00 32.20  ? 188 GLU A CB  1 
ATOM   1465  C CG  . GLU A 1 188 ? 31.268  -31.332 4.606   1.00 47.88  ? 188 GLU A CG  1 
ATOM   1466  C CD  . GLU A 1 188 ? 30.722  -32.185 3.444   1.00 86.48  ? 188 GLU A CD  1 
ATOM   1467  O OE1 . GLU A 1 188 ? 29.779  -31.756 2.714   1.00 49.78  ? 188 GLU A OE1 1 
ATOM   1468  O OE2 . GLU A 1 188 ? 31.188  -33.340 3.315   1.00 102.42 ? 188 GLU A OE2 1 
ATOM   1469  N N   . ASN A 1 189 ? 32.017  -26.641 4.783   1.00 31.44  ? 189 ASN A N   1 
ATOM   1470  C CA  . ASN A 1 189 ? 32.450  -25.414 4.146   1.00 31.18  ? 189 ASN A CA  1 
ATOM   1471  C C   . ASN A 1 189 ? 32.950  -24.376 5.164   1.00 35.68  ? 189 ASN A C   1 
ATOM   1472  O O   . ASN A 1 189 ? 32.933  -23.173 4.882   1.00 33.73  ? 189 ASN A O   1 
ATOM   1473  C CB  . ASN A 1 189 ? 31.298  -24.812 3.334   1.00 31.67  ? 189 ASN A CB  1 
ATOM   1474  C CG  . ASN A 1 189 ? 30.759  -25.759 2.310   1.00 42.78  ? 189 ASN A CG  1 
ATOM   1475  O OD1 . ASN A 1 189 ? 31.484  -26.244 1.443   1.00 49.37  ? 189 ASN A OD1 1 
ATOM   1476  N ND2 . ASN A 1 189 ? 29.476  -26.045 2.416   1.00 24.44  ? 189 ASN A ND2 1 
ATOM   1477  N N   . ASN A 1 190 ? 33.331  -24.833 6.356   1.00 33.03  ? 190 ASN A N   1 
ATOM   1478  C CA  . ASN A 1 190 ? 33.809  -23.935 7.390   1.00 33.04  ? 190 ASN A CA  1 
ATOM   1479  C C   . ASN A 1 190 ? 32.943  -22.686 7.580   1.00 38.36  ? 190 ASN A C   1 
ATOM   1480  O O   . ASN A 1 190 ? 33.449  -21.550 7.582   1.00 37.97  ? 190 ASN A O   1 
ATOM   1481  C CB  . ASN A 1 190 ? 35.253  -23.535 7.111   1.00 33.09  ? 190 ASN A CB  1 
ATOM   1482  C CG  . ASN A 1 190 ? 35.992  -23.088 8.368   1.00 64.29  ? 190 ASN A CG  1 
ATOM   1483  O OD1 . ASN A 1 190 ? 35.836  -23.680 9.440   1.00 64.67  ? 190 ASN A OD1 1 
ATOM   1484  N ND2 . ASN A 1 190 ? 36.830  -22.058 8.233   1.00 51.66  ? 190 ASN A ND2 1 
ATOM   1485  N N   . ARG A 1 191 ? 31.640  -22.902 7.742   1.00 34.65  ? 191 ARG A N   1 
ATOM   1486  C CA  . ARG A 1 191 ? 30.694  -21.821 8.010   1.00 33.19  ? 191 ARG A CA  1 
ATOM   1487  C C   . ARG A 1 191 ? 30.331  -21.899 9.483   1.00 32.56  ? 191 ARG A C   1 
ATOM   1488  O O   . ARG A 1 191 ? 30.476  -22.932 10.114  1.00 33.06  ? 191 ARG A O   1 
ATOM   1489  C CB  . ARG A 1 191 ? 29.418  -22.025 7.183   1.00 36.11  ? 191 ARG A CB  1 
ATOM   1490  C CG  . ARG A 1 191 ? 29.462  -21.370 5.833   1.00 48.69  ? 191 ARG A CG  1 
ATOM   1491  C CD  . ARG A 1 191 ? 30.413  -22.106 4.912   1.00 56.60  ? 191 ARG A CD  1 
ATOM   1492  N NE  . ARG A 1 191 ? 29.977  -21.956 3.535   1.00 68.96  ? 191 ARG A NE  1 
ATOM   1493  C CZ  . ARG A 1 191 ? 30.007  -20.802 2.881   1.00 86.89  ? 191 ARG A CZ  1 
ATOM   1494  N NH1 . ARG A 1 191 ? 30.518  -19.723 3.470   1.00 73.22  ? 191 ARG A NH1 1 
ATOM   1495  N NH2 . ARG A 1 191 ? 29.544  -20.720 1.639   1.00 76.23  ? 191 ARG A NH2 1 
ATOM   1496  N N   . ILE A 1 192 ? 29.796  -20.830 10.031  1.00 26.50  ? 192 ILE A N   1 
ATOM   1497  C CA  . ILE A 1 192 ? 29.465  -20.871 11.428  1.00 25.85  ? 192 ILE A CA  1 
ATOM   1498  C C   . ILE A 1 192 ? 28.074  -21.485 11.696  1.00 28.70  ? 192 ILE A C   1 
ATOM   1499  O O   . ILE A 1 192 ? 27.071  -21.038 11.145  1.00 31.02  ? 192 ILE A O   1 
ATOM   1500  C CB  . ILE A 1 192 ? 29.718  -19.502 12.110  1.00 28.08  ? 192 ILE A CB  1 
ATOM   1501  C CG1 . ILE A 1 192 ? 31.175  -19.067 11.880  1.00 26.90  ? 192 ILE A CG1 1 
ATOM   1502  C CG2 . ILE A 1 192 ? 29.363  -19.573 13.606  1.00 28.39  ? 192 ILE A CG2 1 
ATOM   1503  C CD1 . ILE A 1 192 ? 31.392  -17.546 11.953  1.00 27.46  ? 192 ILE A CD1 1 
ATOM   1504  N N   . PHE A 1 193 ? 28.026  -22.548 12.492  1.00 20.04  ? 193 PHE A N   1 
ATOM   1505  C CA  . PHE A 1 193 ? 26.768  -23.184 12.858  1.00 18.28  ? 193 PHE A CA  1 
ATOM   1506  C C   . PHE A 1 193 ? 26.422  -22.967 14.329  1.00 23.86  ? 193 PHE A C   1 
ATOM   1507  O O   . PHE A 1 193 ? 27.099  -23.497 15.236  1.00 24.72  ? 193 PHE A O   1 
ATOM   1508  C CB  . PHE A 1 193 ? 26.757  -24.694 12.536  1.00 18.96  ? 193 PHE A CB  1 
ATOM   1509  C CG  . PHE A 1 193 ? 25.399  -25.302 12.652  1.00 19.65  ? 193 PHE A CG  1 
ATOM   1510  C CD1 . PHE A 1 193 ? 24.405  -25.021 11.685  1.00 22.77  ? 193 PHE A CD1 1 
ATOM   1511  C CD2 . PHE A 1 193 ? 25.020  -25.938 13.836  1.00 23.09  ? 193 PHE A CD2 1 
ATOM   1512  C CE1 . PHE A 1 193 ? 23.044  -25.422 11.872  1.00 23.54  ? 193 PHE A CE1 1 
ATOM   1513  C CE2 . PHE A 1 193 ? 23.668  -26.363 14.034  1.00 26.24  ? 193 PHE A CE2 1 
ATOM   1514  C CZ  . PHE A 1 193 ? 22.683  -26.120 13.024  1.00 23.34  ? 193 PHE A CZ  1 
ATOM   1515  N N   . THR A 1 194 ? 25.336  -22.238 14.566  1.00 18.62  ? 194 THR A N   1 
ATOM   1516  C CA  . THR A 1 194 ? 24.931  -21.929 15.924  1.00 18.08  ? 194 THR A CA  1 
ATOM   1517  C C   . THR A 1 194 ? 23.560  -22.481 16.245  1.00 22.50  ? 194 THR A C   1 
ATOM   1518  O O   . THR A 1 194 ? 22.720  -22.619 15.351  1.00 22.84  ? 194 THR A O   1 
ATOM   1519  C CB  . THR A 1 194 ? 25.031  -20.401 16.226  1.00 27.80  ? 194 THR A CB  1 
ATOM   1520  O OG1 . THR A 1 194 ? 23.954  -19.710 15.577  1.00 30.09  ? 194 THR A OG1 1 
ATOM   1521  C CG2 . THR A 1 194 ? 26.382  -19.847 15.731  1.00 18.31  ? 194 THR A CG2 1 
ATOM   1522  N N   . LEU A 1 195 ? 23.356  -22.805 17.530  1.00 18.10  ? 195 LEU A N   1 
ATOM   1523  C CA  . LEU A 1 195 ? 22.126  -23.438 18.009  1.00 16.50  ? 195 LEU A CA  1 
ATOM   1524  C C   . LEU A 1 195 ? 21.772  -22.868 19.373  1.00 20.24  ? 195 LEU A C   1 
ATOM   1525  O O   . LEU A 1 195 ? 22.612  -22.314 20.061  1.00 17.61  ? 195 LEU A O   1 
ATOM   1526  C CB  . LEU A 1 195 ? 22.355  -24.964 18.155  1.00 15.98  ? 195 LEU A CB  1 
ATOM   1527  C CG  . LEU A 1 195 ? 21.171  -25.927 18.397  1.00 17.80  ? 195 LEU A CG  1 
ATOM   1528  C CD1 . LEU A 1 195 ? 20.481  -26.337 17.055  1.00 14.60  ? 195 LEU A CD1 1 
ATOM   1529  C CD2 . LEU A 1 195 ? 21.689  -27.159 19.191  1.00 17.43  ? 195 LEU A CD2 1 
ATOM   1530  N N   . ASN A 1 196 ? 20.543  -23.135 19.814  1.00 17.78  ? 196 ASN A N   1 
ATOM   1531  C CA  . ASN A 1 196 ? 20.111  -22.682 21.116  1.00 17.04  ? 196 ASN A CA  1 
ATOM   1532  C C   . ASN A 1 196 ? 19.640  -23.898 21.854  1.00 19.42  ? 196 ASN A C   1 
ATOM   1533  O O   . ASN A 1 196 ? 19.231  -24.847 21.237  1.00 18.82  ? 196 ASN A O   1 
ATOM   1534  C CB  . ASN A 1 196 ? 18.946  -21.719 20.969  1.00 19.00  ? 196 ASN A CB  1 
ATOM   1535  C CG  . ASN A 1 196 ? 18.953  -20.624 21.998  1.00 25.12  ? 196 ASN A CG  1 
ATOM   1536  O OD1 . ASN A 1 196 ? 18.897  -20.885 23.206  1.00 6.12   ? 196 ASN A OD1 1 
ATOM   1537  N ND2 . ASN A 1 196 ? 18.873  -19.370 21.511  1.00 20.71  ? 196 ASN A ND2 1 
ATOM   1538  N N   . LEU A 1 197 ? 19.754  -23.877 23.174  1.00 17.10  ? 197 LEU A N   1 
ATOM   1539  C CA  . LEU A 1 197 ? 19.288  -24.958 24.024  1.00 15.84  ? 197 LEU A CA  1 
ATOM   1540  C C   . LEU A 1 197 ? 17.797  -24.793 24.173  1.00 21.58  ? 197 LEU A C   1 
ATOM   1541  O O   . LEU A 1 197 ? 17.104  -25.725 24.597  1.00 23.76  ? 197 LEU A O   1 
ATOM   1542  C CB  . LEU A 1 197 ? 19.956  -24.899 25.402  1.00 13.95  ? 197 LEU A CB  1 
ATOM   1543  C CG  . LEU A 1 197 ? 21.403  -25.418 25.450  1.00 12.87  ? 197 LEU A CG  1 
ATOM   1544  C CD1 . LEU A 1 197 ? 21.941  -25.253 26.851  1.00 11.03  ? 197 LEU A CD1 1 
ATOM   1545  C CD2 . LEU A 1 197 ? 21.401  -26.887 25.041  1.00 10.63  ? 197 LEU A CD2 1 
ATOM   1546  N N   . SER A 1 198 ? 17.327  -23.599 23.829  1.00 15.73  ? 198 SER A N   1 
ATOM   1547  C CA  . SER A 1 198 ? 15.902  -23.266 23.772  1.00 13.77  ? 198 SER A CA  1 
ATOM   1548  C C   . SER A 1 198 ? 15.045  -23.367 25.014  1.00 13.24  ? 198 SER A C   1 
ATOM   1549  O O   . SER A 1 198 ? 14.255  -22.483 25.292  1.00 13.98  ? 198 SER A O   1 
ATOM   1550  C CB  . SER A 1 198 ? 15.227  -23.948 22.570  1.00 17.50  ? 198 SER A CB  1 
ATOM   1551  O OG  . SER A 1 198 ? 15.834  -23.563 21.338  1.00 23.87  ? 198 SER A OG  1 
ATOM   1552  N N   . ALA A 1 199 ? 15.109  -24.497 25.690  1.00 9.75   ? 199 ALA A N   1 
ATOM   1553  C CA  . ALA A 1 199 ? 14.200  -24.791 26.805  1.00 9.69   ? 199 ALA A CA  1 
ATOM   1554  C C   . ALA A 1 199 ? 14.648  -26.068 27.487  1.00 18.27  ? 199 ALA A C   1 
ATOM   1555  O O   . ALA A 1 199 ? 15.326  -26.869 26.879  1.00 22.75  ? 199 ALA A O   1 
ATOM   1556  C CB  . ALA A 1 199 ? 12.805  -25.001 26.275  1.00 9.21   ? 199 ALA A CB  1 
ATOM   1557  N N   . PRO A 1 200 ? 14.226  -26.297 28.730  1.00 13.64  ? 200 PRO A N   1 
ATOM   1558  C CA  . PRO A 1 200 ? 14.685  -27.487 29.432  1.00 11.53  ? 200 PRO A CA  1 
ATOM   1559  C C   . PRO A 1 200 ? 14.219  -28.771 28.804  1.00 17.80  ? 200 PRO A C   1 
ATOM   1560  O O   . PRO A 1 200 ? 14.945  -29.769 28.813  1.00 20.17  ? 200 PRO A O   1 
ATOM   1561  C CB  . PRO A 1 200 ? 14.121  -27.279 30.834  1.00 11.67  ? 200 PRO A CB  1 
ATOM   1562  C CG  . PRO A 1 200 ? 14.301  -25.820 31.045  1.00 13.98  ? 200 PRO A CG  1 
ATOM   1563  C CD  . PRO A 1 200 ? 13.871  -25.230 29.704  1.00 11.36  ? 200 PRO A CD  1 
ATOM   1564  N N   . PHE A 1 201 ? 13.025  -28.729 28.225  1.00 12.45  ? 201 PHE A N   1 
ATOM   1565  C CA  . PHE A 1 201 ? 12.423  -29.898 27.622  1.00 8.49   ? 201 PHE A CA  1 
ATOM   1566  C C   . PHE A 1 201 ? 13.229  -30.458 26.463  1.00 12.69  ? 201 PHE A C   1 
ATOM   1567  O O   . PHE A 1 201 ? 13.251  -31.689 26.226  1.00 10.93  ? 201 PHE A O   1 
ATOM   1568  C CB  . PHE A 1 201 ? 10.949  -29.667 27.340  1.00 7.66   ? 201 PHE A CB  1 
ATOM   1569  C CG  . PHE A 1 201 ? 10.651  -28.854 26.111  1.00 6.97   ? 201 PHE A CG  1 
ATOM   1570  C CD1 . PHE A 1 201 ? 10.700  -29.430 24.845  1.00 10.43  ? 201 PHE A CD1 1 
ATOM   1571  C CD2 . PHE A 1 201 ? 10.101  -27.600 26.227  1.00 8.24   ? 201 PHE A CD2 1 
ATOM   1572  C CE1 . PHE A 1 201 ? 10.312  -28.721 23.715  1.00 10.28  ? 201 PHE A CE1 1 
ATOM   1573  C CE2 . PHE A 1 201 ? 9.653   -26.896 25.090  1.00 10.67  ? 201 PHE A CE2 1 
ATOM   1574  C CZ  . PHE A 1 201 ? 9.733   -27.472 23.844  1.00 8.15   ? 201 PHE A CZ  1 
ATOM   1575  N N   . ILE A 1 202 ? 14.037  -29.579 25.865  1.00 10.20  ? 202 ILE A N   1 
ATOM   1576  C CA  . ILE A 1 202 ? 14.914  -29.990 24.772  1.00 12.92  ? 202 ILE A CA  1 
ATOM   1577  C C   . ILE A 1 202 ? 16.061  -30.934 25.189  1.00 18.40  ? 202 ILE A C   1 
ATOM   1578  O O   . ILE A 1 202 ? 16.388  -31.882 24.484  1.00 18.52  ? 202 ILE A O   1 
ATOM   1579  C CB  . ILE A 1 202 ? 15.433  -28.803 23.992  1.00 16.86  ? 202 ILE A CB  1 
ATOM   1580  C CG1 . ILE A 1 202 ? 14.235  -28.119 23.312  1.00 18.53  ? 202 ILE A CG1 1 
ATOM   1581  C CG2 . ILE A 1 202 ? 16.458  -29.282 22.942  1.00 15.59  ? 202 ILE A CG2 1 
ATOM   1582  C CD1 . ILE A 1 202 ? 13.630  -28.968 22.199  1.00 25.62  ? 202 ILE A CD1 1 
ATOM   1583  N N   . SER A 1 203 ? 16.614  -30.704 26.377  1.00 14.18  ? 203 SER A N   1 
ATOM   1584  C CA  . SER A 1 203 ? 17.626  -31.575 26.958  1.00 12.70  ? 203 SER A CA  1 
ATOM   1585  C C   . SER A 1 203 ? 17.011  -32.790 27.670  1.00 17.41  ? 203 SER A C   1 
ATOM   1586  O O   . SER A 1 203 ? 17.718  -33.737 28.016  1.00 17.88  ? 203 SER A O   1 
ATOM   1587  C CB  . SER A 1 203 ? 18.465  -30.811 27.981  1.00 11.99  ? 203 SER A CB  1 
ATOM   1588  O OG  . SER A 1 203 ? 19.169  -29.771 27.370  1.00 13.05  ? 203 SER A OG  1 
ATOM   1589  N N   . GLN A 1 204 ? 15.723  -32.738 27.962  1.00 13.80  ? 204 GLN A N   1 
ATOM   1590  C CA  . GLN A 1 204 ? 15.094  -33.820 28.697  1.00 14.46  ? 204 GLN A CA  1 
ATOM   1591  C C   . GLN A 1 204 ? 14.528  -34.912 27.768  1.00 17.28  ? 204 GLN A C   1 
ATOM   1592  O O   . GLN A 1 204 ? 14.757  -36.105 27.962  1.00 16.10  ? 204 GLN A O   1 
ATOM   1593  C CB  . GLN A 1 204 ? 13.983  -33.252 29.589  1.00 16.69  ? 204 GLN A CB  1 
ATOM   1594  C CG  . GLN A 1 204 ? 14.435  -32.091 30.469  1.00 32.61  ? 204 GLN A CG  1 
ATOM   1595  C CD  . GLN A 1 204 ? 13.352  -31.632 31.417  1.00 46.18  ? 204 GLN A CD  1 
ATOM   1596  O OE1 . GLN A 1 204 ? 12.476  -30.853 31.046  1.00 37.12  ? 204 GLN A OE1 1 
ATOM   1597  N NE2 . GLN A 1 204 ? 13.388  -32.130 32.634  1.00 47.41  ? 204 GLN A NE2 1 
ATOM   1598  N N   . PHE A 1 205 ? 13.806  -34.492 26.740  1.00 12.32  ? 205 PHE A N   1 
ATOM   1599  C CA  . PHE A 1 205 ? 13.156  -35.429 25.844  1.00 9.51   ? 205 PHE A CA  1 
ATOM   1600  C C   . PHE A 1 205 ? 13.694  -35.439 24.411  1.00 14.25  ? 205 PHE A C   1 
ATOM   1601  O O   . PHE A 1 205 ? 13.171  -36.185 23.586  1.00 11.94  ? 205 PHE A O   1 
ATOM   1602  C CB  . PHE A 1 205 ? 11.683  -35.102 25.849  1.00 9.94   ? 205 PHE A CB  1 
ATOM   1603  C CG  . PHE A 1 205 ? 11.145  -34.810 27.226  1.00 10.92  ? 205 PHE A CG  1 
ATOM   1604  C CD1 . PHE A 1 205 ? 11.254  -35.760 28.243  1.00 11.77  ? 205 PHE A CD1 1 
ATOM   1605  C CD2 . PHE A 1 205 ? 10.501  -33.609 27.509  1.00 11.45  ? 205 PHE A CD2 1 
ATOM   1606  C CE1 . PHE A 1 205 ? 10.765  -35.508 29.507  1.00 10.25  ? 205 PHE A CE1 1 
ATOM   1607  C CE2 . PHE A 1 205 ? 9.991   -33.374 28.771  1.00 12.32  ? 205 PHE A CE2 1 
ATOM   1608  C CZ  . PHE A 1 205 ? 10.128  -34.332 29.766  1.00 9.15   ? 205 PHE A CZ  1 
ATOM   1609  N N   . TYR A 1 206 ? 14.721  -34.633 24.112  1.00 14.38  ? 206 TYR A N   1 
ATOM   1610  C CA  . TYR A 1 206 ? 15.330  -34.624 22.775  1.00 15.49  ? 206 TYR A CA  1 
ATOM   1611  C C   . TYR A 1 206 ? 16.834  -34.741 22.691  1.00 21.64  ? 206 TYR A C   1 
ATOM   1612  O O   . TYR A 1 206 ? 17.405  -34.530 21.604  1.00 19.75  ? 206 TYR A O   1 
ATOM   1613  C CB  . TYR A 1 206 ? 14.871  -33.447 21.948  1.00 17.14  ? 206 TYR A CB  1 
ATOM   1614  C CG  . TYR A 1 206 ? 13.376  -33.324 21.885  1.00 22.03  ? 206 TYR A CG  1 
ATOM   1615  C CD1 . TYR A 1 206 ? 12.648  -32.914 23.013  1.00 25.31  ? 206 TYR A CD1 1 
ATOM   1616  C CD2 . TYR A 1 206 ? 12.679  -33.657 20.723  1.00 21.69  ? 206 TYR A CD2 1 
ATOM   1617  C CE1 . TYR A 1 206 ? 11.280  -32.811 22.968  1.00 26.04  ? 206 TYR A CE1 1 
ATOM   1618  C CE2 . TYR A 1 206 ? 11.315  -33.579 20.672  1.00 22.36  ? 206 TYR A CE2 1 
ATOM   1619  C CZ  . TYR A 1 206 ? 10.618  -33.145 21.798  1.00 31.16  ? 206 TYR A CZ  1 
ATOM   1620  O OH  . TYR A 1 206 ? 9.253   -33.002 21.766  1.00 26.26  ? 206 TYR A OH  1 
ATOM   1621  N N   . LYS A 1 207 ? 17.457  -35.138 23.796  1.00 22.27  ? 207 LYS A N   1 
ATOM   1622  C CA  . LYS A 1 207 ? 18.917  -35.291 23.853  1.00 24.32  ? 207 LYS A CA  1 
ATOM   1623  C C   . LYS A 1 207 ? 19.527  -36.014 22.640  1.00 25.76  ? 207 LYS A C   1 
ATOM   1624  O O   . LYS A 1 207 ? 20.619  -35.699 22.162  1.00 24.88  ? 207 LYS A O   1 
ATOM   1625  C CB  . LYS A 1 207 ? 19.331  -36.027 25.132  1.00 29.22  ? 207 LYS A CB  1 
ATOM   1626  C CG  . LYS A 1 207 ? 18.360  -35.968 26.293  1.00 41.26  ? 207 LYS A CG  1 
ATOM   1627  C CD  . LYS A 1 207 ? 19.016  -36.596 27.516  1.00 49.96  ? 207 LYS A CD  1 
ATOM   1628  C CE  . LYS A 1 207 ? 18.049  -37.454 28.333  1.00 60.36  ? 207 LYS A CE  1 
ATOM   1629  N NZ  . LYS A 1 207 ? 18.821  -38.384 29.211  1.00 66.93  ? 207 LYS A NZ  1 
ATOM   1630  N N   . GLU A 1 208 ? 18.818  -36.996 22.132  1.00 22.64  ? 208 GLU A N   1 
ATOM   1631  C CA  . GLU A 1 208 ? 19.344  -37.749 21.019  1.00 22.94  ? 208 GLU A CA  1 
ATOM   1632  C C   . GLU A 1 208 ? 19.586  -36.910 19.756  1.00 29.55  ? 208 GLU A C   1 
ATOM   1633  O O   . GLU A 1 208 ? 20.672  -36.946 19.158  1.00 33.11  ? 208 GLU A O   1 
ATOM   1634  C CB  . GLU A 1 208 ? 18.499  -38.978 20.777  1.00 24.21  ? 208 GLU A CB  1 
ATOM   1635  C CG  . GLU A 1 208 ? 19.213  -40.025 19.961  1.00 46.73  ? 208 GLU A CG  1 
ATOM   1636  C CD  . GLU A 1 208 ? 18.296  -41.125 19.471  1.00 78.24  ? 208 GLU A CD  1 
ATOM   1637  O OE1 . GLU A 1 208 ? 17.268  -41.391 20.128  1.00 93.65  ? 208 GLU A OE1 1 
ATOM   1638  O OE2 . GLU A 1 208 ? 18.620  -41.737 18.435  1.00 67.90  ? 208 GLU A OE2 1 
ATOM   1639  N N   . SER A 1 209 ? 18.581  -36.134 19.374  1.00 23.52  ? 209 SER A N   1 
ATOM   1640  C CA  . SER A 1 209 ? 18.684  -35.181 18.275  1.00 20.78  ? 209 SER A CA  1 
ATOM   1641  C C   . SER A 1 209 ? 19.661  -34.052 18.607  1.00 24.53  ? 209 SER A C   1 
ATOM   1642  O O   . SER A 1 209 ? 20.373  -33.589 17.734  1.00 26.46  ? 209 SER A O   1 
ATOM   1643  C CB  . SER A 1 209 ? 17.326  -34.545 18.077  1.00 22.68  ? 209 SER A CB  1 
ATOM   1644  O OG  . SER A 1 209 ? 16.721  -35.027 16.901  1.00 29.54  ? 209 SER A OG  1 
ATOM   1645  N N   . LEU A 1 210 ? 19.650  -33.568 19.852  1.00 19.21  ? 210 LEU A N   1 
ATOM   1646  C CA  . LEU A 1 210 ? 20.528  -32.466 20.284  1.00 17.10  ? 210 LEU A CA  1 
ATOM   1647  C C   . LEU A 1 210 ? 22.011  -32.856 20.295  1.00 21.72  ? 210 LEU A C   1 
ATOM   1648  O O   . LEU A 1 210 ? 22.909  -32.090 19.868  1.00 20.20  ? 210 LEU A O   1 
ATOM   1649  C CB  . LEU A 1 210 ? 20.127  -32.031 21.699  1.00 16.11  ? 210 LEU A CB  1 
ATOM   1650  C CG  . LEU A 1 210 ? 21.008  -30.963 22.367  1.00 18.59  ? 210 LEU A CG  1 
ATOM   1651  C CD1 . LEU A 1 210 ? 21.036  -29.737 21.490  1.00 16.78  ? 210 LEU A CD1 1 
ATOM   1652  C CD2 . LEU A 1 210 ? 20.432  -30.645 23.741  1.00 19.19  ? 210 LEU A CD2 1 
ATOM   1653  N N   . MET A 1 211 ? 22.262  -34.038 20.849  1.00 17.37  ? 211 MET A N   1 
ATOM   1654  C CA  . MET A 1 211 ? 23.622  -34.530 21.027  1.00 15.63  ? 211 MET A CA  1 
ATOM   1655  C C   . MET A 1 211 ? 24.232  -34.997 19.705  1.00 18.58  ? 211 MET A C   1 
ATOM   1656  O O   . MET A 1 211 ? 25.455  -34.921 19.495  1.00 17.96  ? 211 MET A O   1 
ATOM   1657  C CB  . MET A 1 211 ? 23.628  -35.635 22.092  1.00 16.51  ? 211 MET A CB  1 
ATOM   1658  C CG  . MET A 1 211 ? 23.423  -35.096 23.521  1.00 17.37  ? 211 MET A CG  1 
ATOM   1659  S SD  . MET A 1 211 ? 24.272  -33.528 23.688  1.00 20.19  ? 211 MET A SD  1 
ATOM   1660  C CE  . MET A 1 211 ? 26.021  -34.053 23.667  1.00 14.54  ? 211 MET A CE  1 
ATOM   1661  N N   . LYS A 1 212 ? 23.356  -35.353 18.777  1.00 14.83  ? 212 LYS A N   1 
ATOM   1662  C CA  . LYS A 1 212 ? 23.754  -35.752 17.441  1.00 15.32  ? 212 LYS A CA  1 
ATOM   1663  C C   . LYS A 1 212 ? 24.097  -34.497 16.638  1.00 20.87  ? 212 LYS A C   1 
ATOM   1664  O O   . LYS A 1 212 ? 24.931  -34.523 15.721  1.00 21.31  ? 212 LYS A O   1 
ATOM   1665  C CB  . LYS A 1 212 ? 22.584  -36.484 16.790  1.00 18.42  ? 212 LYS A CB  1 
ATOM   1666  C CG  . LYS A 1 212 ? 22.933  -37.347 15.606  1.00 36.95  ? 212 LYS A CG  1 
ATOM   1667  C CD  . LYS A 1 212 ? 21.753  -38.268 15.283  1.00 54.12  ? 212 LYS A CD  1 
ATOM   1668  C CE  . LYS A 1 212 ? 21.856  -39.659 15.970  1.00 55.35  ? 212 LYS A CE  1 
ATOM   1669  N NZ  . LYS A 1 212 ? 20.520  -40.258 16.377  1.00 37.15  ? 212 LYS A NZ  1 
ATOM   1670  N N   . VAL A 1 213 ? 23.455  -33.389 16.996  1.00 14.69  ? 213 VAL A N   1 
ATOM   1671  C CA  . VAL A 1 213 ? 23.724  -32.130 16.336  1.00 13.07  ? 213 VAL A CA  1 
ATOM   1672  C C   . VAL A 1 213 ? 24.911  -31.357 16.939  1.00 13.64  ? 213 VAL A C   1 
ATOM   1673  O O   . VAL A 1 213 ? 25.523  -30.560 16.241  1.00 12.66  ? 213 VAL A O   1 
ATOM   1674  C CB  . VAL A 1 213 ? 22.469  -31.282 16.390  1.00 19.50  ? 213 VAL A CB  1 
ATOM   1675  C CG1 . VAL A 1 213 ? 22.786  -29.768 16.374  1.00 20.24  ? 213 VAL A CG1 1 
ATOM   1676  C CG2 . VAL A 1 213 ? 21.421  -31.741 15.343  1.00 19.12  ? 213 VAL A CG2 1 
ATOM   1677  N N   . MET A 1 214 ? 25.203  -31.576 18.232  1.00 8.22   ? 214 MET A N   1 
ATOM   1678  C CA  . MET A 1 214 ? 26.236  -30.863 19.006  1.00 6.68   ? 214 MET A CA  1 
ATOM   1679  C C   . MET A 1 214 ? 27.673  -30.852 18.491  1.00 13.91  ? 214 MET A C   1 
ATOM   1680  O O   . MET A 1 214 ? 28.496  -29.979 18.859  1.00 11.71  ? 214 MET A O   1 
ATOM   1681  C CB  . MET A 1 214 ? 26.267  -31.341 20.452  1.00 8.10   ? 214 MET A CB  1 
ATOM   1682  C CG  . MET A 1 214 ? 26.994  -30.429 21.414  1.00 10.97  ? 214 MET A CG  1 
ATOM   1683  S SD  . MET A 1 214 ? 26.016  -28.882 21.717  1.00 18.16  ? 214 MET A SD  1 
ATOM   1684  C CE  . MET A 1 214 ? 24.645  -29.408 22.909  1.00 11.22  ? 214 MET A CE  1 
ATOM   1685  N N   . PRO A 1 215 ? 28.036  -31.883 17.735  1.00 13.91  ? 215 PRO A N   1 
ATOM   1686  C CA  . PRO A 1 215 ? 29.413  -31.998 17.257  1.00 12.05  ? 215 PRO A CA  1 
ATOM   1687  C C   . PRO A 1 215 ? 29.638  -30.992 16.127  1.00 18.86  ? 215 PRO A C   1 
ATOM   1688  O O   . PRO A 1 215 ? 30.782  -30.723 15.724  1.00 16.76  ? 215 PRO A O   1 
ATOM   1689  C CB  . PRO A 1 215 ? 29.481  -33.424 16.752  1.00 13.17  ? 215 PRO A CB  1 
ATOM   1690  C CG  . PRO A 1 215 ? 28.550  -34.153 17.595  1.00 19.95  ? 215 PRO A CG  1 
ATOM   1691  C CD  . PRO A 1 215 ? 27.358  -33.192 17.716  1.00 16.43  ? 215 PRO A CD  1 
ATOM   1692  N N   . TYR A 1 216 ? 28.537  -30.363 15.704  1.00 19.31  ? 216 TYR A N   1 
ATOM   1693  C CA  . TYR A 1 216 ? 28.552  -29.379 14.614  1.00 18.80  ? 216 TYR A CA  1 
ATOM   1694  C C   . TYR A 1 216 ? 28.291  -27.982 15.096  1.00 21.80  ? 216 TYR A C   1 
ATOM   1695  O O   . TYR A 1 216 ? 28.405  -27.051 14.317  1.00 23.33  ? 216 TYR A O   1 
ATOM   1696  C CB  . TYR A 1 216 ? 27.541  -29.735 13.519  1.00 17.98  ? 216 TYR A CB  1 
ATOM   1697  C CG  . TYR A 1 216 ? 27.827  -31.073 12.889  1.00 17.55  ? 216 TYR A CG  1 
ATOM   1698  C CD1 . TYR A 1 216 ? 27.171  -32.213 13.308  1.00 18.52  ? 216 TYR A CD1 1 
ATOM   1699  C CD2 . TYR A 1 216 ? 28.806  -31.207 11.905  1.00 18.16  ? 216 TYR A CD2 1 
ATOM   1700  C CE1 . TYR A 1 216 ? 27.446  -33.442 12.740  1.00 19.19  ? 216 TYR A CE1 1 
ATOM   1701  C CE2 . TYR A 1 216 ? 29.069  -32.435 11.323  1.00 18.64  ? 216 TYR A CE2 1 
ATOM   1702  C CZ  . TYR A 1 216 ? 28.395  -33.558 11.739  1.00 21.71  ? 216 TYR A CZ  1 
ATOM   1703  O OH  . TYR A 1 216 ? 28.727  -34.819 11.228  1.00 20.03  ? 216 TYR A OH  1 
ATOM   1704  N N   . VAL A 1 217 ? 27.982  -27.842 16.383  1.00 16.89  ? 217 VAL A N   1 
ATOM   1705  C CA  . VAL A 1 217 ? 27.706  -26.538 16.974  1.00 17.07  ? 217 VAL A CA  1 
ATOM   1706  C C   . VAL A 1 217 ? 28.959  -25.719 17.279  1.00 20.89  ? 217 VAL A C   1 
ATOM   1707  O O   . VAL A 1 217 ? 29.739  -26.067 18.157  1.00 18.13  ? 217 VAL A O   1 
ATOM   1708  C CB  . VAL A 1 217 ? 26.773  -26.635 18.217  1.00 20.94  ? 217 VAL A CB  1 
ATOM   1709  C CG1 . VAL A 1 217 ? 26.693  -25.288 18.946  1.00 20.51  ? 217 VAL A CG1 1 
ATOM   1710  C CG2 . VAL A 1 217 ? 25.376  -27.043 17.767  1.00 20.61  ? 217 VAL A CG2 1 
ATOM   1711  N N   . ASP A 1 218 ? 29.115  -24.602 16.570  1.00 19.75  ? 218 ASP A N   1 
ATOM   1712  C CA  . ASP A 1 218 ? 30.273  -23.735 16.730  1.00 21.35  ? 218 ASP A CA  1 
ATOM   1713  C C   . ASP A 1 218 ? 30.065  -22.773 17.895  1.00 27.66  ? 218 ASP A C   1 
ATOM   1714  O O   . ASP A 1 218 ? 30.977  -22.481 18.677  1.00 29.28  ? 218 ASP A O   1 
ATOM   1715  C CB  . ASP A 1 218 ? 30.587  -22.997 15.405  1.00 23.45  ? 218 ASP A CB  1 
ATOM   1716  C CG  . ASP A 1 218 ? 31.061  -23.957 14.310  1.00 31.35  ? 218 ASP A CG  1 
ATOM   1717  O OD1 . ASP A 1 218 ? 31.878  -24.830 14.642  1.00 29.81  ? 218 ASP A OD1 1 
ATOM   1718  O OD2 . ASP A 1 218 ? 30.479  -24.011 13.198  1.00 43.20  ? 218 ASP A OD2 1 
ATOM   1719  N N   . ILE A 1 219 ? 28.848  -22.282 18.018  1.00 22.80  ? 219 ILE A N   1 
ATOM   1720  C CA  . ILE A 1 219 ? 28.502  -21.444 19.157  1.00 21.41  ? 219 ILE A CA  1 
ATOM   1721  C C   . ILE A 1 219 ? 27.190  -21.979 19.750  1.00 25.23  ? 219 ILE A C   1 
ATOM   1722  O O   . ILE A 1 219 ? 26.165  -22.074 19.038  1.00 25.26  ? 219 ILE A O   1 
ATOM   1723  C CB  . ILE A 1 219 ? 28.239  -19.989 18.775  1.00 24.14  ? 219 ILE A CB  1 
ATOM   1724  C CG1 . ILE A 1 219 ? 29.471  -19.344 18.148  1.00 25.25  ? 219 ILE A CG1 1 
ATOM   1725  C CG2 . ILE A 1 219 ? 27.892  -19.204 20.040  1.00 25.43  ? 219 ILE A CG2 1 
ATOM   1726  C CD1 . ILE A 1 219 ? 29.466  -17.770 18.226  1.00 25.76  ? 219 ILE A CD1 1 
ATOM   1727  N N   . LEU A 1 220 ? 27.209  -22.305 21.046  1.00 17.42  ? 220 LEU A N   1 
ATOM   1728  C CA  . LEU A 1 220 ? 25.993  -22.742 21.735  1.00 15.14  ? 220 LEU A CA  1 
ATOM   1729  C C   . LEU A 1 220 ? 25.451  -21.554 22.583  1.00 20.51  ? 220 LEU A C   1 
ATOM   1730  O O   . LEU A 1 220 ? 26.207  -20.740 23.081  1.00 20.29  ? 220 LEU A O   1 
ATOM   1731  C CB  . LEU A 1 220 ? 26.219  -24.025 22.579  1.00 13.06  ? 220 LEU A CB  1 
ATOM   1732  C CG  . LEU A 1 220 ? 24.998  -24.784 23.152  1.00 13.76  ? 220 LEU A CG  1 
ATOM   1733  C CD1 . LEU A 1 220 ? 24.113  -25.464 22.090  1.00 13.97  ? 220 LEU A CD1 1 
ATOM   1734  C CD2 . LEU A 1 220 ? 25.309  -25.762 24.289  1.00 2.62   ? 220 LEU A CD2 1 
ATOM   1735  N N   . PHE A 1 221 ? 24.135  -21.401 22.618  1.00 17.34  ? 221 PHE A N   1 
ATOM   1736  C CA  . PHE A 1 221 ? 23.452  -20.359 23.381  1.00 15.38  ? 221 PHE A CA  1 
ATOM   1737  C C   . PHE A 1 221 ? 22.423  -21.078 24.292  1.00 20.99  ? 221 PHE A C   1 
ATOM   1738  O O   . PHE A 1 221 ? 22.044  -22.242 24.087  1.00 19.88  ? 221 PHE A O   1 
ATOM   1739  C CB  . PHE A 1 221 ? 22.662  -19.435 22.450  1.00 16.16  ? 221 PHE A CB  1 
ATOM   1740  C CG  . PHE A 1 221 ? 23.489  -18.680 21.438  1.00 17.28  ? 221 PHE A CG  1 
ATOM   1741  C CD1 . PHE A 1 221 ? 23.491  -19.073 20.117  1.00 19.73  ? 221 PHE A CD1 1 
ATOM   1742  C CD2 . PHE A 1 221 ? 24.066  -17.451 21.759  1.00 20.07  ? 221 PHE A CD2 1 
ATOM   1743  C CE1 . PHE A 1 221 ? 24.148  -18.341 19.159  1.00 21.22  ? 221 PHE A CE1 1 
ATOM   1744  C CE2 . PHE A 1 221 ? 24.765  -16.730 20.809  1.00 22.88  ? 221 PHE A CE2 1 
ATOM   1745  C CZ  . PHE A 1 221 ? 24.798  -17.173 19.501  1.00 20.97  ? 221 PHE A CZ  1 
ATOM   1746  N N   . GLY A 1 222 ? 21.932  -20.356 25.275  1.00 19.32  ? 222 GLY A N   1 
ATOM   1747  C CA  . GLY A 1 222 ? 20.983  -20.914 26.211  1.00 19.63  ? 222 GLY A CA  1 
ATOM   1748  C C   . GLY A 1 222 ? 21.107  -20.025 27.445  1.00 25.55  ? 222 GLY A C   1 
ATOM   1749  O O   . GLY A 1 222 ? 22.003  -19.156 27.486  1.00 24.64  ? 222 GLY A O   1 
ATOM   1750  N N   . ASN A 1 223 ? 20.231  -20.243 28.432  1.00 19.48  ? 223 ASN A N   1 
ATOM   1751  C CA  . ASN A 1 223 ? 20.220  -19.423 29.634  1.00 18.63  ? 223 ASN A CA  1 
ATOM   1752  C C   . ASN A 1 223 ? 20.601  -20.339 30.770  1.00 27.02  ? 223 ASN A C   1 
ATOM   1753  O O   . ASN A 1 223 ? 20.827  -21.533 30.528  1.00 27.80  ? 223 ASN A O   1 
ATOM   1754  C CB  . ASN A 1 223 ? 18.823  -18.794 29.861  1.00 14.16  ? 223 ASN A CB  1 
ATOM   1755  C CG  . ASN A 1 223 ? 17.697  -19.843 30.075  1.00 29.34  ? 223 ASN A CG  1 
ATOM   1756  O OD1 . ASN A 1 223 ? 16.519  -19.495 30.161  1.00 13.71  ? 223 ASN A OD1 1 
ATOM   1757  N ND2 . ASN A 1 223 ? 18.061  -21.121 30.174  1.00 25.78  ? 223 ASN A ND2 1 
ATOM   1758  N N   . GLU A 1 224 ? 20.566  -19.816 32.006  1.00 24.09  ? 224 GLU A N   1 
ATOM   1759  C CA  . GLU A 1 224 ? 20.890  -20.583 33.211  1.00 23.17  ? 224 GLU A CA  1 
ATOM   1760  C C   . GLU A 1 224 ? 20.096  -21.861 33.429  1.00 25.29  ? 224 GLU A C   1 
ATOM   1761  O O   . GLU A 1 224 ? 20.695  -22.875 33.714  1.00 27.67  ? 224 GLU A O   1 
ATOM   1762  C CB  . GLU A 1 224 ? 20.842  -19.718 34.480  1.00 24.69  ? 224 GLU A CB  1 
ATOM   1763  C CG  . GLU A 1 224 ? 20.360  -18.320 34.273  1.00 35.87  ? 224 GLU A CG  1 
ATOM   1764  C CD  . GLU A 1 224 ? 18.856  -18.194 34.444  1.00 60.62  ? 224 GLU A CD  1 
ATOM   1765  O OE1 . GLU A 1 224 ? 18.354  -18.699 35.476  1.00 60.80  ? 224 GLU A OE1 1 
ATOM   1766  O OE2 . GLU A 1 224 ? 18.188  -17.609 33.544  1.00 47.10  ? 224 GLU A OE2 1 
ATOM   1767  N N   . THR A 1 225 ? 18.766  -21.803 33.347  1.00 18.90  ? 225 THR A N   1 
ATOM   1768  C CA  . THR A 1 225 ? 17.901  -22.960 33.574  1.00 17.59  ? 225 THR A CA  1 
ATOM   1769  C C   . THR A 1 225 ? 18.122  -24.055 32.543  1.00 20.37  ? 225 THR A C   1 
ATOM   1770  O O   . THR A 1 225 ? 18.202  -25.215 32.905  1.00 21.40  ? 225 THR A O   1 
ATOM   1771  C CB  . THR A 1 225 ? 16.425  -22.548 33.579  1.00 29.17  ? 225 THR A CB  1 
ATOM   1772  O OG1 . THR A 1 225 ? 16.196  -21.617 32.510  1.00 33.11  ? 225 THR A OG1 1 
ATOM   1773  C CG2 . THR A 1 225 ? 16.095  -21.862 34.887  1.00 25.72  ? 225 THR A CG2 1 
ATOM   1774  N N   . GLU A 1 226 ? 18.255  -23.673 31.268  1.00 14.93  ? 226 GLU A N   1 
ATOM   1775  C CA  . GLU A 1 226 ? 18.599  -24.594 30.175  1.00 12.60  ? 226 GLU A CA  1 
ATOM   1776  C C   . GLU A 1 226 ? 20.001  -25.171 30.351  1.00 17.80  ? 226 GLU A C   1 
ATOM   1777  O O   . GLU A 1 226 ? 20.230  -26.351 30.115  1.00 16.47  ? 226 GLU A O   1 
ATOM   1778  C CB  . GLU A 1 226 ? 18.449  -23.890 28.810  1.00 12.83  ? 226 GLU A CB  1 
ATOM   1779  C CG  . GLU A 1 226 ? 16.967  -23.505 28.488  1.00 11.38  ? 226 GLU A CG  1 
ATOM   1780  C CD  . GLU A 1 226 ? 16.799  -22.163 27.810  1.00 22.21  ? 226 GLU A CD  1 
ATOM   1781  O OE1 . GLU A 1 226 ? 15.684  -21.630 27.843  1.00 30.18  ? 226 GLU A OE1 1 
ATOM   1782  O OE2 . GLU A 1 226 ? 17.735  -21.641 27.172  1.00 26.75  ? 226 GLU A OE2 1 
ATOM   1783  N N   . ALA A 1 227 ? 20.938  -24.358 30.827  1.00 17.21  ? 227 ALA A N   1 
ATOM   1784  C CA  . ALA A 1 227 ? 22.287  -24.866 31.083  1.00 17.75  ? 227 ALA A CA  1 
ATOM   1785  C C   . ALA A 1 227 ? 22.292  -25.836 32.287  1.00 21.52  ? 227 ALA A C   1 
ATOM   1786  O O   . ALA A 1 227 ? 23.047  -26.823 32.309  1.00 23.79  ? 227 ALA A O   1 
ATOM   1787  C CB  . ALA A 1 227 ? 23.269  -23.708 31.325  1.00 18.92  ? 227 ALA A CB  1 
ATOM   1788  N N   . ALA A 1 228 ? 21.463  -25.572 33.302  1.00 12.99  ? 228 ALA A N   1 
ATOM   1789  C CA  . ALA A 1 228 ? 21.434  -26.447 34.477  1.00 10.64  ? 228 ALA A CA  1 
ATOM   1790  C C   . ALA A 1 228 ? 20.833  -27.824 34.127  1.00 20.54  ? 228 ALA A C   1 
ATOM   1791  O O   . ALA A 1 228 ? 21.318  -28.900 34.545  1.00 19.74  ? 228 ALA A O   1 
ATOM   1792  C CB  . ALA A 1 228 ? 20.694  -25.826 35.591  1.00 9.24   ? 228 ALA A CB  1 
ATOM   1793  N N   . THR A 1 229 ? 19.758  -27.790 33.348  1.00 18.44  ? 229 THR A N   1 
ATOM   1794  C CA  . THR A 1 229 ? 19.108  -29.010 32.888  1.00 17.01  ? 229 THR A CA  1 
ATOM   1795  C C   . THR A 1 229 ? 20.026  -29.790 31.967  1.00 22.70  ? 229 THR A C   1 
ATOM   1796  O O   . THR A 1 229 ? 20.019  -31.018 31.999  1.00 25.17  ? 229 THR A O   1 
ATOM   1797  C CB  . THR A 1 229 ? 17.870  -28.685 32.105  1.00 17.19  ? 229 THR A CB  1 
ATOM   1798  O OG1 . THR A 1 229 ? 16.934  -28.026 32.954  1.00 7.54   ? 229 THR A OG1 1 
ATOM   1799  C CG2 . THR A 1 229 ? 17.271  -29.953 31.502  1.00 20.05  ? 229 THR A CG2 1 
ATOM   1800  N N   . PHE A 1 230 ? 20.773  -29.079 31.110  1.00 18.07  ? 230 PHE A N   1 
ATOM   1801  C CA  . PHE A 1 230 ? 21.708  -29.704 30.163  1.00 17.18  ? 230 PHE A CA  1 
ATOM   1802  C C   . PHE A 1 230 ? 22.860  -30.401 30.888  1.00 23.54  ? 230 PHE A C   1 
ATOM   1803  O O   . PHE A 1 230 ? 23.311  -31.462 30.476  1.00 21.77  ? 230 PHE A O   1 
ATOM   1804  C CB  . PHE A 1 230 ? 22.255  -28.690 29.147  1.00 17.76  ? 230 PHE A CB  1 
ATOM   1805  C CG  . PHE A 1 230 ? 23.102  -29.309 28.072  1.00 18.80  ? 230 PHE A CG  1 
ATOM   1806  C CD1 . PHE A 1 230 ? 22.522  -29.890 26.951  1.00 19.02  ? 230 PHE A CD1 1 
ATOM   1807  C CD2 . PHE A 1 230 ? 24.497  -29.359 28.213  1.00 20.19  ? 230 PHE A CD2 1 
ATOM   1808  C CE1 . PHE A 1 230 ? 23.314  -30.515 26.002  1.00 18.59  ? 230 PHE A CE1 1 
ATOM   1809  C CE2 . PHE A 1 230 ? 25.289  -29.969 27.240  1.00 20.30  ? 230 PHE A CE2 1 
ATOM   1810  C CZ  . PHE A 1 230 ? 24.684  -30.558 26.157  1.00 17.87  ? 230 PHE A CZ  1 
ATOM   1811  N N   . ALA A 1 231 ? 23.316  -29.810 31.990  1.00 24.10  ? 231 ALA A N   1 
ATOM   1812  C CA  . ALA A 1 231 ? 24.403  -30.402 32.775  1.00 23.51  ? 231 ALA A CA  1 
ATOM   1813  C C   . ALA A 1 231 ? 23.878  -31.638 33.429  1.00 29.82  ? 231 ALA A C   1 
ATOM   1814  O O   . ALA A 1 231 ? 24.436  -32.711 33.289  1.00 32.25  ? 231 ALA A O   1 
ATOM   1815  C CB  . ALA A 1 231 ? 24.901  -29.444 33.808  1.00 23.58  ? 231 ALA A CB  1 
ATOM   1816  N N   . ARG A 1 232 ? 22.729  -31.524 34.068  1.00 28.55  ? 232 ARG A N   1 
ATOM   1817  C CA  . ARG A 1 232 ? 22.138  -32.696 34.721  1.00 28.45  ? 232 ARG A CA  1 
ATOM   1818  C C   . ARG A 1 232 ? 21.800  -33.895 33.850  1.00 28.53  ? 232 ARG A C   1 
ATOM   1819  O O   . ARG A 1 232 ? 21.857  -35.019 34.322  1.00 25.92  ? 232 ARG A O   1 
ATOM   1820  C CB  . ARG A 1 232 ? 20.954  -32.341 35.600  1.00 26.75  ? 232 ARG A CB  1 
ATOM   1821  C CG  . ARG A 1 232 ? 20.375  -33.563 36.266  1.00 45.02  ? 232 ARG A CG  1 
ATOM   1822  C CD  . ARG A 1 232 ? 18.989  -33.288 36.760  1.00 72.76  ? 232 ARG A CD  1 
ATOM   1823  N NE  . ARG A 1 232 ? 19.037  -32.333 37.854  1.00 101.10 ? 232 ARG A NE  1 
ATOM   1824  C CZ  . ARG A 1 232 ? 18.005  -32.039 38.638  1.00 125.69 ? 232 ARG A CZ  1 
ATOM   1825  N NH1 . ARG A 1 232 ? 16.822  -32.613 38.432  1.00 110.36 ? 232 ARG A NH1 1 
ATOM   1826  N NH2 . ARG A 1 232 ? 18.151  -31.160 39.624  1.00 119.63 ? 232 ARG A NH2 1 
ATOM   1827  N N   . GLU A 1 233 ? 21.398  -33.644 32.610  1.00 26.05  ? 233 GLU A N   1 
ATOM   1828  C CA  . GLU A 1 233 ? 21.032  -34.731 31.701  1.00 27.03  ? 233 GLU A CA  1 
ATOM   1829  C C   . GLU A 1 233 ? 22.259  -35.314 30.983  1.00 32.85  ? 233 GLU A C   1 
ATOM   1830  O O   . GLU A 1 233 ? 22.304  -36.490 30.642  1.00 31.41  ? 233 GLU A O   1 
ATOM   1831  C CB  . GLU A 1 233 ? 19.940  -34.291 30.720  1.00 28.08  ? 233 GLU A CB  1 
ATOM   1832  C CG  . GLU A 1 233 ? 18.738  -33.572 31.370  1.00 31.21  ? 233 GLU A CG  1 
ATOM   1833  C CD  . GLU A 1 233 ? 17.683  -34.527 31.937  1.00 39.04  ? 233 GLU A CD  1 
ATOM   1834  O OE1 . GLU A 1 233 ? 16.790  -34.022 32.643  1.00 45.08  ? 233 GLU A OE1 1 
ATOM   1835  O OE2 . GLU A 1 233 ? 17.724  -35.750 31.674  1.00 30.64  ? 233 GLU A OE2 1 
ATOM   1836  N N   . GLN A 1 234 ? 23.299  -34.505 30.849  1.00 31.70  ? 234 GLN A N   1 
ATOM   1837  C CA  . GLN A 1 234 ? 24.530  -34.985 30.258  1.00 32.32  ? 234 GLN A CA  1 
ATOM   1838  C C   . GLN A 1 234 ? 25.396  -35.658 31.317  1.00 40.96  ? 234 GLN A C   1 
ATOM   1839  O O   . GLN A 1 234 ? 26.369  -36.323 30.978  1.00 41.87  ? 234 GLN A O   1 
ATOM   1840  C CB  . GLN A 1 234 ? 25.312  -33.841 29.616  1.00 33.47  ? 234 GLN A CB  1 
ATOM   1841  C CG  . GLN A 1 234 ? 24.885  -33.511 28.191  1.00 49.04  ? 234 GLN A CG  1 
ATOM   1842  C CD  . GLN A 1 234 ? 24.474  -34.738 27.388  1.00 63.94  ? 234 GLN A CD  1 
ATOM   1843  O OE1 . GLN A 1 234 ? 23.352  -35.211 27.485  1.00 63.53  ? 234 GLN A OE1 1 
ATOM   1844  N NE2 . GLN A 1 234 ? 25.367  -35.213 26.543  1.00 60.95  ? 234 GLN A NE2 1 
ATOM   1845  N N   . GLY A 1 235 ? 25.072  -35.469 32.599  1.00 38.11  ? 235 GLY A N   1 
ATOM   1846  C CA  . GLY A 1 235 ? 25.852  -36.097 33.668  1.00 36.83  ? 235 GLY A CA  1 
ATOM   1847  C C   . GLY A 1 235 ? 27.045  -35.249 34.122  1.00 39.86  ? 235 GLY A C   1 
ATOM   1848  O O   . GLY A 1 235 ? 27.975  -35.758 34.734  1.00 41.69  ? 235 GLY A O   1 
ATOM   1849  N N   . PHE A 1 236 ? 26.989  -33.944 33.881  1.00 33.73  ? 236 PHE A N   1 
ATOM   1850  C CA  . PHE A 1 236 ? 28.076  -33.030 34.241  1.00 32.43  ? 236 PHE A CA  1 
ATOM   1851  C C   . PHE A 1 236 ? 28.456  -33.011 35.724  1.00 41.51  ? 236 PHE A C   1 
ATOM   1852  O O   . PHE A 1 236 ? 29.620  -32.778 36.076  1.00 39.74  ? 236 PHE A O   1 
ATOM   1853  C CB  . PHE A 1 236 ? 27.758  -31.613 33.783  1.00 32.31  ? 236 PHE A CB  1 
ATOM   1854  C CG  . PHE A 1 236 ? 28.067  -31.359 32.337  1.00 32.08  ? 236 PHE A CG  1 
ATOM   1855  C CD1 . PHE A 1 236 ? 28.456  -32.404 31.497  1.00 33.81  ? 236 PHE A CD1 1 
ATOM   1856  C CD2 . PHE A 1 236 ? 27.878  -30.096 31.800  1.00 32.11  ? 236 PHE A CD2 1 
ATOM   1857  C CE1 . PHE A 1 236 ? 28.709  -32.176 30.155  1.00 34.08  ? 236 PHE A CE1 1 
ATOM   1858  C CE2 . PHE A 1 236 ? 28.077  -29.882 30.456  1.00 35.27  ? 236 PHE A CE2 1 
ATOM   1859  C CZ  . PHE A 1 236 ? 28.523  -30.919 29.626  1.00 33.06  ? 236 PHE A CZ  1 
ATOM   1860  N N   . GLU A 1 237 ? 27.471  -33.224 36.597  1.00 41.88  ? 237 GLU A N   1 
ATOM   1861  C CA  . GLU A 1 237 ? 27.732  -33.257 38.041  1.00 42.16  ? 237 GLU A CA  1 
ATOM   1862  C C   . GLU A 1 237 ? 28.272  -31.924 38.542  1.00 45.92  ? 237 GLU A C   1 
ATOM   1863  O O   . GLU A 1 237 ? 29.335  -31.844 39.174  1.00 45.06  ? 237 GLU A O   1 
ATOM   1864  C CB  . GLU A 1 237 ? 28.703  -34.395 38.399  1.00 43.87  ? 237 GLU A CB  1 
ATOM   1865  C CG  . GLU A 1 237 ? 28.152  -35.793 38.082  1.00 56.07  ? 237 GLU A CG  1 
ATOM   1866  C CD  . GLU A 1 237 ? 29.125  -36.917 38.413  1.00 71.42  ? 237 GLU A CD  1 
ATOM   1867  O OE1 . GLU A 1 237 ? 30.249  -36.618 38.895  1.00 76.09  ? 237 GLU A OE1 1 
ATOM   1868  O OE2 . GLU A 1 237 ? 28.761  -38.103 38.157  1.00 35.78  ? 237 GLU A OE2 1 
ATOM   1869  N N   . THR A 1 238 ? 27.510  -30.873 38.277  1.00 42.03  ? 238 THR A N   1 
ATOM   1870  C CA  . THR A 1 238 ? 27.902  -29.534 38.678  1.00 39.83  ? 238 THR A CA  1 
ATOM   1871  C C   . THR A 1 238 ? 26.768  -28.572 38.297  1.00 43.33  ? 238 THR A C   1 
ATOM   1872  O O   . THR A 1 238 ? 26.189  -28.661 37.204  1.00 44.27  ? 238 THR A O   1 
ATOM   1873  C CB  . THR A 1 238 ? 29.207  -29.123 37.958  1.00 37.99  ? 238 THR A CB  1 
ATOM   1874  O OG1 . THR A 1 238 ? 29.605  -27.790 38.354  1.00 41.53  ? 238 THR A OG1 1 
ATOM   1875  C CG2 . THR A 1 238 ? 28.996  -29.210 36.433  1.00 27.12  ? 238 THR A CG2 1 
ATOM   1876  N N   . LYS A 1 239 ? 26.475  -27.649 39.211  1.00 36.64  ? 239 LYS A N   1 
ATOM   1877  C CA  . LYS A 1 239 ? 25.434  -26.646 39.047  1.00 33.08  ? 239 LYS A CA  1 
ATOM   1878  C C   . LYS A 1 239 ? 26.150  -25.316 38.777  1.00 33.37  ? 239 LYS A C   1 
ATOM   1879  O O   . LYS A 1 239 ? 25.534  -24.283 38.538  1.00 32.09  ? 239 LYS A O   1 
ATOM   1880  C CB  . LYS A 1 239 ? 24.637  -26.546 40.350  1.00 34.05  ? 239 LYS A CB  1 
ATOM   1881  C CG  . LYS A 1 239 ? 24.001  -27.850 40.828  1.00 31.45  ? 239 LYS A CG  1 
ATOM   1882  C CD  . LYS A 1 239 ? 23.485  -27.714 42.255  1.00 42.55  ? 239 LYS A CD  1 
ATOM   1883  C CE  . LYS A 1 239 ? 22.023  -28.164 42.391  1.00 65.52  ? 239 LYS A CE  1 
ATOM   1884  N NZ  . LYS A 1 239 ? 21.285  -27.539 43.548  1.00 71.93  ? 239 LYS A NZ  1 
ATOM   1885  N N   . ASP A 1 240 ? 27.473  -25.328 38.829  1.00 28.43  ? 240 ASP A N   1 
ATOM   1886  C CA  . ASP A 1 240 ? 28.196  -24.082 38.604  1.00 26.04  ? 240 ASP A CA  1 
ATOM   1887  C C   . ASP A 1 240 ? 28.143  -23.718 37.117  1.00 27.45  ? 240 ASP A C   1 
ATOM   1888  O O   . ASP A 1 240 ? 28.710  -24.437 36.269  1.00 25.69  ? 240 ASP A O   1 
ATOM   1889  C CB  . ASP A 1 240 ? 29.629  -24.163 39.122  1.00 25.60  ? 240 ASP A CB  1 
ATOM   1890  C CG  . ASP A 1 240 ? 30.479  -23.025 38.629  1.00 32.63  ? 240 ASP A CG  1 
ATOM   1891  O OD1 . ASP A 1 240 ? 31.432  -23.282 37.891  1.00 35.74  ? 240 ASP A OD1 1 
ATOM   1892  O OD2 . ASP A 1 240 ? 30.180  -21.859 38.922  1.00 38.66  ? 240 ASP A OD2 1 
ATOM   1893  N N   . ILE A 1 241 ? 27.445  -22.623 36.798  1.00 20.01  ? 241 ILE A N   1 
ATOM   1894  C CA  . ILE A 1 241 ? 27.309  -22.212 35.399  1.00 18.85  ? 241 ILE A CA  1 
ATOM   1895  C C   . ILE A 1 241 ? 28.626  -22.134 34.580  1.00 24.60  ? 241 ILE A C   1 
ATOM   1896  O O   . ILE A 1 241 ? 28.683  -22.601 33.435  1.00 21.63  ? 241 ILE A O   1 
ATOM   1897  C CB  . ILE A 1 241 ? 26.496  -20.912 35.256  1.00 20.29  ? 241 ILE A CB  1 
ATOM   1898  C CG1 . ILE A 1 241 ? 26.219  -20.594 33.784  1.00 19.01  ? 241 ILE A CG1 1 
ATOM   1899  C CG2 . ILE A 1 241 ? 27.254  -19.754 35.891  1.00 20.28  ? 241 ILE A CG2 1 
ATOM   1900  C CD1 . ILE A 1 241 ? 25.118  -21.366 33.135  1.00 13.91  ? 241 ILE A CD1 1 
ATOM   1901  N N   . LYS A 1 242 ? 29.669  -21.518 35.158  1.00 24.79  ? 242 LYS A N   1 
ATOM   1902  C CA  . LYS A 1 242 ? 30.948  -21.354 34.458  1.00 23.83  ? 242 LYS A CA  1 
ATOM   1903  C C   . LYS A 1 242 ? 31.590  -22.710 34.201  1.00 26.99  ? 242 LYS A C   1 
ATOM   1904  O O   . LYS A 1 242 ? 32.167  -22.930 33.153  1.00 26.12  ? 242 LYS A O   1 
ATOM   1905  C CB  . LYS A 1 242 ? 31.890  -20.480 35.264  1.00 24.81  ? 242 LYS A CB  1 
ATOM   1906  C CG  . LYS A 1 242 ? 31.469  -19.038 35.467  1.00 13.17  ? 242 LYS A CG  1 
ATOM   1907  C CD  . LYS A 1 242 ? 32.747  -18.230 35.489  1.00 14.51  ? 242 LYS A CD  1 
ATOM   1908  C CE  . LYS A 1 242 ? 32.809  -17.194 36.587  1.00 31.57  ? 242 LYS A CE  1 
ATOM   1909  N NZ  . LYS A 1 242 ? 34.005  -16.267 36.406  1.00 47.61  ? 242 LYS A NZ  1 
ATOM   1910  N N   . GLU A 1 243 ? 31.425  -23.626 35.147  1.00 24.73  ? 243 GLU A N   1 
ATOM   1911  C CA  . GLU A 1 243 ? 31.912  -25.005 35.022  1.00 26.27  ? 243 GLU A CA  1 
ATOM   1912  C C   . GLU A 1 243 ? 31.126  -25.773 33.935  1.00 30.93  ? 243 GLU A C   1 
ATOM   1913  O O   . GLU A 1 243 ? 31.666  -26.677 33.268  1.00 29.98  ? 243 GLU A O   1 
ATOM   1914  C CB  . GLU A 1 243 ? 31.751  -25.742 36.374  1.00 27.82  ? 243 GLU A CB  1 
ATOM   1915  C CG  . GLU A 1 243 ? 32.489  -27.053 36.479  1.00 34.59  ? 243 GLU A CG  1 
ATOM   1916  C CD  . GLU A 1 243 ? 33.876  -26.945 35.906  1.00 60.78  ? 243 GLU A CD  1 
ATOM   1917  O OE1 . GLU A 1 243 ? 34.412  -27.942 35.370  1.00 56.03  ? 243 GLU A OE1 1 
ATOM   1918  O OE2 . GLU A 1 243 ? 34.409  -25.816 35.910  1.00 66.00  ? 243 GLU A OE2 1 
ATOM   1919  N N   . ILE A 1 244 ? 29.832  -25.462 33.836  1.00 26.32  ? 244 ILE A N   1 
ATOM   1920  C CA  . ILE A 1 244 ? 28.959  -26.080 32.858  1.00 24.95  ? 244 ILE A CA  1 
ATOM   1921  C C   . ILE A 1 244 ? 29.346  -25.571 31.463  1.00 27.96  ? 244 ILE A C   1 
ATOM   1922  O O   . ILE A 1 244 ? 29.464  -26.318 30.478  1.00 24.51  ? 244 ILE A O   1 
ATOM   1923  C CB  . ILE A 1 244 ? 27.484  -25.769 33.181  1.00 26.59  ? 244 ILE A CB  1 
ATOM   1924  C CG1 . ILE A 1 244 ? 27.033  -26.646 34.356  1.00 26.56  ? 244 ILE A CG1 1 
ATOM   1925  C CG2 . ILE A 1 244 ? 26.595  -25.978 31.956  1.00 27.96  ? 244 ILE A CG2 1 
ATOM   1926  C CD1 . ILE A 1 244 ? 25.761  -26.156 35.117  1.00 33.86  ? 244 ILE A CD1 1 
ATOM   1927  N N   . ALA A 1 245 ? 29.585  -24.277 31.394  1.00 25.89  ? 245 ALA A N   1 
ATOM   1928  C CA  . ALA A 1 245 ? 29.943  -23.667 30.130  1.00 26.77  ? 245 ALA A CA  1 
ATOM   1929  C C   . ALA A 1 245 ? 31.232  -24.306 29.627  1.00 32.33  ? 245 ALA A C   1 
ATOM   1930  O O   . ALA A 1 245 ? 31.412  -24.536 28.423  1.00 33.73  ? 245 ALA A O   1 
ATOM   1931  C CB  . ALA A 1 245 ? 30.121  -22.143 30.321  1.00 27.53  ? 245 ALA A CB  1 
ATOM   1932  N N   . LYS A 1 246 ? 32.128  -24.594 30.572  1.00 25.88  ? 246 LYS A N   1 
ATOM   1933  C CA  . LYS A 1 246 ? 33.447  -25.148 30.254  1.00 22.79  ? 246 LYS A CA  1 
ATOM   1934  C C   . LYS A 1 246 ? 33.331  -26.569 29.751  1.00 23.86  ? 246 LYS A C   1 
ATOM   1935  O O   . LYS A 1 246 ? 33.848  -26.880 28.694  1.00 26.65  ? 246 LYS A O   1 
ATOM   1936  C CB  . LYS A 1 246 ? 34.424  -25.043 31.448  1.00 23.57  ? 246 LYS A CB  1 
ATOM   1937  C CG  . LYS A 1 246 ? 35.670  -25.877 31.306  1.00 25.58  ? 246 LYS A CG  1 
ATOM   1938  C CD  . LYS A 1 246 ? 36.403  -26.029 32.617  1.00 41.14  ? 246 LYS A CD  1 
ATOM   1939  C CE  . LYS A 1 246 ? 37.922  -25.837 32.432  1.00 60.25  ? 246 LYS A CE  1 
ATOM   1940  N NZ  . LYS A 1 246 ? 38.756  -26.525 33.477  1.00 62.39  ? 246 LYS A NZ  1 
ATOM   1941  N N   . LYS A 1 247 ? 32.612  -27.433 30.462  1.00 16.61  ? 247 LYS A N   1 
ATOM   1942  C CA  . LYS A 1 247 ? 32.450  -28.817 30.004  1.00 16.04  ? 247 LYS A CA  1 
ATOM   1943  C C   . LYS A 1 247 ? 31.669  -28.901 28.703  1.00 20.98  ? 247 LYS A C   1 
ATOM   1944  O O   . LYS A 1 247 ? 31.958  -29.751 27.854  1.00 20.58  ? 247 LYS A O   1 
ATOM   1945  C CB  . LYS A 1 247 ? 31.797  -29.703 31.069  1.00 17.07  ? 247 LYS A CB  1 
ATOM   1946  C CG  . LYS A 1 247 ? 32.141  -29.292 32.515  1.00 25.94  ? 247 LYS A CG  1 
ATOM   1947  C CD  . LYS A 1 247 ? 31.352  -30.142 33.526  1.00 35.39  ? 247 LYS A CD  1 
ATOM   1948  C CE  . LYS A 1 247 ? 32.245  -30.722 34.633  1.00 38.04  ? 247 LYS A CE  1 
ATOM   1949  N NZ  . LYS A 1 247 ? 33.015  -31.944 34.198  1.00 41.50  ? 247 LYS A NZ  1 
ATOM   1950  N N   . THR A 1 248 ? 30.713  -27.985 28.535  1.00 17.90  ? 248 THR A N   1 
ATOM   1951  C CA  . THR A 1 248 ? 29.926  -27.911 27.304  1.00 17.84  ? 248 THR A CA  1 
ATOM   1952  C C   . THR A 1 248 ? 30.821  -27.495 26.122  1.00 24.24  ? 248 THR A C   1 
ATOM   1953  O O   . THR A 1 248 ? 30.701  -28.080 25.024  1.00 24.13  ? 248 THR A O   1 
ATOM   1954  C CB  . THR A 1 248 ? 28.706  -26.958 27.434  1.00 10.10  ? 248 THR A CB  1 
ATOM   1955  O OG1 . THR A 1 248 ? 27.828  -27.468 28.421  1.00 2.05   ? 248 THR A OG1 1 
ATOM   1956  C CG2 . THR A 1 248 ? 27.932  -26.896 26.169  1.00 1.69   ? 248 THR A CG2 1 
ATOM   1957  N N   . GLN A 1 249 ? 31.738  -26.544 26.361  1.00 18.63  ? 249 GLN A N   1 
ATOM   1958  C CA  . GLN A 1 249 ? 32.647  -26.108 25.300  1.00 17.00  ? 249 GLN A CA  1 
ATOM   1959  C C   . GLN A 1 249 ? 33.624  -27.214 24.857  1.00 21.38  ? 249 GLN A C   1 
ATOM   1960  O O   . GLN A 1 249 ? 34.066  -27.237 23.711  1.00 21.02  ? 249 GLN A O   1 
ATOM   1961  C CB  . GLN A 1 249 ? 33.369  -24.801 25.659  1.00 16.74  ? 249 GLN A CB  1 
ATOM   1962  C CG  . GLN A 1 249 ? 34.896  -24.892 25.685  1.00 30.73  ? 249 GLN A CG  1 
ATOM   1963  C CD  . GLN A 1 249 ? 35.551  -25.060 24.329  1.00 33.79  ? 249 GLN A CD  1 
ATOM   1964  O OE1 . GLN A 1 249 ? 36.428  -25.897 24.162  1.00 37.40  ? 249 GLN A OE1 1 
ATOM   1965  N NE2 . GLN A 1 249 ? 35.045  -24.372 23.339  1.00 30.51  ? 249 GLN A NE2 1 
ATOM   1966  N N   . ALA A 1 250 ? 33.919  -28.161 25.742  1.00 17.48  ? 250 ALA A N   1 
ATOM   1967  C CA  . ALA A 1 250 ? 34.871  -29.221 25.411  1.00 15.98  ? 250 ALA A CA  1 
ATOM   1968  C C   . ALA A 1 250 ? 34.220  -30.423 24.703  1.00 21.53  ? 250 ALA A C   1 
ATOM   1969  O O   . ALA A 1 250 ? 34.872  -31.406 24.387  1.00 22.64  ? 250 ALA A O   1 
ATOM   1970  C CB  . ALA A 1 250 ? 35.610  -29.667 26.662  1.00 15.50  ? 250 ALA A CB  1 
ATOM   1971  N N   . LEU A 1 251 ? 32.914  -30.395 24.512  1.00 16.21  ? 251 LEU A N   1 
ATOM   1972  C CA  . LEU A 1 251 ? 32.215  -31.562 23.940  1.00 15.37  ? 251 LEU A CA  1 
ATOM   1973  C C   . LEU A 1 251 ? 32.763  -31.915 22.577  1.00 15.80  ? 251 LEU A C   1 
ATOM   1974  O O   . LEU A 1 251 ? 33.393  -31.070 21.917  1.00 16.27  ? 251 LEU A O   1 
ATOM   1975  C CB  . LEU A 1 251 ? 30.683  -31.313 23.852  1.00 15.51  ? 251 LEU A CB  1 
ATOM   1976  C CG  . LEU A 1 251 ? 29.980  -31.176 25.199  1.00 19.23  ? 251 LEU A CG  1 
ATOM   1977  C CD1 . LEU A 1 251 ? 28.538  -30.676 25.062  1.00 19.63  ? 251 LEU A CD1 1 
ATOM   1978  C CD2 . LEU A 1 251 ? 30.031  -32.509 25.930  1.00 19.81  ? 251 LEU A CD2 1 
ATOM   1979  N N   . PRO A 1 252 ? 32.520  -33.149 22.137  1.00 10.22  ? 252 PRO A N   1 
ATOM   1980  C CA  . PRO A 1 252 ? 33.128  -33.597 20.873  1.00 11.48  ? 252 PRO A CA  1 
ATOM   1981  C C   . PRO A 1 252 ? 32.713  -32.739 19.694  1.00 21.64  ? 252 PRO A C   1 
ATOM   1982  O O   . PRO A 1 252 ? 31.513  -32.442 19.515  1.00 21.02  ? 252 PRO A O   1 
ATOM   1983  C CB  . PRO A 1 252 ? 32.684  -35.051 20.731  1.00 11.00  ? 252 PRO A CB  1 
ATOM   1984  C CG  . PRO A 1 252 ? 32.440  -35.493 22.095  1.00 13.67  ? 252 PRO A CG  1 
ATOM   1985  C CD  . PRO A 1 252 ? 32.029  -34.292 22.928  1.00 9.82   ? 252 PRO A CD  1 
ATOM   1986  N N   . LYS A 1 253 ? 33.711  -32.266 18.946  1.00 21.02  ? 253 LYS A N   1 
ATOM   1987  C CA  . LYS A 1 253 ? 33.430  -31.357 17.840  1.00 22.23  ? 253 LYS A CA  1 
ATOM   1988  C C   . LYS A 1 253 ? 33.878  -31.934 16.550  1.00 28.03  ? 253 LYS A C   1 
ATOM   1989  O O   . LYS A 1 253 ? 34.967  -32.487 16.438  1.00 25.77  ? 253 LYS A O   1 
ATOM   1990  C CB  . LYS A 1 253 ? 34.051  -29.959 18.047  1.00 24.19  ? 253 LYS A CB  1 
ATOM   1991  C CG  . LYS A 1 253 ? 33.320  -28.880 17.270  1.00 27.27  ? 253 LYS A CG  1 
ATOM   1992  C CD  . LYS A 1 253 ? 33.760  -27.491 17.659  1.00 21.00  ? 253 LYS A CD  1 
ATOM   1993  C CE  . LYS A 1 253 ? 33.147  -26.483 16.711  1.00 19.47  ? 253 LYS A CE  1 
ATOM   1994  N NZ  . LYS A 1 253 ? 33.782  -26.575 15.379  1.00 8.62   ? 253 LYS A NZ  1 
ATOM   1995  N N   . MET A 1 254 ? 33.009  -31.831 15.560  1.00 28.92  ? 254 MET A N   1 
ATOM   1996  C CA  . MET A 1 254 ? 33.343  -32.373 14.238  1.00 28.76  ? 254 MET A CA  1 
ATOM   1997  C C   . MET A 1 254 ? 34.430  -31.542 13.507  1.00 34.02  ? 254 MET A C   1 
ATOM   1998  O O   . MET A 1 254 ? 35.497  -32.054 13.171  1.00 31.95  ? 254 MET A O   1 
ATOM   1999  C CB  . MET A 1 254 ? 32.094  -32.532 13.397  1.00 30.07  ? 254 MET A CB  1 
ATOM   2000  C CG  . MET A 1 254 ? 32.133  -33.728 12.557  1.00 33.25  ? 254 MET A CG  1 
ATOM   2001  S SD  . MET A 1 254 ? 32.288  -35.239 13.505  1.00 36.91  ? 254 MET A SD  1 
ATOM   2002  C CE  . MET A 1 254 ? 31.290  -34.931 14.908  1.00 33.02  ? 254 MET A CE  1 
ATOM   2003  N N   . ASN A 1 255 ? 34.176  -30.252 13.317  1.00 33.68  ? 255 ASN A N   1 
ATOM   2004  C CA  . ASN A 1 255 ? 35.101  -29.355 12.608  1.00 35.25  ? 255 ASN A CA  1 
ATOM   2005  C C   . ASN A 1 255 ? 36.110  -28.678 13.534  1.00 40.80  ? 255 ASN A C   1 
ATOM   2006  O O   . ASN A 1 255 ? 35.815  -27.681 14.187  1.00 40.62  ? 255 ASN A O   1 
ATOM   2007  C CB  . ASN A 1 255 ? 34.313  -28.282 11.831  1.00 39.69  ? 255 ASN A CB  1 
ATOM   2008  C CG  . ASN A 1 255 ? 35.178  -27.115 11.389  1.00 49.99  ? 255 ASN A CG  1 
ATOM   2009  O OD1 . ASN A 1 255 ? 36.348  -27.287 11.077  1.00 42.58  ? 255 ASN A OD1 1 
ATOM   2010  N ND2 . ASN A 1 255 ? 34.571  -25.942 11.271  1.00 44.15  ? 255 ASN A ND2 1 
ATOM   2011  N N   . SER A 1 256 ? 37.326  -29.196 13.519  1.00 39.66  ? 256 SER A N   1 
ATOM   2012  C CA  . SER A 1 256 ? 38.420  -28.707 14.344  1.00 40.16  ? 256 SER A CA  1 
ATOM   2013  C C   . SER A 1 256 ? 38.922  -27.287 14.024  1.00 49.03  ? 256 SER A C   1 
ATOM   2014  O O   . SER A 1 256 ? 39.637  -26.699 14.848  1.00 49.49  ? 256 SER A O   1 
ATOM   2015  C CB  . SER A 1 256 ? 39.577  -29.654 14.144  1.00 43.07  ? 256 SER A CB  1 
ATOM   2016  O OG  . SER A 1 256 ? 39.686  -29.932 12.761  1.00 48.46  ? 256 SER A OG  1 
ATOM   2017  N N   . LYS A 1 257 ? 38.602  -26.759 12.832  1.00 47.31  ? 257 LYS A N   1 
ATOM   2018  C CA  . LYS A 1 257 ? 39.040  -25.399 12.426  1.00 46.43  ? 257 LYS A CA  1 
ATOM   2019  C C   . LYS A 1 257 ? 38.469  -24.342 13.345  1.00 47.31  ? 257 LYS A C   1 
ATOM   2020  O O   . LYS A 1 257 ? 39.061  -23.282 13.532  1.00 48.52  ? 257 LYS A O   1 
ATOM   2021  C CB  . LYS A 1 257 ? 38.660  -25.054 10.973  1.00 48.77  ? 257 LYS A CB  1 
ATOM   2022  C CG  . LYS A 1 257 ? 39.222  -26.016 9.911   1.00 64.93  ? 257 LYS A CG  1 
ATOM   2023  C CD  . LYS A 1 257 ? 38.701  -25.699 8.497   1.00 67.43  ? 257 LYS A CD  1 
ATOM   2024  C CE  . LYS A 1 257 ? 39.017  -26.823 7.516   1.00 78.58  ? 257 LYS A CE  1 
ATOM   2025  N NZ  . LYS A 1 257 ? 40.181  -26.517 6.625   1.00 89.15  ? 257 LYS A NZ  1 
ATOM   2026  N N   . ARG A 1 258 ? 37.295  -24.619 13.887  1.00 40.64  ? 258 ARG A N   1 
ATOM   2027  C CA  . ARG A 1 258 ? 36.653  -23.686 14.792  1.00 39.28  ? 258 ARG A CA  1 
ATOM   2028  C C   . ARG A 1 258 ? 36.624  -24.405 16.120  1.00 42.90  ? 258 ARG A C   1 
ATOM   2029  O O   . ARG A 1 258 ? 36.568  -25.642 16.160  1.00 42.84  ? 258 ARG A O   1 
ATOM   2030  C CB  . ARG A 1 258 ? 35.233  -23.374 14.321  1.00 36.62  ? 258 ARG A CB  1 
ATOM   2031  C CG  . ARG A 1 258 ? 35.104  -22.167 13.403  1.00 40.25  ? 258 ARG A CG  1 
ATOM   2032  C CD  . ARG A 1 258 ? 34.013  -22.387 12.349  1.00 43.59  ? 258 ARG A CD  1 
ATOM   2033  N NE  . ARG A 1 258 ? 34.211  -21.646 11.096  1.00 45.28  ? 258 ARG A NE  1 
ATOM   2034  C CZ  . ARG A 1 258 ? 34.523  -20.350 11.003  1.00 43.00  ? 258 ARG A CZ  1 
ATOM   2035  N NH1 . ARG A 1 258 ? 34.720  -19.621 12.108  1.00 16.62  ? 258 ARG A NH1 1 
ATOM   2036  N NH2 . ARG A 1 258 ? 34.621  -19.787 9.799   1.00 16.16  ? 258 ARG A NH2 1 
ATOM   2037  N N   . GLN A 1 259 ? 36.841  -23.649 17.186  1.00 38.23  ? 259 GLN A N   1 
ATOM   2038  C CA  . GLN A 1 259 ? 36.800  -24.179 18.534  1.00 37.46  ? 259 GLN A CA  1 
ATOM   2039  C C   . GLN A 1 259 ? 35.417  -23.748 19.021  1.00 40.92  ? 259 GLN A C   1 
ATOM   2040  O O   . GLN A 1 259 ? 34.863  -22.746 18.550  1.00 43.42  ? 259 GLN A O   1 
ATOM   2041  C CB  . GLN A 1 259 ? 37.903  -23.545 19.384  1.00 38.76  ? 259 GLN A CB  1 
ATOM   2042  C CG  . GLN A 1 259 ? 38.095  -24.212 20.739  1.00 59.64  ? 259 GLN A CG  1 
ATOM   2043  C CD  . GLN A 1 259 ? 38.624  -25.622 20.617  1.00 75.87  ? 259 GLN A CD  1 
ATOM   2044  O OE1 . GLN A 1 259 ? 38.538  -26.411 21.559  1.00 70.38  ? 259 GLN A OE1 1 
ATOM   2045  N NE2 . GLN A 1 259 ? 39.154  -25.954 19.443  1.00 62.53  ? 259 GLN A NE2 1 
ATOM   2046  N N   . ARG A 1 260 ? 34.792  -24.532 19.882  1.00 33.65  ? 260 ARG A N   1 
ATOM   2047  C CA  . ARG A 1 260 ? 33.448  -24.158 20.283  1.00 31.89  ? 260 ARG A CA  1 
ATOM   2048  C C   . ARG A 1 260 ? 33.383  -22.951 21.180  1.00 30.89  ? 260 ARG A C   1 
ATOM   2049  O O   . ARG A 1 260 ? 34.312  -22.670 21.913  1.00 33.12  ? 260 ARG A O   1 
ATOM   2050  C CB  . ARG A 1 260 ? 32.673  -25.326 20.902  1.00 30.31  ? 260 ARG A CB  1 
ATOM   2051  C CG  . ARG A 1 260 ? 31.177  -25.021 21.091  1.00 23.08  ? 260 ARG A CG  1 
ATOM   2052  C CD  . ARG A 1 260 ? 30.478  -26.151 21.781  1.00 9.34   ? 260 ARG A CD  1 
ATOM   2053  N NE  . ARG A 1 260 ? 30.314  -27.294 20.884  1.00 15.34  ? 260 ARG A NE  1 
ATOM   2054  C CZ  . ARG A 1 260 ? 31.072  -28.391 20.882  1.00 29.15  ? 260 ARG A CZ  1 
ATOM   2055  N NH1 . ARG A 1 260 ? 32.079  -28.498 21.733  1.00 18.77  ? 260 ARG A NH1 1 
ATOM   2056  N NH2 . ARG A 1 260 ? 30.828  -29.385 20.018  1.00 15.02  ? 260 ARG A NH2 1 
ATOM   2057  N N   . ILE A 1 261 ? 32.259  -22.245 21.115  1.00 21.83  ? 261 ILE A N   1 
ATOM   2058  C CA  . ILE A 1 261 ? 31.978  -21.145 22.024  1.00 18.47  ? 261 ILE A CA  1 
ATOM   2059  C C   . ILE A 1 261 ? 30.624  -21.437 22.654  1.00 20.96  ? 261 ILE A C   1 
ATOM   2060  O O   . ILE A 1 261 ? 29.685  -21.819 21.966  1.00 21.37  ? 261 ILE A O   1 
ATOM   2061  C CB  . ILE A 1 261 ? 31.889  -19.781 21.304  1.00 19.29  ? 261 ILE A CB  1 
ATOM   2062  C CG1 . ILE A 1 261 ? 33.093  -19.544 20.388  1.00 17.06  ? 261 ILE A CG1 1 
ATOM   2063  C CG2 . ILE A 1 261 ? 31.676  -18.708 22.308  1.00 17.38  ? 261 ILE A CG2 1 
ATOM   2064  C CD1 . ILE A 1 261 ? 33.152  -18.175 19.847  1.00 18.83  ? 261 ILE A CD1 1 
ATOM   2065  N N   . VAL A 1 262 ? 30.540  -21.287 23.963  1.00 17.74  ? 262 VAL A N   1 
ATOM   2066  C CA  . VAL A 1 262 ? 29.292  -21.439 24.709  1.00 18.54  ? 262 VAL A CA  1 
ATOM   2067  C C   . VAL A 1 262 ? 28.906  -20.092 25.336  1.00 21.66  ? 262 VAL A C   1 
ATOM   2068  O O   . VAL A 1 262 ? 29.768  -19.334 25.793  1.00 20.06  ? 262 VAL A O   1 
ATOM   2069  C CB  . VAL A 1 262 ? 29.400  -22.554 25.812  1.00 23.24  ? 262 VAL A CB  1 
ATOM   2070  C CG1 . VAL A 1 262 ? 28.039  -22.749 26.558  1.00 22.09  ? 262 VAL A CG1 1 
ATOM   2071  C CG2 . VAL A 1 262 ? 29.882  -23.900 25.176  1.00 22.78  ? 262 VAL A CG2 1 
ATOM   2072  N N   . ILE A 1 263 ? 27.609  -19.767 25.295  1.00 18.88  ? 263 ILE A N   1 
ATOM   2073  C CA  . ILE A 1 263 ? 27.139  -18.463 25.747  1.00 19.87  ? 263 ILE A CA  1 
ATOM   2074  C C   . ILE A 1 263 ? 25.852  -18.584 26.531  1.00 22.83  ? 263 ILE A C   1 
ATOM   2075  O O   . ILE A 1 263 ? 24.824  -18.898 25.962  1.00 24.33  ? 263 ILE A O   1 
ATOM   2076  C CB  . ILE A 1 263 ? 26.989  -17.471 24.569  1.00 23.96  ? 263 ILE A CB  1 
ATOM   2077  C CG1 . ILE A 1 263 ? 28.376  -17.126 23.990  1.00 24.93  ? 263 ILE A CG1 1 
ATOM   2078  C CG2 . ILE A 1 263 ? 26.300  -16.196 25.035  1.00 26.42  ? 263 ILE A CG2 1 
ATOM   2079  C CD1 . ILE A 1 263 ? 28.484  -15.713 23.445  1.00 34.75  ? 263 ILE A CD1 1 
ATOM   2080  N N   . PHE A 1 264 ? 25.926  -18.348 27.841  1.00 17.68  ? 264 PHE A N   1 
ATOM   2081  C CA  . PHE A 1 264 ? 24.794  -18.504 28.766  1.00 16.72  ? 264 PHE A CA  1 
ATOM   2082  C C   . PHE A 1 264 ? 24.334  -17.199 29.441  1.00 18.63  ? 264 PHE A C   1 
ATOM   2083  O O   . PHE A 1 264 ? 25.008  -16.655 30.286  1.00 17.59  ? 264 PHE A O   1 
ATOM   2084  C CB  . PHE A 1 264 ? 25.120  -19.528 29.876  1.00 18.02  ? 264 PHE A CB  1 
ATOM   2085  C CG  . PHE A 1 264 ? 25.289  -20.941 29.380  1.00 20.34  ? 264 PHE A CG  1 
ATOM   2086  C CD1 . PHE A 1 264 ? 24.636  -21.386 28.227  1.00 23.93  ? 264 PHE A CD1 1 
ATOM   2087  C CD2 . PHE A 1 264 ? 26.115  -21.830 30.060  1.00 22.78  ? 264 PHE A CD2 1 
ATOM   2088  C CE1 . PHE A 1 264 ? 24.829  -22.696 27.731  1.00 24.70  ? 264 PHE A CE1 1 
ATOM   2089  C CE2 . PHE A 1 264 ? 26.265  -23.158 29.608  1.00 24.75  ? 264 PHE A CE2 1 
ATOM   2090  C CZ  . PHE A 1 264 ? 25.640  -23.578 28.428  1.00 22.99  ? 264 PHE A CZ  1 
ATOM   2091  N N   . THR A 1 265 ? 23.122  -16.786 29.130  1.00 14.64  ? 265 THR A N   1 
ATOM   2092  C CA  . THR A 1 265 ? 22.520  -15.638 29.704  1.00 15.00  ? 265 THR A CA  1 
ATOM   2093  C C   . THR A 1 265 ? 21.911  -15.964 31.051  1.00 24.34  ? 265 THR A C   1 
ATOM   2094  O O   . THR A 1 265 ? 21.432  -17.065 31.243  1.00 24.07  ? 265 THR A O   1 
ATOM   2095  C CB  . THR A 1 265 ? 21.497  -15.023 28.712  1.00 19.79  ? 265 THR A CB  1 
ATOM   2096  O OG1 . THR A 1 265 ? 20.398  -15.930 28.456  1.00 19.71  ? 265 THR A OG1 1 
ATOM   2097  C CG2 . THR A 1 265 ? 22.227  -14.714 27.428  1.00 11.81  ? 265 THR A CG2 1 
ATOM   2098  N N   . GLN A 1 266 ? 21.968  -15.011 31.992  1.00 25.61  ? 266 GLN A N   1 
ATOM   2099  C CA  . GLN A 1 266 ? 21.442  -15.232 33.342  1.00 25.58  ? 266 GLN A CA  1 
ATOM   2100  C C   . GLN A 1 266 ? 20.405  -14.217 33.809  1.00 34.85  ? 266 GLN A C   1 
ATOM   2101  O O   . GLN A 1 266 ? 20.350  -13.897 35.010  1.00 36.09  ? 266 GLN A O   1 
ATOM   2102  C CB  . GLN A 1 266 ? 22.594  -15.301 34.335  1.00 26.14  ? 266 GLN A CB  1 
ATOM   2103  C CG  . GLN A 1 266 ? 23.283  -16.650 34.346  1.00 25.84  ? 266 GLN A CG  1 
ATOM   2104  C CD  . GLN A 1 266 ? 24.476  -16.695 35.259  1.00 36.69  ? 266 GLN A CD  1 
ATOM   2105  O OE1 . GLN A 1 266 ? 25.364  -15.830 35.198  1.00 22.62  ? 266 GLN A OE1 1 
ATOM   2106  N NE2 . GLN A 1 266 ? 24.486  -17.685 36.168  1.00 24.64  ? 266 GLN A NE2 1 
ATOM   2107  N N   . GLY A 1 267 ? 19.542  -13.772 32.883  1.00 33.02  ? 267 GLY A N   1 
ATOM   2108  C CA  . GLY A 1 267 ? 18.535  -12.755 33.181  1.00 32.20  ? 267 GLY A CA  1 
ATOM   2109  C C   . GLY A 1 267 ? 19.293  -11.451 33.418  1.00 38.47  ? 267 GLY A C   1 
ATOM   2110  O O   . GLY A 1 267 ? 20.072  -11.001 32.552  1.00 37.53  ? 267 GLY A O   1 
ATOM   2111  N N   . ARG A 1 268 ? 19.167  -10.921 34.635  1.00 35.96  ? 268 ARG A N   1 
ATOM   2112  C CA  . ARG A 1 268 ? 19.862  -9.698  35.020  1.00 35.54  ? 268 ARG A CA  1 
ATOM   2113  C C   . ARG A 1 268 ? 21.315  -9.931  35.453  1.00 40.13  ? 268 ARG A C   1 
ATOM   2114  O O   . ARG A 1 268 ? 22.172  -9.095  35.192  1.00 38.69  ? 268 ARG A O   1 
ATOM   2115  C CB  . ARG A 1 268 ? 19.050  -8.945  36.043  1.00 34.09  ? 268 ARG A CB  1 
ATOM   2116  C CG  . ARG A 1 268 ? 17.604  -8.818  35.640  1.00 38.50  ? 268 ARG A CG  1 
ATOM   2117  C CD  . ARG A 1 268 ? 16.770  -8.233  36.761  1.00 60.12  ? 268 ARG A CD  1 
ATOM   2118  N NE  . ARG A 1 268 ? 16.865  -6.778  36.779  1.00 81.15  ? 268 ARG A NE  1 
ATOM   2119  C CZ  . ARG A 1 268 ? 17.260  -6.067  37.831  1.00 106.65 ? 268 ARG A CZ  1 
ATOM   2120  N NH1 . ARG A 1 268 ? 17.608  -6.681  38.957  1.00 96.86  ? 268 ARG A NH1 1 
ATOM   2121  N NH2 . ARG A 1 268 ? 17.323  -4.743  37.750  1.00 100.95 ? 268 ARG A NH2 1 
ATOM   2122  N N   . ASP A 1 269 ? 21.612  -11.146 35.911  1.00 39.01  ? 269 ASP A N   1 
ATOM   2123  C CA  . ASP A 1 269 ? 22.988  -11.547 36.229  1.00 39.48  ? 269 ASP A CA  1 
ATOM   2124  C C   . ASP A 1 269 ? 23.859  -11.660 35.005  1.00 41.79  ? 269 ASP A C   1 
ATOM   2125  O O   . ASP A 1 269 ? 23.367  -11.620 33.887  1.00 43.24  ? 269 ASP A O   1 
ATOM   2126  C CB  . ASP A 1 269 ? 23.017  -12.848 37.020  1.00 42.21  ? 269 ASP A CB  1 
ATOM   2127  C CG  . ASP A 1 269 ? 22.395  -12.687 38.375  1.00 61.38  ? 269 ASP A CG  1 
ATOM   2128  O OD1 . ASP A 1 269 ? 22.811  -11.747 39.090  1.00 66.08  ? 269 ASP A OD1 1 
ATOM   2129  O OD2 . ASP A 1 269 ? 21.385  -13.363 38.656  1.00 65.83  ? 269 ASP A OD2 1 
ATOM   2130  N N   . ASP A 1 270 ? 25.154  -11.813 35.221  1.00 36.82  ? 270 ASP A N   1 
ATOM   2131  C CA  . ASP A 1 270 ? 26.110  -11.848 34.118  1.00 36.47  ? 270 ASP A CA  1 
ATOM   2132  C C   . ASP A 1 270 ? 25.829  -12.916 33.064  1.00 41.41  ? 270 ASP A C   1 
ATOM   2133  O O   . ASP A 1 270 ? 25.231  -13.962 33.333  1.00 42.77  ? 270 ASP A O   1 
ATOM   2134  C CB  . ASP A 1 270 ? 27.530  -12.038 34.649  1.00 37.38  ? 270 ASP A CB  1 
ATOM   2135  C CG  . ASP A 1 270 ? 28.038  -10.832 35.416  1.00 44.97  ? 270 ASP A CG  1 
ATOM   2136  O OD1 . ASP A 1 270 ? 27.403  -9.745  35.372  1.00 42.79  ? 270 ASP A OD1 1 
ATOM   2137  O OD2 . ASP A 1 270 ? 29.111  -10.972 36.036  1.00 50.66  ? 270 ASP A OD2 1 
ATOM   2138  N N   . THR A 1 271 ? 26.292  -12.642 31.855  1.00 35.00  ? 271 THR A N   1 
ATOM   2139  C CA  . THR A 1 271 ? 26.254  -13.595 30.767  1.00 31.37  ? 271 THR A CA  1 
ATOM   2140  C C   . THR A 1 271 ? 27.594  -14.306 30.898  1.00 34.81  ? 271 THR A C   1 
ATOM   2141  O O   . THR A 1 271 ? 28.586  -13.725 31.374  1.00 35.24  ? 271 THR A O   1 
ATOM   2142  C CB  . THR A 1 271 ? 26.183  -12.836 29.435  1.00 24.39  ? 271 THR A CB  1 
ATOM   2143  O OG1 . THR A 1 271 ? 24.920  -12.159 29.362  1.00 33.39  ? 271 THR A OG1 1 
ATOM   2144  C CG2 . THR A 1 271 ? 26.360  -13.721 28.221  1.00 9.59   ? 271 THR A CG2 1 
ATOM   2145  N N   . ILE A 1 272 ? 27.613  -15.585 30.552  1.00 29.83  ? 272 ILE A N   1 
ATOM   2146  C CA  . ILE A 1 272 ? 28.845  -16.356 30.645  1.00 28.72  ? 272 ILE A CA  1 
ATOM   2147  C C   . ILE A 1 272 ? 29.291  -16.885 29.302  1.00 31.19  ? 272 ILE A C   1 
ATOM   2148  O O   . ILE A 1 272 ? 28.579  -17.669 28.679  1.00 30.47  ? 272 ILE A O   1 
ATOM   2149  C CB  . ILE A 1 272 ? 28.699  -17.552 31.630  1.00 31.05  ? 272 ILE A CB  1 
ATOM   2150  C CG1 . ILE A 1 272 ? 28.596  -17.041 33.075  1.00 31.46  ? 272 ILE A CG1 1 
ATOM   2151  C CG2 . ILE A 1 272 ? 29.879  -18.524 31.484  1.00 28.07  ? 272 ILE A CG2 1 
ATOM   2152  C CD1 . ILE A 1 272 ? 27.430  -17.603 33.779  1.00 38.86  ? 272 ILE A CD1 1 
ATOM   2153  N N   . MET A 1 273 ? 30.505  -16.529 28.895  1.00 28.20  ? 273 MET A N   1 
ATOM   2154  C CA  . MET A 1 273 ? 31.098  -17.045 27.649  1.00 28.08  ? 273 MET A CA  1 
ATOM   2155  C C   . MET A 1 273 ? 32.314  -17.927 27.926  1.00 30.14  ? 273 MET A C   1 
ATOM   2156  O O   . MET A 1 273 ? 33.281  -17.471 28.511  1.00 31.33  ? 273 MET A O   1 
ATOM   2157  C CB  . MET A 1 273 ? 31.536  -15.895 26.723  1.00 30.81  ? 273 MET A CB  1 
ATOM   2158  C CG  . MET A 1 273 ? 31.964  -16.354 25.320  1.00 35.29  ? 273 MET A CG  1 
ATOM   2159  S SD  . MET A 1 273 ? 32.935  -15.130 24.359  1.00 40.99  ? 273 MET A SD  1 
ATOM   2160  C CE  . MET A 1 273 ? 31.772  -14.505 23.194  1.00 37.64  ? 273 MET A CE  1 
ATOM   2161  N N   . ALA A 1 274 ? 32.297  -19.154 27.430  1.00 24.74  ? 274 ALA A N   1 
ATOM   2162  C CA  . ALA A 1 274 ? 33.411  -20.071 27.586  1.00 23.88  ? 274 ALA A CA  1 
ATOM   2163  C C   . ALA A 1 274 ? 33.945  -20.314 26.198  1.00 29.16  ? 274 ALA A C   1 
ATOM   2164  O O   . ALA A 1 274 ? 33.152  -20.406 25.252  1.00 29.19  ? 274 ALA A O   1 
ATOM   2165  C CB  . ALA A 1 274 ? 32.947  -21.374 28.182  1.00 24.62  ? 274 ALA A CB  1 
ATOM   2166  N N   . THR A 1 275 ? 35.279  -20.330 26.071  1.00 26.25  ? 275 THR A N   1 
ATOM   2167  C CA  . THR A 1 275 ? 35.993  -20.543 24.812  1.00 26.18  ? 275 THR A CA  1 
ATOM   2168  C C   . THR A 1 275 ? 37.105  -21.513 25.214  1.00 35.59  ? 275 THR A C   1 
ATOM   2169  O O   . THR A 1 275 ? 37.305  -21.713 26.413  1.00 38.01  ? 275 THR A O   1 
ATOM   2170  C CB  . THR A 1 275 ? 36.694  -19.242 24.312  1.00 29.21  ? 275 THR A CB  1 
ATOM   2171  O OG1 . THR A 1 275 ? 37.610  -18.763 25.303  1.00 38.89  ? 275 THR A OG1 1 
ATOM   2172  C CG2 . THR A 1 275 ? 35.708  -18.132 23.918  1.00 14.43  ? 275 THR A CG2 1 
ATOM   2173  N N   . GLU A 1 276 ? 37.823  -22.092 24.243  1.00 31.46  ? 276 GLU A N   1 
ATOM   2174  C CA  . GLU A 1 276 ? 38.930  -22.999 24.534  1.00 31.38  ? 276 GLU A CA  1 
ATOM   2175  C C   . GLU A 1 276 ? 39.841  -22.375 25.601  1.00 40.40  ? 276 GLU A C   1 
ATOM   2176  O O   . GLU A 1 276 ? 40.227  -23.019 26.594  1.00 37.89  ? 276 GLU A O   1 
ATOM   2177  C CB  . GLU A 1 276 ? 39.749  -23.219 23.262  1.00 32.59  ? 276 GLU A CB  1 
ATOM   2178  C CG  . GLU A 1 276 ? 40.834  -24.283 23.383  1.00 48.45  ? 276 GLU A CG  1 
ATOM   2179  C CD  . GLU A 1 276 ? 41.909  -24.180 22.295  1.00 76.49  ? 276 GLU A CD  1 
ATOM   2180  O OE1 . GLU A 1 276 ? 41.670  -23.477 21.283  1.00 59.41  ? 276 GLU A OE1 1 
ATOM   2181  O OE2 . GLU A 1 276 ? 42.958  -24.866 22.413  1.00 73.29  ? 276 GLU A OE2 1 
ATOM   2182  N N   . SER A 1 277 ? 40.140  -21.091 25.410  1.00 40.71  ? 277 SER A N   1 
ATOM   2183  C CA  . SER A 1 277 ? 41.011  -20.363 26.316  1.00 40.93  ? 277 SER A CA  1 
ATOM   2184  C C   . SER A 1 277 ? 40.496  -20.264 27.766  1.00 46.13  ? 277 SER A C   1 
ATOM   2185  O O   . SER A 1 277 ? 41.112  -20.844 28.659  1.00 48.11  ? 277 SER A O   1 
ATOM   2186  C CB  . SER A 1 277 ? 41.332  -19.028 25.683  1.00 44.25  ? 277 SER A CB  1 
ATOM   2187  O OG  . SER A 1 277 ? 41.079  -19.131 24.287  1.00 49.78  ? 277 SER A OG  1 
ATOM   2188  N N   . GLU A 1 278 ? 39.356  -19.603 27.989  1.00 40.33  ? 278 GLU A N   1 
ATOM   2189  C CA  . GLU A 1 278 ? 38.757  -19.476 29.328  1.00 38.73  ? 278 GLU A CA  1 
ATOM   2190  C C   . GLU A 1 278 ? 37.236  -19.313 29.345  1.00 39.20  ? 278 GLU A C   1 
ATOM   2191  O O   . GLU A 1 278 ? 36.584  -19.288 28.301  1.00 35.73  ? 278 GLU A O   1 
ATOM   2192  C CB  . GLU A 1 278 ? 39.317  -18.243 30.040  1.00 39.88  ? 278 GLU A CB  1 
ATOM   2193  C CG  . GLU A 1 278 ? 40.800  -18.221 30.196  1.00 60.87  ? 278 GLU A CG  1 
ATOM   2194  C CD  . GLU A 1 278 ? 41.220  -17.405 31.405  1.00 98.05  ? 278 GLU A CD  1 
ATOM   2195  O OE1 . GLU A 1 278 ? 40.365  -16.651 31.929  1.00 113.26 ? 278 GLU A OE1 1 
ATOM   2196  O OE2 . GLU A 1 278 ? 42.384  -17.537 31.852  1.00 81.29  ? 278 GLU A OE2 1 
ATOM   2197  N N   . VAL A 1 279 ? 36.729  -19.028 30.549  1.00 36.07  ? 279 VAL A N   1 
ATOM   2198  C CA  . VAL A 1 279 ? 35.324  -18.712 30.798  1.00 34.93  ? 279 VAL A CA  1 
ATOM   2199  C C   . VAL A 1 279 ? 35.292  -17.291 31.402  1.00 40.51  ? 279 VAL A C   1 
ATOM   2200  O O   . VAL A 1 279 ? 35.950  -17.039 32.402  1.00 39.91  ? 279 VAL A O   1 
ATOM   2201  C CB  . VAL A 1 279 ? 34.704  -19.713 31.819  1.00 36.84  ? 279 VAL A CB  1 
ATOM   2202  C CG1 . VAL A 1 279 ? 33.218  -19.425 32.047  1.00 37.42  ? 279 VAL A CG1 1 
ATOM   2203  C CG2 . VAL A 1 279 ? 34.909  -21.164 31.419  1.00 34.96  ? 279 VAL A CG2 1 
ATOM   2204  N N   . THR A 1 280 ? 34.559  -16.375 30.767  1.00 38.62  ? 280 THR A N   1 
ATOM   2205  C CA  . THR A 1 280 ? 34.452  -14.967 31.205  1.00 37.67  ? 280 THR A CA  1 
ATOM   2206  C C   . THR A 1 280 ? 33.020  -14.515 31.471  1.00 35.77  ? 280 THR A C   1 
ATOM   2207  O O   . THR A 1 280 ? 32.101  -14.933 30.777  1.00 34.03  ? 280 THR A O   1 
ATOM   2208  C CB  . THR A 1 280 ? 35.003  -14.030 30.100  1.00 50.02  ? 280 THR A CB  1 
ATOM   2209  O OG1 . THR A 1 280 ? 36.420  -14.206 29.983  1.00 51.23  ? 280 THR A OG1 1 
ATOM   2210  C CG2 . THR A 1 280 ? 34.648  -12.568 30.376  1.00 45.99  ? 280 THR A CG2 1 
ATOM   2211  N N   . ALA A 1 281 ? 32.845  -13.593 32.410  1.00 31.95  ? 281 ALA A N   1 
ATOM   2212  C CA  . ALA A 1 281 ? 31.507  -13.077 32.714  1.00 31.58  ? 281 ALA A CA  1 
ATOM   2213  C C   . ALA A 1 281 ? 31.307  -11.642 32.214  1.00 37.03  ? 281 ALA A C   1 
ATOM   2214  O O   . ALA A 1 281 ? 32.252  -10.869 32.135  1.00 38.25  ? 281 ALA A O   1 
ATOM   2215  C CB  . ALA A 1 281 ? 31.195  -13.205 34.195  1.00 31.67  ? 281 ALA A CB  1 
ATOM   2216  N N   . PHE A 1 282 ? 30.098  -11.322 31.777  1.00 33.32  ? 282 PHE A N   1 
ATOM   2217  C CA  . PHE A 1 282 ? 29.838  -9.991  31.233  1.00 32.74  ? 282 PHE A CA  1 
ATOM   2218  C C   . PHE A 1 282 ? 28.592  -9.399  31.854  1.00 39.19  ? 282 PHE A C   1 
ATOM   2219  O O   . PHE A 1 282 ? 27.493  -9.941  31.695  1.00 39.54  ? 282 PHE A O   1 
ATOM   2220  C CB  . PHE A 1 282 ? 29.633  -10.102 29.727  1.00 33.72  ? 282 PHE A CB  1 
ATOM   2221  C CG  . PHE A 1 282 ? 30.873  -10.501 28.976  1.00 32.98  ? 282 PHE A CG  1 
ATOM   2222  C CD1 . PHE A 1 282 ? 31.701  -9.546  28.425  1.00 34.02  ? 282 PHE A CD1 1 
ATOM   2223  C CD2 . PHE A 1 282 ? 31.221  -11.824 28.845  1.00 32.80  ? 282 PHE A CD2 1 
ATOM   2224  C CE1 . PHE A 1 282 ? 32.834  -9.915  27.734  1.00 33.66  ? 282 PHE A CE1 1 
ATOM   2225  C CE2 . PHE A 1 282 ? 32.405  -12.183 28.217  1.00 34.75  ? 282 PHE A CE2 1 
ATOM   2226  C CZ  . PHE A 1 282 ? 33.199  -11.230 27.653  1.00 31.56  ? 282 PHE A CZ  1 
ATOM   2227  N N   . ALA A 1 283 ? 28.754  -8.280  32.549  1.00 36.51  ? 283 ALA A N   1 
ATOM   2228  C CA  . ALA A 1 283 ? 27.621  -7.601  33.185  1.00 35.61  ? 283 ALA A CA  1 
ATOM   2229  C C   . ALA A 1 283 ? 26.637  -7.049  32.167  1.00 39.41  ? 283 ALA A C   1 
ATOM   2230  O O   . ALA A 1 283 ? 27.019  -6.507  31.135  1.00 37.84  ? 283 ALA A O   1 
ATOM   2231  C CB  . ALA A 1 283 ? 28.111  -6.501  34.087  1.00 35.93  ? 283 ALA A CB  1 
ATOM   2232  N N   . VAL A 1 284 ? 25.362  -7.156  32.482  1.00 40.36  ? 284 VAL A N   1 
ATOM   2233  C CA  . VAL A 1 284 ? 24.322  -6.649  31.594  1.00 42.65  ? 284 VAL A CA  1 
ATOM   2234  C C   . VAL A 1 284 ? 24.089  -5.147  31.757  1.00 53.36  ? 284 VAL A C   1 
ATOM   2235  O O   . VAL A 1 284 ? 24.439  -4.552  32.784  1.00 53.39  ? 284 VAL A O   1 
ATOM   2236  C CB  . VAL A 1 284 ? 23.007  -7.397  31.814  1.00 45.51  ? 284 VAL A CB  1 
ATOM   2237  C CG1 . VAL A 1 284 ? 21.932  -6.818  30.919  1.00 45.43  ? 284 VAL A CG1 1 
ATOM   2238  C CG2 . VAL A 1 284 ? 23.214  -8.878  31.551  1.00 44.69  ? 284 VAL A CG2 1 
ATOM   2239  N N   . LEU A 1 285 ? 23.517  -4.533  30.726  1.00 54.60  ? 285 LEU A N   1 
ATOM   2240  C CA  . LEU A 1 285 ? 23.229  -3.092  30.742  1.00 55.74  ? 285 LEU A CA  1 
ATOM   2241  C C   . LEU A 1 285 ? 22.275  -2.688  31.869  1.00 63.25  ? 285 LEU A C   1 
ATOM   2242  O O   . LEU A 1 285 ? 21.210  -3.305  32.054  1.00 61.95  ? 285 LEU A O   1 
ATOM   2243  C CB  . LEU A 1 285 ? 22.662  -2.631  29.396  1.00 55.37  ? 285 LEU A CB  1 
ATOM   2244  C CG  . LEU A 1 285 ? 23.510  -3.002  28.187  1.00 60.14  ? 285 LEU A CG  1 
ATOM   2245  C CD1 . LEU A 1 285 ? 23.234  -2.036  27.028  1.00 59.82  ? 285 LEU A CD1 1 
ATOM   2246  C CD2 . LEU A 1 285 ? 24.985  -3.038  28.589  1.00 63.67  ? 285 LEU A CD2 1 
ATOM   2247  N N   . ASP A 1 286 ? 22.641  -1.620  32.583  1.00 63.14  ? 286 ASP A N   1 
ATOM   2248  C CA  . ASP A 1 286 ? 21.825  -1.107  33.680  1.00 64.20  ? 286 ASP A CA  1 
ATOM   2249  C C   . ASP A 1 286 ? 20.415  -0.718  33.271  1.00 68.72  ? 286 ASP A C   1 
ATOM   2250  O O   . ASP A 1 286 ? 19.918  0.349   33.637  1.00 69.30  ? 286 ASP A O   1 
ATOM   2251  C CB  . ASP A 1 286 ? 22.529  0.024   34.418  1.00 67.01  ? 286 ASP A CB  1 
ATOM   2252  C CG  . ASP A 1 286 ? 23.598  -0.494  35.350  1.00 84.01  ? 286 ASP A CG  1 
ATOM   2253  O OD1 . ASP A 1 286 ? 23.245  -1.332  36.209  1.00 85.14  ? 286 ASP A OD1 1 
ATOM   2254  O OD2 . ASP A 1 286 ? 24.796  -0.215  35.114  1.00 91.62  ? 286 ASP A OD2 1 
ATOM   2255  N N   . GLN A 1 287 ? 19.764  -1.630  32.558  1.00 65.74  ? 287 GLN A N   1 
ATOM   2256  C CA  . GLN A 1 287 ? 18.397  -1.440  32.109  1.00 66.63  ? 287 GLN A CA  1 
ATOM   2257  C C   . GLN A 1 287 ? 17.425  -1.710  33.262  1.00 70.34  ? 287 GLN A C   1 
ATOM   2258  O O   . GLN A 1 287 ? 16.386  -2.350  33.069  1.00 69.20  ? 287 GLN A O   1 
ATOM   2259  C CB  . GLN A 1 287 ? 18.096  -2.389  30.939  1.00 68.78  ? 287 GLN A CB  1 
ATOM   2260  C CG  . GLN A 1 287 ? 18.446  -3.850  31.220  1.00 90.87  ? 287 GLN A CG  1 
ATOM   2261  C CD  . GLN A 1 287 ? 18.209  -4.753  30.021  1.00 106.24 ? 287 GLN A CD  1 
ATOM   2262  O OE1 . GLN A 1 287 ? 17.070  -4.976  29.605  1.00 100.55 ? 287 GLN A OE1 1 
ATOM   2263  N NE2 . GLN A 1 287 ? 19.291  -5.296  29.473  1.00 95.08  ? 287 GLN A NE2 1 
ATOM   2264  N N   . ASP A 1 288 ? 17.784  -1.224  34.450  1.00 67.38  ? 288 ASP A N   1 
ATOM   2265  C CA  . ASP A 1 288 ? 16.975  -1.374  35.663  1.00 67.42  ? 288 ASP A CA  1 
ATOM   2266  C C   . ASP A 1 288 ? 15.527  -0.926  35.486  1.00 70.85  ? 288 ASP A C   1 
ATOM   2267  O O   . ASP A 1 288 ? 15.102  -0.582  34.386  1.00 70.01  ? 288 ASP A O   1 
ATOM   2268  C CB  . ASP A 1 288 ? 17.601  -0.578  36.809  1.00 69.78  ? 288 ASP A CB  1 
ATOM   2269  C CG  . ASP A 1 288 ? 19.031  -0.973  37.067  1.00 87.17  ? 288 ASP A CG  1 
ATOM   2270  O OD1 . ASP A 1 288 ? 19.248  -2.128  37.498  1.00 89.15  ? 288 ASP A OD1 1 
ATOM   2271  O OD2 . ASP A 1 288 ? 19.932  -0.144  36.788  1.00 97.28  ? 288 ASP A OD2 1 
ATOM   2272  N N   . GLN A 1 289 ? 14.785  -0.914  36.590  1.00 68.57  ? 289 GLN A N   1 
ATOM   2273  C CA  . GLN A 1 289 ? 13.374  -0.486  36.602  1.00 68.46  ? 289 GLN A CA  1 
ATOM   2274  C C   . GLN A 1 289 ? 12.532  -1.019  35.431  1.00 70.86  ? 289 GLN A C   1 
ATOM   2275  O O   . GLN A 1 289 ? 11.423  -0.532  35.177  1.00 69.18  ? 289 GLN A O   1 
ATOM   2276  C CB  . GLN A 1 289 ? 13.290  1.040   36.646  1.00 70.00  ? 289 GLN A CB  1 
ATOM   2277  C CG  . GLN A 1 289 ? 13.902  1.702   35.434  1.00 87.22  ? 289 GLN A CG  1 
ATOM   2278  C CD  . GLN A 1 289 ? 13.780  3.197   35.478  1.00 110.76 ? 289 GLN A CD  1 
ATOM   2279  O OE1 . GLN A 1 289 ? 12.905  3.772   34.830  1.00 105.08 ? 289 GLN A OE1 1 
ATOM   2280  N NE2 . GLN A 1 289 ? 14.648  3.843   36.255  1.00 106.67 ? 289 GLN A NE2 1 
ATOM   2281  N N   . LYS A 1 290 ? 13.069  -2.014  34.723  1.00 67.71  ? 290 LYS A N   1 
ATOM   2282  C CA  . LYS A 1 290 ? 12.405  -2.585  33.553  1.00 67.20  ? 290 LYS A CA  1 
ATOM   2283  C C   . LYS A 1 290 ? 11.252  -3.521  33.868  1.00 71.87  ? 290 LYS A C   1 
ATOM   2284  O O   . LYS A 1 290 ? 10.521  -3.939  32.959  1.00 72.23  ? 290 LYS A O   1 
ATOM   2285  C CB  . LYS A 1 290 ? 13.407  -3.284  32.643  1.00 69.18  ? 290 LYS A CB  1 
ATOM   2286  C CG  . LYS A 1 290 ? 14.395  -4.172  33.366  1.00 92.75  ? 290 LYS A CG  1 
ATOM   2287  C CD  . LYS A 1 290 ? 13.785  -4.871  34.562  1.00 107.59 ? 290 LYS A CD  1 
ATOM   2288  C CE  . LYS A 1 290 ? 14.794  -5.836  35.151  1.00 123.76 ? 290 LYS A CE  1 
ATOM   2289  N NZ  . LYS A 1 290 ? 16.087  -5.746  34.406  1.00 132.57 ? 290 LYS A NZ  1 
ATOM   2290  N N   . GLU A 1 291 ? 11.113  -3.847  35.152  1.00 67.93  ? 291 GLU A N   1 
ATOM   2291  C CA  . GLU A 1 291 ? 10.080  -4.756  35.652  1.00 67.18  ? 291 GLU A CA  1 
ATOM   2292  C C   . GLU A 1 291 ? 9.439   -5.729  34.651  1.00 69.73  ? 291 GLU A C   1 
ATOM   2293  O O   . GLU A 1 291 ? 9.925   -6.857  34.468  1.00 69.62  ? 291 GLU A O   1 
ATOM   2294  C CB  . GLU A 1 291 ? 9.047   -4.027  36.513  1.00 68.58  ? 291 GLU A CB  1 
ATOM   2295  C CG  . GLU A 1 291 ? 8.111   -3.086  35.773  1.00 83.05  ? 291 GLU A CG  1 
ATOM   2296  C CD  . GLU A 1 291 ? 7.049   -2.476  36.692  1.00 111.33 ? 291 GLU A CD  1 
ATOM   2297  O OE1 . GLU A 1 291 ? 6.161   -3.230  37.154  1.00 100.79 ? 291 GLU A OE1 1 
ATOM   2298  O OE2 . GLU A 1 291 ? 7.117   -1.256  36.974  1.00 109.58 ? 291 GLU A OE2 1 
ATOM   2299  N N   . ILE A 1 292 ? 8.368   -5.290  33.992  1.00 64.08  ? 292 ILE A N   1 
ATOM   2300  C CA  . ILE A 1 292 ? 7.706   -6.144  33.021  1.00 63.48  ? 292 ILE A CA  1 
ATOM   2301  C C   . ILE A 1 292 ? 8.584   -6.358  31.791  1.00 67.64  ? 292 ILE A C   1 
ATOM   2302  O O   . ILE A 1 292 ? 8.413   -5.693  30.766  1.00 69.44  ? 292 ILE A O   1 
ATOM   2303  C CB  . ILE A 1 292 ? 6.305   -5.640  32.622  1.00 66.60  ? 292 ILE A CB  1 
ATOM   2304  C CG1 . ILE A 1 292 ? 5.587   -5.031  33.839  1.00 67.48  ? 292 ILE A CG1 1 
ATOM   2305  C CG2 . ILE A 1 292 ? 5.478   -6.798  32.035  1.00 66.57  ? 292 ILE A CG2 1 
ATOM   2306  C CD1 . ILE A 1 292 ? 4.137   -4.620  33.568  1.00 73.21  ? 292 ILE A CD1 1 
ATOM   2307  N N   . ILE A 1 293 ? 9.548   -7.272  31.918  1.00 60.83  ? 293 ILE A N   1 
ATOM   2308  C CA  . ILE A 1 293 ? 10.459  -7.594  30.826  1.00 58.69  ? 293 ILE A CA  1 
ATOM   2309  C C   . ILE A 1 293 ? 10.536  -9.098  30.508  1.00 58.88  ? 293 ILE A C   1 
ATOM   2310  O O   . ILE A 1 293 ? 11.158  -9.890  31.234  1.00 58.42  ? 293 ILE A O   1 
ATOM   2311  C CB  . ILE A 1 293 ? 11.860  -6.999  31.044  1.00 61.06  ? 293 ILE A CB  1 
ATOM   2312  C CG1 . ILE A 1 293 ? 12.226  -7.042  32.525  1.00 60.47  ? 293 ILE A CG1 1 
ATOM   2313  C CG2 . ILE A 1 293 ? 11.876  -5.555  30.604  1.00 62.65  ? 293 ILE A CG2 1 
ATOM   2314  C CD1 . ILE A 1 293 ? 13.696  -7.251  32.777  1.00 64.97  ? 293 ILE A CD1 1 
ATOM   2315  N N   . ASP A 1 294 ? 9.889   -9.478  29.409  1.00 50.24  ? 294 ASP A N   1 
ATOM   2316  C CA  . ASP A 1 294 ? 9.887   -10.854 28.932  1.00 46.30  ? 294 ASP A CA  1 
ATOM   2317  C C   . ASP A 1 294 ? 11.310  -11.461 28.907  1.00 42.50  ? 294 ASP A C   1 
ATOM   2318  O O   . ASP A 1 294 ? 12.052  -11.271 27.941  1.00 41.85  ? 294 ASP A O   1 
ATOM   2319  C CB  . ASP A 1 294 ? 9.320   -10.842 27.518  1.00 47.39  ? 294 ASP A CB  1 
ATOM   2320  C CG  . ASP A 1 294 ? 8.942   -12.194 27.042  1.00 54.40  ? 294 ASP A CG  1 
ATOM   2321  O OD1 . ASP A 1 294 ? 8.426   -12.294 25.904  1.00 55.55  ? 294 ASP A OD1 1 
ATOM   2322  O OD2 . ASP A 1 294 ? 9.081   -13.137 27.842  1.00 58.75  ? 294 ASP A OD2 1 
ATOM   2323  N N   . THR A 1 295 ? 11.694  -12.197 29.949  1.00 33.13  ? 295 THR A N   1 
ATOM   2324  C CA  . THR A 1 295 ? 13.010  -12.879 29.973  1.00 30.62  ? 295 THR A CA  1 
ATOM   2325  C C   . THR A 1 295 ? 13.266  -13.729 28.709  1.00 31.96  ? 295 THR A C   1 
ATOM   2326  O O   . THR A 1 295 ? 14.344  -13.703 28.105  1.00 32.49  ? 295 THR A O   1 
ATOM   2327  C CB  . THR A 1 295 ? 13.140  -13.825 31.175  1.00 32.60  ? 295 THR A CB  1 
ATOM   2328  O OG1 . THR A 1 295 ? 12.842  -13.115 32.376  1.00 48.87  ? 295 THR A OG1 1 
ATOM   2329  C CG2 . THR A 1 295 ? 14.504  -14.337 31.288  1.00 20.94  ? 295 THR A CG2 1 
ATOM   2330  N N   . ASN A 1 296 ? 12.266  -14.497 28.308  1.00 25.35  ? 296 ASN A N   1 
ATOM   2331  C CA  . ASN A 1 296 ? 12.364  -15.294 27.091  1.00 23.61  ? 296 ASN A CA  1 
ATOM   2332  C C   . ASN A 1 296 ? 12.605  -14.416 25.847  1.00 23.41  ? 296 ASN A C   1 
ATOM   2333  O O   . ASN A 1 296 ? 13.556  -14.656 25.089  1.00 22.96  ? 296 ASN A O   1 
ATOM   2334  C CB  . ASN A 1 296 ? 11.094  -16.134 26.909  1.00 22.60  ? 296 ASN A CB  1 
ATOM   2335  C CG  . ASN A 1 296 ? 10.747  -16.985 28.152  1.00 39.44  ? 296 ASN A CG  1 
ATOM   2336  O OD1 . ASN A 1 296 ? 9.546   -17.092 28.524  1.00 32.53  ? 296 ASN A OD1 1 
ATOM   2337  N ND2 . ASN A 1 296 ? 11.737  -17.767 28.641  1.00 18.60  ? 296 ASN A ND2 1 
ATOM   2338  N N   . GLY A 1 297 ? 11.756  -13.403 25.658  1.00 15.55  ? 297 GLY A N   1 
ATOM   2339  C CA  . GLY A 1 297 ? 11.867  -12.478 24.549  1.00 14.38  ? 297 GLY A CA  1 
ATOM   2340  C C   . GLY A 1 297 ? 13.216  -11.788 24.613  1.00 23.22  ? 297 GLY A C   1 
ATOM   2341  O O   . GLY A 1 297 ? 13.846  -11.501 23.572  1.00 24.45  ? 297 GLY A O   1 
ATOM   2342  N N   . ALA A 1 298 ? 13.686  -11.565 25.839  1.00 20.55  ? 298 ALA A N   1 
ATOM   2343  C CA  . ALA A 1 298 ? 14.968  -10.906 26.067  1.00 20.72  ? 298 ALA A CA  1 
ATOM   2344  C C   . ALA A 1 298 ? 16.066  -11.809 25.568  1.00 24.02  ? 298 ALA A C   1 
ATOM   2345  O O   . ALA A 1 298 ? 16.960  -11.387 24.849  1.00 25.50  ? 298 ALA A O   1 
ATOM   2346  C CB  . ALA A 1 298 ? 15.136  -10.650 27.534  1.00 22.05  ? 298 ALA A CB  1 
ATOM   2347  N N   . GLY A 1 299 ? 15.948  -13.087 25.893  1.00 18.62  ? 299 GLY A N   1 
ATOM   2348  C CA  . GLY A 1 299 ? 16.926  -14.067 25.442  1.00 15.64  ? 299 GLY A CA  1 
ATOM   2349  C C   . GLY A 1 299 ? 17.042  -14.068 23.960  1.00 16.37  ? 299 GLY A C   1 
ATOM   2350  O O   . GLY A 1 299 ? 18.150  -14.182 23.459  1.00 15.81  ? 299 GLY A O   1 
ATOM   2351  N N   . ASP A 1 300 ? 15.906  -14.017 23.255  1.00 13.14  ? 300 ASP A N   1 
ATOM   2352  C CA  . ASP A 1 300 ? 15.889  -14.114 21.796  1.00 14.28  ? 300 ASP A CA  1 
ATOM   2353  C C   . ASP A 1 300 ? 16.572  -12.902 21.135  1.00 20.38  ? 300 ASP A C   1 
ATOM   2354  O O   . ASP A 1 300 ? 17.285  -13.022 20.124  1.00 20.51  ? 300 ASP A O   1 
ATOM   2355  C CB  . ASP A 1 300 ? 14.433  -14.154 21.328  1.00 17.31  ? 300 ASP A CB  1 
ATOM   2356  C CG  . ASP A 1 300 ? 13.757  -15.509 21.522  1.00 22.44  ? 300 ASP A CG  1 
ATOM   2357  O OD1 . ASP A 1 300 ? 14.410  -16.523 21.886  1.00 19.75  ? 300 ASP A OD1 1 
ATOM   2358  O OD2 . ASP A 1 300 ? 12.553  -15.520 21.239  1.00 26.06  ? 300 ASP A OD2 1 
ATOM   2359  N N   . ALA A 1 301 ? 16.287  -11.729 21.698  1.00 18.41  ? 301 ALA A N   1 
ATOM   2360  C CA  . ALA A 1 301 ? 16.836  -10.452 21.238  1.00 19.24  ? 301 ALA A CA  1 
ATOM   2361  C C   . ALA A 1 301 ? 18.340  -10.383 21.486  1.00 23.97  ? 301 ALA A C   1 
ATOM   2362  O O   . ALA A 1 301 ? 19.093  -9.858  20.641  1.00 27.24  ? 301 ALA A O   1 
ATOM   2363  C CB  . ALA A 1 301 ? 16.156  -9.313  21.941  1.00 20.68  ? 301 ALA A CB  1 
ATOM   2364  N N   . PHE A 1 302 ? 18.779  -10.902 22.636  1.00 14.09  ? 302 PHE A N   1 
ATOM   2365  C CA  . PHE A 1 302 ? 20.193  -11.118 22.883  1.00 11.05  ? 302 PHE A CA  1 
ATOM   2366  C C   . PHE A 1 302 ? 20.822  -11.854 21.733  1.00 14.66  ? 302 PHE A C   1 
ATOM   2367  O O   . PHE A 1 302 ? 21.767  -11.353 21.133  1.00 17.52  ? 302 PHE A O   1 
ATOM   2368  C CB  . PHE A 1 302 ? 20.449  -11.954 24.141  1.00 12.30  ? 302 PHE A CB  1 
ATOM   2369  C CG  . PHE A 1 302 ? 21.913  -12.161 24.408  1.00 12.95  ? 302 PHE A CG  1 
ATOM   2370  C CD1 . PHE A 1 302 ? 22.701  -11.109 24.870  1.00 13.61  ? 302 PHE A CD1 1 
ATOM   2371  C CD2 . PHE A 1 302 ? 22.543  -13.315 23.977  1.00 12.69  ? 302 PHE A CD2 1 
ATOM   2372  C CE1 . PHE A 1 302 ? 24.071  -11.254 24.963  1.00 14.44  ? 302 PHE A CE1 1 
ATOM   2373  C CE2 . PHE A 1 302 ? 23.892  -13.463 24.122  1.00 14.24  ? 302 PHE A CE2 1 
ATOM   2374  C CZ  . PHE A 1 302 ? 24.655  -12.431 24.612  1.00 11.82  ? 302 PHE A CZ  1 
ATOM   2375  N N   . VAL A 1 303 ? 20.344  -13.052 21.420  1.00 12.06  ? 303 VAL A N   1 
ATOM   2376  C CA  . VAL A 1 303 ? 20.965  -13.796 20.308  1.00 12.95  ? 303 VAL A CA  1 
ATOM   2377  C C   . VAL A 1 303 ? 20.938  -13.024 18.973  1.00 20.74  ? 303 VAL A C   1 
ATOM   2378  O O   . VAL A 1 303 ? 21.895  -13.085 18.194  1.00 21.59  ? 303 VAL A O   1 
ATOM   2379  C CB  . VAL A 1 303 ? 20.327  -15.157 20.069  1.00 15.62  ? 303 VAL A CB  1 
ATOM   2380  C CG1 . VAL A 1 303 ? 20.996  -15.804 18.813  1.00 16.43  ? 303 VAL A CG1 1 
ATOM   2381  C CG2 . VAL A 1 303 ? 20.395  -16.027 21.305  1.00 13.97  ? 303 VAL A CG2 1 
ATOM   2382  N N   . GLY A 1 304 ? 19.825  -12.348 18.693  1.00 18.04  ? 304 GLY A N   1 
ATOM   2383  C CA  . GLY A 1 304 ? 19.727  -11.520 17.479  1.00 19.08  ? 304 GLY A CA  1 
ATOM   2384  C C   . GLY A 1 304 ? 20.844  -10.449 17.448  1.00 21.31  ? 304 GLY A C   1 
ATOM   2385  O O   . GLY A 1 304 ? 21.593  -10.355 16.473  1.00 17.04  ? 304 GLY A O   1 
ATOM   2386  N N   . GLY A 1 305 ? 21.020  -9.728  18.565  1.00 19.55  ? 305 GLY A N   1 
ATOM   2387  C CA  . GLY A 1 305 ? 22.087  -8.733  18.667  1.00 20.46  ? 305 GLY A CA  1 
ATOM   2388  C C   . GLY A 1 305 ? 23.444  -9.397  18.399  1.00 25.25  ? 305 GLY A C   1 
ATOM   2389  O O   . GLY A 1 305 ? 24.238  -8.954  17.550  1.00 25.44  ? 305 GLY A O   1 
ATOM   2390  N N   . PHE A 1 306 ? 23.702  -10.485 19.116  1.00 19.39  ? 306 PHE A N   1 
ATOM   2391  C CA  . PHE A 1 306 ? 24.982  -11.183 18.977  1.00 17.56  ? 306 PHE A CA  1 
ATOM   2392  C C   . PHE A 1 306 ? 25.214  -11.605 17.537  1.00 22.47  ? 306 PHE A C   1 
ATOM   2393  O O   . PHE A 1 306 ? 26.317  -11.428 17.007  1.00 23.12  ? 306 PHE A O   1 
ATOM   2394  C CB  . PHE A 1 306 ? 25.016  -12.362 19.942  1.00 18.32  ? 306 PHE A CB  1 
ATOM   2395  C CG  . PHE A 1 306 ? 26.317  -13.075 19.992  1.00 18.96  ? 306 PHE A CG  1 
ATOM   2396  C CD1 . PHE A 1 306 ? 26.710  -13.937 18.957  1.00 20.51  ? 306 PHE A CD1 1 
ATOM   2397  C CD2 . PHE A 1 306 ? 27.124  -12.974 21.120  1.00 20.20  ? 306 PHE A CD2 1 
ATOM   2398  C CE1 . PHE A 1 306 ? 27.929  -14.595 19.017  1.00 19.87  ? 306 PHE A CE1 1 
ATOM   2399  C CE2 . PHE A 1 306 ? 28.366  -13.625 21.176  1.00 21.08  ? 306 PHE A CE2 1 
ATOM   2400  C CZ  . PHE A 1 306 ? 28.747  -14.446 20.137  1.00 18.15  ? 306 PHE A CZ  1 
ATOM   2401  N N   . LEU A 1 307 ? 24.163  -12.128 16.881  1.00 19.48  ? 307 LEU A N   1 
ATOM   2402  C CA  . LEU A 1 307 ? 24.255  -12.570 15.470  1.00 17.87  ? 307 LEU A CA  1 
ATOM   2403  C C   . LEU A 1 307 ? 24.495  -11.412 14.494  1.00 19.64  ? 307 LEU A C   1 
ATOM   2404  O O   . LEU A 1 307 ? 25.266  -11.538 13.535  1.00 14.89  ? 307 LEU A O   1 
ATOM   2405  C CB  . LEU A 1 307 ? 23.013  -13.348 15.061  1.00 18.32  ? 307 LEU A CB  1 
ATOM   2406  C CG  . LEU A 1 307 ? 22.758  -14.716 15.704  1.00 24.28  ? 307 LEU A CG  1 
ATOM   2407  C CD1 . LEU A 1 307 ? 21.619  -15.427 14.973  1.00 24.41  ? 307 LEU A CD1 1 
ATOM   2408  C CD2 . LEU A 1 307 ? 23.993  -15.585 15.699  1.00 25.22  ? 307 LEU A CD2 1 
ATOM   2409  N N   . SER A 1 308 ? 23.833  -10.285 14.744  1.00 20.28  ? 308 SER A N   1 
ATOM   2410  C CA  . SER A 1 308 ? 24.063  -9.081  13.952  1.00 22.50  ? 308 SER A CA  1 
ATOM   2411  C C   . SER A 1 308 ? 25.550  -8.737  13.784  1.00 31.44  ? 308 SER A C   1 
ATOM   2412  O O   . SER A 1 308 ? 25.965  -8.454  12.668  1.00 34.90  ? 308 SER A O   1 
ATOM   2413  C CB  . SER A 1 308 ? 23.330  -7.891  14.554  1.00 26.17  ? 308 SER A CB  1 
ATOM   2414  O OG  . SER A 1 308 ? 23.884  -7.582  15.813  1.00 33.92  ? 308 SER A OG  1 
ATOM   2415  N N   . GLN A 1 309 ? 26.343  -8.776  14.863  1.00 27.59  ? 309 GLN A N   1 
ATOM   2416  C CA  . GLN A 1 309 ? 27.791  -8.470  14.791  1.00 27.38  ? 309 GLN A CA  1 
ATOM   2417  C C   . GLN A 1 309 ? 28.639  -9.614  14.273  1.00 36.22  ? 309 GLN A C   1 
ATOM   2418  O O   . GLN A 1 309 ? 29.448  -9.427  13.365  1.00 36.56  ? 309 GLN A O   1 
ATOM   2419  C CB  . GLN A 1 309 ? 28.316  -7.990  16.143  1.00 27.65  ? 309 GLN A CB  1 
ATOM   2420  C CG  . GLN A 1 309 ? 27.522  -6.783  16.688  1.00 23.01  ? 309 GLN A CG  1 
ATOM   2421  C CD  . GLN A 1 309 ? 27.418  -5.665  15.648  1.00 32.59  ? 309 GLN A CD  1 
ATOM   2422  O OE1 . GLN A 1 309 ? 28.416  -5.286  15.054  1.00 27.67  ? 309 GLN A OE1 1 
ATOM   2423  N NE2 . GLN A 1 309 ? 26.189  -5.244  15.324  1.00 31.50  ? 309 GLN A NE2 1 
ATOM   2424  N N   . LEU A 1 310 ? 28.399  -10.804 14.829  1.00 35.61  ? 310 LEU A N   1 
ATOM   2425  C CA  . LEU A 1 310 ? 29.083  -12.042 14.463  1.00 34.82  ? 310 LEU A CA  1 
ATOM   2426  C C   . LEU A 1 310 ? 29.173  -12.189 12.958  1.00 35.91  ? 310 LEU A C   1 
ATOM   2427  O O   . LEU A 1 310 ? 30.189  -12.586 12.421  1.00 35.72  ? 310 LEU A O   1 
ATOM   2428  C CB  . LEU A 1 310 ? 28.299  -13.221 15.039  1.00 35.11  ? 310 LEU A CB  1 
ATOM   2429  C CG  . LEU A 1 310 ? 28.888  -14.637 15.057  1.00 39.20  ? 310 LEU A CG  1 
ATOM   2430  C CD1 . LEU A 1 310 ? 28.773  -15.333 13.728  1.00 39.67  ? 310 LEU A CD1 1 
ATOM   2431  C CD2 . LEU A 1 310 ? 30.311  -14.648 15.578  1.00 39.60  ? 310 LEU A CD2 1 
ATOM   2432  N N   . VAL A 1 311 ? 28.095  -11.867 12.275  1.00 31.44  ? 311 VAL A N   1 
ATOM   2433  C CA  . VAL A 1 311 ? 28.073  -12.000 10.826  1.00 31.75  ? 311 VAL A CA  1 
ATOM   2434  C C   . VAL A 1 311 ? 29.177  -11.215 10.114  1.00 38.95  ? 311 VAL A C   1 
ATOM   2435  O O   . VAL A 1 311 ? 29.759  -11.698 9.132   1.00 40.01  ? 311 VAL A O   1 
ATOM   2436  C CB  . VAL A 1 311 ? 26.667  -11.724 10.243  1.00 34.40  ? 311 VAL A CB  1 
ATOM   2437  C CG1 . VAL A 1 311 ? 26.516  -10.282 9.827   1.00 33.58  ? 311 VAL A CG1 1 
ATOM   2438  C CG2 . VAL A 1 311 ? 26.374  -12.660 9.128   1.00 33.81  ? 311 VAL A CG2 1 
ATOM   2439  N N   . SER A 1 312 ? 29.544  -10.058 10.667  1.00 36.81  ? 312 SER A N   1 
ATOM   2440  C CA  . SER A 1 312 ? 30.623  -9.246  10.093  1.00 37.12  ? 312 SER A CA  1 
ATOM   2441  C C   . SER A 1 312 ? 31.933  -9.368  10.883  1.00 43.68  ? 312 SER A C   1 
ATOM   2442  O O   . SER A 1 312 ? 32.717  -8.425  10.989  1.00 42.57  ? 312 SER A O   1 
ATOM   2443  C CB  . SER A 1 312 ? 30.217  -7.786  9.902   1.00 38.44  ? 312 SER A CB  1 
ATOM   2444  O OG  . SER A 1 312 ? 29.236  -7.408  10.841  1.00 49.99  ? 312 SER A OG  1 
ATOM   2445  N N   . ASP A 1 313 ? 32.140  -10.533 11.473  1.00 42.12  ? 313 ASP A N   1 
ATOM   2446  C CA  . ASP A 1 313 ? 33.370  -10.812 12.164  1.00 43.46  ? 313 ASP A CA  1 
ATOM   2447  C C   . ASP A 1 313 ? 33.802  -9.903  13.303  1.00 45.73  ? 313 ASP A C   1 
ATOM   2448  O O   . ASP A 1 313 ? 34.990  -9.868  13.626  1.00 47.38  ? 313 ASP A O   1 
ATOM   2449  C CB  . ASP A 1 313 ? 34.492  -10.909 11.146  1.00 47.26  ? 313 ASP A CB  1 
ATOM   2450  C CG  . ASP A 1 313 ? 34.717  -12.311 10.691  1.00 65.61  ? 313 ASP A CG  1 
ATOM   2451  O OD1 . ASP A 1 313 ? 35.203  -13.100 11.528  1.00 66.39  ? 313 ASP A OD1 1 
ATOM   2452  O OD2 . ASP A 1 313 ? 34.291  -12.641 9.561   1.00 76.88  ? 313 ASP A OD2 1 
ATOM   2453  N N   . LYS A 1 314 ? 32.879  -9.183  13.926  1.00 38.52  ? 314 LYS A N   1 
ATOM   2454  C CA  . LYS A 1 314 ? 33.271  -8.361  15.058  1.00 37.23  ? 314 LYS A CA  1 
ATOM   2455  C C   . LYS A 1 314 ? 33.818  -9.264  16.181  1.00 42.03  ? 314 LYS A C   1 
ATOM   2456  O O   . LYS A 1 314 ? 33.645  -10.476 16.157  1.00 42.64  ? 314 LYS A O   1 
ATOM   2457  C CB  . LYS A 1 314 ? 32.109  -7.506  15.556  1.00 39.21  ? 314 LYS A CB  1 
ATOM   2458  C CG  . LYS A 1 314 ? 31.647  -6.408  14.592  1.00 41.64  ? 314 LYS A CG  1 
ATOM   2459  C CD  . LYS A 1 314 ? 32.819  -5.724  13.916  1.00 49.08  ? 314 LYS A CD  1 
ATOM   2460  C CE  . LYS A 1 314 ? 32.352  -4.736  12.835  1.00 56.70  ? 314 LYS A CE  1 
ATOM   2461  N NZ  . LYS A 1 314 ? 32.483  -5.205  11.413  1.00 54.53  ? 314 LYS A NZ  1 
ATOM   2462  N N   . PRO A 1 315 ? 34.582  -8.696  17.106  1.00 39.01  ? 315 PRO A N   1 
ATOM   2463  C CA  . PRO A 1 315 ? 35.143  -9.524  18.189  1.00 37.40  ? 315 PRO A CA  1 
ATOM   2464  C C   . PRO A 1 315 ? 33.986  -10.020 19.067  1.00 36.52  ? 315 PRO A C   1 
ATOM   2465  O O   . PRO A 1 315 ? 32.936  -9.396  19.089  1.00 38.02  ? 315 PRO A O   1 
ATOM   2466  C CB  . PRO A 1 315 ? 36.051  -8.536  18.966  1.00 38.53  ? 315 PRO A CB  1 
ATOM   2467  C CG  . PRO A 1 315 ? 36.151  -7.287  18.110  1.00 41.60  ? 315 PRO A CG  1 
ATOM   2468  C CD  . PRO A 1 315 ? 34.916  -7.259  17.273  1.00 37.64  ? 315 PRO A CD  1 
ATOM   2469  N N   . LEU A 1 316 ? 34.183  -11.122 19.793  1.00 28.47  ? 316 LEU A N   1 
ATOM   2470  C CA  . LEU A 1 316 ? 33.146  -11.716 20.648  1.00 25.19  ? 316 LEU A CA  1 
ATOM   2471  C C   . LEU A 1 316 ? 32.584  -10.758 21.679  1.00 31.24  ? 316 LEU A C   1 
ATOM   2472  O O   . LEU A 1 316 ? 31.380  -10.665 21.871  1.00 33.09  ? 316 LEU A O   1 
ATOM   2473  C CB  . LEU A 1 316 ? 33.655  -12.986 21.311  1.00 24.27  ? 316 LEU A CB  1 
ATOM   2474  C CG  . LEU A 1 316 ? 33.890  -14.112 20.297  1.00 28.66  ? 316 LEU A CG  1 
ATOM   2475  C CD1 . LEU A 1 316 ? 34.244  -15.467 20.901  1.00 27.60  ? 316 LEU A CD1 1 
ATOM   2476  C CD2 . LEU A 1 316 ? 32.675  -14.242 19.403  1.00 32.31  ? 316 LEU A CD2 1 
ATOM   2477  N N   . THR A 1 317 ? 33.451  -10.019 22.335  1.00 29.11  ? 317 THR A N   1 
ATOM   2478  C CA  . THR A 1 317 ? 33.017  -9.005  23.300  1.00 29.76  ? 317 THR A CA  1 
ATOM   2479  C C   . THR A 1 317 ? 32.073  -7.951  22.667  1.00 31.98  ? 317 THR A C   1 
ATOM   2480  O O   . THR A 1 317 ? 31.244  -7.337  23.355  1.00 32.92  ? 317 THR A O   1 
ATOM   2481  C CB  . THR A 1 317 ? 34.277  -8.301  23.920  1.00 40.46  ? 317 THR A CB  1 
ATOM   2482  O OG1 . THR A 1 317 ? 34.935  -9.205  24.834  1.00 36.33  ? 317 THR A OG1 1 
ATOM   2483  C CG2 . THR A 1 317 ? 33.901  -6.989  24.628  1.00 37.98  ? 317 THR A CG2 1 
ATOM   2484  N N   . GLU A 1 318 ? 32.242  -7.718  21.369  1.00 26.94  ? 318 GLU A N   1 
ATOM   2485  C CA  . GLU A 1 318 ? 31.438  -6.751  20.622  1.00 27.04  ? 318 GLU A CA  1 
ATOM   2486  C C   . GLU A 1 318 ? 30.067  -7.425  20.339  1.00 32.72  ? 318 GLU A C   1 
ATOM   2487  O O   . GLU A 1 318 ? 28.990  -6.838  20.573  1.00 34.19  ? 318 GLU A O   1 
ATOM   2488  C CB  . GLU A 1 318 ? 32.194  -6.393  19.326  1.00 28.02  ? 318 GLU A CB  1 
ATOM   2489  C CG  . GLU A 1 318 ? 31.716  -5.157  18.615  1.00 37.76  ? 318 GLU A CG  1 
ATOM   2490  C CD  . GLU A 1 318 ? 32.077  -3.902  19.334  1.00 67.50  ? 318 GLU A CD  1 
ATOM   2491  O OE1 . GLU A 1 318 ? 32.129  -3.923  20.575  1.00 91.37  ? 318 GLU A OE1 1 
ATOM   2492  O OE2 . GLU A 1 318 ? 32.362  -2.899  18.659  1.00 72.22  ? 318 GLU A OE2 1 
ATOM   2493  N N   . CYS A 1 319 ? 30.129  -8.690  19.921  1.00 25.68  ? 319 CYS A N   1 
ATOM   2494  C CA  . CYS A 1 319 ? 28.953  -9.532  19.756  1.00 24.26  ? 319 CYS A CA  1 
ATOM   2495  C C   . CYS A 1 319 ? 28.090  -9.552  21.052  1.00 23.51  ? 319 CYS A C   1 
ATOM   2496  O O   . CYS A 1 319 ? 26.895  -9.220  21.044  1.00 24.84  ? 319 CYS A O   1 
ATOM   2497  C CB  . CYS A 1 319 ? 29.423  -10.932 19.402  1.00 24.29  ? 319 CYS A CB  1 
ATOM   2498  S SG  . CYS A 1 319 ? 30.066  -11.111 17.707  1.00 27.85  ? 319 CYS A SG  1 
ATOM   2499  N N   . ILE A 1 320 ? 28.722  -9.828  22.178  1.00 17.33  ? 320 ILE A N   1 
ATOM   2500  C CA  . ILE A 1 320 ? 28.008  -9.799  23.452  1.00 19.69  ? 320 ILE A CA  1 
ATOM   2501  C C   . ILE A 1 320 ? 27.401  -8.413  23.793  1.00 32.95  ? 320 ILE A C   1 
ATOM   2502  O O   . ILE A 1 320 ? 26.308  -8.322  24.378  1.00 33.30  ? 320 ILE A O   1 
ATOM   2503  C CB  . ILE A 1 320 ? 28.907  -10.288 24.619  1.00 21.77  ? 320 ILE A CB  1 
ATOM   2504  C CG1 . ILE A 1 320 ? 29.248  -11.766 24.391  1.00 21.75  ? 320 ILE A CG1 1 
ATOM   2505  C CG2 . ILE A 1 320 ? 28.177  -10.084 25.981  1.00 22.10  ? 320 ILE A CG2 1 
ATOM   2506  C CD1 . ILE A 1 320 ? 30.266  -12.317 25.315  1.00 23.39  ? 320 ILE A CD1 1 
ATOM   2507  N N   . ARG A 1 321 ? 28.129  -7.351  23.426  1.00 33.05  ? 321 ARG A N   1 
ATOM   2508  C CA  . ARG A 1 321 ? 27.736  -5.970  23.689  1.00 33.69  ? 321 ARG A CA  1 
ATOM   2509  C C   . ARG A 1 321 ? 26.459  -5.622  22.945  1.00 36.95  ? 321 ARG A C   1 
ATOM   2510  O O   . ARG A 1 321 ? 25.562  -4.959  23.482  1.00 36.68  ? 321 ARG A O   1 
ATOM   2511  C CB  . ARG A 1 321 ? 28.875  -5.031  23.262  1.00 34.28  ? 321 ARG A CB  1 
ATOM   2512  C CG  . ARG A 1 321 ? 29.083  -3.832  24.204  1.00 32.94  ? 321 ARG A CG  1 
ATOM   2513  C CD  . ARG A 1 321 ? 30.079  -2.838  23.625  1.00 29.26  ? 321 ARG A CD  1 
ATOM   2514  N NE  . ARG A 1 321 ? 29.406  -1.774  22.894  1.00 35.29  ? 321 ARG A NE  1 
ATOM   2515  C CZ  . ARG A 1 321 ? 29.783  -1.346  21.692  1.00 48.46  ? 321 ARG A CZ  1 
ATOM   2516  N NH1 . ARG A 1 321 ? 30.848  -1.911  21.099  1.00 20.39  ? 321 ARG A NH1 1 
ATOM   2517  N NH2 . ARG A 1 321 ? 29.103  -0.352  21.090  1.00 33.83  ? 321 ARG A NH2 1 
ATOM   2518  N N   . ALA A 1 322 ? 26.421  -6.070  21.691  1.00 32.22  ? 322 ALA A N   1 
ATOM   2519  C CA  . ALA A 1 322 ? 25.269  -5.918  20.808  1.00 31.25  ? 322 ALA A CA  1 
ATOM   2520  C C   . ALA A 1 322 ? 24.111  -6.744  21.371  1.00 30.70  ? 322 ALA A C   1 
ATOM   2521  O O   . ALA A 1 322 ? 22.992  -6.277  21.453  1.00 30.69  ? 322 ALA A O   1 
ATOM   2522  C CB  . ALA A 1 322 ? 25.653  -6.412  19.408  1.00 32.37  ? 322 ALA A CB  1 
ATOM   2523  N N   . GLY A 1 323 ? 24.410  -7.966  21.790  1.00 24.30  ? 323 GLY A N   1 
ATOM   2524  C CA  . GLY A 1 323 ? 23.402  -8.792  22.429  1.00 23.88  ? 323 GLY A CA  1 
ATOM   2525  C C   . GLY A 1 323 ? 22.717  -8.084  23.573  1.00 23.85  ? 323 GLY A C   1 
ATOM   2526  O O   . GLY A 1 323 ? 21.526  -7.956  23.578  1.00 24.34  ? 323 GLY A O   1 
ATOM   2527  N N   . HIS A 1 324 ? 23.491  -7.580  24.519  1.00 21.76  ? 324 HIS A N   1 
ATOM   2528  C CA  . HIS A 1 324 ? 22.946  -6.856  25.669  1.00 22.40  ? 324 HIS A CA  1 
ATOM   2529  C C   . HIS A 1 324 ? 22.148  -5.622  25.268  1.00 23.66  ? 324 HIS A C   1 
ATOM   2530  O O   . HIS A 1 324 ? 21.284  -5.180  26.001  1.00 23.41  ? 324 HIS A O   1 
ATOM   2531  C CB  . HIS A 1 324 ? 24.074  -6.412  26.596  1.00 23.70  ? 324 HIS A CB  1 
ATOM   2532  C CG  . HIS A 1 324 ? 24.717  -7.523  27.365  1.00 27.68  ? 324 HIS A CG  1 
ATOM   2533  N ND1 . HIS A 1 324 ? 23.998  -8.505  28.015  1.00 29.80  ? 324 HIS A ND1 1 
ATOM   2534  C CD2 . HIS A 1 324 ? 26.014  -7.732  27.698  1.00 30.47  ? 324 HIS A CD2 1 
ATOM   2535  C CE1 . HIS A 1 324 ? 24.826  -9.305  28.666  1.00 29.49  ? 324 HIS A CE1 1 
ATOM   2536  N NE2 . HIS A 1 324 ? 26.057  -8.849  28.500  1.00 30.28  ? 324 HIS A NE2 1 
ATOM   2537  N N   . TYR A 1 325 ? 22.532  -4.998  24.166  1.00 20.81  ? 325 TYR A N   1 
ATOM   2538  C CA  . TYR A 1 325 ? 21.852  -3.808  23.698  1.00 20.82  ? 325 TYR A CA  1 
ATOM   2539  C C   . TYR A 1 325 ? 20.482  -4.191  23.196  1.00 24.41  ? 325 TYR A C   1 
ATOM   2540  O O   . TYR A 1 325 ? 19.490  -3.694  23.715  1.00 22.42  ? 325 TYR A O   1 
ATOM   2541  C CB  . TYR A 1 325 ? 22.665  -3.033  22.628  1.00 21.79  ? 325 TYR A CB  1 
ATOM   2542  C CG  . TYR A 1 325 ? 21.864  -1.943  21.908  1.00 22.03  ? 325 TYR A CG  1 
ATOM   2543  C CD1 . TYR A 1 325 ? 21.492  -0.771  22.555  1.00 23.22  ? 325 TYR A CD1 1 
ATOM   2544  C CD2 . TYR A 1 325 ? 21.349  -2.170  20.641  1.00 22.86  ? 325 TYR A CD2 1 
ATOM   2545  C CE1 . TYR A 1 325 ? 20.681  0.174   21.908  1.00 23.73  ? 325 TYR A CE1 1 
ATOM   2546  C CE2 . TYR A 1 325 ? 20.611  -1.237  19.980  1.00 23.04  ? 325 TYR A CE2 1 
ATOM   2547  C CZ  . TYR A 1 325 ? 20.245  -0.087  20.614  1.00 34.04  ? 325 TYR A CZ  1 
ATOM   2548  O OH  . TYR A 1 325 ? 19.460  0.800   19.912  1.00 38.55  ? 325 TYR A OH  1 
ATOM   2549  N N   . ALA A 1 326 ? 20.442  -5.054  22.176  1.00 23.03  ? 326 ALA A N   1 
ATOM   2550  C CA  . ALA A 1 326 ? 19.188  -5.569  21.623  1.00 24.02  ? 326 ALA A CA  1 
ATOM   2551  C C   . ALA A 1 326 ? 18.216  -5.997  22.731  1.00 29.22  ? 326 ALA A C   1 
ATOM   2552  O O   . ALA A 1 326 ? 17.047  -5.587  22.730  1.00 29.36  ? 326 ALA A O   1 
ATOM   2553  C CB  . ALA A 1 326 ? 19.467  -6.701  20.719  1.00 25.14  ? 326 ALA A CB  1 
ATOM   2554  N N   . ALA A 1 327 ? 18.744  -6.749  23.702  1.00 24.52  ? 327 ALA A N   1 
ATOM   2555  C CA  . ALA A 1 327 ? 18.004  -7.220  24.862  1.00 22.94  ? 327 ALA A CA  1 
ATOM   2556  C C   . ALA A 1 327 ? 17.384  -6.114  25.739  1.00 32.04  ? 327 ALA A C   1 
ATOM   2557  O O   . ALA A 1 327 ? 16.419  -6.357  26.466  1.00 33.18  ? 327 ALA A O   1 
ATOM   2558  C CB  . ALA A 1 327 ? 18.886  -8.138  25.669  1.00 22.25  ? 327 ALA A CB  1 
ATOM   2559  N N   . SER A 1 328 ? 17.923  -4.900  25.669  1.00 31.93  ? 328 SER A N   1 
ATOM   2560  C CA  . SER A 1 328 ? 17.376  -3.762  26.454  1.00 32.28  ? 328 SER A CA  1 
ATOM   2561  C C   . SER A 1 328 ? 16.300  -2.999  25.710  1.00 35.80  ? 328 SER A C   1 
ATOM   2562  O O   . SER A 1 328 ? 15.372  -2.481  26.313  1.00 34.69  ? 328 SER A O   1 
ATOM   2563  C CB  . SER A 1 328 ? 18.479  -2.776  26.851  1.00 33.99  ? 328 SER A CB  1 
ATOM   2564  O OG  . SER A 1 328 ? 19.370  -2.544  25.772  1.00 40.22  ? 328 SER A OG  1 
ATOM   2565  N N   . ILE A 1 329 ? 16.425  -2.970  24.391  1.00 35.34  ? 329 ILE A N   1 
ATOM   2566  C CA  . ILE A 1 329 ? 15.559  -2.199  23.534  1.00 36.03  ? 329 ILE A CA  1 
ATOM   2567  C C   . ILE A 1 329 ? 14.327  -2.949  23.117  1.00 42.84  ? 329 ILE A C   1 
ATOM   2568  O O   . ILE A 1 329 ? 13.240  -2.648  23.557  1.00 42.02  ? 329 ILE A O   1 
ATOM   2569  C CB  . ILE A 1 329 ? 16.313  -1.708  22.298  1.00 39.49  ? 329 ILE A CB  1 
ATOM   2570  C CG1 . ILE A 1 329 ? 17.566  -0.921  22.715  1.00 40.15  ? 329 ILE A CG1 1 
ATOM   2571  C CG2 . ILE A 1 329 ? 15.399  -0.843  21.466  1.00 42.41  ? 329 ILE A CG2 1 
ATOM   2572  C CD1 . ILE A 1 329 ? 17.276  0.305   23.548  1.00 34.54  ? 329 ILE A CD1 1 
ATOM   2573  N N   . ILE A 1 330 ? 14.527  -3.967  22.294  1.00 44.18  ? 330 ILE A N   1 
ATOM   2574  C CA  . ILE A 1 330 ? 13.431  -4.793  21.758  1.00 44.24  ? 330 ILE A CA  1 
ATOM   2575  C C   . ILE A 1 330 ? 12.604  -5.513  22.835  1.00 50.63  ? 330 ILE A C   1 
ATOM   2576  O O   . ILE A 1 330 ? 12.779  -6.722  23.106  1.00 50.20  ? 330 ILE A O   1 
ATOM   2577  C CB  . ILE A 1 330 ? 13.932  -5.769  20.664  1.00 45.32  ? 330 ILE A CB  1 
ATOM   2578  C CG1 . ILE A 1 330 ? 14.857  -5.017  19.699  1.00 44.47  ? 330 ILE A CG1 1 
ATOM   2579  C CG2 . ILE A 1 330 ? 12.756  -6.305  19.886  1.00 44.80  ? 330 ILE A CG2 1 
ATOM   2580  C CD1 . ILE A 1 330 ? 14.155  -3.878  18.910  1.00 39.42  ? 330 ILE A CD1 1 
ATOM   2581  N N   . ILE A 1 331 ? 11.684  -4.745  23.416  1.00 47.62  ? 331 ILE A N   1 
ATOM   2582  C CA  . ILE A 1 331 ? 10.826  -5.209  24.502  1.00 47.77  ? 331 ILE A CA  1 
ATOM   2583  C C   . ILE A 1 331 ? 9.347   -5.261  24.111  1.00 54.06  ? 331 ILE A C   1 
ATOM   2584  O O   . ILE A 1 331 ? 8.716   -4.216  23.898  1.00 52.96  ? 331 ILE A O   1 
ATOM   2585  C CB  . ILE A 1 331 ? 10.969  -4.293  25.763  1.00 50.13  ? 331 ILE A CB  1 
ATOM   2586  C CG1 . ILE A 1 331 ? 12.454  -4.145  26.158  1.00 50.13  ? 331 ILE A CG1 1 
ATOM   2587  C CG2 . ILE A 1 331 ? 10.086  -4.797  26.902  1.00 48.77  ? 331 ILE A CG2 1 
ATOM   2588  C CD1 . ILE A 1 331 ? 12.696  -3.701  27.599  1.00 52.11  ? 331 ILE A CD1 1 
ATOM   2589  N N   . ARG A 1 332 ? 8.799   -6.469  24.013  1.00 52.67  ? 332 ARG A N   1 
ATOM   2590  C CA  . ARG A 1 332 ? 7.382   -6.598  23.786  1.00 53.38  ? 332 ARG A CA  1 
ATOM   2591  C C   . ARG A 1 332 ? 6.644   -6.190  25.069  1.00 59.62  ? 332 ARG A C   1 
ATOM   2592  O O   . ARG A 1 332 ? 7.224   -6.139  26.160  1.00 56.80  ? 332 ARG A O   1 
ATOM   2593  C CB  . ARG A 1 332 ? 6.984   -7.988  23.277  1.00 53.41  ? 332 ARG A CB  1 
ATOM   2594  C CG  . ARG A 1 332 ? 6.488   -7.927  21.834  1.00 58.94  ? 332 ARG A CG  1 
ATOM   2595  C CD  . ARG A 1 332 ? 6.471   -9.258  21.154  1.00 63.29  ? 332 ARG A CD  1 
ATOM   2596  N NE  . ARG A 1 332 ? 5.582   -10.175 21.844  1.00 72.38  ? 332 ARG A NE  1 
ATOM   2597  C CZ  . ARG A 1 332 ? 5.510   -11.478 21.576  1.00 75.62  ? 332 ARG A CZ  1 
ATOM   2598  N NH1 . ARG A 1 332 ? 6.292   -12.010 20.628  1.00 38.43  ? 332 ARG A NH1 1 
ATOM   2599  N NH2 . ARG A 1 332 ? 4.668   -12.250 22.273  1.00 50.13  ? 332 ARG A NH2 1 
ATOM   2600  N N   . ARG A 1 333 ? 5.402   -5.755  24.908  1.00 60.26  ? 333 ARG A N   1 
ATOM   2601  C CA  . ARG A 1 333 ? 4.619   -5.300  26.054  1.00 61.00  ? 333 ARG A CA  1 
ATOM   2602  C C   . ARG A 1 333 ? 3.117   -5.523  25.908  1.00 67.00  ? 333 ARG A C   1 
ATOM   2603  O O   . ARG A 1 333 ? 2.559   -5.477  24.812  1.00 69.05  ? 333 ARG A O   1 
ATOM   2604  C CB  . ARG A 1 333 ? 4.898   -3.830  26.324  1.00 59.35  ? 333 ARG A CB  1 
ATOM   2605  C CG  . ARG A 1 333 ? 6.360   -3.506  26.461  1.00 66.56  ? 333 ARG A CG  1 
ATOM   2606  C CD  . ARG A 1 333 ? 6.764   -3.447  27.918  1.00 79.90  ? 333 ARG A CD  1 
ATOM   2607  N NE  . ARG A 1 333 ? 6.128   -2.332  28.605  1.00 97.22  ? 333 ARG A NE  1 
ATOM   2608  C CZ  . ARG A 1 333 ? 4.900   -2.360  29.122  1.00 116.91 ? 333 ARG A CZ  1 
ATOM   2609  N NH1 . ARG A 1 333 ? 4.159   -3.458  29.048  1.00 105.90 ? 333 ARG A NH1 1 
ATOM   2610  N NH2 . ARG A 1 333 ? 4.417   -1.284  29.729  1.00 104.95 ? 333 ARG A NH2 1 
ATOM   2611  N N   . THR A 1 334 ? 2.461   -5.769  27.027  1.00 62.22  ? 334 THR A N   1 
ATOM   2612  C CA  . THR A 1 334 ? 1.027   -5.985  27.030  1.00 61.68  ? 334 THR A CA  1 
ATOM   2613  C C   . THR A 1 334 ? 0.274   -4.652  27.032  1.00 63.11  ? 334 THR A C   1 
ATOM   2614  O O   . THR A 1 334 ? 0.744   -3.670  27.596  1.00 62.55  ? 334 THR A O   1 
ATOM   2615  C CB  . THR A 1 334 ? 0.642   -6.778  28.284  1.00 76.06  ? 334 THR A CB  1 
ATOM   2616  O OG1 . THR A 1 334 ? 0.890   -8.176  28.058  1.00 77.40  ? 334 THR A OG1 1 
ATOM   2617  C CG2 . THR A 1 334 ? -0.823  -6.526  28.668  1.00 75.23  ? 334 THR A CG2 1 
ATOM   2618  N N   . GLY A 1 335 ? -0.902  -4.627  26.417  1.00 58.66  ? 335 GLY A N   1 
ATOM   2619  C CA  . GLY A 1 335 ? -1.734  -3.418  26.398  1.00 58.91  ? 335 GLY A CA  1 
ATOM   2620  C C   . GLY A 1 335 ? -1.363  -2.388  25.320  1.00 61.92  ? 335 GLY A C   1 
ATOM   2621  O O   . GLY A 1 335 ? -1.885  -1.265  25.285  1.00 59.65  ? 335 GLY A O   1 
ATOM   2622  N N   . CYS A 1 336 ? -0.498  -2.795  24.405  1.00 59.24  ? 336 CYS A N   1 
ATOM   2623  C CA  . CYS A 1 336 ? -0.054  -1.905  23.351  1.00 59.58  ? 336 CYS A CA  1 
ATOM   2624  C C   . CYS A 1 336 ? -1.055  -1.729  22.203  1.00 63.49  ? 336 CYS A C   1 
ATOM   2625  O O   . CYS A 1 336 ? -1.641  -0.655  22.029  1.00 63.75  ? 336 CYS A O   1 
ATOM   2626  C CB  . CYS A 1 336 ? 1.330   -2.330  22.865  1.00 60.08  ? 336 CYS A CB  1 
ATOM   2627  S SG  . CYS A 1 336 ? 2.502   -2.618  24.232  1.00 64.42  ? 336 CYS A SG  1 
ATOM   2628  N N   . THR A 1 337 ? -1.297  -2.807  21.468  1.00 59.46  ? 337 THR A N   1 
ATOM   2629  C CA  . THR A 1 337 ? -2.225  -2.805  20.340  1.00 58.62  ? 337 THR A CA  1 
ATOM   2630  C C   . THR A 1 337 ? -3.703  -2.736  20.759  1.00 63.09  ? 337 THR A C   1 
ATOM   2631  O O   . THR A 1 337 ? -4.063  -3.021  21.911  1.00 63.01  ? 337 THR A O   1 
ATOM   2632  C CB  . THR A 1 337 ? -2.024  -4.079  19.494  1.00 54.59  ? 337 THR A CB  1 
ATOM   2633  O OG1 . THR A 1 337 ? -3.053  -5.020  19.814  1.00 58.70  ? 337 THR A OG1 1 
ATOM   2634  C CG2 . THR A 1 337 ? -0.683  -4.730  19.827  1.00 41.88  ? 337 THR A CG2 1 
ATOM   2635  N N   . PHE A 1 338 ? -4.551  -2.365  19.802  1.00 59.36  ? 338 PHE A N   1 
ATOM   2636  C CA  . PHE A 1 338 ? -5.999  -2.320  19.998  1.00 58.91  ? 338 PHE A CA  1 
ATOM   2637  C C   . PHE A 1 338 ? -6.623  -3.572  19.355  1.00 56.07  ? 338 PHE A C   1 
ATOM   2638  O O   . PHE A 1 338 ? -6.124  -4.075  18.327  1.00 52.59  ? 338 PHE A O   1 
ATOM   2639  C CB  . PHE A 1 338 ? -6.573  -1.043  19.366  1.00 62.31  ? 338 PHE A CB  1 
ATOM   2640  C CG  . PHE A 1 338 ? -5.906  0.218   19.842  1.00 66.26  ? 338 PHE A CG  1 
ATOM   2641  C CD1 . PHE A 1 338 ? -6.246  1.449   19.296  1.00 71.62  ? 338 PHE A CD1 1 
ATOM   2642  C CD2 . PHE A 1 338 ? -4.951  0.177   20.859  1.00 71.12  ? 338 PHE A CD2 1 
ATOM   2643  C CE1 . PHE A 1 338 ? -5.623  2.626   19.732  1.00 74.08  ? 338 PHE A CE1 1 
ATOM   2644  C CE2 . PHE A 1 338 ? -4.317  1.344   21.311  1.00 75.39  ? 338 PHE A CE2 1 
ATOM   2645  C CZ  . PHE A 1 338 ? -4.657  2.575   20.746  1.00 74.07  ? 338 PHE A CZ  1 
ATOM   2646  N N   . PRO A 1 339 ? -7.675  -4.118  19.961  1.00 49.61  ? 339 PRO A N   1 
ATOM   2647  C CA  . PRO A 1 339 ? -8.260  -5.320  19.358  1.00 47.59  ? 339 PRO A CA  1 
ATOM   2648  C C   . PRO A 1 339 ? -8.822  -4.926  17.994  1.00 50.91  ? 339 PRO A C   1 
ATOM   2649  O O   . PRO A 1 339 ? -9.182  -3.771  17.761  1.00 51.41  ? 339 PRO A O   1 
ATOM   2650  C CB  . PRO A 1 339 ? -9.332  -5.752  20.353  1.00 48.47  ? 339 PRO A CB  1 
ATOM   2651  C CG  . PRO A 1 339 ? -8.867  -5.181  21.654  1.00 53.66  ? 339 PRO A CG  1 
ATOM   2652  C CD  . PRO A 1 339 ? -8.207  -3.867  21.311  1.00 49.31  ? 339 PRO A CD  1 
ATOM   2653  N N   . GLU A 1 340 ? -8.753  -5.853  17.053  1.00 46.48  ? 340 GLU A N   1 
ATOM   2654  C CA  . GLU A 1 340 ? -9.199  -5.620  15.676  1.00 47.43  ? 340 GLU A CA  1 
ATOM   2655  C C   . GLU A 1 340 ? -10.672 -5.241  15.506  1.00 50.78  ? 340 GLU A C   1 
ATOM   2656  O O   . GLU A 1 340 ? -11.023 -4.547  14.545  1.00 49.23  ? 340 GLU A O   1 
ATOM   2657  C CB  . GLU A 1 340 ? -9.003  -6.881  14.848  1.00 49.13  ? 340 GLU A CB  1 
ATOM   2658  C CG  . GLU A 1 340 ? -7.611  -7.417  14.819  1.00 68.01  ? 340 GLU A CG  1 
ATOM   2659  C CD  . GLU A 1 340 ? -7.488  -8.568  13.836  1.00 102.13 ? 340 GLU A CD  1 
ATOM   2660  O OE1 . GLU A 1 340 ? -6.437  -9.254  13.819  1.00 92.44  ? 340 GLU A OE1 1 
ATOM   2661  O OE2 . GLU A 1 340 ? -8.457  -8.797  13.080  1.00 100.10 ? 340 GLU A OE2 1 
ATOM   2662  N N   . LYS A 1 341 ? -11.533 -5.849  16.319  1.00 45.92  ? 341 LYS A N   1 
ATOM   2663  C CA  . LYS A 1 341 ? -12.952 -5.568  16.262  1.00 45.10  ? 341 LYS A CA  1 
ATOM   2664  C C   . LYS A 1 341 ? -13.439 -5.286  17.663  1.00 47.05  ? 341 LYS A C   1 
ATOM   2665  O O   . LYS A 1 341 ? -13.107 -6.016  18.587  1.00 47.78  ? 341 LYS A O   1 
ATOM   2666  C CB  . LYS A 1 341 ? -13.685 -6.780  15.723  1.00 47.37  ? 341 LYS A CB  1 
ATOM   2667  C CG  . LYS A 1 341 ? -13.015 -7.399  14.525  1.00 57.75  ? 341 LYS A CG  1 
ATOM   2668  C CD  . LYS A 1 341 ? -12.974 -6.411  13.374  1.00 71.91  ? 341 LYS A CD  1 
ATOM   2669  C CE  . LYS A 1 341 ? -13.465 -7.046  12.084  1.00 85.59  ? 341 LYS A CE  1 
ATOM   2670  N NZ  . LYS A 1 341 ? -13.356 -6.099  10.934  1.00 94.79  ? 341 LYS A NZ  1 
ATOM   2671  N N   . PRO A 1 342 ? -14.257 -4.255  17.809  1.00 39.63  ? 342 PRO A N   1 
ATOM   2672  C CA  . PRO A 1 342 ? -14.853 -3.925  19.082  1.00 39.45  ? 342 PRO A CA  1 
ATOM   2673  C C   . PRO A 1 342 ? -15.459 -5.181  19.728  1.00 48.11  ? 342 PRO A C   1 
ATOM   2674  O O   . PRO A 1 342 ? -15.348 -6.281  19.213  1.00 45.03  ? 342 PRO A O   1 
ATOM   2675  C CB  . PRO A 1 342 ? -15.977 -2.972  18.675  1.00 39.85  ? 342 PRO A CB  1 
ATOM   2676  C CG  . PRO A 1 342 ? -16.368 -3.417  17.295  1.00 42.68  ? 342 PRO A CG  1 
ATOM   2677  C CD  . PRO A 1 342 ? -15.219 -4.189  16.701  1.00 37.54  ? 342 PRO A CD  1 
ATOM   2678  N N   . ASP A 1 343 ? -16.134 -5.017  20.854  1.00 51.13  ? 343 ASP A N   1 
ATOM   2679  C CA  . ASP A 1 343 ? -16.828 -6.132  21.486  1.00 51.38  ? 343 ASP A CA  1 
ATOM   2680  C C   . ASP A 1 343 ? -17.923 -5.488  22.302  1.00 56.57  ? 343 ASP A C   1 
ATOM   2681  O O   . ASP A 1 343 ? -18.430 -6.063  23.263  1.00 56.53  ? 343 ASP A O   1 
ATOM   2682  C CB  . ASP A 1 343 ? -15.887 -6.887  22.395  1.00 53.83  ? 343 ASP A CB  1 
ATOM   2683  C CG  . ASP A 1 343 ? -16.587 -7.955  23.181  1.00 71.87  ? 343 ASP A CG  1 
ATOM   2684  O OD1 . ASP A 1 343 ? -16.628 -9.093  22.670  1.00 73.59  ? 343 ASP A OD1 1 
ATOM   2685  O OD2 . ASP A 1 343 ? -17.167 -7.636  24.253  1.00 76.53  ? 343 ASP A OD2 1 
ATOM   2686  N N   . PHE A 1 344 ? -18.296 -4.280  21.904  1.00 54.51  ? 344 PHE A N   1 
ATOM   2687  C CA  . PHE A 1 344 ? -19.230 -3.530  22.703  1.00 54.72  ? 344 PHE A CA  1 
ATOM   2688  C C   . PHE A 1 344 ? -20.617 -4.117  22.810  1.00 65.99  ? 344 PHE A C   1 
ATOM   2689  O O   . PHE A 1 344 ? -21.264 -3.987  23.852  1.00 68.29  ? 344 PHE A O   1 
ATOM   2690  C CB  . PHE A 1 344 ? -19.385 -2.126  22.218  1.00 54.61  ? 344 PHE A CB  1 
ATOM   2691  C CG  . PHE A 1 344 ? -20.570 -1.493  22.785  1.00 53.80  ? 344 PHE A CG  1 
ATOM   2692  C CD1 . PHE A 1 344 ? -20.664 -1.338  24.166  1.00 56.53  ? 344 PHE A CD1 1 
ATOM   2693  C CD2 . PHE A 1 344 ? -21.693 -1.354  22.012  1.00 53.87  ? 344 PHE A CD2 1 
ATOM   2694  C CE1 . PHE A 1 344 ? -21.821 -0.860  24.741  1.00 57.90  ? 344 PHE A CE1 1 
ATOM   2695  C CE2 . PHE A 1 344 ? -22.857 -0.861  22.558  1.00 57.65  ? 344 PHE A CE2 1 
ATOM   2696  C CZ  . PHE A 1 344 ? -22.936 -0.619  23.935  1.00 56.58  ? 344 PHE A CZ  1 
ATOM   2697  N N   . HIS A 1 345 ? -21.105 -4.658  21.695  1.00 64.23  ? 345 HIS A N   1 
ATOM   2698  C CA  . HIS A 1 345 ? -22.478 -5.180  21.604  1.00 67.45  ? 345 HIS A CA  1 
ATOM   2699  C C   . HIS A 1 345 ? -23.567 -4.218  21.085  1.00 71.59  ? 345 HIS A C   1 
ATOM   2700  O O   . HIS A 1 345 ? -23.998 -3.293  21.827  1.00 82.44  ? 345 HIS A O   1 
ATOM   2701  C CB  . HIS A 1 345 ? -22.892 -5.859  22.911  1.00 67.85  ? 345 HIS A CB  1 
ATOM   2702  C CG  . HIS A 1 345 ? -22.006 -7.003  23.262  1.00 70.83  ? 345 HIS A CG  1 
ATOM   2703  N ND1 . HIS A 1 345 ? -21.802 -8.052  22.391  1.00 72.19  ? 345 HIS A ND1 1 
ATOM   2704  C CD2 . HIS A 1 345 ? -21.212 -7.238  24.335  1.00 72.18  ? 345 HIS A CD2 1 
ATOM   2705  C CE1 . HIS A 1 345 ? -20.958 -8.911  22.933  1.00 71.51  ? 345 HIS A CE1 1 
ATOM   2706  N NE2 . HIS A 1 345 ? -20.589 -8.445  24.115  1.00 72.02  ? 345 HIS A NE2 1 
ATOM   2707  O OXT . HIS A 1 345 ? -23.985 -4.439  19.925  1.00 75.68  ? 345 HIS A OXT 1 
ATOM   2708  N N   . SER B 1 3   ? 26.354  -0.570  -10.386 1.00 53.14  ? 3   SER B N   1 
ATOM   2709  C CA  . SER B 1 3   ? 27.577  -0.049  -9.795  1.00 53.90  ? 3   SER B CA  1 
ATOM   2710  C C   . SER B 1 3   ? 27.514  1.476   -9.772  1.00 57.18  ? 3   SER B C   1 
ATOM   2711  O O   . SER B 1 3   ? 28.551  2.169   -9.740  1.00 57.77  ? 3   SER B O   1 
ATOM   2712  C CB  . SER B 1 3   ? 28.777  -0.508  -10.633 1.00 59.84  ? 3   SER B CB  1 
ATOM   2713  O OG  . SER B 1 3   ? 28.894  0.231   -11.844 1.00 69.65  ? 3   SER B OG  1 
ATOM   2714  N N   . VAL B 1 4   ? 26.278  1.980   -9.753  1.00 49.54  ? 4   VAL B N   1 
ATOM   2715  C CA  . VAL B 1 4   ? 25.968  3.405   -9.826  1.00 46.02  ? 4   VAL B CA  1 
ATOM   2716  C C   . VAL B 1 4   ? 24.969  3.658   -8.692  1.00 45.03  ? 4   VAL B C   1 
ATOM   2717  O O   . VAL B 1 4   ? 24.027  2.904   -8.534  1.00 43.22  ? 4   VAL B O   1 
ATOM   2718  C CB  . VAL B 1 4   ? 25.284  3.693   -11.212 1.00 48.50  ? 4   VAL B CB  1 
ATOM   2719  C CG1 . VAL B 1 4   ? 26.294  3.534   -12.367 1.00 48.04  ? 4   VAL B CG1 1 
ATOM   2720  C CG2 . VAL B 1 4   ? 24.128  2.721   -11.462 1.00 47.45  ? 4   VAL B CG2 1 
ATOM   2721  N N   . ARG B 1 5   ? 25.187  4.675   -7.863  1.00 39.64  ? 5   ARG B N   1 
ATOM   2722  C CA  . ARG B 1 5   ? 24.279  4.896   -6.741  1.00 37.92  ? 5   ARG B CA  1 
ATOM   2723  C C   . ARG B 1 5   ? 22.953  5.566   -7.074  1.00 37.21  ? 5   ARG B C   1 
ATOM   2724  O O   . ARG B 1 5   ? 22.611  5.757   -8.239  1.00 37.92  ? 5   ARG B O   1 
ATOM   2725  C CB  . ARG B 1 5   ? 24.979  5.636   -5.613  1.00 41.79  ? 5   ARG B CB  1 
ATOM   2726  C CG  . ARG B 1 5   ? 26.449  5.829   -5.847  1.00 55.16  ? 5   ARG B CG  1 
ATOM   2727  C CD  . ARG B 1 5   ? 26.690  6.969   -6.789  1.00 72.49  ? 5   ARG B CD  1 
ATOM   2728  N NE  . ARG B 1 5   ? 28.112  7.276   -6.845  1.00 100.27 ? 5   ARG B NE  1 
ATOM   2729  C CZ  . ARG B 1 5   ? 29.059  6.370   -7.074  1.00 124.77 ? 5   ARG B CZ  1 
ATOM   2730  N NH1 . ARG B 1 5   ? 28.731  5.098   -7.287  1.00 118.61 ? 5   ARG B NH1 1 
ATOM   2731  N NH2 . ARG B 1 5   ? 30.334  6.741   -7.101  1.00 111.36 ? 5   ARG B NH2 1 
ATOM   2732  N N   . GLU B 1 6   ? 22.171  5.881   -6.049  1.00 29.73  ? 6   GLU B N   1 
ATOM   2733  C CA  . GLU B 1 6   ? 20.891  6.523   -6.304  1.00 29.53  ? 6   GLU B CA  1 
ATOM   2734  C C   . GLU B 1 6   ? 21.065  7.999   -6.553  1.00 29.77  ? 6   GLU B C   1 
ATOM   2735  O O   . GLU B 1 6   ? 22.010  8.615   -6.042  1.00 29.10  ? 6   GLU B O   1 
ATOM   2736  C CB  . GLU B 1 6   ? 19.899  6.325   -5.154  1.00 31.64  ? 6   GLU B CB  1 
ATOM   2737  C CG  . GLU B 1 6   ? 20.463  5.778   -3.870  1.00 42.02  ? 6   GLU B CG  1 
ATOM   2738  C CD  . GLU B 1 6   ? 19.415  5.036   -3.055  1.00 47.92  ? 6   GLU B CD  1 
ATOM   2739  O OE1 . GLU B 1 6   ? 19.328  3.797   -3.165  1.00 49.19  ? 6   GLU B OE1 1 
ATOM   2740  O OE2 . GLU B 1 6   ? 18.639  5.680   -2.332  1.00 39.73  ? 6   GLU B OE2 1 
ATOM   2741  N N   . ASN B 1 7   ? 20.185  8.569   -7.367  1.00 23.83  ? 7   ASN B N   1 
ATOM   2742  C CA  . ASN B 1 7   ? 20.268  10.001  -7.613  1.00 23.52  ? 7   ASN B CA  1 
ATOM   2743  C C   . ASN B 1 7   ? 21.454  10.413  -8.505  1.00 26.39  ? 7   ASN B C   1 
ATOM   2744  O O   . ASN B 1 7   ? 21.744  11.618  -8.674  1.00 25.79  ? 7   ASN B O   1 
ATOM   2745  C CB  . ASN B 1 7   ? 20.303  10.740  -6.263  1.00 27.58  ? 7   ASN B CB  1 
ATOM   2746  C CG  . ASN B 1 7   ? 19.126  10.359  -5.369  1.00 32.45  ? 7   ASN B CG  1 
ATOM   2747  O OD1 . ASN B 1 7   ? 19.275  9.627   -4.372  1.00 27.94  ? 7   ASN B OD1 1 
ATOM   2748  N ND2 . ASN B 1 7   ? 17.937  10.690  -5.842  1.00 7.18   ? 7   ASN B ND2 1 
ATOM   2749  N N   . ILE B 1 8   ? 22.093  9.419   -9.120  1.00 21.13  ? 8   ILE B N   1 
ATOM   2750  C CA  . ILE B 1 8   ? 23.202  9.676   -10.036 1.00 20.65  ? 8   ILE B CA  1 
ATOM   2751  C C   . ILE B 1 8   ? 22.784  10.442  -11.302 1.00 21.17  ? 8   ILE B C   1 
ATOM   2752  O O   . ILE B 1 8   ? 23.606  11.055  -11.966 1.00 18.56  ? 8   ILE B O   1 
ATOM   2753  C CB  . ILE B 1 8   ? 23.908  8.369   -10.428 1.00 23.76  ? 8   ILE B CB  1 
ATOM   2754  C CG1 . ILE B 1 8   ? 25.399  8.614   -10.700 1.00 23.50  ? 8   ILE B CG1 1 
ATOM   2755  C CG2 . ILE B 1 8   ? 23.171  7.699   -11.595 1.00 23.42  ? 8   ILE B CG2 1 
ATOM   2756  C CD1 . ILE B 1 8   ? 25.995  7.506   -11.528 1.00 33.93  ? 8   ILE B CD1 1 
ATOM   2757  N N   . LEU B 1 9   ? 21.481  10.456  -11.585 1.00 16.52  ? 9   LEU B N   1 
ATOM   2758  C CA  . LEU B 1 9   ? 20.950  11.160  -12.746 1.00 12.90  ? 9   LEU B CA  1 
ATOM   2759  C C   . LEU B 1 9   ? 19.944  12.113  -12.206 1.00 14.23  ? 9   LEU B C   1 
ATOM   2760  O O   . LEU B 1 9   ? 19.027  11.707  -11.521 1.00 14.01  ? 9   LEU B O   1 
ATOM   2761  C CB  . LEU B 1 9   ? 20.253  10.149  -13.686 1.00 11.95  ? 9   LEU B CB  1 
ATOM   2762  C CG  . LEU B 1 9   ? 20.163  10.444  -15.189 1.00 14.41  ? 9   LEU B CG  1 
ATOM   2763  C CD1 . LEU B 1 9   ? 18.897  9.905   -15.819 1.00 13.62  ? 9   LEU B CD1 1 
ATOM   2764  C CD2 . LEU B 1 9   ? 20.381  11.914  -15.547 1.00 14.06  ? 9   LEU B CD2 1 
ATOM   2765  N N   . PHE B 1 10  ? 20.042  13.378  -12.575 1.00 11.41  ? 10  PHE B N   1 
ATOM   2766  C CA  . PHE B 1 10  ? 19.025  14.350  -12.134 1.00 10.41  ? 10  PHE B CA  1 
ATOM   2767  C C   . PHE B 1 10  ? 18.296  14.952  -13.312 1.00 16.15  ? 10  PHE B C   1 
ATOM   2768  O O   . PHE B 1 10  ? 18.906  15.213  -14.350 1.00 14.20  ? 10  PHE B O   1 
ATOM   2769  C CB  . PHE B 1 10  ? 19.657  15.519  -11.332 1.00 11.63  ? 10  PHE B CB  1 
ATOM   2770  C CG  . PHE B 1 10  ? 18.668  16.584  -10.958 1.00 10.88  ? 10  PHE B CG  1 
ATOM   2771  C CD1 . PHE B 1 10  ? 18.615  17.759  -11.681 1.00 12.56  ? 10  PHE B CD1 1 
ATOM   2772  C CD2 . PHE B 1 10  ? 17.673  16.340  -9.990  1.00 11.82  ? 10  PHE B CD2 1 
ATOM   2773  C CE1 . PHE B 1 10  ? 17.633  18.730  -11.410 1.00 12.57  ? 10  PHE B CE1 1 
ATOM   2774  C CE2 . PHE B 1 10  ? 16.669  17.280  -9.736  1.00 14.28  ? 10  PHE B CE2 1 
ATOM   2775  C CZ  . PHE B 1 10  ? 16.652  18.481  -10.456 1.00 12.25  ? 10  PHE B CZ  1 
ATOM   2776  N N   . GLY B 1 11  ? 17.001  15.231  -13.122 1.00 16.77  ? 11  GLY B N   1 
ATOM   2777  C CA  . GLY B 1 11  ? 16.138  15.838  -14.147 1.00 15.47  ? 11  GLY B CA  1 
ATOM   2778  C C   . GLY B 1 11  ? 15.031  16.629  -13.460 1.00 18.20  ? 11  GLY B C   1 
ATOM   2779  O O   . GLY B 1 11  ? 14.707  16.363  -12.302 1.00 17.31  ? 11  GLY B O   1 
ATOM   2780  N N   . MET B 1 12  ? 14.578  17.691  -14.137 1.00 13.12  ? 12  MET B N   1 
ATOM   2781  C CA  . MET B 1 12  ? 13.452  18.536  -13.739 1.00 13.11  ? 12  MET B CA  1 
ATOM   2782  C C   . MET B 1 12  ? 12.738  19.083  -14.994 1.00 18.75  ? 12  MET B C   1 
ATOM   2783  O O   . MET B 1 12  ? 13.351  19.226  -16.085 1.00 17.14  ? 12  MET B O   1 
ATOM   2784  C CB  . MET B 1 12  ? 13.846  19.650  -12.772 1.00 15.70  ? 12  MET B CB  1 
ATOM   2785  C CG  . MET B 1 12  ? 14.458  20.858  -13.410 1.00 20.44  ? 12  MET B CG  1 
ATOM   2786  S SD  . MET B 1 12  ? 15.214  21.993  -12.219 1.00 26.14  ? 12  MET B SD  1 
ATOM   2787  C CE  . MET B 1 12  ? 13.681  22.562  -11.310 1.00 21.05  ? 12  MET B CE  1 
ATOM   2788  N N   . GLY B 1 13  ? 11.414  19.205  -14.896 1.00 14.08  ? 13  GLY B N   1 
ATOM   2789  C CA  . GLY B 1 13  ? 10.619  19.633  -16.040 1.00 12.61  ? 13  GLY B CA  1 
ATOM   2790  C C   . GLY B 1 13  ? 9.148   19.647  -15.704 1.00 16.97  ? 13  GLY B C   1 
ATOM   2791  O O   . GLY B 1 13  ? 8.752   19.590  -14.533 1.00 17.05  ? 13  GLY B O   1 
ATOM   2792  N N   . ASN B 1 14  ? 8.330   19.778  -16.733 1.00 12.26  ? 14  ASN B N   1 
ATOM   2793  C CA  . ASN B 1 14  ? 6.892   19.792  -16.548 1.00 11.58  ? 14  ASN B CA  1 
ATOM   2794  C C   . ASN B 1 14  ? 6.257   18.395  -16.445 1.00 16.04  ? 14  ASN B C   1 
ATOM   2795  O O   . ASN B 1 14  ? 6.129   17.713  -17.465 1.00 13.54  ? 14  ASN B O   1 
ATOM   2796  C CB  . ASN B 1 14  ? 6.268   20.516  -17.736 1.00 17.04  ? 14  ASN B CB  1 
ATOM   2797  C CG  . ASN B 1 14  ? 6.867   21.908  -17.964 1.00 24.28  ? 14  ASN B CG  1 
ATOM   2798  O OD1 . ASN B 1 14  ? 7.268   22.575  -17.025 1.00 17.56  ? 14  ASN B OD1 1 
ATOM   2799  N ND2 . ASN B 1 14  ? 7.051   22.283  -19.219 1.00 4.63   ? 14  ASN B ND2 1 
ATOM   2800  N N   . PRO B 1 15  ? 5.741   18.031  -15.259 1.00 14.53  ? 15  PRO B N   1 
ATOM   2801  C CA  . PRO B 1 15  ? 5.016   16.759  -15.081 1.00 14.89  ? 15  PRO B CA  1 
ATOM   2802  C C   . PRO B 1 15  ? 3.599   16.907  -15.597 1.00 21.60  ? 15  PRO B C   1 
ATOM   2803  O O   . PRO B 1 15  ? 2.742   17.427  -14.886 1.00 23.37  ? 15  PRO B O   1 
ATOM   2804  C CB  . PRO B 1 15  ? 4.925   16.608  -13.558 1.00 16.33  ? 15  PRO B CB  1 
ATOM   2805  C CG  . PRO B 1 15  ? 5.327   17.950  -13.006 1.00 20.06  ? 15  PRO B CG  1 
ATOM   2806  C CD  . PRO B 1 15  ? 6.240   18.558  -13.982 1.00 14.74  ? 15  PRO B CD  1 
ATOM   2807  N N   . LEU B 1 16  ? 3.354   16.419  -16.813 1.00 16.81  ? 16  LEU B N   1 
ATOM   2808  C CA  . LEU B 1 16  ? 2.035   16.490  -17.445 1.00 14.78  ? 16  LEU B CA  1 
ATOM   2809  C C   . LEU B 1 16  ? 1.405   15.107  -17.556 1.00 16.23  ? 16  LEU B C   1 
ATOM   2810  O O   . LEU B 1 16  ? 2.123   14.104  -17.603 1.00 16.58  ? 16  LEU B O   1 
ATOM   2811  C CB  . LEU B 1 16  ? 2.163   17.098  -18.866 1.00 13.61  ? 16  LEU B CB  1 
ATOM   2812  C CG  . LEU B 1 16  ? 2.898   18.447  -18.963 1.00 14.90  ? 16  LEU B CG  1 
ATOM   2813  C CD1 . LEU B 1 16  ? 3.158   18.892  -20.379 1.00 11.42  ? 16  LEU B CD1 1 
ATOM   2814  C CD2 . LEU B 1 16  ? 2.170   19.532  -18.145 1.00 16.54  ? 16  LEU B CD2 1 
ATOM   2815  N N   . LEU B 1 17  ? 0.082   15.089  -17.707 1.00 10.66  ? 17  LEU B N   1 
ATOM   2816  C CA  . LEU B 1 17  ? -0.674  13.866  -17.957 1.00 10.66  ? 17  LEU B CA  1 
ATOM   2817  C C   . LEU B 1 17  ? -1.205  13.967  -19.367 1.00 20.26  ? 17  LEU B C   1 
ATOM   2818  O O   . LEU B 1 17  ? -1.957  14.882  -19.675 1.00 23.89  ? 17  LEU B O   1 
ATOM   2819  C CB  . LEU B 1 17  ? -1.852  13.718  -17.011 1.00 9.83   ? 17  LEU B CB  1 
ATOM   2820  C CG  . LEU B 1 17  ? -2.618  12.440  -17.364 1.00 11.88  ? 17  LEU B CG  1 
ATOM   2821  C CD1 . LEU B 1 17  ? -1.909  11.294  -16.647 1.00 9.53   ? 17  LEU B CD1 1 
ATOM   2822  C CD2 . LEU B 1 17  ? -4.113  12.513  -17.001 1.00 8.66   ? 17  LEU B CD2 1 
ATOM   2823  N N   . ASP B 1 18  ? -0.776  13.058  -20.229 1.00 17.19  ? 18  ASP B N   1 
ATOM   2824  C CA  . ASP B 1 18  ? -1.166  13.073  -21.627 1.00 16.82  ? 18  ASP B CA  1 
ATOM   2825  C C   . ASP B 1 18  ? -2.625  12.630  -21.866 1.00 21.78  ? 18  ASP B C   1 
ATOM   2826  O O   . ASP B 1 18  ? -3.068  11.566  -21.430 1.00 20.84  ? 18  ASP B O   1 
ATOM   2827  C CB  . ASP B 1 18  ? -0.202  12.187  -22.439 1.00 17.18  ? 18  ASP B CB  1 
ATOM   2828  C CG  . ASP B 1 18  ? 1.183   12.716  -22.441 1.00 17.39  ? 18  ASP B CG  1 
ATOM   2829  O OD1 . ASP B 1 18  ? 1.349   13.944  -22.255 1.00 18.19  ? 18  ASP B OD1 1 
ATOM   2830  O OD2 . ASP B 1 18  ? 2.134   11.929  -22.628 1.00 24.96  ? 18  ASP B OD2 1 
ATOM   2831  N N   . ILE B 1 19  ? -3.346  13.418  -22.634 1.00 19.31  ? 19  ILE B N   1 
ATOM   2832  C CA  . ILE B 1 19  ? -4.695  13.035  -22.994 1.00 20.38  ? 19  ILE B CA  1 
ATOM   2833  C C   . ILE B 1 19  ? -4.834  12.857  -24.518 1.00 25.90  ? 19  ILE B C   1 
ATOM   2834  O O   . ILE B 1 19  ? -4.818  13.808  -25.290 1.00 26.98  ? 19  ILE B O   1 
ATOM   2835  C CB  . ILE B 1 19  ? -5.726  14.007  -22.412 1.00 22.98  ? 19  ILE B CB  1 
ATOM   2836  C CG1 . ILE B 1 19  ? -5.333  14.354  -20.977 1.00 21.77  ? 19  ILE B CG1 1 
ATOM   2837  C CG2 . ILE B 1 19  ? -7.109  13.342  -22.446 1.00 23.66  ? 19  ILE B CG2 1 
ATOM   2838  C CD1 . ILE B 1 19  ? -6.315  15.215  -20.266 1.00 25.66  ? 19  ILE B CD1 1 
ATOM   2839  N N   . SER B 1 20  ? -4.903  11.618  -24.947 1.00 23.58  ? 20  SER B N   1 
ATOM   2840  C CA  . SER B 1 20  ? -4.854  11.328  -26.367 1.00 24.03  ? 20  SER B CA  1 
ATOM   2841  C C   . SER B 1 20  ? -6.110  10.680  -26.876 1.00 27.96  ? 20  SER B C   1 
ATOM   2842  O O   . SER B 1 20  ? -6.689  9.840   -26.207 1.00 26.77  ? 20  SER B O   1 
ATOM   2843  C CB  . SER B 1 20  ? -3.683  10.393  -26.639 1.00 25.53  ? 20  SER B CB  1 
ATOM   2844  O OG  . SER B 1 20  ? -4.068  9.068   -26.355 1.00 30.73  ? 20  SER B OG  1 
ATOM   2845  N N   . ALA B 1 21  ? -6.463  11.022  -28.111 1.00 25.88  ? 21  ALA B N   1 
ATOM   2846  C CA  . ALA B 1 21  ? -7.650  10.484  -28.773 1.00 26.59  ? 21  ALA B CA  1 
ATOM   2847  C C   . ALA B 1 21  ? -7.421  10.585  -30.264 1.00 33.52  ? 21  ALA B C   1 
ATOM   2848  O O   . ALA B 1 21  ? -6.549  11.368  -30.706 1.00 31.13  ? 21  ALA B O   1 
ATOM   2849  C CB  . ALA B 1 21  ? -8.875  11.314  -28.416 1.00 27.28  ? 21  ALA B CB  1 
ATOM   2850  N N   . VAL B 1 22  ? -8.203  9.810   -31.032 1.00 32.27  ? 22  VAL B N   1 
ATOM   2851  C CA  . VAL B 1 22  ? -8.194  9.936   -32.487 1.00 31.55  ? 22  VAL B CA  1 
ATOM   2852  C C   . VAL B 1 22  ? -9.291  10.942  -32.797 1.00 37.52  ? 22  VAL B C   1 
ATOM   2853  O O   . VAL B 1 22  ? -10.380 10.872  -32.233 1.00 36.82  ? 22  VAL B O   1 
ATOM   2854  C CB  . VAL B 1 22  ? -8.451  8.645   -33.228 1.00 34.40  ? 22  VAL B CB  1 
ATOM   2855  C CG1 . VAL B 1 22  ? -8.572  8.953   -34.692 1.00 34.19  ? 22  VAL B CG1 1 
ATOM   2856  C CG2 . VAL B 1 22  ? -7.314  7.648   -32.991 1.00 34.27  ? 22  VAL B CG2 1 
ATOM   2857  N N   . VAL B 1 23  ? -8.932  11.974  -33.555 1.00 36.09  ? 23  VAL B N   1 
ATOM   2858  C CA  . VAL B 1 23  ? -9.855  13.059  -33.874 1.00 35.87  ? 23  VAL B CA  1 
ATOM   2859  C C   . VAL B 1 23  ? -10.063 13.160  -35.397 1.00 46.04  ? 23  VAL B C   1 
ATOM   2860  O O   . VAL B 1 23  ? -9.716  12.241  -36.157 1.00 45.45  ? 23  VAL B O   1 
ATOM   2861  C CB  . VAL B 1 23  ? -9.371  14.417  -33.266 1.00 38.24  ? 23  VAL B CB  1 
ATOM   2862  C CG1 . VAL B 1 23  ? -9.195  14.310  -31.740 1.00 37.86  ? 23  VAL B CG1 1 
ATOM   2863  C CG2 . VAL B 1 23  ? -8.065  14.890  -33.900 1.00 37.10  ? 23  VAL B CG2 1 
ATOM   2864  N N   . ASP B 1 24  ? -10.657 14.267  -35.825 1.00 48.30  ? 24  ASP B N   1 
ATOM   2865  C CA  . ASP B 1 24  ? -10.937 14.517  -37.241 1.00 50.51  ? 24  ASP B CA  1 
ATOM   2866  C C   . ASP B 1 24  ? -10.548 15.943  -37.653 1.00 56.85  ? 24  ASP B C   1 
ATOM   2867  O O   . ASP B 1 24  ? -10.580 16.888  -36.837 1.00 56.14  ? 24  ASP B O   1 
ATOM   2868  C CB  . ASP B 1 24  ? -12.414 14.246  -37.567 1.00 52.70  ? 24  ASP B CB  1 
ATOM   2869  C CG  . ASP B 1 24  ? -13.367 15.231  -36.890 1.00 67.76  ? 24  ASP B CG  1 
ATOM   2870  O OD1 . ASP B 1 24  ? -13.079 15.699  -35.769 1.00 67.61  ? 24  ASP B OD1 1 
ATOM   2871  O OD2 . ASP B 1 24  ? -14.452 15.486  -37.455 1.00 80.05  ? 24  ASP B OD2 1 
ATOM   2872  N N   . LYS B 1 25  ? -10.202 16.094  -38.930 1.00 53.45  ? 25  LYS B N   1 
ATOM   2873  C CA  . LYS B 1 25  ? -9.795  17.382  -39.470 1.00 52.70  ? 25  LYS B CA  1 
ATOM   2874  C C   . LYS B 1 25  ? -10.706 18.540  -39.075 1.00 56.79  ? 25  LYS B C   1 
ATOM   2875  O O   . LYS B 1 25  ? -10.321 19.698  -39.177 1.00 58.70  ? 25  LYS B O   1 
ATOM   2876  C CB  . LYS B 1 25  ? -9.705  17.323  -40.998 1.00 54.93  ? 25  LYS B CB  1 
ATOM   2877  C CG  . LYS B 1 25  ? -9.473  18.693  -41.650 1.00 71.08  ? 25  LYS B CG  1 
ATOM   2878  C CD  . LYS B 1 25  ? -8.286  18.710  -42.641 1.00 75.12  ? 25  LYS B CD  1 
ATOM   2879  C CE  . LYS B 1 25  ? -7.782  20.137  -42.904 1.00 61.31  ? 25  LYS B CE  1 
ATOM   2880  N NZ  . LYS B 1 25  ? -7.264  20.362  -44.272 1.00 46.53  ? 25  LYS B NZ  1 
ATOM   2881  N N   . ASP B 1 26  ? -11.930 18.257  -38.672 1.00 51.07  ? 26  ASP B N   1 
ATOM   2882  C CA  . ASP B 1 26  ? -12.815 19.347  -38.313 1.00 50.76  ? 26  ASP B CA  1 
ATOM   2883  C C   . ASP B 1 26  ? -12.402 19.804  -36.920 1.00 53.75  ? 26  ASP B C   1 
ATOM   2884  O O   . ASP B 1 26  ? -12.475 21.002  -36.563 1.00 52.82  ? 26  ASP B O   1 
ATOM   2885  C CB  . ASP B 1 26  ? -14.279 18.903  -38.343 1.00 52.50  ? 26  ASP B CB  1 
ATOM   2886  C CG  . ASP B 1 26  ? -14.822 18.791  -39.749 1.00 61.32  ? 26  ASP B CG  1 
ATOM   2887  O OD1 . ASP B 1 26  ? -16.047 18.602  -39.875 1.00 65.92  ? 26  ASP B OD1 1 
ATOM   2888  O OD2 . ASP B 1 26  ? -14.047 18.917  -40.718 1.00 56.73  ? 26  ASP B OD2 1 
ATOM   2889  N N   . PHE B 1 27  ? -11.913 18.846  -36.146 1.00 48.90  ? 27  PHE B N   1 
ATOM   2890  C CA  . PHE B 1 27  ? -11.425 19.168  -34.819 1.00 48.87  ? 27  PHE B CA  1 
ATOM   2891  C C   . PHE B 1 27  ? -10.168 20.060  -34.932 1.00 50.91  ? 27  PHE B C   1 
ATOM   2892  O O   . PHE B 1 27  ? -10.074 21.125  -34.322 1.00 50.38  ? 27  PHE B O   1 
ATOM   2893  C CB  . PHE B 1 27  ? -11.123 17.886  -34.041 1.00 51.02  ? 27  PHE B CB  1 
ATOM   2894  C CG  . PHE B 1 27  ? -10.877 18.122  -32.587 1.00 53.01  ? 27  PHE B CG  1 
ATOM   2895  C CD1 . PHE B 1 27  ? -11.877 18.646  -31.784 1.00 56.39  ? 27  PHE B CD1 1 
ATOM   2896  C CD2 . PHE B 1 27  ? -9.621  17.937  -32.052 1.00 55.95  ? 27  PHE B CD2 1 
ATOM   2897  C CE1 . PHE B 1 27  ? -11.644 18.930  -30.453 1.00 58.07  ? 27  PHE B CE1 1 
ATOM   2898  C CE2 . PHE B 1 27  ? -9.373  18.224  -30.726 1.00 59.74  ? 27  PHE B CE2 1 
ATOM   2899  C CZ  . PHE B 1 27  ? -10.393 18.715  -29.915 1.00 57.90  ? 27  PHE B CZ  1 
ATOM   2900  N N   . LEU B 1 28  ? -9.221  19.630  -35.758 1.00 46.00  ? 28  LEU B N   1 
ATOM   2901  C CA  . LEU B 1 28  ? -7.995  20.369  -35.973 1.00 45.40  ? 28  LEU B CA  1 
ATOM   2902  C C   . LEU B 1 28  ? -8.216  21.774  -36.506 1.00 48.07  ? 28  LEU B C   1 
ATOM   2903  O O   . LEU B 1 28  ? -7.532  22.711  -36.097 1.00 49.93  ? 28  LEU B O   1 
ATOM   2904  C CB  . LEU B 1 28  ? -7.079  19.583  -36.900 1.00 46.08  ? 28  LEU B CB  1 
ATOM   2905  C CG  . LEU B 1 28  ? -6.647  18.226  -36.315 1.00 51.45  ? 28  LEU B CG  1 
ATOM   2906  C CD1 . LEU B 1 28  ? -5.601  17.484  -37.148 1.00 50.92  ? 28  LEU B CD1 1 
ATOM   2907  C CD2 . LEU B 1 28  ? -6.153  18.415  -34.888 1.00 55.65  ? 28  LEU B CD2 1 
ATOM   2908  N N   . ASP B 1 29  ? -9.137  21.908  -37.451 1.00 41.76  ? 29  ASP B N   1 
ATOM   2909  C CA  . ASP B 1 29  ? -9.452  23.187  -38.055 1.00 40.91  ? 29  ASP B CA  1 
ATOM   2910  C C   . ASP B 1 29  ? -10.204 24.121  -37.118 1.00 44.03  ? 29  ASP B C   1 
ATOM   2911  O O   . ASP B 1 29  ? -10.080 25.338  -37.222 1.00 43.00  ? 29  ASP B O   1 
ATOM   2912  C CB  . ASP B 1 29  ? -10.241 22.966  -39.338 1.00 43.38  ? 29  ASP B CB  1 
ATOM   2913  C CG  . ASP B 1 29  ? -9.415  22.272  -40.423 1.00 67.36  ? 29  ASP B CG  1 
ATOM   2914  O OD1 . ASP B 1 29  ? -8.214  22.004  -40.184 1.00 71.46  ? 29  ASP B OD1 1 
ATOM   2915  O OD2 . ASP B 1 29  ? -9.966  21.970  -41.512 1.00 74.05  ? 29  ASP B OD2 1 
ATOM   2916  N N   . LYS B 1 30  ? -10.988 23.568  -36.197 1.00 40.67  ? 30  LYS B N   1 
ATOM   2917  C CA  . LYS B 1 30  ? -11.736 24.446  -35.296 1.00 41.03  ? 30  LYS B CA  1 
ATOM   2918  C C   . LYS B 1 30  ? -10.743 25.205  -34.462 1.00 45.39  ? 30  LYS B C   1 
ATOM   2919  O O   . LYS B 1 30  ? -10.908 26.387  -34.183 1.00 43.43  ? 30  LYS B O   1 
ATOM   2920  C CB  . LYS B 1 30  ? -12.704 23.677  -34.384 1.00 42.89  ? 30  LYS B CB  1 
ATOM   2921  C CG  . LYS B 1 30  ? -14.145 23.822  -34.804 1.00 55.81  ? 30  LYS B CG  1 
ATOM   2922  C CD  . LYS B 1 30  ? -14.363 23.118  -36.153 1.00 67.86  ? 30  LYS B CD  1 
ATOM   2923  C CE  . LYS B 1 30  ? -15.675 23.508  -36.799 1.00 65.62  ? 30  LYS B CE  1 
ATOM   2924  N NZ  . LYS B 1 30  ? -15.950 24.929  -36.494 1.00 72.28  ? 30  LYS B NZ  1 
ATOM   2925  N N   . TYR B 1 31  ? -9.689  24.496  -34.076 1.00 44.32  ? 31  TYR B N   1 
ATOM   2926  C CA  . TYR B 1 31  ? -8.648  25.058  -33.235 1.00 44.19  ? 31  TYR B CA  1 
ATOM   2927  C C   . TYR B 1 31  ? -7.388  25.372  -34.006 1.00 48.67  ? 31  TYR B C   1 
ATOM   2928  O O   . TYR B 1 31  ? -6.332  25.587  -33.400 1.00 50.60  ? 31  TYR B O   1 
ATOM   2929  C CB  . TYR B 1 31  ? -8.336  24.132  -32.075 1.00 45.03  ? 31  TYR B CB  1 
ATOM   2930  C CG  . TYR B 1 31  ? -9.547  23.842  -31.210 1.00 46.49  ? 31  TYR B CG  1 
ATOM   2931  C CD1 . TYR B 1 31  ? -10.320 22.692  -31.414 1.00 47.06  ? 31  TYR B CD1 1 
ATOM   2932  C CD2 . TYR B 1 31  ? -9.948  24.738  -30.210 1.00 47.24  ? 31  TYR B CD2 1 
ATOM   2933  C CE1 . TYR B 1 31  ? -11.437 22.434  -30.626 1.00 45.54  ? 31  TYR B CE1 1 
ATOM   2934  C CE2 . TYR B 1 31  ? -11.076 24.494  -29.437 1.00 47.50  ? 31  TYR B CE2 1 
ATOM   2935  C CZ  . TYR B 1 31  ? -11.808 23.347  -29.637 1.00 50.88  ? 31  TYR B CZ  1 
ATOM   2936  O OH  . TYR B 1 31  ? -12.886 23.121  -28.806 1.00 50.58  ? 31  TYR B OH  1 
ATOM   2937  N N   . SER B 1 32  ? -7.539  25.506  -35.325 1.00 42.35  ? 32  SER B N   1 
ATOM   2938  C CA  . SER B 1 32  ? -6.462  25.896  -36.227 1.00 40.94  ? 32  SER B CA  1 
ATOM   2939  C C   . SER B 1 32  ? -5.151  25.247  -35.831 1.00 47.26  ? 32  SER B C   1 
ATOM   2940  O O   . SER B 1 32  ? -4.146  25.932  -35.595 1.00 47.24  ? 32  SER B O   1 
ATOM   2941  C CB  . SER B 1 32  ? -6.312  27.420  -36.323 1.00 41.80  ? 32  SER B CB  1 
ATOM   2942  O OG  . SER B 1 32  ? -6.876  28.076  -35.199 1.00 52.55  ? 32  SER B OG  1 
ATOM   2943  N N   . LEU B 1 33  ? -5.191  23.917  -35.713 1.00 43.59  ? 33  LEU B N   1 
ATOM   2944  C CA  . LEU B 1 33  ? -4.022  23.121  -35.332 1.00 42.79  ? 33  LEU B CA  1 
ATOM   2945  C C   . LEU B 1 33  ? -3.387  22.516  -36.581 1.00 46.68  ? 33  LEU B C   1 
ATOM   2946  O O   . LEU B 1 33  ? -4.066  22.343  -37.596 1.00 48.90  ? 33  LEU B O   1 
ATOM   2947  C CB  . LEU B 1 33  ? -4.431  21.977  -34.371 1.00 42.07  ? 33  LEU B CB  1 
ATOM   2948  C CG  . LEU B 1 33  ? -5.158  22.308  -33.052 1.00 45.46  ? 33  LEU B CG  1 
ATOM   2949  C CD1 . LEU B 1 33  ? -5.887  21.108  -32.452 1.00 43.64  ? 33  LEU B CD1 1 
ATOM   2950  C CD2 . LEU B 1 33  ? -4.245  22.970  -32.017 1.00 48.37  ? 33  LEU B CD2 1 
ATOM   2951  N N   . LYS B 1 34  ? -2.110  22.160  -36.496 1.00 40.43  ? 34  LYS B N   1 
ATOM   2952  C CA  . LYS B 1 34  ? -1.432  21.458  -37.595 1.00 39.49  ? 34  LYS B CA  1 
ATOM   2953  C C   . LYS B 1 34  ? -1.292  19.962  -37.262 1.00 43.79  ? 34  LYS B C   1 
ATOM   2954  O O   . LYS B 1 34  ? -0.791  19.602  -36.207 1.00 42.68  ? 34  LYS B O   1 
ATOM   2955  C CB  . LYS B 1 34  ? -0.045  22.052  -37.882 1.00 40.51  ? 34  LYS B CB  1 
ATOM   2956  C CG  . LYS B 1 34  ? 0.082   23.558  -37.700 1.00 43.59  ? 34  LYS B CG  1 
ATOM   2957  C CD  . LYS B 1 34  ? 1.243   24.128  -38.521 1.00 56.49  ? 34  LYS B CD  1 
ATOM   2958  C CE  . LYS B 1 34  ? 2.259   24.864  -37.646 1.00 71.42  ? 34  LYS B CE  1 
ATOM   2959  N NZ  . LYS B 1 34  ? 3.625   24.832  -38.245 1.00 78.61  ? 34  LYS B NZ  1 
ATOM   2960  N N   . PRO B 1 35  ? -1.690  19.102  -38.194 1.00 42.12  ? 35  PRO B N   1 
ATOM   2961  C CA  . PRO B 1 35  ? -1.637  17.632  -38.028 1.00 42.11  ? 35  PRO B CA  1 
ATOM   2962  C C   . PRO B 1 35  ? -0.510  17.046  -37.152 1.00 42.03  ? 35  PRO B C   1 
ATOM   2963  O O   . PRO B 1 35  ? -0.713  16.083  -36.410 1.00 41.21  ? 35  PRO B O   1 
ATOM   2964  C CB  . PRO B 1 35  ? -1.497  17.124  -39.472 1.00 43.94  ? 35  PRO B CB  1 
ATOM   2965  C CG  . PRO B 1 35  ? -0.811  18.246  -40.192 1.00 48.51  ? 35  PRO B CG  1 
ATOM   2966  C CD  . PRO B 1 35  ? -1.161  19.539  -39.497 1.00 43.20  ? 35  PRO B CD  1 
ATOM   2967  N N   . ASN B 1 36  ? 0.689   17.596  -37.303 1.00 35.34  ? 36  ASN B N   1 
ATOM   2968  C CA  . ASN B 1 36  ? 1.857   17.181  -36.536 1.00 34.05  ? 36  ASN B CA  1 
ATOM   2969  C C   . ASN B 1 36  ? 2.595   18.453  -36.067 1.00 37.96  ? 36  ASN B C   1 
ATOM   2970  O O   . ASN B 1 36  ? 3.090   19.260  -36.886 1.00 36.80  ? 36  ASN B O   1 
ATOM   2971  C CB  . ASN B 1 36  ? 2.786   16.378  -37.407 1.00 32.40  ? 36  ASN B CB  1 
ATOM   2972  C CG  . ASN B 1 36  ? 3.105   15.013  -36.831 1.00 47.45  ? 36  ASN B CG  1 
ATOM   2973  O OD1 . ASN B 1 36  ? 2.350   14.074  -37.085 1.00 23.76  ? 36  ASN B OD1 1 
ATOM   2974  N ND2 . ASN B 1 36  ? 4.351   14.832  -36.355 1.00 37.02  ? 36  ASN B ND2 1 
ATOM   2975  N N   . ASP B 1 37  ? 2.613   18.659  -34.748 1.00 31.27  ? 37  ASP B N   1 
ATOM   2976  C CA  . ASP B 1 37  ? 3.163   19.882  -34.183 1.00 27.03  ? 37  ASP B CA  1 
ATOM   2977  C C   . ASP B 1 37  ? 3.146   19.782  -32.667 1.00 26.46  ? 37  ASP B C   1 
ATOM   2978  O O   . ASP B 1 37  ? 2.577   18.839  -32.099 1.00 27.83  ? 37  ASP B O   1 
ATOM   2979  C CB  . ASP B 1 37  ? 2.286   21.027  -34.640 1.00 28.29  ? 37  ASP B CB  1 
ATOM   2980  C CG  . ASP B 1 37  ? 2.953   22.365  -34.495 1.00 44.54  ? 37  ASP B CG  1 
ATOM   2981  O OD1 . ASP B 1 37  ? 4.145   22.384  -34.121 1.00 47.47  ? 37  ASP B OD1 1 
ATOM   2982  O OD2 . ASP B 1 37  ? 2.266   23.402  -34.692 1.00 46.88  ? 37  ASP B OD2 1 
ATOM   2983  N N   . GLN B 1 38  ? 3.793   20.737  -32.013 1.00 18.78  ? 38  GLN B N   1 
ATOM   2984  C CA  . GLN B 1 38  ? 3.874   20.782  -30.558 1.00 16.83  ? 38  GLN B CA  1 
ATOM   2985  C C   . GLN B 1 38  ? 3.786   22.218  -30.148 1.00 20.26  ? 38  GLN B C   1 
ATOM   2986  O O   . GLN B 1 38  ? 4.620   23.026  -30.494 1.00 18.46  ? 38  GLN B O   1 
ATOM   2987  C CB  . GLN B 1 38  ? 5.213   20.219  -30.086 1.00 17.90  ? 38  GLN B CB  1 
ATOM   2988  C CG  . GLN B 1 38  ? 5.425   18.760  -30.473 1.00 17.00  ? 38  GLN B CG  1 
ATOM   2989  C CD  . GLN B 1 38  ? 6.569   18.152  -29.719 1.00 34.48  ? 38  GLN B CD  1 
ATOM   2990  O OE1 . GLN B 1 38  ? 6.435   17.800  -28.541 1.00 27.52  ? 38  GLN B OE1 1 
ATOM   2991  N NE2 . GLN B 1 38  ? 7.737   18.135  -30.339 1.00 22.87  ? 38  GLN B NE2 1 
ATOM   2992  N N   . ILE B 1 39  ? 2.747   22.553  -29.403 1.00 19.89  ? 39  ILE B N   1 
ATOM   2993  C CA  . ILE B 1 39  ? 2.543   23.943  -29.014 1.00 18.05  ? 39  ILE B CA  1 
ATOM   2994  C C   . ILE B 1 39  ? 2.035   24.104  -27.585 1.00 19.92  ? 39  ILE B C   1 
ATOM   2995  O O   . ILE B 1 39  ? 1.657   23.141  -26.915 1.00 20.31  ? 39  ILE B O   1 
ATOM   2996  C CB  . ILE B 1 39  ? 1.535   24.602  -29.998 1.00 20.28  ? 39  ILE B CB  1 
ATOM   2997  C CG1 . ILE B 1 39  ? 0.163   23.944  -29.871 1.00 21.18  ? 39  ILE B CG1 1 
ATOM   2998  C CG2 . ILE B 1 39  ? 1.946   24.399  -31.468 1.00 14.57  ? 39  ILE B CG2 1 
ATOM   2999  C CD1 . ILE B 1 39  ? -0.967  24.878  -30.225 1.00 19.55  ? 39  ILE B CD1 1 
ATOM   3000  N N   . LEU B 1 40  ? 2.090   25.331  -27.102 1.00 16.62  ? 40  LEU B N   1 
ATOM   3001  C CA  . LEU B 1 40  ? 1.595   25.622  -25.765 1.00 17.37  ? 40  LEU B CA  1 
ATOM   3002  C C   . LEU B 1 40  ? 0.180   26.142  -26.037 1.00 26.08  ? 40  LEU B C   1 
ATOM   3003  O O   . LEU B 1 40  ? -0.060  26.830  -27.063 1.00 23.16  ? 40  LEU B O   1 
ATOM   3004  C CB  . LEU B 1 40  ? 2.389   26.729  -25.093 1.00 16.78  ? 40  LEU B CB  1 
ATOM   3005  C CG  . LEU B 1 40  ? 3.722   26.277  -24.517 1.00 20.70  ? 40  LEU B CG  1 
ATOM   3006  C CD1 . LEU B 1 40  ? 4.170   27.311  -23.472 1.00 20.59  ? 40  LEU B CD1 1 
ATOM   3007  C CD2 . LEU B 1 40  ? 3.506   24.942  -23.866 1.00 20.81  ? 40  LEU B CD2 1 
ATOM   3008  N N   . ALA B 1 41  ? -0.751  25.749  -25.162 1.00 24.40  ? 41  ALA B N   1 
ATOM   3009  C CA  . ALA B 1 41  ? -2.121  26.184  -25.237 1.00 24.79  ? 41  ALA B CA  1 
ATOM   3010  C C   . ALA B 1 41  ? -2.216  27.710  -25.099 1.00 34.52  ? 41  ALA B C   1 
ATOM   3011  O O   . ALA B 1 41  ? -1.387  28.347  -24.445 1.00 32.51  ? 41  ALA B O   1 
ATOM   3012  C CB  . ALA B 1 41  ? -2.934  25.489  -24.185 1.00 25.07  ? 41  ALA B CB  1 
ATOM   3013  N N   . GLU B 1 42  ? -3.188  28.280  -25.806 1.00 37.84  ? 42  GLU B N   1 
ATOM   3014  C CA  . GLU B 1 42  ? -3.477  29.715  -25.783 1.00 41.30  ? 42  GLU B CA  1 
ATOM   3015  C C   . GLU B 1 42  ? -4.916  29.869  -25.309 1.00 51.13  ? 42  GLU B C   1 
ATOM   3016  O O   . GLU B 1 42  ? -5.602  28.865  -25.087 1.00 49.35  ? 42  GLU B O   1 
ATOM   3017  C CB  . GLU B 1 42  ? -3.342  30.308  -27.189 1.00 42.99  ? 42  GLU B CB  1 
ATOM   3018  C CG  . GLU B 1 42  ? -2.208  29.721  -28.016 1.00 54.44  ? 42  GLU B CG  1 
ATOM   3019  C CD  . GLU B 1 42  ? -0.926  30.525  -27.919 1.00 87.32  ? 42  GLU B CD  1 
ATOM   3020  O OE1 . GLU B 1 42  ? -0.553  30.962  -26.801 1.00 109.96 ? 42  GLU B OE1 1 
ATOM   3021  O OE2 . GLU B 1 42  ? -0.266  30.670  -28.969 1.00 71.87  ? 42  GLU B OE2 1 
ATOM   3022  N N   . ASP B 1 43  ? -5.409  31.100  -25.206 1.00 53.54  ? 43  ASP B N   1 
ATOM   3023  C CA  . ASP B 1 43  ? -6.802  31.266  -24.764 1.00 55.42  ? 43  ASP B CA  1 
ATOM   3024  C C   . ASP B 1 43  ? -7.784  30.577  -25.708 1.00 57.11  ? 43  ASP B C   1 
ATOM   3025  O O   . ASP B 1 43  ? -8.761  29.967  -25.275 1.00 57.42  ? 43  ASP B O   1 
ATOM   3026  C CB  . ASP B 1 43  ? -7.169  32.738  -24.534 1.00 58.76  ? 43  ASP B CB  1 
ATOM   3027  C CG  . ASP B 1 43  ? -6.718  33.218  -23.183 1.00 82.07  ? 43  ASP B CG  1 
ATOM   3028  O OD1 . ASP B 1 43  ? -7.212  32.654  -22.185 1.00 85.10  ? 43  ASP B OD1 1 
ATOM   3029  O OD2 . ASP B 1 43  ? -5.711  33.954  -23.114 1.00 93.07  ? 43  ASP B OD2 1 
ATOM   3030  N N   . LYS B 1 44  ? -7.476  30.638  -26.997 1.00 51.37  ? 44  LYS B N   1 
ATOM   3031  C CA  . LYS B 1 44  ? -8.304  30.040  -28.041 1.00 50.80  ? 44  LYS B CA  1 
ATOM   3032  C C   . LYS B 1 44  ? -8.243  28.519  -28.052 1.00 55.74  ? 44  LYS B C   1 
ATOM   3033  O O   . LYS B 1 44  ? -8.538  27.881  -29.072 1.00 54.67  ? 44  LYS B O   1 
ATOM   3034  C CB  . LYS B 1 44  ? -7.844  30.547  -29.411 1.00 52.81  ? 44  LYS B CB  1 
ATOM   3035  C CG  . LYS B 1 44  ? -6.596  31.430  -29.374 1.00 61.96  ? 44  LYS B CG  1 
ATOM   3036  C CD  . LYS B 1 44  ? -5.924  31.437  -30.746 1.00 63.25  ? 44  LYS B CD  1 
ATOM   3037  C CE  . LYS B 1 44  ? -6.701  30.565  -31.720 1.00 37.60  ? 44  LYS B CE  1 
ATOM   3038  N NZ  . LYS B 1 44  ? -5.937  29.370  -32.123 1.00 17.34  ? 44  LYS B NZ  1 
ATOM   3039  N N   . HIS B 1 45  ? -7.802  27.934  -26.946 1.00 53.07  ? 45  HIS B N   1 
ATOM   3040  C CA  . HIS B 1 45  ? -7.660  26.488  -26.879 1.00 52.78  ? 45  HIS B CA  1 
ATOM   3041  C C   . HIS B 1 45  ? -8.428  25.941  -25.664 1.00 56.33  ? 45  HIS B C   1 
ATOM   3042  O O   . HIS B 1 45  ? -8.678  24.730  -25.579 1.00 54.92  ? 45  HIS B O   1 
ATOM   3043  C CB  . HIS B 1 45  ? -6.147  26.087  -26.783 1.00 53.57  ? 45  HIS B CB  1 
ATOM   3044  C CG  . HIS B 1 45  ? -5.328  26.447  -27.989 1.00 56.58  ? 45  HIS B CG  1 
ATOM   3045  N ND1 . HIS B 1 45  ? -5.687  26.075  -29.264 1.00 58.41  ? 45  HIS B ND1 1 
ATOM   3046  C CD2 . HIS B 1 45  ? -4.144  27.098  -28.105 1.00 57.80  ? 45  HIS B CD2 1 
ATOM   3047  C CE1 . HIS B 1 45  ? -4.776  26.510  -30.119 1.00 57.60  ? 45  HIS B CE1 1 
ATOM   3048  N NE2 . HIS B 1 45  ? -3.830  27.135  -29.441 1.00 57.53  ? 45  HIS B NE2 1 
ATOM   3049  N N   . LYS B 1 46  ? -8.774  26.833  -24.730 1.00 53.23  ? 46  LYS B N   1 
ATOM   3050  C CA  . LYS B 1 46  ? -9.480  26.467  -23.484 1.00 53.46  ? 46  LYS B CA  1 
ATOM   3051  C C   . LYS B 1 46  ? -10.564 25.450  -23.742 1.00 56.00  ? 46  LYS B C   1 
ATOM   3052  O O   . LYS B 1 46  ? -10.725 24.483  -22.993 1.00 56.33  ? 46  LYS B O   1 
ATOM   3053  C CB  . LYS B 1 46  ? -10.123 27.698  -22.822 1.00 57.00  ? 46  LYS B CB  1 
ATOM   3054  C CG  . LYS B 1 46  ? -9.171  28.519  -21.937 1.00 72.51  ? 46  LYS B CG  1 
ATOM   3055  C CD  . LYS B 1 46  ? -9.898  29.315  -20.857 1.00 75.55  ? 46  LYS B CD  1 
ATOM   3056  C CE  . LYS B 1 46  ? -8.893  30.086  -19.996 1.00 79.69  ? 46  LYS B CE  1 
ATOM   3057  N NZ  . LYS B 1 46  ? -9.522  31.150  -19.158 1.00 87.85  ? 46  LYS B NZ  1 
ATOM   3058  N N   . GLU B 1 47  ? -11.302 25.693  -24.821 1.00 50.57  ? 47  GLU B N   1 
ATOM   3059  C CA  . GLU B 1 47  ? -12.397 24.829  -25.271 1.00 48.94  ? 47  GLU B CA  1 
ATOM   3060  C C   . GLU B 1 47  ? -11.943 23.479  -25.796 1.00 46.40  ? 47  GLU B C   1 
ATOM   3061  O O   . GLU B 1 47  ? -12.745 22.543  -25.902 1.00 45.35  ? 47  GLU B O   1 
ATOM   3062  C CB  . GLU B 1 47  ? -13.135 25.519  -26.415 1.00 50.84  ? 47  GLU B CB  1 
ATOM   3063  C CG  . GLU B 1 47  ? -14.622 25.281  -26.415 1.00 64.18  ? 47  GLU B CG  1 
ATOM   3064  C CD  . GLU B 1 47  ? -15.360 26.270  -27.279 1.00 90.32  ? 47  GLU B CD  1 
ATOM   3065  O OE1 . GLU B 1 47  ? -15.633 27.393  -26.781 1.00 75.12  ? 47  GLU B OE1 1 
ATOM   3066  O OE2 . GLU B 1 47  ? -15.675 25.909  -28.439 1.00 86.88  ? 47  GLU B OE2 1 
ATOM   3067  N N   . LEU B 1 48  ? -10.691 23.434  -26.245 1.00 38.62  ? 48  LEU B N   1 
ATOM   3068  C CA  . LEU B 1 48  ? -10.112 22.255  -26.875 1.00 35.50  ? 48  LEU B CA  1 
ATOM   3069  C C   . LEU B 1 48  ? -10.128 21.055  -25.951 1.00 34.73  ? 48  LEU B C   1 
ATOM   3070  O O   . LEU B 1 48  ? -10.501 19.954  -26.357 1.00 35.10  ? 48  LEU B O   1 
ATOM   3071  C CB  . LEU B 1 48  ? -8.670  22.563  -27.290 1.00 35.27  ? 48  LEU B CB  1 
ATOM   3072  C CG  . LEU B 1 48  ? -7.980  21.513  -28.148 1.00 39.73  ? 48  LEU B CG  1 
ATOM   3073  C CD1 . LEU B 1 48  ? -6.890  22.211  -28.934 1.00 39.52  ? 48  LEU B CD1 1 
ATOM   3074  C CD2 . LEU B 1 48  ? -7.437  20.346  -27.295 1.00 41.00  ? 48  LEU B CD2 1 
ATOM   3075  N N   . PHE B 1 49  ? -9.696  21.279  -24.713 1.00 27.69  ? 49  PHE B N   1 
ATOM   3076  C CA  . PHE B 1 49  ? -9.572  20.213  -23.731 1.00 26.42  ? 49  PHE B CA  1 
ATOM   3077  C C   . PHE B 1 49  ? -10.884 19.587  -23.301 1.00 34.11  ? 49  PHE B C   1 
ATOM   3078  O O   . PHE B 1 49  ? -10.983 18.356  -23.267 1.00 33.40  ? 49  PHE B O   1 
ATOM   3079  C CB  . PHE B 1 49  ? -8.692  20.627  -22.548 1.00 26.14  ? 49  PHE B CB  1 
ATOM   3080  C CG  . PHE B 1 49  ? -7.273  20.889  -22.939 1.00 25.18  ? 49  PHE B CG  1 
ATOM   3081  C CD1 . PHE B 1 49  ? -6.343  19.847  -22.955 1.00 25.08  ? 49  PHE B CD1 1 
ATOM   3082  C CD2 . PHE B 1 49  ? -6.867  22.153  -23.375 1.00 23.61  ? 49  PHE B CD2 1 
ATOM   3083  C CE1 . PHE B 1 49  ? -5.026  20.072  -23.343 1.00 23.27  ? 49  PHE B CE1 1 
ATOM   3084  C CE2 . PHE B 1 49  ? -5.559  22.352  -23.811 1.00 23.64  ? 49  PHE B CE2 1 
ATOM   3085  C CZ  . PHE B 1 49  ? -4.651  21.316  -23.775 1.00 21.32  ? 49  PHE B CZ  1 
ATOM   3086  N N   . ASP B 1 50  ? -11.913 20.423  -23.130 1.00 33.82  ? 50  ASP B N   1 
ATOM   3087  C CA  . ASP B 1 50  ? -13.253 19.980  -22.709 1.00 33.89  ? 50  ASP B CA  1 
ATOM   3088  C C   . ASP B 1 50  ? -13.972 19.097  -23.709 1.00 38.23  ? 50  ASP B C   1 
ATOM   3089  O O   . ASP B 1 50  ? -14.532 18.056  -23.332 1.00 35.75  ? 50  ASP B O   1 
ATOM   3090  C CB  . ASP B 1 50  ? -14.142 21.168  -22.346 1.00 35.14  ? 50  ASP B CB  1 
ATOM   3091  C CG  . ASP B 1 50  ? -13.660 21.904  -21.112 1.00 49.75  ? 50  ASP B CG  1 
ATOM   3092  O OD1 . ASP B 1 50  ? -13.314 21.238  -20.109 1.00 52.56  ? 50  ASP B OD1 1 
ATOM   3093  O OD2 . ASP B 1 50  ? -13.669 23.156  -21.136 1.00 54.73  ? 50  ASP B OD2 1 
ATOM   3094  N N   . GLU B 1 51  ? -13.988 19.531  -24.969 1.00 37.70  ? 51  GLU B N   1 
ATOM   3095  C CA  . GLU B 1 51  ? -14.663 18.777  -26.030 1.00 38.02  ? 51  GLU B CA  1 
ATOM   3096  C C   . GLU B 1 51  ? -13.884 17.583  -26.578 1.00 41.68  ? 51  GLU B C   1 
ATOM   3097  O O   . GLU B 1 51  ? -14.462 16.699  -27.204 1.00 43.49  ? 51  GLU B O   1 
ATOM   3098  C CB  . GLU B 1 51  ? -15.174 19.704  -27.152 1.00 39.79  ? 51  GLU B CB  1 
ATOM   3099  C CG  . GLU B 1 51  ? -14.138 20.307  -28.102 1.00 47.43  ? 51  GLU B CG  1 
ATOM   3100  C CD  . GLU B 1 51  ? -14.794 20.876  -29.363 1.00 65.26  ? 51  GLU B CD  1 
ATOM   3101  O OE1 . GLU B 1 51  ? -15.129 22.072  -29.368 1.00 56.44  ? 51  GLU B OE1 1 
ATOM   3102  O OE2 . GLU B 1 51  ? -15.060 20.119  -30.319 1.00 60.73  ? 51  GLU B OE2 1 
ATOM   3103  N N   . LEU B 1 52  ? -12.575 17.563  -26.352 1.00 35.55  ? 52  LEU B N   1 
ATOM   3104  C CA  . LEU B 1 52  ? -11.762 16.436  -26.776 1.00 33.60  ? 52  LEU B CA  1 
ATOM   3105  C C   . LEU B 1 52  ? -12.237 15.264  -25.943 1.00 36.82  ? 52  LEU B C   1 
ATOM   3106  O O   . LEU B 1 52  ? -12.460 14.173  -26.474 1.00 35.06  ? 52  LEU B O   1 
ATOM   3107  C CB  . LEU B 1 52  ? -10.239 16.702  -26.552 1.00 32.76  ? 52  LEU B CB  1 
ATOM   3108  C CG  . LEU B 1 52  ? -9.298  15.471  -26.538 1.00 35.31  ? 52  LEU B CG  1 
ATOM   3109  C CD1 . LEU B 1 52  ? -9.009  14.892  -27.928 1.00 34.21  ? 52  LEU B CD1 1 
ATOM   3110  C CD2 . LEU B 1 52  ? -8.015  15.639  -25.739 1.00 36.17  ? 52  LEU B CD2 1 
ATOM   3111  N N   . VAL B 1 53  ? -12.380 15.496  -24.639 1.00 36.07  ? 53  VAL B N   1 
ATOM   3112  C CA  . VAL B 1 53  ? -12.795 14.438  -23.730 1.00 37.97  ? 53  VAL B CA  1 
ATOM   3113  C C   . VAL B 1 53  ? -14.268 14.082  -23.860 1.00 46.28  ? 53  VAL B C   1 
ATOM   3114  O O   . VAL B 1 53  ? -14.645 12.906  -23.800 1.00 46.75  ? 53  VAL B O   1 
ATOM   3115  C CB  . VAL B 1 53  ? -12.460 14.773  -22.295 1.00 41.71  ? 53  VAL B CB  1 
ATOM   3116  C CG1 . VAL B 1 53  ? -12.362 13.483  -21.504 1.00 42.09  ? 53  VAL B CG1 1 
ATOM   3117  C CG2 . VAL B 1 53  ? -11.131 15.562  -22.248 1.00 40.93  ? 53  VAL B CG2 1 
ATOM   3118  N N   . LYS B 1 54  ? -15.077 15.103  -24.134 1.00 44.79  ? 54  LYS B N   1 
ATOM   3119  C CA  . LYS B 1 54  ? -16.520 14.962  -24.300 1.00 44.82  ? 54  LYS B CA  1 
ATOM   3120  C C   . LYS B 1 54  ? -16.917 14.320  -25.625 1.00 45.72  ? 54  LYS B C   1 
ATOM   3121  O O   . LYS B 1 54  ? -17.929 13.633  -25.710 1.00 47.14  ? 54  LYS B O   1 
ATOM   3122  C CB  . LYS B 1 54  ? -17.212 16.333  -24.179 1.00 48.50  ? 54  LYS B CB  1 
ATOM   3123  C CG  . LYS B 1 54  ? -17.232 16.912  -22.759 1.00 73.02  ? 54  LYS B CG  1 
ATOM   3124  C CD  . LYS B 1 54  ? -18.159 18.142  -22.654 1.00 80.34  ? 54  LYS B CD  1 
ATOM   3125  C CE  . LYS B 1 54  ? -18.271 18.658  -21.203 1.00 75.06  ? 54  LYS B CE  1 
ATOM   3126  N NZ  . LYS B 1 54  ? -17.270 19.702  -20.816 1.00 68.20  ? 54  LYS B NZ  1 
ATOM   3127  N N   . LYS B 1 55  ? -16.177 14.598  -26.687 1.00 38.37  ? 55  LYS B N   1 
ATOM   3128  C CA  . LYS B 1 55  ? -16.576 14.062  -27.991 1.00 37.97  ? 55  LYS B CA  1 
ATOM   3129  C C   . LYS B 1 55  ? -15.756 12.888  -28.529 1.00 41.20  ? 55  LYS B C   1 
ATOM   3130  O O   . LYS B 1 55  ? -16.094 12.330  -29.577 1.00 39.44  ? 55  LYS B O   1 
ATOM   3131  C CB  . LYS B 1 55  ? -16.647 15.153  -29.064 1.00 40.23  ? 55  LYS B CB  1 
ATOM   3132  C CG  . LYS B 1 55  ? -17.479 16.353  -28.692 1.00 49.64  ? 55  LYS B CG  1 
ATOM   3133  C CD  . LYS B 1 55  ? -17.929 17.128  -29.931 1.00 54.94  ? 55  LYS B CD  1 
ATOM   3134  C CE  . LYS B 1 55  ? -18.421 18.533  -29.551 1.00 50.78  ? 55  LYS B CE  1 
ATOM   3135  N NZ  . LYS B 1 55  ? -19.905 18.696  -29.424 1.00 22.07  ? 55  LYS B NZ  1 
ATOM   3136  N N   . PHE B 1 56  ? -14.655 12.539  -27.863 1.00 37.92  ? 56  PHE B N   1 
ATOM   3137  C CA  . PHE B 1 56  ? -13.795 11.461  -28.372 1.00 36.90  ? 56  PHE B CA  1 
ATOM   3138  C C   . PHE B 1 56  ? -13.412 10.399  -27.350 1.00 38.94  ? 56  PHE B C   1 
ATOM   3139  O O   . PHE B 1 56  ? -13.566 10.591  -26.136 1.00 38.32  ? 56  PHE B O   1 
ATOM   3140  C CB  . PHE B 1 56  ? -12.538 12.033  -29.038 1.00 38.56  ? 56  PHE B CB  1 
ATOM   3141  C CG  . PHE B 1 56  ? -12.823 13.038  -30.120 1.00 39.61  ? 56  PHE B CG  1 
ATOM   3142  C CD1 . PHE B 1 56  ? -13.147 14.351  -29.794 1.00 42.25  ? 56  PHE B CD1 1 
ATOM   3143  C CD2 . PHE B 1 56  ? -12.794 12.667  -31.457 1.00 41.95  ? 56  PHE B CD2 1 
ATOM   3144  C CE1 . PHE B 1 56  ? -13.427 15.293  -30.777 1.00 43.19  ? 56  PHE B CE1 1 
ATOM   3145  C CE2 . PHE B 1 56  ? -13.083 13.600  -32.454 1.00 45.36  ? 56  PHE B CE2 1 
ATOM   3146  C CZ  . PHE B 1 56  ? -13.356 14.938  -32.106 1.00 42.90  ? 56  PHE B CZ  1 
ATOM   3147  N N   . LYS B 1 57  ? -12.939 9.263   -27.852 1.00 35.22  ? 57  LYS B N   1 
ATOM   3148  C CA  . LYS B 1 57  ? -12.503 8.166   -26.988 1.00 35.36  ? 57  LYS B CA  1 
ATOM   3149  C C   . LYS B 1 57  ? -11.053 8.378   -26.569 1.00 40.31  ? 57  LYS B C   1 
ATOM   3150  O O   . LYS B 1 57  ? -10.100 7.791   -27.109 1.00 39.00  ? 57  LYS B O   1 
ATOM   3151  C CB  . LYS B 1 57  ? -12.696 6.794   -27.637 1.00 37.99  ? 57  LYS B CB  1 
ATOM   3152  C CG  . LYS B 1 57  ? -14.166 6.381   -27.742 1.00 67.92  ? 57  LYS B CG  1 
ATOM   3153  C CD  . LYS B 1 57  ? -14.342 4.870   -27.793 1.00 78.32  ? 57  LYS B CD  1 
ATOM   3154  C CE  . LYS B 1 57  ? -15.669 4.472   -28.461 1.00 82.67  ? 57  LYS B CE  1 
ATOM   3155  N NZ  . LYS B 1 57  ? -16.717 5.538   -28.429 1.00 76.43  ? 57  LYS B NZ  1 
ATOM   3156  N N   . VAL B 1 58  ? -10.907 9.234   -25.570 1.00 37.13  ? 58  VAL B N   1 
ATOM   3157  C CA  . VAL B 1 58  ? -9.609  9.597   -25.027 1.00 34.95  ? 58  VAL B CA  1 
ATOM   3158  C C   . VAL B 1 58  ? -8.993  8.627   -23.994 1.00 37.13  ? 58  VAL B C   1 
ATOM   3159  O O   . VAL B 1 58  ? -9.700  7.858   -23.350 1.00 37.22  ? 58  VAL B O   1 
ATOM   3160  C CB  . VAL B 1 58  ? -9.626  11.066  -24.566 1.00 37.11  ? 58  VAL B CB  1 
ATOM   3161  C CG1 . VAL B 1 58  ? -10.340 11.265  -23.238 1.00 36.38  ? 58  VAL B CG1 1 
ATOM   3162  C CG2 . VAL B 1 58  ? -8.255  11.577  -24.520 1.00 37.88  ? 58  VAL B CG2 1 
ATOM   3163  N N   . GLU B 1 59  ? -7.666  8.638   -23.885 1.00 33.34  ? 59  GLU B N   1 
ATOM   3164  C CA  . GLU B 1 59  ? -6.935  7.795   -22.931 1.00 33.36  ? 59  GLU B CA  1 
ATOM   3165  C C   . GLU B 1 59  ? -5.920  8.611   -22.164 1.00 38.01  ? 59  GLU B C   1 
ATOM   3166  O O   . GLU B 1 59  ? -5.525  9.689   -22.606 1.00 36.75  ? 59  GLU B O   1 
ATOM   3167  C CB  . GLU B 1 59  ? -6.220  6.647   -23.633 1.00 34.85  ? 59  GLU B CB  1 
ATOM   3168  C CG  . GLU B 1 59  ? -7.145  5.578   -24.127 1.00 41.67  ? 59  GLU B CG  1 
ATOM   3169  C CD  . GLU B 1 59  ? -6.391  4.474   -24.758 1.00 49.13  ? 59  GLU B CD  1 
ATOM   3170  O OE1 . GLU B 1 59  ? -5.367  4.114   -24.160 1.00 33.92  ? 59  GLU B OE1 1 
ATOM   3171  O OE2 . GLU B 1 59  ? -6.793  4.006   -25.851 1.00 49.25  ? 59  GLU B OE2 1 
ATOM   3172  N N   . TYR B 1 60  ? -5.493  8.084   -21.014 1.00 35.88  ? 60  TYR B N   1 
ATOM   3173  C CA  . TYR B 1 60  ? -4.582  8.805   -20.114 1.00 33.65  ? 60  TYR B CA  1 
ATOM   3174  C C   . TYR B 1 60  ? -3.254  8.100   -19.847 1.00 35.14  ? 60  TYR B C   1 
ATOM   3175  O O   . TYR B 1 60  ? -3.214  6.887   -19.669 1.00 32.55  ? 60  TYR B O   1 
ATOM   3176  C CB  . TYR B 1 60  ? -5.300  9.145   -18.822 1.00 33.30  ? 60  TYR B CB  1 
ATOM   3177  C CG  . TYR B 1 60  ? -6.619  9.841   -19.022 1.00 34.08  ? 60  TYR B CG  1 
ATOM   3178  C CD1 . TYR B 1 60  ? -6.672  11.217  -19.186 1.00 36.79  ? 60  TYR B CD1 1 
ATOM   3179  C CD2 . TYR B 1 60  ? -7.819  9.140   -18.972 1.00 34.50  ? 60  TYR B CD2 1 
ATOM   3180  C CE1 . TYR B 1 60  ? -7.891  11.889  -19.255 1.00 37.39  ? 60  TYR B CE1 1 
ATOM   3181  C CE2 . TYR B 1 60  ? -9.039  9.802   -19.014 1.00 35.46  ? 60  TYR B CE2 1 
ATOM   3182  C CZ  . TYR B 1 60  ? -9.071  11.171  -19.184 1.00 44.12  ? 60  TYR B CZ  1 
ATOM   3183  O OH  . TYR B 1 60  ? -10.265 11.831  -19.326 1.00 46.59  ? 60  TYR B OH  1 
ATOM   3184  N N   . HIS B 1 61  ? -2.165  8.869   -19.896 1.00 32.62  ? 61  HIS B N   1 
ATOM   3185  C CA  . HIS B 1 61  ? -0.809  8.334   -19.741 1.00 32.56  ? 61  HIS B CA  1 
ATOM   3186  C C   . HIS B 1 61  ? 0.085   9.402   -19.151 1.00 32.75  ? 61  HIS B C   1 
ATOM   3187  O O   . HIS B 1 61  ? 0.143   10.502  -19.690 1.00 33.55  ? 61  HIS B O   1 
ATOM   3188  C CB  . HIS B 1 61  ? -0.197  7.943   -21.129 1.00 34.16  ? 61  HIS B CB  1 
ATOM   3189  C CG  . HIS B 1 61  ? -0.906  6.815   -21.815 1.00 40.14  ? 61  HIS B CG  1 
ATOM   3190  N ND1 . HIS B 1 61  ? -0.705  5.492   -21.478 1.00 42.94  ? 61  HIS B ND1 1 
ATOM   3191  C CD2 . HIS B 1 61  ? -1.842  6.811   -22.797 1.00 43.36  ? 61  HIS B CD2 1 
ATOM   3192  C CE1 . HIS B 1 61  ? -1.477  4.723   -22.226 1.00 42.63  ? 61  HIS B CE1 1 
ATOM   3193  N NE2 . HIS B 1 61  ? -2.173  5.499   -23.039 1.00 43.24  ? 61  HIS B NE2 1 
ATOM   3194  N N   . ALA B 1 62  ? 0.846   9.074   -18.109 1.00 24.18  ? 62  ALA B N   1 
ATOM   3195  C CA  . ALA B 1 62  ? 1.832   10.033  -17.620 1.00 23.40  ? 62  ALA B CA  1 
ATOM   3196  C C   . ALA B 1 62  ? 2.754   10.466  -18.761 1.00 25.22  ? 62  ALA B C   1 
ATOM   3197  O O   . ALA B 1 62  ? 3.240   9.650   -19.580 1.00 20.56  ? 62  ALA B O   1 
ATOM   3198  C CB  . ALA B 1 62  ? 2.679   9.465   -16.461 1.00 24.56  ? 62  ALA B CB  1 
ATOM   3199  N N   . GLY B 1 63  ? 2.982   11.774  -18.803 1.00 22.63  ? 63  GLY B N   1 
ATOM   3200  C CA  . GLY B 1 63  ? 3.848   12.371  -19.818 1.00 20.53  ? 63  GLY B CA  1 
ATOM   3201  C C   . GLY B 1 63  ? 4.817   13.410  -19.245 1.00 17.05  ? 63  GLY B C   1 
ATOM   3202  O O   . GLY B 1 63  ? 5.201   13.366  -18.077 1.00 16.27  ? 63  GLY B O   1 
ATOM   3203  N N   . GLY B 1 64  ? 5.142   14.386  -20.077 1.00 9.61   ? 64  GLY B N   1 
ATOM   3204  C CA  . GLY B 1 64  ? 6.129   15.386  -19.741 1.00 8.22   ? 64  GLY B CA  1 
ATOM   3205  C C   . GLY B 1 64  ? 7.450   14.833  -20.284 1.00 15.59  ? 64  GLY B C   1 
ATOM   3206  O O   . GLY B 1 64  ? 7.935   13.754  -19.887 1.00 15.99  ? 64  GLY B O   1 
ATOM   3207  N N   . SER B 1 65  ? 7.971   15.514  -21.284 1.00 12.14  ? 65  SER B N   1 
ATOM   3208  C CA  . SER B 1 65  ? 9.186   15.080  -21.938 1.00 11.75  ? 65  SER B CA  1 
ATOM   3209  C C   . SER B 1 65  ? 10.338  14.652  -20.969 1.00 16.43  ? 65  SER B C   1 
ATOM   3210  O O   . SER B 1 65  ? 10.711  13.469  -20.911 1.00 19.42  ? 65  SER B O   1 
ATOM   3211  C CB  . SER B 1 65  ? 9.607   16.128  -22.956 1.00 13.04  ? 65  SER B CB  1 
ATOM   3212  O OG  . SER B 1 65  ? 10.608  15.629  -23.799 1.00 26.48  ? 65  SER B OG  1 
ATOM   3213  N N   . THR B 1 66  ? 10.827  15.561  -20.143 1.00 9.07   ? 66  THR B N   1 
ATOM   3214  C CA  . THR B 1 66  ? 11.865  15.193  -19.169 1.00 8.99   ? 66  THR B CA  1 
ATOM   3215  C C   . THR B 1 66  ? 11.477  13.964  -18.307 1.00 14.25  ? 66  THR B C   1 
ATOM   3216  O O   . THR B 1 66  ? 12.243  13.014  -18.176 1.00 14.00  ? 66  THR B O   1 
ATOM   3217  C CB  . THR B 1 66  ? 12.283  16.381  -18.271 1.00 17.04  ? 66  THR B CB  1 
ATOM   3218  O OG1 . THR B 1 66  ? 12.849  17.414  -19.085 1.00 13.98  ? 66  THR B OG1 1 
ATOM   3219  C CG2 . THR B 1 66  ? 13.361  15.954  -17.308 1.00 26.46  ? 66  THR B CG2 1 
ATOM   3220  N N   . GLN B 1 67  ? 10.249  13.949  -17.812 1.00 10.73  ? 67  GLN B N   1 
ATOM   3221  C CA  . GLN B 1 67  ? 9.751   12.868  -16.976 1.00 10.98  ? 67  GLN B CA  1 
ATOM   3222  C C   . GLN B 1 67  ? 9.823   11.510  -17.692 1.00 18.71  ? 67  GLN B C   1 
ATOM   3223  O O   . GLN B 1 67  ? 10.178  10.493  -17.088 1.00 21.24  ? 67  GLN B O   1 
ATOM   3224  C CB  . GLN B 1 67  ? 8.301   13.176  -16.547 1.00 12.18  ? 67  GLN B CB  1 
ATOM   3225  C CG  . GLN B 1 67  ? 7.716   12.156  -15.540 1.00 32.66  ? 67  GLN B CG  1 
ATOM   3226  C CD  . GLN B 1 67  ? 6.569   12.730  -14.707 1.00 34.93  ? 67  GLN B CD  1 
ATOM   3227  O OE1 . GLN B 1 67  ? 6.576   12.678  -13.467 1.00 18.03  ? 67  GLN B OE1 1 
ATOM   3228  N NE2 . GLN B 1 67  ? 5.558   13.260  -15.400 1.00 15.48  ? 67  GLN B NE2 1 
ATOM   3229  N N   . ASN B 1 68  ? 9.469   11.495  -18.972 1.00 12.19  ? 68  ASN B N   1 
ATOM   3230  C CA  . ASN B 1 68  ? 9.509   10.291  -19.771 1.00 10.55  ? 68  ASN B CA  1 
ATOM   3231  C C   . ASN B 1 68  ? 10.943  9.764   -19.953 1.00 17.47  ? 68  ASN B C   1 
ATOM   3232  O O   . ASN B 1 68  ? 11.186  8.554   -19.834 1.00 19.49  ? 68  ASN B O   1 
ATOM   3233  C CB  . ASN B 1 68  ? 8.849   10.567  -21.135 1.00 5.86   ? 68  ASN B CB  1 
ATOM   3234  C CG  . ASN B 1 68  ? 7.340   10.824  -21.019 1.00 27.31  ? 68  ASN B CG  1 
ATOM   3235  O OD1 . ASN B 1 68  ? 6.757   10.624  -19.952 1.00 26.63  ? 68  ASN B OD1 1 
ATOM   3236  N ND2 . ASN B 1 68  ? 6.685   11.221  -22.136 1.00 8.85   ? 68  ASN B ND2 1 
ATOM   3237  N N   . SER B 1 69  ? 11.888  10.654  -20.275 1.00 10.61  ? 69  SER B N   1 
ATOM   3238  C CA  . SER B 1 69  ? 13.284  10.252  -20.465 1.00 7.77   ? 69  SER B CA  1 
ATOM   3239  C C   . SER B 1 69  ? 13.916  9.733   -19.171 1.00 13.01  ? 69  SER B C   1 
ATOM   3240  O O   . SER B 1 69  ? 14.779  8.835   -19.170 1.00 10.79  ? 69  SER B O   1 
ATOM   3241  C CB  . SER B 1 69  ? 14.083  11.435  -20.976 1.00 7.93   ? 69  SER B CB  1 
ATOM   3242  O OG  . SER B 1 69  ? 13.881  11.589  -22.363 1.00 11.14  ? 69  SER B OG  1 
ATOM   3243  N N   . ILE B 1 70  ? 13.532  10.346  -18.060 1.00 13.42  ? 70  ILE B N   1 
ATOM   3244  C CA  . ILE B 1 70  ? 14.065  9.940   -16.754 1.00 12.67  ? 70  ILE B CA  1 
ATOM   3245  C C   . ILE B 1 70  ? 13.488  8.572   -16.395 1.00 17.07  ? 70  ILE B C   1 
ATOM   3246  O O   . ILE B 1 70  ? 14.164  7.751   -15.821 1.00 16.03  ? 70  ILE B O   1 
ATOM   3247  C CB  . ILE B 1 70  ? 13.774  11.046  -15.669 1.00 13.43  ? 70  ILE B CB  1 
ATOM   3248  C CG1 . ILE B 1 70  ? 14.676  12.254  -15.918 1.00 10.21  ? 70  ILE B CG1 1 
ATOM   3249  C CG2 . ILE B 1 70  ? 13.924  10.517  -14.234 1.00 14.16  ? 70  ILE B CG2 1 
ATOM   3250  C CD1 . ILE B 1 70  ? 16.144  12.029  -15.531 1.00 1.00   ? 70  ILE B CD1 1 
ATOM   3251  N N   . LYS B 1 71  ? 12.254  8.313   -16.806 1.00 14.56  ? 71  LYS B N   1 
ATOM   3252  C CA  . LYS B 1 71  ? 11.660  7.025   -16.537 1.00 15.20  ? 71  LYS B CA  1 
ATOM   3253  C C   . LYS B 1 71  ? 12.391  5.913   -17.318 1.00 18.87  ? 71  LYS B C   1 
ATOM   3254  O O   . LYS B 1 71  ? 12.777  4.900   -16.729 1.00 19.88  ? 71  LYS B O   1 
ATOM   3255  C CB  . LYS B 1 71  ? 10.167  7.052   -16.870 1.00 17.71  ? 71  LYS B CB  1 
ATOM   3256  C CG  . LYS B 1 71  ? 9.284   7.606   -15.757 1.00 17.48  ? 71  LYS B CG  1 
ATOM   3257  C CD  . LYS B 1 71  ? 7.810   7.581   -16.166 1.00 19.09  ? 71  LYS B CD  1 
ATOM   3258  C CE  . LYS B 1 71  ? 6.912   8.065   -15.031 1.00 29.70  ? 71  LYS B CE  1 
ATOM   3259  N NZ  . LYS B 1 71  ? 5.807   8.914   -15.519 1.00 22.94  ? 71  LYS B NZ  1 
ATOM   3260  N N   . VAL B 1 72  ? 12.619  6.154   -18.617 1.00 11.53  ? 72  VAL B N   1 
ATOM   3261  C CA  . VAL B 1 72  ? 13.333  5.259   -19.537 1.00 9.83   ? 72  VAL B CA  1 
ATOM   3262  C C   . VAL B 1 72  ? 14.789  5.042   -19.135 1.00 17.37  ? 72  VAL B C   1 
ATOM   3263  O O   . VAL B 1 72  ? 15.335  3.975   -19.279 1.00 19.14  ? 72  VAL B O   1 
ATOM   3264  C CB  . VAL B 1 72  ? 13.288  5.842   -20.957 1.00 12.60  ? 72  VAL B CB  1 
ATOM   3265  C CG1 . VAL B 1 72  ? 14.126  5.016   -21.913 1.00 12.06  ? 72  VAL B CG1 1 
ATOM   3266  C CG2 . VAL B 1 72  ? 11.823  5.936   -21.415 1.00 12.23  ? 72  VAL B CG2 1 
ATOM   3267  N N   . ALA B 1 73  ? 15.407  6.080   -18.622 1.00 17.28  ? 73  ALA B N   1 
ATOM   3268  C CA  . ALA B 1 73  ? 16.759  6.027   -18.136 1.00 17.99  ? 73  ALA B CA  1 
ATOM   3269  C C   . ALA B 1 73  ? 16.773  4.996   -17.027 1.00 25.61  ? 73  ALA B C   1 
ATOM   3270  O O   . ALA B 1 73  ? 17.603  4.077   -17.018 1.00 27.93  ? 73  ALA B O   1 
ATOM   3271  C CB  . ALA B 1 73  ? 17.155  7.429   -17.568 1.00 18.63  ? 73  ALA B CB  1 
ATOM   3272  N N   . GLN B 1 74  ? 15.862  5.194   -16.076 1.00 21.53  ? 74  GLN B N   1 
ATOM   3273  C CA  . GLN B 1 74  ? 15.741  4.356   -14.889 1.00 19.44  ? 74  GLN B CA  1 
ATOM   3274  C C   . GLN B 1 74  ? 15.536  2.940   -15.363 1.00 23.61  ? 74  GLN B C   1 
ATOM   3275  O O   . GLN B 1 74  ? 16.253  2.027   -14.979 1.00 25.58  ? 74  GLN B O   1 
ATOM   3276  C CB  . GLN B 1 74  ? 14.561  4.838   -14.025 1.00 19.36  ? 74  GLN B CB  1 
ATOM   3277  C CG  . GLN B 1 74  ? 14.409  4.156   -12.674 1.00 5.00   ? 74  GLN B CG  1 
ATOM   3278  C CD  . GLN B 1 74  ? 15.724  3.987   -11.918 1.00 27.35  ? 74  GLN B CD  1 
ATOM   3279  O OE1 . GLN B 1 74  ? 16.395  4.978   -11.572 1.00 13.72  ? 74  GLN B OE1 1 
ATOM   3280  N NE2 . GLN B 1 74  ? 16.070  2.733   -11.589 1.00 20.33  ? 74  GLN B NE2 1 
ATOM   3281  N N   . TRP B 1 75  ? 14.599  2.772   -16.273 1.00 20.54  ? 75  TRP B N   1 
ATOM   3282  C CA  . TRP B 1 75  ? 14.315  1.450   -16.820 1.00 20.77  ? 75  TRP B CA  1 
ATOM   3283  C C   . TRP B 1 75  ? 15.556  0.796   -17.416 1.00 25.30  ? 75  TRP B C   1 
ATOM   3284  O O   . TRP B 1 75  ? 15.746  -0.385  -17.211 1.00 28.16  ? 75  TRP B O   1 
ATOM   3285  C CB  . TRP B 1 75  ? 13.209  1.516   -17.860 1.00 19.88  ? 75  TRP B CB  1 
ATOM   3286  C CG  . TRP B 1 75  ? 12.825  0.189   -18.398 1.00 22.06  ? 75  TRP B CG  1 
ATOM   3287  C CD1 . TRP B 1 75  ? 12.081  -0.780  -17.766 1.00 25.13  ? 75  TRP B CD1 1 
ATOM   3288  C CD2 . TRP B 1 75  ? 13.135  -0.329  -19.700 1.00 22.26  ? 75  TRP B CD2 1 
ATOM   3289  N NE1 . TRP B 1 75  ? 11.861  -1.827  -18.625 1.00 25.12  ? 75  TRP B NE1 1 
ATOM   3290  C CE2 . TRP B 1 75  ? 12.543  -1.599  -19.795 1.00 26.15  ? 75  TRP B CE2 1 
ATOM   3291  C CE3 . TRP B 1 75  ? 13.872  0.158   -20.791 1.00 24.13  ? 75  TRP B CE3 1 
ATOM   3292  C CZ2 . TRP B 1 75  ? 12.642  -2.383  -20.946 1.00 25.93  ? 75  TRP B CZ2 1 
ATOM   3293  C CZ3 . TRP B 1 75  ? 14.004  -0.642  -21.921 1.00 25.51  ? 75  TRP B CZ3 1 
ATOM   3294  C CH2 . TRP B 1 75  ? 13.363  -1.880  -22.005 1.00 25.99  ? 75  TRP B CH2 1 
ATOM   3295  N N   . MET B 1 76  ? 16.388  1.516   -18.168 1.00 18.11  ? 76  MET B N   1 
ATOM   3296  C CA  . MET B 1 76  ? 17.581  0.855   -18.685 1.00 17.90  ? 76  MET B CA  1 
ATOM   3297  C C   . MET B 1 76  ? 18.598  0.657   -17.544 1.00 25.50  ? 76  MET B C   1 
ATOM   3298  O O   . MET B 1 76  ? 19.294  -0.341  -17.520 1.00 23.90  ? 76  MET B O   1 
ATOM   3299  C CB  . MET B 1 76  ? 18.252  1.582   -19.853 1.00 20.02  ? 76  MET B CB  1 
ATOM   3300  C CG  . MET B 1 76  ? 17.459  1.791   -21.094 1.00 23.25  ? 76  MET B CG  1 
ATOM   3301  S SD  . MET B 1 76  ? 17.647  0.439   -22.264 1.00 27.30  ? 76  MET B SD  1 
ATOM   3302  C CE  . MET B 1 76  ? 19.202  0.735   -22.924 1.00 23.76  ? 76  MET B CE  1 
ATOM   3303  N N   . ILE B 1 77  ? 18.703  1.607   -16.613 1.00 26.05  ? 77  ILE B N   1 
ATOM   3304  C CA  . ILE B 1 77  ? 19.555  1.327   -15.466 1.00 26.69  ? 77  ILE B CA  1 
ATOM   3305  C C   . ILE B 1 77  ? 19.099  0.060   -14.745 1.00 35.22  ? 77  ILE B C   1 
ATOM   3306  O O   . ILE B 1 77  ? 19.859  -0.871  -14.508 1.00 34.88  ? 77  ILE B O   1 
ATOM   3307  C CB  . ILE B 1 77  ? 19.477  2.519   -14.512 1.00 29.39  ? 77  ILE B CB  1 
ATOM   3308  C CG1 . ILE B 1 77  ? 19.883  3.806   -15.231 1.00 29.28  ? 77  ILE B CG1 1 
ATOM   3309  C CG2 . ILE B 1 77  ? 20.445  2.311   -13.332 1.00 28.62  ? 77  ILE B CG2 1 
ATOM   3310  C CD1 . ILE B 1 77  ? 20.212  4.938   -14.257 1.00 21.75  ? 77  ILE B CD1 1 
ATOM   3311  N N   . GLN B 1 78  ? 17.807  0.061   -14.364 1.00 34.36  ? 78  GLN B N   1 
ATOM   3312  C CA  . GLN B 1 78  ? 17.290  -1.067  -13.599 1.00 34.68  ? 78  GLN B CA  1 
ATOM   3313  C C   . GLN B 1 78  ? 17.673  -0.925  -12.125 1.00 37.32  ? 78  GLN B C   1 
ATOM   3314  O O   . GLN B 1 78  ? 17.163  -0.086  -11.392 1.00 34.42  ? 78  GLN B O   1 
ATOM   3315  C CB  . GLN B 1 78  ? 17.918  -2.336  -14.180 1.00 36.19  ? 78  GLN B CB  1 
ATOM   3316  C CG  . GLN B 1 78  ? 17.015  -3.564  -14.053 1.00 41.79  ? 78  GLN B CG  1 
ATOM   3317  C CD  . GLN B 1 78  ? 15.573  -3.162  -14.250 1.00 51.72  ? 78  GLN B CD  1 
ATOM   3318  O OE1 . GLN B 1 78  ? 15.138  -2.735  -15.306 1.00 26.28  ? 78  GLN B OE1 1 
ATOM   3319  N NE2 . GLN B 1 78  ? 14.811  -3.330  -13.150 1.00 54.36  ? 78  GLN B NE2 1 
ATOM   3320  N N   . GLN B 1 79  ? 18.579  -1.816  -11.685 1.00 37.24  ? 79  GLN B N   1 
ATOM   3321  C CA  . GLN B 1 79  ? 19.146  -1.663  -10.352 1.00 38.78  ? 79  GLN B CA  1 
ATOM   3322  C C   . GLN B 1 79  ? 20.367  -0.742  -10.400 1.00 43.98  ? 79  GLN B C   1 
ATOM   3323  O O   . GLN B 1 79  ? 21.170  -0.781  -11.319 1.00 48.63  ? 79  GLN B O   1 
ATOM   3324  C CB  . GLN B 1 79  ? 19.563  -3.049  -9.853  1.00 40.39  ? 79  GLN B CB  1 
ATOM   3325  C CG  . GLN B 1 79  ? 18.732  -3.518  -8.657  1.00 64.20  ? 79  GLN B CG  1 
ATOM   3326  C CD  . GLN B 1 79  ? 17.516  -4.265  -9.154  1.00 78.86  ? 79  GLN B CD  1 
ATOM   3327  O OE1 . GLN B 1 79  ? 16.674  -3.757  -9.874  1.00 65.03  ? 79  GLN B OE1 1 
ATOM   3328  N NE2 . GLN B 1 79  ? 17.445  -5.541  -8.723  1.00 75.06  ? 79  GLN B NE2 1 
ATOM   3329  N N   . PRO B 1 80  ? 20.480  0.130   -9.381  1.00 32.88  ? 80  PRO B N   1 
ATOM   3330  C CA  . PRO B 1 80  ? 19.544  0.155   -8.273  1.00 29.74  ? 80  PRO B CA  1 
ATOM   3331  C C   . PRO B 1 80  ? 18.308  0.997   -8.593  1.00 32.78  ? 80  PRO B C   1 
ATOM   3332  O O   . PRO B 1 80  ? 18.182  1.611   -9.646  1.00 32.19  ? 80  PRO B O   1 
ATOM   3333  C CB  . PRO B 1 80  ? 20.285  0.772   -7.094  1.00 29.96  ? 80  PRO B CB  1 
ATOM   3334  C CG  . PRO B 1 80  ? 21.417  1.633   -7.656  1.00 34.55  ? 80  PRO B CG  1 
ATOM   3335  C CD  . PRO B 1 80  ? 21.500  1.146   -9.181  1.00 30.90  ? 80  PRO B CD  1 
ATOM   3336  N N   . HIS B 1 81  ? 17.358  0.979   -7.640  1.00 26.32  ? 81  HIS B N   1 
ATOM   3337  C CA  . HIS B 1 81  ? 16.151  1.777   -7.802  1.00 25.00  ? 81  HIS B CA  1 
ATOM   3338  C C   . HIS B 1 81  ? 16.428  3.257   -7.527  1.00 26.19  ? 81  HIS B C   1 
ATOM   3339  O O   . HIS B 1 81  ? 17.268  3.614   -6.712  1.00 25.24  ? 81  HIS B O   1 
ATOM   3340  C CB  . HIS B 1 81  ? 15.105  1.258   -6.813  1.00 27.24  ? 81  HIS B CB  1 
ATOM   3341  C CG  . HIS B 1 81  ? 14.474  -0.004  -7.346  1.00 31.63  ? 81  HIS B CG  1 
ATOM   3342  N ND1 . HIS B 1 81  ? 14.768  -0.533  -8.561  1.00 33.98  ? 81  HIS B ND1 1 
ATOM   3343  C CD2 . HIS B 1 81  ? 13.517  -0.818  -6.728  1.00 33.48  ? 81  HIS B CD2 1 
ATOM   3344  C CE1 . HIS B 1 81  ? 14.007  -1.640  -8.670  1.00 33.55  ? 81  HIS B CE1 1 
ATOM   3345  N NE2 . HIS B 1 81  ? 13.248  -1.835  -7.588  1.00 33.79  ? 81  HIS B NE2 1 
ATOM   3346  N N   . LYS B 1 82  ? 15.729  4.283   -8.022  1.00 24.62  ? 82  LYS B N   1 
ATOM   3347  C CA  . LYS B 1 82  ? 15.937  5.676   -7.624  1.00 24.55  ? 82  LYS B CA  1 
ATOM   3348  C C   . LYS B 1 82  ? 17.294  6.180   -8.064  1.00 28.60  ? 82  LYS B C   1 
ATOM   3349  O O   . LYS B 1 82  ? 17.882  7.092   -7.434  1.00 27.26  ? 82  LYS B O   1 
ATOM   3350  C CB  . LYS B 1 82  ? 15.817  5.832   -6.096  1.00 28.94  ? 82  LYS B CB  1 
ATOM   3351  C CG  . LYS B 1 82  ? 14.392  5.803   -5.541  1.00 31.78  ? 82  LYS B CG  1 
ATOM   3352  C CD  . LYS B 1 82  ? 14.385  6.088   -4.042  1.00 36.08  ? 82  LYS B CD  1 
ATOM   3353  C CE  . LYS B 1 82  ? 12.964  6.088   -3.495  1.00 57.34  ? 82  LYS B CE  1 
ATOM   3354  N NZ  . LYS B 1 82  ? 12.571  4.825   -2.806  1.00 68.23  ? 82  LYS B NZ  1 
ATOM   3355  N N   . ALA B 1 83  ? 17.822  5.567   -9.125  1.00 25.48  ? 83  ALA B N   1 
ATOM   3356  C CA  . ALA B 1 83  ? 19.109  6.007   -9.666  1.00 24.38  ? 83  ALA B CA  1 
ATOM   3357  C C   . ALA B 1 83  ? 18.888  7.353   -10.329 1.00 24.70  ? 83  ALA B C   1 
ATOM   3358  O O   . ALA B 1 83  ? 19.854  8.091   -10.555 1.00 25.52  ? 83  ALA B O   1 
ATOM   3359  C CB  . ALA B 1 83  ? 19.639  5.013   -10.692 1.00 25.67  ? 83  ALA B CB  1 
ATOM   3360  N N   . ALA B 1 84  ? 17.626  7.623   -10.691 1.00 15.85  ? 84  ALA B N   1 
ATOM   3361  C CA  . ALA B 1 84  ? 17.227  8.819   -11.416 1.00 12.64  ? 84  ALA B CA  1 
ATOM   3362  C C   . ALA B 1 84  ? 16.301  9.668   -10.576 1.00 14.98  ? 84  ALA B C   1 
ATOM   3363  O O   . ALA B 1 84  ? 15.341  9.143   -10.034 1.00 13.32  ? 84  ALA B O   1 
ATOM   3364  C CB  . ALA B 1 84  ? 16.538  8.409   -12.698 1.00 12.67  ? 84  ALA B CB  1 
ATOM   3365  N N   . THR B 1 85  ? 16.595  10.969  -10.460 1.00 13.27  ? 85  THR B N   1 
ATOM   3366  C CA  . THR B 1 85  ? 15.758  11.928  -9.695  1.00 13.05  ? 85  THR B CA  1 
ATOM   3367  C C   . THR B 1 85  ? 14.871  12.797  -10.631 1.00 18.79  ? 85  THR B C   1 
ATOM   3368  O O   . THR B 1 85  ? 15.212  12.999  -11.802 1.00 21.54  ? 85  THR B O   1 
ATOM   3369  C CB  . THR B 1 85  ? 16.625  12.853  -8.868  1.00 18.83  ? 85  THR B CB  1 
ATOM   3370  O OG1 . THR B 1 85  ? 17.488  12.063  -8.056  1.00 26.90  ? 85  THR B OG1 1 
ATOM   3371  C CG2 . THR B 1 85  ? 15.776  13.741  -7.994  1.00 18.28  ? 85  THR B CG2 1 
ATOM   3372  N N   . PHE B 1 86  ? 13.735  13.294  -10.134 1.00 12.79  ? 86  PHE B N   1 
ATOM   3373  C CA  . PHE B 1 86  ? 12.848  14.136  -10.961 1.00 11.99  ? 86  PHE B CA  1 
ATOM   3374  C C   . PHE B 1 86  ? 12.014  15.152  -10.160 1.00 19.70  ? 86  PHE B C   1 
ATOM   3375  O O   . PHE B 1 86  ? 11.173  14.748  -9.328  1.00 22.38  ? 86  PHE B O   1 
ATOM   3376  C CB  . PHE B 1 86  ? 11.941  13.304  -11.878 1.00 12.37  ? 86  PHE B CB  1 
ATOM   3377  C CG  . PHE B 1 86  ? 11.045  14.132  -12.748 1.00 12.86  ? 86  PHE B CG  1 
ATOM   3378  C CD1 . PHE B 1 86  ? 11.530  14.734  -13.891 1.00 12.81  ? 86  PHE B CD1 1 
ATOM   3379  C CD2 . PHE B 1 86  ? 9.708   14.364  -12.394 1.00 15.71  ? 86  PHE B CD2 1 
ATOM   3380  C CE1 . PHE B 1 86  ? 10.756  15.632  -14.594 1.00 13.76  ? 86  PHE B CE1 1 
ATOM   3381  C CE2 . PHE B 1 86  ? 8.879   15.200  -13.167 1.00 16.98  ? 86  PHE B CE2 1 
ATOM   3382  C CZ  . PHE B 1 86  ? 9.397   15.824  -14.265 1.00 13.74  ? 86  PHE B CZ  1 
ATOM   3383  N N   . PHE B 1 87  ? 12.231  16.447  -10.436 1.00 13.19  ? 87  PHE B N   1 
ATOM   3384  C CA  . PHE B 1 87  ? 11.493  17.536  -9.779  1.00 12.60  ? 87  PHE B CA  1 
ATOM   3385  C C   . PHE B 1 87  ? 10.431  18.169  -10.713 1.00 19.58  ? 87  PHE B C   1 
ATOM   3386  O O   . PHE B 1 87  ? 10.669  18.321  -11.930 1.00 17.85  ? 87  PHE B O   1 
ATOM   3387  C CB  . PHE B 1 87  ? 12.419  18.672  -9.307  1.00 12.51  ? 87  PHE B CB  1 
ATOM   3388  C CG  . PHE B 1 87  ? 13.325  18.302  -8.163  1.00 14.13  ? 87  PHE B CG  1 
ATOM   3389  C CD1 . PHE B 1 87  ? 13.196  17.070  -7.516  1.00 13.91  ? 87  PHE B CD1 1 
ATOM   3390  C CD2 . PHE B 1 87  ? 14.345  19.197  -7.741  1.00 16.45  ? 87  PHE B CD2 1 
ATOM   3391  C CE1 . PHE B 1 87  ? 14.060  16.724  -6.485  1.00 12.98  ? 87  PHE B CE1 1 
ATOM   3392  C CE2 . PHE B 1 87  ? 15.232  18.844  -6.724  1.00 17.36  ? 87  PHE B CE2 1 
ATOM   3393  C CZ  . PHE B 1 87  ? 15.105  17.592  -6.128  1.00 14.15  ? 87  PHE B CZ  1 
ATOM   3394  N N   . GLY B 1 88  ? 9.333   18.650  -10.120 1.00 16.67  ? 88  GLY B N   1 
ATOM   3395  C CA  . GLY B 1 88  ? 8.311   19.359  -10.874 1.00 16.86  ? 88  GLY B CA  1 
ATOM   3396  C C   . GLY B 1 88  ? 7.103   19.763  -10.033 1.00 21.80  ? 88  GLY B C   1 
ATOM   3397  O O   . GLY B 1 88  ? 6.874   19.254  -8.931  1.00 22.93  ? 88  GLY B O   1 
ATOM   3398  N N   . CYS B 1 89  ? 6.276   20.628  -10.595 1.00 17.31  ? 89  CYS B N   1 
ATOM   3399  C CA  . CYS B 1 89  ? 5.084   21.055  -9.899  1.00 17.88  ? 89  CYS B CA  1 
ATOM   3400  C C   . CYS B 1 89  ? 3.851   20.286  -10.398 1.00 21.58  ? 89  CYS B C   1 
ATOM   3401  O O   . CYS B 1 89  ? 3.660   20.042  -11.592 1.00 20.55  ? 89  CYS B O   1 
ATOM   3402  C CB  . CYS B 1 89  ? 4.881   22.569  -10.049 1.00 19.30  ? 89  CYS B CB  1 
ATOM   3403  S SG  . CYS B 1 89  ? 3.706   23.313  -8.845  1.00 24.08  ? 89  CYS B SG  1 
ATOM   3404  N N   . ILE B 1 90  ? 2.997   19.898  -9.469  1.00 17.61  ? 90  ILE B N   1 
ATOM   3405  C CA  . ILE B 1 90  ? 1.765   19.234  -9.850  1.00 15.87  ? 90  ILE B CA  1 
ATOM   3406  C C   . ILE B 1 90  ? 0.675   19.868  -8.995  1.00 23.57  ? 90  ILE B C   1 
ATOM   3407  O O   . ILE B 1 90  ? 0.943   20.722  -8.149  1.00 22.25  ? 90  ILE B O   1 
ATOM   3408  C CB  . ILE B 1 90  ? 1.825   17.690  -9.634  1.00 17.24  ? 90  ILE B CB  1 
ATOM   3409  C CG1 . ILE B 1 90  ? 2.436   17.360  -8.259  1.00 15.50  ? 90  ILE B CG1 1 
ATOM   3410  C CG2 . ILE B 1 90  ? 2.680   17.008  -10.733 1.00 16.95  ? 90  ILE B CG2 1 
ATOM   3411  C CD1 . ILE B 1 90  ? 2.266   15.955  -7.889  1.00 6.73   ? 90  ILE B CD1 1 
ATOM   3412  N N   . GLY B 1 91  ? -0.564  19.462  -9.243  1.00 23.02  ? 91  GLY B N   1 
ATOM   3413  C CA  . GLY B 1 91  ? -1.703  19.979  -8.498  1.00 20.80  ? 91  GLY B CA  1 
ATOM   3414  C C   . GLY B 1 91  ? -2.065  18.895  -7.491  1.00 18.08  ? 91  GLY B C   1 
ATOM   3415  O O   . GLY B 1 91  ? -1.618  17.761  -7.596  1.00 14.62  ? 91  GLY B O   1 
ATOM   3416  N N   . ILE B 1 92  ? -2.806  19.275  -6.460  1.00 12.39  ? 92  ILE B N   1 
ATOM   3417  C CA  . ILE B 1 92  ? -3.202  18.295  -5.464  1.00 11.65  ? 92  ILE B CA  1 
ATOM   3418  C C   . ILE B 1 92  ? -4.537  17.810  -5.969  1.00 16.88  ? 92  ILE B C   1 
ATOM   3419  O O   . ILE B 1 92  ? -5.565  18.341  -5.610  1.00 14.64  ? 92  ILE B O   1 
ATOM   3420  C CB  . ILE B 1 92  ? -3.399  18.932  -4.049  1.00 13.54  ? 92  ILE B CB  1 
ATOM   3421  C CG1 . ILE B 1 92  ? -2.085  19.316  -3.387  1.00 11.24  ? 92  ILE B CG1 1 
ATOM   3422  C CG2 . ILE B 1 92  ? -4.305  18.083  -3.127  1.00 10.93  ? 92  ILE B CG2 1 
ATOM   3423  C CD1 . ILE B 1 92  ? -2.354  20.128  -2.157  1.00 10.60  ? 92  ILE B CD1 1 
ATOM   3424  N N   . ASP B 1 93  ? -4.506  16.816  -6.847  1.00 17.19  ? 93  ASP B N   1 
ATOM   3425  C CA  . ASP B 1 93  ? -5.731  16.309  -7.415  1.00 17.39  ? 93  ASP B CA  1 
ATOM   3426  C C   . ASP B 1 93  ? -5.537  14.899  -8.016  1.00 23.33  ? 93  ASP B C   1 
ATOM   3427  O O   . ASP B 1 93  ? -4.437  14.352  -7.960  1.00 24.26  ? 93  ASP B O   1 
ATOM   3428  C CB  . ASP B 1 93  ? -6.247  17.337  -8.442  1.00 19.76  ? 93  ASP B CB  1 
ATOM   3429  C CG  . ASP B 1 93  ? -5.240  17.619  -9.586  1.00 28.52  ? 93  ASP B CG  1 
ATOM   3430  O OD1 . ASP B 1 93  ? -5.495  18.555  -10.376 1.00 25.33  ? 93  ASP B OD1 1 
ATOM   3431  O OD2 . ASP B 1 93  ? -4.237  16.884  -9.728  1.00 40.27  ? 93  ASP B OD2 1 
ATOM   3432  N N   . LYS B 1 94  ? -6.600  14.323  -8.583  1.00 18.80  ? 94  LYS B N   1 
ATOM   3433  C CA  . LYS B 1 94  ? -6.538  13.009  -9.216  1.00 18.40  ? 94  LYS B CA  1 
ATOM   3434  C C   . LYS B 1 94  ? -5.354  12.709  -10.144 1.00 22.23  ? 94  LYS B C   1 
ATOM   3435  O O   . LYS B 1 94  ? -4.697  11.680  -9.984  1.00 23.13  ? 94  LYS B O   1 
ATOM   3436  C CB  . LYS B 1 94  ? -7.828  12.709  -9.953  1.00 20.89  ? 94  LYS B CB  1 
ATOM   3437  C CG  . LYS B 1 94  ? -7.841  11.329  -10.577 1.00 42.99  ? 94  LYS B CG  1 
ATOM   3438  C CD  . LYS B 1 94  ? -9.189  11.029  -11.199 1.00 49.21  ? 94  LYS B CD  1 
ATOM   3439  C CE  . LYS B 1 94  ? -9.359  9.545   -11.426 1.00 63.00  ? 94  LYS B CE  1 
ATOM   3440  N NZ  . LYS B 1 94  ? -10.636 9.290   -12.145 1.00 81.15  ? 94  LYS B NZ  1 
ATOM   3441  N N   . PHE B 1 95  ? -5.122  13.574  -11.137 1.00 17.17  ? 95  PHE B N   1 
ATOM   3442  C CA  . PHE B 1 95  ? -4.016  13.433  -12.123 1.00 14.47  ? 95  PHE B CA  1 
ATOM   3443  C C   . PHE B 1 95  ? -2.649  13.528  -11.491 1.00 19.53  ? 95  PHE B C   1 
ATOM   3444  O O   . PHE B 1 95  ? -1.701  12.872  -11.936 1.00 18.73  ? 95  PHE B O   1 
ATOM   3445  C CB  . PHE B 1 95  ? -4.138  14.504  -13.188 1.00 15.27  ? 95  PHE B CB  1 
ATOM   3446  C CG  . PHE B 1 95  ? -5.362  14.340  -14.067 1.00 16.95  ? 95  PHE B CG  1 
ATOM   3447  C CD1 . PHE B 1 95  ? -6.153  13.177  -13.990 1.00 17.37  ? 95  PHE B CD1 1 
ATOM   3448  C CD2 . PHE B 1 95  ? -5.741  15.334  -14.950 1.00 17.75  ? 95  PHE B CD2 1 
ATOM   3449  C CE1 . PHE B 1 95  ? -7.245  13.003  -14.796 1.00 16.15  ? 95  PHE B CE1 1 
ATOM   3450  C CE2 . PHE B 1 95  ? -6.812  15.139  -15.778 1.00 19.81  ? 95  PHE B CE2 1 
ATOM   3451  C CZ  . PHE B 1 95  ? -7.566  13.962  -15.698 1.00 16.80  ? 95  PHE B CZ  1 
ATOM   3452  N N   . GLY B 1 96  ? -2.535  14.389  -10.475 1.00 17.37  ? 96  GLY B N   1 
ATOM   3453  C CA  . GLY B 1 96  ? -1.323  14.510  -9.694  1.00 16.43  ? 96  GLY B CA  1 
ATOM   3454  C C   . GLY B 1 96  ? -1.056  13.152  -9.050  1.00 23.06  ? 96  GLY B C   1 
ATOM   3455  O O   . GLY B 1 96  ? 0.029   12.561  -9.215  1.00 26.14  ? 96  GLY B O   1 
ATOM   3456  N N   . GLU B 1 97  ? -2.054  12.634  -8.341  1.00 18.06  ? 97  GLU B N   1 
ATOM   3457  C CA  . GLU B 1 97  ? -1.911  11.343  -7.674  1.00 18.89  ? 97  GLU B CA  1 
ATOM   3458  C C   . GLU B 1 97  ? -1.466  10.243  -8.651  1.00 19.46  ? 97  GLU B C   1 
ATOM   3459  O O   . GLU B 1 97  ? -0.616  9.396   -8.317  1.00 18.31  ? 97  GLU B O   1 
ATOM   3460  C CB  . GLU B 1 97  ? -3.220  10.977  -6.950  1.00 21.70  ? 97  GLU B CB  1 
ATOM   3461  C CG  . GLU B 1 97  ? -3.064  10.076  -5.712  1.00 41.70  ? 97  GLU B CG  1 
ATOM   3462  C CD  . GLU B 1 97  ? -2.021  10.576  -4.692  1.00 72.41  ? 97  GLU B CD  1 
ATOM   3463  O OE1 . GLU B 1 97  ? -2.305  11.590  -3.996  1.00 46.46  ? 97  GLU B OE1 1 
ATOM   3464  O OE2 . GLU B 1 97  ? -0.962  9.904   -4.534  1.00 70.78  ? 97  GLU B OE2 1 
ATOM   3465  N N   . ILE B 1 98  ? -2.001  10.312  -9.876  1.00 16.13  ? 98  ILE B N   1 
ATOM   3466  C CA  . ILE B 1 98  ? -1.680  9.393   -10.972 1.00 15.22  ? 98  ILE B CA  1 
ATOM   3467  C C   . ILE B 1 98  ? -0.240  9.541   -11.384 1.00 19.84  ? 98  ILE B C   1 
ATOM   3468  O O   . ILE B 1 98  ? 0.456   8.561   -11.507 1.00 22.21  ? 98  ILE B O   1 
ATOM   3469  C CB  . ILE B 1 98  ? -2.505  9.675   -12.231 1.00 18.82  ? 98  ILE B CB  1 
ATOM   3470  C CG1 . ILE B 1 98  ? -4.002  9.442   -11.990 1.00 18.30  ? 98  ILE B CG1 1 
ATOM   3471  C CG2 . ILE B 1 98  ? -1.953  8.848   -13.454 1.00 19.17  ? 98  ILE B CG2 1 
ATOM   3472  C CD1 . ILE B 1 98  ? -4.833  9.461   -13.296 1.00 1.19   ? 98  ILE B CD1 1 
ATOM   3473  N N   . LEU B 1 99  ? 0.207   10.770  -11.597 1.00 16.26  ? 99  LEU B N   1 
ATOM   3474  C CA  . LEU B 1 99  ? 1.590   11.017  -11.969 1.00 16.86  ? 99  LEU B CA  1 
ATOM   3475  C C   . LEU B 1 99  ? 2.548   10.524  -10.923 1.00 22.94  ? 99  LEU B C   1 
ATOM   3476  O O   . LEU B 1 99  ? 3.612   10.021  -11.253 1.00 23.01  ? 99  LEU B O   1 
ATOM   3477  C CB  . LEU B 1 99  ? 1.831   12.514  -12.242 1.00 17.01  ? 99  LEU B CB  1 
ATOM   3478  C CG  . LEU B 1 99  ? 1.104   13.076  -13.481 1.00 19.78  ? 99  LEU B CG  1 
ATOM   3479  C CD1 . LEU B 1 99  ? 1.483   14.510  -13.690 1.00 21.49  ? 99  LEU B CD1 1 
ATOM   3480  C CD2 . LEU B 1 99  ? 1.393   12.283  -14.709 1.00 14.17  ? 99  LEU B CD2 1 
ATOM   3481  N N   . LYS B 1 100 ? 2.220   10.735  -9.657  1.00 23.37  ? 100 LYS B N   1 
ATOM   3482  C CA  . LYS B 1 100 ? 3.133   10.299  -8.604  1.00 24.17  ? 100 LYS B CA  1 
ATOM   3483  C C   . LYS B 1 100 ? 3.134   8.749   -8.518  1.00 28.30  ? 100 LYS B C   1 
ATOM   3484  O O   . LYS B 1 100 ? 4.169   8.119   -8.235  1.00 24.69  ? 100 LYS B O   1 
ATOM   3485  C CB  . LYS B 1 100 ? 2.740   10.940  -7.275  1.00 26.49  ? 100 LYS B CB  1 
ATOM   3486  C CG  . LYS B 1 100 ? 2.669   12.438  -7.317  1.00 25.07  ? 100 LYS B CG  1 
ATOM   3487  C CD  . LYS B 1 100 ? 1.738   12.973  -6.246  1.00 35.50  ? 100 LYS B CD  1 
ATOM   3488  C CE  . LYS B 1 100 ? 2.056   12.454  -4.844  1.00 27.05  ? 100 LYS B CE  1 
ATOM   3489  N NZ  . LYS B 1 100 ? 0.853   12.690  -3.983  1.00 29.51  ? 100 LYS B NZ  1 
ATOM   3490  N N   . ARG B 1 101 ? 1.976   8.136   -8.787  1.00 25.39  ? 101 ARG B N   1 
ATOM   3491  C CA  . ARG B 1 101 ? 1.907   6.669   -8.737  1.00 25.16  ? 101 ARG B CA  1 
ATOM   3492  C C   . ARG B 1 101 ? 2.834   6.066   -9.801  1.00 28.81  ? 101 ARG B C   1 
ATOM   3493  O O   . ARG B 1 101 ? 3.681   5.188   -9.521  1.00 28.18  ? 101 ARG B O   1 
ATOM   3494  C CB  . ARG B 1 101 ? 0.479   6.169   -8.944  1.00 20.48  ? 101 ARG B CB  1 
ATOM   3495  C CG  . ARG B 1 101 ? 0.397   4.629   -9.020  1.00 25.00  ? 101 ARG B CG  1 
ATOM   3496  C CD  . ARG B 1 101 ? -0.952  4.095   -8.569  1.00 31.05  ? 101 ARG B CD  1 
ATOM   3497  N NE  . ARG B 1 101 ? -2.041  4.618   -9.393  1.00 47.27  ? 101 ARG B NE  1 
ATOM   3498  C CZ  . ARG B 1 101 ? -2.117  4.461   -10.713 1.00 57.83  ? 101 ARG B CZ  1 
ATOM   3499  N NH1 . ARG B 1 101 ? -1.182  3.765   -11.372 1.00 27.74  ? 101 ARG B NH1 1 
ATOM   3500  N NH2 . ARG B 1 101 ? -3.141  4.980   -11.374 1.00 47.71  ? 101 ARG B NH2 1 
ATOM   3501  N N   . LYS B 1 102 ? 2.670   6.601   -11.008 1.00 24.03  ? 102 LYS B N   1 
ATOM   3502  C CA  . LYS B 1 102 ? 3.375   6.196   -12.207 1.00 23.16  ? 102 LYS B CA  1 
ATOM   3503  C C   . LYS B 1 102 ? 4.870   6.395   -12.115 1.00 29.31  ? 102 LYS B C   1 
ATOM   3504  O O   . LYS B 1 102 ? 5.637   5.652   -12.742 1.00 30.05  ? 102 LYS B O   1 
ATOM   3505  C CB  . LYS B 1 102 ? 2.772   6.888   -13.433 1.00 23.42  ? 102 LYS B CB  1 
ATOM   3506  C CG  . LYS B 1 102 ? 1.356   6.371   -13.732 1.00 27.02  ? 102 LYS B CG  1 
ATOM   3507  C CD  . LYS B 1 102 ? 1.432   5.083   -14.562 1.00 37.23  ? 102 LYS B CD  1 
ATOM   3508  C CE  . LYS B 1 102 ? 0.183   4.239   -14.492 1.00 47.51  ? 102 LYS B CE  1 
ATOM   3509  N NZ  . LYS B 1 102 ? 0.518   2.846   -14.907 1.00 58.04  ? 102 LYS B NZ  1 
ATOM   3510  N N   . ALA B 1 103 ? 5.276   7.347   -11.272 1.00 25.05  ? 103 ALA B N   1 
ATOM   3511  C CA  . ALA B 1 103 ? 6.691   7.621   -11.017 1.00 22.88  ? 103 ALA B CA  1 
ATOM   3512  C C   . ALA B 1 103 ? 7.253   6.568   -10.071 1.00 25.19  ? 103 ALA B C   1 
ATOM   3513  O O   . ALA B 1 103 ? 8.352   6.062   -10.273 1.00 24.46  ? 103 ALA B O   1 
ATOM   3514  C CB  . ALA B 1 103 ? 6.870   9.012   -10.422 1.00 22.47  ? 103 ALA B CB  1 
ATOM   3515  N N   . ALA B 1 104 ? 6.486   6.239   -9.040  1.00 22.31  ? 104 ALA B N   1 
ATOM   3516  C CA  . ALA B 1 104 ? 6.935   5.270   -8.059  1.00 22.50  ? 104 ALA B CA  1 
ATOM   3517  C C   . ALA B 1 104 ? 7.061   3.877   -8.688  1.00 29.54  ? 104 ALA B C   1 
ATOM   3518  O O   . ALA B 1 104 ? 7.966   3.128   -8.308  1.00 30.46  ? 104 ALA B O   1 
ATOM   3519  C CB  . ALA B 1 104 ? 6.016   5.264   -6.841  1.00 22.24  ? 104 ALA B CB  1 
ATOM   3520  N N   . GLU B 1 105 ? 6.182   3.570   -9.661  1.00 23.12  ? 105 GLU B N   1 
ATOM   3521  C CA  . GLU B 1 105 ? 6.194   2.287   -10.392 1.00 21.11  ? 105 GLU B CA  1 
ATOM   3522  C C   . GLU B 1 105 ? 7.316   2.245   -11.419 1.00 27.72  ? 105 GLU B C   1 
ATOM   3523  O O   . GLU B 1 105 ? 7.619   1.184   -12.007 1.00 29.83  ? 105 GLU B O   1 
ATOM   3524  C CB  . GLU B 1 105 ? 4.855   2.020   -11.099 1.00 21.20  ? 105 GLU B CB  1 
ATOM   3525  C CG  . GLU B 1 105 ? 3.632   2.094   -10.158 1.00 19.74  ? 105 GLU B CG  1 
ATOM   3526  C CD  . GLU B 1 105 ? 2.308   1.854   -10.868 1.00 33.24  ? 105 GLU B CD  1 
ATOM   3527  O OE1 . GLU B 1 105 ? 2.238   1.908   -12.123 1.00 30.89  ? 105 GLU B OE1 1 
ATOM   3528  O OE2 . GLU B 1 105 ? 1.313   1.668   -10.141 1.00 27.44  ? 105 GLU B OE2 1 
ATOM   3529  N N   . ALA B 1 106 ? 7.938   3.400   -11.624 1.00 21.90  ? 106 ALA B N   1 
ATOM   3530  C CA  . ALA B 1 106 ? 9.058   3.521   -12.532 1.00 20.59  ? 106 ALA B CA  1 
ATOM   3531  C C   . ALA B 1 106 ? 10.338  3.487   -11.706 1.00 25.36  ? 106 ALA B C   1 
ATOM   3532  O O   . ALA B 1 106 ? 11.449  3.407   -12.266 1.00 25.61  ? 106 ALA B O   1 
ATOM   3533  C CB  . ALA B 1 106 ? 8.969   4.815   -13.288 1.00 21.76  ? 106 ALA B CB  1 
ATOM   3534  N N   . HIS B 1 107 ? 10.185  3.543   -10.379 1.00 21.31  ? 107 HIS B N   1 
ATOM   3535  C CA  . HIS B 1 107 ? 11.316  3.464   -9.457  1.00 21.14  ? 107 HIS B CA  1 
ATOM   3536  C C   . HIS B 1 107 ? 12.119  4.773   -9.561  1.00 23.18  ? 107 HIS B C   1 
ATOM   3537  O O   . HIS B 1 107 ? 13.293  4.885   -9.207  1.00 23.90  ? 107 HIS B O   1 
ATOM   3538  C CB  . HIS B 1 107 ? 12.222  2.181   -9.722  1.00 23.64  ? 107 HIS B CB  1 
ATOM   3539  C CG  . HIS B 1 107 ? 11.480  0.861   -9.689  1.00 27.85  ? 107 HIS B CG  1 
ATOM   3540  N ND1 . HIS B 1 107 ? 10.687  0.466   -8.627  1.00 29.51  ? 107 HIS B ND1 1 
ATOM   3541  C CD2 . HIS B 1 107 ? 11.433  -0.152  -10.592 1.00 29.99  ? 107 HIS B CD2 1 
ATOM   3542  C CE1 . HIS B 1 107 ? 10.158  -0.717  -8.893  1.00 29.78  ? 107 HIS B CE1 1 
ATOM   3543  N NE2 . HIS B 1 107 ? 10.589  -1.111  -10.082 1.00 30.40  ? 107 HIS B NE2 1 
ATOM   3544  N N   . VAL B 1 108 ? 11.461  5.811   -10.027 1.00 17.58  ? 108 VAL B N   1 
ATOM   3545  C CA  . VAL B 1 108 ? 12.150  7.093   -10.142 1.00 15.43  ? 108 VAL B CA  1 
ATOM   3546  C C   . VAL B 1 108 ? 11.984  7.747   -8.777  1.00 17.46  ? 108 VAL B C   1 
ATOM   3547  O O   . VAL B 1 108 ? 10.889  7.647   -8.174  1.00 15.68  ? 108 VAL B O   1 
ATOM   3548  C CB  . VAL B 1 108 ? 11.424  7.969   -11.256 1.00 16.65  ? 108 VAL B CB  1 
ATOM   3549  C CG1 . VAL B 1 108 ? 12.011  9.373   -11.413 1.00 15.00  ? 108 VAL B CG1 1 
ATOM   3550  C CG2 . VAL B 1 108 ? 11.342  7.217   -12.560 1.00 15.69  ? 108 VAL B CG2 1 
ATOM   3551  N N   . ASP B 1 109 ? 13.043  8.418   -8.307  1.00 12.72  ? 109 ASP B N   1 
ATOM   3552  C CA  . ASP B 1 109 ? 13.005  9.175   -7.031  1.00 11.84  ? 109 ASP B CA  1 
ATOM   3553  C C   . ASP B 1 109 ? 12.390  10.551  -7.298  1.00 14.13  ? 109 ASP B C   1 
ATOM   3554  O O   . ASP B 1 109 ? 13.083  11.537  -7.500  1.00 11.30  ? 109 ASP B O   1 
ATOM   3555  C CB  . ASP B 1 109 ? 14.410  9.319   -6.406  1.00 13.28  ? 109 ASP B CB  1 
ATOM   3556  C CG  . ASP B 1 109 ? 14.368  9.689   -4.926  1.00 27.86  ? 109 ASP B CG  1 
ATOM   3557  O OD1 . ASP B 1 109 ? 13.273  9.711   -4.351  1.00 33.96  ? 109 ASP B OD1 1 
ATOM   3558  O OD2 . ASP B 1 109 ? 15.397  10.068  -4.350  1.00 35.53  ? 109 ASP B OD2 1 
ATOM   3559  N N   . ALA B 1 110 ? 11.070  10.585  -7.389  1.00 14.47  ? 110 ALA B N   1 
ATOM   3560  C CA  . ALA B 1 110 ? 10.360  11.817  -7.725  1.00 15.72  ? 110 ALA B CA  1 
ATOM   3561  C C   . ALA B 1 110 ? 10.055  12.682  -6.510  1.00 24.99  ? 110 ALA B C   1 
ATOM   3562  O O   . ALA B 1 110 ? 9.570   12.187  -5.469  1.00 25.21  ? 110 ALA B O   1 
ATOM   3563  C CB  . ALA B 1 110 ? 9.060   11.499  -8.514  1.00 15.64  ? 110 ALA B CB  1 
ATOM   3564  N N   . HIS B 1 111 ? 10.283  13.987  -6.665  1.00 22.57  ? 111 HIS B N   1 
ATOM   3565  C CA  . HIS B 1 111 ? 9.950   14.950  -5.623  1.00 21.77  ? 111 HIS B CA  1 
ATOM   3566  C C   . HIS B 1 111 ? 9.239   16.150  -6.248  1.00 22.86  ? 111 HIS B C   1 
ATOM   3567  O O   . HIS B 1 111 ? 9.843   17.022  -6.831  1.00 21.09  ? 111 HIS B O   1 
ATOM   3568  C CB  . HIS B 1 111 ? 11.203  15.362  -4.820  1.00 23.00  ? 111 HIS B CB  1 
ATOM   3569  C CG  . HIS B 1 111 ? 11.960  14.201  -4.237  1.00 27.40  ? 111 HIS B CG  1 
ATOM   3570  N ND1 . HIS B 1 111 ? 11.643  13.643  -3.014  1.00 29.52  ? 111 HIS B ND1 1 
ATOM   3571  C CD2 . HIS B 1 111 ? 13.001  13.476  -4.717  1.00 28.60  ? 111 HIS B CD2 1 
ATOM   3572  C CE1 . HIS B 1 111 ? 12.472  12.646  -2.755  1.00 27.72  ? 111 HIS B CE1 1 
ATOM   3573  N NE2 . HIS B 1 111 ? 13.300  12.520  -3.773  1.00 27.82  ? 111 HIS B NE2 1 
ATOM   3574  N N   . TYR B 1 112 ? 7.925   16.161  -6.166  1.00 21.28  ? 112 TYR B N   1 
ATOM   3575  C CA  . TYR B 1 112 ? 7.151   17.241  -6.749  1.00 20.79  ? 112 TYR B CA  1 
ATOM   3576  C C   . TYR B 1 112 ? 6.826   18.325  -5.754  1.00 25.24  ? 112 TYR B C   1 
ATOM   3577  O O   . TYR B 1 112 ? 6.760   18.077  -4.542  1.00 27.66  ? 112 TYR B O   1 
ATOM   3578  C CB  . TYR B 1 112 ? 5.833   16.696  -7.284  1.00 21.10  ? 112 TYR B CB  1 
ATOM   3579  C CG  . TYR B 1 112 ? 5.978   15.537  -8.235  1.00 20.89  ? 112 TYR B CG  1 
ATOM   3580  C CD1 . TYR B 1 112 ? 5.872   14.221  -7.788  1.00 22.51  ? 112 TYR B CD1 1 
ATOM   3581  C CD2 . TYR B 1 112 ? 6.165   15.752  -9.591  1.00 19.94  ? 112 TYR B CD2 1 
ATOM   3582  C CE1 . TYR B 1 112 ? 5.989   13.169  -8.667  1.00 19.62  ? 112 TYR B CE1 1 
ATOM   3583  C CE2 . TYR B 1 112 ? 6.224   14.686  -10.483 1.00 19.16  ? 112 TYR B CE2 1 
ATOM   3584  C CZ  . TYR B 1 112 ? 6.160   13.414  -9.996  1.00 19.71  ? 112 TYR B CZ  1 
ATOM   3585  O OH  . TYR B 1 112 ? 6.330   12.362  -10.849 1.00 25.81  ? 112 TYR B OH  1 
ATOM   3586  N N   . TYR B 1 113 ? 6.551   19.514  -6.277  1.00 19.68  ? 113 TYR B N   1 
ATOM   3587  C CA  . TYR B 1 113 ? 6.041   20.600  -5.453  1.00 20.42  ? 113 TYR B CA  1 
ATOM   3588  C C   . TYR B 1 113 ? 4.536   20.485  -5.607  1.00 24.25  ? 113 TYR B C   1 
ATOM   3589  O O   . TYR B 1 113 ? 4.028   20.434  -6.746  1.00 25.64  ? 113 TYR B O   1 
ATOM   3590  C CB  . TYR B 1 113 ? 6.485   21.964  -5.996  1.00 22.75  ? 113 TYR B CB  1 
ATOM   3591  C CG  . TYR B 1 113 ? 5.918   23.149  -5.208  1.00 25.22  ? 113 TYR B CG  1 
ATOM   3592  C CD1 . TYR B 1 113 ? 6.470   23.516  -3.981  1.00 27.18  ? 113 TYR B CD1 1 
ATOM   3593  C CD2 . TYR B 1 113 ? 4.869   23.929  -5.705  1.00 25.54  ? 113 TYR B CD2 1 
ATOM   3594  C CE1 . TYR B 1 113 ? 5.983   24.594  -3.258  1.00 26.39  ? 113 TYR B CE1 1 
ATOM   3595  C CE2 . TYR B 1 113 ? 4.371   25.023  -4.972  1.00 25.60  ? 113 TYR B CE2 1 
ATOM   3596  C CZ  . TYR B 1 113 ? 4.938   25.343  -3.748  1.00 32.46  ? 113 TYR B CZ  1 
ATOM   3597  O OH  . TYR B 1 113 ? 4.516   26.437  -2.999  1.00 34.13  ? 113 TYR B OH  1 
ATOM   3598  N N   . GLU B 1 114 ? 3.807   20.416  -4.500  1.00 18.44  ? 114 GLU B N   1 
ATOM   3599  C CA  . GLU B 1 114 ? 2.361   20.287  -4.641  1.00 18.18  ? 114 GLU B CA  1 
ATOM   3600  C C   . GLU B 1 114 ? 1.599   21.537  -4.200  1.00 20.89  ? 114 GLU B C   1 
ATOM   3601  O O   . GLU B 1 114 ? 2.053   22.266  -3.323  1.00 19.90  ? 114 GLU B O   1 
ATOM   3602  C CB  . GLU B 1 114 ? 1.859   19.006  -3.954  1.00 19.76  ? 114 GLU B CB  1 
ATOM   3603  C CG  . GLU B 1 114 ? 2.401   17.716  -4.562  1.00 25.26  ? 114 GLU B CG  1 
ATOM   3604  C CD  . GLU B 1 114 ? 2.163   16.520  -3.682  1.00 44.69  ? 114 GLU B CD  1 
ATOM   3605  O OE1 . GLU B 1 114 ? 1.130   15.823  -3.882  1.00 33.38  ? 114 GLU B OE1 1 
ATOM   3606  O OE2 . GLU B 1 114 ? 2.968   16.367  -2.732  1.00 30.59  ? 114 GLU B OE2 1 
ATOM   3607  N N   . GLN B 1 115 ? 0.491   21.821  -4.879  1.00 17.29  ? 115 GLN B N   1 
ATOM   3608  C CA  . GLN B 1 115 ? -0.341  22.998  -4.598  1.00 17.52  ? 115 GLN B CA  1 
ATOM   3609  C C   . GLN B 1 115 ? -1.831  22.876  -5.007  1.00 23.85  ? 115 GLN B C   1 
ATOM   3610  O O   . GLN B 1 115 ? -2.250  21.919  -5.685  1.00 24.39  ? 115 GLN B O   1 
ATOM   3611  C CB  . GLN B 1 115 ? 0.294   24.321  -5.072  1.00 18.42  ? 115 GLN B CB  1 
ATOM   3612  C CG  . GLN B 1 115 ? 0.809   24.328  -6.538  1.00 24.84  ? 115 GLN B CG  1 
ATOM   3613  C CD  . GLN B 1 115 ? -0.297  24.089  -7.559  1.00 36.48  ? 115 GLN B CD  1 
ATOM   3614  O OE1 . GLN B 1 115 ? -0.441  22.982  -8.102  1.00 37.03  ? 115 GLN B OE1 1 
ATOM   3615  N NE2 . GLN B 1 115 ? -1.123  25.105  -7.781  1.00 15.77  ? 115 GLN B NE2 1 
ATOM   3616  N N   . ASN B 1 116 ? -2.648  23.765  -4.461  1.00 19.60  ? 116 ASN B N   1 
ATOM   3617  C CA  . ASN B 1 116 ? -4.093  23.696  -4.660  1.00 20.22  ? 116 ASN B CA  1 
ATOM   3618  C C   . ASN B 1 116 ? -4.647  24.737  -5.686  1.00 21.09  ? 116 ASN B C   1 
ATOM   3619  O O   . ASN B 1 116 ? -5.739  24.546  -6.262  1.00 15.28  ? 116 ASN B O   1 
ATOM   3620  C CB  . ASN B 1 116 ? -4.858  23.804  -3.294  1.00 23.62  ? 116 ASN B CB  1 
ATOM   3621  C CG  . ASN B 1 116 ? -4.418  22.743  -2.242  1.00 33.26  ? 116 ASN B CG  1 
ATOM   3622  O OD1 . ASN B 1 116 ? -4.791  21.563  -2.320  1.00 16.71  ? 116 ASN B OD1 1 
ATOM   3623  N ND2 . ASN B 1 116 ? -3.856  23.235  -1.142  1.00 26.86  ? 116 ASN B ND2 1 
ATOM   3624  N N   . GLU B 1 117 ? -3.915  25.839  -5.890  1.00 18.16  ? 117 GLU B N   1 
ATOM   3625  C CA  . GLU B 1 117 ? -4.341  26.878  -6.827  1.00 16.26  ? 117 GLU B CA  1 
ATOM   3626  C C   . GLU B 1 117 ? -4.430  26.345  -8.290  1.00 23.33  ? 117 GLU B C   1 
ATOM   3627  O O   . GLU B 1 117 ? -5.380  26.616  -9.024  1.00 23.87  ? 117 GLU B O   1 
ATOM   3628  C CB  . GLU B 1 117 ? -3.378  28.051  -6.756  1.00 16.92  ? 117 GLU B CB  1 
ATOM   3629  C CG  . GLU B 1 117 ? -3.219  28.729  -5.392  1.00 27.22  ? 117 GLU B CG  1 
ATOM   3630  C CD  . GLU B 1 117 ? -2.673  27.815  -4.271  1.00 48.79  ? 117 GLU B CD  1 
ATOM   3631  O OE1 . GLU B 1 117 ? -3.108  27.957  -3.107  1.00 38.35  ? 117 GLU B OE1 1 
ATOM   3632  O OE2 . GLU B 1 117 ? -1.756  27.014  -4.517  1.00 42.12  ? 117 GLU B OE2 1 
ATOM   3633  N N   . GLN B 1 118 ? -3.437  25.592  -8.735  1.00 19.67  ? 118 GLN B N   1 
ATOM   3634  C CA  . GLN B 1 118 ? -3.440  25.145  -10.111 1.00 18.61  ? 118 GLN B CA  1 
ATOM   3635  C C   . GLN B 1 118 ? -3.596  23.640  -10.177 1.00 23.75  ? 118 GLN B C   1 
ATOM   3636  O O   . GLN B 1 118 ? -2.906  22.896  -9.467  1.00 25.56  ? 118 GLN B O   1 
ATOM   3637  C CB  . GLN B 1 118 ? -2.094  25.515  -10.762 1.00 20.99  ? 118 GLN B CB  1 
ATOM   3638  C CG  . GLN B 1 118 ? -1.952  26.951  -11.257 1.00 36.90  ? 118 GLN B CG  1 
ATOM   3639  C CD  . GLN B 1 118 ? -2.662  27.175  -12.592 1.00 62.75  ? 118 GLN B CD  1 
ATOM   3640  O OE1 . GLN B 1 118 ? -3.788  26.702  -12.805 1.00 53.54  ? 118 GLN B OE1 1 
ATOM   3641  N NE2 . GLN B 1 118 ? -1.977  27.841  -13.523 1.00 58.12  ? 118 GLN B NE2 1 
ATOM   3642  N N   . PRO B 1 119 ? -4.424  23.181  -11.110 1.00 19.01  ? 119 PRO B N   1 
ATOM   3643  C CA  . PRO B 1 119 ? -4.585  21.746  -11.359 1.00 17.33  ? 119 PRO B CA  1 
ATOM   3644  C C   . PRO B 1 119 ? -3.373  21.215  -12.121 1.00 20.76  ? 119 PRO B C   1 
ATOM   3645  O O   . PRO B 1 119 ? -2.675  21.971  -12.825 1.00 17.74  ? 119 PRO B O   1 
ATOM   3646  C CB  . PRO B 1 119 ? -5.801  21.698  -12.270 1.00 17.80  ? 119 PRO B CB  1 
ATOM   3647  C CG  . PRO B 1 119 ? -5.733  22.983  -13.055 1.00 20.77  ? 119 PRO B CG  1 
ATOM   3648  C CD  . PRO B 1 119 ? -5.033  23.995  -12.185 1.00 17.97  ? 119 PRO B CD  1 
ATOM   3649  N N   . THR B 1 120 ? -3.142  19.910  -12.003 1.00 19.06  ? 120 THR B N   1 
ATOM   3650  C CA  . THR B 1 120 ? -2.027  19.269  -12.691 1.00 17.36  ? 120 THR B CA  1 
ATOM   3651  C C   . THR B 1 120 ? -2.103  19.553  -14.189 1.00 23.23  ? 120 THR B C   1 
ATOM   3652  O O   . THR B 1 120 ? -3.192  19.660  -14.773 1.00 22.94  ? 120 THR B O   1 
ATOM   3653  C CB  . THR B 1 120 ? -1.990  17.776  -12.383 1.00 17.23  ? 120 THR B CB  1 
ATOM   3654  O OG1 . THR B 1 120 ? -1.732  17.595  -10.978 1.00 12.26  ? 120 THR B OG1 1 
ATOM   3655  C CG2 . THR B 1 120 ? -0.888  17.059  -13.245 1.00 13.85  ? 120 THR B CG2 1 
ATOM   3656  N N   . GLY B 1 121 ? -0.941  19.801  -14.786 1.00 21.23  ? 121 GLY B N   1 
ATOM   3657  C CA  . GLY B 1 121 ? -0.862  20.170  -16.195 1.00 19.42  ? 121 GLY B CA  1 
ATOM   3658  C C   . GLY B 1 121 ? -1.194  19.034  -17.112 1.00 20.79  ? 121 GLY B C   1 
ATOM   3659  O O   . GLY B 1 121 ? -1.001  17.866  -16.777 1.00 22.43  ? 121 GLY B O   1 
ATOM   3660  N N   . THR B 1 122 ? -1.666  19.362  -18.302 1.00 14.84  ? 122 THR B N   1 
ATOM   3661  C CA  . THR B 1 122 ? -2.043  18.307  -19.241 1.00 15.60  ? 122 THR B CA  1 
ATOM   3662  C C   . THR B 1 122 ? -1.598  18.699  -20.642 1.00 21.89  ? 122 THR B C   1 
ATOM   3663  O O   . THR B 1 122 ? -1.353  19.903  -20.909 1.00 20.75  ? 122 THR B O   1 
ATOM   3664  C CB  . THR B 1 122 ? -3.546  18.092  -19.293 1.00 16.15  ? 122 THR B CB  1 
ATOM   3665  O OG1 . THR B 1 122 ? -4.194  19.377  -19.302 1.00 19.37  ? 122 THR B OG1 1 
ATOM   3666  C CG2 . THR B 1 122 ? -4.007  17.250  -18.109 1.00 10.15  ? 122 THR B CG2 1 
ATOM   3667  N N   . CYS B 1 123 ? -1.399  17.666  -21.477 1.00 16.85  ? 123 CYS B N   1 
ATOM   3668  C CA  . CYS B 1 123 ? -1.047  17.807  -22.889 1.00 16.98  ? 123 CYS B CA  1 
ATOM   3669  C C   . CYS B 1 123 ? -1.991  16.945  -23.742 1.00 20.44  ? 123 CYS B C   1 
ATOM   3670  O O   . CYS B 1 123 ? -2.097  15.731  -23.535 1.00 19.48  ? 123 CYS B O   1 
ATOM   3671  C CB  . CYS B 1 123 ? 0.401   17.368  -23.151 1.00 17.93  ? 123 CYS B CB  1 
ATOM   3672  S SG  . CYS B 1 123 ? 1.048   17.871  -24.786 1.00 22.02  ? 123 CYS B SG  1 
ATOM   3673  N N   . ALA B 1 124 ? -2.690  17.586  -24.669 1.00 19.19  ? 124 ALA B N   1 
ATOM   3674  C CA  . ALA B 1 124 ? -3.571  16.888  -25.622 1.00 20.24  ? 124 ALA B CA  1 
ATOM   3675  C C   . ALA B 1 124 ? -2.744  16.317  -26.790 1.00 22.77  ? 124 ALA B C   1 
ATOM   3676  O O   . ALA B 1 124 ? -1.902  16.986  -27.393 1.00 21.36  ? 124 ALA B O   1 
ATOM   3677  C CB  . ALA B 1 124 ? -4.661  17.869  -26.179 1.00 21.48  ? 124 ALA B CB  1 
ATOM   3678  N N   . ALA B 1 125 ? -3.003  15.078  -27.133 1.00 21.57  ? 125 ALA B N   1 
ATOM   3679  C CA  . ALA B 1 125 ? -2.314  14.474  -28.263 1.00 22.05  ? 125 ALA B CA  1 
ATOM   3680  C C   . ALA B 1 125 ? -3.384  14.109  -29.262 1.00 27.66  ? 125 ALA B C   1 
ATOM   3681  O O   . ALA B 1 125 ? -3.969  13.023  -29.165 1.00 27.38  ? 125 ALA B O   1 
ATOM   3682  C CB  . ALA B 1 125 ? -1.567  13.232  -27.808 1.00 22.97  ? 125 ALA B CB  1 
ATOM   3683  N N   . CYS B 1 126 ? -3.738  15.088  -30.104 1.00 26.15  ? 126 CYS B N   1 
ATOM   3684  C CA  . CYS B 1 126 ? -4.801  14.955  -31.109 1.00 26.48  ? 126 CYS B CA  1 
ATOM   3685  C C   . CYS B 1 126 ? -4.330  14.163  -32.318 1.00 29.90  ? 126 CYS B C   1 
ATOM   3686  O O   . CYS B 1 126 ? -3.615  14.679  -33.175 1.00 30.05  ? 126 CYS B O   1 
ATOM   3687  C CB  . CYS B 1 126 ? -5.328  16.324  -31.521 1.00 27.74  ? 126 CYS B CB  1 
ATOM   3688  S SG  . CYS B 1 126 ? -5.777  17.362  -30.088 1.00 32.68  ? 126 CYS B SG  1 
ATOM   3689  N N   . ILE B 1 127 ? -4.704  12.890  -32.357 1.00 27.31  ? 127 ILE B N   1 
ATOM   3690  C CA  . ILE B 1 127 ? -4.236  11.974  -33.406 1.00 28.60  ? 127 ILE B CA  1 
ATOM   3691  C C   . ILE B 1 127 ? -5.107  11.816  -34.659 1.00 36.29  ? 127 ILE B C   1 
ATOM   3692  O O   . ILE B 1 127 ? -6.324  11.513  -34.592 1.00 36.34  ? 127 ILE B O   1 
ATOM   3693  C CB  . ILE B 1 127 ? -3.971  10.548  -32.873 1.00 30.94  ? 127 ILE B CB  1 
ATOM   3694  C CG1 . ILE B 1 127 ? -3.137  10.565  -31.580 1.00 32.58  ? 127 ILE B CG1 1 
ATOM   3695  C CG2 . ILE B 1 127 ? -3.417  9.670   -33.969 1.00 27.03  ? 127 ILE B CG2 1 
ATOM   3696  C CD1 . ILE B 1 127 ? -3.054  9.181   -30.911 1.00 41.90  ? 127 ILE B CD1 1 
ATOM   3697  N N   . THR B 1 128 ? -4.453  11.973  -35.805 1.00 32.14  ? 128 THR B N   1 
ATOM   3698  C CA  . THR B 1 128 ? -5.099  11.752  -37.087 1.00 32.30  ? 128 THR B CA  1 
ATOM   3699  C C   . THR B 1 128 ? -4.165  10.882  -37.915 1.00 37.88  ? 128 THR B C   1 
ATOM   3700  O O   . THR B 1 128 ? -3.003  11.234  -38.162 1.00 39.32  ? 128 THR B O   1 
ATOM   3701  C CB  . THR B 1 128 ? -5.371  13.038  -37.850 1.00 38.85  ? 128 THR B CB  1 
ATOM   3702  O OG1 . THR B 1 128 ? -4.123  13.679  -38.141 1.00 41.48  ? 128 THR B OG1 1 
ATOM   3703  C CG2 . THR B 1 128 ? -6.308  13.969  -37.057 1.00 31.52  ? 128 THR B CG2 1 
ATOM   3704  N N   . GLY B 1 129 ? -4.653  9.714   -38.299 1.00 32.75  ? 129 GLY B N   1 
ATOM   3705  C CA  . GLY B 1 129 ? -3.831  8.814   -39.054 1.00 33.06  ? 129 GLY B CA  1 
ATOM   3706  C C   . GLY B 1 129 ? -2.573  8.528   -38.280 1.00 39.64  ? 129 GLY B C   1 
ATOM   3707  O O   . GLY B 1 129 ? -2.630  7.863   -37.250 1.00 41.45  ? 129 GLY B O   1 
ATOM   3708  N N   . ASP B 1 130 ? -1.458  9.086   -38.748 1.00 37.13  ? 130 ASP B N   1 
ATOM   3709  C CA  . ASP B 1 130 ? -0.141  8.830   -38.159 1.00 37.11  ? 130 ASP B CA  1 
ATOM   3710  C C   . ASP B 1 130 ? 0.450   10.124  -37.657 1.00 37.42  ? 130 ASP B C   1 
ATOM   3711  O O   . ASP B 1 130 ? 1.633   10.203  -37.367 1.00 34.15  ? 130 ASP B O   1 
ATOM   3712  C CB  . ASP B 1 130 ? 0.818   8.236   -39.210 1.00 40.01  ? 130 ASP B CB  1 
ATOM   3713  C CG  . ASP B 1 130 ? 0.508   6.763   -39.551 1.00 62.00  ? 130 ASP B CG  1 
ATOM   3714  O OD1 . ASP B 1 130 ? 1.292   6.163   -40.333 1.00 66.28  ? 130 ASP B OD1 1 
ATOM   3715  O OD2 . ASP B 1 130 ? -0.501  6.203   -39.047 1.00 64.95  ? 130 ASP B OD2 1 
ATOM   3716  N N   . ASN B 1 131 ? -0.382  11.152  -37.608 1.00 35.65  ? 131 ASN B N   1 
ATOM   3717  C CA  . ASN B 1 131 ? 0.066   12.480  -37.203 1.00 36.52  ? 131 ASN B CA  1 
ATOM   3718  C C   . ASN B 1 131 ? -0.376  12.758  -35.784 1.00 39.93  ? 131 ASN B C   1 
ATOM   3719  O O   . ASN B 1 131 ? -1.387  12.237  -35.322 1.00 41.74  ? 131 ASN B O   1 
ATOM   3720  C CB  . ASN B 1 131 ? -0.478  13.568  -38.153 1.00 43.00  ? 131 ASN B CB  1 
ATOM   3721  C CG  . ASN B 1 131 ? -0.302  13.208  -39.619 1.00 58.94  ? 131 ASN B CG  1 
ATOM   3722  O OD1 . ASN B 1 131 ? -1.244  12.735  -40.256 1.00 38.05  ? 131 ASN B OD1 1 
ATOM   3723  N ND2 . ASN B 1 131 ? 0.928   13.331  -40.125 1.00 55.68  ? 131 ASN B ND2 1 
ATOM   3724  N N   . ARG B 1 132 ? 0.406   13.555  -35.073 1.00 35.29  ? 132 ARG B N   1 
ATOM   3725  C CA  . ARG B 1 132 ? 0.115   13.856  -33.669 1.00 33.41  ? 132 ARG B CA  1 
ATOM   3726  C C   . ARG B 1 132 ? 0.257   15.327  -33.405 1.00 32.08  ? 132 ARG B C   1 
ATOM   3727  O O   . ARG B 1 132 ? 1.286   15.911  -33.673 1.00 32.01  ? 132 ARG B O   1 
ATOM   3728  C CB  . ARG B 1 132 ? 1.008   13.044  -32.747 1.00 31.52  ? 132 ARG B CB  1 
ATOM   3729  C CG  . ARG B 1 132 ? 0.871   11.557  -33.012 1.00 46.00  ? 132 ARG B CG  1 
ATOM   3730  C CD  . ARG B 1 132 ? 1.897   10.725  -32.258 1.00 55.83  ? 132 ARG B CD  1 
ATOM   3731  N NE  . ARG B 1 132 ? 1.706   10.866  -30.824 1.00 56.59  ? 132 ARG B NE  1 
ATOM   3732  C CZ  . ARG B 1 132 ? 0.883   10.123  -30.102 1.00 63.16  ? 132 ARG B CZ  1 
ATOM   3733  N NH1 . ARG B 1 132 ? 0.171   9.145   -30.654 1.00 56.15  ? 132 ARG B NH1 1 
ATOM   3734  N NH2 . ARG B 1 132 ? 0.787   10.362  -28.811 1.00 42.23  ? 132 ARG B NH2 1 
ATOM   3735  N N   . SER B 1 133 ? -0.831  15.944  -32.983 1.00 26.07  ? 133 SER B N   1 
ATOM   3736  C CA  . SER B 1 133 ? -0.844  17.372  -32.776 1.00 25.41  ? 133 SER B CA  1 
ATOM   3737  C C   . SER B 1 133 ? -0.958  17.545  -31.255 1.00 31.16  ? 133 SER B C   1 
ATOM   3738  O O   . SER B 1 133 ? -1.987  17.171  -30.664 1.00 31.91  ? 133 SER B O   1 
ATOM   3739  C CB  . SER B 1 133 ? -2.075  17.946  -33.528 1.00 23.98  ? 133 SER B CB  1 
ATOM   3740  O OG  . SER B 1 133 ? -2.074  19.358  -33.608 1.00 21.22  ? 133 SER B OG  1 
ATOM   3741  N N   . LEU B 1 134 ? 0.120   18.005  -30.616 1.00 26.37  ? 134 LEU B N   1 
ATOM   3742  C CA  . LEU B 1 134 ? 0.142   18.179  -29.141 1.00 24.32  ? 134 LEU B CA  1 
ATOM   3743  C C   . LEU B 1 134 ? 0.047   19.611  -28.743 1.00 24.49  ? 134 LEU B C   1 
ATOM   3744  O O   . LEU B 1 134 ? 0.871   20.442  -29.158 1.00 23.40  ? 134 LEU B O   1 
ATOM   3745  C CB  . LEU B 1 134 ? 1.424   17.634  -28.510 1.00 24.47  ? 134 LEU B CB  1 
ATOM   3746  C CG  . LEU B 1 134 ? 1.861   16.175  -28.682 1.00 28.87  ? 134 LEU B CG  1 
ATOM   3747  C CD1 . LEU B 1 134 ? 3.125   15.960  -27.923 1.00 29.78  ? 134 LEU B CD1 1 
ATOM   3748  C CD2 . LEU B 1 134 ? 0.850   15.260  -28.118 1.00 31.58  ? 134 LEU B CD2 1 
ATOM   3749  N N   . ILE B 1 135 ? -0.888  19.860  -27.835 1.00 19.88  ? 135 ILE B N   1 
ATOM   3750  C CA  . ILE B 1 135 ? -1.083  21.172  -27.224 1.00 18.11  ? 135 ILE B CA  1 
ATOM   3751  C C   . ILE B 1 135 ? -0.953  20.949  -25.720 1.00 20.72  ? 135 ILE B C   1 
ATOM   3752  O O   . ILE B 1 135 ? -1.649  20.091  -25.169 1.00 20.77  ? 135 ILE B O   1 
ATOM   3753  C CB  . ILE B 1 135 ? -2.514  21.688  -27.562 1.00 20.99  ? 135 ILE B CB  1 
ATOM   3754  C CG1 . ILE B 1 135 ? -2.767  21.596  -29.086 1.00 19.52  ? 135 ILE B CG1 1 
ATOM   3755  C CG2 . ILE B 1 135 ? -2.746  23.120  -27.055 1.00 21.77  ? 135 ILE B CG2 1 
ATOM   3756  C CD1 . ILE B 1 135 ? -3.174  20.240  -29.604 1.00 6.14   ? 135 ILE B CD1 1 
ATOM   3757  N N   . ALA B 1 136 ? -0.005  21.641  -25.079 1.00 16.15  ? 136 ALA B N   1 
ATOM   3758  C CA  . ALA B 1 136 ? 0.200   21.525  -23.621 1.00 14.76  ? 136 ALA B CA  1 
ATOM   3759  C C   . ALA B 1 136 ? -0.512  22.625  -22.848 1.00 17.98  ? 136 ALA B C   1 
ATOM   3760  O O   . ALA B 1 136 ? -0.312  23.788  -23.153 1.00 19.07  ? 136 ALA B O   1 
ATOM   3761  C CB  . ALA B 1 136 ? 1.713   21.538  -23.256 1.00 14.73  ? 136 ALA B CB  1 
ATOM   3762  N N   . ASN B 1 137 ? -1.248  22.265  -21.796 1.00 13.98  ? 137 ASN B N   1 
ATOM   3763  C CA  . ASN B 1 137 ? -1.857  23.245  -20.880 1.00 13.44  ? 137 ASN B CA  1 
ATOM   3764  C C   . ASN B 1 137 ? -1.069  23.027  -19.572 1.00 15.11  ? 137 ASN B C   1 
ATOM   3765  O O   . ASN B 1 137 ? -1.305  22.060  -18.873 1.00 16.53  ? 137 ASN B O   1 
ATOM   3766  C CB  . ASN B 1 137 ? -3.375  22.972  -20.721 1.00 15.16  ? 137 ASN B CB  1 
ATOM   3767  C CG  . ASN B 1 137 ? -4.025  23.838  -19.644 1.00 39.33  ? 137 ASN B CG  1 
ATOM   3768  O OD1 . ASN B 1 137 ? -4.166  25.035  -19.813 1.00 29.20  ? 137 ASN B OD1 1 
ATOM   3769  N ND2 . ASN B 1 137 ? -4.421  23.218  -18.540 1.00 35.83  ? 137 ASN B ND2 1 
ATOM   3770  N N   . LEU B 1 138 ? 0.028   23.755  -19.390 1.00 10.98  ? 138 LEU B N   1 
ATOM   3771  C CA  . LEU B 1 138 ? 0.961   23.475  -18.287 1.00 8.71   ? 138 LEU B CA  1 
ATOM   3772  C C   . LEU B 1 138 ? 0.230   23.514  -16.961 1.00 14.89  ? 138 LEU B C   1 
ATOM   3773  O O   . LEU B 1 138 ? 0.301   22.599  -16.186 1.00 14.80  ? 138 LEU B O   1 
ATOM   3774  C CB  . LEU B 1 138 ? 2.194   24.390  -18.337 1.00 7.35   ? 138 LEU B CB  1 
ATOM   3775  C CG  . LEU B 1 138 ? 2.950   24.149  -19.622 1.00 13.23  ? 138 LEU B CG  1 
ATOM   3776  C CD1 . LEU B 1 138 ? 4.333   24.904  -19.681 1.00 13.95  ? 138 LEU B CD1 1 
ATOM   3777  C CD2 . LEU B 1 138 ? 3.132   22.657  -19.715 1.00 17.10  ? 138 LEU B CD2 1 
ATOM   3778  N N   . ALA B 1 139 ? -0.528  24.572  -16.740 1.00 15.81  ? 139 ALA B N   1 
ATOM   3779  C CA  . ALA B 1 139 ? -1.308  24.706  -15.521 1.00 16.02  ? 139 ALA B CA  1 
ATOM   3780  C C   . ALA B 1 139 ? -0.372  24.684  -14.313 1.00 21.37  ? 139 ALA B C   1 
ATOM   3781  O O   . ALA B 1 139 ? 0.295   25.682  -14.046 1.00 22.77  ? 139 ALA B O   1 
ATOM   3782  C CB  . ALA B 1 139 ? -2.381  23.623  -15.444 1.00 15.58  ? 139 ALA B CB  1 
ATOM   3783  N N   . ALA B 1 140 ? -0.366  23.583  -13.565 1.00 15.47  ? 140 ALA B N   1 
ATOM   3784  C CA  . ALA B 1 140 ? 0.490   23.457  -12.393 1.00 12.46  ? 140 ALA B CA  1 
ATOM   3785  C C   . ALA B 1 140 ? 1.949   23.345  -12.776 1.00 13.64  ? 140 ALA B C   1 
ATOM   3786  O O   . ALA B 1 140 ? 2.799   23.741  -11.995 1.00 10.46  ? 140 ALA B O   1 
ATOM   3787  C CB  . ALA B 1 140 ? 0.076   22.259  -11.550 1.00 12.70  ? 140 ALA B CB  1 
ATOM   3788  N N   . ALA B 1 141 ? 2.267   22.753  -13.939 1.00 12.65  ? 141 ALA B N   1 
ATOM   3789  C CA  . ALA B 1 141 ? 3.697   22.557  -14.303 1.00 12.74  ? 141 ALA B CA  1 
ATOM   3790  C C   . ALA B 1 141 ? 4.400   23.906  -14.270 1.00 23.26  ? 141 ALA B C   1 
ATOM   3791  O O   . ALA B 1 141 ? 5.590   24.033  -13.952 1.00 24.97  ? 141 ALA B O   1 
ATOM   3792  C CB  . ALA B 1 141 ? 3.883   21.886  -15.658 1.00 11.65  ? 141 ALA B CB  1 
ATOM   3793  N N   . ASN B 1 142 ? 3.627   24.930  -14.560 1.00 22.36  ? 142 ASN B N   1 
ATOM   3794  C CA  . ASN B 1 142 ? 4.118   26.294  -14.627 1.00 23.28  ? 142 ASN B CA  1 
ATOM   3795  C C   . ASN B 1 142 ? 4.314   27.012  -13.267 1.00 31.12  ? 142 ASN B C   1 
ATOM   3796  O O   . ASN B 1 142 ? 4.822   28.146  -13.210 1.00 28.39  ? 142 ASN B O   1 
ATOM   3797  C CB  . ASN B 1 142 ? 3.149   27.059  -15.507 1.00 20.83  ? 142 ASN B CB  1 
ATOM   3798  C CG  . ASN B 1 142 ? 3.551   28.466  -15.725 1.00 55.90  ? 142 ASN B CG  1 
ATOM   3799  O OD1 . ASN B 1 142 ? 2.750   29.371  -15.472 1.00 46.81  ? 142 ASN B OD1 1 
ATOM   3800  N ND2 . ASN B 1 142 ? 4.715   28.668  -16.368 1.00 49.77  ? 142 ASN B ND2 1 
ATOM   3801  N N   . CYS B 1 143 ? 3.950   26.365  -12.165 1.00 33.82  ? 143 CYS B N   1 
ATOM   3802  C CA  . CYS B 1 143 ? 4.109   27.030  -10.868 1.00 36.84  ? 143 CYS B CA  1 
ATOM   3803  C C   . CYS B 1 143 ? 5.367   26.654  -10.150 1.00 33.80  ? 143 CYS B C   1 
ATOM   3804  O O   . CYS B 1 143 ? 5.377   26.619  -8.929  1.00 35.39  ? 143 CYS B O   1 
ATOM   3805  C CB  . CYS B 1 143 ? 2.918   26.790  -9.935  1.00 40.86  ? 143 CYS B CB  1 
ATOM   3806  S SG  . CYS B 1 143 ? 1.772   25.493  -10.492 1.00 47.97  ? 143 CYS B SG  1 
ATOM   3807  N N   . TYR B 1 144 ? 6.418   26.330  -10.889 1.00 23.20  ? 144 TYR B N   1 
ATOM   3808  C CA  . TYR B 1 144 ? 7.663   25.934  -10.236 1.00 20.47  ? 144 TYR B CA  1 
ATOM   3809  C C   . TYR B 1 144 ? 8.515   27.160  -9.982  1.00 25.89  ? 144 TYR B C   1 
ATOM   3810  O O   . TYR B 1 144 ? 8.759   27.950  -10.884 1.00 24.42  ? 144 TYR B O   1 
ATOM   3811  C CB  . TYR B 1 144 ? 8.451   24.903  -11.048 1.00 18.26  ? 144 TYR B CB  1 
ATOM   3812  C CG  . TYR B 1 144 ? 9.576   24.282  -10.265 1.00 14.90  ? 144 TYR B CG  1 
ATOM   3813  C CD1 . TYR B 1 144 ? 9.386   23.091  -9.581  1.00 16.11  ? 144 TYR B CD1 1 
ATOM   3814  C CD2 . TYR B 1 144 ? 10.838  24.886  -10.212 1.00 14.15  ? 144 TYR B CD2 1 
ATOM   3815  C CE1 . TYR B 1 144 ? 10.399  22.522  -8.849  1.00 15.59  ? 144 TYR B CE1 1 
ATOM   3816  C CE2 . TYR B 1 144 ? 11.849  24.342  -9.469  1.00 14.23  ? 144 TYR B CE2 1 
ATOM   3817  C CZ  . TYR B 1 144 ? 11.621  23.151  -8.783  1.00 20.51  ? 144 TYR B CZ  1 
ATOM   3818  O OH  . TYR B 1 144 ? 12.643  22.560  -8.079  1.00 19.24  ? 144 TYR B OH  1 
ATOM   3819  N N   . LYS B 1 145 ? 8.921   27.321  -8.734  1.00 23.27  ? 145 LYS B N   1 
ATOM   3820  C CA  . LYS B 1 145 ? 9.742   28.435  -8.310  1.00 23.87  ? 145 LYS B CA  1 
ATOM   3821  C C   . LYS B 1 145 ? 10.952  27.831  -7.590  1.00 30.87  ? 145 LYS B C   1 
ATOM   3822  O O   . LYS B 1 145 ? 10.804  27.000  -6.711  1.00 33.20  ? 145 LYS B O   1 
ATOM   3823  C CB  . LYS B 1 145 ? 8.919   29.278  -7.321  1.00 26.48  ? 145 LYS B CB  1 
ATOM   3824  C CG  . LYS B 1 145 ? 7.683   29.882  -7.930  1.00 25.14  ? 145 LYS B CG  1 
ATOM   3825  C CD  . LYS B 1 145 ? 8.067   30.776  -9.094  1.00 38.23  ? 145 LYS B CD  1 
ATOM   3826  C CE  . LYS B 1 145 ? 6.980   31.768  -9.475  1.00 57.58  ? 145 LYS B CE  1 
ATOM   3827  N NZ  . LYS B 1 145 ? 7.518   32.850  -10.373 1.00 74.86  ? 145 LYS B NZ  1 
ATOM   3828  N N   . LYS B 1 146 ? 12.155  28.197  -7.972  1.00 28.76  ? 146 LYS B N   1 
ATOM   3829  C CA  . LYS B 1 146 ? 13.297  27.575  -7.320  1.00 29.85  ? 146 LYS B CA  1 
ATOM   3830  C C   . LYS B 1 146 ? 13.342  27.858  -5.811  1.00 38.63  ? 146 LYS B C   1 
ATOM   3831  O O   . LYS B 1 146 ? 13.814  27.011  -5.027  1.00 41.13  ? 146 LYS B O   1 
ATOM   3832  C CB  . LYS B 1 146 ? 14.620  28.010  -7.980  1.00 30.86  ? 146 LYS B CB  1 
ATOM   3833  C CG  . LYS B 1 146 ? 15.036  29.457  -7.714  1.00 23.83  ? 146 LYS B CG  1 
ATOM   3834  C CD  . LYS B 1 146 ? 16.420  29.764  -8.339  1.00 19.38  ? 146 LYS B CD  1 
ATOM   3835  C CE  . LYS B 1 146 ? 17.261  30.631  -7.467  1.00 14.61  ? 146 LYS B CE  1 
ATOM   3836  N NZ  . LYS B 1 146 ? 17.192  30.254  -6.025  1.00 36.19  ? 146 LYS B NZ  1 
ATOM   3837  N N   . GLU B 1 147 ? 12.929  29.069  -5.414  1.00 32.26  ? 147 GLU B N   1 
ATOM   3838  C CA  . GLU B 1 147 ? 12.997  29.486  -4.010  1.00 30.46  ? 147 GLU B CA  1 
ATOM   3839  C C   . GLU B 1 147 ? 12.100  28.658  -3.094  1.00 30.80  ? 147 GLU B C   1 
ATOM   3840  O O   . GLU B 1 147 ? 12.390  28.494  -1.913  1.00 29.14  ? 147 GLU B O   1 
ATOM   3841  C CB  . GLU B 1 147 ? 12.641  30.957  -3.885  1.00 32.56  ? 147 GLU B CB  1 
ATOM   3842  C CG  . GLU B 1 147 ? 11.257  31.283  -4.456  1.00 52.71  ? 147 GLU B CG  1 
ATOM   3843  C CD  . GLU B 1 147 ? 11.338  31.825  -5.869  1.00 86.80  ? 147 GLU B CD  1 
ATOM   3844  O OE1 . GLU B 1 147 ? 12.423  31.708  -6.495  1.00 69.59  ? 147 GLU B OE1 1 
ATOM   3845  O OE2 . GLU B 1 147 ? 10.358  32.463  -6.308  1.00 94.52  ? 147 GLU B OE2 1 
ATOM   3846  N N   . LYS B 1 148 ? 11.000  28.148  -3.634  1.00 26.80  ? 148 LYS B N   1 
ATOM   3847  C CA  . LYS B 1 148 ? 10.122  27.274  -2.868  1.00 25.51  ? 148 LYS B CA  1 
ATOM   3848  C C   . LYS B 1 148 ? 10.305  25.767  -3.083  1.00 26.87  ? 148 LYS B C   1 
ATOM   3849  O O   . LYS B 1 148 ? 9.504   24.980  -2.597  1.00 26.79  ? 148 LYS B O   1 
ATOM   3850  C CB  . LYS B 1 148 ? 8.670   27.628  -3.113  1.00 28.66  ? 148 LYS B CB  1 
ATOM   3851  C CG  . LYS B 1 148 ? 8.421   28.350  -4.407  1.00 46.04  ? 148 LYS B CG  1 
ATOM   3852  C CD  . LYS B 1 148 ? 6.956   28.718  -4.490  1.00 51.99  ? 148 LYS B CD  1 
ATOM   3853  C CE  . LYS B 1 148 ? 6.440   29.293  -3.166  1.00 44.00  ? 148 LYS B CE  1 
ATOM   3854  N NZ  . LYS B 1 148 ? 5.328   30.243  -3.455  1.00 51.68  ? 148 LYS B NZ  1 
ATOM   3855  N N   . HIS B 1 149 ? 11.323  25.340  -3.834  1.00 20.26  ? 149 HIS B N   1 
ATOM   3856  C CA  . HIS B 1 149 ? 11.510  23.903  -3.978  1.00 18.02  ? 149 HIS B CA  1 
ATOM   3857  C C   . HIS B 1 149 ? 12.959  23.494  -4.162  1.00 20.61  ? 149 HIS B C   1 
ATOM   3858  O O   . HIS B 1 149 ? 13.534  22.852  -3.285  1.00 21.17  ? 149 HIS B O   1 
ATOM   3859  C CB  . HIS B 1 149 ? 10.595  23.289  -5.061  1.00 17.54  ? 149 HIS B CB  1 
ATOM   3860  C CG  . HIS B 1 149 ? 10.655  21.783  -5.131  1.00 19.81  ? 149 HIS B CG  1 
ATOM   3861  N ND1 . HIS B 1 149 ? 11.662  21.104  -5.786  1.00 20.58  ? 149 HIS B ND1 1 
ATOM   3862  C CD2 . HIS B 1 149 ? 9.849   20.830  -4.605  1.00 19.37  ? 149 HIS B CD2 1 
ATOM   3863  C CE1 . HIS B 1 149 ? 11.450  19.804  -5.693  1.00 18.70  ? 149 HIS B CE1 1 
ATOM   3864  N NE2 . HIS B 1 149 ? 10.370  19.611  -4.964  1.00 18.52  ? 149 HIS B NE2 1 
ATOM   3865  N N   . LEU B 1 150 ? 13.512  23.831  -5.328  1.00 14.79  ? 150 LEU B N   1 
ATOM   3866  C CA  . LEU B 1 150 ? 14.895  23.531  -5.708  1.00 13.61  ? 150 LEU B CA  1 
ATOM   3867  C C   . LEU B 1 150 ? 15.906  23.993  -4.631  1.00 21.02  ? 150 LEU B C   1 
ATOM   3868  O O   . LEU B 1 150 ? 16.809  23.242  -4.236  1.00 22.03  ? 150 LEU B O   1 
ATOM   3869  C CB  . LEU B 1 150 ? 15.208  24.145  -7.088  1.00 13.16  ? 150 LEU B CB  1 
ATOM   3870  C CG  . LEU B 1 150 ? 16.600  23.901  -7.735  1.00 17.58  ? 150 LEU B CG  1 
ATOM   3871  C CD1 . LEU B 1 150 ? 16.937  22.397  -8.112  1.00 18.21  ? 150 LEU B CD1 1 
ATOM   3872  C CD2 . LEU B 1 150 ? 16.807  24.809  -8.912  1.00 13.13  ? 150 LEU B CD2 1 
ATOM   3873  N N   . ASP B 1 151 ? 15.679  25.188  -4.090  1.00 18.10  ? 151 ASP B N   1 
ATOM   3874  C CA  . ASP B 1 151 ? 16.498  25.768  -3.016  1.00 17.37  ? 151 ASP B CA  1 
ATOM   3875  C C   . ASP B 1 151 ? 16.358  25.123  -1.615  1.00 24.80  ? 151 ASP B C   1 
ATOM   3876  O O   . ASP B 1 151 ? 17.156  25.401  -0.718  1.00 24.60  ? 151 ASP B O   1 
ATOM   3877  C CB  . ASP B 1 151 ? 16.192  27.260  -2.915  1.00 16.96  ? 151 ASP B CB  1 
ATOM   3878  C CG  . ASP B 1 151 ? 16.529  28.015  -4.190  1.00 26.20  ? 151 ASP B CG  1 
ATOM   3879  O OD1 . ASP B 1 151 ? 17.243  27.490  -5.048  1.00 26.61  ? 151 ASP B OD1 1 
ATOM   3880  O OD2 . ASP B 1 151 ? 16.240  29.226  -4.248  1.00 37.68  ? 151 ASP B OD2 1 
ATOM   3881  N N   . LEU B 1 152 ? 15.337  24.290  -1.399  1.00 23.05  ? 152 LEU B N   1 
ATOM   3882  C CA  . LEU B 1 152 ? 15.198  23.642  -0.091  1.00 21.57  ? 152 LEU B CA  1 
ATOM   3883  C C   . LEU B 1 152 ? 16.325  22.646  0.082   1.00 25.01  ? 152 LEU B C   1 
ATOM   3884  O O   . LEU B 1 152 ? 16.529  21.822  -0.777  1.00 24.82  ? 152 LEU B O   1 
ATOM   3885  C CB  . LEU B 1 152 ? 13.871  22.917  0.031   1.00 20.39  ? 152 LEU B CB  1 
ATOM   3886  C CG  . LEU B 1 152 ? 12.598  23.770  -0.050  1.00 22.61  ? 152 LEU B CG  1 
ATOM   3887  C CD1 . LEU B 1 152 ? 11.445  22.917  0.401   1.00 22.21  ? 152 LEU B CD1 1 
ATOM   3888  C CD2 . LEU B 1 152 ? 12.680  25.068  0.719   1.00 12.02  ? 152 LEU B CD2 1 
ATOM   3889  N N   . GLU B 1 153 ? 17.047  22.728  1.188   1.00 23.13  ? 153 GLU B N   1 
ATOM   3890  C CA  . GLU B 1 153 ? 18.166  21.832  1.428   1.00 25.20  ? 153 GLU B CA  1 
ATOM   3891  C C   . GLU B 1 153 ? 17.945  20.341  1.122   1.00 32.30  ? 153 GLU B C   1 
ATOM   3892  O O   . GLU B 1 153 ? 18.829  19.685  0.558   1.00 33.39  ? 153 GLU B O   1 
ATOM   3893  C CB  . GLU B 1 153 ? 18.836  22.048  2.800   1.00 26.41  ? 153 GLU B CB  1 
ATOM   3894  C CG  . GLU B 1 153 ? 19.781  20.909  3.183   1.00 44.21  ? 153 GLU B CG  1 
ATOM   3895  C CD  . GLU B 1 153 ? 20.418  21.073  4.578   1.00 80.64  ? 153 GLU B CD  1 
ATOM   3896  O OE1 . GLU B 1 153 ? 20.417  22.203  5.116   1.00 70.01  ? 153 GLU B OE1 1 
ATOM   3897  O OE2 . GLU B 1 153 ? 20.869  20.065  5.171   1.00 80.40  ? 153 GLU B OE2 1 
ATOM   3898  N N   . LYS B 1 154 ? 16.779  19.814  1.473   1.00 28.54  ? 154 LYS B N   1 
ATOM   3899  C CA  . LYS B 1 154 ? 16.495  18.414  1.206   1.00 28.65  ? 154 LYS B CA  1 
ATOM   3900  C C   . LYS B 1 154 ? 16.490  18.086  -0.272  1.00 32.97  ? 154 LYS B C   1 
ATOM   3901  O O   . LYS B 1 154 ? 17.033  17.059  -0.695  1.00 34.08  ? 154 LYS B O   1 
ATOM   3902  C CB  . LYS B 1 154 ? 15.206  17.933  1.898   1.00 30.87  ? 154 LYS B CB  1 
ATOM   3903  C CG  . LYS B 1 154 ? 13.935  18.669  1.547   1.00 31.26  ? 154 LYS B CG  1 
ATOM   3904  C CD  . LYS B 1 154 ? 12.735  17.790  1.941   1.00 45.25  ? 154 LYS B CD  1 
ATOM   3905  C CE  . LYS B 1 154 ? 11.414  18.349  1.474   1.00 65.70  ? 154 LYS B CE  1 
ATOM   3906  N NZ  . LYS B 1 154 ? 10.751  19.143  2.560   1.00 81.75  ? 154 LYS B NZ  1 
ATOM   3907  N N   . ASN B 1 155 ? 15.905  18.981  -1.058  1.00 28.05  ? 155 ASN B N   1 
ATOM   3908  C CA  . ASN B 1 155 ? 15.851  18.813  -2.510  1.00 26.11  ? 155 ASN B CA  1 
ATOM   3909  C C   . ASN B 1 155 ? 17.219  19.156  -3.143  1.00 28.75  ? 155 ASN B C   1 
ATOM   3910  O O   . ASN B 1 155 ? 17.757  18.395  -3.933  1.00 28.79  ? 155 ASN B O   1 
ATOM   3911  C CB  . ASN B 1 155 ? 14.807  19.752  -3.100  1.00 18.03  ? 155 ASN B CB  1 
ATOM   3912  C CG  . ASN B 1 155 ? 13.440  19.584  -2.482  1.00 19.84  ? 155 ASN B CG  1 
ATOM   3913  O OD1 . ASN B 1 155 ? 12.596  20.486  -2.601  1.00 10.46  ? 155 ASN B OD1 1 
ATOM   3914  N ND2 . ASN B 1 155 ? 13.142  18.381  -2.011  1.00 8.53   ? 155 ASN B ND2 1 
ATOM   3915  N N   . TRP B 1 156 ? 17.776  20.315  -2.814  1.00 24.12  ? 156 TRP B N   1 
ATOM   3916  C CA  . TRP B 1 156 ? 19.051  20.718  -3.430  1.00 24.08  ? 156 TRP B CA  1 
ATOM   3917  C C   . TRP B 1 156 ? 20.185  19.723  -3.157  1.00 29.61  ? 156 TRP B C   1 
ATOM   3918  O O   . TRP B 1 156 ? 21.111  19.594  -3.943  1.00 28.06  ? 156 TRP B O   1 
ATOM   3919  C CB  . TRP B 1 156 ? 19.453  22.175  -3.103  1.00 21.29  ? 156 TRP B CB  1 
ATOM   3920  C CG  . TRP B 1 156 ? 20.747  22.574  -3.759  1.00 21.47  ? 156 TRP B CG  1 
ATOM   3921  C CD1 . TRP B 1 156 ? 21.989  22.485  -3.217  1.00 24.26  ? 156 TRP B CD1 1 
ATOM   3922  C CD2 . TRP B 1 156 ? 20.945  22.933  -5.136  1.00 21.26  ? 156 TRP B CD2 1 
ATOM   3923  N NE1 . TRP B 1 156 ? 22.950  22.784  -4.155  1.00 22.71  ? 156 TRP B NE1 1 
ATOM   3924  C CE2 . TRP B 1 156 ? 22.331  23.053  -5.343  1.00 23.71  ? 156 TRP B CE2 1 
ATOM   3925  C CE3 . TRP B 1 156 ? 20.084  23.159  -6.217  1.00 22.39  ? 156 TRP B CE3 1 
ATOM   3926  C CZ2 . TRP B 1 156 ? 22.871  23.394  -6.574  1.00 22.24  ? 156 TRP B CZ2 1 
ATOM   3927  C CZ3 . TRP B 1 156 ? 20.645  23.466  -7.448  1.00 22.52  ? 156 TRP B CZ3 1 
ATOM   3928  C CH2 . TRP B 1 156 ? 22.011  23.598  -7.606  1.00 22.48  ? 156 TRP B CH2 1 
ATOM   3929  N N   . MET B 1 157 ? 20.064  19.004  -2.046  1.00 28.77  ? 157 MET B N   1 
ATOM   3930  C CA  . MET B 1 157 ? 20.981  17.909  -1.685  1.00 29.13  ? 157 MET B CA  1 
ATOM   3931  C C   . MET B 1 157 ? 20.997  16.884  -2.817  1.00 26.71  ? 157 MET B C   1 
ATOM   3932  O O   . MET B 1 157 ? 22.064  16.553  -3.350  1.00 25.24  ? 157 MET B O   1 
ATOM   3933  C CB  . MET B 1 157 ? 20.463  17.187  -0.425  1.00 33.05  ? 157 MET B CB  1 
ATOM   3934  C CG  . MET B 1 157 ? 21.525  16.467  0.411   1.00 39.39  ? 157 MET B CG  1 
ATOM   3935  S SD  . MET B 1 157 ? 21.273  16.683  2.218   1.00 47.09  ? 157 MET B SD  1 
ATOM   3936  C CE  . MET B 1 157 ? 19.556  16.051  2.410   1.00 43.80  ? 157 MET B CE  1 
ATOM   3937  N N   . LEU B 1 158 ? 19.805  16.365  -3.136  1.00 19.89  ? 158 LEU B N   1 
ATOM   3938  C CA  . LEU B 1 158 ? 19.602  15.385  -4.214  1.00 19.32  ? 158 LEU B CA  1 
ATOM   3939  C C   . LEU B 1 158 ? 20.316  15.760  -5.516  1.00 22.37  ? 158 LEU B C   1 
ATOM   3940  O O   . LEU B 1 158 ? 21.043  14.924  -6.101  1.00 18.97  ? 158 LEU B O   1 
ATOM   3941  C CB  . LEU B 1 158 ? 18.086  15.168  -4.470  1.00 18.45  ? 158 LEU B CB  1 
ATOM   3942  C CG  . LEU B 1 158 ? 17.300  14.483  -3.322  1.00 19.83  ? 158 LEU B CG  1 
ATOM   3943  C CD1 . LEU B 1 158 ? 15.950  14.028  -3.730  1.00 18.10  ? 158 LEU B CD1 1 
ATOM   3944  C CD2 . LEU B 1 158 ? 18.080  13.324  -2.679  1.00 18.76  ? 158 LEU B CD2 1 
ATOM   3945  N N   . VAL B 1 159 ? 20.119  17.027  -5.922  1.00 20.00  ? 159 VAL B N   1 
ATOM   3946  C CA  . VAL B 1 159 ? 20.791  17.654  -7.073  1.00 20.07  ? 159 VAL B CA  1 
ATOM   3947  C C   . VAL B 1 159 ? 22.339  17.529  -7.037  1.00 27.91  ? 159 VAL B C   1 
ATOM   3948  O O   . VAL B 1 159 ? 22.980  17.343  -8.077  1.00 29.31  ? 159 VAL B O   1 
ATOM   3949  C CB  . VAL B 1 159 ? 20.469  19.181  -7.174  1.00 20.95  ? 159 VAL B CB  1 
ATOM   3950  C CG1 . VAL B 1 159 ? 21.251  19.820  -8.323  1.00 20.02  ? 159 VAL B CG1 1 
ATOM   3951  C CG2 . VAL B 1 159 ? 18.964  19.444  -7.295  1.00 18.84  ? 159 VAL B CG2 1 
ATOM   3952  N N   . GLU B 1 160 ? 22.943  17.709  -5.865  1.00 23.05  ? 160 GLU B N   1 
ATOM   3953  C CA  . GLU B 1 160 ? 24.402  17.593  -5.733  1.00 21.68  ? 160 GLU B CA  1 
ATOM   3954  C C   . GLU B 1 160 ? 24.902  16.152  -5.909  1.00 25.44  ? 160 GLU B C   1 
ATOM   3955  O O   . GLU B 1 160 ? 26.079  15.884  -6.093  1.00 24.50  ? 160 GLU B O   1 
ATOM   3956  C CB  . GLU B 1 160 ? 24.836  18.137  -4.369  1.00 22.29  ? 160 GLU B CB  1 
ATOM   3957  C CG  . GLU B 1 160 ? 24.179  19.460  -4.033  1.00 30.30  ? 160 GLU B CG  1 
ATOM   3958  C CD  . GLU B 1 160 ? 25.154  20.517  -3.567  1.00 46.67  ? 160 GLU B CD  1 
ATOM   3959  O OE1 . GLU B 1 160 ? 25.201  20.800  -2.362  1.00 38.02  ? 160 GLU B OE1 1 
ATOM   3960  O OE2 . GLU B 1 160 ? 25.817  21.129  -4.409  1.00 56.80  ? 160 GLU B OE2 1 
ATOM   3961  N N   . LYS B 1 161 ? 23.998  15.194  -5.838  1.00 22.60  ? 161 LYS B N   1 
ATOM   3962  C CA  . LYS B 1 161 ? 24.397  13.797  -5.940  1.00 22.04  ? 161 LYS B CA  1 
ATOM   3963  C C   . LYS B 1 161 ? 24.646  13.378  -7.402  1.00 25.63  ? 161 LYS B C   1 
ATOM   3964  O O   . LYS B 1 161 ? 25.333  12.394  -7.710  1.00 24.11  ? 161 LYS B O   1 
ATOM   3965  C CB  . LYS B 1 161 ? 23.272  12.929  -5.357  1.00 25.08  ? 161 LYS B CB  1 
ATOM   3966  C CG  . LYS B 1 161 ? 22.989  13.191  -3.869  1.00 37.54  ? 161 LYS B CG  1 
ATOM   3967  C CD  . LYS B 1 161 ? 22.062  12.136  -3.278  1.00 37.42  ? 161 LYS B CD  1 
ATOM   3968  C CE  . LYS B 1 161 ? 22.734  10.780  -3.212  1.00 32.93  ? 161 LYS B CE  1 
ATOM   3969  N NZ  . LYS B 1 161 ? 21.744  9.648   -3.165  1.00 45.02  ? 161 LYS B NZ  1 
ATOM   3970  N N   . ALA B 1 162 ? 24.049  14.148  -8.289  1.00 22.99  ? 162 ALA B N   1 
ATOM   3971  C CA  . ALA B 1 162 ? 23.961  13.861  -9.696  1.00 23.67  ? 162 ALA B CA  1 
ATOM   3972  C C   . ALA B 1 162 ? 25.284  14.062  -10.440 1.00 30.27  ? 162 ALA B C   1 
ATOM   3973  O O   . ALA B 1 162 ? 25.919  15.113  -10.293 1.00 31.99  ? 162 ALA B O   1 
ATOM   3974  C CB  . ALA B 1 162 ? 22.805  14.755  -10.317 1.00 23.84  ? 162 ALA B CB  1 
ATOM   3975  N N   . ARG B 1 163 ? 25.627  13.092  -11.299 1.00 23.87  ? 163 ARG B N   1 
ATOM   3976  C CA  . ARG B 1 163 ? 26.827  13.123  -12.136 1.00 21.86  ? 163 ARG B CA  1 
ATOM   3977  C C   . ARG B 1 163 ? 26.429  13.708  -13.469 1.00 22.06  ? 163 ARG B C   1 
ATOM   3978  O O   . ARG B 1 163 ? 27.258  14.262  -14.216 1.00 20.35  ? 163 ARG B O   1 
ATOM   3979  C CB  . ARG B 1 163 ? 27.273  11.692  -12.391 1.00 23.36  ? 163 ARG B CB  1 
ATOM   3980  C CG  . ARG B 1 163 ? 28.081  11.099  -11.263 1.00 51.41  ? 163 ARG B CG  1 
ATOM   3981  C CD  . ARG B 1 163 ? 29.373  11.878  -11.080 1.00 75.83  ? 163 ARG B CD  1 
ATOM   3982  N NE  . ARG B 1 163 ? 30.454  11.053  -10.541 1.00 99.04  ? 163 ARG B NE  1 
ATOM   3983  C CZ  . ARG B 1 163 ? 31.708  11.060  -10.993 1.00 113.40 ? 163 ARG B CZ  1 
ATOM   3984  N NH1 . ARG B 1 163 ? 32.624  10.292  -10.417 1.00 96.68  ? 163 ARG B NH1 1 
ATOM   3985  N NH2 . ARG B 1 163 ? 32.057  11.840  -12.010 1.00 100.09 ? 163 ARG B NH2 1 
ATOM   3986  N N   . VAL B 1 164 ? 25.147  13.523  -13.772 1.00 15.55  ? 164 VAL B N   1 
ATOM   3987  C CA  . VAL B 1 164 ? 24.560  13.937  -15.035 1.00 14.97  ? 164 VAL B CA  1 
ATOM   3988  C C   . VAL B 1 164 ? 23.226  14.597  -14.712 1.00 21.39  ? 164 VAL B C   1 
ATOM   3989  O O   . VAL B 1 164 ? 22.433  14.052  -13.920 1.00 22.48  ? 164 VAL B O   1 
ATOM   3990  C CB  . VAL B 1 164 ? 24.278  12.709  -15.998 1.00 16.64  ? 164 VAL B CB  1 
ATOM   3991  C CG1 . VAL B 1 164 ? 23.627  13.168  -17.293 1.00 16.26  ? 164 VAL B CG1 1 
ATOM   3992  C CG2 . VAL B 1 164 ? 25.540  11.907  -16.272 1.00 15.25  ? 164 VAL B CG2 1 
ATOM   3993  N N   . CYS B 1 165 ? 22.986  15.759  -15.323 1.00 16.38  ? 165 CYS B N   1 
ATOM   3994  C CA  . CYS B 1 165 ? 21.699  16.439  -15.204 1.00 16.57  ? 165 CYS B CA  1 
ATOM   3995  C C   . CYS B 1 165 ? 21.094  16.588  -16.590 1.00 17.89  ? 165 CYS B C   1 
ATOM   3996  O O   . CYS B 1 165 ? 21.827  16.662  -17.583 1.00 18.67  ? 165 CYS B O   1 
ATOM   3997  C CB  . CYS B 1 165 ? 21.843  17.819  -14.568 1.00 17.63  ? 165 CYS B CB  1 
ATOM   3998  S SG  . CYS B 1 165 ? 22.397  17.749  -12.836 1.00 21.07  ? 165 CYS B SG  1 
ATOM   3999  N N   . TYR B 1 166 ? 19.771  16.521  -16.673 1.00 10.08  ? 166 TYR B N   1 
ATOM   4000  C CA  . TYR B 1 166 ? 19.098  16.658  -17.958 1.00 7.18   ? 166 TYR B CA  1 
ATOM   4001  C C   . TYR B 1 166 ? 17.783  17.353  -17.755 1.00 8.56   ? 166 TYR B C   1 
ATOM   4002  O O   . TYR B 1 166 ? 16.974  16.899  -16.947 1.00 7.01   ? 166 TYR B O   1 
ATOM   4003  C CB  . TYR B 1 166 ? 18.881  15.318  -18.681 1.00 6.29   ? 166 TYR B CB  1 
ATOM   4004  C CG  . TYR B 1 166 ? 17.910  15.418  -19.859 1.00 5.67   ? 166 TYR B CG  1 
ATOM   4005  C CD1 . TYR B 1 166 ? 18.302  16.005  -21.040 1.00 5.66   ? 166 TYR B CD1 1 
ATOM   4006  C CD2 . TYR B 1 166 ? 16.614  14.933  -19.780 1.00 6.20   ? 166 TYR B CD2 1 
ATOM   4007  C CE1 . TYR B 1 166 ? 17.444  16.096  -22.115 1.00 4.74   ? 166 TYR B CE1 1 
ATOM   4008  C CE2 . TYR B 1 166 ? 15.741  15.055  -20.839 1.00 7.32   ? 166 TYR B CE2 1 
ATOM   4009  C CZ  . TYR B 1 166 ? 16.142  15.707  -21.987 1.00 15.97  ? 166 TYR B CZ  1 
ATOM   4010  O OH  . TYR B 1 166 ? 15.247  15.806  -23.046 1.00 17.43  ? 166 TYR B OH  1 
ATOM   4011  N N   . ILE B 1 167 ? 17.615  18.476  -18.466 1.00 6.41   ? 167 ILE B N   1 
ATOM   4012  C CA  . ILE B 1 167 ? 16.383  19.260  -18.488 1.00 6.52   ? 167 ILE B CA  1 
ATOM   4013  C C   . ILE B 1 167 ? 15.964  19.538  -19.942 1.00 10.65  ? 167 ILE B C   1 
ATOM   4014  O O   . ILE B 1 167 ? 16.783  19.931  -20.751 1.00 9.41   ? 167 ILE B O   1 
ATOM   4015  C CB  . ILE B 1 167 ? 16.465  20.591  -17.616 1.00 9.32   ? 167 ILE B CB  1 
ATOM   4016  C CG1 . ILE B 1 167 ? 17.036  20.321  -16.217 1.00 7.08   ? 167 ILE B CG1 1 
ATOM   4017  C CG2 . ILE B 1 167 ? 15.036  21.243  -17.426 1.00 10.47  ? 167 ILE B CG2 1 
ATOM   4018  C CD1 . ILE B 1 167 ? 17.889  21.471  -15.678 1.00 1.00   ? 167 ILE B CD1 1 
ATOM   4019  N N   . ALA B 1 168 ? 14.705  19.248  -20.272 1.00 11.93  ? 168 ALA B N   1 
ATOM   4020  C CA  . ALA B 1 168 ? 14.167  19.466  -21.627 1.00 11.57  ? 168 ALA B CA  1 
ATOM   4021  C C   . ALA B 1 168 ? 13.913  20.956  -21.735 1.00 16.22  ? 168 ALA B C   1 
ATOM   4022  O O   . ALA B 1 168 ? 13.501  21.580  -20.752 1.00 14.86  ? 168 ALA B O   1 
ATOM   4023  C CB  . ALA B 1 168 ? 12.859  18.660  -21.854 1.00 10.75  ? 168 ALA B CB  1 
ATOM   4024  N N   . GLY B 1 169 ? 14.194  21.510  -22.916 1.00 14.07  ? 169 GLY B N   1 
ATOM   4025  C CA  . GLY B 1 169 ? 14.085  22.949  -23.195 1.00 13.41  ? 169 GLY B CA  1 
ATOM   4026  C C   . GLY B 1 169 ? 12.722  23.499  -22.798 1.00 17.23  ? 169 GLY B C   1 
ATOM   4027  O O   . GLY B 1 169 ? 12.584  24.685  -22.431 1.00 19.06  ? 169 GLY B O   1 
ATOM   4028  N N   . PHE B 1 170 ? 11.715  22.633  -22.886 1.00 10.01  ? 170 PHE B N   1 
ATOM   4029  C CA  . PHE B 1 170 ? 10.335  22.960  -22.505 1.00 7.12   ? 170 PHE B CA  1 
ATOM   4030  C C   . PHE B 1 170 ? 10.301  23.707  -21.194 1.00 13.14  ? 170 PHE B C   1 
ATOM   4031  O O   . PHE B 1 170 ? 9.614   24.712  -21.086 1.00 16.18  ? 170 PHE B O   1 
ATOM   4032  C CB  . PHE B 1 170 ? 9.547   21.664  -22.337 1.00 7.61   ? 170 PHE B CB  1 
ATOM   4033  C CG  . PHE B 1 170 ? 9.099   21.058  -23.624 1.00 7.96   ? 170 PHE B CG  1 
ATOM   4034  C CD1 . PHE B 1 170 ? 9.164   19.688  -23.814 1.00 8.29   ? 170 PHE B CD1 1 
ATOM   4035  C CD2 . PHE B 1 170 ? 8.551   21.863  -24.640 1.00 9.71   ? 170 PHE B CD2 1 
ATOM   4036  C CE1 . PHE B 1 170 ? 8.611   19.089  -24.969 1.00 8.65   ? 170 PHE B CE1 1 
ATOM   4037  C CE2 . PHE B 1 170 ? 8.056   21.287  -25.816 1.00 10.81  ? 170 PHE B CE2 1 
ATOM   4038  C CZ  . PHE B 1 170 ? 8.062   19.884  -25.969 1.00 7.59   ? 170 PHE B CZ  1 
ATOM   4039  N N   . PHE B 1 171 ? 11.031  23.207  -20.193 1.00 8.69   ? 171 PHE B N   1 
ATOM   4040  C CA  . PHE B 1 171 ? 11.059  23.839  -18.870 1.00 9.07   ? 171 PHE B CA  1 
ATOM   4041  C C   . PHE B 1 171 ? 11.644  25.291  -18.843 1.00 16.40  ? 171 PHE B C   1 
ATOM   4042  O O   . PHE B 1 171 ? 11.566  25.985  -17.831 1.00 19.11  ? 171 PHE B O   1 
ATOM   4043  C CB  . PHE B 1 171 ? 11.772  22.898  -17.891 1.00 10.14  ? 171 PHE B CB  1 
ATOM   4044  C CG  . PHE B 1 171 ? 11.495  23.177  -16.450 1.00 9.74   ? 171 PHE B CG  1 
ATOM   4045  C CD1 . PHE B 1 171 ? 10.227  23.031  -15.940 1.00 13.37  ? 171 PHE B CD1 1 
ATOM   4046  C CD2 . PHE B 1 171 ? 12.529  23.501  -15.569 1.00 8.75   ? 171 PHE B CD2 1 
ATOM   4047  C CE1 . PHE B 1 171 ? 9.965   23.295  -14.568 1.00 13.07  ? 171 PHE B CE1 1 
ATOM   4048  C CE2 . PHE B 1 171 ? 12.260  23.771  -14.194 1.00 9.50   ? 171 PHE B CE2 1 
ATOM   4049  C CZ  . PHE B 1 171 ? 11.005  23.661  -13.707 1.00 7.80   ? 171 PHE B CZ  1 
ATOM   4050  N N   . LEU B 1 172 ? 12.172  25.766  -19.963 1.00 12.70  ? 172 LEU B N   1 
ATOM   4051  C CA  . LEU B 1 172 ? 12.705  27.130  -20.038 1.00 11.42  ? 172 LEU B CA  1 
ATOM   4052  C C   . LEU B 1 172 ? 11.581  28.132  -20.026 1.00 16.06  ? 172 LEU B C   1 
ATOM   4053  O O   . LEU B 1 172 ? 11.836  29.283  -19.701 1.00 18.18  ? 172 LEU B O   1 
ATOM   4054  C CB  . LEU B 1 172 ? 13.496  27.342  -21.334 1.00 11.22  ? 172 LEU B CB  1 
ATOM   4055  C CG  . LEU B 1 172 ? 14.904  26.759  -21.457 1.00 15.64  ? 172 LEU B CG  1 
ATOM   4056  C CD1 . LEU B 1 172 ? 15.274  26.836  -22.904 1.00 15.89  ? 172 LEU B CD1 1 
ATOM   4057  C CD2 . LEU B 1 172 ? 15.906  27.492  -20.588 1.00 14.75  ? 172 LEU B CD2 1 
ATOM   4058  N N   . THR B 1 173 ? 10.377  27.739  -20.465 1.00 11.75  ? 173 THR B N   1 
ATOM   4059  C CA  . THR B 1 173 ? 9.224   28.646  -20.480 1.00 10.39  ? 173 THR B CA  1 
ATOM   4060  C C   . THR B 1 173 ? 8.725   28.736  -19.055 1.00 16.18  ? 173 THR B C   1 
ATOM   4061  O O   . THR B 1 173 ? 8.020   29.649  -18.712 1.00 17.33  ? 173 THR B O   1 
ATOM   4062  C CB  . THR B 1 173 ? 8.028   28.160  -21.359 1.00 14.91  ? 173 THR B CB  1 
ATOM   4063  O OG1 . THR B 1 173 ? 7.294   27.182  -20.643 1.00 16.02  ? 173 THR B OG1 1 
ATOM   4064  C CG2 . THR B 1 173 ? 8.434   27.582  -22.740 1.00 14.45  ? 173 THR B CG2 1 
ATOM   4065  N N   . VAL B 1 174 ? 9.175   27.854  -18.179 1.00 15.95  ? 174 VAL B N   1 
ATOM   4066  C CA  . VAL B 1 174 ? 8.648   27.855  -16.806 1.00 16.90  ? 174 VAL B CA  1 
ATOM   4067  C C   . VAL B 1 174 ? 9.518   28.535  -15.800 1.00 20.91  ? 174 VAL B C   1 
ATOM   4068  O O   . VAL B 1 174 ? 9.074   29.495  -15.180 1.00 21.51  ? 174 VAL B O   1 
ATOM   4069  C CB  . VAL B 1 174 ? 8.177   26.414  -16.301 1.00 20.22  ? 174 VAL B CB  1 
ATOM   4070  C CG1 . VAL B 1 174 ? 7.879   26.420  -14.776 1.00 19.90  ? 174 VAL B CG1 1 
ATOM   4071  C CG2 . VAL B 1 174 ? 6.955   25.910  -17.110 1.00 18.33  ? 174 VAL B CG2 1 
ATOM   4072  N N   . SER B 1 175 ? 10.750  28.048  -15.655 1.00 16.47  ? 175 SER B N   1 
ATOM   4073  C CA  . SER B 1 175 ? 11.685  28.587  -14.673 1.00 16.22  ? 175 SER B CA  1 
ATOM   4074  C C   . SER B 1 175 ? 13.139  28.545  -15.176 1.00 26.88  ? 175 SER B C   1 
ATOM   4075  O O   . SER B 1 175 ? 13.906  27.622  -14.843 1.00 29.98  ? 175 SER B O   1 
ATOM   4076  C CB  . SER B 1 175 ? 11.597  27.800  -13.376 1.00 16.89  ? 175 SER B CB  1 
ATOM   4077  O OG  . SER B 1 175 ? 12.406  28.402  -12.388 1.00 31.34  ? 175 SER B OG  1 
ATOM   4078  N N   . PRO B 1 176 ? 13.517  29.532  -15.988 1.00 21.27  ? 176 PRO B N   1 
ATOM   4079  C CA  . PRO B 1 176 ? 14.868  29.566  -16.541 1.00 18.63  ? 176 PRO B CA  1 
ATOM   4080  C C   . PRO B 1 176 ? 15.875  29.653  -15.399 1.00 23.10  ? 176 PRO B C   1 
ATOM   4081  O O   . PRO B 1 176 ? 17.065  29.308  -15.537 1.00 22.92  ? 176 PRO B O   1 
ATOM   4082  C CB  . PRO B 1 176 ? 14.876  30.873  -17.338 1.00 19.57  ? 176 PRO B CB  1 
ATOM   4083  C CG  . PRO B 1 176 ? 13.452  31.047  -17.773 1.00 24.52  ? 176 PRO B CG  1 
ATOM   4084  C CD  . PRO B 1 176 ? 12.595  30.447  -16.701 1.00 20.41  ? 176 PRO B CD  1 
ATOM   4085  N N   . GLU B 1 177 ? 15.416  30.190  -14.278 1.00 18.39  ? 177 GLU B N   1 
ATOM   4086  C CA  . GLU B 1 177 ? 16.306  30.445  -13.135 1.00 16.52  ? 177 GLU B CA  1 
ATOM   4087  C C   . GLU B 1 177 ? 16.739  29.164  -12.471 1.00 21.50  ? 177 GLU B C   1 
ATOM   4088  O O   . GLU B 1 177 ? 17.902  29.017  -12.102 1.00 22.57  ? 177 GLU B O   1 
ATOM   4089  C CB  . GLU B 1 177 ? 15.622  31.372  -12.136 1.00 16.58  ? 177 GLU B CB  1 
ATOM   4090  C CG  . GLU B 1 177 ? 15.194  32.698  -12.742 1.00 9.90   ? 177 GLU B CG  1 
ATOM   4091  C CD  . GLU B 1 177 ? 13.838  32.627  -13.407 1.00 28.41  ? 177 GLU B CD  1 
ATOM   4092  O OE1 . GLU B 1 177 ? 13.229  31.546  -13.412 1.00 17.70  ? 177 GLU B OE1 1 
ATOM   4093  O OE2 . GLU B 1 177 ? 13.381  33.652  -13.950 1.00 35.82  ? 177 GLU B OE2 1 
ATOM   4094  N N   . SER B 1 178 ? 15.812  28.214  -12.387 1.00 17.99  ? 178 SER B N   1 
ATOM   4095  C CA  . SER B 1 178 ? 16.089  26.886  -11.860 1.00 16.53  ? 178 SER B CA  1 
ATOM   4096  C C   . SER B 1 178 ? 17.088  26.156  -12.798 1.00 21.59  ? 178 SER B C   1 
ATOM   4097  O O   . SER B 1 178 ? 18.134  25.626  -12.342 1.00 20.05  ? 178 SER B O   1 
ATOM   4098  C CB  . SER B 1 178 ? 14.785  26.092  -11.749 1.00 18.69  ? 178 SER B CB  1 
ATOM   4099  O OG  . SER B 1 178 ? 13.807  26.769  -10.962 1.00 19.16  ? 178 SER B OG  1 
ATOM   4100  N N   . VAL B 1 179 ? 16.785  26.153  -14.102 1.00 16.36  ? 179 VAL B N   1 
ATOM   4101  C CA  . VAL B 1 179 ? 17.695  25.566  -15.086 1.00 13.77  ? 179 VAL B CA  1 
ATOM   4102  C C   . VAL B 1 179 ? 19.080  26.184  -14.938 1.00 19.14  ? 179 VAL B C   1 
ATOM   4103  O O   . VAL B 1 179 ? 20.104  25.475  -14.870 1.00 21.08  ? 179 VAL B O   1 
ATOM   4104  C CB  . VAL B 1 179 ? 17.252  25.867  -16.507 1.00 16.32  ? 179 VAL B CB  1 
ATOM   4105  C CG1 . VAL B 1 179 ? 18.239  25.307  -17.479 1.00 15.68  ? 179 VAL B CG1 1 
ATOM   4106  C CG2 . VAL B 1 179 ? 15.806  25.424  -16.766 1.00 15.62  ? 179 VAL B CG2 1 
ATOM   4107  N N   . LEU B 1 180 ? 19.129  27.515  -14.916 1.00 16.58  ? 180 LEU B N   1 
ATOM   4108  C CA  . LEU B 1 180 ? 20.411  28.237  -14.735 1.00 17.32  ? 180 LEU B CA  1 
ATOM   4109  C C   . LEU B 1 180 ? 21.142  27.869  -13.441 1.00 21.97  ? 180 LEU B C   1 
ATOM   4110  O O   . LEU B 1 180 ? 22.342  27.695  -13.454 1.00 20.78  ? 180 LEU B O   1 
ATOM   4111  C CB  . LEU B 1 180 ? 20.211  29.751  -14.768 1.00 17.52  ? 180 LEU B CB  1 
ATOM   4112  C CG  . LEU B 1 180 ? 20.423  30.464  -16.110 1.00 23.32  ? 180 LEU B CG  1 
ATOM   4113  C CD1 . LEU B 1 180 ? 19.871  31.907  -16.086 1.00 21.79  ? 180 LEU B CD1 1 
ATOM   4114  C CD2 . LEU B 1 180 ? 21.911  30.411  -16.584 1.00 24.98  ? 180 LEU B CD2 1 
ATOM   4115  N N   . LYS B 1 181 ? 20.428  27.780  -12.315 1.00 18.75  ? 181 LYS B N   1 
ATOM   4116  C CA  . LYS B 1 181 ? 21.087  27.401  -11.060 1.00 17.26  ? 181 LYS B CA  1 
ATOM   4117  C C   . LYS B 1 181 ? 21.732  26.010  -11.172 1.00 19.70  ? 181 LYS B C   1 
ATOM   4118  O O   . LYS B 1 181 ? 22.834  25.784  -10.674 1.00 14.73  ? 181 LYS B O   1 
ATOM   4119  C CB  . LYS B 1 181 ? 20.105  27.426  -9.878  1.00 17.91  ? 181 LYS B CB  1 
ATOM   4120  C CG  . LYS B 1 181 ? 20.766  27.001  -8.543  1.00 15.66  ? 181 LYS B CG  1 
ATOM   4121  C CD  . LYS B 1 181 ? 19.756  27.164  -7.392  1.00 29.61  ? 181 LYS B CD  1 
ATOM   4122  C CE  . LYS B 1 181 ? 20.017  26.276  -6.172  1.00 14.09  ? 181 LYS B CE  1 
ATOM   4123  N NZ  . LYS B 1 181 ? 19.813  27.062  -4.916  1.00 11.61  ? 181 LYS B NZ  1 
ATOM   4124  N N   . VAL B 1 182 ? 20.999  25.081  -11.803 1.00 20.11  ? 182 VAL B N   1 
ATOM   4125  C CA  . VAL B 1 182 ? 21.422  23.684  -11.975 1.00 20.74  ? 182 VAL B CA  1 
ATOM   4126  C C   . VAL B 1 182 ? 22.598  23.590  -12.964 1.00 28.97  ? 182 VAL B C   1 
ATOM   4127  O O   . VAL B 1 182 ? 23.676  23.038  -12.638 1.00 27.08  ? 182 VAL B O   1 
ATOM   4128  C CB  . VAL B 1 182 ? 20.212  22.764  -12.362 1.00 21.99  ? 182 VAL B CB  1 
ATOM   4129  C CG1 . VAL B 1 182 ? 20.509  21.342  -12.118 1.00 20.12  ? 182 VAL B CG1 1 
ATOM   4130  C CG2 . VAL B 1 182 ? 19.036  23.139  -11.503 1.00 22.64  ? 182 VAL B CG2 1 
ATOM   4131  N N   . ALA B 1 183 ? 22.438  24.212  -14.131 1.00 27.99  ? 183 ALA B N   1 
ATOM   4132  C CA  . ALA B 1 183 ? 23.538  24.204  -15.105 1.00 28.26  ? 183 ALA B CA  1 
ATOM   4133  C C   . ALA B 1 183 ? 24.821  24.904  -14.639 1.00 30.18  ? 183 ALA B C   1 
ATOM   4134  O O   . ALA B 1 183 ? 25.911  24.407  -14.880 1.00 30.82  ? 183 ALA B O   1 
ATOM   4135  C CB  . ALA B 1 183 ? 23.090  24.665  -16.508 1.00 29.25  ? 183 ALA B CB  1 
ATOM   4136  N N   . HIS B 1 184 ? 24.702  25.987  -13.883 1.00 26.34  ? 184 HIS B N   1 
ATOM   4137  C CA  . HIS B 1 184 ? 25.873  26.634  -13.315 1.00 26.55  ? 184 HIS B CA  1 
ATOM   4138  C C   . HIS B 1 184 ? 26.586  25.667  -12.351 1.00 28.55  ? 184 HIS B C   1 
ATOM   4139  O O   . HIS B 1 184 ? 27.799  25.440  -12.437 1.00 27.24  ? 184 HIS B O   1 
ATOM   4140  C CB  . HIS B 1 184 ? 25.465  27.889  -12.579 1.00 29.24  ? 184 HIS B CB  1 
ATOM   4141  C CG  . HIS B 1 184 ? 26.621  28.761  -12.210 1.00 35.03  ? 184 HIS B CG  1 
ATOM   4142  N ND1 . HIS B 1 184 ? 27.428  28.494  -11.120 1.00 37.95  ? 184 HIS B ND1 1 
ATOM   4143  C CD2 . HIS B 1 184 ? 27.147  29.859  -12.807 1.00 37.72  ? 184 HIS B CD2 1 
ATOM   4144  C CE1 . HIS B 1 184 ? 28.375  29.410  -11.042 1.00 37.51  ? 184 HIS B CE1 1 
ATOM   4145  N NE2 . HIS B 1 184 ? 28.213  30.263  -12.039 1.00 37.76  ? 184 HIS B NE2 1 
ATOM   4146  N N   . HIS B 1 185 ? 25.806  25.050  -11.471 1.00 24.02  ? 185 HIS B N   1 
ATOM   4147  C CA  . HIS B 1 185 ? 26.323  24.064  -10.524 1.00 23.42  ? 185 HIS B CA  1 
ATOM   4148  C C   . HIS B 1 185 ? 27.132  22.951  -11.182 1.00 25.86  ? 185 HIS B C   1 
ATOM   4149  O O   . HIS B 1 185 ? 28.192  22.580  -10.688 1.00 24.84  ? 185 HIS B O   1 
ATOM   4150  C CB  . HIS B 1 185 ? 25.167  23.430  -9.701  1.00 25.11  ? 185 HIS B CB  1 
ATOM   4151  C CG  . HIS B 1 185 ? 25.628  22.338  -8.786  1.00 29.18  ? 185 HIS B CG  1 
ATOM   4152  N ND1 . HIS B 1 185 ? 26.232  22.592  -7.570  1.00 30.78  ? 185 HIS B ND1 1 
ATOM   4153  C CD2 . HIS B 1 185 ? 25.676  20.988  -8.952  1.00 30.28  ? 185 HIS B CD2 1 
ATOM   4154  C CE1 . HIS B 1 185 ? 26.599  21.446  -7.016  1.00 29.34  ? 185 HIS B CE1 1 
ATOM   4155  N NE2 . HIS B 1 185 ? 26.275  20.458  -7.831  1.00 29.26  ? 185 HIS B NE2 1 
ATOM   4156  N N   . ALA B 1 186 ? 26.587  22.354  -12.244 1.00 22.66  ? 186 ALA B N   1 
ATOM   4157  C CA  . ALA B 1 186 ? 27.304  21.320  -13.022 1.00 20.85  ? 186 ALA B CA  1 
ATOM   4158  C C   . ALA B 1 186 ? 28.635  21.890  -13.540 1.00 21.19  ? 186 ALA B C   1 
ATOM   4159  O O   . ALA B 1 186 ? 29.665  21.229  -13.492 1.00 17.92  ? 186 ALA B O   1 
ATOM   4160  C CB  . ALA B 1 186 ? 26.447  20.846  -14.212 1.00 21.12  ? 186 ALA B CB  1 
ATOM   4161  N N   . SER B 1 187 ? 28.611  23.139  -14.008 1.00 19.51  ? 187 SER B N   1 
ATOM   4162  C CA  . SER B 1 187 ? 29.837  23.775  -14.519 1.00 21.88  ? 187 SER B CA  1 
ATOM   4163  C C   . SER B 1 187 ? 30.947  23.850  -13.453 1.00 31.21  ? 187 SER B C   1 
ATOM   4164  O O   . SER B 1 187 ? 32.023  23.233  -13.577 1.00 31.16  ? 187 SER B O   1 
ATOM   4165  C CB  . SER B 1 187 ? 29.522  25.185  -15.001 1.00 26.37  ? 187 SER B CB  1 
ATOM   4166  O OG  . SER B 1 187 ? 30.573  25.681  -15.802 1.00 44.06  ? 187 SER B OG  1 
ATOM   4167  N N   . GLU B 1 188 ? 30.673  24.667  -12.433 1.00 29.19  ? 188 GLU B N   1 
ATOM   4168  C CA  . GLU B 1 188 ? 31.531  24.842  -11.286 1.00 28.23  ? 188 GLU B CA  1 
ATOM   4169  C C   . GLU B 1 188 ? 32.055  23.518  -10.739 1.00 32.08  ? 188 GLU B C   1 
ATOM   4170  O O   . GLU B 1 188 ? 33.198  23.457  -10.271 1.00 33.68  ? 188 GLU B O   1 
ATOM   4171  C CB  . GLU B 1 188 ? 30.743  25.567  -10.212 1.00 29.82  ? 188 GLU B CB  1 
ATOM   4172  C CG  . GLU B 1 188 ? 30.585  27.063  -10.493 1.00 48.90  ? 188 GLU B CG  1 
ATOM   4173  C CD  . GLU B 1 188 ? 30.343  27.872  -9.231  1.00 86.48  ? 188 GLU B CD  1 
ATOM   4174  O OE1 . GLU B 1 188 ? 29.404  27.531  -8.468  1.00 83.24  ? 188 GLU B OE1 1 
ATOM   4175  O OE2 . GLU B 1 188 ? 31.061  28.878  -9.035  1.00 91.10  ? 188 GLU B OE2 1 
ATOM   4176  N N   . ASN B 1 189 ? 31.237  22.461  -10.791 1.00 25.78  ? 189 ASN B N   1 
ATOM   4177  C CA  . ASN B 1 189 ? 31.637  21.165  -10.257 1.00 24.34  ? 189 ASN B CA  1 
ATOM   4178  C C   . ASN B 1 189 ? 31.955  20.116  -11.311 1.00 29.73  ? 189 ASN B C   1 
ATOM   4179  O O   . ASN B 1 189 ? 32.171  18.934  -11.000 1.00 27.74  ? 189 ASN B O   1 
ATOM   4180  C CB  . ASN B 1 189 ? 30.621  20.648  -9.232  1.00 19.06  ? 189 ASN B CB  1 
ATOM   4181  C CG  . ASN B 1 189 ? 30.429  21.625  -8.065  1.00 32.24  ? 189 ASN B CG  1 
ATOM   4182  O OD1 . ASN B 1 189 ? 31.240  21.674  -7.158  1.00 33.39  ? 189 ASN B OD1 1 
ATOM   4183  N ND2 . ASN B 1 189 ? 29.389  22.449  -8.132  1.00 14.70  ? 189 ASN B ND2 1 
ATOM   4184  N N   . ASN B 1 190 ? 32.031  20.560  -12.562 1.00 28.44  ? 190 ASN B N   1 
ATOM   4185  C CA  . ASN B 1 190 ? 32.404  19.682  -13.657 1.00 28.57  ? 190 ASN B CA  1 
ATOM   4186  C C   . ASN B 1 190 ? 31.531  18.447  -13.746 1.00 33.01  ? 190 ASN B C   1 
ATOM   4187  O O   . ASN B 1 190 ? 32.025  17.325  -13.959 1.00 33.15  ? 190 ASN B O   1 
ATOM   4188  C CB  . ASN B 1 190 ? 33.888  19.293  -13.594 1.00 31.60  ? 190 ASN B CB  1 
ATOM   4189  C CG  . ASN B 1 190 ? 34.392  18.730  -14.911 1.00 59.90  ? 190 ASN B CG  1 
ATOM   4190  O OD1 . ASN B 1 190 ? 34.148  19.302  -15.971 1.00 55.17  ? 190 ASN B OD1 1 
ATOM   4191  N ND2 . ASN B 1 190 ? 35.027  17.566  -14.859 1.00 56.45  ? 190 ASN B ND2 1 
ATOM   4192  N N   . ARG B 1 191 ? 30.227  18.662  -13.587 1.00 29.46  ? 191 ARG B N   1 
ATOM   4193  C CA  . ARG B 1 191 ? 29.228  17.612  -13.786 1.00 28.36  ? 191 ARG B CA  1 
ATOM   4194  C C   . ARG B 1 191 ? 28.743  17.795  -15.209 1.00 28.55  ? 191 ARG B C   1 
ATOM   4195  O O   . ARG B 1 191 ? 28.965  18.844  -15.815 1.00 29.28  ? 191 ARG B O   1 
ATOM   4196  C CB  . ARG B 1 191 ? 28.027  17.786  -12.850 1.00 31.65  ? 191 ARG B CB  1 
ATOM   4197  C CG  . ARG B 1 191 ? 28.230  17.269  -11.443 1.00 44.00  ? 191 ARG B CG  1 
ATOM   4198  C CD  . ARG B 1 191 ? 29.456  17.903  -10.816 1.00 59.39  ? 191 ARG B CD  1 
ATOM   4199  N NE  . ARG B 1 191 ? 29.472  17.780  -9.365  1.00 65.15  ? 191 ARG B NE  1 
ATOM   4200  C CZ  . ARG B 1 191 ? 29.204  16.656  -8.714  1.00 81.98  ? 191 ARG B CZ  1 
ATOM   4201  N NH1 . ARG B 1 191 ? 28.883  15.548  -9.381  1.00 61.62  ? 191 ARG B NH1 1 
ATOM   4202  N NH2 . ARG B 1 191 ? 29.251  16.645  -7.386  1.00 73.04  ? 191 ARG B NH2 1 
ATOM   4203  N N   . ILE B 1 192 ? 28.022  16.803  -15.712 1.00 23.24  ? 192 ILE B N   1 
ATOM   4204  C CA  . ILE B 1 192 ? 27.488  16.873  -17.078 1.00 22.10  ? 192 ILE B CA  1 
ATOM   4205  C C   . ILE B 1 192 ? 26.082  17.474  -17.113 1.00 21.33  ? 192 ILE B C   1 
ATOM   4206  O O   . ILE B 1 192 ? 25.128  16.893  -16.590 1.00 19.61  ? 192 ILE B O   1 
ATOM   4207  C CB  . ILE B 1 192 ? 27.426  15.478  -17.802 1.00 24.21  ? 192 ILE B CB  1 
ATOM   4208  C CG1 . ILE B 1 192 ? 28.616  14.603  -17.422 1.00 23.27  ? 192 ILE B CG1 1 
ATOM   4209  C CG2 . ILE B 1 192 ? 27.399  15.667  -19.320 1.00 24.88  ? 192 ILE B CG2 1 
ATOM   4210  C CD1 . ILE B 1 192 ? 29.152  13.867  -18.550 1.00 13.58  ? 192 ILE B CD1 1 
ATOM   4211  N N   . PHE B 1 193 ? 25.971  18.612  -17.787 1.00 16.69  ? 193 PHE B N   1 
ATOM   4212  C CA  . PHE B 1 193 ? 24.692  19.281  -18.044 1.00 16.03  ? 193 PHE B CA  1 
ATOM   4213  C C   . PHE B 1 193 ? 24.181  18.999  -19.455 1.00 16.80  ? 193 PHE B C   1 
ATOM   4214  O O   . PHE B 1 193 ? 24.867  19.190  -20.459 1.00 14.07  ? 193 PHE B O   1 
ATOM   4215  C CB  . PHE B 1 193 ? 24.758  20.790  -17.805 1.00 17.59  ? 193 PHE B CB  1 
ATOM   4216  C CG  . PHE B 1 193 ? 23.415  21.422  -17.726 1.00 20.09  ? 193 PHE B CG  1 
ATOM   4217  C CD1 . PHE B 1 193 ? 22.539  21.080  -16.693 1.00 22.95  ? 193 PHE B CD1 1 
ATOM   4218  C CD2 . PHE B 1 193 ? 22.966  22.260  -18.741 1.00 23.89  ? 193 PHE B CD2 1 
ATOM   4219  C CE1 . PHE B 1 193 ? 21.272  21.595  -16.645 1.00 23.39  ? 193 PHE B CE1 1 
ATOM   4220  C CE2 . PHE B 1 193 ? 21.677  22.775  -18.716 1.00 26.20  ? 193 PHE B CE2 1 
ATOM   4221  C CZ  . PHE B 1 193 ? 20.831  22.431  -17.660 1.00 24.50  ? 193 PHE B CZ  1 
ATOM   4222  N N   . THR B 1 194 ? 22.945  18.544  -19.523 1.00 14.94  ? 194 THR B N   1 
ATOM   4223  C CA  . THR B 1 194 ? 22.352  18.203  -20.800 1.00 13.83  ? 194 THR B CA  1 
ATOM   4224  C C   . THR B 1 194 ? 20.994  18.855  -20.962 1.00 14.17  ? 194 THR B C   1 
ATOM   4225  O O   . THR B 1 194 ? 20.304  19.119  -19.971 1.00 9.58   ? 194 THR B O   1 
ATOM   4226  C CB  . THR B 1 194 ? 22.323  16.679  -21.001 1.00 19.60  ? 194 THR B CB  1 
ATOM   4227  O OG1 . THR B 1 194 ? 21.422  16.092  -20.054 1.00 23.68  ? 194 THR B OG1 1 
ATOM   4228  C CG2 . THR B 1 194 ? 23.763  16.089  -20.830 1.00 8.13   ? 194 THR B CG2 1 
ATOM   4229  N N   . LEU B 1 195 ? 20.676  19.204  -22.212 1.00 12.47  ? 195 LEU B N   1 
ATOM   4230  C CA  . LEU B 1 195 ? 19.461  19.967  -22.550 1.00 11.23  ? 195 LEU B CA  1 
ATOM   4231  C C   . LEU B 1 195 ? 18.839  19.525  -23.865 1.00 15.10  ? 195 LEU B C   1 
ATOM   4232  O O   . LEU B 1 195 ? 19.486  19.013  -24.762 1.00 16.53  ? 195 LEU B O   1 
ATOM   4233  C CB  . LEU B 1 195 ? 19.770  21.491  -22.610 1.00 10.28  ? 195 LEU B CB  1 
ATOM   4234  C CG  . LEU B 1 195 ? 18.602  22.512  -22.561 1.00 12.48  ? 195 LEU B CG  1 
ATOM   4235  C CD1 . LEU B 1 195 ? 18.167  22.896  -21.162 1.00 8.57   ? 195 LEU B CD1 1 
ATOM   4236  C CD2 . LEU B 1 195 ? 18.930  23.766  -23.418 1.00 14.19  ? 195 LEU B CD2 1 
ATOM   4237  N N   . ASN B 1 196 ? 17.559  19.759  -24.007 1.00 11.97  ? 196 ASN B N   1 
ATOM   4238  C CA  . ASN B 1 196 ? 16.915  19.403  -25.250 1.00 11.70  ? 196 ASN B CA  1 
ATOM   4239  C C   . ASN B 1 196 ? 16.362  20.675  -25.908 1.00 16.21  ? 196 ASN B C   1 
ATOM   4240  O O   . ASN B 1 196 ? 16.020  21.644  -25.220 1.00 15.27  ? 196 ASN B O   1 
ATOM   4241  C CB  . ASN B 1 196 ? 15.787  18.421  -24.957 1.00 10.70  ? 196 ASN B CB  1 
ATOM   4242  C CG  . ASN B 1 196 ? 15.430  17.550  -26.143 1.00 27.59  ? 196 ASN B CG  1 
ATOM   4243  O OD1 . ASN B 1 196 ? 14.945  18.051  -27.160 1.00 19.47  ? 196 ASN B OD1 1 
ATOM   4244  N ND2 . ASN B 1 196 ? 15.512  16.225  -25.953 1.00 23.93  ? 196 ASN B ND2 1 
ATOM   4245  N N   . LEU B 1 197 ? 16.291  20.686  -27.238 1.00 11.97  ? 197 LEU B N   1 
ATOM   4246  C CA  . LEU B 1 197 ? 15.721  21.818  -27.943 1.00 11.20  ? 197 LEU B CA  1 
ATOM   4247  C C   . LEU B 1 197 ? 14.222  21.727  -27.817 1.00 12.33  ? 197 LEU B C   1 
ATOM   4248  O O   . LEU B 1 197 ? 13.532  22.708  -28.076 1.00 12.22  ? 197 LEU B O   1 
ATOM   4249  C CB  . LEU B 1 197 ? 16.067  21.727  -29.420 1.00 12.30  ? 197 LEU B CB  1 
ATOM   4250  C CG  . LEU B 1 197 ? 17.477  22.187  -29.772 1.00 15.67  ? 197 LEU B CG  1 
ATOM   4251  C CD1 . LEU B 1 197 ? 17.619  22.084  -31.276 1.00 14.61  ? 197 LEU B CD1 1 
ATOM   4252  C CD2 . LEU B 1 197 ? 17.741  23.616  -29.231 1.00 14.03  ? 197 LEU B CD2 1 
ATOM   4253  N N   . SER B 1 198 ? 13.743  20.508  -27.540 1.00 6.62   ? 198 SER B N   1 
ATOM   4254  C CA  . SER B 1 198 ? 12.323  20.195  -27.272 1.00 5.21   ? 198 SER B CA  1 
ATOM   4255  C C   . SER B 1 198 ? 11.317  20.398  -28.361 1.00 6.55   ? 198 SER B C   1 
ATOM   4256  O O   . SER B 1 198 ? 10.477  19.529  -28.603 1.00 4.91   ? 198 SER B O   1 
ATOM   4257  C CB  . SER B 1 198 ? 11.792  20.795  -25.968 1.00 8.21   ? 198 SER B CB  1 
ATOM   4258  O OG  . SER B 1 198 ? 12.548  20.377  -24.843 1.00 27.50  ? 198 SER B OG  1 
ATOM   4259  N N   . ALA B 1 199 ? 11.274  21.603  -28.906 1.00 5.45   ? 199 ALA B N   1 
ATOM   4260  C CA  . ALA B 1 199 ? 10.233  21.930  -29.904 1.00 7.13   ? 199 ALA B CA  1 
ATOM   4261  C C   . ALA B 1 199 ? 10.710  23.206  -30.574 1.00 16.01  ? 199 ALA B C   1 
ATOM   4262  O O   . ALA B 1 199 ? 11.573  23.866  -30.023 1.00 19.18  ? 199 ALA B O   1 
ATOM   4263  C CB  . ALA B 1 199 ? 8.813   22.129  -29.223 1.00 6.23   ? 199 ALA B CB  1 
ATOM   4264  N N   . PRO B 1 200 ? 10.253  23.482  -31.786 1.00 12.28  ? 200 PRO B N   1 
ATOM   4265  C CA  . PRO B 1 200 ? 10.696  24.670  -32.526 1.00 11.26  ? 200 PRO B CA  1 
ATOM   4266  C C   . PRO B 1 200 ? 10.360  25.915  -31.739 1.00 16.71  ? 200 PRO B C   1 
ATOM   4267  O O   . PRO B 1 200 ? 11.218  26.818  -31.608 1.00 17.37  ? 200 PRO B O   1 
ATOM   4268  C CB  . PRO B 1 200 ? 9.878   24.608  -33.857 1.00 12.13  ? 200 PRO B CB  1 
ATOM   4269  C CG  . PRO B 1 200 ? 9.577   23.129  -34.054 1.00 15.71  ? 200 PRO B CG  1 
ATOM   4270  C CD  . PRO B 1 200 ? 9.512   22.521  -32.640 1.00 12.96  ? 200 PRO B CD  1 
ATOM   4271  N N   . PHE B 1 201 ? 9.169   25.908  -31.127 1.00 14.78  ? 201 PHE B N   1 
ATOM   4272  C CA  . PHE B 1 201 ? 8.680   27.032  -30.321 1.00 15.08  ? 201 PHE B CA  1 
ATOM   4273  C C   . PHE B 1 201 ? 9.583   27.603  -29.223 1.00 18.91  ? 201 PHE B C   1 
ATOM   4274  O O   . PHE B 1 201 ? 9.458   28.769  -28.844 1.00 19.02  ? 201 PHE B O   1 
ATOM   4275  C CB  . PHE B 1 201 ? 7.247   26.794  -29.867 1.00 16.92  ? 201 PHE B CB  1 
ATOM   4276  C CG  . PHE B 1 201 ? 7.099   26.094  -28.539 1.00 17.22  ? 201 PHE B CG  1 
ATOM   4277  C CD1 . PHE B 1 201 ? 7.431   26.738  -27.341 1.00 20.32  ? 201 PHE B CD1 1 
ATOM   4278  C CD2 . PHE B 1 201 ? 6.362   24.904  -28.483 1.00 17.18  ? 201 PHE B CD2 1 
ATOM   4279  C CE1 . PHE B 1 201 ? 7.123   26.155  -26.101 1.00 20.31  ? 201 PHE B CE1 1 
ATOM   4280  C CE2 . PHE B 1 201 ? 6.033   24.324  -27.271 1.00 18.89  ? 201 PHE B CE2 1 
ATOM   4281  C CZ  . PHE B 1 201 ? 6.411   24.944  -26.070 1.00 17.51  ? 201 PHE B CZ  1 
ATOM   4282  N N   . ILE B 1 202 ? 10.531  26.793  -28.771 1.00 13.77  ? 202 ILE B N   1 
ATOM   4283  C CA  . ILE B 1 202 ? 11.517  27.218  -27.793 1.00 12.89  ? 202 ILE B CA  1 
ATOM   4284  C C   . ILE B 1 202 ? 12.616  28.034  -28.503 1.00 17.29  ? 202 ILE B C   1 
ATOM   4285  O O   . ILE B 1 202 ? 13.258  28.903  -27.948 1.00 15.08  ? 202 ILE B O   1 
ATOM   4286  C CB  . ILE B 1 202 ? 12.140  25.966  -27.126 1.00 14.51  ? 202 ILE B CB  1 
ATOM   4287  C CG1 . ILE B 1 202 ? 11.047  25.080  -26.498 1.00 14.16  ? 202 ILE B CG1 1 
ATOM   4288  C CG2 . ILE B 1 202 ? 13.311  26.338  -26.196 1.00 11.60  ? 202 ILE B CG2 1 
ATOM   4289  C CD1 . ILE B 1 202 ? 10.600  25.519  -25.137 1.00 16.97  ? 202 ILE B CD1 1 
ATOM   4290  N N   . SER B 1 203 ? 12.815  27.761  -29.772 1.00 18.05  ? 203 SER B N   1 
ATOM   4291  C CA  . SER B 1 203 ? 13.883  28.448  -30.503 1.00 19.89  ? 203 SER B CA  1 
ATOM   4292  C C   . SER B 1 203 ? 13.342  29.765  -30.988 1.00 26.04  ? 203 SER B C   1 
ATOM   4293  O O   . SER B 1 203 ? 14.082  30.749  -31.110 1.00 26.11  ? 203 SER B O   1 
ATOM   4294  C CB  . SER B 1 203 ? 14.336  27.631  -31.733 1.00 23.47  ? 203 SER B CB  1 
ATOM   4295  O OG  . SER B 1 203 ? 15.359  26.705  -31.408 1.00 35.81  ? 203 SER B OG  1 
ATOM   4296  N N   . GLN B 1 204 ? 12.036  29.759  -31.283 1.00 21.66  ? 204 GLN B N   1 
ATOM   4297  C CA  . GLN B 1 204 ? 11.320  30.931  -31.794 1.00 18.70  ? 204 GLN B CA  1 
ATOM   4298  C C   . GLN B 1 204 ? 10.934  31.973  -30.751 1.00 21.27  ? 204 GLN B C   1 
ATOM   4299  O O   . GLN B 1 204 ? 11.125  33.189  -30.977 1.00 23.49  ? 204 GLN B O   1 
ATOM   4300  C CB  . GLN B 1 204 ? 10.077  30.465  -32.495 1.00 19.40  ? 204 GLN B CB  1 
ATOM   4301  C CG  . GLN B 1 204 ? 10.351  29.410  -33.479 1.00 18.34  ? 204 GLN B CG  1 
ATOM   4302  C CD  . GLN B 1 204 ? 9.147   29.062  -34.257 1.00 33.01  ? 204 GLN B CD  1 
ATOM   4303  O OE1 . GLN B 1 204 ? 8.234   28.449  -33.719 1.00 24.66  ? 204 GLN B OE1 1 
ATOM   4304  N NE2 . GLN B 1 204 ? 9.204   29.269  -35.568 1.00 31.69  ? 204 GLN B NE2 1 
ATOM   4305  N N   . PHE B 1 205 ? 10.478  31.506  -29.586 1.00 14.09  ? 205 PHE B N   1 
ATOM   4306  C CA  . PHE B 1 205 ? 10.000  32.415  -28.556 1.00 12.14  ? 205 PHE B CA  1 
ATOM   4307  C C   . PHE B 1 205 ? 10.797  32.511  -27.262 1.00 18.66  ? 205 PHE B C   1 
ATOM   4308  O O   . PHE B 1 205 ? 10.604  33.423  -26.470 1.00 17.09  ? 205 PHE B O   1 
ATOM   4309  C CB  . PHE B 1 205 ? 8.514   32.202  -28.290 1.00 12.13  ? 205 PHE B CB  1 
ATOM   4310  C CG  . PHE B 1 205 ? 7.691   32.077  -29.524 1.00 14.17  ? 205 PHE B CG  1 
ATOM   4311  C CD1 . PHE B 1 205 ? 7.620   33.099  -30.435 1.00 15.86  ? 205 PHE B CD1 1 
ATOM   4312  C CD2 . PHE B 1 205 ? 6.941   30.915  -29.761 1.00 20.72  ? 205 PHE B CD2 1 
ATOM   4313  C CE1 . PHE B 1 205 ? 6.794   33.003  -31.564 1.00 17.25  ? 205 PHE B CE1 1 
ATOM   4314  C CE2 . PHE B 1 205 ? 6.118   30.811  -30.897 1.00 23.39  ? 205 PHE B CE2 1 
ATOM   4315  C CZ  . PHE B 1 205 ? 6.065   31.880  -31.806 1.00 19.28  ? 205 PHE B CZ  1 
ATOM   4316  N N   . TYR B 1 206 ? 11.700  31.567  -27.031 1.00 18.77  ? 206 TYR B N   1 
ATOM   4317  C CA  . TYR B 1 206 ? 12.476  31.572  -25.780 1.00 17.79  ? 206 TYR B CA  1 
ATOM   4318  C C   . TYR B 1 206 ? 13.967  31.527  -26.035 1.00 20.73  ? 206 TYR B C   1 
ATOM   4319  O O   . TYR B 1 206 ? 14.732  31.014  -25.236 1.00 19.98  ? 206 TYR B O   1 
ATOM   4320  C CB  . TYR B 1 206 ? 12.031  30.453  -24.830 1.00 17.30  ? 206 TYR B CB  1 
ATOM   4321  C CG  . TYR B 1 206 ? 10.529  30.429  -24.657 1.00 18.07  ? 206 TYR B CG  1 
ATOM   4322  C CD1 . TYR B 1 206 ? 9.708   30.192  -25.724 1.00 20.71  ? 206 TYR B CD1 1 
ATOM   4323  C CD2 . TYR B 1 206 ? 9.931   30.751  -23.453 1.00 18.22  ? 206 TYR B CD2 1 
ATOM   4324  C CE1 . TYR B 1 206 ? 8.357   30.198  -25.593 1.00 22.27  ? 206 TYR B CE1 1 
ATOM   4325  C CE2 . TYR B 1 206 ? 8.562   30.758  -23.313 1.00 16.61  ? 206 TYR B CE2 1 
ATOM   4326  C CZ  . TYR B 1 206 ? 7.793   30.497  -24.395 1.00 23.53  ? 206 TYR B CZ  1 
ATOM   4327  O OH  . TYR B 1 206 ? 6.412   30.479  -24.311 1.00 18.70  ? 206 TYR B OH  1 
ATOM   4328  N N   . LYS B 1 207 ? 14.394  32.135  -27.129 1.00 19.28  ? 207 LYS B N   1 
ATOM   4329  C CA  . LYS B 1 207 ? 15.804  32.103  -27.436 1.00 20.45  ? 207 LYS B CA  1 
ATOM   4330  C C   . LYS B 1 207 ? 16.613  32.739  -26.321 1.00 24.77  ? 207 LYS B C   1 
ATOM   4331  O O   . LYS B 1 207 ? 17.727  32.302  -26.009 1.00 23.72  ? 207 LYS B O   1 
ATOM   4332  C CB  . LYS B 1 207 ? 16.129  32.696  -28.816 1.00 23.03  ? 207 LYS B CB  1 
ATOM   4333  C CG  . LYS B 1 207 ? 15.069  33.630  -29.399 1.00 25.85  ? 207 LYS B CG  1 
ATOM   4334  C CD  . LYS B 1 207 ? 15.515  34.205  -30.766 1.00 24.84  ? 207 LYS B CD  1 
ATOM   4335  C CE  . LYS B 1 207 ? 14.527  33.877  -31.888 1.00 29.38  ? 207 LYS B CE  1 
ATOM   4336  N NZ  . LYS B 1 207 ? 14.856  34.701  -33.094 1.00 48.72  ? 207 LYS B NZ  1 
ATOM   4337  N N   . GLU B 1 208 ? 16.057  33.761  -25.688 1.00 22.38  ? 208 GLU B N   1 
ATOM   4338  C CA  . GLU B 1 208 ? 16.839  34.429  -24.649 1.00 24.25  ? 208 GLU B CA  1 
ATOM   4339  C C   . GLU B 1 208 ? 17.284  33.516  -23.492 1.00 27.43  ? 208 GLU B C   1 
ATOM   4340  O O   . GLU B 1 208 ? 18.478  33.413  -23.206 1.00 24.17  ? 208 GLU B O   1 
ATOM   4341  C CB  . GLU B 1 208 ? 16.155  35.691  -24.145 1.00 26.91  ? 208 GLU B CB  1 
ATOM   4342  C CG  . GLU B 1 208 ? 17.156  36.745  -23.653 1.00 42.98  ? 208 GLU B CG  1 
ATOM   4343  C CD  . GLU B 1 208 ? 16.478  37.956  -23.084 1.00 82.23  ? 208 GLU B CD  1 
ATOM   4344  O OE1 . GLU B 1 208 ? 15.850  38.698  -23.868 1.00 83.86  ? 208 GLU B OE1 1 
ATOM   4345  O OE2 . GLU B 1 208 ? 16.628  38.196  -21.869 1.00 91.66  ? 208 GLU B OE2 1 
ATOM   4346  N N   . SER B 1 209 ? 16.310  32.827  -22.876 1.00 24.97  ? 209 SER B N   1 
ATOM   4347  C CA  . SER B 1 209 ? 16.565  31.836  -21.829 1.00 24.11  ? 209 SER B CA  1 
ATOM   4348  C C   . SER B 1 209 ? 17.391  30.665  -22.390 1.00 28.31  ? 209 SER B C   1 
ATOM   4349  O O   . SER B 1 209 ? 18.276  30.129  -21.718 1.00 29.18  ? 209 SER B O   1 
ATOM   4350  C CB  . SER B 1 209 ? 15.239  31.301  -21.253 1.00 27.54  ? 209 SER B CB  1 
ATOM   4351  O OG  . SER B 1 209 ? 14.243  32.327  -21.045 1.00 24.81  ? 209 SER B OG  1 
ATOM   4352  N N   . LEU B 1 210 ? 17.137  30.298  -23.639 1.00 23.70  ? 210 LEU B N   1 
ATOM   4353  C CA  . LEU B 1 210 ? 17.887  29.213  -24.256 1.00 22.82  ? 210 LEU B CA  1 
ATOM   4354  C C   . LEU B 1 210 ? 19.372  29.545  -24.419 1.00 25.72  ? 210 LEU B C   1 
ATOM   4355  O O   . LEU B 1 210 ? 20.255  28.790  -23.988 1.00 28.74  ? 210 LEU B O   1 
ATOM   4356  C CB  . LEU B 1 210 ? 17.268  28.843  -25.610 1.00 22.29  ? 210 LEU B CB  1 
ATOM   4357  C CG  . LEU B 1 210 ? 17.961  27.708  -26.381 1.00 23.97  ? 210 LEU B CG  1 
ATOM   4358  C CD1 . LEU B 1 210 ? 17.779  26.420  -25.594 1.00 21.34  ? 210 LEU B CD1 1 
ATOM   4359  C CD2 . LEU B 1 210 ? 17.333  27.574  -27.780 1.00 26.16  ? 210 LEU B CD2 1 
ATOM   4360  N N   . MET B 1 211 ? 19.632  30.674  -25.056 1.00 18.91  ? 211 MET B N   1 
ATOM   4361  C CA  . MET B 1 211 ? 20.987  31.109  -25.349 1.00 16.90  ? 211 MET B CA  1 
ATOM   4362  C C   . MET B 1 211 ? 21.708  31.568  -24.108 1.00 19.94  ? 211 MET B C   1 
ATOM   4363  O O   . MET B 1 211 ? 22.910  31.743  -24.096 1.00 23.14  ? 211 MET B O   1 
ATOM   4364  C CB  . MET B 1 211 ? 20.966  32.185  -26.434 1.00 18.33  ? 211 MET B CB  1 
ATOM   4365  C CG  . MET B 1 211 ? 20.622  31.630  -27.827 1.00 21.35  ? 211 MET B CG  1 
ATOM   4366  S SD  . MET B 1 211 ? 21.667  30.219  -28.289 1.00 26.27  ? 211 MET B SD  1 
ATOM   4367  C CE  . MET B 1 211 ? 23.172  30.982  -28.663 1.00 21.47  ? 211 MET B CE  1 
ATOM   4368  N N   . LYS B 1 212 ? 20.981  31.708  -23.027 1.00 15.78  ? 212 LYS B N   1 
ATOM   4369  C CA  . LYS B 1 212 ? 21.599  32.117  -21.770 1.00 15.23  ? 212 LYS B CA  1 
ATOM   4370  C C   . LYS B 1 212 ? 22.088  30.853  -21.092 1.00 21.20  ? 212 LYS B C   1 
ATOM   4371  O O   . LYS B 1 212 ? 23.029  30.866  -20.287 1.00 22.77  ? 212 LYS B O   1 
ATOM   4372  C CB  . LYS B 1 212 ? 20.594  32.880  -20.858 1.00 14.19  ? 212 LYS B CB  1 
ATOM   4373  C CG  . LYS B 1 212 ? 21.260  34.019  -20.136 1.00 21.74  ? 212 LYS B CG  1 
ATOM   4374  C CD  . LYS B 1 212 ? 20.282  34.932  -19.463 1.00 46.44  ? 212 LYS B CD  1 
ATOM   4375  C CE  . LYS B 1 212 ? 19.886  36.106  -20.348 1.00 53.69  ? 212 LYS B CE  1 
ATOM   4376  N NZ  . LYS B 1 212 ? 18.392  36.348  -20.345 1.00 45.66  ? 212 LYS B NZ  1 
ATOM   4377  N N   . VAL B 1 213 ? 21.448  29.743  -21.437 1.00 16.17  ? 213 VAL B N   1 
ATOM   4378  C CA  . VAL B 1 213 ? 21.807  28.468  -20.842 1.00 15.62  ? 213 VAL B CA  1 
ATOM   4379  C C   . VAL B 1 213 ? 22.805  27.698  -21.725 1.00 20.62  ? 213 VAL B C   1 
ATOM   4380  O O   . VAL B 1 213 ? 23.651  26.923  -21.223 1.00 19.79  ? 213 VAL B O   1 
ATOM   4381  C CB  . VAL B 1 213 ? 20.542  27.610  -20.607 1.00 18.26  ? 213 VAL B CB  1 
ATOM   4382  C CG1 . VAL B 1 213 ? 20.898  26.293  -19.928 1.00 17.19  ? 213 VAL B CG1 1 
ATOM   4383  C CG2 . VAL B 1 213 ? 19.444  28.424  -19.818 1.00 17.32  ? 213 VAL B CG2 1 
ATOM   4384  N N   . MET B 1 214 ? 22.693  27.906  -23.041 1.00 14.44  ? 214 MET B N   1 
ATOM   4385  C CA  . MET B 1 214 ? 23.539  27.202  -23.987 1.00 12.80  ? 214 MET B CA  1 
ATOM   4386  C C   . MET B 1 214 ? 25.021  27.133  -23.644 1.00 21.79  ? 214 MET B C   1 
ATOM   4387  O O   . MET B 1 214 ? 25.711  26.167  -23.996 1.00 21.86  ? 214 MET B O   1 
ATOM   4388  C CB  . MET B 1 214 ? 23.378  27.752  -25.393 1.00 13.90  ? 214 MET B CB  1 
ATOM   4389  C CG  . MET B 1 214 ? 24.101  26.905  -26.444 1.00 15.20  ? 214 MET B CG  1 
ATOM   4390  S SD  . MET B 1 214 ? 23.181  25.405  -26.872 1.00 17.01  ? 214 MET B SD  1 
ATOM   4391  C CE  . MET B 1 214 ? 21.487  26.127  -27.183 1.00 11.45  ? 214 MET B CE  1 
ATOM   4392  N N   . PRO B 1 215 ? 25.556  28.198  -23.052 1.00 19.56  ? 215 PRO B N   1 
ATOM   4393  C CA  . PRO B 1 215 ? 26.980  28.175  -22.772 1.00 17.98  ? 215 PRO B CA  1 
ATOM   4394  C C   . PRO B 1 215 ? 27.348  27.146  -21.718 1.00 22.43  ? 215 PRO B C   1 
ATOM   4395  O O   . PRO B 1 215 ? 28.538  26.898  -21.505 1.00 22.49  ? 215 PRO B O   1 
ATOM   4396  C CB  . PRO B 1 215 ? 27.255  29.587  -22.288 1.00 18.81  ? 215 PRO B CB  1 
ATOM   4397  C CG  . PRO B 1 215 ? 26.249  30.441  -23.022 1.00 21.64  ? 215 PRO B CG  1 
ATOM   4398  C CD  . PRO B 1 215 ? 25.072  29.574  -23.313 1.00 18.42  ? 215 PRO B CD  1 
ATOM   4399  N N   . TYR B 1 216 ? 26.344  26.552  -21.065 1.00 18.88  ? 216 TYR B N   1 
ATOM   4400  C CA  . TYR B 1 216 ? 26.573  25.566  -20.002 1.00 17.59  ? 216 TYR B CA  1 
ATOM   4401  C C   . TYR B 1 216 ? 26.295  24.133  -20.472 1.00 23.71  ? 216 TYR B C   1 
ATOM   4402  O O   . TYR B 1 216 ? 26.709  23.160  -19.853 1.00 26.81  ? 216 TYR B O   1 
ATOM   4403  C CB  . TYR B 1 216 ? 25.709  25.878  -18.793 1.00 18.01  ? 216 TYR B CB  1 
ATOM   4404  C CG  . TYR B 1 216 ? 26.062  27.167  -18.043 1.00 20.56  ? 216 TYR B CG  1 
ATOM   4405  C CD1 . TYR B 1 216 ? 25.233  28.272  -18.100 1.00 22.06  ? 216 TYR B CD1 1 
ATOM   4406  C CD2 . TYR B 1 216 ? 27.138  27.218  -17.164 1.00 21.13  ? 216 TYR B CD2 1 
ATOM   4407  C CE1 . TYR B 1 216 ? 25.491  29.379  -17.369 1.00 22.67  ? 216 TYR B CE1 1 
ATOM   4408  C CE2 . TYR B 1 216 ? 27.429  28.365  -16.458 1.00 21.46  ? 216 TYR B CE2 1 
ATOM   4409  C CZ  . TYR B 1 216 ? 26.602  29.439  -16.553 1.00 26.30  ? 216 TYR B CZ  1 
ATOM   4410  O OH  . TYR B 1 216 ? 26.841  30.591  -15.820 1.00 25.31  ? 216 TYR B OH  1 
ATOM   4411  N N   . VAL B 1 217 ? 25.645  24.015  -21.616 1.00 17.93  ? 217 VAL B N   1 
ATOM   4412  C CA  . VAL B 1 217 ? 25.242  22.730  -22.155 1.00 14.64  ? 217 VAL B CA  1 
ATOM   4413  C C   . VAL B 1 217 ? 26.413  21.931  -22.657 1.00 17.51  ? 217 VAL B C   1 
ATOM   4414  O O   . VAL B 1 217 ? 27.039  22.313  -23.648 1.00 18.03  ? 217 VAL B O   1 
ATOM   4415  C CB  . VAL B 1 217 ? 24.222  22.949  -23.288 1.00 14.43  ? 217 VAL B CB  1 
ATOM   4416  C CG1 . VAL B 1 217 ? 23.698  21.598  -23.822 1.00 13.40  ? 217 VAL B CG1 1 
ATOM   4417  C CG2 . VAL B 1 217 ? 23.103  23.818  -22.754 1.00 12.79  ? 217 VAL B CG2 1 
ATOM   4418  N N   . ASP B 1 218 ? 26.697  20.819  -21.974 1.00 12.92  ? 218 ASP B N   1 
ATOM   4419  C CA  . ASP B 1 218 ? 27.775  19.878  -22.350 1.00 11.69  ? 218 ASP B CA  1 
ATOM   4420  C C   . ASP B 1 218 ? 27.242  19.002  -23.506 1.00 16.99  ? 218 ASP B C   1 
ATOM   4421  O O   . ASP B 1 218 ? 27.896  18.824  -24.538 1.00 15.16  ? 218 ASP B O   1 
ATOM   4422  C CB  . ASP B 1 218 ? 28.198  19.023  -21.129 1.00 12.23  ? 218 ASP B CB  1 
ATOM   4423  C CG  . ASP B 1 218 ? 29.012  19.826  -20.109 1.00 28.47  ? 218 ASP B CG  1 
ATOM   4424  O OD1 . ASP B 1 218 ? 30.046  20.389  -20.533 1.00 33.05  ? 218 ASP B OD1 1 
ATOM   4425  O OD2 . ASP B 1 218 ? 28.585  20.029  -18.936 1.00 32.37  ? 218 ASP B OD2 1 
ATOM   4426  N N   . ILE B 1 219 ? 25.978  18.599  -23.394 1.00 14.92  ? 219 ILE B N   1 
ATOM   4427  C CA  . ILE B 1 219 ? 25.337  17.851  -24.467 1.00 13.64  ? 219 ILE B CA  1 
ATOM   4428  C C   . ILE B 1 219 ? 23.978  18.440  -24.866 1.00 12.73  ? 219 ILE B C   1 
ATOM   4429  O O   . ILE B 1 219 ? 23.085  18.546  -24.052 1.00 8.21   ? 219 ILE B O   1 
ATOM   4430  C CB  . ILE B 1 219 ? 25.225  16.317  -24.154 1.00 16.03  ? 219 ILE B CB  1 
ATOM   4431  C CG1 . ILE B 1 219 ? 26.559  15.795  -23.599 1.00 15.03  ? 219 ILE B CG1 1 
ATOM   4432  C CG2 . ILE B 1 219 ? 24.908  15.517  -25.449 1.00 14.21  ? 219 ILE B CG2 1 
ATOM   4433  C CD1 . ILE B 1 219 ? 26.658  14.258  -23.585 1.00 3.76   ? 219 ILE B CD1 1 
ATOM   4434  N N   . LEU B 1 220 ? 23.828  18.790  -26.148 1.00 12.26  ? 220 LEU B N   1 
ATOM   4435  C CA  . LEU B 1 220 ? 22.531  19.266  -26.669 1.00 11.89  ? 220 LEU B CA  1 
ATOM   4436  C C   . LEU B 1 220 ? 21.854  18.207  -27.509 1.00 18.16  ? 220 LEU B C   1 
ATOM   4437  O O   . LEU B 1 220 ? 22.424  17.728  -28.474 1.00 20.82  ? 220 LEU B O   1 
ATOM   4438  C CB  . LEU B 1 220 ? 22.660  20.531  -27.529 1.00 10.56  ? 220 LEU B CB  1 
ATOM   4439  C CG  . LEU B 1 220 ? 21.354  21.270  -27.915 1.00 10.16  ? 220 LEU B CG  1 
ATOM   4440  C CD1 . LEU B 1 220 ? 20.712  21.976  -26.689 1.00 7.52   ? 220 LEU B CD1 1 
ATOM   4441  C CD2 . LEU B 1 220 ? 21.640  22.303  -28.991 1.00 4.69   ? 220 LEU B CD2 1 
ATOM   4442  N N   . PHE B 1 221 ? 20.616  17.885  -27.162 1.00 13.65  ? 221 PHE B N   1 
ATOM   4443  C CA  . PHE B 1 221 ? 19.804  16.972  -27.947 1.00 11.68  ? 221 PHE B CA  1 
ATOM   4444  C C   . PHE B 1 221 ? 18.721  17.775  -28.709 1.00 15.39  ? 221 PHE B C   1 
ATOM   4445  O O   . PHE B 1 221 ? 18.406  18.932  -28.391 1.00 12.82  ? 221 PHE B O   1 
ATOM   4446  C CB  . PHE B 1 221 ? 19.077  16.013  -27.016 1.00 12.29  ? 221 PHE B CB  1 
ATOM   4447  C CG  . PHE B 1 221 ? 19.969  15.151  -26.199 1.00 13.31  ? 221 PHE B CG  1 
ATOM   4448  C CD1 . PHE B 1 221 ? 20.210  15.459  -24.869 1.00 15.85  ? 221 PHE B CD1 1 
ATOM   4449  C CD2 . PHE B 1 221 ? 20.397  13.921  -26.684 1.00 16.72  ? 221 PHE B CD2 1 
ATOM   4450  C CE1 . PHE B 1 221 ? 20.934  14.605  -24.043 1.00 15.79  ? 221 PHE B CE1 1 
ATOM   4451  C CE2 . PHE B 1 221 ? 21.182  13.077  -25.881 1.00 19.57  ? 221 PHE B CE2 1 
ATOM   4452  C CZ  . PHE B 1 221 ? 21.423  13.417  -24.547 1.00 16.80  ? 221 PHE B CZ  1 
ATOM   4453  N N   . GLY B 1 222 ? 18.060  17.090  -29.631 1.00 15.73  ? 222 GLY B N   1 
ATOM   4454  C CA  . GLY B 1 222 ? 16.931  17.647  -30.390 1.00 16.20  ? 222 GLY B CA  1 
ATOM   4455  C C   . GLY B 1 222 ? 16.771  16.853  -31.664 1.00 20.35  ? 222 GLY B C   1 
ATOM   4456  O O   . GLY B 1 222 ? 17.591  15.981  -31.956 1.00 18.25  ? 222 GLY B O   1 
ATOM   4457  N N   . ASN B 1 223 ? 15.698  17.121  -32.403 1.00 18.19  ? 223 ASN B N   1 
ATOM   4458  C CA  . ASN B 1 223 ? 15.442  16.405  -33.649 1.00 15.94  ? 223 ASN B CA  1 
ATOM   4459  C C   . ASN B 1 223 ? 15.790  17.271  -34.845 1.00 17.70  ? 223 ASN B C   1 
ATOM   4460  O O   . ASN B 1 223 ? 16.378  18.350  -34.687 1.00 14.95  ? 223 ASN B O   1 
ATOM   4461  C CB  . ASN B 1 223 ? 13.997  15.894  -33.665 1.00 17.90  ? 223 ASN B CB  1 
ATOM   4462  C CG  . ASN B 1 223 ? 12.946  17.014  -33.795 1.00 27.37  ? 223 ASN B CG  1 
ATOM   4463  O OD1 . ASN B 1 223 ? 11.746  16.763  -33.707 1.00 24.00  ? 223 ASN B OD1 1 
ATOM   4464  N ND2 . ASN B 1 223 ? 13.380  18.190  -34.144 1.00 16.64  ? 223 ASN B ND2 1 
ATOM   4465  N N   . GLU B 1 224 ? 15.408  16.844  -36.043 1.00 15.72  ? 224 GLU B N   1 
ATOM   4466  C CA  . GLU B 1 224 ? 15.752  17.657  -37.219 1.00 16.39  ? 224 GLU B CA  1 
ATOM   4467  C C   . GLU B 1 224 ? 14.988  18.970  -37.335 1.00 21.85  ? 224 GLU B C   1 
ATOM   4468  O O   . GLU B 1 224 ? 15.561  19.957  -37.774 1.00 24.24  ? 224 GLU B O   1 
ATOM   4469  C CB  . GLU B 1 224 ? 15.587  16.879  -38.507 1.00 17.85  ? 224 GLU B CB  1 
ATOM   4470  C CG  . GLU B 1 224 ? 14.960  15.496  -38.307 1.00 34.13  ? 224 GLU B CG  1 
ATOM   4471  C CD  . GLU B 1 224 ? 13.463  15.553  -38.219 1.00 52.11  ? 224 GLU B CD  1 
ATOM   4472  O OE1 . GLU B 1 224 ? 12.828  15.965  -39.213 1.00 51.22  ? 224 GLU B OE1 1 
ATOM   4473  O OE2 . GLU B 1 224 ? 12.927  15.289  -37.118 1.00 46.58  ? 224 GLU B OE2 1 
ATOM   4474  N N   . THR B 1 225 ? 13.688  18.974  -37.031 1.00 16.72  ? 225 THR B N   1 
ATOM   4475  C CA  . THR B 1 225 ? 12.881  20.185  -37.164 1.00 16.06  ? 225 THR B CA  1 
ATOM   4476  C C   . THR B 1 225 ? 13.333  21.212  -36.120 1.00 18.68  ? 225 THR B C   1 
ATOM   4477  O O   . THR B 1 225 ? 13.438  22.409  -36.400 1.00 21.16  ? 225 THR B O   1 
ATOM   4478  C CB  . THR B 1 225 ? 11.333  19.919  -37.056 1.00 27.73  ? 225 THR B CB  1 
ATOM   4479  O OG1 . THR B 1 225 ? 11.073  19.132  -35.894 1.00 38.05  ? 225 THR B OG1 1 
ATOM   4480  C CG2 . THR B 1 225 ? 10.775  19.148  -38.269 1.00 22.74  ? 225 THR B CG2 1 
ATOM   4481  N N   . GLU B 1 226 ? 13.724  20.733  -34.948 1.00 10.74  ? 226 GLU B N   1 
ATOM   4482  C CA  . GLU B 1 226 ? 14.172  21.625  -33.894 1.00 10.69  ? 226 GLU B CA  1 
ATOM   4483  C C   . GLU B 1 226 ? 15.513  22.258  -34.217 1.00 16.82  ? 226 GLU B C   1 
ATOM   4484  O O   . GLU B 1 226 ? 15.720  23.445  -33.957 1.00 15.85  ? 226 GLU B O   1 
ATOM   4485  C CB  . GLU B 1 226 ? 14.156  20.933  -32.509 1.00 11.82  ? 226 GLU B CB  1 
ATOM   4486  C CG  . GLU B 1 226 ? 12.709  20.617  -31.999 1.00 13.74  ? 226 GLU B CG  1 
ATOM   4487  C CD  . GLU B 1 226 ? 12.614  19.274  -31.296 1.00 26.37  ? 226 GLU B CD  1 
ATOM   4488  O OE1 . GLU B 1 226 ? 11.474  18.770  -31.160 1.00 23.80  ? 226 GLU B OE1 1 
ATOM   4489  O OE2 . GLU B 1 226 ? 13.674  18.697  -30.939 1.00 12.63  ? 226 GLU B OE2 1 
ATOM   4490  N N   . ALA B 1 227 ? 16.409  21.447  -34.777 1.00 14.46  ? 227 ALA B N   1 
ATOM   4491  C CA  . ALA B 1 227 ? 17.746  21.875  -35.189 1.00 13.50  ? 227 ALA B CA  1 
ATOM   4492  C C   . ALA B 1 227 ? 17.634  22.890  -36.314 1.00 17.57  ? 227 ALA B C   1 
ATOM   4493  O O   . ALA B 1 227 ? 18.443  23.833  -36.364 1.00 16.10  ? 227 ALA B O   1 
ATOM   4494  C CB  . ALA B 1 227 ? 18.602  20.665  -35.652 1.00 13.89  ? 227 ALA B CB  1 
ATOM   4495  N N   . ALA B 1 228 ? 16.681  22.666  -37.241 1.00 13.11  ? 228 ALA B N   1 
ATOM   4496  C CA  . ALA B 1 228 ? 16.468  23.580  -38.375 1.00 12.02  ? 228 ALA B CA  1 
ATOM   4497  C C   . ALA B 1 228 ? 16.014  24.917  -37.840 1.00 20.89  ? 228 ALA B C   1 
ATOM   4498  O O   . ALA B 1 228 ? 16.620  25.965  -38.114 1.00 22.57  ? 228 ALA B O   1 
ATOM   4499  C CB  . ALA B 1 228 ? 15.443  23.056  -39.320 1.00 12.12  ? 228 ALA B CB  1 
ATOM   4500  N N   . THR B 1 229 ? 14.955  24.876  -37.035 1.00 18.37  ? 229 THR B N   1 
ATOM   4501  C CA  . THR B 1 229 ? 14.432  26.097  -36.414 1.00 17.46  ? 229 THR B CA  1 
ATOM   4502  C C   . THR B 1 229 ? 15.514  26.837  -35.654 1.00 22.29  ? 229 THR B C   1 
ATOM   4503  O O   . THR B 1 229 ? 15.578  28.056  -35.675 1.00 23.05  ? 229 THR B O   1 
ATOM   4504  C CB  . THR B 1 229 ? 13.332  25.810  -35.394 1.00 14.83  ? 229 THR B CB  1 
ATOM   4505  O OG1 . THR B 1 229 ? 12.334  24.931  -35.952 1.00 5.47   ? 229 THR B OG1 1 
ATOM   4506  C CG2 . THR B 1 229 ? 12.711  27.153  -34.930 1.00 14.64  ? 229 THR B CG2 1 
ATOM   4507  N N   . PHE B 1 230 ? 16.311  26.099  -34.898 1.00 19.32  ? 230 PHE B N   1 
ATOM   4508  C CA  . PHE B 1 230 ? 17.315  26.727  -34.051 1.00 18.70  ? 230 PHE B CA  1 
ATOM   4509  C C   . PHE B 1 230 ? 18.301  27.451  -34.939 1.00 27.33  ? 230 PHE B C   1 
ATOM   4510  O O   . PHE B 1 230 ? 18.630  28.616  -34.677 1.00 29.04  ? 230 PHE B O   1 
ATOM   4511  C CB  . PHE B 1 230 ? 17.994  25.681  -33.159 1.00 19.31  ? 230 PHE B CB  1 
ATOM   4512  C CG  . PHE B 1 230 ? 19.098  26.229  -32.326 1.00 20.04  ? 230 PHE B CG  1 
ATOM   4513  C CD1 . PHE B 1 230 ? 18.814  27.009  -31.213 1.00 21.51  ? 230 PHE B CD1 1 
ATOM   4514  C CD2 . PHE B 1 230 ? 20.438  25.966  -32.633 1.00 21.10  ? 230 PHE B CD2 1 
ATOM   4515  C CE1 . PHE B 1 230 ? 19.827  27.502  -30.440 1.00 20.24  ? 230 PHE B CE1 1 
ATOM   4516  C CE2 . PHE B 1 230 ? 21.462  26.499  -31.850 1.00 21.16  ? 230 PHE B CE2 1 
ATOM   4517  C CZ  . PHE B 1 230 ? 21.149  27.232  -30.758 1.00 18.47  ? 230 PHE B CZ  1 
ATOM   4518  N N   . ALA B 1 231 ? 18.706  26.793  -36.032 1.00 24.15  ? 231 ALA B N   1 
ATOM   4519  C CA  . ALA B 1 231 ? 19.632  27.370  -37.000 1.00 22.71  ? 231 ALA B CA  1 
ATOM   4520  C C   . ALA B 1 231 ? 19.091  28.718  -37.494 1.00 29.22  ? 231 ALA B C   1 
ATOM   4521  O O   . ALA B 1 231 ? 19.744  29.776  -37.404 1.00 30.28  ? 231 ALA B O   1 
ATOM   4522  C CB  . ALA B 1 231 ? 19.757  26.448  -38.154 1.00 23.13  ? 231 ALA B CB  1 
ATOM   4523  N N   . ARG B 1 232 ? 17.897  28.673  -38.062 1.00 25.05  ? 232 ARG B N   1 
ATOM   4524  C CA  . ARG B 1 232 ? 17.296  29.873  -38.616 1.00 23.39  ? 232 ARG B CA  1 
ATOM   4525  C C   . ARG B 1 232 ? 17.243  31.033  -37.610 1.00 27.00  ? 232 ARG B C   1 
ATOM   4526  O O   . ARG B 1 232 ? 17.603  32.178  -37.923 1.00 25.62  ? 232 ARG B O   1 
ATOM   4527  C CB  . ARG B 1 232 ? 15.915  29.550  -39.173 1.00 18.65  ? 232 ARG B CB  1 
ATOM   4528  C CG  . ARG B 1 232 ? 15.273  30.736  -39.826 1.00 36.39  ? 232 ARG B CG  1 
ATOM   4529  C CD  . ARG B 1 232 ? 13.881  30.424  -40.185 1.00 60.20  ? 232 ARG B CD  1 
ATOM   4530  N NE  . ARG B 1 232 ? 13.868  29.663  -41.417 1.00 85.29  ? 232 ARG B NE  1 
ATOM   4531  C CZ  . ARG B 1 232 ? 12.759  29.341  -42.066 1.00 116.84 ? 232 ARG B CZ  1 
ATOM   4532  N NH1 . ARG B 1 232 ? 11.580  29.716  -41.582 1.00 115.09 ? 232 ARG B NH1 1 
ATOM   4533  N NH2 . ARG B 1 232 ? 12.829  28.651  -43.198 1.00 105.76 ? 232 ARG B NH2 1 
ATOM   4534  N N   . GLU B 1 233 ? 16.781  30.722  -36.403 1.00 23.43  ? 233 GLU B N   1 
ATOM   4535  C CA  . GLU B 1 233 ? 16.634  31.709  -35.353 1.00 22.21  ? 233 GLU B CA  1 
ATOM   4536  C C   . GLU B 1 233 ? 17.984  32.244  -34.922 1.00 27.80  ? 233 GLU B C   1 
ATOM   4537  O O   . GLU B 1 233 ? 18.094  33.367  -34.447 1.00 28.14  ? 233 GLU B O   1 
ATOM   4538  C CB  . GLU B 1 233 ? 15.886  31.097  -34.173 1.00 22.74  ? 233 GLU B CB  1 
ATOM   4539  C CG  . GLU B 1 233 ? 14.451  30.696  -34.505 1.00 30.47  ? 233 GLU B CG  1 
ATOM   4540  C CD  . GLU B 1 233 ? 13.600  31.875  -34.963 1.00 48.87  ? 233 GLU B CD  1 
ATOM   4541  O OE1 . GLU B 1 233 ? 12.744  31.699  -35.860 1.00 27.00  ? 233 GLU B OE1 1 
ATOM   4542  O OE2 . GLU B 1 233 ? 13.791  32.989  -34.425 1.00 46.34  ? 233 GLU B OE2 1 
ATOM   4543  N N   . GLN B 1 234 ? 19.027  31.430  -35.056 1.00 25.34  ? 234 GLN B N   1 
ATOM   4544  C CA  . GLN B 1 234 ? 20.363  31.886  -34.632 1.00 24.56  ? 234 GLN B CA  1 
ATOM   4545  C C   . GLN B 1 234 ? 21.179  32.554  -35.724 1.00 26.56  ? 234 GLN B C   1 
ATOM   4546  O O   . GLN B 1 234 ? 22.336  32.868  -35.481 1.00 25.92  ? 234 GLN B O   1 
ATOM   4547  C CB  . GLN B 1 234 ? 21.190  30.713  -34.064 1.00 25.57  ? 234 GLN B CB  1 
ATOM   4548  C CG  . GLN B 1 234 ? 20.819  30.250  -32.639 1.00 39.29  ? 234 GLN B CG  1 
ATOM   4549  C CD  . GLN B 1 234 ? 20.673  31.400  -31.633 1.00 47.07  ? 234 GLN B CD  1 
ATOM   4550  O OE1 . GLN B 1 234 ? 19.572  31.682  -31.186 1.00 44.55  ? 234 GLN B OE1 1 
ATOM   4551  N NE2 . GLN B 1 234 ? 21.785  32.020  -31.241 1.00 31.28  ? 234 GLN B NE2 1 
ATOM   4552  N N   . GLY B 1 235 ? 20.651  32.643  -36.948 1.00 23.69  ? 235 GLY B N   1 
ATOM   4553  C CA  . GLY B 1 235 ? 21.406  33.137  -38.099 1.00 24.34  ? 235 GLY B CA  1 
ATOM   4554  C C   . GLY B 1 235 ? 22.561  32.204  -38.597 1.00 32.80  ? 235 GLY B C   1 
ATOM   4555  O O   . GLY B 1 235 ? 23.612  32.696  -39.050 1.00 33.96  ? 235 GLY B O   1 
ATOM   4556  N N   . PHE B 1 236 ? 22.381  30.880  -38.500 1.00 27.48  ? 236 PHE B N   1 
ATOM   4557  C CA  . PHE B 1 236 ? 23.316  29.870  -38.979 1.00 25.68  ? 236 PHE B CA  1 
ATOM   4558  C C   . PHE B 1 236 ? 23.422  29.877  -40.506 1.00 33.26  ? 236 PHE B C   1 
ATOM   4559  O O   . PHE B 1 236 ? 24.461  29.597  -41.090 1.00 31.26  ? 236 PHE B O   1 
ATOM   4560  C CB  . PHE B 1 236 ? 22.829  28.506  -38.492 1.00 25.43  ? 236 PHE B CB  1 
ATOM   4561  C CG  . PHE B 1 236 ? 23.337  28.256  -37.103 1.00 23.92  ? 236 PHE B CG  1 
ATOM   4562  C CD1 . PHE B 1 236 ? 23.862  29.309  -36.362 1.00 24.49  ? 236 PHE B CD1 1 
ATOM   4563  C CD2 . PHE B 1 236 ? 23.304  26.976  -36.574 1.00 22.96  ? 236 PHE B CD2 1 
ATOM   4564  C CE1 . PHE B 1 236 ? 24.355  29.075  -35.086 1.00 23.98  ? 236 PHE B CE1 1 
ATOM   4565  C CE2 . PHE B 1 236 ? 23.798  26.751  -35.292 1.00 22.23  ? 236 PHE B CE2 1 
ATOM   4566  C CZ  . PHE B 1 236 ? 24.324  27.797  -34.545 1.00 21.32  ? 236 PHE B CZ  1 
ATOM   4567  N N   . GLU B 1 237 ? 22.281  30.170  -41.157 1.00 33.25  ? 237 GLU B N   1 
ATOM   4568  C CA  . GLU B 1 237 ? 22.287  30.256  -42.614 1.00 34.24  ? 237 GLU B CA  1 
ATOM   4569  C C   . GLU B 1 237 ? 22.645  28.915  -43.260 1.00 39.24  ? 237 GLU B C   1 
ATOM   4570  O O   . GLU B 1 237 ? 23.492  28.818  -44.139 1.00 42.67  ? 237 GLU B O   1 
ATOM   4571  C CB  . GLU B 1 237 ? 23.312  31.315  -43.020 1.00 35.95  ? 237 GLU B CB  1 
ATOM   4572  C CG  . GLU B 1 237 ? 22.974  32.699  -42.465 1.00 40.68  ? 237 GLU B CG  1 
ATOM   4573  C CD  . GLU B 1 237 ? 22.028  33.401  -43.412 1.00 77.47  ? 237 GLU B CD  1 
ATOM   4574  O OE1 . GLU B 1 237 ? 20.896  32.957  -43.546 1.00 81.44  ? 237 GLU B OE1 1 
ATOM   4575  O OE2 . GLU B 1 237 ? 22.436  34.393  -44.015 1.00 76.17  ? 237 GLU B OE2 1 
ATOM   4576  N N   . THR B 1 238 ? 21.990  27.850  -42.765 1.00 32.31  ? 238 THR B N   1 
ATOM   4577  C CA  . THR B 1 238 ? 22.265  26.525  -43.307 1.00 30.92  ? 238 THR B CA  1 
ATOM   4578  C C   . THR B 1 238 ? 21.143  25.538  -42.979 1.00 31.56  ? 238 THR B C   1 
ATOM   4579  O O   . THR B 1 238 ? 20.587  25.526  -41.889 1.00 31.35  ? 238 THR B O   1 
ATOM   4580  C CB  . THR B 1 238 ? 23.585  26.033  -42.714 1.00 35.26  ? 238 THR B CB  1 
ATOM   4581  O OG1 . THR B 1 238 ? 23.758  24.652  -43.039 1.00 37.71  ? 238 THR B OG1 1 
ATOM   4582  C CG2 . THR B 1 238 ? 23.562  26.181  -41.190 1.00 29.23  ? 238 THR B CG2 1 
ATOM   4583  N N   . LYS B 1 239 ? 20.650  24.742  -43.910 1.00 26.86  ? 239 LYS B N   1 
ATOM   4584  C CA  . LYS B 1 239 ? 19.579  23.784  -43.632 1.00 25.55  ? 239 LYS B CA  1 
ATOM   4585  C C   . LYS B 1 239 ? 20.230  22.448  -43.524 1.00 25.43  ? 239 LYS B C   1 
ATOM   4586  O O   . LYS B 1 239 ? 19.546  21.455  -43.651 1.00 25.98  ? 239 LYS B O   1 
ATOM   4587  C CB  . LYS B 1 239 ? 18.602  23.674  -44.813 1.00 27.54  ? 239 LYS B CB  1 
ATOM   4588  C CG  . LYS B 1 239 ? 17.861  24.948  -45.161 1.00 50.41  ? 239 LYS B CG  1 
ATOM   4589  C CD  . LYS B 1 239 ? 17.062  24.787  -46.475 1.00 62.77  ? 239 LYS B CD  1 
ATOM   4590  C CE  . LYS B 1 239 ? 16.028  25.915  -46.642 1.00 64.84  ? 239 LYS B CE  1 
ATOM   4591  N NZ  . LYS B 1 239 ? 15.262  25.822  -47.923 1.00 72.04  ? 239 LYS B NZ  1 
ATOM   4592  N N   . ASP B 1 240 ? 21.555  22.425  -43.511 1.00 20.79  ? 240 ASP B N   1 
ATOM   4593  C CA  . ASP B 1 240 ? 22.270  21.158  -43.510 1.00 20.66  ? 240 ASP B CA  1 
ATOM   4594  C C   . ASP B 1 240 ? 22.435  20.709  -42.060 1.00 23.28  ? 240 ASP B C   1 
ATOM   4595  O O   . ASP B 1 240 ? 22.915  21.454  -41.208 1.00 19.88  ? 240 ASP B O   1 
ATOM   4596  C CB  . ASP B 1 240 ? 23.614  21.286  -44.248 1.00 22.71  ? 240 ASP B CB  1 
ATOM   4597  C CG  . ASP B 1 240 ? 24.437  20.007  -44.201 1.00 25.15  ? 240 ASP B CG  1 
ATOM   4598  O OD1 . ASP B 1 240 ? 25.343  19.954  -43.364 1.00 27.64  ? 240 ASP B OD1 1 
ATOM   4599  O OD2 . ASP B 1 240 ? 24.088  19.022  -44.888 1.00 20.32  ? 240 ASP B OD2 1 
ATOM   4600  N N   . ILE B 1 241 ? 21.926  19.522  -41.766 1.00 22.90  ? 241 ILE B N   1 
ATOM   4601  C CA  . ILE B 1 241 ? 21.925  19.029  -40.400 1.00 21.62  ? 241 ILE B CA  1 
ATOM   4602  C C   . ILE B 1 241 ? 23.285  18.889  -39.728 1.00 19.17  ? 241 ILE B C   1 
ATOM   4603  O O   . ILE B 1 241 ? 23.488  19.401  -38.628 1.00 17.00  ? 241 ILE B O   1 
ATOM   4604  C CB  . ILE B 1 241 ? 21.065  17.786  -40.229 1.00 25.14  ? 241 ILE B CB  1 
ATOM   4605  C CG1 . ILE B 1 241 ? 20.853  17.495  -38.727 1.00 25.73  ? 241 ILE B CG1 1 
ATOM   4606  C CG2 . ILE B 1 241 ? 21.637  16.624  -41.043 1.00 23.22  ? 241 ILE B CG2 1 
ATOM   4607  C CD1 . ILE B 1 241 ? 19.747  18.246  -38.166 1.00 22.88  ? 241 ILE B CD1 1 
ATOM   4608  N N   . LYS B 1 242 ? 24.208  18.190  -40.375 1.00 14.35  ? 242 LYS B N   1 
ATOM   4609  C CA  . LYS B 1 242 ? 25.554  18.028  -39.842 1.00 13.68  ? 242 LYS B CA  1 
ATOM   4610  C C   . LYS B 1 242 ? 26.219  19.404  -39.640 1.00 20.21  ? 242 LYS B C   1 
ATOM   4611  O O   . LYS B 1 242 ? 26.930  19.629  -38.669 1.00 20.66  ? 242 LYS B O   1 
ATOM   4612  C CB  . LYS B 1 242 ? 26.395  17.190  -40.797 1.00 15.99  ? 242 LYS B CB  1 
ATOM   4613  C CG  . LYS B 1 242 ? 25.895  15.795  -41.147 1.00 9.96   ? 242 LYS B CG  1 
ATOM   4614  C CD  . LYS B 1 242 ? 27.036  15.047  -41.794 1.00 9.95   ? 242 LYS B CD  1 
ATOM   4615  C CE  . LYS B 1 242 ? 26.579  13.887  -42.674 1.00 33.62  ? 242 LYS B CE  1 
ATOM   4616  N NZ  . LYS B 1 242 ? 27.764  13.031  -43.001 1.00 39.63  ? 242 LYS B NZ  1 
ATOM   4617  N N   . GLU B 1 243 ? 26.016  20.315  -40.583 1.00 19.89  ? 243 GLU B N   1 
ATOM   4618  C CA  . GLU B 1 243 ? 26.546  21.677  -40.485 1.00 22.14  ? 243 GLU B CA  1 
ATOM   4619  C C   . GLU B 1 243 ? 25.933  22.448  -39.297 1.00 26.85  ? 243 GLU B C   1 
ATOM   4620  O O   . GLU B 1 243 ? 26.612  23.232  -38.582 1.00 27.58  ? 243 GLU B O   1 
ATOM   4621  C CB  . GLU B 1 243 ? 26.294  22.436  -41.800 1.00 24.58  ? 243 GLU B CB  1 
ATOM   4622  C CG  . GLU B 1 243 ? 27.070  23.755  -41.936 1.00 44.84  ? 243 GLU B CG  1 
ATOM   4623  C CD  . GLU B 1 243 ? 28.580  23.606  -41.726 1.00 89.28  ? 243 GLU B CD  1 
ATOM   4624  O OE1 . GLU B 1 243 ? 29.178  24.451  -41.009 1.00 80.65  ? 243 GLU B OE1 1 
ATOM   4625  O OE2 . GLU B 1 243 ? 29.169  22.651  -42.289 1.00 101.89 ? 243 GLU B OE2 1 
ATOM   4626  N N   . ILE B 1 244 ? 24.649  22.217  -39.054 1.00 20.84  ? 244 ILE B N   1 
ATOM   4627  C CA  . ILE B 1 244 ? 24.027  22.839  -37.891 1.00 19.29  ? 244 ILE B CA  1 
ATOM   4628  C C   . ILE B 1 244 ? 24.587  22.177  -36.632 1.00 18.47  ? 244 ILE B C   1 
ATOM   4629  O O   . ILE B 1 244 ? 24.803  22.815  -35.625 1.00 15.54  ? 244 ILE B O   1 
ATOM   4630  C CB  . ILE B 1 244 ? 22.496  22.667  -37.867 1.00 22.11  ? 244 ILE B CB  1 
ATOM   4631  C CG1 . ILE B 1 244 ? 21.841  23.368  -39.068 1.00 21.64  ? 244 ILE B CG1 1 
ATOM   4632  C CG2 . ILE B 1 244 ? 21.991  23.202  -36.542 1.00 24.17  ? 244 ILE B CG2 1 
ATOM   4633  C CD1 . ILE B 1 244 ? 20.379  22.928  -39.348 1.00 15.73  ? 244 ILE B CD1 1 
ATOM   4634  N N   . ALA B 1 245 ? 24.769  20.863  -36.692 1.00 15.82  ? 245 ALA B N   1 
ATOM   4635  C CA  . ALA B 1 245 ? 25.281  20.099  -35.574 1.00 15.70  ? 245 ALA B CA  1 
ATOM   4636  C C   . ALA B 1 245 ? 26.727  20.527  -35.290 1.00 21.38  ? 245 ALA B C   1 
ATOM   4637  O O   . ALA B 1 245 ? 27.199  20.495  -34.148 1.00 19.48  ? 245 ALA B O   1 
ATOM   4638  C CB  . ALA B 1 245 ? 25.213  18.619  -35.899 1.00 16.60  ? 245 ALA B CB  1 
ATOM   4639  N N   . LYS B 1 246 ? 27.412  20.985  -36.334 1.00 20.53  ? 246 LYS B N   1 
ATOM   4640  C CA  . LYS B 1 246 ? 28.766  21.502  -36.202 1.00 21.16  ? 246 LYS B CA  1 
ATOM   4641  C C   . LYS B 1 246 ? 28.854  22.937  -35.641 1.00 27.01  ? 246 LYS B C   1 
ATOM   4642  O O   . LYS B 1 246 ? 29.707  23.245  -34.767 1.00 29.64  ? 246 LYS B O   1 
ATOM   4643  C CB  . LYS B 1 246 ? 29.506  21.418  -37.529 1.00 23.25  ? 246 LYS B CB  1 
ATOM   4644  C CG  . LYS B 1 246 ? 30.997  21.667  -37.402 1.00 22.82  ? 246 LYS B CG  1 
ATOM   4645  C CD  . LYS B 1 246 ? 31.530  22.431  -38.612 1.00 26.57  ? 246 LYS B CD  1 
ATOM   4646  C CE  . LYS B 1 246 ? 32.963  22.031  -38.936 1.00 38.81  ? 246 LYS B CE  1 
ATOM   4647  N NZ  . LYS B 1 246 ? 33.873  23.132  -38.537 1.00 47.17  ? 246 LYS B NZ  1 
ATOM   4648  N N   . LYS B 1 247 ? 27.983  23.828  -36.112 1.00 18.05  ? 247 LYS B N   1 
ATOM   4649  C CA  . LYS B 1 247 ? 28.050  25.195  -35.588 1.00 14.48  ? 247 LYS B CA  1 
ATOM   4650  C C   . LYS B 1 247 ? 27.505  25.223  -34.182 1.00 14.42  ? 247 LYS B C   1 
ATOM   4651  O O   . LYS B 1 247 ? 27.938  25.979  -33.331 1.00 12.17  ? 247 LYS B O   1 
ATOM   4652  C CB  . LYS B 1 247 ? 27.289  26.175  -36.482 1.00 14.52  ? 247 LYS B CB  1 
ATOM   4653  C CG  . LYS B 1 247 ? 27.622  26.019  -37.937 1.00 2.70   ? 247 LYS B CG  1 
ATOM   4654  C CD  . LYS B 1 247 ? 26.689  26.768  -38.847 1.00 24.38  ? 247 LYS B CD  1 
ATOM   4655  C CE  . LYS B 1 247 ? 27.431  27.222  -40.100 1.00 36.57  ? 247 LYS B CE  1 
ATOM   4656  N NZ  . LYS B 1 247 ? 27.974  28.607  -39.940 1.00 38.85  ? 247 LYS B NZ  1 
ATOM   4657  N N   . THR B 1 248 ? 26.519  24.396  -33.919 1.00 12.59  ? 248 THR B N   1 
ATOM   4658  C CA  . THR B 1 248 ? 25.968  24.408  -32.583 1.00 13.92  ? 248 THR B CA  1 
ATOM   4659  C C   . THR B 1 248 ? 27.027  23.980  -31.591 1.00 21.96  ? 248 THR B C   1 
ATOM   4660  O O   . THR B 1 248 ? 27.201  24.636  -30.557 1.00 23.91  ? 248 THR B O   1 
ATOM   4661  C CB  . THR B 1 248 ? 24.726  23.511  -32.475 1.00 18.28  ? 248 THR B CB  1 
ATOM   4662  O OG1 . THR B 1 248 ? 23.888  23.793  -33.583 1.00 20.64  ? 248 THR B OG1 1 
ATOM   4663  C CG2 . THR B 1 248 ? 23.944  23.759  -31.194 1.00 12.46  ? 248 THR B CG2 1 
ATOM   4664  N N   . GLN B 1 249 ? 27.764  22.915  -31.930 1.00 17.88  ? 249 GLN B N   1 
ATOM   4665  C CA  . GLN B 1 249 ? 28.772  22.374  -31.025 1.00 16.92  ? 249 GLN B CA  1 
ATOM   4666  C C   . GLN B 1 249 ? 29.864  23.386  -30.733 1.00 21.21  ? 249 GLN B C   1 
ATOM   4667  O O   . GLN B 1 249 ? 30.505  23.327  -29.697 1.00 19.86  ? 249 GLN B O   1 
ATOM   4668  C CB  . GLN B 1 249 ? 29.387  21.095  -31.580 1.00 17.60  ? 249 GLN B CB  1 
ATOM   4669  C CG  . GLN B 1 249 ? 30.884  21.242  -31.878 1.00 23.87  ? 249 GLN B CG  1 
ATOM   4670  C CD  . GLN B 1 249 ? 31.785  20.936  -30.701 1.00 21.21  ? 249 GLN B CD  1 
ATOM   4671  O OE1 . GLN B 1 249 ? 32.907  21.370  -30.656 1.00 19.32  ? 249 GLN B OE1 1 
ATOM   4672  N NE2 . GLN B 1 249 ? 31.344  20.060  -29.835 1.00 21.99  ? 249 GLN B NE2 1 
ATOM   4673  N N   . ALA B 1 250 ? 30.055  24.315  -31.666 1.00 18.66  ? 250 ALA B N   1 
ATOM   4674  C CA  . ALA B 1 250 ? 31.105  25.313  -31.561 1.00 18.78  ? 250 ALA B CA  1 
ATOM   4675  C C   . ALA B 1 250 ? 30.701  26.577  -30.818 1.00 23.91  ? 250 ALA B C   1 
ATOM   4676  O O   . ALA B 1 250 ? 31.508  27.463  -30.608 1.00 25.49  ? 250 ALA B O   1 
ATOM   4677  C CB  . ALA B 1 250 ? 31.620  25.649  -32.943 1.00 19.63  ? 250 ALA B CB  1 
ATOM   4678  N N   . LEU B 1 251 ? 29.440  26.678  -30.429 1.00 21.80  ? 251 LEU B N   1 
ATOM   4679  C CA  . LEU B 1 251 ? 28.960  27.855  -29.699 1.00 20.59  ? 251 LEU B CA  1 
ATOM   4680  C C   . LEU B 1 251 ? 29.816  28.072  -28.437 1.00 26.80  ? 251 LEU B C   1 
ATOM   4681  O O   . LEU B 1 251 ? 30.384  27.115  -27.890 1.00 28.03  ? 251 LEU B O   1 
ATOM   4682  C CB  . LEU B 1 251 ? 27.497  27.651  -29.317 1.00 19.25  ? 251 LEU B CB  1 
ATOM   4683  C CG  . LEU B 1 251 ? 26.557  27.689  -30.509 1.00 21.97  ? 251 LEU B CG  1 
ATOM   4684  C CD1 . LEU B 1 251 ? 25.132  27.360  -30.082 1.00 21.87  ? 251 LEU B CD1 1 
ATOM   4685  C CD2 . LEU B 1 251 ? 26.634  29.038  -31.169 1.00 18.90  ? 251 LEU B CD2 1 
ATOM   4686  N N   . PRO B 1 252 ? 29.963  29.323  -27.999 1.00 22.38  ? 252 PRO B N   1 
ATOM   4687  C CA  . PRO B 1 252 ? 30.762  29.589  -26.792 1.00 19.77  ? 252 PRO B CA  1 
ATOM   4688  C C   . PRO B 1 252 ? 30.336  28.700  -25.644 1.00 25.63  ? 252 PRO B C   1 
ATOM   4689  O O   . PRO B 1 252 ? 29.161  28.426  -25.453 1.00 28.26  ? 252 PRO B O   1 
ATOM   4690  C CB  . PRO B 1 252 ? 30.462  31.043  -26.487 1.00 20.34  ? 252 PRO B CB  1 
ATOM   4691  C CG  . PRO B 1 252 ? 30.229  31.663  -27.859 1.00 26.37  ? 252 PRO B CG  1 
ATOM   4692  C CD  . PRO B 1 252 ? 29.686  30.559  -28.767 1.00 21.98  ? 252 PRO B CD  1 
ATOM   4693  N N   . LYS B 1 253 ? 31.312  28.130  -24.966 1.00 23.39  ? 253 LYS B N   1 
ATOM   4694  C CA  . LYS B 1 253 ? 31.039  27.273  -23.823 1.00 22.79  ? 253 LYS B CA  1 
ATOM   4695  C C   . LYS B 1 253 ? 31.668  27.844  -22.547 1.00 25.53  ? 253 LYS B C   1 
ATOM   4696  O O   . LYS B 1 253 ? 32.752  28.445  -22.575 1.00 21.69  ? 253 LYS B O   1 
ATOM   4697  C CB  . LYS B 1 253 ? 31.480  25.827  -24.083 1.00 23.88  ? 253 LYS B CB  1 
ATOM   4698  C CG  . LYS B 1 253 ? 30.767  24.841  -23.186 1.00 21.59  ? 253 LYS B CG  1 
ATOM   4699  C CD  . LYS B 1 253 ? 30.801  23.473  -23.740 1.00 20.27  ? 253 LYS B CD  1 
ATOM   4700  C CE  . LYS B 1 253 ? 30.392  22.474  -22.683 1.00 22.00  ? 253 LYS B CE  1 
ATOM   4701  N NZ  . LYS B 1 253 ? 31.149  22.763  -21.419 1.00 22.43  ? 253 LYS B NZ  1 
ATOM   4702  N N   . MET B 1 254 ? 30.944  27.717  -21.435 1.00 24.61  ? 254 MET B N   1 
ATOM   4703  C CA  . MET B 1 254 ? 31.398  28.267  -20.154 1.00 24.23  ? 254 MET B CA  1 
ATOM   4704  C C   . MET B 1 254 ? 32.493  27.401  -19.579 1.00 30.96  ? 254 MET B C   1 
ATOM   4705  O O   . MET B 1 254 ? 33.594  27.882  -19.316 1.00 31.55  ? 254 MET B O   1 
ATOM   4706  C CB  . MET B 1 254 ? 30.239  28.355  -19.160 1.00 25.92  ? 254 MET B CB  1 
ATOM   4707  C CG  . MET B 1 254 ? 30.463  29.315  -18.030 1.00 29.13  ? 254 MET B CG  1 
ATOM   4708  S SD  . MET B 1 254 ? 30.067  30.983  -18.545 1.00 34.38  ? 254 MET B SD  1 
ATOM   4709  C CE  . MET B 1 254 ? 29.665  30.672  -20.298 1.00 30.93  ? 254 MET B CE  1 
ATOM   4710  N N   . ASN B 1 255 ? 32.194  26.117  -19.393 1.00 29.24  ? 255 ASN B N   1 
ATOM   4711  C CA  . ASN B 1 255 ? 33.188  25.165  -18.886 1.00 29.79  ? 255 ASN B CA  1 
ATOM   4712  C C   . ASN B 1 255 ? 34.019  24.507  -19.995 1.00 36.41  ? 255 ASN B C   1 
ATOM   4713  O O   . ASN B 1 255 ? 33.548  23.596  -20.687 1.00 35.81  ? 255 ASN B O   1 
ATOM   4714  C CB  . ASN B 1 255 ? 32.530  24.105  -17.999 1.00 28.45  ? 255 ASN B CB  1 
ATOM   4715  C CG  . ASN B 1 255 ? 33.475  22.944  -17.647 1.00 41.82  ? 255 ASN B CG  1 
ATOM   4716  O OD1 . ASN B 1 255 ? 34.722  23.070  -17.711 1.00 28.21  ? 255 ASN B OD1 1 
ATOM   4717  N ND2 . ASN B 1 255 ? 32.884  21.806  -17.263 1.00 23.08  ? 255 ASN B ND2 1 
ATOM   4718  N N   . SER B 1 256 ? 35.267  24.962  -20.125 1.00 35.61  ? 256 SER B N   1 
ATOM   4719  C CA  . SER B 1 256 ? 36.249  24.446  -21.097 1.00 35.04  ? 256 SER B CA  1 
ATOM   4720  C C   . SER B 1 256 ? 36.851  23.073  -20.734 1.00 38.79  ? 256 SER B C   1 
ATOM   4721  O O   . SER B 1 256 ? 37.792  22.614  -21.372 1.00 38.16  ? 256 SER B O   1 
ATOM   4722  C CB  . SER B 1 256 ? 37.418  25.403  -21.105 1.00 39.14  ? 256 SER B CB  1 
ATOM   4723  O OG  . SER B 1 256 ? 37.977  25.433  -19.797 1.00 49.55  ? 256 SER B OG  1 
ATOM   4724  N N   . LYS B 1 257 ? 36.402  22.464  -19.647 1.00 35.62  ? 257 LYS B N   1 
ATOM   4725  C CA  . LYS B 1 257 ? 36.922  21.157  -19.283 1.00 34.62  ? 257 LYS B CA  1 
ATOM   4726  C C   . LYS B 1 257 ? 36.204  20.059  -20.094 1.00 38.78  ? 257 LYS B C   1 
ATOM   4727  O O   . LYS B 1 257 ? 36.724  18.937  -20.239 1.00 38.04  ? 257 LYS B O   1 
ATOM   4728  C CB  . LYS B 1 257 ? 36.759  20.939  -17.778 1.00 35.79  ? 257 LYS B CB  1 
ATOM   4729  C CG  . LYS B 1 257 ? 38.002  21.275  -16.951 1.00 35.53  ? 257 LYS B CG  1 
ATOM   4730  C CD  . LYS B 1 257 ? 37.735  20.987  -15.490 1.00 32.21  ? 257 LYS B CD  1 
ATOM   4731  C CE  . LYS B 1 257 ? 38.725  21.705  -14.577 1.00 32.48  ? 257 LYS B CE  1 
ATOM   4732  N NZ  . LYS B 1 257 ? 38.703  21.126  -13.185 1.00 22.31  ? 257 LYS B NZ  1 
ATOM   4733  N N   . ARG B 1 258 ? 35.010  20.393  -20.611 1.00 33.27  ? 258 ARG B N   1 
ATOM   4734  C CA  . ARG B 1 258 ? 34.201  19.471  -21.417 1.00 30.90  ? 258 ARG B CA  1 
ATOM   4735  C C   . ARG B 1 258 ? 33.788  20.189  -22.677 1.00 37.72  ? 258 ARG B C   1 
ATOM   4736  O O   . ARG B 1 258 ? 33.119  21.205  -22.612 1.00 39.53  ? 258 ARG B O   1 
ATOM   4737  C CB  . ARG B 1 258 ? 32.934  19.007  -20.695 1.00 18.88  ? 258 ARG B CB  1 
ATOM   4738  C CG  . ARG B 1 258 ? 33.158  18.343  -19.360 1.00 17.93  ? 258 ARG B CG  1 
ATOM   4739  C CD  . ARG B 1 258 ? 31.793  17.900  -18.822 1.00 36.42  ? 258 ARG B CD  1 
ATOM   4740  N NE  . ARG B 1 258 ? 31.838  17.298  -17.494 1.00 50.29  ? 258 ARG B NE  1 
ATOM   4741  C CZ  . ARG B 1 258 ? 32.418  16.133  -17.252 1.00 49.22  ? 258 ARG B CZ  1 
ATOM   4742  N NH1 . ARG B 1 258 ? 32.988  15.531  -18.263 1.00 21.73  ? 258 ARG B NH1 1 
ATOM   4743  N NH2 . ARG B 1 258 ? 32.448  15.598  -16.019 1.00 26.05  ? 258 ARG B NH2 1 
ATOM   4744  N N   . GLN B 1 259 ? 34.208  19.653  -23.816 1.00 33.86  ? 259 GLN B N   1 
ATOM   4745  C CA  . GLN B 1 259 ? 33.916  20.172  -25.154 1.00 32.54  ? 259 GLN B CA  1 
ATOM   4746  C C   . GLN B 1 259 ? 32.512  19.695  -25.498 1.00 33.04  ? 259 GLN B C   1 
ATOM   4747  O O   . GLN B 1 259 ? 32.235  18.495  -25.373 1.00 35.65  ? 259 GLN B O   1 
ATOM   4748  C CB  . GLN B 1 259 ? 34.912  19.504  -26.109 1.00 35.11  ? 259 GLN B CB  1 
ATOM   4749  C CG  . GLN B 1 259 ? 35.033  20.117  -27.495 1.00 57.41  ? 259 GLN B CG  1 
ATOM   4750  C CD  . GLN B 1 259 ? 35.630  21.488  -27.456 1.00 72.52  ? 259 GLN B CD  1 
ATOM   4751  O OE1 . GLN B 1 259 ? 35.811  22.117  -28.498 1.00 67.43  ? 259 GLN B OE1 1 
ATOM   4752  N NE2 . GLN B 1 259 ? 35.956  21.969  -26.247 1.00 58.20  ? 259 GLN B NE2 1 
ATOM   4753  N N   . ARG B 1 260 ? 31.633  20.599  -25.942 1.00 23.16  ? 260 ARG B N   1 
ATOM   4754  C CA  . ARG B 1 260 ? 30.241  20.222  -26.208 1.00 19.24  ? 260 ARG B CA  1 
ATOM   4755  C C   . ARG B 1 260 ? 30.051  19.064  -27.151 1.00 20.25  ? 260 ARG B C   1 
ATOM   4756  O O   . ARG B 1 260 ? 30.907  18.784  -27.985 1.00 17.97  ? 260 ARG B O   1 
ATOM   4757  C CB  . ARG B 1 260 ? 29.410  21.394  -26.708 1.00 17.28  ? 260 ARG B CB  1 
ATOM   4758  C CG  . ARG B 1 260 ? 27.896  21.199  -26.522 1.00 17.15  ? 260 ARG B CG  1 
ATOM   4759  C CD  . ARG B 1 260 ? 27.100  22.343  -27.127 1.00 6.61   ? 260 ARG B CD  1 
ATOM   4760  N NE  . ARG B 1 260 ? 27.146  23.545  -26.276 1.00 8.43   ? 260 ARG B NE  1 
ATOM   4761  C CZ  . ARG B 1 260 ? 27.996  24.560  -26.406 1.00 21.46  ? 260 ARG B CZ  1 
ATOM   4762  N NH1 . ARG B 1 260 ? 28.922  24.559  -27.357 1.00 20.76  ? 260 ARG B NH1 1 
ATOM   4763  N NH2 . ARG B 1 260 ? 27.913  25.591  -25.578 1.00 14.09  ? 260 ARG B NH2 1 
ATOM   4764  N N   . ILE B 1 261 ? 28.896  18.403  -27.022 1.00 16.88  ? 261 ILE B N   1 
ATOM   4765  C CA  . ILE B 1 261 ? 28.484  17.324  -27.905 1.00 14.97  ? 261 ILE B CA  1 
ATOM   4766  C C   . ILE B 1 261 ? 27.065  17.650  -28.358 1.00 18.79  ? 261 ILE B C   1 
ATOM   4767  O O   . ILE B 1 261 ? 26.235  18.141  -27.578 1.00 21.38  ? 261 ILE B O   1 
ATOM   4768  C CB  . ILE B 1 261 ? 28.473  15.983  -27.182 1.00 17.61  ? 261 ILE B CB  1 
ATOM   4769  C CG1 . ILE B 1 261 ? 29.877  15.633  -26.740 1.00 18.09  ? 261 ILE B CG1 1 
ATOM   4770  C CG2 . ILE B 1 261 ? 27.892  14.877  -28.084 1.00 18.98  ? 261 ILE B CG2 1 
ATOM   4771  C CD1 . ILE B 1 261 ? 30.341  14.303  -27.277 1.00 33.94  ? 261 ILE B CD1 1 
ATOM   4772  N N   . VAL B 1 262 ? 26.744  17.287  -29.587 1.00 12.19  ? 262 VAL B N   1 
ATOM   4773  C CA  . VAL B 1 262 ? 25.436  17.596  -30.106 1.00 11.80  ? 262 VAL B CA  1 
ATOM   4774  C C   . VAL B 1 262 ? 24.899  16.357  -30.734 1.00 18.71  ? 262 VAL B C   1 
ATOM   4775  O O   . VAL B 1 262 ? 25.591  15.705  -31.516 1.00 18.97  ? 262 VAL B O   1 
ATOM   4776  C CB  . VAL B 1 262 ? 25.475  18.752  -31.175 1.00 15.59  ? 262 VAL B CB  1 
ATOM   4777  C CG1 . VAL B 1 262 ? 24.126  18.977  -31.759 1.00 15.63  ? 262 VAL B CG1 1 
ATOM   4778  C CG2 . VAL B 1 262 ? 25.995  20.081  -30.551 1.00 14.41  ? 262 VAL B CG2 1 
ATOM   4779  N N   . ILE B 1 263 ? 23.660  16.015  -30.346 1.00 18.29  ? 263 ILE B N   1 
ATOM   4780  C CA  . ILE B 1 263 ? 22.939  14.885  -30.894 1.00 16.70  ? 263 ILE B CA  1 
ATOM   4781  C C   . ILE B 1 263 ? 21.574  15.232  -31.473 1.00 17.38  ? 263 ILE B C   1 
ATOM   4782  O O   . ILE B 1 263 ? 20.628  15.411  -30.745 1.00 16.65  ? 263 ILE B O   1 
ATOM   4783  C CB  . ILE B 1 263 ? 22.832  13.724  -29.876 1.00 19.64  ? 263 ILE B CB  1 
ATOM   4784  C CG1 . ILE B 1 263 ? 24.052  12.831  -30.029 1.00 21.63  ? 263 ILE B CG1 1 
ATOM   4785  C CG2 . ILE B 1 263 ? 21.546  12.861  -30.104 1.00 16.52  ? 263 ILE B CG2 1 
ATOM   4786  C CD1 . ILE B 1 263 ? 24.227  11.935  -28.879 1.00 36.46  ? 263 ILE B CD1 1 
ATOM   4787  N N   . PHE B 1 264 ? 21.461  15.215  -32.795 1.00 13.18  ? 264 PHE B N   1 
ATOM   4788  C CA  . PHE B 1 264 ? 20.166  15.366  -33.477 1.00 12.63  ? 264 PHE B CA  1 
ATOM   4789  C C   . PHE B 1 264 ? 19.585  14.030  -34.022 1.00 14.50  ? 264 PHE B C   1 
ATOM   4790  O O   . PHE B 1 264 ? 20.286  13.270  -34.682 1.00 11.98  ? 264 PHE B O   1 
ATOM   4791  C CB  . PHE B 1 264 ? 20.252  16.400  -34.607 1.00 13.89  ? 264 PHE B CB  1 
ATOM   4792  C CG  . PHE B 1 264 ? 20.669  17.769  -34.135 1.00 14.86  ? 264 PHE B CG  1 
ATOM   4793  C CD1 . PHE B 1 264 ? 20.104  18.314  -32.989 1.00 18.90  ? 264 PHE B CD1 1 
ATOM   4794  C CD2 . PHE B 1 264 ? 21.677  18.459  -34.766 1.00 15.82  ? 264 PHE B CD2 1 
ATOM   4795  C CE1 . PHE B 1 264 ? 20.477  19.590  -32.518 1.00 19.92  ? 264 PHE B CE1 1 
ATOM   4796  C CE2 . PHE B 1 264 ? 22.033  19.710  -34.333 1.00 19.88  ? 264 PHE B CE2 1 
ATOM   4797  C CZ  . PHE B 1 264 ? 21.436  20.281  -33.181 1.00 18.63  ? 264 PHE B CZ  1 
ATOM   4798  N N   . THR B 1 265 ? 18.312  13.766  -33.709 1.00 9.30   ? 265 THR B N   1 
ATOM   4799  C CA  . THR B 1 265 ? 17.665  12.594  -34.189 1.00 9.76   ? 265 THR B CA  1 
ATOM   4800  C C   . THR B 1 265 ? 16.835  13.010  -35.395 1.00 18.69  ? 265 THR B C   1 
ATOM   4801  O O   . THR B 1 265 ? 16.319  14.131  -35.430 1.00 19.82  ? 265 THR B O   1 
ATOM   4802  C CB  . THR B 1 265 ? 16.729  11.946  -33.148 1.00 16.99  ? 265 THR B CB  1 
ATOM   4803  O OG1 . THR B 1 265 ? 15.696  12.860  -32.707 1.00 21.57  ? 265 THR B OG1 1 
ATOM   4804  C CG2 . THR B 1 265 ? 17.505  11.377  -32.028 1.00 11.50  ? 265 THR B CG2 1 
ATOM   4805  N N   . GLN B 1 266 ? 16.657  12.085  -36.339 1.00 16.10  ? 266 GLN B N   1 
ATOM   4806  C CA  . GLN B 1 266 ? 15.925  12.361  -37.557 1.00 16.68  ? 266 GLN B CA  1 
ATOM   4807  C C   . GLN B 1 266 ? 14.883  11.320  -37.868 1.00 24.37  ? 266 GLN B C   1 
ATOM   4808  O O   . GLN B 1 266 ? 14.698  10.986  -39.016 1.00 25.27  ? 266 GLN B O   1 
ATOM   4809  C CB  . GLN B 1 266 ? 16.888  12.459  -38.740 1.00 18.04  ? 266 GLN B CB  1 
ATOM   4810  C CG  . GLN B 1 266 ? 17.757  13.711  -38.729 1.00 25.72  ? 266 GLN B CG  1 
ATOM   4811  C CD  . GLN B 1 266 ? 18.783  13.690  -39.848 1.00 41.75  ? 266 GLN B CD  1 
ATOM   4812  O OE1 . GLN B 1 266 ? 19.671  12.816  -39.874 1.00 28.29  ? 266 GLN B OE1 1 
ATOM   4813  N NE2 . GLN B 1 266 ? 18.626  14.615  -40.820 1.00 21.90  ? 266 GLN B NE2 1 
ATOM   4814  N N   . GLY B 1 267 ? 14.180  10.824  -36.853 1.00 23.70  ? 267 GLY B N   1 
ATOM   4815  C CA  . GLY B 1 267 ? 13.121  9.846   -37.061 1.00 23.44  ? 267 GLY B CA  1 
ATOM   4816  C C   . GLY B 1 267 ? 13.713  8.533   -37.487 1.00 30.41  ? 267 GLY B C   1 
ATOM   4817  O O   . GLY B 1 267 ? 14.498  7.933   -36.748 1.00 32.00  ? 267 GLY B O   1 
ATOM   4818  N N   . ARG B 1 268 ? 13.420  8.140   -38.726 1.00 28.31  ? 268 ARG B N   1 
ATOM   4819  C CA  . ARG B 1 268 ? 13.947  6.906   -39.300 1.00 28.05  ? 268 ARG B CA  1 
ATOM   4820  C C   . ARG B 1 268 ? 15.271  7.122   -40.052 1.00 31.78  ? 268 ARG B C   1 
ATOM   4821  O O   . ARG B 1 268 ? 15.851  6.172   -40.573 1.00 32.25  ? 268 ARG B O   1 
ATOM   4822  C CB  . ARG B 1 268 ? 12.899  6.289   -40.217 1.00 28.41  ? 268 ARG B CB  1 
ATOM   4823  C CG  . ARG B 1 268 ? 11.553  6.041   -39.545 1.00 45.31  ? 268 ARG B CG  1 
ATOM   4824  C CD  . ARG B 1 268 ? 10.492  5.599   -40.571 1.00 76.98  ? 268 ARG B CD  1 
ATOM   4825  N NE  . ARG B 1 268 ? 10.258  4.148   -40.650 1.00 99.96  ? 268 ARG B NE  1 
ATOM   4826  C CZ  . ARG B 1 268 ? 10.502  3.418   -41.737 1.00 118.23 ? 268 ARG B CZ  1 
ATOM   4827  N NH1 . ARG B 1 268 ? 11.020  3.982   -42.814 1.00 107.24 ? 268 ARG B NH1 1 
ATOM   4828  N NH2 . ARG B 1 268 ? 10.216  2.114   -41.746 1.00 104.06 ? 268 ARG B NH2 1 
ATOM   4829  N N   . ASP B 1 269 ? 15.735  8.370   -40.094 1.00 26.55  ? 269 ASP B N   1 
ATOM   4830  C CA  . ASP B 1 269 ? 16.988  8.733   -40.744 1.00 26.73  ? 269 ASP B CA  1 
ATOM   4831  C C   . ASP B 1 269 ? 18.114  8.776   -39.726 1.00 26.84  ? 269 ASP B C   1 
ATOM   4832  O O   . ASP B 1 269 ? 17.875  8.836   -38.538 1.00 26.96  ? 269 ASP B O   1 
ATOM   4833  C CB  . ASP B 1 269 ? 16.851  10.098  -41.450 1.00 30.71  ? 269 ASP B CB  1 
ATOM   4834  C CG  . ASP B 1 269 ? 16.176  9.986   -42.824 1.00 59.40  ? 269 ASP B CG  1 
ATOM   4835  O OD1 . ASP B 1 269 ? 16.359  8.945   -43.501 1.00 68.01  ? 269 ASP B OD1 1 
ATOM   4836  O OD2 . ASP B 1 269 ? 15.483  10.943  -43.241 1.00 60.37  ? 269 ASP B OD2 1 
ATOM   4837  N N   . ASP B 1 270 ? 19.348  8.724   -40.178 1.00 22.76  ? 270 ASP B N   1 
ATOM   4838  C CA  . ASP B 1 270 ? 20.456  8.715   -39.220 1.00 23.46  ? 270 ASP B CA  1 
ATOM   4839  C C   . ASP B 1 270 ? 20.368  9.758   -38.104 1.00 27.66  ? 270 ASP B C   1 
ATOM   4840  O O   . ASP B 1 270 ? 19.770  10.829  -38.262 1.00 27.34  ? 270 ASP B O   1 
ATOM   4841  C CB  . ASP B 1 270 ? 21.820  8.847   -39.909 1.00 24.00  ? 270 ASP B CB  1 
ATOM   4842  C CG  . ASP B 1 270 ? 22.002  7.860   -41.044 1.00 27.38  ? 270 ASP B CG  1 
ATOM   4843  O OD1 . ASP B 1 270 ? 21.380  6.763   -41.049 1.00 23.91  ? 270 ASP B OD1 1 
ATOM   4844  O OD2 . ASP B 1 270 ? 22.808  8.201   -41.931 1.00 37.43  ? 270 ASP B OD2 1 
ATOM   4845  N N   . THR B 1 271 ? 20.999  9.425   -36.990 1.00 21.98  ? 271 THR B N   1 
ATOM   4846  C CA  . THR B 1 271 ? 21.099  10.290  -35.846 1.00 20.24  ? 271 THR B CA  1 
ATOM   4847  C C   . THR B 1 271 ? 22.445  10.901  -36.081 1.00 26.39  ? 271 THR B C   1 
ATOM   4848  O O   . THR B 1 271 ? 23.370  10.189  -36.496 1.00 25.25  ? 271 THR B O   1 
ATOM   4849  C CB  . THR B 1 271 ? 21.165  9.436   -34.553 1.00 22.15  ? 271 THR B CB  1 
ATOM   4850  O OG1 . THR B 1 271 ? 19.877  8.873   -34.284 1.00 24.02  ? 271 THR B OG1 1 
ATOM   4851  C CG2 . THR B 1 271 ? 21.598  10.231  -33.378 1.00 18.94  ? 271 THR B CG2 1 
ATOM   4852  N N   . ILE B 1 272 ? 22.543  12.220  -35.906 1.00 23.81  ? 272 ILE B N   1 
ATOM   4853  C CA  . ILE B 1 272 ? 23.811  12.907  -36.105 1.00 22.69  ? 272 ILE B CA  1 
ATOM   4854  C C   . ILE B 1 272 ? 24.400  13.341  -34.779 1.00 24.80  ? 272 ILE B C   1 
ATOM   4855  O O   . ILE B 1 272 ? 23.684  13.792  -33.895 1.00 25.64  ? 272 ILE B O   1 
ATOM   4856  C CB  . ILE B 1 272 ? 23.661  14.112  -37.077 1.00 24.85  ? 272 ILE B CB  1 
ATOM   4857  C CG1 . ILE B 1 272 ? 23.358  13.603  -38.483 1.00 23.26  ? 272 ILE B CG1 1 
ATOM   4858  C CG2 . ILE B 1 272 ? 24.929  14.970  -37.091 1.00 24.38  ? 272 ILE B CG2 1 
ATOM   4859  C CD1 . ILE B 1 272 ? 22.002  13.942  -38.913 1.00 28.30  ? 272 ILE B CD1 1 
ATOM   4860  N N   . MET B 1 273 ? 25.713  13.224  -34.659 1.00 22.05  ? 273 MET B N   1 
ATOM   4861  C CA  . MET B 1 273 ? 26.453  13.683  -33.469 1.00 21.71  ? 273 MET B CA  1 
ATOM   4862  C C   . MET B 1 273 ? 27.685  14.475  -33.909 1.00 26.98  ? 273 MET B C   1 
ATOM   4863  O O   . MET B 1 273 ? 28.506  14.003  -34.732 1.00 26.42  ? 273 MET B O   1 
ATOM   4864  C CB  . MET B 1 273 ? 26.926  12.488  -32.605 1.00 23.90  ? 273 MET B CB  1 
ATOM   4865  C CG  . MET B 1 273 ? 27.997  12.819  -31.545 1.00 26.71  ? 273 MET B CG  1 
ATOM   4866  S SD  . MET B 1 273 ? 28.655  11.429  -30.563 1.00 29.94  ? 273 MET B SD  1 
ATOM   4867  C CE  . MET B 1 273 ? 27.426  10.235  -30.679 1.00 26.71  ? 273 MET B CE  1 
ATOM   4868  N N   . ALA B 1 274 ? 27.831  15.662  -33.328 1.00 22.17  ? 274 ALA B N   1 
ATOM   4869  C CA  . ALA B 1 274 ? 28.994  16.491  -33.592 1.00 21.72  ? 274 ALA B CA  1 
ATOM   4870  C C   . ALA B 1 274 ? 29.766  16.546  -32.299 1.00 28.57  ? 274 ALA B C   1 
ATOM   4871  O O   . ALA B 1 274 ? 29.180  16.648  -31.227 1.00 31.03  ? 274 ALA B O   1 
ATOM   4872  C CB  . ALA B 1 274 ? 28.602  17.906  -34.002 1.00 21.92  ? 274 ALA B CB  1 
ATOM   4873  N N   . THR B 1 275 ? 31.089  16.473  -32.412 1.00 21.48  ? 275 THR B N   1 
ATOM   4874  C CA  . THR B 1 275 ? 31.980  16.615  -31.294 1.00 19.26  ? 275 THR B CA  1 
ATOM   4875  C C   . THR B 1 275 ? 33.007  17.587  -31.822 1.00 26.40  ? 275 THR B C   1 
ATOM   4876  O O   . THR B 1 275 ? 32.849  18.121  -32.925 1.00 26.14  ? 275 THR B O   1 
ATOM   4877  C CB  . THR B 1 275 ? 32.692  15.313  -30.921 1.00 19.23  ? 275 THR B CB  1 
ATOM   4878  O OG1 . THR B 1 275 ? 33.397  14.768  -32.050 1.00 15.45  ? 275 THR B OG1 1 
ATOM   4879  C CG2 . THR B 1 275 ? 31.709  14.295  -30.347 1.00 19.01  ? 275 THR B CG2 1 
ATOM   4880  N N   . GLU B 1 276 ? 34.037  17.833  -31.026 1.00 25.89  ? 276 GLU B N   1 
ATOM   4881  C CA  . GLU B 1 276 ? 35.118  18.740  -31.398 1.00 29.06  ? 276 GLU B CA  1 
ATOM   4882  C C   . GLU B 1 276 ? 35.846  18.227  -32.633 1.00 34.11  ? 276 GLU B C   1 
ATOM   4883  O O   . GLU B 1 276 ? 36.218  18.961  -33.544 1.00 32.78  ? 276 GLU B O   1 
ATOM   4884  C CB  . GLU B 1 276 ? 36.123  18.800  -30.242 1.00 31.61  ? 276 GLU B CB  1 
ATOM   4885  C CG  . GLU B 1 276 ? 37.204  19.867  -30.402 1.00 46.41  ? 276 GLU B CG  1 
ATOM   4886  C CD  . GLU B 1 276 ? 38.469  19.460  -29.709 1.00 80.02  ? 276 GLU B CD  1 
ATOM   4887  O OE1 . GLU B 1 276 ? 38.424  19.330  -28.468 1.00 80.20  ? 276 GLU B OE1 1 
ATOM   4888  O OE2 . GLU B 1 276 ? 39.444  19.099  -30.405 1.00 79.78  ? 276 GLU B OE2 1 
ATOM   4889  N N   . SER B 1 277 ? 36.102  16.936  -32.620 1.00 32.98  ? 277 SER B N   1 
ATOM   4890  C CA  . SER B 1 277 ? 36.770  16.287  -33.724 1.00 32.93  ? 277 SER B CA  1 
ATOM   4891  C C   . SER B 1 277 ? 35.905  16.375  -34.964 1.00 39.49  ? 277 SER B C   1 
ATOM   4892  O O   . SER B 1 277 ? 36.306  16.990  -35.947 1.00 39.33  ? 277 SER B O   1 
ATOM   4893  C CB  . SER B 1 277 ? 37.026  14.805  -33.417 1.00 34.35  ? 277 SER B CB  1 
ATOM   4894  O OG  . SER B 1 277 ? 37.727  14.654  -32.205 1.00 50.43  ? 277 SER B OG  1 
ATOM   4895  N N   . GLU B 1 278 ? 34.733  15.728  -34.923 1.00 37.14  ? 278 GLU B N   1 
ATOM   4896  C CA  . GLU B 1 278 ? 33.902  15.573  -36.118 1.00 36.46  ? 278 GLU B CA  1 
ATOM   4897  C C   . GLU B 1 278 ? 32.373  15.433  -35.985 1.00 36.80  ? 278 GLU B C   1 
ATOM   4898  O O   . GLU B 1 278 ? 31.803  15.440  -34.888 1.00 34.75  ? 278 GLU B O   1 
ATOM   4899  C CB  . GLU B 1 278 ? 34.414  14.358  -36.893 1.00 37.91  ? 278 GLU B CB  1 
ATOM   4900  C CG  . GLU B 1 278 ? 35.634  14.663  -37.740 1.00 59.70  ? 278 GLU B CG  1 
ATOM   4901  C CD  . GLU B 1 278 ? 35.950  13.565  -38.748 1.00 92.00  ? 278 GLU B CD  1 
ATOM   4902  O OE1 . GLU B 1 278 ? 35.042  12.751  -39.063 1.00 78.26  ? 278 GLU B OE1 1 
ATOM   4903  O OE2 . GLU B 1 278 ? 37.106  13.542  -39.236 1.00 85.24  ? 278 GLU B OE2 1 
ATOM   4904  N N   . VAL B 1 279 ? 31.740  15.247  -37.147 1.00 31.96  ? 279 VAL B N   1 
ATOM   4905  C CA  . VAL B 1 279 ? 30.304  15.003  -37.266 1.00 32.21  ? 279 VAL B CA  1 
ATOM   4906  C C   . VAL B 1 279 ? 30.123  13.590  -37.827 1.00 34.86  ? 279 VAL B C   1 
ATOM   4907  O O   . VAL B 1 279 ? 30.632  13.269  -38.890 1.00 35.61  ? 279 VAL B O   1 
ATOM   4908  C CB  . VAL B 1 279 ? 29.580  15.994  -38.246 1.00 35.56  ? 279 VAL B CB  1 
ATOM   4909  C CG1 . VAL B 1 279 ? 28.085  15.768  -38.213 1.00 34.66  ? 279 VAL B CG1 1 
ATOM   4910  C CG2 . VAL B 1 279 ? 29.876  17.425  -37.908 1.00 35.50  ? 279 VAL B CG2 1 
ATOM   4911  N N   . THR B 1 280 ? 29.329  12.778  -37.151 1.00 29.65  ? 280 THR B N   1 
ATOM   4912  C CA  . THR B 1 280 ? 29.135  11.397  -37.564 1.00 27.77  ? 280 THR B CA  1 
ATOM   4913  C C   . THR B 1 280 ? 27.642  11.059  -37.573 1.00 27.30  ? 280 THR B C   1 
ATOM   4914  O O   . THR B 1 280 ? 26.840  11.769  -36.980 1.00 24.29  ? 280 THR B O   1 
ATOM   4915  C CB  . THR B 1 280 ? 29.950  10.453  -36.627 1.00 32.59  ? 280 THR B CB  1 
ATOM   4916  O OG1 . THR B 1 280 ? 31.327  10.603  -36.944 1.00 26.00  ? 280 THR B OG1 1 
ATOM   4917  C CG2 . THR B 1 280 ? 29.572  8.987   -36.813 1.00 35.70  ? 280 THR B CG2 1 
ATOM   4918  N N   . ALA B 1 281 ? 27.269  10.063  -38.364 1.00 25.10  ? 281 ALA B N   1 
ATOM   4919  C CA  . ALA B 1 281 ? 25.876  9.637   -38.457 1.00 25.38  ? 281 ALA B CA  1 
ATOM   4920  C C   . ALA B 1 281 ? 25.813  8.186   -38.044 1.00 28.13  ? 281 ALA B C   1 
ATOM   4921  O O   . ALA B 1 281 ? 26.786  7.493   -38.137 1.00 28.30  ? 281 ALA B O   1 
ATOM   4922  C CB  . ALA B 1 281 ? 25.301  9.838   -39.865 1.00 25.90  ? 281 ALA B CB  1 
ATOM   4923  N N   . PHE B 1 282 ? 24.669  7.780   -37.516 1.00 24.79  ? 282 PHE B N   1 
ATOM   4924  C CA  . PHE B 1 282 ? 24.441  6.480   -36.921 1.00 23.49  ? 282 PHE B CA  1 
ATOM   4925  C C   . PHE B 1 282 ? 23.063  6.022   -37.344 1.00 31.43  ? 282 PHE B C   1 
ATOM   4926  O O   . PHE B 1 282 ? 22.062  6.560   -36.874 1.00 31.64  ? 282 PHE B O   1 
ATOM   4927  C CB  . PHE B 1 282 ? 24.436  6.643   -35.404 1.00 24.64  ? 282 PHE B CB  1 
ATOM   4928  C CG  . PHE B 1 282 ? 25.795  6.965   -34.833 1.00 26.48  ? 282 PHE B CG  1 
ATOM   4929  C CD1 . PHE B 1 282 ? 26.605  5.951   -34.349 1.00 28.90  ? 282 PHE B CD1 1 
ATOM   4930  C CD2 . PHE B 1 282 ? 26.322  8.255   -34.914 1.00 27.64  ? 282 PHE B CD2 1 
ATOM   4931  C CE1 . PHE B 1 282 ? 27.848  6.228   -33.860 1.00 29.46  ? 282 PHE B CE1 1 
ATOM   4932  C CE2 . PHE B 1 282 ? 27.566  8.527   -34.435 1.00 30.06  ? 282 PHE B CE2 1 
ATOM   4933  C CZ  . PHE B 1 282 ? 28.338  7.515   -33.904 1.00 28.07  ? 282 PHE B CZ  1 
ATOM   4934  N N   . ALA B 1 283 ? 23.005  5.022   -38.219 1.00 29.98  ? 283 ALA B N   1 
ATOM   4935  C CA  . ALA B 1 283 ? 21.718  4.532   -38.703 1.00 28.57  ? 283 ALA B CA  1 
ATOM   4936  C C   . ALA B 1 283 ? 20.959  3.975   -37.554 1.00 33.13  ? 283 ALA B C   1 
ATOM   4937  O O   . ALA B 1 283 ? 21.541  3.470   -36.602 1.00 33.67  ? 283 ALA B O   1 
ATOM   4938  C CB  . ALA B 1 283 ? 21.900  3.483   -39.750 1.00 28.83  ? 283 ALA B CB  1 
ATOM   4939  N N   . VAL B 1 284 ? 19.650  4.113   -37.636 1.00 31.79  ? 284 VAL B N   1 
ATOM   4940  C CA  . VAL B 1 284 ? 18.740  3.630   -36.610 1.00 31.92  ? 284 VAL B CA  1 
ATOM   4941  C C   . VAL B 1 284 ? 18.612  2.107   -36.700 1.00 41.22  ? 284 VAL B C   1 
ATOM   4942  O O   . VAL B 1 284 ? 18.907  1.511   -37.740 1.00 39.30  ? 284 VAL B O   1 
ATOM   4943  C CB  . VAL B 1 284 ? 17.338  4.240   -36.841 1.00 33.36  ? 284 VAL B CB  1 
ATOM   4944  C CG1 . VAL B 1 284 ? 16.296  3.527   -36.042 1.00 33.19  ? 284 VAL B CG1 1 
ATOM   4945  C CG2 . VAL B 1 284 ? 17.327  5.691   -36.535 1.00 32.49  ? 284 VAL B CG2 1 
ATOM   4946  N N   . LEU B 1 285 ? 18.089  1.507   -35.627 1.00 43.57  ? 285 LEU B N   1 
ATOM   4947  C CA  . LEU B 1 285 ? 17.747  0.076   -35.574 1.00 45.34  ? 285 LEU B CA  1 
ATOM   4948  C C   . LEU B 1 285 ? 16.630  -0.318  -36.589 1.00 54.32  ? 285 LEU B C   1 
ATOM   4949  O O   . LEU B 1 285 ? 15.577  0.331   -36.646 1.00 52.96  ? 285 LEU B O   1 
ATOM   4950  C CB  . LEU B 1 285 ? 17.273  -0.262  -34.150 1.00 44.69  ? 285 LEU B CB  1 
ATOM   4951  C CG  . LEU B 1 285 ? 18.220  -1.115  -33.309 1.00 48.43  ? 285 LEU B CG  1 
ATOM   4952  C CD1 . LEU B 1 285 ? 17.559  -1.700  -32.080 1.00 47.60  ? 285 LEU B CD1 1 
ATOM   4953  C CD2 . LEU B 1 285 ? 18.857  -2.196  -34.169 1.00 50.31  ? 285 LEU B CD2 1 
ATOM   4954  N N   . ASP B 1 286 ? 16.827  -1.411  -37.329 1.00 55.63  ? 286 ASP B N   1 
ATOM   4955  C CA  . ASP B 1 286 ? 15.786  -1.902  -38.260 1.00 57.39  ? 286 ASP B CA  1 
ATOM   4956  C C   . ASP B 1 286 ? 14.471  -2.269  -37.564 1.00 62.79  ? 286 ASP B C   1 
ATOM   4957  O O   . ASP B 1 286 ? 14.047  -3.429  -37.574 1.00 61.17  ? 286 ASP B O   1 
ATOM   4958  C CB  . ASP B 1 286 ? 16.264  -3.096  -39.097 1.00 59.45  ? 286 ASP B CB  1 
ATOM   4959  C CG  . ASP B 1 286 ? 17.230  -2.687  -40.196 1.00 74.34  ? 286 ASP B CG  1 
ATOM   4960  O OD1 . ASP B 1 286 ? 16.881  -1.805  -41.012 1.00 75.39  ? 286 ASP B OD1 1 
ATOM   4961  O OD2 . ASP B 1 286 ? 18.359  -3.222  -40.213 1.00 83.17  ? 286 ASP B OD2 1 
ATOM   4962  N N   . GLN B 1 287 ? 13.846  -1.260  -36.964 1.00 61.79  ? 287 GLN B N   1 
ATOM   4963  C CA  . GLN B 1 287 ? 12.558  -1.415  -36.302 1.00 63.22  ? 287 GLN B CA  1 
ATOM   4964  C C   . GLN B 1 287 ? 11.456  -1.066  -37.307 1.00 68.10  ? 287 GLN B C   1 
ATOM   4965  O O   . GLN B 1 287 ? 10.534  -0.311  -37.005 1.00 66.41  ? 287 GLN B O   1 
ATOM   4966  C CB  . GLN B 1 287 ? 12.485  -0.474  -35.091 1.00 65.06  ? 287 GLN B CB  1 
ATOM   4967  C CG  . GLN B 1 287 ? 12.921  0.947   -35.417 1.00 86.25  ? 287 GLN B CG  1 
ATOM   4968  C CD  . GLN B 1 287 ? 12.856  1.867   -34.227 1.00 105.12 ? 287 GLN B CD  1 
ATOM   4969  O OE1 . GLN B 1 287 ? 11.785  2.104   -33.665 1.00 101.65 ? 287 GLN B OE1 1 
ATOM   4970  N NE2 . GLN B 1 287 ? 14.003  2.429   -33.858 1.00 95.64  ? 287 GLN B NE2 1 
ATOM   4971  N N   . ASP B 1 288 ? 11.599  -1.582  -38.523 1.00 67.26  ? 288 ASP B N   1 
ATOM   4972  C CA  . ASP B 1 288 ? 10.651  -1.316  -39.606 1.00 67.36  ? 288 ASP B CA  1 
ATOM   4973  C C   . ASP B 1 288 ? 9.220   -1.730  -39.248 1.00 71.18  ? 288 ASP B C   1 
ATOM   4974  O O   . ASP B 1 288 ? 8.926   -2.023  -38.087 1.00 70.57  ? 288 ASP B O   1 
ATOM   4975  C CB  . ASP B 1 288 ? 11.123  -1.995  -40.896 1.00 69.39  ? 288 ASP B CB  1 
ATOM   4976  C CG  . ASP B 1 288 ? 12.593  -1.722  -41.186 1.00 81.73  ? 288 ASP B CG  1 
ATOM   4977  O OD1 . ASP B 1 288 ? 13.070  -0.625  -40.787 1.00 81.50  ? 288 ASP B OD1 1 
ATOM   4978  O OD2 . ASP B 1 288 ? 13.285  -2.633  -41.710 1.00 87.68  ? 288 ASP B OD2 1 
ATOM   4979  N N   . GLN B 1 289 ? 8.327   -1.684  -40.239 1.00 68.26  ? 289 GLN B N   1 
ATOM   4980  C CA  . GLN B 1 289 ? 6.912   -2.045  -40.075 1.00 67.99  ? 289 GLN B CA  1 
ATOM   4981  C C   . GLN B 1 289 ? 6.243   -1.462  -38.816 1.00 74.66  ? 289 GLN B C   1 
ATOM   4982  O O   . GLN B 1 289 ? 5.070   -1.776  -38.515 1.00 74.90  ? 289 GLN B O   1 
ATOM   4983  C CB  . GLN B 1 289 ? 6.746   -3.564  -40.097 1.00 69.10  ? 289 GLN B CB  1 
ATOM   4984  C CG  . GLN B 1 289 ? 7.621   -4.297  -39.076 1.00 98.70  ? 289 GLN B CG  1 
ATOM   4985  C CD  . GLN B 1 289 ? 7.371   -5.799  -39.037 1.00 131.00 ? 289 GLN B CD  1 
ATOM   4986  O OE1 . GLN B 1 289 ? 6.365   -6.256  -38.488 1.00 129.06 ? 289 GLN B OE1 1 
ATOM   4987  N NE2 . GLN B 1 289 ? 8.325   -6.575  -39.548 1.00 125.81 ? 289 GLN B NE2 1 
ATOM   4988  N N   . LYS B 1 290 ? 6.992   -0.632  -38.080 1.00 71.20  ? 290 LYS B N   1 
ATOM   4989  C CA  . LYS B 1 290 ? 6.527   -0.063  -36.816 1.00 70.32  ? 290 LYS B CA  1 
ATOM   4990  C C   . LYS B 1 290 ? 5.355   0.908   -36.931 1.00 73.94  ? 290 LYS B C   1 
ATOM   4991  O O   . LYS B 1 290 ? 4.680   1.191   -35.935 1.00 74.19  ? 290 LYS B O   1 
ATOM   4992  C CB  . LYS B 1 290 ? 7.687   0.575   -36.047 1.00 72.22  ? 290 LYS B CB  1 
ATOM   4993  C CG  . LYS B 1 290 ? 8.536   1.532   -36.859 1.00 90.92  ? 290 LYS B CG  1 
ATOM   4994  C CD  . LYS B 1 290 ? 7.725   2.682   -37.418 1.00 105.18 ? 290 LYS B CD  1 
ATOM   4995  C CE  . LYS B 1 290 ? 8.591   3.578   -38.296 1.00 120.46 ? 290 LYS B CE  1 
ATOM   4996  N NZ  . LYS B 1 290 ? 9.802   4.061   -37.568 1.00 127.72 ? 290 LYS B NZ  1 
ATOM   4997  N N   . GLU B 1 291 ? 5.096   1.378   -38.150 1.00 69.53  ? 291 GLU B N   1 
ATOM   4998  C CA  . GLU B 1 291 ? 4.039   2.359   -38.424 1.00 68.94  ? 291 GLU B CA  1 
ATOM   4999  C C   . GLU B 1 291 ? 3.624   3.310   -37.281 1.00 71.51  ? 291 GLU B C   1 
ATOM   5000  O O   . GLU B 1 291 ? 4.312   4.304   -37.022 1.00 71.50  ? 291 GLU B O   1 
ATOM   5001  C CB  . GLU B 1 291 ? 2.852   1.753   -39.184 1.00 70.25  ? 291 GLU B CB  1 
ATOM   5002  C CG  . GLU B 1 291 ? 2.128   0.665   -38.446 1.00 82.41  ? 291 GLU B CG  1 
ATOM   5003  C CD  . GLU B 1 291 ? 0.918   0.171   -39.201 1.00 102.81 ? 291 GLU B CD  1 
ATOM   5004  O OE1 . GLU B 1 291 ? 0.264   0.983   -39.893 1.00 99.15  ? 291 GLU B OE1 1 
ATOM   5005  O OE2 . GLU B 1 291 ? 0.642   -1.043  -39.118 1.00 94.59  ? 291 GLU B OE2 1 
ATOM   5006  N N   . ILE B 1 292 ? 2.551   2.984   -36.563 1.00 66.15  ? 292 ILE B N   1 
ATOM   5007  C CA  . ILE B 1 292 ? 2.099   3.865   -35.492 1.00 65.19  ? 292 ILE B CA  1 
ATOM   5008  C C   . ILE B 1 292 ? 3.107   4.104   -34.375 1.00 65.60  ? 292 ILE B C   1 
ATOM   5009  O O   . ILE B 1 292 ? 2.805   3.914   -33.189 1.00 66.56  ? 292 ILE B O   1 
ATOM   5010  C CB  . ILE B 1 292 ? 0.729   3.482   -34.923 1.00 69.12  ? 292 ILE B CB  1 
ATOM   5011  C CG1 . ILE B 1 292 ? -0.298  3.347   -36.054 1.00 69.96  ? 292 ILE B CG1 1 
ATOM   5012  C CG2 . ILE B 1 292 ? 0.243   4.578   -33.956 1.00 70.55  ? 292 ILE B CG2 1 
ATOM   5013  C CD1 . ILE B 1 292 ? -1.662  3.967   -35.712 1.00 79.19  ? 292 ILE B CD1 1 
ATOM   5014  N N   . ILE B 1 293 ? 4.279   4.607   -34.751 1.00 57.73  ? 293 ILE B N   1 
ATOM   5015  C CA  . ILE B 1 293 ? 5.323   4.924   -33.774 1.00 55.06  ? 293 ILE B CA  1 
ATOM   5016  C C   . ILE B 1 293 ? 5.467   6.423   -33.403 1.00 52.77  ? 293 ILE B C   1 
ATOM   5017  O O   . ILE B 1 293 ? 6.108   7.190   -34.137 1.00 53.29  ? 293 ILE B O   1 
ATOM   5018  C CB  . ILE B 1 293 ? 6.687   4.347   -34.205 1.00 57.55  ? 293 ILE B CB  1 
ATOM   5019  C CG1 . ILE B 1 293 ? 7.221   5.081   -35.436 1.00 57.89  ? 293 ILE B CG1 1 
ATOM   5020  C CG2 . ILE B 1 293 ? 6.549   2.885   -34.534 1.00 57.46  ? 293 ILE B CG2 1 
ATOM   5021  C CD1 . ILE B 1 293 ? 8.703   5.375   -35.355 1.00 62.23  ? 293 ILE B CD1 1 
ATOM   5022  N N   . ASP B 1 294 ? 4.882   6.812   -32.266 1.00 42.26  ? 294 ASP B N   1 
ATOM   5023  C CA  . ASP B 1 294 ? 4.980   8.168   -31.738 1.00 39.16  ? 294 ASP B CA  1 
ATOM   5024  C C   . ASP B 1 294 ? 6.456   8.613   -31.835 1.00 39.23  ? 294 ASP B C   1 
ATOM   5025  O O   . ASP B 1 294 ? 7.326   8.069   -31.162 1.00 37.00  ? 294 ASP B O   1 
ATOM   5026  C CB  . ASP B 1 294 ? 4.432   8.205   -30.277 1.00 39.76  ? 294 ASP B CB  1 
ATOM   5027  C CG  . ASP B 1 294 ? 4.543   9.581   -29.617 1.00 40.29  ? 294 ASP B CG  1 
ATOM   5028  O OD1 . ASP B 1 294 ? 4.612   9.613   -28.388 1.00 42.84  ? 294 ASP B OD1 1 
ATOM   5029  O OD2 . ASP B 1 294 ? 4.503   10.630  -30.291 1.00 41.76  ? 294 ASP B OD2 1 
ATOM   5030  N N   . THR B 1 295 ? 6.728   9.492   -32.797 1.00 34.63  ? 295 THR B N   1 
ATOM   5031  C CA  . THR B 1 295 ? 8.059   10.044  -33.025 1.00 34.41  ? 295 THR B CA  1 
ATOM   5032  C C   . THR B 1 295 ? 8.495   10.832  -31.775 1.00 38.13  ? 295 THR B C   1 
ATOM   5033  O O   . THR B 1 295 ? 9.625   10.685  -31.241 1.00 37.89  ? 295 THR B O   1 
ATOM   5034  C CB  . THR B 1 295 ? 8.028   11.021  -34.220 1.00 55.20  ? 295 THR B CB  1 
ATOM   5035  O OG1 . THR B 1 295 ? 7.290   10.432  -35.300 1.00 67.08  ? 295 THR B OG1 1 
ATOM   5036  C CG2 . THR B 1 295 ? 9.443   11.334  -34.700 1.00 57.38  ? 295 THR B CG2 1 
ATOM   5037  N N   . ASN B 1 296 ? 7.584   11.662  -31.288 1.00 31.58  ? 296 ASN B N   1 
ATOM   5038  C CA  . ASN B 1 296 ? 7.856   12.453  -30.108 1.00 29.73  ? 296 ASN B CA  1 
ATOM   5039  C C   . ASN B 1 296 ? 8.250   11.553  -28.910 1.00 31.71  ? 296 ASN B C   1 
ATOM   5040  O O   . ASN B 1 296 ? 9.319   11.722  -28.281 1.00 33.17  ? 296 ASN B O   1 
ATOM   5041  C CB  . ASN B 1 296 ? 6.645   13.333  -29.801 1.00 28.58  ? 296 ASN B CB  1 
ATOM   5042  C CG  . ASN B 1 296 ? 6.442   14.454  -30.854 1.00 31.21  ? 296 ASN B CG  1 
ATOM   5043  O OD1 . ASN B 1 296 ? 5.307   14.770  -31.191 1.00 21.98  ? 296 ASN B OD1 1 
ATOM   5044  N ND2 . ASN B 1 296 ? 7.551   15.060  -31.350 1.00 4.77   ? 296 ASN B ND2 1 
ATOM   5045  N N   . GLY B 1 297 ? 7.417   10.561  -28.625 1.00 22.01  ? 297 GLY B N   1 
ATOM   5046  C CA  . GLY B 1 297 ? 7.738   9.600   -27.590 1.00 19.29  ? 297 GLY B CA  1 
ATOM   5047  C C   . GLY B 1 297 ? 9.066   8.909   -27.896 1.00 23.04  ? 297 GLY B C   1 
ATOM   5048  O O   . GLY B 1 297 ? 9.812   8.624   -26.986 1.00 25.47  ? 297 GLY B O   1 
ATOM   5049  N N   . ALA B 1 298 ? 9.374   8.629   -29.164 1.00 16.65  ? 298 ALA B N   1 
ATOM   5050  C CA  . ALA B 1 298 ? 10.627  7.957   -29.496 1.00 15.22  ? 298 ALA B CA  1 
ATOM   5051  C C   . ALA B 1 298 ? 11.758  8.911   -29.158 1.00 19.23  ? 298 ALA B C   1 
ATOM   5052  O O   . ALA B 1 298 ? 12.820  8.509   -28.674 1.00 19.01  ? 298 ALA B O   1 
ATOM   5053  C CB  . ALA B 1 298 ? 10.680  7.599   -30.976 1.00 15.44  ? 298 ALA B CB  1 
ATOM   5054  N N   . GLY B 1 299 ? 11.535  10.194  -29.430 1.00 14.44  ? 299 GLY B N   1 
ATOM   5055  C CA  . GLY B 1 299 ? 12.557  11.188  -29.094 1.00 11.89  ? 299 GLY B CA  1 
ATOM   5056  C C   . GLY B 1 299 ? 12.943  11.042  -27.632 1.00 10.65  ? 299 GLY B C   1 
ATOM   5057  O O   . GLY B 1 299 ? 14.061  10.710  -27.337 1.00 9.01   ? 299 GLY B O   1 
ATOM   5058  N N   . ASP B 1 300 ? 11.954  11.130  -26.743 1.00 8.18   ? 300 ASP B N   1 
ATOM   5059  C CA  . ASP B 1 300 ? 12.164  11.024  -25.294 1.00 8.86   ? 300 ASP B CA  1 
ATOM   5060  C C   . ASP B 1 300 ? 12.855  9.754   -24.789 1.00 15.66  ? 300 ASP B C   1 
ATOM   5061  O O   . ASP B 1 300 ? 13.568  9.768   -23.783 1.00 17.13  ? 300 ASP B O   1 
ATOM   5062  C CB  . ASP B 1 300 ? 10.818  11.128  -24.612 1.00 10.01  ? 300 ASP B CB  1 
ATOM   5063  C CG  . ASP B 1 300 ? 10.244  12.522  -24.668 1.00 9.46   ? 300 ASP B CG  1 
ATOM   5064  O OD1 . ASP B 1 300 ? 10.972  13.494  -25.098 1.00 6.53   ? 300 ASP B OD1 1 
ATOM   5065  O OD2 . ASP B 1 300 ? 9.075   12.612  -24.261 1.00 7.06   ? 300 ASP B OD2 1 
ATOM   5066  N N   . ALA B 1 301 ? 12.554  8.645   -25.445 1.00 11.83  ? 301 ALA B N   1 
ATOM   5067  C CA  . ALA B 1 301 ? 13.105  7.363   -25.099 1.00 12.31  ? 301 ALA B CA  1 
ATOM   5068  C C   . ALA B 1 301 ? 14.558  7.306   -25.575 1.00 15.55  ? 301 ALA B C   1 
ATOM   5069  O O   . ALA B 1 301 ? 15.452  6.801   -24.880 1.00 15.46  ? 301 ALA B O   1 
ATOM   5070  C CB  . ALA B 1 301 ? 12.260  6.256   -25.735 1.00 13.29  ? 301 ALA B CB  1 
ATOM   5071  N N   . PHE B 1 302 ? 14.801  7.848   -26.761 1.00 10.91  ? 302 PHE B N   1 
ATOM   5072  C CA  . PHE B 1 302 ? 16.175  7.954   -27.238 1.00 9.83   ? 302 PHE B CA  1 
ATOM   5073  C C   . PHE B 1 302 ? 17.053  8.552   -26.159 1.00 13.33  ? 302 PHE B C   1 
ATOM   5074  O O   . PHE B 1 302 ? 17.996  7.904   -25.722 1.00 15.52  ? 302 PHE B O   1 
ATOM   5075  C CB  . PHE B 1 302 ? 16.307  8.792   -28.500 1.00 11.64  ? 302 PHE B CB  1 
ATOM   5076  C CG  . PHE B 1 302 ? 17.730  8.969   -28.938 1.00 12.92  ? 302 PHE B CG  1 
ATOM   5077  C CD1 . PHE B 1 302 ? 18.342  8.042   -29.753 1.00 15.31  ? 302 PHE B CD1 1 
ATOM   5078  C CD2 . PHE B 1 302 ? 18.503  9.970   -28.382 1.00 13.98  ? 302 PHE B CD2 1 
ATOM   5079  C CE1 . PHE B 1 302 ? 19.697  8.136   -29.994 1.00 16.68  ? 302 PHE B CE1 1 
ATOM   5080  C CE2 . PHE B 1 302 ? 19.828  10.090  -28.669 1.00 15.54  ? 302 PHE B CE2 1 
ATOM   5081  C CZ  . PHE B 1 302 ? 20.430  9.173   -29.478 1.00 13.84  ? 302 PHE B CZ  1 
ATOM   5082  N N   . VAL B 1 303 ? 16.719  9.765   -25.700 1.00 10.31  ? 303 VAL B N   1 
ATOM   5083  C CA  . VAL B 1 303 ? 17.475  10.488  -24.619 1.00 9.44   ? 303 VAL B CA  1 
ATOM   5084  C C   . VAL B 1 303 ? 17.649  9.681   -23.299 1.00 16.92  ? 303 VAL B C   1 
ATOM   5085  O O   . VAL B 1 303 ? 18.730  9.655   -22.737 1.00 17.17  ? 303 VAL B O   1 
ATOM   5086  C CB  . VAL B 1 303 ? 16.764  11.832  -24.209 1.00 10.41  ? 303 VAL B CB  1 
ATOM   5087  C CG1 . VAL B 1 303 ? 17.542  12.518  -23.086 1.00 9.86   ? 303 VAL B CG1 1 
ATOM   5088  C CG2 . VAL B 1 303 ? 16.504  12.769  -25.397 1.00 8.38   ? 303 VAL B CG2 1 
ATOM   5089  N N   . GLY B 1 304 ? 16.571  9.060   -22.794 1.00 14.75  ? 304 GLY B N   1 
ATOM   5090  C CA  . GLY B 1 304 ? 16.657  8.205   -21.600 1.00 13.94  ? 304 GLY B CA  1 
ATOM   5091  C C   . GLY B 1 304 ? 17.650  7.033   -21.846 1.00 16.92  ? 304 GLY B C   1 
ATOM   5092  O O   . GLY B 1 304 ? 18.471  6.736   -21.019 1.00 16.66  ? 304 GLY B O   1 
ATOM   5093  N N   . GLY B 1 305 ? 17.599  6.384   -22.998 1.00 14.46  ? 305 GLY B N   1 
ATOM   5094  C CA  . GLY B 1 305 ? 18.561  5.334   -23.303 1.00 14.75  ? 305 GLY B CA  1 
ATOM   5095  C C   . GLY B 1 305 ? 19.978  5.905   -23.357 1.00 17.85  ? 305 GLY B C   1 
ATOM   5096  O O   . GLY B 1 305 ? 20.920  5.266   -22.860 1.00 17.49  ? 305 GLY B O   1 
ATOM   5097  N N   . PHE B 1 306 ? 20.131  7.110   -23.930 1.00 11.74  ? 306 PHE B N   1 
ATOM   5098  C CA  . PHE B 1 306 ? 21.459  7.744   -24.035 1.00 9.18   ? 306 PHE B CA  1 
ATOM   5099  C C   . PHE B 1 306 ? 21.980  8.033   -22.628 1.00 17.06  ? 306 PHE B C   1 
ATOM   5100  O O   . PHE B 1 306 ? 23.074  7.645   -22.256 1.00 17.66  ? 306 PHE B O   1 
ATOM   5101  C CB  . PHE B 1 306 ? 21.363  9.046   -24.827 1.00 9.75   ? 306 PHE B CB  1 
ATOM   5102  C CG  . PHE B 1 306 ? 22.693  9.694   -25.099 1.00 10.00  ? 306 PHE B CG  1 
ATOM   5103  C CD1 . PHE B 1 306 ? 23.387  10.352  -24.099 1.00 12.28  ? 306 PHE B CD1 1 
ATOM   5104  C CD2 . PHE B 1 306 ? 23.277  9.618   -26.358 1.00 10.53  ? 306 PHE B CD2 1 
ATOM   5105  C CE1 . PHE B 1 306 ? 24.669  10.883  -24.320 1.00 10.63  ? 306 PHE B CE1 1 
ATOM   5106  C CE2 . PHE B 1 306 ? 24.510  10.178  -26.592 1.00 11.95  ? 306 PHE B CE2 1 
ATOM   5107  C CZ  . PHE B 1 306 ? 25.168  10.882  -25.578 1.00 9.68   ? 306 PHE B CZ  1 
ATOM   5108  N N   . LEU B 1 307 ? 21.134  8.671   -21.828 1.00 17.15  ? 307 LEU B N   1 
ATOM   5109  C CA  . LEU B 1 307 ? 21.434  9.027   -20.453 1.00 18.31  ? 307 LEU B CA  1 
ATOM   5110  C C   . LEU B 1 307 ? 21.776  7.815   -19.576 1.00 24.16  ? 307 LEU B C   1 
ATOM   5111  O O   . LEU B 1 307 ? 22.687  7.911   -18.733 1.00 24.19  ? 307 LEU B O   1 
ATOM   5112  C CB  . LEU B 1 307 ? 20.252  9.816   -19.861 1.00 18.48  ? 307 LEU B CB  1 
ATOM   5113  C CG  . LEU B 1 307 ? 19.831  11.181  -20.465 1.00 21.85  ? 307 LEU B CG  1 
ATOM   5114  C CD1 . LEU B 1 307 ? 18.621  11.729  -19.691 1.00 21.57  ? 307 LEU B CD1 1 
ATOM   5115  C CD2 . LEU B 1 307 ? 20.941  12.198  -20.394 1.00 19.03  ? 307 LEU B CD2 1 
ATOM   5116  N N   . SER B 1 308 ? 21.019  6.722   -19.747 1.00 20.26  ? 308 SER B N   1 
ATOM   5117  C CA  . SER B 1 308 ? 21.241  5.451   -19.044 1.00 21.09  ? 308 SER B CA  1 
ATOM   5118  C C   . SER B 1 308 ? 22.671  4.912   -19.092 1.00 25.60  ? 308 SER B C   1 
ATOM   5119  O O   . SER B 1 308 ? 23.087  4.229   -18.169 1.00 25.27  ? 308 SER B O   1 
ATOM   5120  C CB  . SER B 1 308 ? 20.297  4.337   -19.556 1.00 22.20  ? 308 SER B CB  1 
ATOM   5121  O OG  . SER B 1 308 ? 20.885  3.631   -20.638 1.00 19.31  ? 308 SER B OG  1 
ATOM   5122  N N   . GLN B 1 309 ? 23.377  5.165   -20.193 1.00 22.15  ? 309 GLN B N   1 
ATOM   5123  C CA  . GLN B 1 309 ? 24.744  4.705   -20.367 1.00 21.91  ? 309 GLN B CA  1 
ATOM   5124  C C   . GLN B 1 309 ? 25.753  5.760   -19.923 1.00 29.24  ? 309 GLN B C   1 
ATOM   5125  O O   . GLN B 1 309 ? 26.742  5.436   -19.282 1.00 31.02  ? 309 GLN B O   1 
ATOM   5126  C CB  . GLN B 1 309 ? 24.996  4.302   -21.841 1.00 22.42  ? 309 GLN B CB  1 
ATOM   5127  C CG  . GLN B 1 309 ? 24.115  3.107   -22.333 1.00 7.61   ? 309 GLN B CG  1 
ATOM   5128  C CD  . GLN B 1 309 ? 24.233  1.903   -21.414 1.00 23.46  ? 309 GLN B CD  1 
ATOM   5129  O OE1 . GLN B 1 309 ? 25.352  1.482   -21.114 1.00 14.73  ? 309 GLN B OE1 1 
ATOM   5130  N NE2 . GLN B 1 309 ? 23.100  1.463   -20.830 1.00 18.70  ? 309 GLN B NE2 1 
ATOM   5131  N N   . LEU B 1 310 ? 25.498  7.007   -20.313 1.00 27.27  ? 310 LEU B N   1 
ATOM   5132  C CA  . LEU B 1 310 ? 26.350  8.191   -20.103 1.00 26.72  ? 310 LEU B CA  1 
ATOM   5133  C C   . LEU B 1 310 ? 26.624  8.385   -18.647 1.00 29.23  ? 310 LEU B C   1 
ATOM   5134  O O   . LEU B 1 310 ? 27.585  9.062   -18.256 1.00 26.89  ? 310 LEU B O   1 
ATOM   5135  C CB  . LEU B 1 310 ? 25.565  9.427   -20.577 1.00 27.52  ? 310 LEU B CB  1 
ATOM   5136  C CG  . LEU B 1 310 ? 26.213  10.773  -20.942 1.00 31.53  ? 310 LEU B CG  1 
ATOM   5137  C CD1 . LEU B 1 310 ? 25.752  11.971  -20.119 1.00 29.95  ? 310 LEU B CD1 1 
ATOM   5138  C CD2 . LEU B 1 310 ? 27.691  10.674  -21.024 1.00 30.32  ? 310 LEU B CD2 1 
ATOM   5139  N N   . VAL B 1 311 ? 25.686  7.869   -17.862 1.00 27.39  ? 311 VAL B N   1 
ATOM   5140  C CA  . VAL B 1 311 ? 25.656  8.000   -16.410 1.00 27.57  ? 311 VAL B CA  1 
ATOM   5141  C C   . VAL B 1 311 ? 26.714  7.108   -15.762 1.00 33.15  ? 311 VAL B C   1 
ATOM   5142  O O   . VAL B 1 311 ? 27.130  7.314   -14.592 1.00 32.41  ? 311 VAL B O   1 
ATOM   5143  C CB  . VAL B 1 311 ? 24.257  7.651   -15.928 1.00 30.86  ? 311 VAL B CB  1 
ATOM   5144  C CG1 . VAL B 1 311 ? 24.216  6.305   -15.298 1.00 30.43  ? 311 VAL B CG1 1 
ATOM   5145  C CG2 . VAL B 1 311 ? 23.729  8.734   -15.067 1.00 31.10  ? 311 VAL B CG2 1 
ATOM   5146  N N   . SER B 1 312 ? 27.170  6.137   -16.558 1.00 29.21  ? 312 SER B N   1 
ATOM   5147  C CA  . SER B 1 312 ? 28.251  5.233   -16.169 1.00 29.08  ? 312 SER B CA  1 
ATOM   5148  C C   . SER B 1 312 ? 29.435  5.321   -17.111 1.00 34.05  ? 312 SER B C   1 
ATOM   5149  O O   . SER B 1 312 ? 30.143  4.336   -17.307 1.00 35.59  ? 312 SER B O   1 
ATOM   5150  C CB  . SER B 1 312 ? 27.779  3.793   -16.065 1.00 32.67  ? 312 SER B CB  1 
ATOM   5151  O OG  . SER B 1 312 ? 27.374  3.308   -17.329 1.00 44.39  ? 312 SER B OG  1 
ATOM   5152  N N   . ASP B 1 313 ? 29.636  6.493   -17.709 1.00 29.69  ? 313 ASP B N   1 
ATOM   5153  C CA  . ASP B 1 313 ? 30.782  6.736   -18.572 1.00 28.57  ? 313 ASP B CA  1 
ATOM   5154  C C   . ASP B 1 313 ? 30.990  5.874   -19.790 1.00 30.79  ? 313 ASP B C   1 
ATOM   5155  O O   . ASP B 1 313 ? 32.121  5.716   -20.219 1.00 32.12  ? 313 ASP B O   1 
ATOM   5156  C CB  . ASP B 1 313 ? 32.047  6.686   -17.749 1.00 30.91  ? 313 ASP B CB  1 
ATOM   5157  C CG  . ASP B 1 313 ? 32.477  8.049   -17.289 1.00 56.29  ? 313 ASP B CG  1 
ATOM   5158  O OD1 . ASP B 1 313 ? 33.505  8.533   -17.836 1.00 58.82  ? 313 ASP B OD1 1 
ATOM   5159  O OD2 . ASP B 1 313 ? 31.738  8.658   -16.464 1.00 65.00  ? 313 ASP B OD2 1 
ATOM   5160  N N   . LYS B 1 314 ? 29.937  5.308   -20.366 1.00 26.58  ? 314 LYS B N   1 
ATOM   5161  C CA  . LYS B 1 314 ? 30.129  4.452   -21.543 1.00 26.07  ? 314 LYS B CA  1 
ATOM   5162  C C   . LYS B 1 314 ? 30.488  5.305   -22.742 1.00 31.57  ? 314 LYS B C   1 
ATOM   5163  O O   . LYS B 1 314 ? 30.162  6.470   -22.789 1.00 33.07  ? 314 LYS B O   1 
ATOM   5164  C CB  . LYS B 1 314 ? 28.897  3.583   -21.867 1.00 27.36  ? 314 LYS B CB  1 
ATOM   5165  C CG  . LYS B 1 314 ? 28.457  2.696   -20.755 1.00 28.75  ? 314 LYS B CG  1 
ATOM   5166  C CD  . LYS B 1 314 ? 29.531  1.676   -20.463 1.00 47.24  ? 314 LYS B CD  1 
ATOM   5167  C CE  . LYS B 1 314 ? 29.158  0.761   -19.294 1.00 54.74  ? 314 LYS B CE  1 
ATOM   5168  N NZ  . LYS B 1 314 ? 29.819  1.154   -18.010 1.00 64.14  ? 314 LYS B NZ  1 
ATOM   5169  N N   . PRO B 1 315 ? 31.126  4.713   -23.740 1.00 30.11  ? 315 PRO B N   1 
ATOM   5170  C CA  . PRO B 1 315 ? 31.498  5.482   -24.921 1.00 29.28  ? 315 PRO B CA  1 
ATOM   5171  C C   . PRO B 1 315 ? 30.256  6.035   -25.624 1.00 31.12  ? 315 PRO B C   1 
ATOM   5172  O O   . PRO B 1 315 ? 29.236  5.357   -25.712 1.00 33.77  ? 315 PRO B O   1 
ATOM   5173  C CB  . PRO B 1 315 ? 32.199  4.432   -25.811 1.00 30.71  ? 315 PRO B CB  1 
ATOM   5174  C CG  . PRO B 1 315 ? 32.412  3.206   -24.946 1.00 34.08  ? 315 PRO B CG  1 
ATOM   5175  C CD  . PRO B 1 315 ? 31.338  3.258   -23.939 1.00 30.28  ? 315 PRO B CD  1 
ATOM   5176  N N   . LEU B 1 316 ? 30.336  7.262   -26.131 1.00 21.57  ? 316 LEU B N   1 
ATOM   5177  C CA  . LEU B 1 316 ? 29.213  7.863   -26.868 1.00 18.12  ? 316 LEU B CA  1 
ATOM   5178  C C   . LEU B 1 316 ? 28.525  6.924   -27.901 1.00 21.02  ? 316 LEU B C   1 
ATOM   5179  O O   . LEU B 1 316 ? 27.315  7.069   -28.196 1.00 24.17  ? 316 LEU B O   1 
ATOM   5180  C CB  . LEU B 1 316 ? 29.687  9.121   -27.586 1.00 16.50  ? 316 LEU B CB  1 
ATOM   5181  C CG  . LEU B 1 316 ? 30.288  10.292  -26.809 1.00 17.05  ? 316 LEU B CG  1 
ATOM   5182  C CD1 . LEU B 1 316 ? 30.851  11.294  -27.774 1.00 11.80  ? 316 LEU B CD1 1 
ATOM   5183  C CD2 . LEU B 1 316 ? 29.148  10.951  -25.927 1.00 21.25  ? 316 LEU B CD2 1 
ATOM   5184  N N   . THR B 1 317 ? 29.280  5.971   -28.449 1.00 11.93  ? 317 THR B N   1 
ATOM   5185  C CA  . THR B 1 317 ? 28.770  5.053   -29.491 1.00 11.85  ? 317 THR B CA  1 
ATOM   5186  C C   . THR B 1 317 ? 27.817  4.109   -28.823 1.00 17.37  ? 317 THR B C   1 
ATOM   5187  O O   . THR B 1 317 ? 26.772  3.758   -29.338 1.00 16.57  ? 317 THR B O   1 
ATOM   5188  C CB  . THR B 1 317 ? 29.949  4.233   -30.133 1.00 24.27  ? 317 THR B CB  1 
ATOM   5189  O OG1 . THR B 1 317 ? 30.728  5.086   -30.978 1.00 22.49  ? 317 THR B OG1 1 
ATOM   5190  C CG2 . THR B 1 317 ? 29.461  3.023   -30.927 1.00 20.64  ? 317 THR B CG2 1 
ATOM   5191  N N   . GLU B 1 318 ? 28.166  3.771   -27.602 1.00 19.06  ? 318 GLU B N   1 
ATOM   5192  C CA  . GLU B 1 318 ? 27.353  2.924   -26.775 1.00 20.68  ? 318 GLU B CA  1 
ATOM   5193  C C   . GLU B 1 318 ? 26.094  3.655   -26.243 1.00 24.33  ? 318 GLU B C   1 
ATOM   5194  O O   . GLU B 1 318 ? 25.014  3.066   -26.172 1.00 23.64  ? 318 GLU B O   1 
ATOM   5195  C CB  . GLU B 1 318 ? 28.236  2.397   -25.647 1.00 23.18  ? 318 GLU B CB  1 
ATOM   5196  C CG  . GLU B 1 318 ? 27.617  1.233   -24.912 1.00 40.71  ? 318 GLU B CG  1 
ATOM   5197  C CD  . GLU B 1 318 ? 27.539  0.003   -25.763 1.00 47.12  ? 318 GLU B CD  1 
ATOM   5198  O OE1 . GLU B 1 318 ? 28.269  -0.085  -26.761 1.00 29.57  ? 318 GLU B OE1 1 
ATOM   5199  O OE2 . GLU B 1 318 ? 26.758  -0.897  -25.417 1.00 49.17  ? 318 GLU B OE2 1 
ATOM   5200  N N   . CYS B 1 319 ? 26.223  4.950   -25.942 1.00 20.95  ? 319 CYS B N   1 
ATOM   5201  C CA  . CYS B 1 319 ? 25.074  5.771   -25.533 1.00 19.92  ? 319 CYS B CA  1 
ATOM   5202  C C   . CYS B 1 319 ? 24.077  5.841   -26.688 1.00 19.00  ? 319 CYS B C   1 
ATOM   5203  O O   . CYS B 1 319 ? 22.895  5.547   -26.531 1.00 14.91  ? 319 CYS B O   1 
ATOM   5204  C CB  . CYS B 1 319 ? 25.547  7.179   -25.203 1.00 20.94  ? 319 CYS B CB  1 
ATOM   5205  S SG  . CYS B 1 319 ? 26.836  7.214   -23.932 1.00 25.32  ? 319 CYS B SG  1 
ATOM   5206  N N   . ILE B 1 320 ? 24.584  6.196   -27.870 1.00 14.84  ? 320 ILE B N   1 
ATOM   5207  C CA  . ILE B 1 320 ? 23.733  6.270   -29.068 1.00 12.40  ? 320 ILE B CA  1 
ATOM   5208  C C   . ILE B 1 320 ? 23.046  4.950   -29.329 1.00 19.04  ? 320 ILE B C   1 
ATOM   5209  O O   . ILE B 1 320 ? 21.907  4.916   -29.786 1.00 20.59  ? 320 ILE B O   1 
ATOM   5210  C CB  . ILE B 1 320 ? 24.558  6.652   -30.294 1.00 14.00  ? 320 ILE B CB  1 
ATOM   5211  C CG1 . ILE B 1 320 ? 25.139  8.048   -30.111 1.00 13.47  ? 320 ILE B CG1 1 
ATOM   5212  C CG2 . ILE B 1 320 ? 23.739  6.526   -31.571 1.00 16.28  ? 320 ILE B CG2 1 
ATOM   5213  C CD1 . ILE B 1 320 ? 24.891  8.927   -31.242 1.00 11.09  ? 320 ILE B CD1 1 
ATOM   5214  N N   . ARG B 1 321 ? 23.756  3.864   -29.038 1.00 18.23  ? 321 ARG B N   1 
ATOM   5215  C CA  . ARG B 1 321 ? 23.242  2.526   -29.253 1.00 19.17  ? 321 ARG B CA  1 
ATOM   5216  C C   . ARG B 1 321 ? 22.066  2.234   -28.302 1.00 24.65  ? 321 ARG B C   1 
ATOM   5217  O O   . ARG B 1 321 ? 21.018  1.752   -28.788 1.00 24.71  ? 321 ARG B O   1 
ATOM   5218  C CB  . ARG B 1 321 ? 24.371  1.492   -29.121 1.00 19.89  ? 321 ARG B CB  1 
ATOM   5219  C CG  . ARG B 1 321 ? 24.287  0.280   -30.070 1.00 23.27  ? 321 ARG B CG  1 
ATOM   5220  C CD  . ARG B 1 321 ? 25.272  -0.880  -29.710 1.00 10.68  ? 321 ARG B CD  1 
ATOM   5221  N NE  . ARG B 1 321 ? 24.627  -1.851  -28.818 1.00 31.86  ? 321 ARG B NE  1 
ATOM   5222  C CZ  . ARG B 1 321 ? 25.175  -2.333  -27.700 1.00 58.46  ? 321 ARG B CZ  1 
ATOM   5223  N NH1 . ARG B 1 321 ? 26.419  -1.999  -27.370 1.00 59.63  ? 321 ARG B NH1 1 
ATOM   5224  N NH2 . ARG B 1 321 ? 24.514  -3.203  -26.944 1.00 38.16  ? 321 ARG B NH2 1 
ATOM   5225  N N   . ALA B 1 322 ? 22.194  2.613   -27.003 1.00 18.06  ? 322 ALA B N   1 
ATOM   5226  C CA  . ALA B 1 322 ? 21.099  2.440   -26.009 1.00 16.26  ? 322 ALA B CA  1 
ATOM   5227  C C   . ALA B 1 322 ? 19.917  3.350   -26.280 1.00 19.57  ? 322 ALA B C   1 
ATOM   5228  O O   . ALA B 1 322 ? 18.765  2.985   -26.022 1.00 22.29  ? 322 ALA B O   1 
ATOM   5229  C CB  . ALA B 1 322 ? 21.593  2.635   -24.574 1.00 16.80  ? 322 ALA B CB  1 
ATOM   5230  N N   . GLY B 1 323 ? 20.204  4.526   -26.825 1.00 12.63  ? 323 GLY B N   1 
ATOM   5231  C CA  . GLY B 1 323 ? 19.158  5.453   -27.216 1.00 13.08  ? 323 GLY B CA  1 
ATOM   5232  C C   . GLY B 1 323 ? 18.322  4.840   -28.377 1.00 19.73  ? 323 GLY B C   1 
ATOM   5233  O O   . GLY B 1 323 ? 17.057  4.888   -28.367 1.00 18.01  ? 323 GLY B O   1 
ATOM   5234  N N   . HIS B 1 324 ? 19.011  4.267   -29.363 1.00 15.42  ? 324 HIS B N   1 
ATOM   5235  C CA  . HIS B 1 324 ? 18.294  3.613   -30.460 1.00 15.49  ? 324 HIS B CA  1 
ATOM   5236  C C   . HIS B 1 324 ? 17.477  2.459   -29.934 1.00 23.51  ? 324 HIS B C   1 
ATOM   5237  O O   . HIS B 1 324 ? 16.323  2.288   -30.293 1.00 26.25  ? 324 HIS B O   1 
ATOM   5238  C CB  . HIS B 1 324 ? 19.247  3.133   -31.566 1.00 15.43  ? 324 HIS B CB  1 
ATOM   5239  C CG  . HIS B 1 324 ? 19.791  4.244   -32.415 1.00 18.24  ? 324 HIS B CG  1 
ATOM   5240  N ND1 . HIS B 1 324 ? 19.055  5.365   -32.747 1.00 19.53  ? 324 HIS B ND1 1 
ATOM   5241  C CD2 . HIS B 1 324 ? 21.013  4.416   -32.975 1.00 20.54  ? 324 HIS B CD2 1 
ATOM   5242  C CE1 . HIS B 1 324 ? 19.806  6.183   -33.461 1.00 19.96  ? 324 HIS B CE1 1 
ATOM   5243  N NE2 . HIS B 1 324 ? 21.004  5.637   -33.603 1.00 20.49  ? 324 HIS B NE2 1 
ATOM   5244  N N   . TYR B 1 325 ? 18.062  1.691   -29.026 1.00 21.16  ? 325 TYR B N   1 
ATOM   5245  C CA  . TYR B 1 325 ? 17.358  0.552   -28.463 1.00 19.64  ? 325 TYR B CA  1 
ATOM   5246  C C   . TYR B 1 325 ? 16.078  1.026   -27.743 1.00 24.94  ? 325 TYR B C   1 
ATOM   5247  O O   . TYR B 1 325 ? 14.981  0.539   -28.054 1.00 26.46  ? 325 TYR B O   1 
ATOM   5248  C CB  . TYR B 1 325 ? 18.284  -0.275  -27.554 1.00 18.65  ? 325 TYR B CB  1 
ATOM   5249  C CG  . TYR B 1 325 ? 17.503  -1.262  -26.729 1.00 18.46  ? 325 TYR B CG  1 
ATOM   5250  C CD1 . TYR B 1 325 ? 16.875  -2.345  -27.326 1.00 19.66  ? 325 TYR B CD1 1 
ATOM   5251  C CD2 . TYR B 1 325 ? 17.232  -1.006  -25.387 1.00 19.87  ? 325 TYR B CD2 1 
ATOM   5252  C CE1 . TYR B 1 325 ? 16.087  -3.199  -26.593 1.00 21.04  ? 325 TYR B CE1 1 
ATOM   5253  C CE2 . TYR B 1 325 ? 16.400  -1.845  -24.644 1.00 20.64  ? 325 TYR B CE2 1 
ATOM   5254  C CZ  . TYR B 1 325 ? 15.821  -2.916  -25.255 1.00 29.11  ? 325 TYR B CZ  1 
ATOM   5255  O OH  . TYR B 1 325 ? 15.038  -3.729  -24.475 1.00 33.33  ? 325 TYR B OH  1 
ATOM   5256  N N   . ALA B 1 326 ? 16.225  1.951   -26.780 1.00 19.52  ? 326 ALA B N   1 
ATOM   5257  C CA  . ALA B 1 326 ? 15.093  2.559   -26.057 1.00 19.27  ? 326 ALA B CA  1 
ATOM   5258  C C   . ALA B 1 326 ? 13.991  2.992   -27.013 1.00 21.84  ? 326 ALA B C   1 
ATOM   5259  O O   . ALA B 1 326 ? 12.829  2.685   -26.830 1.00 23.62  ? 326 ALA B O   1 
ATOM   5260  C CB  . ALA B 1 326 ? 15.569  3.805   -25.307 1.00 21.15  ? 326 ALA B CB  1 
ATOM   5261  N N   . ALA B 1 327 ? 14.353  3.756   -28.031 1.00 16.44  ? 327 ALA B N   1 
ATOM   5262  C CA  . ALA B 1 327 ? 13.355  4.216   -28.970 1.00 15.64  ? 327 ALA B CA  1 
ATOM   5263  C C   . ALA B 1 327 ? 12.506  3.117   -29.643 1.00 20.72  ? 327 ALA B C   1 
ATOM   5264  O O   . ALA B 1 327 ? 11.296  3.298   -29.832 1.00 20.95  ? 327 ALA B O   1 
ATOM   5265  C CB  . ALA B 1 327 ? 13.955  5.177   -29.976 1.00 15.85  ? 327 ALA B CB  1 
ATOM   5266  N N   . SER B 1 328 ? 13.117  1.966   -29.930 1.00 18.18  ? 328 SER B N   1 
ATOM   5267  C CA  . SER B 1 328 ? 12.455  0.828   -30.592 1.00 17.70  ? 328 SER B CA  1 
ATOM   5268  C C   . SER B 1 328 ? 11.589  -0.017  -29.691 1.00 25.65  ? 328 SER B C   1 
ATOM   5269  O O   . SER B 1 328 ? 10.746  -0.753  -30.171 1.00 24.88  ? 328 SER B O   1 
ATOM   5270  C CB  . SER B 1 328 ? 13.500  -0.075  -31.255 1.00 18.54  ? 328 SER B CB  1 
ATOM   5271  O OG  . SER B 1 328 ? 14.388  -0.659  -30.316 1.00 20.68  ? 328 SER B OG  1 
ATOM   5272  N N   . ILE B 1 329 ? 11.825  0.075   -28.384 1.00 26.00  ? 329 ILE B N   1 
ATOM   5273  C CA  . ILE B 1 329 ? 11.135  -0.759  -27.408 1.00 27.09  ? 329 ILE B CA  1 
ATOM   5274  C C   . ILE B 1 329 ? 10.032  0.017   -26.767 1.00 33.85  ? 329 ILE B C   1 
ATOM   5275  O O   . ILE B 1 329 ? 8.883   -0.204  -27.044 1.00 34.25  ? 329 ILE B O   1 
ATOM   5276  C CB  . ILE B 1 329 ? 12.122  -1.269  -26.302 1.00 30.59  ? 329 ILE B CB  1 
ATOM   5277  C CG1 . ILE B 1 329 ? 13.177  -2.196  -26.917 1.00 31.49  ? 329 ILE B CG1 1 
ATOM   5278  C CG2 . ILE B 1 329 ? 11.393  -2.038  -25.218 1.00 30.27  ? 329 ILE B CG2 1 
ATOM   5279  C CD1 . ILE B 1 329 ? 12.580  -3.440  -27.571 1.00 40.65  ? 329 ILE B CD1 1 
ATOM   5280  N N   . ILE B 1 330 ? 10.399  0.956   -25.909 1.00 34.55  ? 330 ILE B N   1 
ATOM   5281  C CA  . ILE B 1 330 ? 9.403   1.789   -25.234 1.00 35.23  ? 330 ILE B CA  1 
ATOM   5282  C C   . ILE B 1 330 ? 8.496   2.597   -26.182 1.00 44.44  ? 330 ILE B C   1 
ATOM   5283  O O   . ILE B 1 330 ? 8.860   3.706   -26.643 1.00 43.51  ? 330 ILE B O   1 
ATOM   5284  C CB  . ILE B 1 330 ? 10.011  2.617   -24.092 1.00 35.37  ? 330 ILE B CB  1 
ATOM   5285  C CG1 . ILE B 1 330 ? 10.897  1.706   -23.227 1.00 32.97  ? 330 ILE B CG1 1 
ATOM   5286  C CG2 . ILE B 1 330 ? 8.881   3.105   -23.228 1.00 34.54  ? 330 ILE B CG2 1 
ATOM   5287  C CD1 . ILE B 1 330 ? 10.079  0.713   -22.325 1.00 16.38  ? 330 ILE B CD1 1 
ATOM   5288  N N   . ILE B 1 331 ? 7.365   1.972   -26.535 1.00 44.28  ? 331 ILE B N   1 
ATOM   5289  C CA  . ILE B 1 331 ? 6.426   2.515   -27.515 1.00 45.10  ? 331 ILE B CA  1 
ATOM   5290  C C   . ILE B 1 331 ? 5.019   2.625   -26.994 1.00 51.88  ? 331 ILE B C   1 
ATOM   5291  O O   . ILE B 1 331 ? 4.317   1.625   -26.904 1.00 52.29  ? 331 ILE B O   1 
ATOM   5292  C CB  . ILE B 1 331 ? 6.348   1.649   -28.762 1.00 47.57  ? 331 ILE B CB  1 
ATOM   5293  C CG1 . ILE B 1 331 ? 7.759   1.335   -29.281 1.00 48.21  ? 331 ILE B CG1 1 
ATOM   5294  C CG2 . ILE B 1 331 ? 5.495   2.344   -29.797 1.00 47.66  ? 331 ILE B CG2 1 
ATOM   5295  C CD1 . ILE B 1 331 ? 7.979   -0.129  -29.664 1.00 53.89  ? 331 ILE B CD1 1 
ATOM   5296  N N   . ARG B 1 332 ? 4.576   3.849   -26.726 1.00 49.15  ? 332 ARG B N   1 
ATOM   5297  C CA  . ARG B 1 332 ? 3.208   4.031   -26.287 1.00 49.37  ? 332 ARG B CA  1 
ATOM   5298  C C   . ARG B 1 332 ? 2.225   3.799   -27.448 1.00 54.27  ? 332 ARG B C   1 
ATOM   5299  O O   . ARG B 1 332 ? 2.518   4.145   -28.592 1.00 53.25  ? 332 ARG B O   1 
ATOM   5300  C CB  . ARG B 1 332 ? 3.000   5.381   -25.590 1.00 50.39  ? 332 ARG B CB  1 
ATOM   5301  C CG  . ARG B 1 332 ? 2.428   5.224   -24.172 1.00 60.15  ? 332 ARG B CG  1 
ATOM   5302  C CD  . ARG B 1 332 ? 2.546   6.489   -23.346 1.00 65.71  ? 332 ARG B CD  1 
ATOM   5303  N NE  . ARG B 1 332 ? 1.541   7.471   -23.726 1.00 66.13  ? 332 ARG B NE  1 
ATOM   5304  C CZ  . ARG B 1 332 ? 1.600   8.759   -23.397 1.00 64.57  ? 332 ARG B CZ  1 
ATOM   5305  N NH1 . ARG B 1 332 ? 2.650   9.223   -22.682 1.00 21.52  ? 332 ARG B NH1 1 
ATOM   5306  N NH2 . ARG B 1 332 ? 0.621   9.575   -23.789 1.00 46.61  ? 332 ARG B NH2 1 
ATOM   5307  N N   . ARG B 1 333 ? 1.089   3.158   -27.153 1.00 51.63  ? 333 ARG B N   1 
ATOM   5308  C CA  . ARG B 1 333 ? 0.103   2.821   -28.182 1.00 50.81  ? 333 ARG B CA  1 
ATOM   5309  C C   . ARG B 1 333 ? -1.336  3.135   -27.829 1.00 53.74  ? 333 ARG B C   1 
ATOM   5310  O O   . ARG B 1 333 ? -1.684  3.233   -26.657 1.00 54.06  ? 333 ARG B O   1 
ATOM   5311  C CB  . ARG B 1 333 ? 0.236   1.353   -28.555 1.00 48.15  ? 333 ARG B CB  1 
ATOM   5312  C CG  . ARG B 1 333 ? 1.624   1.002   -28.957 1.00 57.57  ? 333 ARG B CG  1 
ATOM   5313  C CD  . ARG B 1 333 ? 1.746   1.039   -30.458 1.00 77.54  ? 333 ARG B CD  1 
ATOM   5314  N NE  . ARG B 1 333 ? 0.990   -0.044  -31.086 1.00 97.43  ? 333 ARG B NE  1 
ATOM   5315  C CZ  . ARG B 1 333 ? -0.207  0.103   -31.647 1.00 115.47 ? 333 ARG B CZ  1 
ATOM   5316  N NH1 . ARG B 1 333 ? -0.783  1.299   -31.681 1.00 105.81 ? 333 ARG B NH1 1 
ATOM   5317  N NH2 . ARG B 1 333 ? -0.821  -0.937  -32.201 1.00 101.85 ? 333 ARG B NH2 1 
ATOM   5318  N N   . THR B 1 334 ? -2.178  3.254   -28.851 1.00 49.16  ? 334 THR B N   1 
ATOM   5319  C CA  . THR B 1 334 ? -3.591  3.570   -28.636 1.00 49.18  ? 334 THR B CA  1 
ATOM   5320  C C   . THR B 1 334 ? -4.447  2.325   -28.441 1.00 47.64  ? 334 THR B C   1 
ATOM   5321  O O   . THR B 1 334 ? -4.106  1.248   -28.912 1.00 43.92  ? 334 THR B O   1 
ATOM   5322  C CB  . THR B 1 334 ? -4.179  4.466   -29.772 1.00 65.16  ? 334 THR B CB  1 
ATOM   5323  O OG1 . THR B 1 334 ? -4.126  5.848   -29.379 1.00 70.05  ? 334 THR B OG1 1 
ATOM   5324  C CG2 . THR B 1 334 ? -5.623  4.084   -30.059 1.00 62.60  ? 334 THR B CG2 1 
ATOM   5325  N N   . GLY B 1 335 ? -5.513  2.470   -27.663 1.00 45.21  ? 335 GLY B N   1 
ATOM   5326  C CA  . GLY B 1 335 ? -6.434  1.372   -27.386 1.00 46.41  ? 335 GLY B CA  1 
ATOM   5327  C C   . GLY B 1 335 ? -5.896  0.231   -26.517 1.00 52.59  ? 335 GLY B C   1 
ATOM   5328  O O   . GLY B 1 335 ? -6.405  -0.894  -26.566 1.00 50.94  ? 335 GLY B O   1 
ATOM   5329  N N   . CYS B 1 336 ? -4.904  0.527   -25.688 1.00 51.80  ? 336 CYS B N   1 
ATOM   5330  C CA  . CYS B 1 336 ? -4.336  -0.515  -24.842 1.00 52.40  ? 336 CYS B CA  1 
ATOM   5331  C C   . CYS B 1 336 ? -5.192  -0.676  -23.595 1.00 57.75  ? 336 CYS B C   1 
ATOM   5332  O O   . CYS B 1 336 ? -5.795  -1.736  -23.371 1.00 57.70  ? 336 CYS B O   1 
ATOM   5333  C CB  . CYS B 1 336 ? -2.865  -0.234  -24.485 1.00 52.95  ? 336 CYS B CB  1 
ATOM   5334  S SG  . CYS B 1 336 ? -1.674  -0.224  -25.877 1.00 57.09  ? 336 CYS B SG  1 
ATOM   5335  N N   . THR B 1 337 ? -5.305  0.422   -22.844 1.00 54.48  ? 337 THR B N   1 
ATOM   5336  C CA  . THR B 1 337 ? -6.048  0.487   -21.578 1.00 54.29  ? 337 THR B CA  1 
ATOM   5337  C C   . THR B 1 337 ? -7.583  0.642   -21.649 1.00 57.54  ? 337 THR B C   1 
ATOM   5338  O O   . THR B 1 337 ? -8.138  1.309   -22.532 1.00 57.26  ? 337 THR B O   1 
ATOM   5339  C CB  . THR B 1 337 ? -5.462  1.584   -20.673 1.00 60.98  ? 337 THR B CB  1 
ATOM   5340  O OG1 . THR B 1 337 ? -5.952  2.866   -21.087 1.00 64.27  ? 337 THR B OG1 1 
ATOM   5341  C CG2 . THR B 1 337 ? -3.950  1.584   -20.799 1.00 57.45  ? 337 THR B CG2 1 
ATOM   5342  N N   . PHE B 1 338 ? -8.258  0.082   -20.652 1.00 52.72  ? 338 PHE B N   1 
ATOM   5343  C CA  . PHE B 1 338 ? -9.725  0.123   -20.595 1.00 51.66  ? 338 PHE B CA  1 
ATOM   5344  C C   . PHE B 1 338 ? -10.272 1.319   -19.789 1.00 51.74  ? 338 PHE B C   1 
ATOM   5345  O O   . PHE B 1 338 ? -9.726  1.688   -18.733 1.00 48.71  ? 338 PHE B O   1 
ATOM   5346  C CB  . PHE B 1 338 ? -10.275 -1.201  -20.043 1.00 53.40  ? 338 PHE B CB  1 
ATOM   5347  C CG  . PHE B 1 338 ? -9.574  -2.412  -20.587 1.00 56.14  ? 338 PHE B CG  1 
ATOM   5348  C CD1 . PHE B 1 338 ? -9.227  -3.473  -19.749 1.00 60.43  ? 338 PHE B CD1 1 
ATOM   5349  C CD2 . PHE B 1 338 ? -9.213  -2.467  -21.932 1.00 59.43  ? 338 PHE B CD2 1 
ATOM   5350  C CE1 . PHE B 1 338 ? -8.562  -4.589  -20.247 1.00 61.89  ? 338 PHE B CE1 1 
ATOM   5351  C CE2 . PHE B 1 338 ? -8.554  -3.577  -22.450 1.00 63.03  ? 338 PHE B CE2 1 
ATOM   5352  C CZ  . PHE B 1 338 ? -8.221  -4.645  -21.608 1.00 61.72  ? 338 PHE B CZ  1 
ATOM   5353  N N   . PRO B 1 339 ? -11.369 1.900   -20.267 1.00 46.24  ? 339 PRO B N   1 
ATOM   5354  C CA  . PRO B 1 339 ? -11.966 3.029   -19.573 1.00 45.23  ? 339 PRO B CA  1 
ATOM   5355  C C   . PRO B 1 339 ? -12.253 2.601   -18.135 1.00 49.27  ? 339 PRO B C   1 
ATOM   5356  O O   . PRO B 1 339 ? -12.672 1.471   -17.889 1.00 47.85  ? 339 PRO B O   1 
ATOM   5357  C CB  . PRO B 1 339 ? -13.266 3.283   -20.329 1.00 46.74  ? 339 PRO B CB  1 
ATOM   5358  C CG  . PRO B 1 339 ? -13.125 2.549   -21.602 1.00 52.02  ? 339 PRO B CG  1 
ATOM   5359  C CD  . PRO B 1 339 ? -12.247 1.370   -21.311 1.00 46.86  ? 339 PRO B CD  1 
ATOM   5360  N N   . GLU B 1 340 ? -11.965 3.492   -17.184 1.00 46.63  ? 340 GLU B N   1 
ATOM   5361  C CA  . GLU B 1 340 ? -12.156 3.220   -15.751 1.00 46.29  ? 340 GLU B CA  1 
ATOM   5362  C C   . GLU B 1 340 ? -13.580 2.821   -15.370 1.00 47.78  ? 340 GLU B C   1 
ATOM   5363  O O   . GLU B 1 340 ? -13.788 1.983   -14.484 1.00 45.15  ? 340 GLU B O   1 
ATOM   5364  C CB  . GLU B 1 340 ? -11.759 4.421   -14.912 1.00 47.90  ? 340 GLU B CB  1 
ATOM   5365  C CG  . GLU B 1 340 ? -10.398 4.976   -15.238 1.00 67.71  ? 340 GLU B CG  1 
ATOM   5366  C CD  . GLU B 1 340 ? -10.033 6.111   -14.305 1.00 101.57 ? 340 GLU B CD  1 
ATOM   5367  O OE1 . GLU B 1 340 ? -8.945  6.712   -14.477 1.00 109.44 ? 340 GLU B OE1 1 
ATOM   5368  O OE2 . GLU B 1 340 ? -10.838 6.380   -13.382 1.00 91.17  ? 340 GLU B OE2 1 
ATOM   5369  N N   . LYS B 1 341 ? -14.549 3.491   -15.989 1.00 43.01  ? 341 LYS B N   1 
ATOM   5370  C CA  . LYS B 1 341 ? -15.953 3.190   -15.807 1.00 40.69  ? 341 LYS B CA  1 
ATOM   5371  C C   . LYS B 1 341 ? -16.506 2.893   -17.185 1.00 42.88  ? 341 LYS B C   1 
ATOM   5372  O O   . LYS B 1 341 ? -16.001 3.371   -18.197 1.00 44.44  ? 341 LYS B O   1 
ATOM   5373  C CB  . LYS B 1 341 ? -16.669 4.413   -15.235 1.00 44.38  ? 341 LYS B CB  1 
ATOM   5374  C CG  . LYS B 1 341 ? -15.936 5.127   -14.070 1.00 48.37  ? 341 LYS B CG  1 
ATOM   5375  C CD  . LYS B 1 341 ? -15.559 4.144   -12.985 1.00 59.10  ? 341 LYS B CD  1 
ATOM   5376  C CE  . LYS B 1 341 ? -15.675 4.771   -11.617 1.00 81.41  ? 341 LYS B CE  1 
ATOM   5377  N NZ  . LYS B 1 341 ? -15.265 3.816   -10.545 1.00 99.11  ? 341 LYS B NZ  1 
ATOM   5378  N N   . PRO B 1 342 ? -17.540 2.079   -17.226 1.00 37.37  ? 342 PRO B N   1 
ATOM   5379  C CA  . PRO B 1 342 ? -18.214 1.748   -18.487 1.00 36.45  ? 342 PRO B CA  1 
ATOM   5380  C C   . PRO B 1 342 ? -19.246 2.849   -18.849 1.00 37.69  ? 342 PRO B C   1 
ATOM   5381  O O   . PRO B 1 342 ? -19.833 3.466   -17.962 1.00 31.91  ? 342 PRO B O   1 
ATOM   5382  C CB  . PRO B 1 342 ? -18.901 0.405   -18.172 1.00 37.15  ? 342 PRO B CB  1 
ATOM   5383  C CG  . PRO B 1 342 ? -19.057 0.390   -16.652 1.00 40.28  ? 342 PRO B CG  1 
ATOM   5384  C CD  . PRO B 1 342 ? -17.982 1.260   -16.079 1.00 35.82  ? 342 PRO B CD  1 
ATOM   5385  N N   . ASP B 1 343 ? -19.427 3.114   -20.141 1.00 38.46  ? 343 ASP B N   1 
ATOM   5386  C CA  . ASP B 1 343 ? -20.390 4.116   -20.599 1.00 39.29  ? 343 ASP B CA  1 
ATOM   5387  C C   . ASP B 1 343 ? -21.424 3.327   -21.400 1.00 43.96  ? 343 ASP B C   1 
ATOM   5388  O O   . ASP B 1 343 ? -21.395 3.301   -22.640 1.00 46.84  ? 343 ASP B O   1 
ATOM   5389  C CB  . ASP B 1 343 ? -19.687 5.180   -21.462 1.00 42.21  ? 343 ASP B CB  1 
ATOM   5390  C CG  . ASP B 1 343 ? -20.653 6.152   -22.092 1.00 65.57  ? 343 ASP B CG  1 
ATOM   5391  O OD1 . ASP B 1 343 ? -21.345 6.872   -21.332 1.00 67.34  ? 343 ASP B OD1 1 
ATOM   5392  O OD2 . ASP B 1 343 ? -20.785 6.141   -23.341 1.00 79.04  ? 343 ASP B OD2 1 
ATOM   5393  N N   . PHE B 1 344 ? -22.253 2.574   -20.679 1.00 37.78  ? 344 PHE B N   1 
ATOM   5394  C CA  . PHE B 1 344 ? -23.235 1.699   -21.325 1.00 38.65  ? 344 PHE B CA  1 
ATOM   5395  C C   . PHE B 1 344 ? -24.680 2.228   -21.210 1.00 48.79  ? 344 PHE B C   1 
ATOM   5396  O O   . PHE B 1 344 ? -25.508 2.132   -22.161 1.00 48.16  ? 344 PHE B O   1 
ATOM   5397  C CB  . PHE B 1 344 ? -23.096 0.224   -20.841 1.00 39.09  ? 344 PHE B CB  1 
ATOM   5398  C CG  . PHE B 1 344 ? -24.239 -0.673  -21.262 1.00 38.57  ? 344 PHE B CG  1 
ATOM   5399  C CD1 . PHE B 1 344 ? -24.530 -0.880  -22.606 1.00 39.43  ? 344 PHE B CD1 1 
ATOM   5400  C CD2 . PHE B 1 344 ? -25.103 -1.210  -20.300 1.00 38.41  ? 344 PHE B CD2 1 
ATOM   5401  C CE1 . PHE B 1 344 ? -25.640 -1.636  -22.975 1.00 40.67  ? 344 PHE B CE1 1 
ATOM   5402  C CE2 . PHE B 1 344 ? -26.222 -1.968  -20.664 1.00 40.27  ? 344 PHE B CE2 1 
ATOM   5403  C CZ  . PHE B 1 344 ? -26.487 -2.196  -22.000 1.00 38.35  ? 344 PHE B CZ  1 
ATOM   5404  N N   . HIS B 1 345 ? -24.970 2.850   -20.072 1.00 48.36  ? 345 HIS B N   1 
ATOM   5405  C CA  . HIS B 1 345 ? -26.291 3.468   -19.854 1.00 60.18  ? 345 HIS B CA  1 
ATOM   5406  C C   . HIS B 1 345 ? -27.392 2.403   -19.800 1.00 59.96  ? 345 HIS B C   1 
ATOM   5407  O O   . HIS B 1 345 ? -27.673 1.791   -20.868 1.00 46.60  ? 345 HIS B O   1 
ATOM   5408  C CB  . HIS B 1 345 ? -26.712 4.476   -21.000 1.00 62.32  ? 345 HIS B CB  1 
ATOM   5409  C CG  . HIS B 1 345 ? -25.676 5.496   -21.382 1.00 67.23  ? 345 HIS B CG  1 
ATOM   5410  N ND1 . HIS B 1 345 ? -25.217 6.460   -20.509 1.00 70.04  ? 345 HIS B ND1 1 
ATOM   5411  C CD2 . HIS B 1 345 ? -25.137 5.804   -22.591 1.00 70.09  ? 345 HIS B CD2 1 
ATOM   5412  C CE1 . HIS B 1 345 ? -24.388 7.274   -21.146 1.00 69.86  ? 345 HIS B CE1 1 
ATOM   5413  N NE2 . HIS B 1 345 ? -24.310 6.890   -22.408 1.00 70.15  ? 345 HIS B NE2 1 
ATOM   5414  O OXT . HIS B 1 345 ? -28.163 2.373   -18.811 1.00 65.73  ? 345 HIS B OXT 1 
ATOM   5415  N N   . SER C 1 3   ? -27.426 -2.046  -6.255  1.00 60.44  ? 3   SER C N   1 
ATOM   5416  C CA  . SER C 1 3   ? -28.541 -2.732  -5.571  1.00 59.94  ? 3   SER C CA  1 
ATOM   5417  C C   . SER C 1 3   ? -28.498 -4.275  -5.565  1.00 63.16  ? 3   SER C C   1 
ATOM   5418  O O   . SER C 1 3   ? -29.525 -4.936  -5.324  1.00 63.29  ? 3   SER C O   1 
ATOM   5419  C CB  . SER C 1 3   ? -29.913 -2.211  -6.021  1.00 62.28  ? 3   SER C CB  1 
ATOM   5420  O OG  . SER C 1 3   ? -29.906 -1.810  -7.384  1.00 71.39  ? 3   SER C OG  1 
ATOM   5421  N N   . VAL C 1 4   ? -27.304 -4.833  -5.791  1.00 57.13  ? 4   VAL C N   1 
ATOM   5422  C CA  . VAL C 1 4   ? -27.077 -6.277  -5.731  1.00 55.50  ? 4   VAL C CA  1 
ATOM   5423  C C   . VAL C 1 4   ? -25.943 -6.462  -4.738  1.00 56.83  ? 4   VAL C C   1 
ATOM   5424  O O   . VAL C 1 4   ? -25.018 -5.649  -4.728  1.00 56.65  ? 4   VAL C O   1 
ATOM   5425  C CB  . VAL C 1 4   ? -26.590 -6.850  -7.080  1.00 58.84  ? 4   VAL C CB  1 
ATOM   5426  C CG1 . VAL C 1 4   ? -27.624 -6.655  -8.175  1.00 58.68  ? 4   VAL C CG1 1 
ATOM   5427  C CG2 . VAL C 1 4   ? -25.251 -6.251  -7.454  1.00 58.42  ? 4   VAL C CG2 1 
ATOM   5428  N N   . ARG C 1 5   ? -26.000 -7.515  -3.912  1.00 51.07  ? 5   ARG C N   1 
ATOM   5429  C CA  . ARG C 1 5   ? -24.948 -7.737  -2.905  1.00 49.15  ? 5   ARG C CA  1 
ATOM   5430  C C   . ARG C 1 5   ? -23.706 -8.396  -3.437  1.00 46.43  ? 5   ARG C C   1 
ATOM   5431  O O   . ARG C 1 5   ? -23.654 -8.795  -4.593  1.00 45.22  ? 5   ARG C O   1 
ATOM   5432  C CB  . ARG C 1 5   ? -25.418 -8.551  -1.690  1.00 49.58  ? 5   ARG C CB  1 
ATOM   5433  C CG  . ARG C 1 5   ? -26.884 -8.737  -1.581  1.00 59.60  ? 5   ARG C CG  1 
ATOM   5434  C CD  . ARG C 1 5   ? -27.319 -9.897  -2.407  1.00 74.32  ? 5   ARG C CD  1 
ATOM   5435  N NE  . ARG C 1 5   ? -28.758 -10.040 -2.293  1.00 87.58  ? 5   ARG C NE  1 
ATOM   5436  C CZ  . ARG C 1 5   ? -29.613 -9.043  -2.495  1.00 107.38 ? 5   ARG C CZ  1 
ATOM   5437  N NH1 . ARG C 1 5   ? -29.179 -7.850  -2.882  1.00 95.54  ? 5   ARG C NH1 1 
ATOM   5438  N NH2 . ARG C 1 5   ? -30.914 -9.249  -2.357  1.00 97.65  ? 5   ARG C NH2 1 
ATOM   5439  N N   . GLU C 1 6   ? -22.758 -8.602  -2.532  1.00 39.66  ? 6   GLU C N   1 
ATOM   5440  C CA  . GLU C 1 6   ? -21.534 -9.287  -2.878  1.00 39.37  ? 6   GLU C CA  1 
ATOM   5441  C C   . GLU C 1 6   ? -21.773 -10.773 -3.103  1.00 41.05  ? 6   GLU C C   1 
ATOM   5442  O O   . GLU C 1 6   ? -22.616 -11.398 -2.437  1.00 42.18  ? 6   GLU C O   1 
ATOM   5443  C CB  . GLU C 1 6   ? -20.461 -9.102  -1.801  1.00 40.85  ? 6   GLU C CB  1 
ATOM   5444  C CG  . GLU C 1 6   ? -20.891 -8.385  -0.555  1.00 49.38  ? 6   GLU C CG  1 
ATOM   5445  C CD  . GLU C 1 6   ? -19.712 -7.744  0.160   1.00 63.91  ? 6   GLU C CD  1 
ATOM   5446  O OE1 . GLU C 1 6   ? -19.216 -6.708  -0.340  1.00 43.16  ? 6   GLU C OE1 1 
ATOM   5447  O OE2 . GLU C 1 6   ? -19.260 -8.276  1.195   1.00 58.99  ? 6   GLU C OE2 1 
ATOM   5448  N N   . ASN C 1 7   ? -21.038 -11.348 -4.043  1.00 33.23  ? 7   ASN C N   1 
ATOM   5449  C CA  . ASN C 1 7   ? -21.176 -12.775 -4.274  1.00 31.51  ? 7   ASN C CA  1 
ATOM   5450  C C   . ASN C 1 7   ? -22.515 -13.162 -4.926  1.00 31.25  ? 7   ASN C C   1 
ATOM   5451  O O   . ASN C 1 7   ? -22.974 -14.307 -4.818  1.00 29.44  ? 7   ASN C O   1 
ATOM   5452  C CB  . ASN C 1 7   ? -20.970 -13.534 -2.961  1.00 32.09  ? 7   ASN C CB  1 
ATOM   5453  C CG  . ASN C 1 7   ? -19.709 -13.121 -2.244  1.00 46.62  ? 7   ASN C CG  1 
ATOM   5454  O OD1 . ASN C 1 7   ? -19.748 -12.404 -1.239  1.00 32.29  ? 7   ASN C OD1 1 
ATOM   5455  N ND2 . ASN C 1 7   ? -18.576 -13.527 -2.794  1.00 42.10  ? 7   ASN C ND2 1 
ATOM   5456  N N   . ILE C 1 8   ? -23.118 -12.219 -5.640  1.00 26.76  ? 8   ILE C N   1 
ATOM   5457  C CA  . ILE C 1 8   ? -24.355 -12.484 -6.357  1.00 26.64  ? 8   ILE C CA  1 
ATOM   5458  C C   . ILE C 1 8   ? -24.059 -13.316 -7.604  1.00 28.58  ? 8   ILE C C   1 
ATOM   5459  O O   . ILE C 1 8   ? -24.946 -13.934 -8.192  1.00 28.64  ? 8   ILE C O   1 
ATOM   5460  C CB  . ILE C 1 8   ? -25.036 -11.180 -6.802  1.00 30.92  ? 8   ILE C CB  1 
ATOM   5461  C CG1 . ILE C 1 8   ? -26.534 -11.420 -7.049  1.00 33.30  ? 8   ILE C CG1 1 
ATOM   5462  C CG2 . ILE C 1 8   ? -24.350 -10.591 -8.030  1.00 28.92  ? 8   ILE C CG2 1 
ATOM   5463  C CD1 . ILE C 1 8   ? -27.093 -10.625 -8.213  1.00 42.39  ? 8   ILE C CD1 1 
ATOM   5464  N N   . LEU C 1 9   ? -22.806 -13.294 -8.018  1.00 22.65  ? 9   LEU C N   1 
ATOM   5465  C CA  . LEU C 1 9   ? -22.377 -14.006 -9.199  1.00 22.77  ? 9   LEU C CA  1 
ATOM   5466  C C   . LEU C 1 9   ? -21.334 -14.963 -8.685  1.00 27.47  ? 9   LEU C C   1 
ATOM   5467  O O   . LEU C 1 9   ? -20.442 -14.568 -7.932  1.00 28.17  ? 9   LEU C O   1 
ATOM   5468  C CB  . LEU C 1 9   ? -21.676 -13.043 -10.202 1.00 22.25  ? 9   LEU C CB  1 
ATOM   5469  C CG  . LEU C 1 9   ? -21.775 -13.229 -11.728 1.00 23.56  ? 9   LEU C CG  1 
ATOM   5470  C CD1 . LEU C 1 9   ? -20.704 -12.509 -12.541 1.00 19.96  ? 9   LEU C CD1 1 
ATOM   5471  C CD2 . LEU C 1 9   ? -21.903 -14.678 -12.126 1.00 28.09  ? 9   LEU C CD2 1 
ATOM   5472  N N   . PHE C 1 10  ? -21.420 -16.210 -9.127  1.00 21.86  ? 10  PHE C N   1 
ATOM   5473  C CA  . PHE C 1 10  ? -20.387 -17.176 -8.829  1.00 19.82  ? 10  PHE C CA  1 
ATOM   5474  C C   . PHE C 1 10  ? -19.838 -17.816 -10.082 1.00 23.70  ? 10  PHE C C   1 
ATOM   5475  O O   . PHE C 1 10  ? -20.595 -18.271 -10.940 1.00 24.15  ? 10  PHE C O   1 
ATOM   5476  C CB  . PHE C 1 10  ? -20.875 -18.265 -7.903  1.00 20.97  ? 10  PHE C CB  1 
ATOM   5477  C CG  . PHE C 1 10  ? -19.883 -19.373 -7.730  1.00 21.89  ? 10  PHE C CG  1 
ATOM   5478  C CD1 . PHE C 1 10  ? -19.945 -20.510 -8.563  1.00 23.79  ? 10  PHE C CD1 1 
ATOM   5479  C CD2 . PHE C 1 10  ? -18.749 -19.175 -6.944  1.00 23.24  ? 10  PHE C CD2 1 
ATOM   5480  C CE1 . PHE C 1 10  ? -18.975 -21.500 -8.507  1.00 23.15  ? 10  PHE C CE1 1 
ATOM   5481  C CE2 . PHE C 1 10  ? -17.747 -20.154 -6.877  1.00 26.37  ? 10  PHE C CE2 1 
ATOM   5482  C CZ  . PHE C 1 10  ? -17.870 -21.330 -7.654  1.00 24.29  ? 10  PHE C CZ  1 
ATOM   5483  N N   . GLY C 1 11  ? -18.515 -17.893 -10.160 1.00 20.20  ? 11  GLY C N   1 
ATOM   5484  C CA  . GLY C 1 11  ? -17.849 -18.590 -11.256 1.00 20.07  ? 11  GLY C CA  1 
ATOM   5485  C C   . GLY C 1 11  ? -16.642 -19.367 -10.711 1.00 23.96  ? 11  GLY C C   1 
ATOM   5486  O O   . GLY C 1 11  ? -16.117 -19.063 -9.618  1.00 22.73  ? 11  GLY C O   1 
ATOM   5487  N N   . MET C 1 12  ? -16.225 -20.375 -11.477 1.00 18.69  ? 12  MET C N   1 
ATOM   5488  C CA  . MET C 1 12  ? -14.992 -21.115 -11.201 1.00 17.74  ? 12  MET C CA  1 
ATOM   5489  C C   . MET C 1 12  ? -14.399 -21.567 -12.541 1.00 20.39  ? 12  MET C C   1 
ATOM   5490  O O   . MET C 1 12  ? -15.080 -21.567 -13.580 1.00 17.38  ? 12  MET C O   1 
ATOM   5491  C CB  . MET C 1 12  ? -15.237 -22.297 -10.277 1.00 20.30  ? 12  MET C CB  1 
ATOM   5492  C CG  . MET C 1 12  ? -16.235 -23.286 -10.840 1.00 24.42  ? 12  MET C CG  1 
ATOM   5493  S SD  . MET C 1 12  ? -16.680 -24.527 -9.653  1.00 29.52  ? 12  MET C SD  1 
ATOM   5494  C CE  . MET C 1 12  ? -15.081 -24.866 -8.835  1.00 24.82  ? 12  MET C CE  1 
ATOM   5495  N N   . GLY C 1 13  ? -13.112 -21.898 -12.551 1.00 18.19  ? 13  GLY C N   1 
ATOM   5496  C CA  . GLY C 1 13  ? -12.490 -22.273 -13.807 1.00 17.00  ? 13  GLY C CA  1 
ATOM   5497  C C   . GLY C 1 13  ? -11.014 -22.316 -13.694 1.00 18.08  ? 13  GLY C C   1 
ATOM   5498  O O   . GLY C 1 13  ? -10.497 -22.561 -12.646 1.00 21.42  ? 13  GLY C O   1 
ATOM   5499  N N   . ASN C 1 14  ? -10.331 -22.131 -14.806 1.00 13.13  ? 14  ASN C N   1 
ATOM   5500  C CA  . ASN C 1 14  ? -8.879  -22.276 -14.846 1.00 12.74  ? 14  ASN C CA  1 
ATOM   5501  C C   . ASN C 1 14  ? -8.137  -20.945 -14.755 1.00 17.14  ? 14  ASN C C   1 
ATOM   5502  O O   . ASN C 1 14  ? -8.096  -20.180 -15.706 1.00 13.96  ? 14  ASN C O   1 
ATOM   5503  C CB  . ASN C 1 14  ? -8.451  -23.034 -16.101 1.00 2.96   ? 14  ASN C CB  1 
ATOM   5504  C CG  . ASN C 1 14  ? -9.123  -24.366 -16.213 1.00 13.91  ? 14  ASN C CG  1 
ATOM   5505  O OD1 . ASN C 1 14  ? -9.291  -25.077 -15.224 1.00 12.54  ? 14  ASN C OD1 1 
ATOM   5506  N ND2 . ASN C 1 14  ? -9.571  -24.692 -17.397 1.00 6.54   ? 14  ASN C ND2 1 
ATOM   5507  N N   . PRO C 1 15  ? -7.565  -20.660 -13.600 1.00 15.27  ? 15  PRO C N   1 
ATOM   5508  C CA  . PRO C 1 15  ? -6.825  -19.433 -13.508 1.00 14.95  ? 15  PRO C CA  1 
ATOM   5509  C C   . PRO C 1 15  ? -5.516  -19.653 -14.285 1.00 19.36  ? 15  PRO C C   1 
ATOM   5510  O O   . PRO C 1 15  ? -4.634  -20.447 -13.898 1.00 16.63  ? 15  PRO C O   1 
ATOM   5511  C CB  . PRO C 1 15  ? -6.600  -19.243 -11.982 1.00 16.41  ? 15  PRO C CB  1 
ATOM   5512  C CG  . PRO C 1 15  ? -7.165  -20.542 -11.305 1.00 20.04  ? 15  PRO C CG  1 
ATOM   5513  C CD  . PRO C 1 15  ? -7.372  -21.522 -12.412 1.00 15.88  ? 15  PRO C CD  1 
ATOM   5514  N N   . LEU C 1 16  ? -5.398  -18.957 -15.409 1.00 17.35  ? 16  LEU C N   1 
ATOM   5515  C CA  . LEU C 1 16  ? -4.197  -19.113 -16.212 1.00 18.14  ? 16  LEU C CA  1 
ATOM   5516  C C   . LEU C 1 16  ? -3.486  -17.783 -16.448 1.00 21.37  ? 16  LEU C C   1 
ATOM   5517  O O   . LEU C 1 16  ? -4.128  -16.746 -16.481 1.00 21.03  ? 16  LEU C O   1 
ATOM   5518  C CB  . LEU C 1 16  ? -4.540  -19.756 -17.578 1.00 17.51  ? 16  LEU C CB  1 
ATOM   5519  C CG  . LEU C 1 16  ? -5.194  -21.133 -17.511 1.00 20.12  ? 16  LEU C CG  1 
ATOM   5520  C CD1 . LEU C 1 16  ? -5.445  -21.729 -18.902 1.00 18.30  ? 16  LEU C CD1 1 
ATOM   5521  C CD2 . LEU C 1 16  ? -4.375  -22.044 -16.602 1.00 22.18  ? 16  LEU C CD2 1 
ATOM   5522  N N   . LEU C 1 17  ? -2.183  -17.841 -16.696 1.00 16.92  ? 17  LEU C N   1 
ATOM   5523  C CA  . LEU C 1 17  ? -1.424  -16.665 -17.096 1.00 16.64  ? 17  LEU C CA  1 
ATOM   5524  C C   . LEU C 1 17  ? -1.150  -16.738 -18.595 1.00 21.72  ? 17  LEU C C   1 
ATOM   5525  O O   . LEU C 1 17  ? -0.529  -17.685 -19.101 1.00 21.70  ? 17  LEU C O   1 
ATOM   5526  C CB  . LEU C 1 17  ? -0.097  -16.584 -16.359 1.00 16.43  ? 17  LEU C CB  1 
ATOM   5527  C CG  . LEU C 1 17  ? 0.648   -15.244 -16.269 1.00 19.63  ? 17  LEU C CG  1 
ATOM   5528  C CD1 . LEU C 1 17  ? -0.247  -14.062 -15.875 1.00 18.02  ? 17  LEU C CD1 1 
ATOM   5529  C CD2 . LEU C 1 17  ? 1.824   -15.421 -15.326 1.00 20.02  ? 17  LEU C CD2 1 
ATOM   5530  N N   . ASP C 1 18  ? -1.599  -15.718 -19.304 1.00 18.60  ? 18  ASP C N   1 
ATOM   5531  C CA  . ASP C 1 18  ? -1.373  -15.652 -20.729 1.00 18.40  ? 18  ASP C CA  1 
ATOM   5532  C C   . ASP C 1 18  ? 0.038   -15.154 -21.050 1.00 26.55  ? 18  ASP C C   1 
ATOM   5533  O O   . ASP C 1 18  ? 0.536   -14.147 -20.491 1.00 27.73  ? 18  ASP C O   1 
ATOM   5534  C CB  . ASP C 1 18  ? -2.420  -14.769 -21.387 1.00 18.99  ? 18  ASP C CB  1 
ATOM   5535  C CG  . ASP C 1 18  ? -3.802  -15.357 -21.316 1.00 19.78  ? 18  ASP C CG  1 
ATOM   5536  O OD1 . ASP C 1 18  ? -3.939  -16.576 -21.147 1.00 17.85  ? 18  ASP C OD1 1 
ATOM   5537  O OD2 . ASP C 1 18  ? -4.779  -14.599 -21.447 1.00 34.58  ? 18  ASP C OD2 1 
ATOM   5538  N N   . ILE C 1 19  ? 0.697   -15.926 -21.897 1.00 23.76  ? 19  ILE C N   1 
ATOM   5539  C CA  . ILE C 1 19  ? 2.025   -15.648 -22.400 1.00 23.79  ? 19  ILE C CA  1 
ATOM   5540  C C   . ILE C 1 19  ? 1.816   -15.539 -23.906 1.00 28.30  ? 19  ILE C C   1 
ATOM   5541  O O   . ILE C 1 19  ? 1.439   -16.518 -24.566 1.00 28.00  ? 19  ILE C O   1 
ATOM   5542  C CB  . ILE C 1 19  ? 2.920   -16.854 -22.122 1.00 27.73  ? 19  ILE C CB  1 
ATOM   5543  C CG1 . ILE C 1 19  ? 3.054   -17.087 -20.615 1.00 27.89  ? 19  ILE C CG1 1 
ATOM   5544  C CG2 . ILE C 1 19  ? 4.277   -16.659 -22.746 1.00 31.44  ? 19  ILE C CG2 1 
ATOM   5545  C CD1 . ILE C 1 19  ? 3.498   -18.525 -20.281 1.00 26.95  ? 19  ILE C CD1 1 
ATOM   5546  N N   . SER C 1 20  ? 1.905   -14.323 -24.424 1.00 27.39  ? 20  SER C N   1 
ATOM   5547  C CA  . SER C 1 20  ? 1.648   -14.075 -25.846 1.00 28.34  ? 20  SER C CA  1 
ATOM   5548  C C   . SER C 1 20  ? 2.806   -13.349 -26.478 1.00 31.46  ? 20  SER C C   1 
ATOM   5549  O O   . SER C 1 20  ? 3.571   -12.703 -25.794 1.00 29.04  ? 20  SER C O   1 
ATOM   5550  C CB  . SER C 1 20  ? 0.347   -13.293 -26.065 1.00 33.78  ? 20  SER C CB  1 
ATOM   5551  O OG  . SER C 1 20  ? 0.234   -12.196 -25.173 1.00 49.39  ? 20  SER C OG  1 
ATOM   5552  N N   . ALA C 1 21  ? 2.945   -13.524 -27.785 1.00 31.26  ? 21  ALA C N   1 
ATOM   5553  C CA  . ALA C 1 21  ? 4.056   -13.010 -28.574 1.00 31.79  ? 21  ALA C CA  1 
ATOM   5554  C C   . ALA C 1 21  ? 3.710   -13.243 -30.045 1.00 39.56  ? 21  ALA C C   1 
ATOM   5555  O O   . ALA C 1 21  ? 3.086   -14.254 -30.400 1.00 38.78  ? 21  ALA C O   1 
ATOM   5556  C CB  . ALA C 1 21  ? 5.353   -13.805 -28.220 1.00 32.06  ? 21  ALA C CB  1 
ATOM   5557  N N   . VAL C 1 22  ? 4.154   -12.337 -30.909 1.00 38.89  ? 22  VAL C N   1 
ATOM   5558  C CA  . VAL C 1 22  ? 4.041   -12.564 -32.342 1.00 39.19  ? 22  VAL C CA  1 
ATOM   5559  C C   . VAL C 1 22  ? 5.117   -13.621 -32.737 1.00 42.70  ? 22  VAL C C   1 
ATOM   5560  O O   . VAL C 1 22  ? 6.244   -13.621 -32.193 1.00 40.27  ? 22  VAL C O   1 
ATOM   5561  C CB  . VAL C 1 22  ? 4.260   -11.254 -33.110 1.00 42.18  ? 22  VAL C CB  1 
ATOM   5562  C CG1 . VAL C 1 22  ? 3.994   -11.450 -34.604 1.00 41.71  ? 22  VAL C CG1 1 
ATOM   5563  C CG2 . VAL C 1 22  ? 3.395   -10.152 -32.503 1.00 41.53  ? 22  VAL C CG2 1 
ATOM   5564  N N   . VAL C 1 23  ? 4.733   -14.552 -33.611 1.00 38.29  ? 23  VAL C N   1 
ATOM   5565  C CA  . VAL C 1 23  ? 5.647   -15.593 -34.055 1.00 38.42  ? 23  VAL C CA  1 
ATOM   5566  C C   . VAL C 1 23  ? 5.623   -15.774 -35.584 1.00 43.93  ? 23  VAL C C   1 
ATOM   5567  O O   . VAL C 1 23  ? 5.087   -14.924 -36.322 1.00 43.32  ? 23  VAL C O   1 
ATOM   5568  C CB  . VAL C 1 23  ? 5.452   -16.924 -33.276 1.00 42.76  ? 23  VAL C CB  1 
ATOM   5569  C CG1 . VAL C 1 23  ? 5.629   -16.697 -31.796 1.00 41.75  ? 23  VAL C CG1 1 
ATOM   5570  C CG2 . VAL C 1 23  ? 4.055   -17.559 -33.557 1.00 42.90  ? 23  VAL C CG2 1 
ATOM   5571  N N   . ASP C 1 24  ? 6.260   -16.846 -36.052 1.00 41.42  ? 24  ASP C N   1 
ATOM   5572  C CA  . ASP C 1 24  ? 6.370   -17.123 -37.477 1.00 40.88  ? 24  ASP C CA  1 
ATOM   5573  C C   . ASP C 1 24  ? 5.881   -18.512 -37.847 1.00 45.55  ? 24  ASP C C   1 
ATOM   5574  O O   . ASP C 1 24  ? 5.874   -19.421 -37.016 1.00 45.25  ? 24  ASP C O   1 
ATOM   5575  C CB  . ASP C 1 24  ? 7.810   -16.931 -37.955 1.00 41.84  ? 24  ASP C CB  1 
ATOM   5576  C CG  . ASP C 1 24  ? 8.758   -17.920 -37.347 1.00 47.58  ? 24  ASP C CG  1 
ATOM   5577  O OD1 . ASP C 1 24  ? 8.865   -17.963 -36.111 1.00 44.22  ? 24  ASP C OD1 1 
ATOM   5578  O OD2 . ASP C 1 24  ? 9.436   -18.635 -38.105 1.00 64.03  ? 24  ASP C OD2 1 
ATOM   5579  N N   . LYS C 1 25  ? 5.477   -18.663 -39.107 1.00 41.63  ? 25  LYS C N   1 
ATOM   5580  C CA  . LYS C 1 25  ? 4.971   -19.922 -39.615 1.00 39.95  ? 25  LYS C CA  1 
ATOM   5581  C C   . LYS C 1 25  ? 5.917   -21.083 -39.364 1.00 42.93  ? 25  LYS C C   1 
ATOM   5582  O O   . LYS C 1 25  ? 5.515   -22.232 -39.348 1.00 44.82  ? 25  LYS C O   1 
ATOM   5583  C CB  . LYS C 1 25  ? 4.560   -19.806 -41.087 1.00 42.28  ? 25  LYS C CB  1 
ATOM   5584  C CG  . LYS C 1 25  ? 4.274   -21.172 -41.758 1.00 66.55  ? 25  LYS C CG  1 
ATOM   5585  C CD  . LYS C 1 25  ? 2.992   -21.228 -42.619 1.00 73.07  ? 25  LYS C CD  1 
ATOM   5586  C CE  . LYS C 1 25  ? 2.732   -22.678 -43.072 1.00 67.24  ? 25  LYS C CE  1 
ATOM   5587  N NZ  . LYS C 1 25  ? 2.142   -22.840 -44.421 1.00 61.72  ? 25  LYS C NZ  1 
ATOM   5588  N N   . ASP C 1 26  ? 7.169   -20.794 -39.084 1.00 39.56  ? 26  ASP C N   1 
ATOM   5589  C CA  . ASP C 1 26  ? 8.111   -21.876 -38.806 1.00 40.21  ? 26  ASP C CA  1 
ATOM   5590  C C   . ASP C 1 26  ? 7.932   -22.407 -37.385 1.00 43.55  ? 26  ASP C C   1 
ATOM   5591  O O   . ASP C 1 26  ? 8.096   -23.604 -37.129 1.00 43.79  ? 26  ASP C O   1 
ATOM   5592  C CB  . ASP C 1 26  ? 9.560   -21.427 -39.035 1.00 42.61  ? 26  ASP C CB  1 
ATOM   5593  C CG  . ASP C 1 26  ? 9.931   -21.370 -40.515 1.00 56.87  ? 26  ASP C CG  1 
ATOM   5594  O OD1 . ASP C 1 26  ? 11.113  -21.050 -40.814 1.00 58.49  ? 26  ASP C OD1 1 
ATOM   5595  O OD2 . ASP C 1 26  ? 9.040   -21.623 -41.371 1.00 60.96  ? 26  ASP C OD2 1 
ATOM   5596  N N   . PHE C 1 27  ? 7.556   -21.516 -36.472 1.00 38.46  ? 27  PHE C N   1 
ATOM   5597  C CA  . PHE C 1 27  ? 7.248   -21.886 -35.097 1.00 37.10  ? 27  PHE C CA  1 
ATOM   5598  C C   . PHE C 1 27  ? 5.971   -22.716 -35.053 1.00 38.71  ? 27  PHE C C   1 
ATOM   5599  O O   . PHE C 1 27  ? 5.904   -23.756 -34.386 1.00 37.70  ? 27  PHE C O   1 
ATOM   5600  C CB  . PHE C 1 27  ? 7.043   -20.636 -34.254 1.00 39.17  ? 27  PHE C CB  1 
ATOM   5601  C CG  . PHE C 1 27  ? 6.929   -20.918 -32.794 1.00 40.79  ? 27  PHE C CG  1 
ATOM   5602  C CD1 . PHE C 1 27  ? 8.058   -21.089 -32.028 1.00 43.58  ? 27  PHE C CD1 1 
ATOM   5603  C CD2 . PHE C 1 27  ? 5.699   -21.008 -32.193 1.00 44.48  ? 27  PHE C CD2 1 
ATOM   5604  C CE1 . PHE C 1 27  ? 7.979   -21.405 -30.694 1.00 44.71  ? 27  PHE C CE1 1 
ATOM   5605  C CE2 . PHE C 1 27  ? 5.606   -21.324 -30.852 1.00 47.76  ? 27  PHE C CE2 1 
ATOM   5606  C CZ  . PHE C 1 27  ? 6.757   -21.474 -30.094 1.00 45.00  ? 27  PHE C CZ  1 
ATOM   5607  N N   . LEU C 1 28  ? 4.980   -22.274 -35.816 1.00 36.13  ? 28  LEU C N   1 
ATOM   5608  C CA  . LEU C 1 28  ? 3.690   -22.950 -35.882 1.00 37.77  ? 28  LEU C CA  1 
ATOM   5609  C C   . LEU C 1 28  ? 3.833   -24.397 -36.334 1.00 46.08  ? 28  LEU C C   1 
ATOM   5610  O O   . LEU C 1 28  ? 3.331   -25.322 -35.671 1.00 46.04  ? 28  LEU C O   1 
ATOM   5611  C CB  . LEU C 1 28  ? 2.765   -22.194 -36.835 1.00 37.57  ? 28  LEU C CB  1 
ATOM   5612  C CG  . LEU C 1 28  ? 2.058   -20.973 -36.220 1.00 41.60  ? 28  LEU C CG  1 
ATOM   5613  C CD1 . LEU C 1 28  ? 1.091   -20.314 -37.217 1.00 41.61  ? 28  LEU C CD1 1 
ATOM   5614  C CD2 . LEU C 1 28  ? 1.338   -21.350 -34.917 1.00 42.17  ? 28  LEU C CD2 1 
ATOM   5615  N N   . ASP C 1 29  ? 4.525   -24.565 -37.464 1.00 44.48  ? 29  ASP C N   1 
ATOM   5616  C CA  . ASP C 1 29  ? 4.764   -25.860 -38.081 1.00 45.45  ? 29  ASP C CA  1 
ATOM   5617  C C   . ASP C 1 29  ? 5.576   -26.772 -37.185 1.00 47.70  ? 29  ASP C C   1 
ATOM   5618  O O   . ASP C 1 29  ? 5.315   -27.965 -37.083 1.00 46.78  ? 29  ASP C O   1 
ATOM   5619  C CB  . ASP C 1 29  ? 5.464   -25.689 -39.443 1.00 49.78  ? 29  ASP C CB  1 
ATOM   5620  C CG  . ASP C 1 29  ? 4.547   -25.085 -40.516 1.00 79.06  ? 29  ASP C CG  1 
ATOM   5621  O OD1 . ASP C 1 29  ? 3.306   -25.285 -40.461 1.00 84.02  ? 29  ASP C OD1 1 
ATOM   5622  O OD2 . ASP C 1 29  ? 5.094   -24.455 -41.452 1.00 88.32  ? 29  ASP C OD2 1 
ATOM   5623  N N   . LYS C 1 30  ? 6.576   -26.206 -36.532 1.00 45.72  ? 30  LYS C N   1 
ATOM   5624  C CA  . LYS C 1 30  ? 7.403   -26.988 -35.614 1.00 46.06  ? 30  LYS C CA  1 
ATOM   5625  C C   . LYS C 1 30  ? 6.540   -27.778 -34.587 1.00 47.84  ? 30  LYS C C   1 
ATOM   5626  O O   . LYS C 1 30  ? 6.839   -28.928 -34.234 1.00 46.55  ? 30  LYS C O   1 
ATOM   5627  C CB  . LYS C 1 30  ? 8.407   -26.061 -34.920 1.00 48.72  ? 30  LYS C CB  1 
ATOM   5628  C CG  . LYS C 1 30  ? 9.570   -25.639 -35.820 1.00 77.35  ? 30  LYS C CG  1 
ATOM   5629  C CD  . LYS C 1 30  ? 9.325   -26.048 -37.284 1.00 91.38  ? 30  LYS C CD  1 
ATOM   5630  C CE  . LYS C 1 30  ? 10.613  -26.288 -38.065 1.00 104.89 ? 30  LYS C CE  1 
ATOM   5631  N NZ  . LYS C 1 30  ? 10.890  -27.749 -38.227 1.00 114.18 ? 30  LYS C NZ  1 
ATOM   5632  N N   . TYR C 1 31  ? 5.457   -27.161 -34.122 1.00 41.99  ? 31  TYR C N   1 
ATOM   5633  C CA  . TYR C 1 31  ? 4.598   -27.813 -33.145 1.00 40.40  ? 31  TYR C CA  1 
ATOM   5634  C C   . TYR C 1 31  ? 3.297   -28.235 -33.767 1.00 44.38  ? 31  TYR C C   1 
ATOM   5635  O O   . TYR C 1 31  ? 2.378   -28.632 -33.047 1.00 45.73  ? 31  TYR C O   1 
ATOM   5636  C CB  . TYR C 1 31  ? 4.335   -26.896 -31.943 1.00 39.96  ? 31  TYR C CB  1 
ATOM   5637  C CG  . TYR C 1 31  ? 5.613   -26.514 -31.251 1.00 40.05  ? 31  TYR C CG  1 
ATOM   5638  C CD1 . TYR C 1 31  ? 6.254   -25.306 -31.536 1.00 40.84  ? 31  TYR C CD1 1 
ATOM   5639  C CD2 . TYR C 1 31  ? 6.271   -27.427 -30.437 1.00 40.49  ? 31  TYR C CD2 1 
ATOM   5640  C CE1 . TYR C 1 31  ? 7.485   -25.004 -30.988 1.00 37.96  ? 31  TYR C CE1 1 
ATOM   5641  C CE2 . TYR C 1 31  ? 7.502   -27.131 -29.892 1.00 41.05  ? 31  TYR C CE2 1 
ATOM   5642  C CZ  . TYR C 1 31  ? 8.097   -25.921 -30.168 1.00 45.90  ? 31  TYR C CZ  1 
ATOM   5643  O OH  . TYR C 1 31  ? 9.301   -25.630 -29.578 1.00 52.70  ? 31  TYR C OH  1 
ATOM   5644  N N   . SER C 1 32  ? 3.225   -28.166 -35.094 1.00 38.32  ? 32  SER C N   1 
ATOM   5645  C CA  . SER C 1 32  ? 2.017   -28.564 -35.804 1.00 37.12  ? 32  SER C CA  1 
ATOM   5646  C C   . SER C 1 32  ? 0.805   -27.853 -35.174 1.00 39.71  ? 32  SER C C   1 
ATOM   5647  O O   . SER C 1 32  ? -0.033  -28.458 -34.489 1.00 37.22  ? 32  SER C O   1 
ATOM   5648  C CB  . SER C 1 32  ? 1.886   -30.091 -35.772 1.00 38.72  ? 32  SER C CB  1 
ATOM   5649  O OG  . SER C 1 32  ? 3.175   -30.690 -35.846 1.00 39.46  ? 32  SER C OG  1 
ATOM   5650  N N   . LEU C 1 33  ? 0.806   -26.529 -35.306 1.00 36.62  ? 33  LEU C N   1 
ATOM   5651  C CA  . LEU C 1 33  ? -0.277  -25.703 -34.776 1.00 36.23  ? 33  LEU C CA  1 
ATOM   5652  C C   . LEU C 1 33  ? -0.968  -24.954 -35.905 1.00 41.35  ? 33  LEU C C   1 
ATOM   5653  O O   . LEU C 1 33  ? -0.311  -24.460 -36.826 1.00 40.84  ? 33  LEU C O   1 
ATOM   5654  C CB  . LEU C 1 33  ? 0.256   -24.660 -33.787 1.00 35.88  ? 33  LEU C CB  1 
ATOM   5655  C CG  . LEU C 1 33  ? 1.151   -25.031 -32.614 1.00 39.14  ? 33  LEU C CG  1 
ATOM   5656  C CD1 . LEU C 1 33  ? 1.589   -23.713 -32.068 1.00 38.34  ? 33  LEU C CD1 1 
ATOM   5657  C CD2 . LEU C 1 33  ? 0.431   -25.877 -31.572 1.00 38.80  ? 33  LEU C CD2 1 
ATOM   5658  N N   . LYS C 1 34  ? -2.292  -24.830 -35.792 1.00 38.89  ? 34  LYS C N   1 
ATOM   5659  C CA  . LYS C 1 34  ? -3.114  -24.119 -36.786 1.00 37.63  ? 34  LYS C CA  1 
ATOM   5660  C C   . LYS C 1 34  ? -3.135  -22.679 -36.355 1.00 37.11  ? 34  LYS C C   1 
ATOM   5661  O O   . LYS C 1 34  ? -3.236  -22.416 -35.154 1.00 35.37  ? 34  LYS C O   1 
ATOM   5662  C CB  . LYS C 1 34  ? -4.540  -24.667 -36.791 1.00 40.83  ? 34  LYS C CB  1 
ATOM   5663  C CG  . LYS C 1 34  ? -4.625  -26.180 -36.896 1.00 64.72  ? 34  LYS C CG  1 
ATOM   5664  C CD  . LYS C 1 34  ? -5.997  -26.625 -37.393 1.00 81.60  ? 34  LYS C CD  1 
ATOM   5665  C CE  . LYS C 1 34  ? -6.993  -26.718 -36.252 1.00 99.09  ? 34  LYS C CE  1 
ATOM   5666  N NZ  . LYS C 1 34  ? -8.000  -27.795 -36.487 1.00 106.66 ? 34  LYS C NZ  1 
ATOM   5667  N N   . PRO C 1 35  ? -2.967  -21.777 -37.333 1.00 30.61  ? 35  PRO C N   1 
ATOM   5668  C CA  . PRO C 1 35  ? -2.819  -20.331 -37.105 1.00 28.53  ? 35  PRO C CA  1 
ATOM   5669  C C   . PRO C 1 35  ? -3.774  -19.754 -36.060 1.00 30.36  ? 35  PRO C C   1 
ATOM   5670  O O   . PRO C 1 35  ? -3.379  -18.920 -35.228 1.00 26.84  ? 35  PRO C O   1 
ATOM   5671  C CB  . PRO C 1 35  ? -3.085  -19.713 -38.494 1.00 28.92  ? 35  PRO C CB  1 
ATOM   5672  C CG  . PRO C 1 35  ? -3.347  -20.836 -39.402 1.00 32.54  ? 35  PRO C CG  1 
ATOM   5673  C CD  . PRO C 1 35  ? -2.913  -22.118 -38.760 1.00 28.33  ? 35  PRO C CD  1 
ATOM   5674  N N   . ASN C 1 36  ? -5.029  -20.201 -36.146 1.00 27.19  ? 36  ASN C N   1 
ATOM   5675  C CA  . ASN C 1 36  ? -6.113  -19.774 -35.268 1.00 26.30  ? 36  ASN C CA  1 
ATOM   5676  C C   . ASN C 1 36  ? -6.675  -21.049 -34.701 1.00 28.89  ? 36  ASN C C   1 
ATOM   5677  O O   . ASN C 1 36  ? -7.190  -21.863 -35.454 1.00 29.14  ? 36  ASN C O   1 
ATOM   5678  C CB  . ASN C 1 36  ? -7.201  -19.071 -36.078 1.00 23.10  ? 36  ASN C CB  1 
ATOM   5679  C CG  . ASN C 1 36  ? -7.469  -17.675 -35.600 1.00 51.35  ? 36  ASN C CG  1 
ATOM   5680  O OD1 . ASN C 1 36  ? -6.611  -16.818 -35.692 1.00 42.78  ? 36  ASN C OD1 1 
ATOM   5681  N ND2 . ASN C 1 36  ? -8.664  -17.441 -35.072 1.00 53.74  ? 36  ASN C ND2 1 
ATOM   5682  N N   . ASP C 1 37  ? -6.500  -21.259 -33.399 1.00 24.54  ? 37  ASP C N   1 
ATOM   5683  C CA  . ASP C 1 37  ? -7.003  -22.464 -32.734 1.00 22.37  ? 37  ASP C CA  1 
ATOM   5684  C C   . ASP C 1 37  ? -6.899  -22.326 -31.214 1.00 23.06  ? 37  ASP C C   1 
ATOM   5685  O O   . ASP C 1 37  ? -6.298  -21.363 -30.734 1.00 21.24  ? 37  ASP C O   1 
ATOM   5686  C CB  . ASP C 1 37  ? -6.211  -23.663 -33.199 1.00 23.40  ? 37  ASP C CB  1 
ATOM   5687  C CG  . ASP C 1 37  ? -6.900  -24.984 -32.903 1.00 38.31  ? 37  ASP C CG  1 
ATOM   5688  O OD1 . ASP C 1 37  ? -8.117  -24.980 -32.547 1.00 42.43  ? 37  ASP C OD1 1 
ATOM   5689  O OD2 . ASP C 1 37  ? -6.204  -26.029 -33.075 1.00 38.90  ? 37  ASP C OD2 1 
ATOM   5690  N N   . GLN C 1 38  ? -7.493  -23.289 -30.491 1.00 17.92  ? 38  GLN C N   1 
ATOM   5691  C CA  . GLN C 1 38  ? -7.515  -23.367 -29.013 1.00 16.43  ? 38  GLN C CA  1 
ATOM   5692  C C   . GLN C 1 38  ? -7.338  -24.836 -28.558 1.00 19.38  ? 38  GLN C C   1 
ATOM   5693  O O   . GLN C 1 38  ? -8.187  -25.691 -28.796 1.00 15.21  ? 38  GLN C O   1 
ATOM   5694  C CB  . GLN C 1 38  ? -8.829  -22.789 -28.466 1.00 15.51  ? 38  GLN C CB  1 
ATOM   5695  C CG  . GLN C 1 38  ? -8.962  -21.308 -28.747 1.00 9.68   ? 38  GLN C CG  1 
ATOM   5696  C CD  . GLN C 1 38  ? -10.128 -20.697 -27.967 1.00 24.71  ? 38  GLN C CD  1 
ATOM   5697  O OE1 . GLN C 1 38  ? -9.929  -20.117 -26.898 1.00 12.09  ? 38  GLN C OE1 1 
ATOM   5698  N NE2 . GLN C 1 38  ? -11.366 -20.970 -28.414 1.00 13.05  ? 38  GLN C NE2 1 
ATOM   5699  N N   . ILE C 1 39  ? -6.189  -25.180 -27.999 1.00 18.56  ? 39  ILE C N   1 
ATOM   5700  C CA  . ILE C 1 39  ? -5.988  -26.582 -27.679 1.00 18.10  ? 39  ILE C CA  1 
ATOM   5701  C C   . ILE C 1 39  ? -5.336  -26.768 -26.345 1.00 25.31  ? 39  ILE C C   1 
ATOM   5702  O O   . ILE C 1 39  ? -4.781  -25.824 -25.781 1.00 28.27  ? 39  ILE C O   1 
ATOM   5703  C CB  . ILE C 1 39  ? -5.091  -27.264 -28.729 1.00 21.73  ? 39  ILE C CB  1 
ATOM   5704  C CG1 . ILE C 1 39  ? -3.666  -26.699 -28.707 1.00 24.86  ? 39  ILE C CG1 1 
ATOM   5705  C CG2 . ILE C 1 39  ? -5.667  -27.173 -30.135 1.00 19.17  ? 39  ILE C CG2 1 
ATOM   5706  C CD1 . ILE C 1 39  ? -2.534  -27.771 -29.017 1.00 25.39  ? 39  ILE C CD1 1 
ATOM   5707  N N   . LEU C 1 40  ? -5.431  -27.980 -25.826 1.00 22.33  ? 40  LEU C N   1 
ATOM   5708  C CA  . LEU C 1 40  ? -4.753  -28.347 -24.591 1.00 22.92  ? 40  LEU C CA  1 
ATOM   5709  C C   . LEU C 1 40  ? -3.364  -28.951 -24.953 1.00 30.77  ? 40  LEU C C   1 
ATOM   5710  O O   . LEU C 1 40  ? -3.245  -29.813 -25.836 1.00 28.41  ? 40  LEU C O   1 
ATOM   5711  C CB  . LEU C 1 40  ? -5.600  -29.357 -23.809 1.00 22.72  ? 40  LEU C CB  1 
ATOM   5712  C CG  . LEU C 1 40  ? -6.830  -28.846 -23.035 1.00 25.70  ? 40  LEU C CG  1 
ATOM   5713  C CD1 . LEU C 1 40  ? -7.233  -29.860 -22.034 1.00 24.66  ? 40  LEU C CD1 1 
ATOM   5714  C CD2 . LEU C 1 40  ? -6.469  -27.579 -22.301 1.00 30.28  ? 40  LEU C CD2 1 
ATOM   5715  N N   . ALA C 1 41  ? -2.322  -28.425 -24.314 1.00 31.02  ? 41  ALA C N   1 
ATOM   5716  C CA  . ALA C 1 41  ? -0.940  -28.852 -24.504 1.00 29.98  ? 41  ALA C CA  1 
ATOM   5717  C C   . ALA C 1 41  ? -0.800  -30.327 -24.274 1.00 35.04  ? 41  ALA C C   1 
ATOM   5718  O O   . ALA C 1 41  ? -1.164  -30.798 -23.215 1.00 34.14  ? 41  ALA C O   1 
ATOM   5719  C CB  . ALA C 1 41  ? -0.090  -28.146 -23.503 1.00 30.29  ? 41  ALA C CB  1 
ATOM   5720  N N   . GLU C 1 42  ? -0.220  -31.041 -25.236 1.00 35.87  ? 42  GLU C N   1 
ATOM   5721  C CA  . GLU C 1 42  ? 0.093   -32.475 -25.068 1.00 37.39  ? 42  GLU C CA  1 
ATOM   5722  C C   . GLU C 1 42  ? 1.516   -32.666 -24.519 1.00 47.73  ? 42  GLU C C   1 
ATOM   5723  O O   . GLU C 1 42  ? 1.963   -31.925 -23.646 1.00 46.64  ? 42  GLU C O   1 
ATOM   5724  C CB  . GLU C 1 42  ? -0.020  -33.227 -26.389 1.00 37.84  ? 42  GLU C CB  1 
ATOM   5725  C CG  . GLU C 1 42  ? -1.197  -32.836 -27.224 1.00 49.13  ? 42  GLU C CG  1 
ATOM   5726  C CD  . GLU C 1 42  ? -2.485  -33.516 -26.780 1.00 67.41  ? 42  GLU C CD  1 
ATOM   5727  O OE1 . GLU C 1 42  ? -2.529  -34.015 -25.627 1.00 49.34  ? 42  GLU C OE1 1 
ATOM   5728  O OE2 . GLU C 1 42  ? -3.453  -33.543 -27.578 1.00 61.07  ? 42  GLU C OE2 1 
ATOM   5729  N N   . ASP C 1 43  ? 2.241   -33.635 -25.071 1.00 49.88  ? 43  ASP C N   1 
ATOM   5730  C CA  . ASP C 1 43  ? 3.630   -33.860 -24.668 1.00 50.55  ? 43  ASP C CA  1 
ATOM   5731  C C   . ASP C 1 43  ? 4.608   -33.337 -25.719 1.00 51.06  ? 43  ASP C C   1 
ATOM   5732  O O   . ASP C 1 43  ? 5.680   -32.830 -25.399 1.00 52.08  ? 43  ASP C O   1 
ATOM   5733  C CB  . ASP C 1 43  ? 3.866   -35.330 -24.311 1.00 53.73  ? 43  ASP C CB  1 
ATOM   5734  C CG  . ASP C 1 43  ? 3.601   -35.609 -22.837 1.00 64.84  ? 43  ASP C CG  1 
ATOM   5735  O OD1 . ASP C 1 43  ? 4.423   -35.201 -21.990 1.00 66.84  ? 43  ASP C OD1 1 
ATOM   5736  O OD2 . ASP C 1 43  ? 2.472   -36.007 -22.502 1.00 66.88  ? 43  ASP C OD2 1 
ATOM   5737  N N   . LYS C 1 44  ? 4.181   -33.362 -26.970 1.00 44.59  ? 44  LYS C N   1 
ATOM   5738  C CA  . LYS C 1 44  ? 4.953   -32.801 -28.074 1.00 43.57  ? 44  LYS C CA  1 
ATOM   5739  C C   . LYS C 1 44  ? 5.086   -31.271 -27.912 1.00 48.37  ? 44  LYS C C   1 
ATOM   5740  O O   . LYS C 1 44  ? 5.794   -30.610 -28.671 1.00 47.49  ? 44  LYS C O   1 
ATOM   5741  C CB  . LYS C 1 44  ? 4.205   -33.101 -29.382 1.00 43.63  ? 44  LYS C CB  1 
ATOM   5742  C CG  . LYS C 1 44  ? 2.879   -33.843 -29.142 1.00 47.28  ? 44  LYS C CG  1 
ATOM   5743  C CD  . LYS C 1 44  ? 2.199   -34.328 -30.416 1.00 56.25  ? 44  LYS C CD  1 
ATOM   5744  C CE  . LYS C 1 44  ? 2.173   -33.233 -31.487 1.00 75.29  ? 44  LYS C CE  1 
ATOM   5745  N NZ  . LYS C 1 44  ? 1.046   -32.268 -31.308 1.00 78.69  ? 44  LYS C NZ  1 
ATOM   5746  N N   . HIS C 1 45  ? 4.342   -30.707 -26.961 1.00 44.92  ? 45  HIS C N   1 
ATOM   5747  C CA  . HIS C 1 45  ? 4.265   -29.260 -26.780 1.00 43.35  ? 45  HIS C CA  1 
ATOM   5748  C C   . HIS C 1 45  ? 5.115   -28.667 -25.667 1.00 50.06  ? 45  HIS C C   1 
ATOM   5749  O O   . HIS C 1 45  ? 5.272   -27.451 -25.603 1.00 50.22  ? 45  HIS C O   1 
ATOM   5750  C CB  . HIS C 1 45  ? 2.799   -28.857 -26.560 1.00 42.39  ? 45  HIS C CB  1 
ATOM   5751  C CG  . HIS C 1 45  ? 1.884   -29.288 -27.659 1.00 43.99  ? 45  HIS C CG  1 
ATOM   5752  N ND1 . HIS C 1 45  ? 2.097   -28.951 -28.974 1.00 44.89  ? 45  HIS C ND1 1 
ATOM   5753  C CD2 . HIS C 1 45  ? 0.738   -30.007 -27.633 1.00 45.37  ? 45  HIS C CD2 1 
ATOM   5754  C CE1 . HIS C 1 45  ? 1.137   -29.467 -29.718 1.00 44.86  ? 45  HIS C CE1 1 
ATOM   5755  N NE2 . HIS C 1 45  ? 0.292   -30.104 -28.927 1.00 45.22  ? 45  HIS C NE2 1 
ATOM   5756  N N   . LYS C 1 46  ? 5.616   -29.512 -24.769 1.00 48.22  ? 46  LYS C N   1 
ATOM   5757  C CA  . LYS C 1 46  ? 6.449   -29.061 -23.652 1.00 48.73  ? 46  LYS C CA  1 
ATOM   5758  C C   . LYS C 1 46  ? 7.587   -28.087 -24.076 1.00 54.29  ? 46  LYS C C   1 
ATOM   5759  O O   . LYS C 1 46  ? 7.917   -27.123 -23.358 1.00 53.38  ? 46  LYS C O   1 
ATOM   5760  C CB  . LYS C 1 46  ? 7.003   -30.271 -22.884 1.00 50.62  ? 46  LYS C CB  1 
ATOM   5761  C CG  . LYS C 1 46  ? 6.064   -30.800 -21.781 1.00 65.43  ? 46  LYS C CG  1 
ATOM   5762  C CD  . LYS C 1 46  ? 6.781   -31.777 -20.832 1.00 73.50  ? 46  LYS C CD  1 
ATOM   5763  C CE  . LYS C 1 46  ? 6.309   -33.222 -21.024 1.00 79.45  ? 46  LYS C CE  1 
ATOM   5764  N NZ  . LYS C 1 46  ? 7.042   -34.172 -20.138 1.00 73.91  ? 46  LYS C NZ  1 
ATOM   5765  N N   . GLU C 1 47  ? 8.159   -28.338 -25.254 1.00 50.98  ? 47  GLU C N   1 
ATOM   5766  C CA  . GLU C 1 47  ? 9.229   -27.518 -25.810 1.00 50.07  ? 47  GLU C CA  1 
ATOM   5767  C C   . GLU C 1 47  ? 8.737   -26.151 -26.221 1.00 50.93  ? 47  GLU C C   1 
ATOM   5768  O O   . GLU C 1 47  ? 9.487   -25.179 -26.162 1.00 51.53  ? 47  GLU C O   1 
ATOM   5769  C CB  . GLU C 1 47  ? 9.789   -28.198 -27.056 1.00 52.10  ? 47  GLU C CB  1 
ATOM   5770  C CG  . GLU C 1 47  ? 11.316  -28.304 -27.107 1.00 66.45  ? 47  GLU C CG  1 
ATOM   5771  C CD  . GLU C 1 47  ? 11.790  -28.873 -28.435 1.00 90.21  ? 47  GLU C CD  1 
ATOM   5772  O OE1 . GLU C 1 47  ? 11.562  -30.088 -28.675 1.00 85.71  ? 47  GLU C OE1 1 
ATOM   5773  O OE2 . GLU C 1 47  ? 12.281  -28.084 -29.274 1.00 75.78  ? 47  GLU C OE2 1 
ATOM   5774  N N   . LEU C 1 48  ? 7.509   -26.103 -26.724 1.00 44.57  ? 48  LEU C N   1 
ATOM   5775  C CA  . LEU C 1 48  ? 6.883   -24.877 -27.198 1.00 43.56  ? 48  LEU C CA  1 
ATOM   5776  C C   . LEU C 1 48  ? 6.985   -23.706 -26.208 1.00 48.57  ? 48  LEU C C   1 
ATOM   5777  O O   . LEU C 1 48  ? 7.267   -22.558 -26.598 1.00 48.80  ? 48  LEU C O   1 
ATOM   5778  C CB  . LEU C 1 48  ? 5.406   -25.169 -27.489 1.00 43.29  ? 48  LEU C CB  1 
ATOM   5779  C CG  . LEU C 1 48  ? 4.474   -24.034 -27.910 1.00 46.93  ? 48  LEU C CG  1 
ATOM   5780  C CD1 . LEU C 1 48  ? 3.389   -24.642 -28.759 1.00 48.24  ? 48  LEU C CD1 1 
ATOM   5781  C CD2 . LEU C 1 48  ? 3.878   -23.315 -26.711 1.00 42.86  ? 48  LEU C CD2 1 
ATOM   5782  N N   . PHE C 1 49  ? 6.724   -23.991 -24.935 1.00 43.30  ? 49  PHE C N   1 
ATOM   5783  C CA  . PHE C 1 49  ? 6.637   -22.958 -23.925 1.00 42.90  ? 49  PHE C CA  1 
ATOM   5784  C C   . PHE C 1 49  ? 7.965   -22.331 -23.565 1.00 50.31  ? 49  PHE C C   1 
ATOM   5785  O O   . PHE C 1 49  ? 8.045   -21.118 -23.284 1.00 48.47  ? 49  PHE C O   1 
ATOM   5786  C CB  . PHE C 1 49  ? 5.925   -23.480 -22.686 1.00 43.67  ? 49  PHE C CB  1 
ATOM   5787  C CG  . PHE C 1 49  ? 4.461   -23.682 -22.879 1.00 44.03  ? 49  PHE C CG  1 
ATOM   5788  C CD1 . PHE C 1 49  ? 3.560   -22.678 -22.559 1.00 47.06  ? 49  PHE C CD1 1 
ATOM   5789  C CD2 . PHE C 1 49  ? 3.983   -24.859 -23.440 1.00 44.18  ? 49  PHE C CD2 1 
ATOM   5790  C CE1 . PHE C 1 49  ? 2.198   -22.877 -22.743 1.00 47.43  ? 49  PHE C CE1 1 
ATOM   5791  C CE2 . PHE C 1 49  ? 2.644   -25.058 -23.639 1.00 46.30  ? 49  PHE C CE2 1 
ATOM   5792  C CZ  . PHE C 1 49  ? 1.747   -24.076 -23.280 1.00 45.14  ? 49  PHE C CZ  1 
ATOM   5793  N N   . ASP C 1 50  ? 9.004   -23.157 -23.583 1.00 49.61  ? 50  ASP C N   1 
ATOM   5794  C CA  . ASP C 1 50  ? 10.350  -22.688 -23.291 1.00 49.72  ? 50  ASP C CA  1 
ATOM   5795  C C   . ASP C 1 50  ? 10.886  -21.817 -24.409 1.00 49.61  ? 50  ASP C C   1 
ATOM   5796  O O   . ASP C 1 50  ? 11.284  -20.682 -24.160 1.00 47.55  ? 50  ASP C O   1 
ATOM   5797  C CB  . ASP C 1 50  ? 11.299  -23.857 -23.033 1.00 53.31  ? 50  ASP C CB  1 
ATOM   5798  C CG  . ASP C 1 50  ? 11.077  -24.500 -21.670 1.00 72.70  ? 50  ASP C CG  1 
ATOM   5799  O OD1 . ASP C 1 50  ? 11.603  -23.963 -20.656 1.00 70.63  ? 50  ASP C OD1 1 
ATOM   5800  O OD2 . ASP C 1 50  ? 10.342  -25.521 -21.617 1.00 83.99  ? 50  ASP C OD2 1 
ATOM   5801  N N   . GLU C 1 51  ? 10.904  -22.335 -25.638 1.00 45.47  ? 51  GLU C N   1 
ATOM   5802  C CA  . GLU C 1 51  ? 11.439  -21.534 -26.730 1.00 45.04  ? 51  GLU C CA  1 
ATOM   5803  C C   . GLU C 1 51  ? 10.631  -20.285 -27.052 1.00 48.71  ? 51  GLU C C   1 
ATOM   5804  O O   . GLU C 1 51  ? 11.209  -19.268 -27.405 1.00 49.87  ? 51  GLU C O   1 
ATOM   5805  C CB  . GLU C 1 51  ? 11.818  -22.356 -27.959 1.00 46.11  ? 51  GLU C CB  1 
ATOM   5806  C CG  . GLU C 1 51  ? 10.711  -22.572 -28.936 1.00 55.74  ? 51  GLU C CG  1 
ATOM   5807  C CD  . GLU C 1 51  ? 11.158  -23.350 -30.146 1.00 64.71  ? 51  GLU C CD  1 
ATOM   5808  O OE1 . GLU C 1 51  ? 11.297  -24.594 -30.046 1.00 65.63  ? 51  GLU C OE1 1 
ATOM   5809  O OE2 . GLU C 1 51  ? 11.409  -22.704 -31.187 1.00 45.26  ? 51  GLU C OE2 1 
ATOM   5810  N N   . LEU C 1 52  ? 9.327   -20.307 -26.790 1.00 42.87  ? 52  LEU C N   1 
ATOM   5811  C CA  . LEU C 1 52  ? 8.518   -19.122 -27.052 1.00 41.14  ? 52  LEU C CA  1 
ATOM   5812  C C   . LEU C 1 52  ? 9.087   -17.929 -26.259 1.00 43.65  ? 52  LEU C C   1 
ATOM   5813  O O   . LEU C 1 52  ? 9.451   -16.891 -26.824 1.00 41.19  ? 52  LEU C O   1 
ATOM   5814  C CB  . LEU C 1 52  ? 7.018   -19.380 -26.782 1.00 40.30  ? 52  LEU C CB  1 
ATOM   5815  C CG  . LEU C 1 52  ? 6.042   -18.189 -26.819 1.00 42.38  ? 52  LEU C CG  1 
ATOM   5816  C CD1 . LEU C 1 52  ? 5.693   -17.696 -28.217 1.00 40.81  ? 52  LEU C CD1 1 
ATOM   5817  C CD2 . LEU C 1 52  ? 4.795   -18.394 -25.991 1.00 39.77  ? 52  LEU C CD2 1 
ATOM   5818  N N   . VAL C 1 53  ? 9.267   -18.118 -24.962 1.00 42.35  ? 53  VAL C N   1 
ATOM   5819  C CA  . VAL C 1 53  ? 9.843   -17.075 -24.102 1.00 42.18  ? 53  VAL C CA  1 
ATOM   5820  C C   . VAL C 1 53  ? 11.283  -16.731 -24.503 1.00 46.46  ? 53  VAL C C   1 
ATOM   5821  O O   . VAL C 1 53  ? 11.646  -15.554 -24.644 1.00 45.54  ? 53  VAL C O   1 
ATOM   5822  C CB  . VAL C 1 53  ? 9.850   -17.503 -22.624 1.00 45.26  ? 53  VAL C CB  1 
ATOM   5823  C CG1 . VAL C 1 53  ? 10.785  -16.601 -21.832 1.00 44.92  ? 53  VAL C CG1 1 
ATOM   5824  C CG2 . VAL C 1 53  ? 8.431   -17.485 -22.040 1.00 44.97  ? 53  VAL C CG2 1 
ATOM   5825  N N   . LYS C 1 54  ? 12.096  -17.766 -24.690 1.00 44.29  ? 54  LYS C N   1 
ATOM   5826  C CA  . LYS C 1 54  ? 13.484  -17.595 -25.104 1.00 45.34  ? 54  LYS C CA  1 
ATOM   5827  C C   . LYS C 1 54  ? 13.685  -16.898 -26.465 1.00 50.70  ? 54  LYS C C   1 
ATOM   5828  O O   . LYS C 1 54  ? 14.535  -16.023 -26.574 1.00 54.36  ? 54  LYS C O   1 
ATOM   5829  C CB  . LYS C 1 54  ? 14.198  -18.946 -25.113 1.00 48.84  ? 54  LYS C CB  1 
ATOM   5830  C CG  . LYS C 1 54  ? 14.263  -19.648 -23.752 1.00 67.32  ? 54  LYS C CG  1 
ATOM   5831  C CD  . LYS C 1 54  ? 15.203  -20.865 -23.805 1.00 73.69  ? 54  LYS C CD  1 
ATOM   5832  C CE  . LYS C 1 54  ? 15.235  -21.634 -22.480 1.00 80.60  ? 54  LYS C CE  1 
ATOM   5833  N NZ  . LYS C 1 54  ? 14.595  -22.984 -22.552 1.00 80.25  ? 54  LYS C NZ  1 
ATOM   5834  N N   . LYS C 1 55  ? 12.929  -17.285 -27.495 1.00 42.60  ? 55  LYS C N   1 
ATOM   5835  C CA  . LYS C 1 55  ? 13.099  -16.720 -28.828 1.00 41.04  ? 55  LYS C CA  1 
ATOM   5836  C C   . LYS C 1 55  ? 12.333  -15.441 -29.172 1.00 46.07  ? 55  LYS C C   1 
ATOM   5837  O O   . LYS C 1 55  ? 12.742  -14.703 -30.071 1.00 45.82  ? 55  LYS C O   1 
ATOM   5838  C CB  . LYS C 1 55  ? 12.790  -17.771 -29.898 1.00 43.08  ? 55  LYS C CB  1 
ATOM   5839  C CG  . LYS C 1 55  ? 13.508  -19.103 -29.737 1.00 59.45  ? 55  LYS C CG  1 
ATOM   5840  C CD  . LYS C 1 55  ? 13.461  -19.910 -31.043 1.00 76.24  ? 55  LYS C CD  1 
ATOM   5841  C CE  . LYS C 1 55  ? 14.726  -20.740 -31.219 1.00 95.44  ? 55  LYS C CE  1 
ATOM   5842  N NZ  . LYS C 1 55  ? 15.925  -20.062 -30.635 1.00 105.92 ? 55  LYS C NZ  1 
ATOM   5843  N N   . PHE C 1 56  ? 11.170  -15.228 -28.562 1.00 43.64  ? 56  PHE C N   1 
ATOM   5844  C CA  . PHE C 1 56  ? 10.326  -14.089 -28.950 1.00 43.52  ? 56  PHE C CA  1 
ATOM   5845  C C   . PHE C 1 56  ? 10.012  -13.038 -27.883 1.00 45.42  ? 56  PHE C C   1 
ATOM   5846  O O   . PHE C 1 56  ? 10.409  -13.146 -26.727 1.00 44.59  ? 56  PHE C O   1 
ATOM   5847  C CB  . PHE C 1 56  ? 9.042   -14.559 -29.654 1.00 45.35  ? 56  PHE C CB  1 
ATOM   5848  C CG  . PHE C 1 56  ? 9.282   -15.603 -30.712 1.00 46.42  ? 56  PHE C CG  1 
ATOM   5849  C CD1 . PHE C 1 56  ? 9.640   -16.906 -30.362 1.00 47.89  ? 56  PHE C CD1 1 
ATOM   5850  C CD2 . PHE C 1 56  ? 9.162   -15.280 -32.059 1.00 48.04  ? 56  PHE C CD2 1 
ATOM   5851  C CE1 . PHE C 1 56  ? 9.833   -17.871 -31.323 1.00 48.34  ? 56  PHE C CE1 1 
ATOM   5852  C CE2 . PHE C 1 56  ? 9.348   -16.248 -33.035 1.00 50.34  ? 56  PHE C CE2 1 
ATOM   5853  C CZ  . PHE C 1 56  ? 9.686   -17.550 -32.664 1.00 47.76  ? 56  PHE C CZ  1 
ATOM   5854  N N   . LYS C 1 57  ? 9.383   -11.960 -28.307 1.00 41.25  ? 57  LYS C N   1 
ATOM   5855  C CA  . LYS C 1 57  ? 9.086   -10.895 -27.370 1.00 41.20  ? 57  LYS C CA  1 
ATOM   5856  C C   . LYS C 1 57  ? 7.719   -11.183 -26.778 1.00 43.96  ? 57  LYS C C   1 
ATOM   5857  O O   . LYS C 1 57  ? 6.681   -10.780 -27.303 1.00 44.93  ? 57  LYS C O   1 
ATOM   5858  C CB  . LYS C 1 57  ? 9.147   -9.508  -28.043 1.00 43.19  ? 57  LYS C CB  1 
ATOM   5859  C CG  . LYS C 1 57  ? 10.551  -9.077  -28.455 1.00 61.90  ? 57  LYS C CG  1 
ATOM   5860  C CD  . LYS C 1 57  ? 10.526  -7.773  -29.242 1.00 81.15  ? 57  LYS C CD  1 
ATOM   5861  C CE  . LYS C 1 57  ? 11.863  -7.052  -29.153 1.00 92.60  ? 57  LYS C CE  1 
ATOM   5862  N NZ  . LYS C 1 57  ? 12.951  -8.018  -28.839 1.00 103.71 ? 57  LYS C NZ  1 
ATOM   5863  N N   . VAL C 1 58  ? 7.725   -11.886 -25.661 1.00 38.05  ? 58  VAL C N   1 
ATOM   5864  C CA  . VAL C 1 58  ? 6.494   -12.242 -24.988 1.00 37.32  ? 58  VAL C CA  1 
ATOM   5865  C C   . VAL C 1 58  ? 5.955   -11.236 -23.988 1.00 40.38  ? 58  VAL C C   1 
ATOM   5866  O O   . VAL C 1 58  ? 6.693   -10.501 -23.347 1.00 41.29  ? 58  VAL C O   1 
ATOM   5867  C CB  . VAL C 1 58  ? 6.614   -13.606 -24.295 1.00 42.44  ? 58  VAL C CB  1 
ATOM   5868  C CG1 . VAL C 1 58  ? 7.908   -13.700 -23.467 1.00 42.14  ? 58  VAL C CG1 1 
ATOM   5869  C CG2 . VAL C 1 58  ? 5.379   -13.880 -23.435 1.00 42.43  ? 58  VAL C CG2 1 
ATOM   5870  N N   . GLU C 1 59  ? 4.645   -11.266 -23.804 1.00 35.18  ? 59  GLU C N   1 
ATOM   5871  C CA  . GLU C 1 59  ? 3.976   -10.429 -22.832 1.00 32.60  ? 59  GLU C CA  1 
ATOM   5872  C C   . GLU C 1 59  ? 3.250   -11.327 -21.836 1.00 35.39  ? 59  GLU C C   1 
ATOM   5873  O O   . GLU C 1 59  ? 3.064   -12.530 -22.089 1.00 35.91  ? 59  GLU C O   1 
ATOM   5874  C CB  . GLU C 1 59  ? 2.984   -9.522  -23.543 1.00 33.07  ? 59  GLU C CB  1 
ATOM   5875  C CG  . GLU C 1 59  ? 3.661   -8.410  -24.323 1.00 42.95  ? 59  GLU C CG  1 
ATOM   5876  C CD  . GLU C 1 59  ? 2.742   -7.224  -24.547 1.00 64.01  ? 59  GLU C CD  1 
ATOM   5877  O OE1 . GLU C 1 59  ? 2.287   -6.641  -23.538 1.00 48.99  ? 59  GLU C OE1 1 
ATOM   5878  O OE2 . GLU C 1 59  ? 2.432   -6.903  -25.717 1.00 57.91  ? 59  GLU C OE2 1 
ATOM   5879  N N   . TYR C 1 60  ? 2.838   -10.755 -20.704 1.00 29.00  ? 60  TYR C N   1 
ATOM   5880  C CA  . TYR C 1 60  ? 2.099   -11.522 -19.710 1.00 27.09  ? 60  TYR C CA  1 
ATOM   5881  C C   . TYR C 1 60  ? 0.780   -10.841 -19.332 1.00 32.77  ? 60  TYR C C   1 
ATOM   5882  O O   . TYR C 1 60  ? 0.722   -9.623  -19.217 1.00 34.01  ? 60  TYR C O   1 
ATOM   5883  C CB  . TYR C 1 60  ? 2.963   -11.776 -18.493 1.00 26.57  ? 60  TYR C CB  1 
ATOM   5884  C CG  . TYR C 1 60  ? 4.248   -12.502 -18.829 1.00 26.16  ? 60  TYR C CG  1 
ATOM   5885  C CD1 . TYR C 1 60  ? 4.304   -13.898 -18.870 1.00 28.01  ? 60  TYR C CD1 1 
ATOM   5886  C CD2 . TYR C 1 60  ? 5.399   -11.803 -19.124 1.00 25.79  ? 60  TYR C CD2 1 
ATOM   5887  C CE1 . TYR C 1 60  ? 5.482   -14.570 -19.201 1.00 25.43  ? 60  TYR C CE1 1 
ATOM   5888  C CE2 . TYR C 1 60  ? 6.578   -12.479 -19.452 1.00 26.16  ? 60  TYR C CE2 1 
ATOM   5889  C CZ  . TYR C 1 60  ? 6.600   -13.839 -19.520 1.00 30.70  ? 60  TYR C CZ  1 
ATOM   5890  O OH  . TYR C 1 60  ? 7.762   -14.456 -19.919 1.00 39.06  ? 60  TYR C OH  1 
ATOM   5891  N N   . HIS C 1 61  ? -0.293  -11.629 -19.219 1.00 28.14  ? 61  HIS C N   1 
ATOM   5892  C CA  . HIS C 1 61  ? -1.624  -11.130 -18.863 1.00 26.08  ? 61  HIS C CA  1 
ATOM   5893  C C   . HIS C 1 61  ? -2.427  -12.201 -18.106 1.00 26.52  ? 61  HIS C C   1 
ATOM   5894  O O   . HIS C 1 61  ? -2.489  -13.352 -18.526 1.00 25.21  ? 61  HIS C O   1 
ATOM   5895  C CB  . HIS C 1 61  ? -2.404  -10.684 -20.126 1.00 26.87  ? 61  HIS C CB  1 
ATOM   5896  C CG  . HIS C 1 61  ? -1.770  -9.547  -20.862 1.00 31.88  ? 61  HIS C CG  1 
ATOM   5897  N ND1 . HIS C 1 61  ? -1.817  -8.241  -20.416 1.00 35.23  ? 61  HIS C ND1 1 
ATOM   5898  C CD2 . HIS C 1 61  ? -1.061  -9.520  -22.014 1.00 35.30  ? 61  HIS C CD2 1 
ATOM   5899  C CE1 . HIS C 1 61  ? -1.159  -7.461  -21.258 1.00 35.36  ? 61  HIS C CE1 1 
ATOM   5900  N NE2 . HIS C 1 61  ? -0.689  -8.214  -22.239 1.00 35.69  ? 61  HIS C NE2 1 
ATOM   5901  N N   . ALA C 1 62  ? -3.091  -11.802 -17.023 1.00 21.13  ? 62  ALA C N   1 
ATOM   5902  C CA  . ALA C 1 62  ? -3.945  -12.715 -16.266 1.00 19.60  ? 62  ALA C CA  1 
ATOM   5903  C C   . ALA C 1 62  ? -5.029  -13.178 -17.208 1.00 23.44  ? 62  ALA C C   1 
ATOM   5904  O O   . ALA C 1 62  ? -5.649  -12.378 -17.923 1.00 21.30  ? 62  ALA C O   1 
ATOM   5905  C CB  . ALA C 1 62  ? -4.553  -12.022 -15.076 1.00 20.28  ? 62  ALA C CB  1 
ATOM   5906  N N   . GLY C 1 63  ? -5.239  -14.490 -17.249 1.00 21.77  ? 63  GLY C N   1 
ATOM   5907  C CA  . GLY C 1 63  ? -6.198  -15.068 -18.192 1.00 20.20  ? 63  GLY C CA  1 
ATOM   5908  C C   . GLY C 1 63  ? -7.098  -16.106 -17.549 1.00 20.85  ? 63  GLY C C   1 
ATOM   5909  O O   . GLY C 1 63  ? -7.425  -16.011 -16.378 1.00 19.87  ? 63  GLY C O   1 
ATOM   5910  N N   . GLY C 1 64  ? -7.479  -17.115 -18.321 1.00 16.12  ? 64  GLY C N   1 
ATOM   5911  C CA  . GLY C 1 64  ? -8.461  -18.080 -17.875 1.00 15.78  ? 64  GLY C CA  1 
ATOM   5912  C C   . GLY C 1 64  ? -9.778  -17.478 -18.359 1.00 18.71  ? 64  GLY C C   1 
ATOM   5913  O O   . GLY C 1 64  ? -10.030 -16.283 -18.131 1.00 14.67  ? 64  GLY C O   1 
ATOM   5914  N N   . SER C 1 65  ? -10.536 -18.265 -19.137 1.00 14.29  ? 65  SER C N   1 
ATOM   5915  C CA  . SER C 1 65  ? -11.764 -17.774 -19.756 1.00 13.05  ? 65  SER C CA  1 
ATOM   5916  C C   . SER C 1 65  ? -12.762 -17.292 -18.705 1.00 17.19  ? 65  SER C C   1 
ATOM   5917  O O   . SER C 1 65  ? -13.111 -16.114 -18.660 1.00 17.61  ? 65  SER C O   1 
ATOM   5918  C CB  . SER C 1 65  ? -12.386 -18.856 -20.650 1.00 15.91  ? 65  SER C CB  1 
ATOM   5919  O OG  . SER C 1 65  ? -13.613 -18.412 -21.170 1.00 23.92  ? 65  SER C OG  1 
ATOM   5920  N N   . THR C 1 66  ? -13.159 -18.173 -17.798 1.00 12.12  ? 66  THR C N   1 
ATOM   5921  C CA  . THR C 1 66  ? -14.143 -17.827 -16.788 1.00 10.25  ? 66  THR C CA  1 
ATOM   5922  C C   . THR C 1 66  ? -13.664 -16.695 -15.959 1.00 14.32  ? 66  THR C C   1 
ATOM   5923  O O   . THR C 1 66  ? -14.416 -15.759 -15.665 1.00 17.62  ? 66  THR C O   1 
ATOM   5924  C CB  . THR C 1 66  ? -14.451 -19.014 -15.880 1.00 15.38  ? 66  THR C CB  1 
ATOM   5925  O OG1 . THR C 1 66  ? -14.963 -20.084 -16.667 1.00 18.18  ? 66  THR C OG1 1 
ATOM   5926  C CG2 . THR C 1 66  ? -15.462 -18.661 -14.869 1.00 8.12   ? 66  THR C CG2 1 
ATOM   5927  N N   . GLN C 1 67  ? -12.425 -16.796 -15.513 1.00 9.16   ? 67  GLN C N   1 
ATOM   5928  C CA  . GLN C 1 67  ? -11.803 -15.712 -14.737 1.00 8.74   ? 67  GLN C CA  1 
ATOM   5929  C C   . GLN C 1 67  ? -11.970 -14.331 -15.414 1.00 12.91  ? 67  GLN C C   1 
ATOM   5930  O O   . GLN C 1 67  ? -12.402 -13.361 -14.785 1.00 11.54  ? 67  GLN C O   1 
ATOM   5931  C CB  . GLN C 1 67  ? -10.308 -16.007 -14.421 1.00 9.22   ? 67  GLN C CB  1 
ATOM   5932  C CG  . GLN C 1 67  ? -9.847  -15.205 -13.231 1.00 14.50  ? 67  GLN C CG  1 
ATOM   5933  C CD  . GLN C 1 67  ? -8.423  -15.430 -12.844 1.00 30.48  ? 67  GLN C CD  1 
ATOM   5934  O OE1 . GLN C 1 67  ? -8.029  -15.096 -11.708 1.00 16.42  ? 67  GLN C OE1 1 
ATOM   5935  N NE2 . GLN C 1 67  ? -7.623  -16.011 -13.764 1.00 16.82  ? 67  GLN C NE2 1 
ATOM   5936  N N   . ASN C 1 68  ? -11.632 -14.254 -16.700 1.00 10.03  ? 68  ASN C N   1 
ATOM   5937  C CA  . ASN C 1 68  ? -11.773 -13.023 -17.477 1.00 9.75   ? 68  ASN C CA  1 
ATOM   5938  C C   . ASN C 1 68  ? -13.207 -12.480 -17.409 1.00 14.98  ? 68  ASN C C   1 
ATOM   5939  O O   . ASN C 1 68  ? -13.427 -11.271 -17.202 1.00 13.11  ? 68  ASN C O   1 
ATOM   5940  C CB  . ASN C 1 68  ? -11.409 -13.285 -18.928 1.00 7.62   ? 68  ASN C CB  1 
ATOM   5941  C CG  . ASN C 1 68  ? -9.923  -13.479 -19.121 1.00 26.19  ? 68  ASN C CG  1 
ATOM   5942  O OD1 . ASN C 1 68  ? -9.151  -13.321 -18.165 1.00 25.25  ? 68  ASN C OD1 1 
ATOM   5943  N ND2 . ASN C 1 68  ? -9.497  -13.674 -20.382 1.00 5.86   ? 68  ASN C ND2 1 
ATOM   5944  N N   . SER C 1 69  ? -14.167 -13.378 -17.644 1.00 12.49  ? 69  SER C N   1 
ATOM   5945  C CA  . SER C 1 69  ? -15.602 -13.061 -17.696 1.00 10.94  ? 69  SER C CA  1 
ATOM   5946  C C   . SER C 1 69  ? -16.079 -12.521 -16.385 1.00 19.86  ? 69  SER C C   1 
ATOM   5947  O O   . SER C 1 69  ? -16.677 -11.447 -16.351 1.00 22.95  ? 69  SER C O   1 
ATOM   5948  C CB  . SER C 1 69  ? -16.409 -14.284 -18.077 1.00 10.84  ? 69  SER C CB  1 
ATOM   5949  O OG  . SER C 1 69  ? -16.326 -14.504 -19.468 1.00 17.94  ? 69  SER C OG  1 
ATOM   5950  N N   . ILE C 1 70  ? -15.790 -13.245 -15.299 1.00 16.21  ? 70  ILE C N   1 
ATOM   5951  C CA  . ILE C 1 70  ? -16.060 -12.756 -13.924 1.00 13.73  ? 70  ILE C CA  1 
ATOM   5952  C C   . ILE C 1 70  ? -15.466 -11.337 -13.666 1.00 14.49  ? 70  ILE C C   1 
ATOM   5953  O O   . ILE C 1 70  ? -16.080 -10.516 -12.989 1.00 14.42  ? 70  ILE C O   1 
ATOM   5954  C CB  . ILE C 1 70  ? -15.523 -13.781 -12.861 1.00 15.60  ? 70  ILE C CB  1 
ATOM   5955  C CG1 . ILE C 1 70  ? -16.396 -15.066 -12.862 1.00 15.47  ? 70  ILE C CG1 1 
ATOM   5956  C CG2 . ILE C 1 70  ? -15.504 -13.190 -11.433 1.00 14.73  ? 70  ILE C CG2 1 
ATOM   5957  C CD1 . ILE C 1 70  ? -17.891 -14.870 -12.481 1.00 1.00   ? 70  ILE C CD1 1 
ATOM   5958  N N   . LYS C 1 71  ? -14.284 -11.044 -14.210 1.00 9.54   ? 71  LYS C N   1 
ATOM   5959  C CA  . LYS C 1 71  ? -13.696 -9.720  -14.059 1.00 10.76  ? 71  LYS C CA  1 
ATOM   5960  C C   . LYS C 1 71  ? -14.446 -8.642  -14.839 1.00 19.08  ? 71  LYS C C   1 
ATOM   5961  O O   . LYS C 1 71  ? -14.719 -7.588  -14.322 1.00 18.76  ? 71  LYS C O   1 
ATOM   5962  C CB  . LYS C 1 71  ? -12.218 -9.706  -14.429 1.00 13.02  ? 71  LYS C CB  1 
ATOM   5963  C CG  . LYS C 1 71  ? -11.315 -10.502 -13.465 1.00 22.95  ? 71  LYS C CG  1 
ATOM   5964  C CD  . LYS C 1 71  ? -9.924  -10.667 -14.081 1.00 20.67  ? 71  LYS C CD  1 
ATOM   5965  C CE  . LYS C 1 71  ? -8.874  -11.187 -13.097 1.00 5.59   ? 71  LYS C CE  1 
ATOM   5966  N NZ  . LYS C 1 71  ? -7.567  -11.170 -13.796 1.00 6.83   ? 71  LYS C NZ  1 
ATOM   5967  N N   . VAL C 1 72  ? -14.752 -8.903  -16.096 1.00 19.56  ? 72  VAL C N   1 
ATOM   5968  C CA  . VAL C 1 72  ? -15.509 -7.963  -16.928 1.00 19.24  ? 72  VAL C CA  1 
ATOM   5969  C C   . VAL C 1 72  ? -16.859 -7.674  -16.270 1.00 29.32  ? 72  VAL C C   1 
ATOM   5970  O O   . VAL C 1 72  ? -17.279 -6.495  -16.195 1.00 30.87  ? 72  VAL C O   1 
ATOM   5971  C CB  . VAL C 1 72  ? -15.741 -8.577  -18.313 1.00 21.55  ? 72  VAL C CB  1 
ATOM   5972  C CG1 . VAL C 1 72  ? -16.690 -7.737  -19.152 1.00 20.58  ? 72  VAL C CG1 1 
ATOM   5973  C CG2 . VAL C 1 72  ? -14.395 -8.748  -18.999 1.00 20.77  ? 72  VAL C CG2 1 
ATOM   5974  N N   . ALA C 1 73  ? -17.512 -8.735  -15.761 1.00 24.56  ? 73  ALA C N   1 
ATOM   5975  C CA  . ALA C 1 73  ? -18.802 -8.616  -15.086 1.00 23.38  ? 73  ALA C CA  1 
ATOM   5976  C C   . ALA C 1 73  ? -18.715 -7.715  -13.864 1.00 28.37  ? 73  ALA C C   1 
ATOM   5977  O O   . ALA C 1 73  ? -19.588 -6.884  -13.643 1.00 29.98  ? 73  ALA C O   1 
ATOM   5978  C CB  . ALA C 1 73  ? -19.343 -9.967  -14.700 1.00 24.11  ? 73  ALA C CB  1 
ATOM   5979  N N   . GLN C 1 74  ? -17.684 -7.911  -13.056 1.00 24.63  ? 74  GLN C N   1 
ATOM   5980  C CA  . GLN C 1 74  ? -17.450 -7.079  -11.875 1.00 24.51  ? 74  GLN C CA  1 
ATOM   5981  C C   . GLN C 1 74  ? -17.293 -5.638  -12.328 1.00 27.94  ? 74  GLN C C   1 
ATOM   5982  O O   . GLN C 1 74  ? -17.897 -4.727  -11.784 1.00 29.76  ? 74  GLN C O   1 
ATOM   5983  C CB  . GLN C 1 74  ? -16.164 -7.521  -11.137 1.00 25.46  ? 74  GLN C CB  1 
ATOM   5984  C CG  . GLN C 1 74  ? -15.821 -6.724  -9.838  1.00 15.73  ? 74  GLN C CG  1 
ATOM   5985  C CD  . GLN C 1 74  ? -16.951 -6.719  -8.828  1.00 31.52  ? 74  GLN C CD  1 
ATOM   5986  O OE1 . GLN C 1 74  ? -17.622 -7.738  -8.631  1.00 26.76  ? 74  GLN C OE1 1 
ATOM   5987  N NE2 . GLN C 1 74  ? -17.270 -5.528  -8.308  1.00 16.79  ? 74  GLN C NE2 1 
ATOM   5988  N N   . TRP C 1 75  ? -16.441 -5.436  -13.302 1.00 24.04  ? 75  TRP C N   1 
ATOM   5989  C CA  . TRP C 1 75  ? -16.219 -4.111  -13.827 1.00 25.59  ? 75  TRP C CA  1 
ATOM   5990  C C   . TRP C 1 75  ? -17.563 -3.467  -14.225 1.00 33.28  ? 75  TRP C C   1 
ATOM   5991  O O   . TRP C 1 75  ? -17.761 -2.271  -14.031 1.00 35.18  ? 75  TRP C O   1 
ATOM   5992  C CB  . TRP C 1 75  ? -15.301 -4.192  -15.055 1.00 24.16  ? 75  TRP C CB  1 
ATOM   5993  C CG  . TRP C 1 75  ? -14.997 -2.846  -15.666 1.00 24.89  ? 75  TRP C CG  1 
ATOM   5994  C CD1 . TRP C 1 75  ? -14.304 -1.820  -15.086 1.00 27.27  ? 75  TRP C CD1 1 
ATOM   5995  C CD2 . TRP C 1 75  ? -15.440 -2.357  -16.940 1.00 24.62  ? 75  TRP C CD2 1 
ATOM   5996  N NE1 . TRP C 1 75  ? -14.231 -0.760  -15.940 1.00 25.84  ? 75  TRP C NE1 1 
ATOM   5997  C CE2 . TRP C 1 75  ? -14.920 -1.055  -17.086 1.00 27.60  ? 75  TRP C CE2 1 
ATOM   5998  C CE3 . TRP C 1 75  ? -16.166 -2.910  -17.987 1.00 26.04  ? 75  TRP C CE3 1 
ATOM   5999  C CZ2 . TRP C 1 75  ? -15.140 -0.285  -18.223 1.00 27.03  ? 75  TRP C CZ2 1 
ATOM   6000  C CZ3 . TRP C 1 75  ? -16.325 -2.168  -19.137 1.00 27.79  ? 75  TRP C CZ3 1 
ATOM   6001  C CH2 . TRP C 1 75  ? -15.844 -0.862  -19.234 1.00 28.19  ? 75  TRP C CH2 1 
ATOM   6002  N N   . MET C 1 76  ? -18.460 -4.240  -14.824 1.00 28.45  ? 76  MET C N   1 
ATOM   6003  C CA  . MET C 1 76  ? -19.720 -3.692  -15.282 1.00 28.13  ? 76  MET C CA  1 
ATOM   6004  C C   . MET C 1 76  ? -20.626 -3.401  -14.099 1.00 32.16  ? 76  MET C C   1 
ATOM   6005  O O   . MET C 1 76  ? -21.536 -2.585  -14.189 1.00 30.73  ? 76  MET C O   1 
ATOM   6006  C CB  . MET C 1 76  ? -20.445 -4.708  -16.183 1.00 30.68  ? 76  MET C CB  1 
ATOM   6007  C CG  . MET C 1 76  ? -19.906 -4.835  -17.593 1.00 34.38  ? 76  MET C CG  1 
ATOM   6008  S SD  . MET C 1 76  ? -19.878 -3.316  -18.619 1.00 37.89  ? 76  MET C SD  1 
ATOM   6009  C CE  . MET C 1 76  ? -21.310 -3.605  -19.788 1.00 32.47  ? 76  MET C CE  1 
ATOM   6010  N N   . ILE C 1 77  ? -20.504 -4.234  -13.071 1.00 29.26  ? 77  ILE C N   1 
ATOM   6011  C CA  . ILE C 1 77  ? -21.392 -4.172  -11.907 1.00 27.80  ? 77  ILE C CA  1 
ATOM   6012  C C   . ILE C 1 77  ? -20.940 -3.021  -11.058 1.00 31.05  ? 77  ILE C C   1 
ATOM   6013  O O   . ILE C 1 77  ? -21.719 -2.434  -10.341 1.00 27.87  ? 77  ILE C O   1 
ATOM   6014  C CB  . ILE C 1 77  ? -21.390 -5.511  -11.112 1.00 29.85  ? 77  ILE C CB  1 
ATOM   6015  C CG1 . ILE C 1 77  ? -22.116 -6.593  -11.928 1.00 28.63  ? 77  ILE C CG1 1 
ATOM   6016  C CG2 . ILE C 1 77  ? -22.016 -5.353  -9.728  1.00 29.27  ? 77  ILE C CG2 1 
ATOM   6017  C CD1 . ILE C 1 77  ? -21.450 -7.960  -11.879 1.00 22.87  ? 77  ILE C CD1 1 
ATOM   6018  N N   . GLN C 1 78  ? -19.668 -2.679  -11.227 1.00 31.22  ? 78  GLN C N   1 
ATOM   6019  C CA  . GLN C 1 78  ? -19.020 -1.545  -10.581 1.00 31.18  ? 78  GLN C CA  1 
ATOM   6020  C C   . GLN C 1 78  ? -19.409 -1.411  -9.129  1.00 37.33  ? 78  GLN C C   1 
ATOM   6021  O O   . GLN C 1 78  ? -18.584 -1.479  -8.210  1.00 35.81  ? 78  GLN C O   1 
ATOM   6022  C CB  . GLN C 1 78  ? -19.362 -0.273  -11.340 1.00 31.90  ? 78  GLN C CB  1 
ATOM   6023  C CG  . GLN C 1 78  ? -18.429 0.866   -10.996 1.00 43.36  ? 78  GLN C CG  1 
ATOM   6024  C CD  . GLN C 1 78  ? -16.986 0.513   -11.261 1.00 61.70  ? 78  GLN C CD  1 
ATOM   6025  O OE1 . GLN C 1 78  ? -16.682 -0.204  -12.219 1.00 62.18  ? 78  GLN C OE1 1 
ATOM   6026  N NE2 . GLN C 1 78  ? -16.084 0.989   -10.397 1.00 46.04  ? 78  GLN C NE2 1 
ATOM   6027  N N   . GLN C 1 79  ? -20.703 -1.230  -8.957  1.00 37.84  ? 79  GLN C N   1 
ATOM   6028  C CA  . GLN C 1 79  ? -21.385 -1.115  -7.684  1.00 40.01  ? 79  GLN C CA  1 
ATOM   6029  C C   . GLN C 1 79  ? -20.720 -1.633  -6.409  1.00 42.36  ? 79  GLN C C   1 
ATOM   6030  O O   . GLN C 1 79  ? -19.880 -0.915  -5.858  1.00 44.17  ? 79  GLN C O   1 
ATOM   6031  C CB  . GLN C 1 79  ? -22.871 -1.493  -7.838  1.00 42.71  ? 79  GLN C CB  1 
ATOM   6032  C CG  . GLN C 1 79  ? -23.794 -0.276  -7.787  1.00 80.36  ? 79  GLN C CG  1 
ATOM   6033  C CD  . GLN C 1 79  ? -23.848 0.480   -9.104  1.00 97.40  ? 79  GLN C CD  1 
ATOM   6034  O OE1 . GLN C 1 79  ? -22.895 1.160   -9.500  1.00 89.41  ? 79  GLN C OE1 1 
ATOM   6035  N NE2 . GLN C 1 79  ? -24.963 0.342   -9.806  1.00 90.66  ? 79  GLN C NE2 1 
ATOM   6036  N N   . PRO C 1 80  ? -21.145 -2.784  -5.865  1.00 35.42  ? 80  PRO C N   1 
ATOM   6037  C CA  . PRO C 1 80  ? -20.479 -3.253  -4.636  1.00 33.77  ? 80  PRO C CA  1 
ATOM   6038  C C   . PRO C 1 80  ? -19.313 -4.125  -5.072  1.00 33.44  ? 80  PRO C C   1 
ATOM   6039  O O   . PRO C 1 80  ? -19.438 -4.918  -6.047  1.00 30.32  ? 80  PRO C O   1 
ATOM   6040  C CB  . PRO C 1 80  ? -21.547 -4.088  -3.929  1.00 34.97  ? 80  PRO C CB  1 
ATOM   6041  C CG  . PRO C 1 80  ? -22.434 -4.613  -5.061  1.00 38.58  ? 80  PRO C CG  1 
ATOM   6042  C CD  . PRO C 1 80  ? -22.291 -3.657  -6.228  1.00 34.09  ? 80  PRO C CD  1 
ATOM   6043  N N   . HIS C 1 81  ? -18.173 -3.902  -4.408  1.00 27.19  ? 81  HIS C N   1 
ATOM   6044  C CA  . HIS C 1 81  ? -16.958 -4.629  -4.708  1.00 26.27  ? 81  HIS C CA  1 
ATOM   6045  C C   . HIS C 1 81  ? -17.219 -6.088  -4.347  1.00 29.07  ? 81  HIS C C   1 
ATOM   6046  O O   . HIS C 1 81  ? -18.115 -6.382  -3.554  1.00 29.19  ? 81  HIS C O   1 
ATOM   6047  C CB  . HIS C 1 81  ? -15.798 -4.050  -3.907  1.00 27.63  ? 81  HIS C CB  1 
ATOM   6048  C CG  . HIS C 1 81  ? -15.266 -2.754  -4.450  1.00 32.32  ? 81  HIS C CG  1 
ATOM   6049  N ND1 . HIS C 1 81  ? -15.596 -2.264  -5.700  1.00 35.12  ? 81  HIS C ND1 1 
ATOM   6050  C CD2 . HIS C 1 81  ? -14.407 -1.856  -3.912  1.00 34.31  ? 81  HIS C CD2 1 
ATOM   6051  C CE1 . HIS C 1 81  ? -14.946 -1.131  -5.911  1.00 34.39  ? 81  HIS C CE1 1 
ATOM   6052  N NE2 . HIS C 1 81  ? -14.234 -0.853  -4.834  1.00 34.42  ? 81  HIS C NE2 1 
ATOM   6053  N N   . LYS C 1 82  ? -16.549 -7.009  -5.023  1.00 23.52  ? 82  LYS C N   1 
ATOM   6054  C CA  . LYS C 1 82  ? -16.738 -8.407  -4.714  1.00 21.99  ? 82  LYS C CA  1 
ATOM   6055  C C   . LYS C 1 82  ? -18.142 -8.916  -4.996  1.00 25.49  ? 82  LYS C C   1 
ATOM   6056  O O   . LYS C 1 82  ? -18.613 -9.847  -4.313  1.00 25.19  ? 82  LYS C O   1 
ATOM   6057  C CB  . LYS C 1 82  ? -16.415 -8.647  -3.240  1.00 23.50  ? 82  LYS C CB  1 
ATOM   6058  C CG  . LYS C 1 82  ? -14.963 -8.481  -2.880  1.00 30.23  ? 82  LYS C CG  1 
ATOM   6059  C CD  . LYS C 1 82  ? -14.771 -8.461  -1.367  1.00 37.26  ? 82  LYS C CD  1 
ATOM   6060  C CE  . LYS C 1 82  ? -13.340 -8.821  -0.982  1.00 51.03  ? 82  LYS C CE  1 
ATOM   6061  N NZ  . LYS C 1 82  ? -12.288 -8.014  -1.679  1.00 55.44  ? 82  LYS C NZ  1 
ATOM   6062  N N   . ALA C 1 83  ? -18.831 -8.292  -5.957  1.00 21.76  ? 83  ALA C N   1 
ATOM   6063  C CA  . ALA C 1 83  ? -20.157 -8.772  -6.425  1.00 19.40  ? 83  ALA C CA  1 
ATOM   6064  C C   . ALA C 1 83  ? -20.028 -10.138 -7.130  1.00 17.77  ? 83  ALA C C   1 
ATOM   6065  O O   . ALA C 1 83  ? -20.963 -10.935 -7.080  1.00 12.04  ? 83  ALA C O   1 
ATOM   6066  C CB  . ALA C 1 83  ? -20.784 -7.772  -7.373  1.00 19.96  ? 83  ALA C CB  1 
ATOM   6067  N N   . ALA C 1 84  ? -18.832 -10.412 -7.701  1.00 15.43  ? 84  ALA C N   1 
ATOM   6068  C CA  . ALA C 1 84  ? -18.510 -11.656 -8.411  1.00 13.01  ? 84  ALA C CA  1 
ATOM   6069  C C   . ALA C 1 84  ? -17.429 -12.518 -7.708  1.00 19.14  ? 84  ALA C C   1 
ATOM   6070  O O   . ALA C 1 84  ? -16.340 -12.033 -7.372  1.00 18.86  ? 84  ALA C O   1 
ATOM   6071  C CB  . ALA C 1 84  ? -18.126 -11.348 -9.852  1.00 12.22  ? 84  ALA C CB  1 
ATOM   6072  N N   . THR C 1 85  ? -17.739 -13.807 -7.510  1.00 15.32  ? 85  THR C N   1 
ATOM   6073  C CA  . THR C 1 85  ? -16.852 -14.763 -6.846  1.00 13.87  ? 85  THR C CA  1 
ATOM   6074  C C   . THR C 1 85  ? -16.098 -15.634 -7.853  1.00 20.27  ? 85  THR C C   1 
ATOM   6075  O O   . THR C 1 85  ? -16.634 -15.984 -8.932  1.00 19.96  ? 85  THR C O   1 
ATOM   6076  C CB  . THR C 1 85  ? -17.680 -15.692 -5.939  1.00 18.57  ? 85  THR C CB  1 
ATOM   6077  O OG1 . THR C 1 85  ? -18.631 -14.916 -5.209  1.00 22.50  ? 85  THR C OG1 1 
ATOM   6078  C CG2 . THR C 1 85  ? -16.805 -16.489 -4.967  1.00 20.25  ? 85  THR C CG2 1 
ATOM   6079  N N   . PHE C 1 86  ? -14.869 -16.021 -7.489  1.00 16.38  ? 86  PHE C N   1 
ATOM   6080  C CA  . PHE C 1 86  ? -14.058 -16.901 -8.350  1.00 14.97  ? 86  PHE C CA  1 
ATOM   6081  C C   . PHE C 1 86  ? -13.208 -17.937 -7.578  1.00 18.91  ? 86  PHE C C   1 
ATOM   6082  O O   . PHE C 1 86  ? -12.440 -17.587 -6.645  1.00 18.24  ? 86  PHE C O   1 
ATOM   6083  C CB  . PHE C 1 86  ? -13.175 -16.108 -9.344  1.00 14.91  ? 86  PHE C CB  1 
ATOM   6084  C CG  . PHE C 1 86  ? -12.526 -16.971 -10.398 1.00 14.75  ? 86  PHE C CG  1 
ATOM   6085  C CD1 . PHE C 1 86  ? -13.257 -17.440 -11.501 1.00 15.12  ? 86  PHE C CD1 1 
ATOM   6086  C CD2 . PHE C 1 86  ? -11.191 -17.355 -10.256 1.00 17.00  ? 86  PHE C CD2 1 
ATOM   6087  C CE1 . PHE C 1 86  ? -12.668 -18.279 -12.466 1.00 16.51  ? 86  PHE C CE1 1 
ATOM   6088  C CE2 . PHE C 1 86  ? -10.573 -18.196 -11.213 1.00 19.64  ? 86  PHE C CE2 1 
ATOM   6089  C CZ  . PHE C 1 86  ? -11.329 -18.677 -12.320 1.00 16.71  ? 86  PHE C CZ  1 
ATOM   6090  N N   . PHE C 1 87  ? -13.328 -19.196 -7.996  1.00 12.43  ? 87  PHE C N   1 
ATOM   6091  C CA  . PHE C 1 87  ? -12.555 -20.281 -7.406  1.00 13.22  ? 87  PHE C CA  1 
ATOM   6092  C C   . PHE C 1 87  ? -11.648 -20.940 -8.441  1.00 21.50  ? 87  PHE C C   1 
ATOM   6093  O O   . PHE C 1 87  ? -12.064 -21.259 -9.564  1.00 23.08  ? 87  PHE C O   1 
ATOM   6094  C CB  . PHE C 1 87  ? -13.451 -21.375 -6.824  1.00 14.28  ? 87  PHE C CB  1 
ATOM   6095  C CG  . PHE C 1 87  ? -14.284 -20.932 -5.681  1.00 15.60  ? 87  PHE C CG  1 
ATOM   6096  C CD1 . PHE C 1 87  ? -14.101 -19.679 -5.119  1.00 19.99  ? 87  PHE C CD1 1 
ATOM   6097  C CD2 . PHE C 1 87  ? -15.260 -21.768 -5.180  1.00 19.18  ? 87  PHE C CD2 1 
ATOM   6098  C CE1 . PHE C 1 87  ? -14.944 -19.212 -4.112  1.00 21.55  ? 87  PHE C CE1 1 
ATOM   6099  C CE2 . PHE C 1 87  ? -16.135 -21.324 -4.225  1.00 23.47  ? 87  PHE C CE2 1 
ATOM   6100  C CZ  . PHE C 1 87  ? -15.982 -20.025 -3.688  1.00 21.93  ? 87  PHE C CZ  1 
ATOM   6101  N N   . GLY C 1 88  ? -10.440 -21.274 -8.030  1.00 17.11  ? 88  GLY C N   1 
ATOM   6102  C CA  . GLY C 1 88  ? -9.603  -21.975 -8.962  1.00 18.84  ? 88  GLY C CA  1 
ATOM   6103  C C   . GLY C 1 88  ? -8.388  -22.454 -8.213  1.00 28.95  ? 88  GLY C C   1 
ATOM   6104  O O   . GLY C 1 88  ? -8.217  -22.078 -7.052  1.00 29.78  ? 88  GLY C O   1 
ATOM   6105  N N   . CYS C 1 89  ? -7.540  -23.237 -8.892  1.00 26.94  ? 89  CYS C N   1 
ATOM   6106  C CA  . CYS C 1 89  ? -6.304  -23.764 -8.328  1.00 26.65  ? 89  CYS C CA  1 
ATOM   6107  C C   . CYS C 1 89  ? -5.078  -23.096 -8.970  1.00 31.72  ? 89  CYS C C   1 
ATOM   6108  O O   . CYS C 1 89  ? -4.865  -23.211 -10.177 1.00 31.51  ? 89  CYS C O   1 
ATOM   6109  C CB  . CYS C 1 89  ? -6.225  -25.297 -8.513  1.00 26.98  ? 89  CYS C CB  1 
ATOM   6110  S SG  . CYS C 1 89  ? -4.847  -26.151 -7.648  1.00 30.76  ? 89  CYS C SG  1 
ATOM   6111  N N   . ILE C 1 90  ? -4.260  -22.428 -8.150  1.00 27.92  ? 90  ILE C N   1 
ATOM   6112  C CA  . ILE C 1 90  ? -3.025  -21.811 -8.632  1.00 26.37  ? 90  ILE C CA  1 
ATOM   6113  C C   . ILE C 1 90  ? -1.833  -22.445 -7.909  1.00 26.26  ? 90  ILE C C   1 
ATOM   6114  O O   . ILE C 1 90  ? -1.985  -23.182 -6.938  1.00 23.34  ? 90  ILE C O   1 
ATOM   6115  C CB  . ILE C 1 90  ? -2.985  -20.283 -8.390  1.00 28.71  ? 90  ILE C CB  1 
ATOM   6116  C CG1 . ILE C 1 90  ? -3.612  -19.963 -7.031  1.00 27.47  ? 90  ILE C CG1 1 
ATOM   6117  C CG2 . ILE C 1 90  ? -3.734  -19.540 -9.505  1.00 30.34  ? 90  ILE C CG2 1 
ATOM   6118  C CD1 . ILE C 1 90  ? -3.225  -18.657 -6.505  1.00 10.96  ? 90  ILE C CD1 1 
ATOM   6119  N N   . GLY C 1 91  ? -0.631  -22.139 -8.359  1.00 21.36  ? 91  GLY C N   1 
ATOM   6120  C CA  . GLY C 1 91  ? 0.526   -22.718 -7.705  1.00 19.93  ? 91  GLY C CA  1 
ATOM   6121  C C   . GLY C 1 91  ? 0.977   -21.660 -6.760  1.00 20.82  ? 91  GLY C C   1 
ATOM   6122  O O   . GLY C 1 91  ? 0.511   -20.525 -6.832  1.00 21.02  ? 91  GLY C O   1 
ATOM   6123  N N   . ILE C 1 92  ? 1.851   -22.032 -5.841  1.00 16.46  ? 92  ILE C N   1 
ATOM   6124  C CA  . ILE C 1 92  ? 2.433   -21.052 -4.916  1.00 16.51  ? 92  ILE C CA  1 
ATOM   6125  C C   . ILE C 1 92  ? 3.730   -20.528 -5.563  1.00 21.58  ? 92  ILE C C   1 
ATOM   6126  O O   . ILE C 1 92  ? 4.806   -21.121 -5.406  1.00 22.90  ? 92  ILE C O   1 
ATOM   6127  C CB  . ILE C 1 92  ? 2.685   -21.700 -3.561  1.00 19.32  ? 92  ILE C CB  1 
ATOM   6128  C CG1 . ILE C 1 92  ? 1.397   -22.340 -3.050  1.00 19.95  ? 92  ILE C CG1 1 
ATOM   6129  C CG2 . ILE C 1 92  ? 3.171   -20.712 -2.603  1.00 19.66  ? 92  ILE C CG2 1 
ATOM   6130  C CD1 . ILE C 1 92  ? 1.263   -22.353 -1.537  1.00 26.52  ? 92  ILE C CD1 1 
ATOM   6131  N N   . ASP C 1 93  ? 3.576   -19.570 -6.472  1.00 16.32  ? 93  ASP C N   1 
ATOM   6132  C CA  . ASP C 1 93  ? 4.699   -19.085 -7.253  1.00 13.67  ? 93  ASP C CA  1 
ATOM   6133  C C   . ASP C 1 93  ? 4.466   -17.679 -7.747  1.00 12.65  ? 93  ASP C C   1 
ATOM   6134  O O   . ASP C 1 93  ? 3.515   -17.050 -7.335  1.00 8.16   ? 93  ASP C O   1 
ATOM   6135  C CB  . ASP C 1 93  ? 5.082   -20.085 -8.361  1.00 15.56  ? 93  ASP C CB  1 
ATOM   6136  C CG  . ASP C 1 93  ? 3.930   -20.422 -9.335  1.00 18.08  ? 93  ASP C CG  1 
ATOM   6137  O OD1 . ASP C 1 93  ? 4.129   -21.324 -10.168 1.00 19.78  ? 93  ASP C OD1 1 
ATOM   6138  O OD2 . ASP C 1 93  ? 2.986   -19.651 -9.488  1.00 15.92  ? 93  ASP C OD2 1 
ATOM   6139  N N   . LYS C 1 94  ? 5.413   -17.141 -8.505  1.00 12.53  ? 94  LYS C N   1 
ATOM   6140  C CA  . LYS C 1 94  ? 5.312   -15.753 -9.011  1.00 12.30  ? 94  LYS C CA  1 
ATOM   6141  C C   . LYS C 1 94  ? 3.960   -15.540 -9.755  1.00 18.73  ? 94  LYS C C   1 
ATOM   6142  O O   . LYS C 1 94  ? 3.074   -14.816 -9.273  1.00 19.88  ? 94  LYS C O   1 
ATOM   6143  C CB  . LYS C 1 94  ? 6.521   -15.447 -9.915  1.00 12.85  ? 94  LYS C CB  1 
ATOM   6144  C CG  . LYS C 1 94  ? 6.696   -14.011 -10.313 1.00 21.70  ? 94  LYS C CG  1 
ATOM   6145  C CD  . LYS C 1 94  ? 7.596   -13.931 -11.531 1.00 32.61  ? 94  LYS C CD  1 
ATOM   6146  C CE  . LYS C 1 94  ? 7.609   -12.520 -12.115 1.00 58.19  ? 94  LYS C CE  1 
ATOM   6147  N NZ  . LYS C 1 94  ? 7.508   -12.558 -13.622 1.00 69.98  ? 94  LYS C NZ  1 
ATOM   6148  N N   . PHE C 1 95  ? 3.756   -16.291 -10.840 1.00 14.63  ? 95  PHE C N   1 
ATOM   6149  C CA  . PHE C 1 95  ? 2.519   -16.261 -11.624 1.00 14.34  ? 95  PHE C CA  1 
ATOM   6150  C C   . PHE C 1 95  ? 1.216   -16.293 -10.814 1.00 16.68  ? 95  PHE C C   1 
ATOM   6151  O O   . PHE C 1 95  ? 0.250   -15.594 -11.133 1.00 15.63  ? 95  PHE C O   1 
ATOM   6152  C CB  . PHE C 1 95  ? 2.539   -17.404 -12.626 1.00 16.80  ? 95  PHE C CB  1 
ATOM   6153  C CG  . PHE C 1 95  ? 3.590   -17.248 -13.674 1.00 18.18  ? 95  PHE C CG  1 
ATOM   6154  C CD1 . PHE C 1 95  ? 4.360   -16.093 -13.716 1.00 18.56  ? 95  PHE C CD1 1 
ATOM   6155  C CD2 . PHE C 1 95  ? 3.780   -18.224 -14.638 1.00 20.18  ? 95  PHE C CD2 1 
ATOM   6156  C CE1 . PHE C 1 95  ? 5.312   -15.927 -14.697 1.00 19.45  ? 95  PHE C CE1 1 
ATOM   6157  C CE2 . PHE C 1 95  ? 4.729   -18.048 -15.635 1.00 21.99  ? 95  PHE C CE2 1 
ATOM   6158  C CZ  . PHE C 1 95  ? 5.509   -16.903 -15.649 1.00 19.21  ? 95  PHE C CZ  1 
ATOM   6159  N N   . GLY C 1 96  ? 1.176   -17.181 -9.825  1.00 12.61  ? 96  GLY C N   1 
ATOM   6160  C CA  . GLY C 1 96  ? 0.097   -17.307 -8.881  1.00 10.52  ? 96  GLY C CA  1 
ATOM   6161  C C   . GLY C 1 96  ? -0.112  -15.976 -8.153  1.00 17.89  ? 96  GLY C C   1 
ATOM   6162  O O   . GLY C 1 96  ? -1.268  -15.476 -8.005  1.00 17.50  ? 96  GLY C O   1 
ATOM   6163  N N   . GLU C 1 97  ? 1.004   -15.383 -7.722  1.00 15.55  ? 97  GLU C N   1 
ATOM   6164  C CA  . GLU C 1 97  ? 0.955   -14.113 -6.972  1.00 15.89  ? 97  GLU C CA  1 
ATOM   6165  C C   . GLU C 1 97  ? 0.412   -12.954 -7.833  1.00 19.98  ? 97  GLU C C   1 
ATOM   6166  O O   . GLU C 1 97  ? -0.422  -12.162 -7.387  1.00 22.03  ? 97  GLU C O   1 
ATOM   6167  C CB  . GLU C 1 97  ? 2.307   -13.807 -6.328  1.00 17.40  ? 97  GLU C CB  1 
ATOM   6168  C CG  . GLU C 1 97  ? 2.240   -12.832 -5.129  1.00 35.63  ? 97  GLU C CG  1 
ATOM   6169  C CD  . GLU C 1 97  ? 1.357   -13.332 -3.978  1.00 58.52  ? 97  GLU C CD  1 
ATOM   6170  O OE1 . GLU C 1 97  ? 1.482   -14.529 -3.618  1.00 28.10  ? 97  GLU C OE1 1 
ATOM   6171  O OE2 . GLU C 1 97  ? 0.525   -12.550 -3.455  1.00 57.43  ? 97  GLU C OE2 1 
ATOM   6172  N N   . ILE C 1 98  ? 0.819   -12.924 -9.095  1.00 14.22  ? 98  ILE C N   1 
ATOM   6173  C CA  . ILE C 1 98  ? 0.263   -12.016 -10.102 1.00 13.32  ? 98  ILE C CA  1 
ATOM   6174  C C   . ILE C 1 98  ? -1.267  -12.247 -10.307 1.00 19.08  ? 98  ILE C C   1 
ATOM   6175  O O   . ILE C 1 98  ? -2.070  -11.283 -10.223 1.00 20.63  ? 98  ILE C O   1 
ATOM   6176  C CB  . ILE C 1 98  ? 1.002   -12.256 -11.417 1.00 15.78  ? 98  ILE C CB  1 
ATOM   6177  C CG1 . ILE C 1 98  ? 2.521   -12.064 -11.184 1.00 15.07  ? 98  ILE C CG1 1 
ATOM   6178  C CG2 . ILE C 1 98  ? 0.403   -11.440 -12.526 1.00 15.90  ? 98  ILE C CG2 1 
ATOM   6179  C CD1 . ILE C 1 98  ? 3.408   -12.652 -12.237 1.00 21.44  ? 98  ILE C CD1 1 
ATOM   6180  N N   . LEU C 1 99  ? -1.694  -13.511 -10.491 1.00 11.59  ? 99  LEU C N   1 
ATOM   6181  C CA  . LEU C 1 99  ? -3.127  -13.791 -10.642 1.00 10.23  ? 99  LEU C CA  1 
ATOM   6182  C C   . LEU C 1 99  ? -3.955  -13.245 -9.474  1.00 16.42  ? 99  LEU C C   1 
ATOM   6183  O O   . LEU C 1 99  ? -5.002  -12.594 -9.676  1.00 16.65  ? 99  LEU C O   1 
ATOM   6184  C CB  . LEU C 1 99  ? -3.431  -15.280 -10.917 1.00 9.17   ? 99  LEU C CB  1 
ATOM   6185  C CG  . LEU C 1 99  ? -2.975  -15.847 -12.286 1.00 12.22  ? 99  LEU C CG  1 
ATOM   6186  C CD1 . LEU C 1 99  ? -3.326  -17.277 -12.476 1.00 11.73  ? 99  LEU C CD1 1 
ATOM   6187  C CD2 . LEU C 1 99  ? -3.337  -15.012 -13.500 1.00 10.79  ? 99  LEU C CD2 1 
ATOM   6188  N N   . LYS C 1 100 ? -3.491  -13.474 -8.245  1.00 14.15  ? 100 LYS C N   1 
ATOM   6189  C CA  . LYS C 1 100 ? -4.203  -12.958 -7.064  1.00 12.72  ? 100 LYS C CA  1 
ATOM   6190  C C   . LYS C 1 100 ? -4.264  -11.447 -7.042  1.00 21.97  ? 100 LYS C C   1 
ATOM   6191  O O   . LYS C 1 100 ? -5.317  -10.841 -6.804  1.00 23.17  ? 100 LYS C O   1 
ATOM   6192  C CB  . LYS C 1 100 ? -3.563  -13.431 -5.796  1.00 12.43  ? 100 LYS C CB  1 
ATOM   6193  C CG  . LYS C 1 100 ? -3.798  -14.901 -5.544  1.00 17.72  ? 100 LYS C CG  1 
ATOM   6194  C CD  . LYS C 1 100 ? -2.567  -15.531 -4.984  1.00 22.74  ? 100 LYS C CD  1 
ATOM   6195  C CE  . LYS C 1 100 ? -2.466  -15.321 -3.505  1.00 8.75   ? 100 LYS C CE  1 
ATOM   6196  N NZ  . LYS C 1 100 ? -1.214  -15.925 -3.005  1.00 20.68  ? 100 LYS C NZ  1 
ATOM   6197  N N   . ARG C 1 101 ? -3.135  -10.822 -7.335  1.00 21.90  ? 101 ARG C N   1 
ATOM   6198  C CA  . ARG C 1 101 ? -3.074  -9.371  -7.358  1.00 22.47  ? 101 ARG C CA  1 
ATOM   6199  C C   . ARG C 1 101 ? -4.024  -8.807  -8.406  1.00 28.41  ? 101 ARG C C   1 
ATOM   6200  O O   . ARG C 1 101 ? -4.780  -7.877  -8.157  1.00 29.51  ? 101 ARG C O   1 
ATOM   6201  C CB  . ARG C 1 101 ? -1.640  -8.942  -7.649  1.00 23.93  ? 101 ARG C CB  1 
ATOM   6202  C CG  . ARG C 1 101 ? -1.471  -7.435  -7.811  1.00 38.06  ? 101 ARG C CG  1 
ATOM   6203  C CD  . ARG C 1 101 ? -0.026  -7.015  -7.703  1.00 35.39  ? 101 ARG C CD  1 
ATOM   6204  N NE  . ARG C 1 101 ? 0.797   -7.637  -8.737  1.00 38.71  ? 101 ARG C NE  1 
ATOM   6205  C CZ  . ARG C 1 101 ? 0.747   -7.311  -10.025 1.00 45.92  ? 101 ARG C CZ  1 
ATOM   6206  N NH1 . ARG C 1 101 ? -0.081  -6.344  -10.444 1.00 20.14  ? 101 ARG C NH1 1 
ATOM   6207  N NH2 . ARG C 1 101 ? 1.553   -7.929  -10.883 1.00 31.01  ? 101 ARG C NH2 1 
ATOM   6208  N N   . LYS C 1 102 ? -4.007  -9.390  -9.589  1.00 26.95  ? 102 LYS C N   1 
ATOM   6209  C CA  . LYS C 1 102 ? -4.867  -8.911  -10.667 1.00 24.19  ? 102 LYS C CA  1 
ATOM   6210  C C   . LYS C 1 102 ? -6.323  -9.120  -10.329 1.00 24.15  ? 102 LYS C C   1 
ATOM   6211  O O   . LYS C 1 102 ? -7.169  -8.297  -10.653 1.00 20.71  ? 102 LYS C O   1 
ATOM   6212  C CB  . LYS C 1 102 ? -4.452  -9.602  -11.955 1.00 22.98  ? 102 LYS C CB  1 
ATOM   6213  C CG  . LYS C 1 102 ? -3.120  -9.089  -12.392 1.00 12.71  ? 102 LYS C CG  1 
ATOM   6214  C CD  . LYS C 1 102 ? -3.213  -7.586  -12.542 1.00 22.09  ? 102 LYS C CD  1 
ATOM   6215  C CE  . LYS C 1 102 ? -1.941  -6.956  -13.104 1.00 35.42  ? 102 LYS C CE  1 
ATOM   6216  N NZ  . LYS C 1 102 ? -1.646  -5.637  -12.449 1.00 51.10  ? 102 LYS C NZ  1 
ATOM   6217  N N   . ALA C 1 103 ? -6.601  -10.208 -9.623  1.00 23.71  ? 103 ALA C N   1 
ATOM   6218  C CA  . ALA C 1 103 ? -7.978  -10.530 -9.211  1.00 24.92  ? 103 ALA C CA  1 
ATOM   6219  C C   . ALA C 1 103 ? -8.485  -9.487  -8.261  1.00 28.34  ? 103 ALA C C   1 
ATOM   6220  O O   . ALA C 1 103 ? -9.626  -9.060  -8.340  1.00 28.34  ? 103 ALA C O   1 
ATOM   6221  C CB  . ALA C 1 103 ? -8.031  -11.866 -8.532  1.00 26.44  ? 103 ALA C CB  1 
ATOM   6222  N N   . ALA C 1 104 ? -7.624  -9.132  -7.314  1.00 25.30  ? 104 ALA C N   1 
ATOM   6223  C CA  . ALA C 1 104 ? -7.923  -8.129  -6.309  1.00 24.73  ? 104 ALA C CA  1 
ATOM   6224  C C   . ALA C 1 104 ? -8.200  -6.735  -6.921  1.00 23.03  ? 104 ALA C C   1 
ATOM   6225  O O   . ALA C 1 104 ? -9.246  -6.148  -6.663  1.00 20.57  ? 104 ALA C O   1 
ATOM   6226  C CB  . ALA C 1 104 ? -6.784  -8.088  -5.332  1.00 26.11  ? 104 ALA C CB  1 
ATOM   6227  N N   . GLU C 1 105 ? -7.265  -6.262  -7.753  1.00 17.48  ? 105 GLU C N   1 
ATOM   6228  C CA  . GLU C 1 105 ? -7.404  -5.018  -8.499  1.00 16.50  ? 105 GLU C CA  1 
ATOM   6229  C C   . GLU C 1 105 ? -8.729  -4.942  -9.231  1.00 25.84  ? 105 GLU C C   1 
ATOM   6230  O O   . GLU C 1 105 ? -9.293  -3.867  -9.376  1.00 25.03  ? 105 GLU C O   1 
ATOM   6231  C CB  . GLU C 1 105 ? -6.267  -4.901  -9.502  1.00 16.50  ? 105 GLU C CB  1 
ATOM   6232  C CG  . GLU C 1 105 ? -4.898  -5.027  -8.880  1.00 13.64  ? 105 GLU C CG  1 
ATOM   6233  C CD  . GLU C 1 105 ? -3.799  -4.647  -9.832  1.00 38.84  ? 105 GLU C CD  1 
ATOM   6234  O OE1 . GLU C 1 105 ? -3.968  -4.870  -11.051 1.00 56.52  ? 105 GLU C OE1 1 
ATOM   6235  O OE2 . GLU C 1 105 ? -2.775  -4.118  -9.363  1.00 40.41  ? 105 GLU C OE2 1 
ATOM   6236  N N   . ALA C 1 106 ? -9.225  -6.105  -9.665  1.00 27.20  ? 106 ALA C N   1 
ATOM   6237  C CA  . ALA C 1 106 ? -10.479 -6.209  -10.399 1.00 27.54  ? 106 ALA C CA  1 
ATOM   6238  C C   . ALA C 1 106 ? -11.656 -6.222  -9.433  1.00 31.56  ? 106 ALA C C   1 
ATOM   6239  O O   . ALA C 1 106 ? -12.817 -6.226  -9.852  1.00 31.33  ? 106 ALA C O   1 
ATOM   6240  C CB  . ALA C 1 106 ? -10.471 -7.464  -11.265 1.00 28.64  ? 106 ALA C CB  1 
ATOM   6241  N N   . HIS C 1 107 ? -11.343 -6.180  -8.139  1.00 28.09  ? 107 HIS C N   1 
ATOM   6242  C CA  . HIS C 1 107 ? -12.357 -6.135  -7.070  1.00 28.46  ? 107 HIS C CA  1 
ATOM   6243  C C   . HIS C 1 107 ? -13.177 -7.420  -7.028  1.00 32.70  ? 107 HIS C C   1 
ATOM   6244  O O   . HIS C 1 107 ? -14.333 -7.436  -6.571  1.00 32.05  ? 107 HIS C O   1 
ATOM   6245  C CB  . HIS C 1 107 ? -13.300 -4.899  -7.188  1.00 28.67  ? 107 HIS C CB  1 
ATOM   6246  C CG  . HIS C 1 107 ? -12.577 -3.587  -7.227  1.00 32.01  ? 107 HIS C CG  1 
ATOM   6247  N ND1 . HIS C 1 107 ? -11.570 -3.259  -6.339  1.00 33.49  ? 107 HIS C ND1 1 
ATOM   6248  C CD2 . HIS C 1 107 ? -12.685 -2.538  -8.076  1.00 33.92  ? 107 HIS C CD2 1 
ATOM   6249  C CE1 . HIS C 1 107 ? -11.111 -2.054  -6.623  1.00 32.81  ? 107 HIS C CE1 1 
ATOM   6250  N NE2 . HIS C 1 107 ? -11.781 -1.589  -7.664  1.00 33.59  ? 107 HIS C NE2 1 
ATOM   6251  N N   . VAL C 1 108 ? -12.561 -8.494  -7.503  1.00 28.15  ? 108 VAL C N   1 
ATOM   6252  C CA  . VAL C 1 108 ? -13.247 -9.769  -7.568  1.00 27.72  ? 108 VAL C CA  1 
ATOM   6253  C C   . VAL C 1 108 ? -12.988 -10.514 -6.276  1.00 31.87  ? 108 VAL C C   1 
ATOM   6254  O O   . VAL C 1 108 ? -11.846 -10.571 -5.814  1.00 34.05  ? 108 VAL C O   1 
ATOM   6255  C CB  . VAL C 1 108 ? -12.726 -10.595 -8.767  1.00 31.07  ? 108 VAL C CB  1 
ATOM   6256  C CG1 . VAL C 1 108 ? -13.547 -11.862 -8.970  1.00 31.35  ? 108 VAL C CG1 1 
ATOM   6257  C CG2 . VAL C 1 108 ? -12.690 -9.746  -10.030 1.00 29.96  ? 108 VAL C CG2 1 
ATOM   6258  N N   . ASP C 1 109 ? -14.034 -11.080 -5.680  1.00 25.30  ? 109 ASP C N   1 
ATOM   6259  C CA  . ASP C 1 109 ? -13.842 -11.883 -4.466  1.00 23.30  ? 109 ASP C CA  1 
ATOM   6260  C C   . ASP C 1 109 ? -13.273 -13.290 -4.833  1.00 26.74  ? 109 ASP C C   1 
ATOM   6261  O O   . ASP C 1 109 ? -13.988 -14.296 -4.883  1.00 26.58  ? 109 ASP C O   1 
ATOM   6262  C CB  . ASP C 1 109 ? -15.134 -11.948 -3.648  1.00 23.22  ? 109 ASP C CB  1 
ATOM   6263  C CG  . ASP C 1 109 ? -14.964 -12.685 -2.314  1.00 21.07  ? 109 ASP C CG  1 
ATOM   6264  O OD1 . ASP C 1 109 ? -13.859 -12.675 -1.724  1.00 22.03  ? 109 ASP C OD1 1 
ATOM   6265  O OD2 . ASP C 1 109 ? -15.963 -13.240 -1.831  1.00 16.03  ? 109 ASP C OD2 1 
ATOM   6266  N N   . ALA C 1 110 ? -11.984 -13.320 -5.156  1.00 22.92  ? 110 ALA C N   1 
ATOM   6267  C CA  . ALA C 1 110 ? -11.282 -14.531 -5.563  1.00 23.13  ? 110 ALA C CA  1 
ATOM   6268  C C   . ALA C 1 110 ? -10.724 -15.351 -4.411  1.00 27.27  ? 110 ALA C C   1 
ATOM   6269  O O   . ALA C 1 110 ? -9.981  -14.838 -3.588  1.00 28.41  ? 110 ALA C O   1 
ATOM   6270  C CB  . ALA C 1 110 ? -10.142 -14.171 -6.495  1.00 24.14  ? 110 ALA C CB  1 
ATOM   6271  N N   . HIS C 1 111 ? -10.996 -16.652 -4.453  1.00 22.89  ? 111 HIS C N   1 
ATOM   6272  C CA  . HIS C 1 111 ? -10.541 -17.651 -3.481  1.00 21.04  ? 111 HIS C CA  1 
ATOM   6273  C C   . HIS C 1 111 ? -9.960  -18.820 -4.286  1.00 23.74  ? 111 HIS C C   1 
ATOM   6274  O O   . HIS C 1 111 ? -10.618 -19.432 -5.159  1.00 21.89  ? 111 HIS C O   1 
ATOM   6275  C CB  . HIS C 1 111 ? -11.710 -18.144 -2.586  1.00 21.84  ? 111 HIS C CB  1 
ATOM   6276  C CG  . HIS C 1 111 ? -12.426 -17.043 -1.876  1.00 25.30  ? 111 HIS C CG  1 
ATOM   6277  N ND1 . HIS C 1 111 ? -12.013 -16.559 -0.656  1.00 27.38  ? 111 HIS C ND1 1 
ATOM   6278  C CD2 . HIS C 1 111 ? -13.560 -16.372 -2.181  1.00 27.52  ? 111 HIS C CD2 1 
ATOM   6279  C CE1 . HIS C 1 111 ? -12.835 -15.606 -0.261  1.00 26.88  ? 111 HIS C CE1 1 
ATOM   6280  N NE2 . HIS C 1 111 ? -13.794 -15.484 -1.158  1.00 27.11  ? 111 HIS C NE2 1 
ATOM   6281  N N   . TYR C 1 112 ? -8.683  -19.050 -4.038  1.00 19.85  ? 112 TYR C N   1 
ATOM   6282  C CA  . TYR C 1 112 ? -7.921  -19.987 -4.800  1.00 17.65  ? 112 TYR C CA  1 
ATOM   6283  C C   . TYR C 1 112 ? -7.466  -21.140 -3.960  1.00 21.64  ? 112 TYR C C   1 
ATOM   6284  O O   . TYR C 1 112 ? -7.378  -21.035 -2.751  1.00 22.97  ? 112 TYR C O   1 
ATOM   6285  C CB  . TYR C 1 112 ? -6.723  -19.252 -5.326  1.00 17.13  ? 112 TYR C CB  1 
ATOM   6286  C CG  . TYR C 1 112 ? -7.068  -18.170 -6.337  1.00 17.08  ? 112 TYR C CG  1 
ATOM   6287  C CD1 . TYR C 1 112 ? -6.975  -16.822 -5.983  1.00 18.74  ? 112 TYR C CD1 1 
ATOM   6288  C CD2 . TYR C 1 112 ? -7.422  -18.488 -7.673  1.00 14.94  ? 112 TYR C CD2 1 
ATOM   6289  C CE1 . TYR C 1 112 ? -7.167  -15.811 -6.936  1.00 18.09  ? 112 TYR C CE1 1 
ATOM   6290  C CE2 . TYR C 1 112 ? -7.611  -17.482 -8.621  1.00 13.63  ? 112 TYR C CE2 1 
ATOM   6291  C CZ  . TYR C 1 112 ? -7.465  -16.142 -8.259  1.00 14.21  ? 112 TYR C CZ  1 
ATOM   6292  O OH  . TYR C 1 112 ? -7.624  -15.113 -9.180  1.00 5.05   ? 112 TYR C OH  1 
ATOM   6293  N N   . TYR C 1 113 ? -7.313  -22.286 -4.608  1.00 18.10  ? 113 TYR C N   1 
ATOM   6294  C CA  . TYR C 1 113 ? -6.730  -23.442 -3.980  1.00 17.01  ? 113 TYR C CA  1 
ATOM   6295  C C   . TYR C 1 113 ? -5.251  -23.228 -4.354  1.00 21.25  ? 113 TYR C C   1 
ATOM   6296  O O   . TYR C 1 113 ? -4.927  -22.965 -5.533  1.00 21.05  ? 113 TYR C O   1 
ATOM   6297  C CB  . TYR C 1 113 ? -7.304  -24.770 -4.550  1.00 17.33  ? 113 TYR C CB  1 
ATOM   6298  C CG  . TYR C 1 113 ? -6.744  -25.973 -3.789  1.00 21.03  ? 113 TYR C CG  1 
ATOM   6299  C CD1 . TYR C 1 113 ? -7.202  -26.310 -2.502  1.00 20.69  ? 113 TYR C CD1 1 
ATOM   6300  C CD2 . TYR C 1 113 ? -5.610  -26.641 -4.268  1.00 23.96  ? 113 TYR C CD2 1 
ATOM   6301  C CE1 . TYR C 1 113 ? -6.613  -27.327 -1.786  1.00 16.28  ? 113 TYR C CE1 1 
ATOM   6302  C CE2 . TYR C 1 113 ? -5.002  -27.635 -3.538  1.00 25.37  ? 113 TYR C CE2 1 
ATOM   6303  C CZ  . TYR C 1 113 ? -5.514  -27.994 -2.304  1.00 34.08  ? 113 TYR C CZ  1 
ATOM   6304  O OH  . TYR C 1 113 ? -4.914  -29.042 -1.616  1.00 47.19  ? 113 TYR C OH  1 
ATOM   6305  N N   . GLU C 1 114 ? -4.361  -23.202 -3.364  1.00 16.81  ? 114 GLU C N   1 
ATOM   6306  C CA  . GLU C 1 114 ? -2.960  -22.954 -3.679  1.00 16.11  ? 114 GLU C CA  1 
ATOM   6307  C C   . GLU C 1 114 ? -2.196  -24.180 -3.281  1.00 20.50  ? 114 GLU C C   1 
ATOM   6308  O O   . GLU C 1 114 ? -2.519  -24.776 -2.249  1.00 21.92  ? 114 GLU C O   1 
ATOM   6309  C CB  . GLU C 1 114 ? -2.457  -21.724 -2.909  1.00 18.11  ? 114 GLU C CB  1 
ATOM   6310  C CG  . GLU C 1 114 ? -3.250  -20.389 -3.169  1.00 20.39  ? 114 GLU C CG  1 
ATOM   6311  C CD  . GLU C 1 114 ? -2.440  -19.146 -2.756  1.00 30.59  ? 114 GLU C CD  1 
ATOM   6312  O OE1 . GLU C 1 114 ? -1.414  -18.813 -3.414  1.00 18.50  ? 114 GLU C OE1 1 
ATOM   6313  O OE2 . GLU C 1 114 ? -2.771  -18.556 -1.706  1.00 25.86  ? 114 GLU C OE2 1 
ATOM   6314  N N   . GLN C 1 115 ? -1.230  -24.582 -4.110  1.00 17.15  ? 115 GLN C N   1 
ATOM   6315  C CA  . GLN C 1 115 ? -0.384  -25.761 -3.857  1.00 17.65  ? 115 GLN C CA  1 
ATOM   6316  C C   . GLN C 1 115 ? 1.029   -25.667 -4.456  1.00 22.66  ? 115 GLN C C   1 
ATOM   6317  O O   . GLN C 1 115 ? 1.279   -24.885 -5.365  1.00 22.28  ? 115 GLN C O   1 
ATOM   6318  C CB  . GLN C 1 115 ? -1.088  -27.092 -4.226  1.00 19.16  ? 115 GLN C CB  1 
ATOM   6319  C CG  . GLN C 1 115 ? -1.778  -27.127 -5.578  1.00 14.70  ? 115 GLN C CG  1 
ATOM   6320  C CD  . GLN C 1 115 ? -0.827  -26.846 -6.704  1.00 36.69  ? 115 GLN C CD  1 
ATOM   6321  O OE1 . GLN C 1 115 ? -0.785  -25.741 -7.231  1.00 38.97  ? 115 GLN C OE1 1 
ATOM   6322  N NE2 . GLN C 1 115 ? -0.017  -27.839 -7.054  1.00 35.70  ? 115 GLN C NE2 1 
ATOM   6323  N N   . ASN C 1 116 ? 1.961   -26.456 -3.934  1.00 21.78  ? 116 ASN C N   1 
ATOM   6324  C CA  . ASN C 1 116 ? 3.339   -26.396 -4.415  1.00 22.46  ? 116 ASN C CA  1 
ATOM   6325  C C   . ASN C 1 116 ? 3.691   -27.494 -5.426  1.00 27.37  ? 116 ASN C C   1 
ATOM   6326  O O   . ASN C 1 116 ? 4.704   -27.421 -6.125  1.00 26.34  ? 116 ASN C O   1 
ATOM   6327  C CB  . ASN C 1 116 ? 4.338   -26.437 -3.246  1.00 19.73  ? 116 ASN C CB  1 
ATOM   6328  C CG  . ASN C 1 116 ? 3.966   -25.527 -2.123  1.00 16.26  ? 116 ASN C CG  1 
ATOM   6329  O OD1 . ASN C 1 116 ? 4.156   -24.301 -2.222  1.00 16.05  ? 116 ASN C OD1 1 
ATOM   6330  N ND2 . ASN C 1 116 ? 3.632   -26.125 -0.971  1.00 10.38  ? 116 ASN C ND2 1 
ATOM   6331  N N   . GLU C 1 117 ? 2.890   -28.544 -5.474  1.00 25.44  ? 117 GLU C N   1 
ATOM   6332  C CA  . GLU C 1 117 ? 3.199   -29.629 -6.402  1.00 26.32  ? 117 GLU C CA  1 
ATOM   6333  C C   . GLU C 1 117 ? 3.224   -29.086 -7.819  1.00 33.22  ? 117 GLU C C   1 
ATOM   6334  O O   . GLU C 1 117 ? 4.240   -29.216 -8.501  1.00 34.80  ? 117 GLU C O   1 
ATOM   6335  C CB  . GLU C 1 117 ? 2.191   -30.752 -6.270  1.00 27.32  ? 117 GLU C CB  1 
ATOM   6336  C CG  . GLU C 1 117 ? 2.165   -31.402 -4.924  1.00 27.00  ? 117 GLU C CG  1 
ATOM   6337  C CD  . GLU C 1 117 ? 1.602   -30.515 -3.828  1.00 51.72  ? 117 GLU C CD  1 
ATOM   6338  O OE1 . GLU C 1 117 ? 1.566   -30.982 -2.668  1.00 38.80  ? 117 GLU C OE1 1 
ATOM   6339  O OE2 . GLU C 1 117 ? 1.309   -29.321 -4.085  1.00 52.03  ? 117 GLU C OE2 1 
ATOM   6340  N N   . GLN C 1 118 ? 2.121   -28.451 -8.244  1.00 29.07  ? 118 GLN C N   1 
ATOM   6341  C CA  . GLN C 1 118 ? 2.042   -27.891 -9.593  1.00 28.63  ? 118 GLN C CA  1 
ATOM   6342  C C   . GLN C 1 118 ? 2.222   -26.374 -9.636  1.00 29.77  ? 118 GLN C C   1 
ATOM   6343  O O   . GLN C 1 118 ? 1.724   -25.655 -8.757  1.00 27.74  ? 118 GLN C O   1 
ATOM   6344  C CB  . GLN C 1 118 ? 0.734   -28.284 -10.286 1.00 30.21  ? 118 GLN C CB  1 
ATOM   6345  C CG  . GLN C 1 118 ? 0.603   -29.773 -10.566 1.00 48.50  ? 118 GLN C CG  1 
ATOM   6346  C CD  . GLN C 1 118 ? 1.134   -30.158 -11.930 1.00 68.01  ? 118 GLN C CD  1 
ATOM   6347  O OE1 . GLN C 1 118 ? 2.336   -30.139 -12.164 1.00 65.83  ? 118 GLN C OE1 1 
ATOM   6348  N NE2 . GLN C 1 118 ? 0.234   -30.465 -12.848 1.00 62.86  ? 118 GLN C NE2 1 
ATOM   6349  N N   . PRO C 1 119 ? 2.906   -25.899 -10.686 1.00 24.16  ? 119 PRO C N   1 
ATOM   6350  C CA  . PRO C 1 119 ? 3.076   -24.464 -10.935 1.00 22.49  ? 119 PRO C CA  1 
ATOM   6351  C C   . PRO C 1 119 ? 1.805   -23.909 -11.585 1.00 24.95  ? 119 PRO C C   1 
ATOM   6352  O O   . PRO C 1 119 ? 1.105   -24.633 -12.315 1.00 22.77  ? 119 PRO C O   1 
ATOM   6353  C CB  . PRO C 1 119 ? 4.187   -24.439 -11.986 1.00 23.60  ? 119 PRO C CB  1 
ATOM   6354  C CG  . PRO C 1 119 ? 4.040   -25.746 -12.716 1.00 26.84  ? 119 PRO C CG  1 
ATOM   6355  C CD  . PRO C 1 119 ? 3.681   -26.723 -11.647 1.00 22.88  ? 119 PRO C CD  1 
ATOM   6356  N N   . THR C 1 120 ? 1.510   -22.640 -11.313 1.00 20.77  ? 120 THR C N   1 
ATOM   6357  C CA  . THR C 1 120 ? 0.342   -21.978 -11.877 1.00 19.55  ? 120 THR C CA  1 
ATOM   6358  C C   . THR C 1 120 ? 0.337   -22.252 -13.371 1.00 27.80  ? 120 THR C C   1 
ATOM   6359  O O   . THR C 1 120 ? 1.405   -22.228 -13.999 1.00 27.99  ? 120 THR C O   1 
ATOM   6360  C CB  . THR C 1 120 ? 0.427   -20.479 -11.666 1.00 13.58  ? 120 THR C CB  1 
ATOM   6361  O OG1 . THR C 1 120 ? 0.135   -20.196 -10.298 1.00 17.70  ? 120 THR C OG1 1 
ATOM   6362  C CG2 . THR C 1 120 ? -0.560  -19.740 -12.548 1.00 5.15   ? 120 THR C CG2 1 
ATOM   6363  N N   . GLY C 1 121 ? -0.845  -22.590 -13.911 1.00 24.23  ? 121 GLY C N   1 
ATOM   6364  C CA  . GLY C 1 121 ? -1.014  -22.916 -15.321 1.00 21.61  ? 121 GLY C CA  1 
ATOM   6365  C C   . GLY C 1 121 ? -0.806  -21.693 -16.210 1.00 24.97  ? 121 GLY C C   1 
ATOM   6366  O O   . GLY C 1 121 ? -0.960  -20.546 -15.775 1.00 25.84  ? 121 GLY C O   1 
ATOM   6367  N N   . THR C 1 122 ? -0.458  -21.936 -17.465 1.00 22.42  ? 122 THR C N   1 
ATOM   6368  C CA  . THR C 1 122 ? -0.214  -20.851 -18.412 1.00 22.22  ? 122 THR C CA  1 
ATOM   6369  C C   . THR C 1 122 ? -0.865  -21.205 -19.717 1.00 25.82  ? 122 THR C C   1 
ATOM   6370  O O   . THR C 1 122 ? -1.244  -22.369 -19.923 1.00 28.01  ? 122 THR C O   1 
ATOM   6371  C CB  . THR C 1 122 ? 1.304   -20.633 -18.663 1.00 22.30  ? 122 THR C CB  1 
ATOM   6372  O OG1 . THR C 1 122 ? 1.921   -21.889 -18.996 1.00 32.32  ? 122 THR C OG1 1 
ATOM   6373  C CG2 . THR C 1 122 ? 1.988   -20.056 -17.408 1.00 8.18   ? 122 THR C CG2 1 
ATOM   6374  N N   . CYS C 1 123 ? -1.008  -20.199 -20.580 1.00 20.25  ? 123 CYS C N   1 
ATOM   6375  C CA  . CYS C 1 123 ? -1.606  -20.381 -21.902 1.00 20.25  ? 123 CYS C CA  1 
ATOM   6376  C C   . CYS C 1 123 ? -0.721  -19.638 -22.859 1.00 24.16  ? 123 CYS C C   1 
ATOM   6377  O O   . CYS C 1 123 ? -0.426  -18.500 -22.616 1.00 24.56  ? 123 CYS C O   1 
ATOM   6378  C CB  . CYS C 1 123 ? -3.045  -19.801 -21.994 1.00 19.62  ? 123 CYS C CB  1 
ATOM   6379  S SG  . CYS C 1 123 ? -3.965  -20.359 -23.487 1.00 23.18  ? 123 CYS C SG  1 
ATOM   6380  N N   . ALA C 1 124 ? -0.314  -20.264 -23.950 1.00 21.92  ? 124 ALA C N   1 
ATOM   6381  C CA  . ALA C 1 124 ? 0.467   -19.541 -24.957 1.00 22.92  ? 124 ALA C CA  1 
ATOM   6382  C C   . ALA C 1 124 ? -0.465  -19.006 -26.034 1.00 26.56  ? 124 ALA C C   1 
ATOM   6383  O O   . ALA C 1 124 ? -1.465  -19.655 -26.436 1.00 22.62  ? 124 ALA C O   1 
ATOM   6384  C CB  . ALA C 1 124 ? 1.559   -20.451 -25.587 1.00 23.72  ? 124 ALA C CB  1 
ATOM   6385  N N   . ALA C 1 125 ? -0.155  -17.800 -26.471 1.00 23.44  ? 125 ALA C N   1 
ATOM   6386  C CA  . ALA C 1 125 ? -0.950  -17.153 -27.489 1.00 22.72  ? 125 ALA C CA  1 
ATOM   6387  C C   . ALA C 1 125 ? 0.020   -16.780 -28.608 1.00 26.74  ? 125 ALA C C   1 
ATOM   6388  O O   . ALA C 1 125 ? 0.596   -15.686 -28.639 1.00 23.19  ? 125 ALA C O   1 
ATOM   6389  C CB  . ALA C 1 125 ? -1.659  -15.918 -26.924 1.00 22.80  ? 125 ALA C CB  1 
ATOM   6390  N N   . CYS C 1 126 ? 0.209   -17.753 -29.493 1.00 25.22  ? 126 CYS C N   1 
ATOM   6391  C CA  . CYS C 1 126 ? 1.033   -17.652 -30.684 1.00 23.78  ? 126 CYS C CA  1 
ATOM   6392  C C   . CYS C 1 126 ? 0.338   -16.849 -31.801 1.00 25.89  ? 126 CYS C C   1 
ATOM   6393  O O   . CYS C 1 126 ? -0.450  -17.388 -32.601 1.00 21.85  ? 126 CYS C O   1 
ATOM   6394  C CB  . CYS C 1 126 ? 1.346   -19.050 -31.160 1.00 24.29  ? 126 CYS C CB  1 
ATOM   6395  S SG  . CYS C 1 126 ? 2.316   -20.007 -29.945 1.00 28.74  ? 126 CYS C SG  1 
ATOM   6396  N N   . ILE C 1 127 ? 0.716   -15.577 -31.901 1.00 21.83  ? 127 ILE C N   1 
ATOM   6397  C CA  . ILE C 1 127 ? 0.129   -14.686 -32.887 1.00 22.07  ? 127 ILE C CA  1 
ATOM   6398  C C   . ILE C 1 127 ? 0.893   -14.605 -34.229 1.00 33.91  ? 127 ILE C C   1 
ATOM   6399  O O   . ILE C 1 127 ? 2.094   -14.305 -34.287 1.00 35.88  ? 127 ILE C O   1 
ATOM   6400  C CB  . ILE C 1 127 ? 0.067   -13.218 -32.342 1.00 23.64  ? 127 ILE C CB  1 
ATOM   6401  C CG1 . ILE C 1 127 ? -0.843  -13.054 -31.115 1.00 23.12  ? 127 ILE C CG1 1 
ATOM   6402  C CG2 . ILE C 1 127 ? -0.296  -12.275 -33.469 1.00 21.78  ? 127 ILE C CG2 1 
ATOM   6403  C CD1 . ILE C 1 127 ? -0.129  -13.040 -29.798 1.00 23.83  ? 127 ILE C CD1 1 
ATOM   6404  N N   . THR C 1 128 ? 0.163   -14.785 -35.317 1.00 32.37  ? 128 THR C N   1 
ATOM   6405  C CA  . THR C 1 128 ? 0.674   -14.517 -36.659 1.00 32.45  ? 128 THR C CA  1 
ATOM   6406  C C   . THR C 1 128 ? -0.435  -13.727 -37.354 1.00 37.75  ? 128 THR C C   1 
ATOM   6407  O O   . THR C 1 128 ? -1.621  -14.107 -37.287 1.00 34.94  ? 128 THR C O   1 
ATOM   6408  C CB  . THR C 1 128 ? 1.026   -15.776 -37.481 1.00 42.07  ? 128 THR C CB  1 
ATOM   6409  O OG1 . THR C 1 128 ? -0.160  -16.530 -37.777 1.00 49.43  ? 128 THR C OG1 1 
ATOM   6410  C CG2 . THR C 1 128 ? 2.051   -16.647 -36.746 1.00 37.27  ? 128 THR C CG2 1 
ATOM   6411  N N   . GLY C 1 129 ? -0.060  -12.588 -37.933 1.00 37.04  ? 129 GLY C N   1 
ATOM   6412  C CA  . GLY C 1 129 ? -1.028  -11.719 -38.564 1.00 37.70  ? 129 GLY C CA  1 
ATOM   6413  C C   . GLY C 1 129 ? -2.155  -11.424 -37.567 1.00 44.33  ? 129 GLY C C   1 
ATOM   6414  O O   . GLY C 1 129 ? -1.914  -10.957 -36.457 1.00 46.17  ? 129 GLY C O   1 
ATOM   6415  N N   . ASP C 1 130 ? -3.380  -11.728 -37.979 1.00 40.39  ? 130 ASP C N   1 
ATOM   6416  C CA  . ASP C 1 130 ? -4.557  -11.478 -37.177 1.00 40.47  ? 130 ASP C CA  1 
ATOM   6417  C C   . ASP C 1 130 ? -5.035  -12.776 -36.583 1.00 44.49  ? 130 ASP C C   1 
ATOM   6418  O O   . ASP C 1 130 ? -6.131  -12.843 -36.023 1.00 45.52  ? 130 ASP C O   1 
ATOM   6419  C CB  . ASP C 1 130 ? -5.663  -10.896 -38.054 1.00 43.82  ? 130 ASP C CB  1 
ATOM   6420  C CG  . ASP C 1 130 ? -5.356  -9.466  -38.518 1.00 66.89  ? 130 ASP C CG  1 
ATOM   6421  O OD1 . ASP C 1 130 ? -6.104  -8.970  -39.393 1.00 70.84  ? 130 ASP C OD1 1 
ATOM   6422  O OD2 . ASP C 1 130 ? -4.385  -8.837  -38.018 1.00 70.46  ? 130 ASP C OD2 1 
ATOM   6423  N N   . ASN C 1 131 ? -4.205  -13.808 -36.722 1.00 39.41  ? 131 ASN C N   1 
ATOM   6424  C CA  . ASN C 1 131 ? -4.506  -15.117 -36.203 1.00 37.44  ? 131 ASN C CA  1 
ATOM   6425  C C   . ASN C 1 131 ? -3.903  -15.326 -34.814 1.00 39.64  ? 131 ASN C C   1 
ATOM   6426  O O   . ASN C 1 131 ? -2.896  -14.720 -34.454 1.00 39.57  ? 131 ASN C O   1 
ATOM   6427  C CB  . ASN C 1 131 ? -4.019  -16.180 -37.183 1.00 39.23  ? 131 ASN C CB  1 
ATOM   6428  C CG  . ASN C 1 131 ? -4.517  -15.935 -38.596 1.00 53.67  ? 131 ASN C CG  1 
ATOM   6429  O OD1 . ASN C 1 131 ? -3.768  -15.465 -39.444 1.00 51.21  ? 131 ASN C OD1 1 
ATOM   6430  N ND2 . ASN C 1 131 ? -5.814  -16.121 -38.815 1.00 43.16  ? 131 ASN C ND2 1 
ATOM   6431  N N   . ARG C 1 132 ? -4.555  -16.164 -34.017 1.00 33.68  ? 132 ARG C N   1 
ATOM   6432  C CA  . ARG C 1 132 ? -4.076  -16.483 -32.686 1.00 30.88  ? 132 ARG C CA  1 
ATOM   6433  C C   . ARG C 1 132 ? -4.223  -17.978 -32.470 1.00 29.15  ? 132 ARG C C   1 
ATOM   6434  O O   . ARG C 1 132 ? -5.214  -18.586 -32.819 1.00 29.52  ? 132 ARG C O   1 
ATOM   6435  C CB  . ARG C 1 132 ? -4.852  -15.701 -31.626 1.00 32.62  ? 132 ARG C CB  1 
ATOM   6436  C CG  . ARG C 1 132 ? -5.001  -14.235 -31.941 1.00 40.43  ? 132 ARG C CG  1 
ATOM   6437  C CD  . ARG C 1 132 ? -5.905  -13.577 -30.922 1.00 51.94  ? 132 ARG C CD  1 
ATOM   6438  N NE  . ARG C 1 132 ? -5.337  -13.623 -29.577 1.00 59.23  ? 132 ARG C NE  1 
ATOM   6439  C CZ  . ARG C 1 132 ? -4.418  -12.777 -29.111 1.00 65.74  ? 132 ARG C CZ  1 
ATOM   6440  N NH1 . ARG C 1 132 ? -3.952  -11.804 -29.891 1.00 45.61  ? 132 ARG C NH1 1 
ATOM   6441  N NH2 . ARG C 1 132 ? -3.977  -12.899 -27.856 1.00 43.49  ? 132 ARG C NH2 1 
ATOM   6442  N N   . SER C 1 133 ? -3.162  -18.583 -31.991 1.00 23.44  ? 133 SER C N   1 
ATOM   6443  C CA  . SER C 1 133 ? -3.145  -20.000 -31.726 1.00 21.64  ? 133 SER C CA  1 
ATOM   6444  C C   . SER C 1 133 ? -2.875  -20.216 -30.225 1.00 24.42  ? 133 SER C C   1 
ATOM   6445  O O   . SER C 1 133 ? -1.754  -20.004 -29.782 1.00 23.95  ? 133 SER C O   1 
ATOM   6446  C CB  . SER C 1 133 ? -2.062  -20.685 -32.546 1.00 20.73  ? 133 SER C CB  1 
ATOM   6447  O OG  . SER C 1 133 ? -2.139  -22.092 -32.350 1.00 24.49  ? 133 SER C OG  1 
ATOM   6448  N N   . LEU C 1 134 ? -3.905  -20.649 -29.480 1.00 17.56  ? 134 LEU C N   1 
ATOM   6449  C CA  . LEU C 1 134 ? -3.805  -20.880 -28.047 1.00 15.62  ? 134 LEU C CA  1 
ATOM   6450  C C   . LEU C 1 134 ? -3.570  -22.323 -27.648 1.00 20.56  ? 134 LEU C C   1 
ATOM   6451  O O   . LEU C 1 134 ? -4.318  -23.227 -28.051 1.00 20.31  ? 134 LEU C O   1 
ATOM   6452  C CB  . LEU C 1 134 ? -5.007  -20.313 -27.286 1.00 14.28  ? 134 LEU C CB  1 
ATOM   6453  C CG  . LEU C 1 134 ? -5.462  -18.904 -27.662 1.00 17.81  ? 134 LEU C CG  1 
ATOM   6454  C CD1 . LEU C 1 134 ? -6.353  -18.227 -26.650 1.00 17.07  ? 134 LEU C CD1 1 
ATOM   6455  C CD2 . LEU C 1 134 ? -4.355  -18.003 -28.169 1.00 21.13  ? 134 LEU C CD2 1 
ATOM   6456  N N   . ILE C 1 135 ? -2.535  -22.520 -26.818 1.00 17.15  ? 135 ILE C N   1 
ATOM   6457  C CA  . ILE C 1 135 ? -2.212  -23.821 -26.254 1.00 15.80  ? 135 ILE C CA  1 
ATOM   6458  C C   . ILE C 1 135 ? -2.161  -23.692 -24.748 1.00 19.93  ? 135 ILE C C   1 
ATOM   6459  O O   . ILE C 1 135 ? -1.293  -23.025 -24.207 1.00 18.64  ? 135 ILE C O   1 
ATOM   6460  C CB  . ILE C 1 135 ? -0.845  -24.372 -26.736 1.00 18.62  ? 135 ILE C CB  1 
ATOM   6461  C CG1 . ILE C 1 135 ? -0.606  -24.014 -28.198 1.00 18.90  ? 135 ILE C CG1 1 
ATOM   6462  C CG2 . ILE C 1 135 ? -0.820  -25.923 -26.578 1.00 18.84  ? 135 ILE C CG2 1 
ATOM   6463  C CD1 . ILE C 1 135 ? -0.227  -22.583 -28.422 1.00 27.58  ? 135 ILE C CD1 1 
ATOM   6464  N N   . ALA C 1 136 ? -3.118  -24.288 -24.055 1.00 19.63  ? 136 ALA C N   1 
ATOM   6465  C CA  . ALA C 1 136 ? -3.126  -24.132 -22.604 1.00 20.06  ? 136 ALA C CA  1 
ATOM   6466  C C   . ALA C 1 136 ? -2.437  -25.265 -21.844 1.00 23.48  ? 136 ALA C C   1 
ATOM   6467  O O   . ALA C 1 136 ? -2.794  -26.441 -21.975 1.00 22.81  ? 136 ALA C O   1 
ATOM   6468  C CB  . ALA C 1 136 ? -4.521  -23.885 -22.078 1.00 20.35  ? 136 ALA C CB  1 
ATOM   6469  N N   . ASN C 1 137 ? -1.486  -24.874 -21.002 1.00 17.49  ? 137 ASN C N   1 
ATOM   6470  C CA  . ASN C 1 137 ? -0.795  -25.822 -20.141 1.00 16.21  ? 137 ASN C CA  1 
ATOM   6471  C C   . ASN C 1 137 ? -1.373  -25.643 -18.732 1.00 14.78  ? 137 ASN C C   1 
ATOM   6472  O O   . ASN C 1 137 ? -0.877  -24.897 -17.970 1.00 10.50  ? 137 ASN C O   1 
ATOM   6473  C CB  . ASN C 1 137 ? 0.718   -25.526 -20.167 1.00 15.94  ? 137 ASN C CB  1 
ATOM   6474  C CG  . ASN C 1 137 ? 1.498   -26.489 -19.336 1.00 34.73  ? 137 ASN C CG  1 
ATOM   6475  O OD1 . ASN C 1 137 ? 1.339   -27.695 -19.458 1.00 33.29  ? 137 ASN C OD1 1 
ATOM   6476  N ND2 . ASN C 1 137 ? 2.253   -25.965 -18.401 1.00 33.65  ? 137 ASN C ND2 1 
ATOM   6477  N N   . LEU C 1 138 ? -2.491  -26.279 -18.445 1.00 14.63  ? 138 LEU C N   1 
ATOM   6478  C CA  . LEU C 1 138 ? -3.222  -26.059 -17.201 1.00 14.66  ? 138 LEU C CA  1 
ATOM   6479  C C   . LEU C 1 138 ? -2.371  -26.201 -15.958 1.00 21.33  ? 138 LEU C C   1 
ATOM   6480  O O   . LEU C 1 138 ? -2.486  -25.379 -15.004 1.00 18.86  ? 138 LEU C O   1 
ATOM   6481  C CB  . LEU C 1 138 ? -4.463  -26.962 -17.135 1.00 14.28  ? 138 LEU C CB  1 
ATOM   6482  C CG  . LEU C 1 138 ? -5.395  -26.994 -18.366 1.00 16.97  ? 138 LEU C CG  1 
ATOM   6483  C CD1 . LEU C 1 138 ? -6.647  -27.878 -18.120 1.00 14.89  ? 138 LEU C CD1 1 
ATOM   6484  C CD2 . LEU C 1 138 ? -5.742  -25.565 -18.850 1.00 13.31  ? 138 LEU C CD2 1 
ATOM   6485  N N   . ALA C 1 139 ? -1.435  -27.156 -16.021 1.00 20.50  ? 139 ALA C N   1 
ATOM   6486  C CA  . ALA C 1 139 ? -0.543  -27.449 -14.884 1.00 19.40  ? 139 ALA C CA  1 
ATOM   6487  C C   . ALA C 1 139 ? -1.415  -27.374 -13.619 1.00 24.41  ? 139 ALA C C   1 
ATOM   6488  O O   . ALA C 1 139 ? -2.426  -28.073 -13.563 1.00 24.17  ? 139 ALA C O   1 
ATOM   6489  C CB  . ALA C 1 139 ? 0.660   -26.502 -14.844 1.00 18.19  ? 139 ALA C CB  1 
ATOM   6490  N N   . ALA C 1 140 ? -1.130  -26.455 -12.695 1.00 20.64  ? 140 ALA C N   1 
ATOM   6491  C CA  . ALA C 1 140 ? -1.961  -26.324 -11.481 1.00 19.48  ? 140 ALA C CA  1 
ATOM   6492  C C   . ALA C 1 140 ? -3.475  -26.092 -11.666 1.00 21.75  ? 140 ALA C C   1 
ATOM   6493  O O   . ALA C 1 140 ? -4.270  -26.515 -10.833 1.00 17.94  ? 140 ALA C O   1 
ATOM   6494  C CB  . ALA C 1 140 ? -1.364  -25.311 -10.488 1.00 20.59  ? 140 ALA C CB  1 
ATOM   6495  N N   . ALA C 1 141 ? -3.902  -25.394 -12.719 1.00 22.70  ? 141 ALA C N   1 
ATOM   6496  C CA  . ALA C 1 141 ? -5.352  -25.193 -12.912 1.00 23.63  ? 141 ALA C CA  1 
ATOM   6497  C C   . ALA C 1 141 ? -6.076  -26.569 -13.003 1.00 28.42  ? 141 ALA C C   1 
ATOM   6498  O O   . ALA C 1 141 ? -7.285  -26.699 -12.773 1.00 28.62  ? 141 ALA C O   1 
ATOM   6499  C CB  . ALA C 1 141 ? -5.624  -24.326 -14.154 1.00 24.66  ? 141 ALA C CB  1 
ATOM   6500  N N   . ASN C 1 142 ? -5.299  -27.611 -13.267 1.00 25.88  ? 142 ASN C N   1 
ATOM   6501  C CA  . ASN C 1 142 ? -5.795  -28.989 -13.335 1.00 25.45  ? 142 ASN C CA  1 
ATOM   6502  C C   . ASN C 1 142 ? -5.861  -29.711 -11.961 1.00 33.48  ? 142 ASN C C   1 
ATOM   6503  O O   . ASN C 1 142 ? -6.320  -30.849 -11.871 1.00 33.45  ? 142 ASN C O   1 
ATOM   6504  C CB  . ASN C 1 142 ? -4.951  -29.771 -14.341 1.00 21.13  ? 142 ASN C CB  1 
ATOM   6505  C CG  . ASN C 1 142 ? -5.579  -31.105 -14.770 1.00 50.67  ? 142 ASN C CG  1 
ATOM   6506  O OD1 . ASN C 1 142 ? -4.872  -32.085 -15.048 1.00 47.99  ? 142 ASN C OD1 1 
ATOM   6507  N ND2 . ASN C 1 142 ? -6.890  -31.104 -14.953 1.00 37.47  ? 142 ASN C ND2 1 
ATOM   6508  N N   . CYS C 1 143 ? -5.458  -29.059 -10.880 1.00 34.86  ? 143 CYS C N   1 
ATOM   6509  C CA  . CYS C 1 143 ? -5.508  -29.729 -9.576  1.00 38.72  ? 143 CYS C CA  1 
ATOM   6510  C C   . CYS C 1 143 ? -6.738  -29.461 -8.715  1.00 39.05  ? 143 CYS C C   1 
ATOM   6511  O O   . CYS C 1 143 ? -6.744  -29.756 -7.519  1.00 39.97  ? 143 CYS C O   1 
ATOM   6512  C CB  . CYS C 1 143 ? -4.264  -29.455 -8.721  1.00 43.24  ? 143 CYS C CB  1 
ATOM   6513  S SG  . CYS C 1 143 ? -2.969  -28.389 -9.425  1.00 50.02  ? 143 CYS C SG  1 
ATOM   6514  N N   . TYR C 1 144 ? -7.767  -28.860 -9.295  1.00 31.25  ? 144 TYR C N   1 
ATOM   6515  C CA  . TYR C 1 144 ? -8.955  -28.512 -8.531  1.00 28.76  ? 144 TYR C CA  1 
ATOM   6516  C C   . TYR C 1 144 ? -9.828  -29.717 -8.145  1.00 36.47  ? 144 TYR C C   1 
ATOM   6517  O O   . TYR C 1 144 ? -10.440 -30.352 -8.989  1.00 35.72  ? 144 TYR C O   1 
ATOM   6518  C CB  . TYR C 1 144 ? -9.796  -27.480 -9.278  1.00 26.76  ? 144 TYR C CB  1 
ATOM   6519  C CG  . TYR C 1 144 ? -10.810 -26.851 -8.376  1.00 24.92  ? 144 TYR C CG  1 
ATOM   6520  C CD1 . TYR C 1 144 ? -10.482 -25.746 -7.604  1.00 25.87  ? 144 TYR C CD1 1 
ATOM   6521  C CD2 . TYR C 1 144 ? -12.061 -27.433 -8.198  1.00 25.37  ? 144 TYR C CD2 1 
ATOM   6522  C CE1 . TYR C 1 144 ? -11.393 -25.224 -6.693  1.00 27.32  ? 144 TYR C CE1 1 
ATOM   6523  C CE2 . TYR C 1 144 ? -12.974 -26.925 -7.294  1.00 25.81  ? 144 TYR C CE2 1 
ATOM   6524  C CZ  . TYR C 1 144 ? -12.651 -25.825 -6.534  1.00 28.92  ? 144 TYR C CZ  1 
ATOM   6525  O OH  . TYR C 1 144 ? -13.612 -25.326 -5.674  1.00 18.11  ? 144 TYR C OH  1 
ATOM   6526  N N   . LYS C 1 145 ? -9.922  -29.993 -6.852  1.00 34.89  ? 145 LYS C N   1 
ATOM   6527  C CA  . LYS C 1 145 ? -10.703 -31.122 -6.350  1.00 33.68  ? 145 LYS C CA  1 
ATOM   6528  C C   . LYS C 1 145 ? -11.826 -30.527 -5.527  1.00 33.19  ? 145 LYS C C   1 
ATOM   6529  O O   . LYS C 1 145 ? -11.603 -29.578 -4.818  1.00 29.80  ? 145 LYS C O   1 
ATOM   6530  C CB  . LYS C 1 145 ? -9.807  -32.011 -5.459  1.00 36.07  ? 145 LYS C CB  1 
ATOM   6531  C CG  . LYS C 1 145 ? -8.663  -32.666 -6.196  1.00 43.00  ? 145 LYS C CG  1 
ATOM   6532  C CD  . LYS C 1 145 ? -9.161  -33.865 -6.980  1.00 54.45  ? 145 LYS C CD  1 
ATOM   6533  C CE  . LYS C 1 145 ? -8.264  -34.167 -8.167  1.00 68.24  ? 145 LYS C CE  1 
ATOM   6534  N NZ  . LYS C 1 145 ? -8.915  -35.166 -9.055  1.00 82.49  ? 145 LYS C NZ  1 
ATOM   6535  N N   . LYS C 1 146 ? -13.041 -31.039 -5.673  1.00 32.27  ? 146 LYS C N   1 
ATOM   6536  C CA  . LYS C 1 146 ? -14.193 -30.454 -4.975  1.00 33.46  ? 146 LYS C CA  1 
ATOM   6537  C C   . LYS C 1 146 ? -14.128 -30.749 -3.469  1.00 41.88  ? 146 LYS C C   1 
ATOM   6538  O O   . LYS C 1 146 ? -14.536 -29.930 -2.620  1.00 41.59  ? 146 LYS C O   1 
ATOM   6539  C CB  . LYS C 1 146 ? -15.521 -30.955 -5.569  1.00 33.55  ? 146 LYS C CB  1 
ATOM   6540  C CG  . LYS C 1 146 ? -15.753 -32.476 -5.395  1.00 30.04  ? 146 LYS C CG  1 
ATOM   6541  C CD  . LYS C 1 146 ? -17.140 -32.955 -5.855  1.00 28.02  ? 146 LYS C CD  1 
ATOM   6542  C CE  . LYS C 1 146 ? -18.180 -32.959 -4.710  1.00 30.20  ? 146 LYS C CE  1 
ATOM   6543  N NZ  . LYS C 1 146 ? -17.541 -33.177 -3.371  1.00 41.36  ? 146 LYS C NZ  1 
ATOM   6544  N N   . GLU C 1 147 ? -13.580 -31.912 -3.140  1.00 38.38  ? 147 GLU C N   1 
ATOM   6545  C CA  . GLU C 1 147 ? -13.472 -32.302 -1.747  1.00 38.31  ? 147 GLU C CA  1 
ATOM   6546  C C   . GLU C 1 147 ? -12.429 -31.477 -0.996  1.00 40.29  ? 147 GLU C C   1 
ATOM   6547  O O   . GLU C 1 147 ? -12.453 -31.407 0.235   1.00 41.96  ? 147 GLU C O   1 
ATOM   6548  C CB  . GLU C 1 147 ? -13.176 -33.800 -1.624  1.00 39.91  ? 147 GLU C CB  1 
ATOM   6549  C CG  . GLU C 1 147 ? -11.854 -34.238 -2.237  1.00 47.71  ? 147 GLU C CG  1 
ATOM   6550  C CD  . GLU C 1 147 ? -12.009 -34.817 -3.622  1.00 60.29  ? 147 GLU C CD  1 
ATOM   6551  O OE1 . GLU C 1 147 ? -13.148 -34.807 -4.143  1.00 42.00  ? 147 GLU C OE1 1 
ATOM   6552  O OE2 . GLU C 1 147 ? -11.000 -35.319 -4.169  1.00 60.64  ? 147 GLU C OE2 1 
ATOM   6553  N N   . LYS C 1 148 ? -11.509 -30.857 -1.726  1.00 33.00  ? 148 LYS C N   1 
ATOM   6554  C CA  . LYS C 1 148 ? -10.478 -30.044 -1.083  1.00 31.91  ? 148 LYS C CA  1 
ATOM   6555  C C   . LYS C 1 148 ? -10.582 -28.525 -1.235  1.00 34.04  ? 148 LYS C C   1 
ATOM   6556  O O   . LYS C 1 148 ? -9.655  -27.790 -0.925  1.00 32.77  ? 148 LYS C O   1 
ATOM   6557  C CB  . LYS C 1 148 ? -9.060  -30.559 -1.346  1.00 33.50  ? 148 LYS C CB  1 
ATOM   6558  C CG  . LYS C 1 148 ? -8.729  -30.913 -2.774  1.00 43.80  ? 148 LYS C CG  1 
ATOM   6559  C CD  . LYS C 1 148 ? -7.265  -31.378 -2.867  1.00 52.31  ? 148 LYS C CD  1 
ATOM   6560  C CE  . LYS C 1 148 ? -6.929  -32.399 -1.772  1.00 59.22  ? 148 LYS C CE  1 
ATOM   6561  N NZ  . LYS C 1 148 ? -5.490  -32.822 -1.711  1.00 63.22  ? 148 LYS C NZ  1 
ATOM   6562  N N   . HIS C 1 149 ? -11.749 -28.044 -1.643  1.00 30.13  ? 149 HIS C N   1 
ATOM   6563  C CA  . HIS C 1 149 ? -11.931 -26.614 -1.766  1.00 29.22  ? 149 HIS C CA  1 
ATOM   6564  C C   . HIS C 1 149 ? -13.393 -26.271 -1.912  1.00 30.09  ? 149 HIS C C   1 
ATOM   6565  O O   . HIS C 1 149 ? -13.961 -25.492 -1.151  1.00 29.86  ? 149 HIS C O   1 
ATOM   6566  C CB  . HIS C 1 149 ? -11.121 -26.049 -2.983  1.00 29.71  ? 149 HIS C CB  1 
ATOM   6567  C CG  . HIS C 1 149 ? -11.152 -24.557 -3.064  1.00 32.26  ? 149 HIS C CG  1 
ATOM   6568  N ND1 . HIS C 1 149 ? -12.204 -23.869 -3.627  1.00 33.25  ? 149 HIS C ND1 1 
ATOM   6569  C CD2 . HIS C 1 149 ? -10.361 -23.623 -2.487  1.00 33.36  ? 149 HIS C CD2 1 
ATOM   6570  C CE1 . HIS C 1 149 ? -12.029 -22.574 -3.444  1.00 32.24  ? 149 HIS C CE1 1 
ATOM   6571  N NE2 . HIS C 1 149 ? -10.910 -22.398 -2.768  1.00 32.79  ? 149 HIS C NE2 1 
ATOM   6572  N N   . LEU C 1 150 ? -14.000 -26.806 -2.949  1.00 27.25  ? 150 LEU C N   1 
ATOM   6573  C CA  . LEU C 1 150 ? -15.415 -26.497 -3.216  1.00 26.93  ? 150 LEU C CA  1 
ATOM   6574  C C   . LEU C 1 150 ? -16.353 -26.907 -2.089  1.00 32.49  ? 150 LEU C C   1 
ATOM   6575  O O   . LEU C 1 150 ? -17.236 -26.143 -1.707  1.00 31.44  ? 150 LEU C O   1 
ATOM   6576  C CB  . LEU C 1 150 ? -15.856 -27.078 -4.555  1.00 25.34  ? 150 LEU C CB  1 
ATOM   6577  C CG  . LEU C 1 150 ? -17.290 -26.762 -4.932  1.00 27.29  ? 150 LEU C CG  1 
ATOM   6578  C CD1 . LEU C 1 150 ? -17.672 -25.321 -4.780  1.00 26.49  ? 150 LEU C CD1 1 
ATOM   6579  C CD2 . LEU C 1 150 ? -17.556 -27.239 -6.319  1.00 28.36  ? 150 LEU C CD2 1 
ATOM   6580  N N   . ASP C 1 151 ? -16.076 -28.077 -1.507  1.00 32.67  ? 151 ASP C N   1 
ATOM   6581  C CA  . ASP C 1 151 ? -16.838 -28.618 -0.371  1.00 33.56  ? 151 ASP C CA  1 
ATOM   6582  C C   . ASP C 1 151 ? -16.493 -28.100 1.019   1.00 36.95  ? 151 ASP C C   1 
ATOM   6583  O O   . ASP C 1 151 ? -16.998 -28.654 1.982   1.00 36.92  ? 151 ASP C O   1 
ATOM   6584  C CB  . ASP C 1 151 ? -16.739 -30.141 -0.328  1.00 35.62  ? 151 ASP C CB  1 
ATOM   6585  C CG  . ASP C 1 151 ? -17.000 -30.790 -1.682  1.00 41.91  ? 151 ASP C CG  1 
ATOM   6586  O OD1 . ASP C 1 151 ? -17.934 -30.337 -2.374  1.00 39.60  ? 151 ASP C OD1 1 
ATOM   6587  O OD2 . ASP C 1 151 ? -16.305 -31.784 -2.030  1.00 42.04  ? 151 ASP C OD2 1 
ATOM   6588  N N   . LEU C 1 152 ? -15.588 -27.131 1.149   1.00 33.01  ? 152 LEU C N   1 
ATOM   6589  C CA  . LEU C 1 152 ? -15.291 -26.600 2.483   1.00 33.01  ? 152 LEU C CA  1 
ATOM   6590  C C   . LEU C 1 152 ? -16.373 -25.547 2.724   1.00 38.27  ? 152 LEU C C   1 
ATOM   6591  O O   . LEU C 1 152 ? -16.789 -24.877 1.795   1.00 38.25  ? 152 LEU C O   1 
ATOM   6592  C CB  . LEU C 1 152 ? -13.879 -25.990 2.576   1.00 32.56  ? 152 LEU C CB  1 
ATOM   6593  C CG  . LEU C 1 152 ? -12.641 -26.821 2.177   1.00 35.56  ? 152 LEU C CG  1 
ATOM   6594  C CD1 . LEU C 1 152 ? -11.367 -26.085 2.522   1.00 34.31  ? 152 LEU C CD1 1 
ATOM   6595  C CD2 . LEU C 1 152 ? -12.624 -28.234 2.759   1.00 34.56  ? 152 LEU C CD2 1 
ATOM   6596  N N   . GLU C 1 153 ? -16.887 -25.465 3.947   1.00 35.67  ? 153 GLU C N   1 
ATOM   6597  C CA  . GLU C 1 153 ? -17.966 -24.541 4.263   1.00 35.39  ? 153 GLU C CA  1 
ATOM   6598  C C   . GLU C 1 153 ? -17.736 -23.077 3.908   1.00 36.14  ? 153 GLU C C   1 
ATOM   6599  O O   . GLU C 1 153 ? -18.648 -22.412 3.439   1.00 36.10  ? 153 GLU C O   1 
ATOM   6600  C CB  . GLU C 1 153 ? -18.333 -24.633 5.735   1.00 37.68  ? 153 GLU C CB  1 
ATOM   6601  C CG  . GLU C 1 153 ? -19.025 -23.376 6.258   1.00 55.00  ? 153 GLU C CG  1 
ATOM   6602  C CD  . GLU C 1 153 ? -19.827 -23.634 7.521   1.00 94.41  ? 153 GLU C CD  1 
ATOM   6603  O OE1 . GLU C 1 153 ? -20.352 -24.759 7.673   1.00 100.55 ? 153 GLU C OE1 1 
ATOM   6604  O OE2 . GLU C 1 153 ? -19.949 -22.694 8.340   1.00 91.30  ? 153 GLU C OE2 1 
ATOM   6605  N N   . LYS C 1 154 ? -16.565 -22.546 4.233   1.00 30.61  ? 154 LYS C N   1 
ATOM   6606  C CA  . LYS C 1 154 ? -16.309 -21.143 3.998   1.00 29.72  ? 154 LYS C CA  1 
ATOM   6607  C C   . LYS C 1 154 ? -16.458 -20.822 2.528   1.00 35.60  ? 154 LYS C C   1 
ATOM   6608  O O   . LYS C 1 154 ? -16.944 -19.742 2.169   1.00 34.81  ? 154 LYS C O   1 
ATOM   6609  C CB  . LYS C 1 154 ? -14.938 -20.712 4.534   1.00 31.68  ? 154 LYS C CB  1 
ATOM   6610  C CG  . LYS C 1 154 ? -13.719 -21.494 4.029   1.00 36.30  ? 154 LYS C CG  1 
ATOM   6611  C CD  . LYS C 1 154 ? -12.490 -20.575 3.958   1.00 43.27  ? 154 LYS C CD  1 
ATOM   6612  C CE  . LYS C 1 154 ? -11.172 -21.348 3.914   1.00 34.15  ? 154 LYS C CE  1 
ATOM   6613  N NZ  . LYS C 1 154 ? -11.400 -22.738 4.362   1.00 38.13  ? 154 LYS C NZ  1 
ATOM   6614  N N   . ASN C 1 155 ? -16.071 -21.783 1.681   1.00 32.59  ? 155 ASN C N   1 
ATOM   6615  C CA  . ASN C 1 155 ? -16.126 -21.621 0.225   1.00 31.63  ? 155 ASN C CA  1 
ATOM   6616  C C   . ASN C 1 155 ? -17.503 -21.928 -0.337  1.00 32.37  ? 155 ASN C C   1 
ATOM   6617  O O   . ASN C 1 155 ? -18.081 -21.119 -1.035  1.00 32.79  ? 155 ASN C O   1 
ATOM   6618  C CB  . ASN C 1 155 ? -15.104 -22.522 -0.470  1.00 33.62  ? 155 ASN C CB  1 
ATOM   6619  C CG  . ASN C 1 155 ? -13.715 -22.267 -0.005  1.00 38.01  ? 155 ASN C CG  1 
ATOM   6620  O OD1 . ASN C 1 155 ? -13.078 -23.138 0.585   1.00 27.72  ? 155 ASN C OD1 1 
ATOM   6621  N ND2 . ASN C 1 155 ? -13.266 -21.040 -0.189  1.00 32.08  ? 155 ASN C ND2 1 
ATOM   6622  N N   . TRP C 1 156 ? -18.014 -23.115 -0.057  1.00 28.09  ? 156 TRP C N   1 
ATOM   6623  C CA  . TRP C 1 156 ? -19.336 -23.520 -0.525  1.00 28.60  ? 156 TRP C CA  1 
ATOM   6624  C C   . TRP C 1 156 ? -20.409 -22.537 -0.096  1.00 36.87  ? 156 TRP C C   1 
ATOM   6625  O O   . TRP C 1 156 ? -21.462 -22.440 -0.711  1.00 36.50  ? 156 TRP C O   1 
ATOM   6626  C CB  . TRP C 1 156 ? -19.702 -24.925 -0.020  1.00 26.75  ? 156 TRP C CB  1 
ATOM   6627  C CG  . TRP C 1 156 ? -21.055 -25.365 -0.499  1.00 27.16  ? 156 TRP C CG  1 
ATOM   6628  C CD1 . TRP C 1 156 ? -22.207 -25.478 0.245   1.00 30.02  ? 156 TRP C CD1 1 
ATOM   6629  C CD2 . TRP C 1 156 ? -21.434 -25.633 -1.859  1.00 27.02  ? 156 TRP C CD2 1 
ATOM   6630  N NE1 . TRP C 1 156 ? -23.283 -25.803 -0.577  1.00 29.32  ? 156 TRP C NE1 1 
ATOM   6631  C CE2 . TRP C 1 156 ? -22.825 -25.908 -1.866  1.00 30.94  ? 156 TRP C CE2 1 
ATOM   6632  C CE3 . TRP C 1 156 ? -20.724 -25.734 -3.060  1.00 27.90  ? 156 TRP C CE3 1 
ATOM   6633  C CZ2 . TRP C 1 156 ? -23.503 -26.234 -3.028  1.00 30.22  ? 156 TRP C CZ2 1 
ATOM   6634  C CZ3 . TRP C 1 156 ? -21.400 -26.038 -4.200  1.00 29.57  ? 156 TRP C CZ3 1 
ATOM   6635  C CH2 . TRP C 1 156 ? -22.775 -26.277 -4.187  1.00 30.59  ? 156 TRP C CH2 1 
ATOM   6636  N N   . MET C 1 157 ? -20.176 -21.869 1.017   1.00 38.24  ? 157 MET C N   1 
ATOM   6637  C CA  . MET C 1 157 ? -21.116 -20.877 1.501   1.00 39.54  ? 157 MET C CA  1 
ATOM   6638  C C   . MET C 1 157 ? -21.191 -19.672 0.536   1.00 39.68  ? 157 MET C C   1 
ATOM   6639  O O   . MET C 1 157 ? -22.262 -19.089 0.365   1.00 39.76  ? 157 MET C O   1 
ATOM   6640  C CB  . MET C 1 157 ? -20.726 -20.445 2.919   1.00 43.02  ? 157 MET C CB  1 
ATOM   6641  C CG  . MET C 1 157 ? -21.479 -19.239 3.431   1.00 48.26  ? 157 MET C CG  1 
ATOM   6642  S SD  . MET C 1 157 ? -20.448 -18.121 4.458   1.00 53.81  ? 157 MET C SD  1 
ATOM   6643  C CE  . MET C 1 157 ? -18.703 -18.654 4.039   1.00 49.77  ? 157 MET C CE  1 
ATOM   6644  N N   . LEU C 1 158 ? -20.067 -19.311 -0.092  1.00 32.16  ? 158 LEU C N   1 
ATOM   6645  C CA  . LEU C 1 158 ? -20.030 -18.192 -1.046  1.00 30.94  ? 158 LEU C CA  1 
ATOM   6646  C C   . LEU C 1 158 ? -20.837 -18.519 -2.317  1.00 36.03  ? 158 LEU C C   1 
ATOM   6647  O O   . LEU C 1 158 ? -21.401 -17.630 -2.978  1.00 36.29  ? 158 LEU C O   1 
ATOM   6648  C CB  . LEU C 1 158 ? -18.577 -17.877 -1.435  1.00 29.83  ? 158 LEU C CB  1 
ATOM   6649  C CG  . LEU C 1 158 ? -17.687 -17.359 -0.302  1.00 31.05  ? 158 LEU C CG  1 
ATOM   6650  C CD1 . LEU C 1 158 ? -16.335 -16.983 -0.832  1.00 29.09  ? 158 LEU C CD1 1 
ATOM   6651  C CD2 . LEU C 1 158 ? -18.365 -16.177 0.433   1.00 30.22  ? 158 LEU C CD2 1 
ATOM   6652  N N   . VAL C 1 159 ? -20.837 -19.803 -2.667  1.00 31.01  ? 159 VAL C N   1 
ATOM   6653  C CA  . VAL C 1 159 ? -21.554 -20.335 -3.818  1.00 29.81  ? 159 VAL C CA  1 
ATOM   6654  C C   . VAL C 1 159 ? -23.055 -20.314 -3.537  1.00 32.72  ? 159 VAL C C   1 
ATOM   6655  O O   . VAL C 1 159 ? -23.860 -20.207 -4.445  1.00 32.27  ? 159 VAL C O   1 
ATOM   6656  C CB  . VAL C 1 159 ? -21.131 -21.804 -4.061  1.00 33.90  ? 159 VAL C CB  1 
ATOM   6657  C CG1 . VAL C 1 159 ? -22.194 -22.576 -4.808  1.00 34.29  ? 159 VAL C CG1 1 
ATOM   6658  C CG2 . VAL C 1 159 ? -19.785 -21.900 -4.746  1.00 33.41  ? 159 VAL C CG2 1 
ATOM   6659  N N   . GLU C 1 160 ? -23.431 -20.397 -2.270  1.00 30.07  ? 160 GLU C N   1 
ATOM   6660  C CA  . GLU C 1 160 ? -24.838 -20.443 -1.905  1.00 29.62  ? 160 GLU C CA  1 
ATOM   6661  C C   . GLU C 1 160 ? -25.452 -19.052 -1.992  1.00 33.26  ? 160 GLU C C   1 
ATOM   6662  O O   . GLU C 1 160 ? -26.683 -18.901 -2.117  1.00 32.20  ? 160 GLU C O   1 
ATOM   6663  C CB  . GLU C 1 160 ? -24.999 -21.035 -0.498  1.00 31.12  ? 160 GLU C CB  1 
ATOM   6664  C CG  . GLU C 1 160 ? -24.810 -22.561 -0.410  1.00 38.17  ? 160 GLU C CG  1 
ATOM   6665  C CD  . GLU C 1 160 ? -26.038 -23.254 0.159   1.00 60.73  ? 160 GLU C CD  1 
ATOM   6666  O OE1 . GLU C 1 160 ? -26.717 -22.648 1.012   1.00 52.92  ? 160 GLU C OE1 1 
ATOM   6667  O OE2 . GLU C 1 160 ? -26.368 -24.375 -0.279  1.00 62.47  ? 160 GLU C OE2 1 
ATOM   6668  N N   . LYS C 1 161 ? -24.572 -18.051 -1.988  1.00 29.63  ? 161 LYS C N   1 
ATOM   6669  C CA  . LYS C 1 161 ? -24.952 -16.639 -2.061  1.00 28.46  ? 161 LYS C CA  1 
ATOM   6670  C C   . LYS C 1 161 ? -25.338 -16.220 -3.490  1.00 34.83  ? 161 LYS C C   1 
ATOM   6671  O O   . LYS C 1 161 ? -26.120 -15.295 -3.673  1.00 36.46  ? 161 LYS C O   1 
ATOM   6672  C CB  . LYS C 1 161 ? -23.813 -15.736 -1.523  1.00 28.02  ? 161 LYS C CB  1 
ATOM   6673  C CG  . LYS C 1 161 ? -23.224 -16.190 -0.170  1.00 37.96  ? 161 LYS C CG  1 
ATOM   6674  C CD  . LYS C 1 161 ? -22.378 -15.123 0.555   1.00 37.82  ? 161 LYS C CD  1 
ATOM   6675  C CE  . LYS C 1 161 ? -22.857 -13.709 0.267   1.00 32.94  ? 161 LYS C CE  1 
ATOM   6676  N NZ  . LYS C 1 161 ? -22.084 -12.702 1.070   1.00 33.33  ? 161 LYS C NZ  1 
ATOM   6677  N N   . ALA C 1 162 ? -24.784 -16.898 -4.492  1.00 30.39  ? 162 ALA C N   1 
ATOM   6678  C CA  . ALA C 1 162 ? -25.024 -16.579 -5.903  1.00 30.45  ? 162 ALA C CA  1 
ATOM   6679  C C   . ALA C 1 162 ? -26.479 -16.659 -6.408  1.00 38.28  ? 162 ALA C C   1 
ATOM   6680  O O   . ALA C 1 162 ? -27.232 -17.582 -6.058  1.00 38.95  ? 162 ALA C O   1 
ATOM   6681  C CB  . ALA C 1 162 ? -24.117 -17.451 -6.801  1.00 30.51  ? 162 ALA C CB  1 
ATOM   6682  N N   . ARG C 1 163 ? -26.827 -15.733 -7.302  1.00 34.76  ? 163 ARG C N   1 
ATOM   6683  C CA  . ARG C 1 163 ? -28.130 -15.709 -7.955  1.00 33.75  ? 163 ARG C CA  1 
ATOM   6684  C C   . ARG C 1 163 ? -27.893 -16.351 -9.273  1.00 33.90  ? 163 ARG C C   1 
ATOM   6685  O O   . ARG C 1 163 ? -28.816 -16.961 -9.812  1.00 34.37  ? 163 ARG C O   1 
ATOM   6686  C CB  . ARG C 1 163 ? -28.537 -14.280 -8.269  1.00 39.18  ? 163 ARG C CB  1 
ATOM   6687  C CG  . ARG C 1 163 ? -29.346 -13.606 -7.183  1.00 67.43  ? 163 ARG C CG  1 
ATOM   6688  C CD  . ARG C 1 163 ? -30.414 -14.537 -6.613  1.00 83.21  ? 163 ARG C CD  1 
ATOM   6689  N NE  . ARG C 1 163 ? -31.480 -13.773 -5.978  1.00 93.08  ? 163 ARG C NE  1 
ATOM   6690  C CZ  . ARG C 1 163 ? -32.746 -13.789 -6.377  1.00 116.07 ? 163 ARG C CZ  1 
ATOM   6691  N NH1 . ARG C 1 163 ? -33.651 -13.054 -5.743  1.00 111.78 ? 163 ARG C NH1 1 
ATOM   6692  N NH2 . ARG C 1 163 ? -33.109 -14.543 -7.407  1.00 103.39 ? 163 ARG C NH2 1 
ATOM   6693  N N   . VAL C 1 164 ? -26.669 -16.140 -9.794  1.00 25.55  ? 164 VAL C N   1 
ATOM   6694  C CA  . VAL C 1 164 ? -26.215 -16.625 -11.101 1.00 23.36  ? 164 VAL C CA  1 
ATOM   6695  C C   . VAL C 1 164 ? -24.857 -17.347 -10.974 1.00 27.00  ? 164 VAL C C   1 
ATOM   6696  O O   . VAL C 1 164 ? -23.958 -16.882 -10.276 1.00 27.13  ? 164 VAL C O   1 
ATOM   6697  C CB  . VAL C 1 164 ? -26.127 -15.421 -12.114 1.00 25.03  ? 164 VAL C CB  1 
ATOM   6698  C CG1 . VAL C 1 164 ? -25.583 -15.851 -13.444 1.00 23.97  ? 164 VAL C CG1 1 
ATOM   6699  C CG2 . VAL C 1 164 ? -27.492 -14.755 -12.276 1.00 24.07  ? 164 VAL C CG2 1 
ATOM   6700  N N   . CYS C 1 165 ? -24.695 -18.465 -11.679 1.00 22.66  ? 165 CYS C N   1 
ATOM   6701  C CA  . CYS C 1 165 ? -23.437 -19.228 -11.646 1.00 21.05  ? 165 CYS C CA  1 
ATOM   6702  C C   . CYS C 1 165 ? -22.963 -19.324 -13.050 1.00 24.41  ? 165 CYS C C   1 
ATOM   6703  O O   . CYS C 1 165 ? -23.779 -19.531 -13.941 1.00 25.18  ? 165 CYS C O   1 
ATOM   6704  C CB  . CYS C 1 165 ? -23.663 -20.654 -11.122 1.00 20.92  ? 165 CYS C CB  1 
ATOM   6705  S SG  . CYS C 1 165 ? -23.907 -20.748 -9.319  1.00 25.07  ? 165 CYS C SG  1 
ATOM   6706  N N   . TYR C 1 166 ? -21.654 -19.173 -13.256 1.00 19.02  ? 166 TYR C N   1 
ATOM   6707  C CA  . TYR C 1 166 ? -21.075 -19.313 -14.590 1.00 16.99  ? 166 TYR C CA  1 
ATOM   6708  C C   . TYR C 1 166 ? -19.790 -20.107 -14.511 1.00 21.80  ? 166 TYR C C   1 
ATOM   6709  O O   . TYR C 1 166 ? -18.917 -19.824 -13.668 1.00 21.14  ? 166 TYR C O   1 
ATOM   6710  C CB  . TYR C 1 166 ? -20.758 -17.954 -15.212 1.00 17.07  ? 166 TYR C CB  1 
ATOM   6711  C CG  . TYR C 1 166 ? -20.034 -18.069 -16.554 1.00 15.82  ? 166 TYR C CG  1 
ATOM   6712  C CD1 . TYR C 1 166 ? -20.574 -18.849 -17.587 1.00 15.41  ? 166 TYR C CD1 1 
ATOM   6713  C CD2 . TYR C 1 166 ? -18.762 -17.534 -16.731 1.00 15.19  ? 166 TYR C CD2 1 
ATOM   6714  C CE1 . TYR C 1 166 ? -19.968 -18.940 -18.808 1.00 13.98  ? 166 TYR C CE1 1 
ATOM   6715  C CE2 . TYR C 1 166 ? -18.089 -17.706 -17.933 1.00 16.53  ? 166 TYR C CE2 1 
ATOM   6716  C CZ  . TYR C 1 166 ? -18.711 -18.385 -18.985 1.00 23.59  ? 166 TYR C CZ  1 
ATOM   6717  O OH  . TYR C 1 166 ? -18.058 -18.511 -20.194 1.00 18.63  ? 166 TYR C OH  1 
ATOM   6718  N N   . ILE C 1 167 ? -19.656 -21.060 -15.435 1.00 17.06  ? 167 ILE C N   1 
ATOM   6719  C CA  . ILE C 1 167 ? -18.457 -21.857 -15.562 1.00 15.62  ? 167 ILE C CA  1 
ATOM   6720  C C   . ILE C 1 167 ? -18.266 -22.081 -17.048 1.00 19.94  ? 167 ILE C C   1 
ATOM   6721  O O   . ILE C 1 167 ? -19.167 -22.549 -17.725 1.00 23.76  ? 167 ILE C O   1 
ATOM   6722  C CB  . ILE C 1 167 ? -18.556 -23.296 -14.918 1.00 19.02  ? 167 ILE C CB  1 
ATOM   6723  C CG1 . ILE C 1 167 ? -19.250 -23.282 -13.562 1.00 20.62  ? 167 ILE C CG1 1 
ATOM   6724  C CG2 . ILE C 1 167 ? -17.128 -23.896 -14.774 1.00 17.55  ? 167 ILE C CG2 1 
ATOM   6725  C CD1 . ILE C 1 167 ? -18.559 -24.131 -12.548 1.00 27.57  ? 167 ILE C CD1 1 
ATOM   6726  N N   . ALA C 1 168 ? -17.054 -21.872 -17.528 1.00 12.33  ? 168 ALA C N   1 
ATOM   6727  C CA  . ALA C 1 168 ? -16.732 -22.139 -18.898 1.00 11.41  ? 168 ALA C CA  1 
ATOM   6728  C C   . ALA C 1 168 ? -16.540 -23.667 -19.125 1.00 20.76  ? 168 ALA C C   1 
ATOM   6729  O O   . ALA C 1 168 ? -16.094 -24.395 -18.235 1.00 20.95  ? 168 ALA C O   1 
ATOM   6730  C CB  . ALA C 1 168 ? -15.515 -21.397 -19.264 1.00 11.16  ? 168 ALA C CB  1 
ATOM   6731  N N   . GLY C 1 169 ? -16.876 -24.134 -20.328 1.00 18.27  ? 169 GLY C N   1 
ATOM   6732  C CA  . GLY C 1 169 ? -16.778 -25.545 -20.684 1.00 17.61  ? 169 GLY C CA  1 
ATOM   6733  C C   . GLY C 1 169 ? -15.389 -26.060 -20.437 1.00 22.07  ? 169 GLY C C   1 
ATOM   6734  O O   . GLY C 1 169 ? -15.230 -27.236 -20.123 1.00 21.74  ? 169 GLY C O   1 
ATOM   6735  N N   . PHE C 1 170 ? -14.394 -25.165 -20.525 1.00 17.91  ? 170 PHE C N   1 
ATOM   6736  C CA  . PHE C 1 170 ? -12.981 -25.521 -20.281 1.00 14.58  ? 170 PHE C CA  1 
ATOM   6737  C C   . PHE C 1 170 ? -12.784 -26.297 -18.988 1.00 19.43  ? 170 PHE C C   1 
ATOM   6738  O O   . PHE C 1 170 ? -11.857 -27.095 -18.891 1.00 22.51  ? 170 PHE C O   1 
ATOM   6739  C CB  . PHE C 1 170 ? -12.064 -24.280 -20.246 1.00 14.58  ? 170 PHE C CB  1 
ATOM   6740  C CG  . PHE C 1 170 ? -11.773 -23.675 -21.612 1.00 14.53  ? 170 PHE C CG  1 
ATOM   6741  C CD1 . PHE C 1 170 ? -12.066 -22.330 -21.872 1.00 15.04  ? 170 PHE C CD1 1 
ATOM   6742  C CD2 . PHE C 1 170 ? -11.203 -24.426 -22.625 1.00 13.57  ? 170 PHE C CD2 1 
ATOM   6743  C CE1 . PHE C 1 170 ? -11.778 -21.769 -23.106 1.00 14.06  ? 170 PHE C CE1 1 
ATOM   6744  C CE2 . PHE C 1 170 ? -10.979 -23.880 -23.873 1.00 15.45  ? 170 PHE C CE2 1 
ATOM   6745  C CZ  . PHE C 1 170 ? -11.244 -22.541 -24.108 1.00 12.60  ? 170 PHE C CZ  1 
ATOM   6746  N N   . PHE C 1 171 ? -13.582 -25.991 -17.968 1.00 14.88  ? 171 PHE C N   1 
ATOM   6747  C CA  . PHE C 1 171 ? -13.416 -26.622 -16.658 1.00 14.47  ? 171 PHE C CA  1 
ATOM   6748  C C   . PHE C 1 171 ? -13.785 -28.095 -16.645 1.00 20.40  ? 171 PHE C C   1 
ATOM   6749  O O   . PHE C 1 171 ? -13.357 -28.841 -15.755 1.00 19.65  ? 171 PHE C O   1 
ATOM   6750  C CB  . PHE C 1 171 ? -14.193 -25.891 -15.575 1.00 14.68  ? 171 PHE C CB  1 
ATOM   6751  C CG  . PHE C 1 171 ? -13.606 -26.034 -14.218 1.00 15.21  ? 171 PHE C CG  1 
ATOM   6752  C CD1 . PHE C 1 171 ? -12.240 -25.884 -14.021 1.00 18.87  ? 171 PHE C CD1 1 
ATOM   6753  C CD2 . PHE C 1 171 ? -14.421 -26.296 -13.123 1.00 16.24  ? 171 PHE C CD2 1 
ATOM   6754  C CE1 . PHE C 1 171 ? -11.702 -26.021 -12.757 1.00 18.77  ? 171 PHE C CE1 1 
ATOM   6755  C CE2 . PHE C 1 171 ? -13.891 -26.462 -11.869 1.00 18.60  ? 171 PHE C CE2 1 
ATOM   6756  C CZ  . PHE C 1 171 ? -12.525 -26.341 -11.691 1.00 17.02  ? 171 PHE C CZ  1 
ATOM   6757  N N   . LEU C 1 172 ? -14.627 -28.497 -17.597 1.00 16.68  ? 172 LEU C N   1 
ATOM   6758  C CA  . LEU C 1 172 ? -15.038 -29.900 -17.697 1.00 15.57  ? 172 LEU C CA  1 
ATOM   6759  C C   . LEU C 1 172 ? -13.808 -30.831 -17.824 1.00 14.95  ? 172 LEU C C   1 
ATOM   6760  O O   . LEU C 1 172 ? -13.825 -31.952 -17.345 1.00 10.67  ? 172 LEU C O   1 
ATOM   6761  C CB  . LEU C 1 172 ? -16.042 -30.146 -18.858 1.00 15.41  ? 172 LEU C CB  1 
ATOM   6762  C CG  . LEU C 1 172 ? -17.413 -29.427 -18.824 1.00 18.70  ? 172 LEU C CG  1 
ATOM   6763  C CD1 . LEU C 1 172 ? -18.311 -29.799 -19.994 1.00 17.72  ? 172 LEU C CD1 1 
ATOM   6764  C CD2 . LEU C 1 172 ? -18.145 -29.565 -17.543 1.00 17.77  ? 172 LEU C CD2 1 
ATOM   6765  N N   . THR C 1 173 ? -12.743 -30.373 -18.475 1.00 13.72  ? 173 THR C N   1 
ATOM   6766  C CA  . THR C 1 173 ? -11.513 -31.172 -18.547 1.00 14.33  ? 173 THR C CA  1 
ATOM   6767  C C   . THR C 1 173 ? -10.746 -31.227 -17.230 1.00 22.19  ? 173 THR C C   1 
ATOM   6768  O O   . THR C 1 173 ? -9.647  -31.789 -17.191 1.00 24.58  ? 173 THR C O   1 
ATOM   6769  C CB  . THR C 1 173 ? -10.520 -30.720 -19.663 1.00 18.74  ? 173 THR C CB  1 
ATOM   6770  O OG1 . THR C 1 173 ? -9.767  -29.575 -19.245 1.00 15.74  ? 173 THR C OG1 1 
ATOM   6771  C CG2 . THR C 1 173 ? -11.251 -30.409 -20.903 1.00 26.76  ? 173 THR C CG2 1 
ATOM   6772  N N   . VAL C 1 174 ? -11.250 -30.560 -16.192 1.00 18.88  ? 174 VAL C N   1 
ATOM   6773  C CA  . VAL C 1 174 ? -10.546 -30.553 -14.907 1.00 17.67  ? 174 VAL C CA  1 
ATOM   6774  C C   . VAL C 1 174 ? -11.349 -31.178 -13.762 1.00 27.38  ? 174 VAL C C   1 
ATOM   6775  O O   . VAL C 1 174 ? -10.822 -32.046 -13.034 1.00 31.03  ? 174 VAL C O   1 
ATOM   6776  C CB  . VAL C 1 174 ? -10.033 -29.159 -14.491 1.00 18.20  ? 174 VAL C CB  1 
ATOM   6777  C CG1 . VAL C 1 174 ? -9.426  -29.215 -13.113 1.00 18.94  ? 174 VAL C CG1 1 
ATOM   6778  C CG2 . VAL C 1 174 ? -9.058  -28.579 -15.489 1.00 16.15  ? 174 VAL C CG2 1 
ATOM   6779  N N   . SER C 1 175 ? -12.601 -30.744 -13.588 1.00 22.03  ? 175 SER C N   1 
ATOM   6780  C CA  . SER C 1 175 ? -13.437 -31.210 -12.476 1.00 19.99  ? 175 SER C CA  1 
ATOM   6781  C C   . SER C 1 175 ? -14.927 -31.277 -12.834 1.00 23.33  ? 175 SER C C   1 
ATOM   6782  O O   . SER C 1 175 ? -15.718 -30.464 -12.357 1.00 23.34  ? 175 SER C O   1 
ATOM   6783  C CB  . SER C 1 175 ? -13.264 -30.248 -11.291 1.00 22.14  ? 175 SER C CB  1 
ATOM   6784  O OG  . SER C 1 175 ? -13.582 -30.846 -10.052 1.00 31.16  ? 175 SER C OG  1 
ATOM   6785  N N   . PRO C 1 176 ? -15.321 -32.282 -13.610 1.00 20.97  ? 176 PRO C N   1 
ATOM   6786  C CA  . PRO C 1 176 ? -16.742 -32.451 -13.971 1.00 20.88  ? 176 PRO C CA  1 
ATOM   6787  C C   . PRO C 1 176 ? -17.622 -32.590 -12.722 1.00 23.40  ? 176 PRO C C   1 
ATOM   6788  O O   . PRO C 1 176 ? -18.731 -32.032 -12.665 1.00 20.42  ? 176 PRO C O   1 
ATOM   6789  C CB  . PRO C 1 176 ? -16.764 -33.718 -14.849 1.00 21.69  ? 176 PRO C CB  1 
ATOM   6790  C CG  . PRO C 1 176 ? -15.374 -33.950 -15.247 1.00 25.80  ? 176 PRO C CG  1 
ATOM   6791  C CD  . PRO C 1 176 ? -14.450 -33.267 -14.279 1.00 21.25  ? 176 PRO C CD  1 
ATOM   6792  N N   . GLU C 1 177 ? -17.056 -33.213 -11.682 1.00 22.59  ? 177 GLU C N   1 
ATOM   6793  C CA  . GLU C 1 177 ? -17.718 -33.351 -10.357 1.00 22.07  ? 177 GLU C CA  1 
ATOM   6794  C C   . GLU C 1 177 ? -18.067 -32.018 -9.698  1.00 26.10  ? 177 GLU C C   1 
ATOM   6795  O O   . GLU C 1 177 ? -19.182 -31.841 -9.212  1.00 25.43  ? 177 GLU C O   1 
ATOM   6796  C CB  . GLU C 1 177 ? -16.878 -34.200 -9.413  1.00 22.88  ? 177 GLU C CB  1 
ATOM   6797  C CG  . GLU C 1 177 ? -16.461 -35.554 -10.025 1.00 29.36  ? 177 GLU C CG  1 
ATOM   6798  C CD  . GLU C 1 177 ? -15.286 -35.442 -11.013 1.00 58.31  ? 177 GLU C CD  1 
ATOM   6799  O OE1 . GLU C 1 177 ? -14.556 -34.413 -11.058 1.00 49.93  ? 177 GLU C OE1 1 
ATOM   6800  O OE2 . GLU C 1 177 ? -15.022 -36.449 -11.687 1.00 60.79  ? 177 GLU C OE2 1 
ATOM   6801  N N   . SER C 1 178 ? -17.145 -31.055 -9.729  1.00 20.76  ? 178 SER C N   1 
ATOM   6802  C CA  . SER C 1 178 ? -17.455 -29.761 -9.135  1.00 17.91  ? 178 SER C CA  1 
ATOM   6803  C C   . SER C 1 178 ? -18.523 -29.034 -9.936  1.00 20.13  ? 178 SER C C   1 
ATOM   6804  O O   . SER C 1 178 ? -19.433 -28.418 -9.367  1.00 22.09  ? 178 SER C O   1 
ATOM   6805  C CB  . SER C 1 178 ? -16.183 -28.929 -8.972  1.00 19.17  ? 178 SER C CB  1 
ATOM   6806  O OG  . SER C 1 178 ? -15.059 -29.785 -8.774  1.00 20.36  ? 178 SER C OG  1 
ATOM   6807  N N   . VAL C 1 179 ? -18.425 -29.117 -11.258 1.00 14.48  ? 179 VAL C N   1 
ATOM   6808  C CA  . VAL C 1 179 ? -19.372 -28.455 -12.158 1.00 13.36  ? 179 VAL C CA  1 
ATOM   6809  C C   . VAL C 1 179 ? -20.789 -28.961 -11.918 1.00 20.68  ? 179 VAL C C   1 
ATOM   6810  O O   . VAL C 1 179 ? -21.757 -28.176 -11.916 1.00 21.65  ? 179 VAL C O   1 
ATOM   6811  C CB  . VAL C 1 179 ? -19.006 -28.681 -13.670 1.00 15.38  ? 179 VAL C CB  1 
ATOM   6812  C CG1 . VAL C 1 179 ? -19.978 -27.909 -14.570 1.00 14.44  ? 179 VAL C CG1 1 
ATOM   6813  C CG2 . VAL C 1 179 ? -17.568 -28.307 -13.954 1.00 12.92  ? 179 VAL C CG2 1 
ATOM   6814  N N   . LEU C 1 180 ? -20.904 -30.269 -11.689 1.00 19.53  ? 180 LEU C N   1 
ATOM   6815  C CA  . LEU C 1 180 ? -22.191 -30.904 -11.404 1.00 19.41  ? 180 LEU C CA  1 
ATOM   6816  C C   . LEU C 1 180 ? -22.771 -30.477 -10.060 1.00 25.78  ? 180 LEU C C   1 
ATOM   6817  O O   . LEU C 1 180 ? -23.932 -30.083 -9.974  1.00 29.75  ? 180 LEU C O   1 
ATOM   6818  C CB  . LEU C 1 180 ? -22.061 -32.410 -11.491 1.00 19.42  ? 180 LEU C CB  1 
ATOM   6819  C CG  . LEU C 1 180 ? -22.258 -32.909 -12.919 1.00 24.52  ? 180 LEU C CG  1 
ATOM   6820  C CD1 . LEU C 1 180 ? -21.799 -34.350 -13.085 1.00 25.28  ? 180 LEU C CD1 1 
ATOM   6821  C CD2 . LEU C 1 180 ? -23.684 -32.738 -13.404 1.00 23.90  ? 180 LEU C CD2 1 
ATOM   6822  N N   . LYS C 1 181 ? -21.954 -30.557 -9.023  1.00 20.78  ? 181 LYS C N   1 
ATOM   6823  C CA  . LYS C 1 181 ? -22.326 -30.105 -7.699  1.00 20.42  ? 181 LYS C CA  1 
ATOM   6824  C C   . LYS C 1 181 ? -22.976 -28.744 -7.834  1.00 29.47  ? 181 LYS C C   1 
ATOM   6825  O O   . LYS C 1 181 ? -24.122 -28.553 -7.455  1.00 30.46  ? 181 LYS C O   1 
ATOM   6826  C CB  . LYS C 1 181 ? -21.081 -29.981 -6.813  1.00 20.92  ? 181 LYS C CB  1 
ATOM   6827  C CG  . LYS C 1 181 ? -21.363 -29.646 -5.358  1.00 32.17  ? 181 LYS C CG  1 
ATOM   6828  C CD  . LYS C 1 181 ? -20.218 -30.143 -4.464  1.00 43.31  ? 181 LYS C CD  1 
ATOM   6829  C CE  . LYS C 1 181 ? -20.584 -30.030 -2.983  1.00 44.22  ? 181 LYS C CE  1 
ATOM   6830  N NZ  . LYS C 1 181 ? -20.184 -28.716 -2.417  1.00 43.90  ? 181 LYS C NZ  1 
ATOM   6831  N N   . VAL C 1 182 ? -22.248 -27.802 -8.422  1.00 28.85  ? 182 VAL C N   1 
ATOM   6832  C CA  . VAL C 1 182 ? -22.765 -26.449 -8.585  1.00 27.56  ? 182 VAL C CA  1 
ATOM   6833  C C   . VAL C 1 182 ? -24.066 -26.504 -9.356  1.00 31.49  ? 182 VAL C C   1 
ATOM   6834  O O   . VAL C 1 182 ? -25.091 -26.153 -8.809  1.00 28.52  ? 182 VAL C O   1 
ATOM   6835  C CB  . VAL C 1 182 ? -21.741 -25.537 -9.256  1.00 29.65  ? 182 VAL C CB  1 
ATOM   6836  C CG1 . VAL C 1 182 ? -22.233 -24.088 -9.237  1.00 28.65  ? 182 VAL C CG1 1 
ATOM   6837  C CG2 . VAL C 1 182 ? -20.429 -25.655 -8.514  1.00 29.47  ? 182 VAL C CG2 1 
ATOM   6838  N N   . ALA C 1 183 ? -24.006 -27.023 -10.594 1.00 32.12  ? 183 ALA C N   1 
ATOM   6839  C CA  . ALA C 1 183 ? -25.176 -27.178 -11.496 1.00 31.44  ? 183 ALA C CA  1 
ATOM   6840  C C   . ALA C 1 183 ? -26.359 -27.788 -10.798 1.00 32.77  ? 183 ALA C C   1 
ATOM   6841  O O   . ALA C 1 183 ? -27.455 -27.264 -10.871 1.00 29.82  ? 183 ALA C O   1 
ATOM   6842  C CB  . ALA C 1 183 ? -24.828 -28.033 -12.766 1.00 31.89  ? 183 ALA C CB  1 
ATOM   6843  N N   . HIS C 1 184 ? -26.139 -28.917 -10.132 1.00 32.16  ? 184 HIS C N   1 
ATOM   6844  C CA  . HIS C 1 184 ? -27.215 -29.557 -9.386  1.00 33.67  ? 184 HIS C CA  1 
ATOM   6845  C C   . HIS C 1 184 ? -27.855 -28.636 -8.327  1.00 37.10  ? 184 HIS C C   1 
ATOM   6846  O O   . HIS C 1 184 ? -29.086 -28.592 -8.182  1.00 37.46  ? 184 HIS C O   1 
ATOM   6847  C CB  . HIS C 1 184 ? -26.755 -30.865 -8.742  1.00 36.06  ? 184 HIS C CB  1 
ATOM   6848  C CG  . HIS C 1 184 ? -27.890 -31.669 -8.185  1.00 41.39  ? 184 HIS C CG  1 
ATOM   6849  N ND1 . HIS C 1 184 ? -28.560 -31.302 -7.036  1.00 43.50  ? 184 HIS C ND1 1 
ATOM   6850  C CD2 . HIS C 1 184 ? -28.579 -32.718 -8.702  1.00 44.80  ? 184 HIS C CD2 1 
ATOM   6851  C CE1 . HIS C 1 184 ? -29.574 -32.124 -6.839  1.00 43.73  ? 184 HIS C CE1 1 
ATOM   6852  N NE2 . HIS C 1 184 ? -29.612 -32.990 -7.837  1.00 44.46  ? 184 HIS C NE2 1 
ATOM   6853  N N   . HIS C 1 185 ? -27.012 -27.887 -7.626  1.00 32.80  ? 185 HIS C N   1 
ATOM   6854  C CA  . HIS C 1 185 ? -27.440 -26.931 -6.622  1.00 32.57  ? 185 HIS C CA  1 
ATOM   6855  C C   . HIS C 1 185 ? -28.313 -25.870 -7.247  1.00 31.37  ? 185 HIS C C   1 
ATOM   6856  O O   . HIS C 1 185 ? -29.324 -25.465 -6.671  1.00 30.69  ? 185 HIS C O   1 
ATOM   6857  C CB  . HIS C 1 185 ? -26.189 -26.243 -5.947  1.00 34.20  ? 185 HIS C CB  1 
ATOM   6858  C CG  . HIS C 1 185 ? -26.549 -25.149 -4.975  1.00 37.71  ? 185 HIS C CG  1 
ATOM   6859  N ND1 . HIS C 1 185 ? -26.892 -25.408 -3.666  1.00 39.19  ? 185 HIS C ND1 1 
ATOM   6860  C CD2 . HIS C 1 185 ? -26.639 -23.803 -5.130  1.00 38.55  ? 185 HIS C CD2 1 
ATOM   6861  C CE1 . HIS C 1 185 ? -27.188 -24.268 -3.061  1.00 38.60  ? 185 HIS C CE1 1 
ATOM   6862  N NE2 . HIS C 1 185 ? -27.042 -23.282 -3.927  1.00 38.41  ? 185 HIS C NE2 1 
ATOM   6863  N N   . ALA C 1 186 ? -27.882 -25.378 -8.402  1.00 26.44  ? 186 ALA C N   1 
ATOM   6864  C CA  . ALA C 1 186 ? -28.583 -24.283 -9.085  1.00 26.00  ? 186 ALA C CA  1 
ATOM   6865  C C   . ALA C 1 186 ? -30.010 -24.734 -9.315  1.00 30.15  ? 186 ALA C C   1 
ATOM   6866  O O   . ALA C 1 186 ? -30.954 -24.025 -8.934  1.00 29.30  ? 186 ALA C O   1 
ATOM   6867  C CB  . ALA C 1 186 ? -27.887 -23.943 -10.419 1.00 26.01  ? 186 ALA C CB  1 
ATOM   6868  N N   . SER C 1 187 ? -30.125 -25.971 -9.816  1.00 26.55  ? 187 SER C N   1 
ATOM   6869  C CA  . SER C 1 187 ? -31.392 -26.648 -10.084 1.00 27.54  ? 187 SER C CA  1 
ATOM   6870  C C   . SER C 1 187 ? -32.279 -26.673 -8.869  1.00 32.49  ? 187 SER C C   1 
ATOM   6871  O O   . SER C 1 187 ? -33.316 -25.988 -8.830  1.00 32.43  ? 187 SER C O   1 
ATOM   6872  C CB  . SER C 1 187 ? -31.155 -28.098 -10.532 1.00 33.06  ? 187 SER C CB  1 
ATOM   6873  O OG  . SER C 1 187 ? -32.160 -28.532 -11.456 1.00 39.75  ? 187 SER C OG  1 
ATOM   6874  N N   . GLU C 1 188 ? -31.845 -27.433 -7.867  1.00 29.87  ? 188 GLU C N   1 
ATOM   6875  C CA  . GLU C 1 188 ? -32.585 -27.569 -6.609  1.00 31.96  ? 188 GLU C CA  1 
ATOM   6876  C C   . GLU C 1 188 ? -33.077 -26.282 -5.960  1.00 38.51  ? 188 GLU C C   1 
ATOM   6877  O O   . GLU C 1 188 ? -34.100 -26.278 -5.285  1.00 39.82  ? 188 GLU C O   1 
ATOM   6878  C CB  . GLU C 1 188 ? -31.793 -28.367 -5.589  1.00 33.95  ? 188 GLU C CB  1 
ATOM   6879  C CG  . GLU C 1 188 ? -31.702 -29.855 -5.916  1.00 53.34  ? 188 GLU C CG  1 
ATOM   6880  C CD  . GLU C 1 188 ? -31.248 -30.673 -4.716  1.00 96.85  ? 188 GLU C CD  1 
ATOM   6881  O OE1 . GLU C 1 188 ? -30.271 -30.265 -4.040  1.00 96.23  ? 188 GLU C OE1 1 
ATOM   6882  O OE2 . GLU C 1 188 ? -31.883 -31.715 -4.443  1.00 100.15 ? 188 GLU C OE2 1 
ATOM   6883  N N   . ASN C 1 189 ? -32.361 -25.189 -6.176  1.00 35.95  ? 189 ASN C N   1 
ATOM   6884  C CA  . ASN C 1 189 ? -32.712 -23.913 -5.569  1.00 35.27  ? 189 ASN C CA  1 
ATOM   6885  C C   . ASN C 1 189 ? -33.229 -22.892 -6.577  1.00 39.16  ? 189 ASN C C   1 
ATOM   6886  O O   . ASN C 1 189 ? -33.465 -21.722 -6.232  1.00 36.68  ? 189 ASN C O   1 
ATOM   6887  C CB  . ASN C 1 189 ? -31.512 -23.366 -4.818  1.00 28.56  ? 189 ASN C CB  1 
ATOM   6888  C CG  . ASN C 1 189 ? -31.190 -24.183 -3.597  1.00 49.98  ? 189 ASN C CG  1 
ATOM   6889  O OD1 . ASN C 1 189 ? -31.837 -24.016 -2.553  1.00 47.44  ? 189 ASN C OD1 1 
ATOM   6890  N ND2 . ASN C 1 189 ? -30.273 -25.161 -3.746  1.00 30.54  ? 189 ASN C ND2 1 
ATOM   6891  N N   . ASN C 1 190 ? -33.392 -23.340 -7.822  1.00 36.86  ? 190 ASN C N   1 
ATOM   6892  C CA  . ASN C 1 190 ? -33.856 -22.473 -8.901  1.00 37.31  ? 190 ASN C CA  1 
ATOM   6893  C C   . ASN C 1 190 ? -32.991 -21.253 -9.170  1.00 42.95  ? 190 ASN C C   1 
ATOM   6894  O O   . ASN C 1 190 ? -33.526 -20.164 -9.371  1.00 45.04  ? 190 ASN C O   1 
ATOM   6895  C CB  . ASN C 1 190 ? -35.284 -21.982 -8.660  1.00 36.06  ? 190 ASN C CB  1 
ATOM   6896  C CG  . ASN C 1 190 ? -35.931 -21.475 -9.925  1.00 60.07  ? 190 ASN C CG  1 
ATOM   6897  O OD1 . ASN C 1 190 ? -35.982 -22.192 -10.926 1.00 63.00  ? 190 ASN C OD1 1 
ATOM   6898  N ND2 . ASN C 1 190 ? -36.321 -20.201 -9.932  1.00 43.22  ? 190 ASN C ND2 1 
ATOM   6899  N N   . ARG C 1 191 ? -31.676 -21.401 -9.152  1.00 37.54  ? 191 ARG C N   1 
ATOM   6900  C CA  . ARG C 1 191 ? -30.832 -20.265 -9.473  1.00 37.78  ? 191 ARG C CA  1 
ATOM   6901  C C   . ARG C 1 191 ? -30.508 -20.450 -10.933 1.00 40.64  ? 191 ARG C C   1 
ATOM   6902  O O   . ARG C 1 191 ? -30.740 -21.512 -11.492 1.00 43.83  ? 191 ARG C O   1 
ATOM   6903  C CB  . ARG C 1 191 ? -29.535 -20.275 -8.645  1.00 43.98  ? 191 ARG C CB  1 
ATOM   6904  C CG  . ARG C 1 191 ? -29.716 -19.745 -7.218  1.00 56.89  ? 191 ARG C CG  1 
ATOM   6905  C CD  . ARG C 1 191 ? -30.553 -20.705 -6.401  1.00 72.88  ? 191 ARG C CD  1 
ATOM   6906  N NE  . ARG C 1 191 ? -30.314 -20.591 -4.970  1.00 78.33  ? 191 ARG C NE  1 
ATOM   6907  C CZ  . ARG C 1 191 ? -30.314 -19.442 -4.317  1.00 92.27  ? 191 ARG C CZ  1 
ATOM   6908  N NH1 . ARG C 1 191 ? -30.515 -18.309 -4.974  1.00 79.15  ? 191 ARG C NH1 1 
ATOM   6909  N NH2 . ARG C 1 191 ? -30.098 -19.431 -3.012  1.00 84.08  ? 191 ARG C NH2 1 
ATOM   6910  N N   . ILE C 1 192 ? -29.940 -19.440 -11.558 1.00 34.14  ? 192 ILE C N   1 
ATOM   6911  C CA  . ILE C 1 192 ? -29.572 -19.558 -12.963 1.00 33.05  ? 192 ILE C CA  1 
ATOM   6912  C C   . ILE C 1 192 ? -28.146 -20.103 -13.118 1.00 32.78  ? 192 ILE C C   1 
ATOM   6913  O O   . ILE C 1 192 ? -27.187 -19.449 -12.678 1.00 32.20  ? 192 ILE C O   1 
ATOM   6914  C CB  . ILE C 1 192 ? -29.600 -18.180 -13.645 1.00 36.19  ? 192 ILE C CB  1 
ATOM   6915  C CG1 . ILE C 1 192 ? -31.024 -17.622 -13.678 1.00 36.29  ? 192 ILE C CG1 1 
ATOM   6916  C CG2 . ILE C 1 192 ? -28.974 -18.245 -15.034 1.00 36.92  ? 192 ILE C CG2 1 
ATOM   6917  C CD1 . ILE C 1 192 ? -31.157 -16.248 -13.003 1.00 37.88  ? 192 ILE C CD1 1 
ATOM   6918  N N   . PHE C 1 193 ? -28.029 -21.261 -13.767 1.00 25.04  ? 193 PHE C N   1 
ATOM   6919  C CA  . PHE C 1 193 ? -26.741 -21.890 -14.074 1.00 24.61  ? 193 PHE C CA  1 
ATOM   6920  C C   . PHE C 1 193 ? -26.358 -21.770 -15.570 1.00 25.88  ? 193 PHE C C   1 
ATOM   6921  O O   . PHE C 1 193 ? -27.122 -22.119 -16.492 1.00 22.87  ? 193 PHE C O   1 
ATOM   6922  C CB  . PHE C 1 193 ? -26.738 -23.350 -13.671 1.00 25.64  ? 193 PHE C CB  1 
ATOM   6923  C CG  . PHE C 1 193 ? -25.411 -24.011 -13.859 1.00 25.72  ? 193 PHE C CG  1 
ATOM   6924  C CD1 . PHE C 1 193 ? -24.433 -23.887 -12.890 1.00 27.12  ? 193 PHE C CD1 1 
ATOM   6925  C CD2 . PHE C 1 193 ? -25.158 -24.787 -14.977 1.00 25.86  ? 193 PHE C CD2 1 
ATOM   6926  C CE1 . PHE C 1 193 ? -23.262 -24.554 -13.018 1.00 28.46  ? 193 PHE C CE1 1 
ATOM   6927  C CE2 . PHE C 1 193 ? -23.971 -25.456 -15.110 1.00 28.23  ? 193 PHE C CE2 1 
ATOM   6928  C CZ  . PHE C 1 193 ? -23.010 -25.319 -14.145 1.00 26.99  ? 193 PHE C CZ  1 
ATOM   6929  N N   . THR C 1 194 ? -25.161 -21.253 -15.787 1.00 20.29  ? 194 THR C N   1 
ATOM   6930  C CA  . THR C 1 194 ? -24.707 -20.955 -17.121 1.00 18.76  ? 194 THR C CA  1 
ATOM   6931  C C   . THR C 1 194 ? -23.368 -21.657 -17.380 1.00 19.36  ? 194 THR C C   1 
ATOM   6932  O O   . THR C 1 194 ? -22.593 -21.920 -16.438 1.00 17.13  ? 194 THR C O   1 
ATOM   6933  C CB  . THR C 1 194 ? -24.619 -19.381 -17.350 1.00 20.51  ? 194 THR C CB  1 
ATOM   6934  O OG1 . THR C 1 194 ? -23.501 -18.843 -16.636 1.00 26.22  ? 194 THR C OG1 1 
ATOM   6935  C CG2 . THR C 1 194 ? -25.940 -18.640 -16.849 1.00 5.34   ? 194 THR C CG2 1 
ATOM   6936  N N   . LEU C 1 195 ? -23.126 -21.963 -18.659 1.00 13.82  ? 195 LEU C N   1 
ATOM   6937  C CA  . LEU C 1 195 ? -21.936 -22.657 -19.117 1.00 10.68  ? 195 LEU C CA  1 
ATOM   6938  C C   . LEU C 1 195 ? -21.535 -22.106 -20.466 1.00 16.16  ? 195 LEU C C   1 
ATOM   6939  O O   . LEU C 1 195 ? -22.358 -21.552 -21.195 1.00 14.81  ? 195 LEU C O   1 
ATOM   6940  C CB  . LEU C 1 195 ? -22.256 -24.145 -19.281 1.00 9.38   ? 195 LEU C CB  1 
ATOM   6941  C CG  . LEU C 1 195 ? -21.138 -25.063 -19.750 1.00 13.10  ? 195 LEU C CG  1 
ATOM   6942  C CD1 . LEU C 1 195 ? -20.276 -25.598 -18.612 1.00 12.54  ? 195 LEU C CD1 1 
ATOM   6943  C CD2 . LEU C 1 195 ? -21.780 -26.215 -20.501 1.00 19.27  ? 195 LEU C CD2 1 
ATOM   6944  N N   . ASN C 1 196 ? -20.269 -22.347 -20.818 1.00 15.11  ? 196 ASN C N   1 
ATOM   6945  C CA  . ASN C 1 196 ? -19.719 -21.978 -22.113 1.00 14.74  ? 196 ASN C CA  1 
ATOM   6946  C C   . ASN C 1 196 ? -19.217 -23.203 -22.872 1.00 18.65  ? 196 ASN C C   1 
ATOM   6947  O O   . ASN C 1 196 ? -18.737 -24.147 -22.252 1.00 18.95  ? 196 ASN C O   1 
ATOM   6948  C CB  . ASN C 1 196 ? -18.604 -20.955 -21.945 1.00 9.68   ? 196 ASN C CB  1 
ATOM   6949  C CG  . ASN C 1 196 ? -18.407 -20.113 -23.190 1.00 14.97  ? 196 ASN C CG  1 
ATOM   6950  O OD1 . ASN C 1 196 ? -18.147 -20.656 -24.270 1.00 1.19   ? 196 ASN C OD1 1 
ATOM   6951  N ND2 . ASN C 1 196 ? -18.653 -18.800 -23.079 1.00 6.22   ? 196 ASN C ND2 1 
ATOM   6952  N N   . LEU C 1 197 ? -19.361 -23.198 -24.207 1.00 14.02  ? 197 LEU C N   1 
ATOM   6953  C CA  . LEU C 1 197 ? -18.910 -24.315 -25.076 1.00 11.35  ? 197 LEU C CA  1 
ATOM   6954  C C   . LEU C 1 197 ? -17.387 -24.237 -25.188 1.00 12.79  ? 197 LEU C C   1 
ATOM   6955  O O   . LEU C 1 197 ? -16.704 -25.229 -25.461 1.00 12.88  ? 197 LEU C O   1 
ATOM   6956  C CB  . LEU C 1 197 ? -19.549 -24.263 -26.472 1.00 10.36  ? 197 LEU C CB  1 
ATOM   6957  C CG  . LEU C 1 197 ? -20.944 -24.847 -26.764 1.00 12.24  ? 197 LEU C CG  1 
ATOM   6958  C CD1 . LEU C 1 197 ? -21.147 -24.741 -28.243 1.00 12.35  ? 197 LEU C CD1 1 
ATOM   6959  C CD2 . LEU C 1 197 ? -21.197 -26.283 -26.305 1.00 7.82   ? 197 LEU C CD2 1 
ATOM   6960  N N   . SER C 1 198 ? -16.868 -23.034 -24.931 1.00 4.38   ? 198 SER C N   1 
ATOM   6961  C CA  . SER C 1 198 ? -15.443 -22.762 -24.788 1.00 2.59   ? 198 SER C CA  1 
ATOM   6962  C C   . SER C 1 198 ? -14.602 -23.001 -25.996 1.00 10.40  ? 198 SER C C   1 
ATOM   6963  O O   . SER C 1 198 ? -13.776 -22.178 -26.350 1.00 11.29  ? 198 SER C O   1 
ATOM   6964  C CB  . SER C 1 198 ? -14.805 -23.471 -23.533 1.00 4.68   ? 198 SER C CB  1 
ATOM   6965  O OG  . SER C 1 198 ? -15.335 -23.036 -22.279 1.00 10.57  ? 198 SER C OG  1 
ATOM   6966  N N   . ALA C 1 199 ? -14.625 -24.215 -26.514 1.00 9.52   ? 199 ALA C N   1 
ATOM   6967  C CA  . ALA C 1 199 ? -13.756 -24.551 -27.646 1.00 9.10   ? 199 ALA C CA  1 
ATOM   6968  C C   . ALA C 1 199 ? -14.400 -25.758 -28.352 1.00 18.82  ? 199 ALA C C   1 
ATOM   6969  O O   . ALA C 1 199 ? -15.440 -26.204 -27.930 1.00 21.34  ? 199 ALA C O   1 
ATOM   6970  C CB  . ALA C 1 199 ? -12.340 -24.863 -27.164 1.00 8.38   ? 199 ALA C CB  1 
ATOM   6971  N N   . PRO C 1 200 ? -13.906 -26.148 -29.519 1.00 16.73  ? 200 PRO C N   1 
ATOM   6972  C CA  . PRO C 1 200 ? -14.477 -27.296 -30.204 1.00 16.49  ? 200 PRO C CA  1 
ATOM   6973  C C   . PRO C 1 200 ? -14.056 -28.591 -29.489 1.00 23.45  ? 200 PRO C C   1 
ATOM   6974  O O   . PRO C 1 200 ? -14.801 -29.583 -29.468 1.00 25.66  ? 200 PRO C O   1 
ATOM   6975  C CB  . PRO C 1 200 ? -13.781 -27.255 -31.569 1.00 16.88  ? 200 PRO C CB  1 
ATOM   6976  C CG  . PRO C 1 200 ? -13.483 -25.870 -31.804 1.00 19.83  ? 200 PRO C CG  1 
ATOM   6977  C CD  . PRO C 1 200 ? -13.205 -25.252 -30.460 1.00 15.65  ? 200 PRO C CD  1 
ATOM   6978  N N   . PHE C 1 201 ? -12.833 -28.599 -28.964 1.00 16.96  ? 201 PHE C N   1 
ATOM   6979  C CA  . PHE C 1 201 ? -12.278 -29.803 -28.388 1.00 14.38  ? 201 PHE C CA  1 
ATOM   6980  C C   . PHE C 1 201 ? -13.119 -30.266 -27.222 1.00 19.46  ? 201 PHE C C   1 
ATOM   6981  O O   . PHE C 1 201 ? -13.275 -31.470 -26.991 1.00 21.40  ? 201 PHE C O   1 
ATOM   6982  C CB  . PHE C 1 201 ? -10.786 -29.633 -28.071 1.00 15.11  ? 201 PHE C CB  1 
ATOM   6983  C CG  . PHE C 1 201 ? -10.482 -28.840 -26.807 1.00 14.49  ? 201 PHE C CG  1 
ATOM   6984  C CD1 . PHE C 1 201 ? -10.683 -29.388 -25.538 1.00 15.27  ? 201 PHE C CD1 1 
ATOM   6985  C CD2 . PHE C 1 201 ? -9.857  -27.576 -26.891 1.00 12.76  ? 201 PHE C CD2 1 
ATOM   6986  C CE1 . PHE C 1 201 ? -10.387 -28.613 -24.382 1.00 15.41  ? 201 PHE C CE1 1 
ATOM   6987  C CE2 . PHE C 1 201 ? -9.468  -26.882 -25.747 1.00 12.13  ? 201 PHE C CE2 1 
ATOM   6988  C CZ  . PHE C 1 201 ? -9.744  -27.371 -24.513 1.00 10.16  ? 201 PHE C CZ  1 
ATOM   6989  N N   . ILE C 1 202 ? -13.785 -29.324 -26.568 1.00 13.49  ? 202 ILE C N   1 
ATOM   6990  C CA  . ILE C 1 202 ? -14.658 -29.717 -25.470 1.00 11.14  ? 202 ILE C CA  1 
ATOM   6991  C C   . ILE C 1 202 ? -15.771 -30.642 -26.020 1.00 20.64  ? 202 ILE C C   1 
ATOM   6992  O O   . ILE C 1 202 ? -16.001 -31.737 -25.489 1.00 21.71  ? 202 ILE C O   1 
ATOM   6993  C CB  . ILE C 1 202 ? -15.198 -28.484 -24.716 1.00 11.09  ? 202 ILE C CB  1 
ATOM   6994  C CG1 . ILE C 1 202 ? -14.074 -27.858 -23.926 1.00 10.82  ? 202 ILE C CG1 1 
ATOM   6995  C CG2 . ILE C 1 202 ? -16.352 -28.832 -23.780 1.00 8.65   ? 202 ILE C CG2 1 
ATOM   6996  C CD1 . ILE C 1 202 ? -13.745 -28.618 -22.641 1.00 13.96  ? 202 ILE C CD1 1 
ATOM   6997  N N   . SER C 1 203 ? -16.397 -30.239 -27.127 1.00 18.78  ? 203 SER C N   1 
ATOM   6998  C CA  . SER C 1 203 ? -17.474 -31.033 -27.746 1.00 19.80  ? 203 SER C CA  1 
ATOM   6999  C C   . SER C 1 203 ? -16.994 -32.303 -28.460 1.00 26.09  ? 203 SER C C   1 
ATOM   7000  O O   . SER C 1 203 ? -17.785 -33.201 -28.770 1.00 28.87  ? 203 SER C O   1 
ATOM   7001  C CB  . SER C 1 203 ? -18.324 -30.187 -28.702 1.00 21.14  ? 203 SER C CB  1 
ATOM   7002  O OG  . SER C 1 203 ? -19.111 -29.278 -27.955 1.00 19.84  ? 203 SER C OG  1 
ATOM   7003  N N   . GLN C 1 204 ? -15.704 -32.396 -28.737 1.00 19.02  ? 204 GLN C N   1 
ATOM   7004  C CA  . GLN C 1 204 ? -15.226 -33.584 -29.428 1.00 17.88  ? 204 GLN C CA  1 
ATOM   7005  C C   . GLN C 1 204 ? -14.714 -34.647 -28.466 1.00 21.35  ? 204 GLN C C   1 
ATOM   7006  O O   . GLN C 1 204 ? -14.954 -35.820 -28.652 1.00 21.54  ? 204 GLN C O   1 
ATOM   7007  C CB  . GLN C 1 204 ? -14.125 -33.223 -30.419 1.00 18.24  ? 204 GLN C CB  1 
ATOM   7008  C CG  . GLN C 1 204 ? -14.474 -32.067 -31.326 1.00 26.99  ? 204 GLN C CG  1 
ATOM   7009  C CD  . GLN C 1 204 ? -13.314 -31.714 -32.239 1.00 54.27  ? 204 GLN C CD  1 
ATOM   7010  O OE1 . GLN C 1 204 ? -12.475 -30.862 -31.910 1.00 58.33  ? 204 GLN C OE1 1 
ATOM   7011  N NE2 . GLN C 1 204 ? -13.199 -32.438 -33.339 1.00 31.01  ? 204 GLN C NE2 1 
ATOM   7012  N N   . PHE C 1 205 ? -14.027 -34.220 -27.422 1.00 16.73  ? 205 PHE C N   1 
ATOM   7013  C CA  . PHE C 1 205 ? -13.426 -35.144 -26.487 1.00 14.10  ? 205 PHE C CA  1 
ATOM   7014  C C   . PHE C 1 205 ? -14.047 -35.120 -25.095 1.00 18.94  ? 205 PHE C C   1 
ATOM   7015  O O   . PHE C 1 205 ? -13.808 -36.034 -24.336 1.00 21.28  ? 205 PHE C O   1 
ATOM   7016  C CB  . PHE C 1 205 ? -11.920 -34.855 -26.432 1.00 14.21  ? 205 PHE C CB  1 
ATOM   7017  C CG  . PHE C 1 205 ? -11.315 -34.622 -27.792 1.00 13.47  ? 205 PHE C CG  1 
ATOM   7018  C CD1 . PHE C 1 205 ? -11.634 -35.466 -28.865 1.00 13.60  ? 205 PHE C CD1 1 
ATOM   7019  C CD2 . PHE C 1 205 ? -10.416 -33.584 -28.006 1.00 12.35  ? 205 PHE C CD2 1 
ATOM   7020  C CE1 . PHE C 1 205 ? -11.112 -35.225 -30.149 1.00 11.81  ? 205 PHE C CE1 1 
ATOM   7021  C CE2 . PHE C 1 205 ? -9.858  -33.372 -29.291 1.00 13.39  ? 205 PHE C CE2 1 
ATOM   7022  C CZ  . PHE C 1 205 ? -10.228 -34.172 -30.358 1.00 8.79   ? 205 PHE C CZ  1 
ATOM   7023  N N   . TYR C 1 206 ? -14.855 -34.113 -24.761 1.00 12.92  ? 206 TYR C N   1 
ATOM   7024  C CA  . TYR C 1 206 ? -15.473 -34.053 -23.430 1.00 12.16  ? 206 TYR C CA  1 
ATOM   7025  C C   . TYR C 1 206 ? -16.999 -34.030 -23.494 1.00 14.50  ? 206 TYR C C   1 
ATOM   7026  O O   . TYR C 1 206 ? -17.701 -33.485 -22.602 1.00 13.10  ? 206 TYR C O   1 
ATOM   7027  C CB  . TYR C 1 206 ? -14.934 -32.847 -22.597 1.00 13.62  ? 206 TYR C CB  1 
ATOM   7028  C CG  . TYR C 1 206 ? -13.422 -32.867 -22.431 1.00 12.43  ? 206 TYR C CG  1 
ATOM   7029  C CD1 . TYR C 1 206 ? -12.590 -32.534 -23.495 1.00 14.89  ? 206 TYR C CD1 1 
ATOM   7030  C CD2 . TYR C 1 206 ? -12.826 -33.393 -21.260 1.00 10.67  ? 206 TYR C CD2 1 
ATOM   7031  C CE1 . TYR C 1 206 ? -11.207 -32.693 -23.416 1.00 16.03  ? 206 TYR C CE1 1 
ATOM   7032  C CE2 . TYR C 1 206 ? -11.455 -33.515 -21.149 1.00 10.31  ? 206 TYR C CE2 1 
ATOM   7033  C CZ  . TYR C 1 206 ? -10.649 -33.219 -22.249 1.00 21.28  ? 206 TYR C CZ  1 
ATOM   7034  O OH  . TYR C 1 206 ? -9.274  -33.340 -22.174 1.00 18.69  ? 206 TYR C OH  1 
ATOM   7035  N N   . LYS C 1 207 ? -17.542 -34.622 -24.547 1.00 12.83  ? 207 LYS C N   1 
ATOM   7036  C CA  . LYS C 1 207 ? -19.004 -34.619 -24.692 1.00 13.41  ? 207 LYS C CA  1 
ATOM   7037  C C   . LYS C 1 207 ? -19.712 -35.443 -23.601 1.00 22.87  ? 207 LYS C C   1 
ATOM   7038  O O   . LYS C 1 207 ? -20.861 -35.166 -23.213 1.00 26.77  ? 207 LYS C O   1 
ATOM   7039  C CB  . LYS C 1 207 ? -19.433 -34.988 -26.109 1.00 14.73  ? 207 LYS C CB  1 
ATOM   7040  C CG  . LYS C 1 207 ? -18.659 -36.139 -26.743 1.00 28.36  ? 207 LYS C CG  1 
ATOM   7041  C CD  . LYS C 1 207 ? -19.390 -36.617 -27.983 1.00 42.59  ? 207 LYS C CD  1 
ATOM   7042  C CE  . LYS C 1 207 ? -18.481 -36.838 -29.171 1.00 51.75  ? 207 LYS C CE  1 
ATOM   7043  N NZ  . LYS C 1 207 ? -19.268 -36.823 -30.451 1.00 62.91  ? 207 LYS C NZ  1 
ATOM   7044  N N   . GLU C 1 208 ? -19.010 -36.417 -23.045 1.00 19.55  ? 208 GLU C N   1 
ATOM   7045  C CA  . GLU C 1 208 ? -19.586 -37.176 -21.946 1.00 19.94  ? 208 GLU C CA  1 
ATOM   7046  C C   . GLU C 1 208 ? -19.935 -36.261 -20.756 1.00 21.40  ? 208 GLU C C   1 
ATOM   7047  O O   . GLU C 1 208 ? -21.105 -36.158 -20.388 1.00 24.33  ? 208 GLU C O   1 
ATOM   7048  C CB  . GLU C 1 208 ? -18.689 -38.356 -21.543 1.00 21.63  ? 208 GLU C CB  1 
ATOM   7049  C CG  . GLU C 1 208 ? -19.395 -39.324 -20.604 1.00 42.86  ? 208 GLU C CG  1 
ATOM   7050  C CD  . GLU C 1 208 ? -18.473 -40.389 -20.038 1.00 68.80  ? 208 GLU C CD  1 
ATOM   7051  O OE1 . GLU C 1 208 ? -17.658 -40.944 -20.806 1.00 72.63  ? 208 GLU C OE1 1 
ATOM   7052  O OE2 . GLU C 1 208 ? -18.590 -40.694 -18.830 1.00 51.46  ? 208 GLU C OE2 1 
ATOM   7053  N N   . SER C 1 209 ? -18.950 -35.513 -20.256 1.00 14.85  ? 209 SER C N   1 
ATOM   7054  C CA  . SER C 1 209 ? -19.136 -34.570 -19.144 1.00 13.53  ? 209 SER C CA  1 
ATOM   7055  C C   . SER C 1 209 ? -19.973 -33.363 -19.510 1.00 17.52  ? 209 SER C C   1 
ATOM   7056  O O   . SER C 1 209 ? -20.727 -32.901 -18.685 1.00 14.78  ? 209 SER C O   1 
ATOM   7057  C CB  . SER C 1 209 ? -17.827 -34.101 -18.479 1.00 13.43  ? 209 SER C CB  1 
ATOM   7058  O OG  . SER C 1 209 ? -16.664 -34.894 -18.743 1.00 16.16  ? 209 SER C OG  1 
ATOM   7059  N N   . LEU C 1 210 ? -19.867 -32.880 -20.754 1.00 16.55  ? 210 LEU C N   1 
ATOM   7060  C CA  . LEU C 1 210 ? -20.640 -31.706 -21.201 1.00 16.06  ? 210 LEU C CA  1 
ATOM   7061  C C   . LEU C 1 210 ? -22.120 -32.054 -21.288 1.00 18.51  ? 210 LEU C C   1 
ATOM   7062  O O   . LEU C 1 210 ? -23.025 -31.242 -20.967 1.00 17.24  ? 210 LEU C O   1 
ATOM   7063  C CB  . LEU C 1 210 ? -20.155 -31.248 -22.593 1.00 16.04  ? 210 LEU C CB  1 
ATOM   7064  C CG  . LEU C 1 210 ? -21.098 -30.243 -23.290 1.00 17.62  ? 210 LEU C CG  1 
ATOM   7065  C CD1 . LEU C 1 210 ? -20.901 -28.863 -22.671 1.00 16.01  ? 210 LEU C CD1 1 
ATOM   7066  C CD2 . LEU C 1 210 ? -20.787 -30.194 -24.752 1.00 15.28  ? 210 LEU C CD2 1 
ATOM   7067  N N   . MET C 1 211 ? -22.354 -33.263 -21.760 1.00 16.05  ? 211 MET C N   1 
ATOM   7068  C CA  . MET C 1 211 ? -23.711 -33.733 -21.930 1.00 18.82  ? 211 MET C CA  1 
ATOM   7069  C C   . MET C 1 211 ? -24.372 -34.094 -20.600 1.00 25.29  ? 211 MET C C   1 
ATOM   7070  O O   . MET C 1 211 ? -25.553 -33.848 -20.393 1.00 25.90  ? 211 MET C O   1 
ATOM   7071  C CB  . MET C 1 211 ? -23.720 -34.850 -22.960 1.00 21.14  ? 211 MET C CB  1 
ATOM   7072  C CG  . MET C 1 211 ? -23.492 -34.275 -24.370 1.00 24.83  ? 211 MET C CG  1 
ATOM   7073  S SD  . MET C 1 211 ? -24.494 -32.748 -24.584 1.00 29.56  ? 211 MET C SD  1 
ATOM   7074  C CE  . MET C 1 211 ? -26.172 -33.375 -24.573 1.00 25.41  ? 211 MET C CE  1 
ATOM   7075  N N   . LYS C 1 212 ? -23.546 -34.532 -19.663 1.00 24.39  ? 212 LYS C N   1 
ATOM   7076  C CA  . LYS C 1 212 ? -23.986 -34.883 -18.325 1.00 24.29  ? 212 LYS C CA  1 
ATOM   7077  C C   . LYS C 1 212 ? -24.381 -33.629 -17.615 1.00 24.11  ? 212 LYS C C   1 
ATOM   7078  O O   . LYS C 1 212 ? -25.291 -33.633 -16.812 1.00 22.78  ? 212 LYS C O   1 
ATOM   7079  C CB  . LYS C 1 212 ? -22.865 -35.588 -17.542 1.00 26.79  ? 212 LYS C CB  1 
ATOM   7080  C CG  . LYS C 1 212 ? -23.352 -36.186 -16.222 1.00 40.15  ? 212 LYS C CG  1 
ATOM   7081  C CD  . LYS C 1 212 ? -22.328 -37.127 -15.584 1.00 48.61  ? 212 LYS C CD  1 
ATOM   7082  C CE  . LYS C 1 212 ? -21.873 -38.242 -16.528 1.00 55.86  ? 212 LYS C CE  1 
ATOM   7083  N NZ  . LYS C 1 212 ? -20.627 -37.944 -17.292 1.00 57.72  ? 212 LYS C NZ  1 
ATOM   7084  N N   . VAL C 1 213 ? -23.705 -32.538 -17.958 1.00 21.06  ? 213 VAL C N   1 
ATOM   7085  C CA  . VAL C 1 213 ? -23.963 -31.206 -17.368 1.00 20.56  ? 213 VAL C CA  1 
ATOM   7086  C C   . VAL C 1 213 ? -25.062 -30.413 -18.098 1.00 25.54  ? 213 VAL C C   1 
ATOM   7087  O O   . VAL C 1 213 ? -25.749 -29.595 -17.491 1.00 24.45  ? 213 VAL C O   1 
ATOM   7088  C CB  . VAL C 1 213 ? -22.677 -30.326 -17.300 1.00 23.31  ? 213 VAL C CB  1 
ATOM   7089  C CG1 . VAL C 1 213 ? -23.015 -28.925 -16.785 1.00 23.00  ? 213 VAL C CG1 1 
ATOM   7090  C CG2 . VAL C 1 213 ? -21.607 -30.961 -16.394 1.00 22.75  ? 213 VAL C CG2 1 
ATOM   7091  N N   . MET C 1 214 ? -25.207 -30.631 -19.404 1.00 23.42  ? 214 MET C N   1 
ATOM   7092  C CA  . MET C 1 214 ? -26.223 -29.911 -20.181 1.00 23.97  ? 214 MET C CA  1 
ATOM   7093  C C   . MET C 1 214 ? -27.676 -29.810 -19.664 1.00 30.66  ? 214 MET C C   1 
ATOM   7094  O O   . MET C 1 214 ? -28.322 -28.782 -19.875 1.00 31.20  ? 214 MET C O   1 
ATOM   7095  C CB  . MET C 1 214 ? -26.206 -30.299 -21.673 1.00 25.74  ? 214 MET C CB  1 
ATOM   7096  C CG  . MET C 1 214 ? -26.987 -29.331 -22.567 1.00 28.00  ? 214 MET C CG  1 
ATOM   7097  S SD  . MET C 1 214 ? -26.113 -27.747 -22.767 1.00 32.21  ? 214 MET C SD  1 
ATOM   7098  C CE  . MET C 1 214 ? -25.057 -28.064 -24.164 1.00 28.44  ? 214 MET C CE  1 
ATOM   7099  N N   . PRO C 1 215 ? -28.237 -30.861 -19.066 1.00 27.35  ? 215 PRO C N   1 
ATOM   7100  C CA  . PRO C 1 215 ? -29.647 -30.765 -18.645 1.00 26.28  ? 215 PRO C CA  1 
ATOM   7101  C C   . PRO C 1 215 ? -29.819 -29.708 -17.545 1.00 31.31  ? 215 PRO C C   1 
ATOM   7102  O O   . PRO C 1 215 ? -30.941 -29.260 -17.264 1.00 30.66  ? 215 PRO C O   1 
ATOM   7103  C CB  . PRO C 1 215 ? -29.964 -32.170 -18.136 1.00 27.40  ? 215 PRO C CB  1 
ATOM   7104  C CG  . PRO C 1 215 ? -29.058 -33.039 -18.916 1.00 32.12  ? 215 PRO C CG  1 
ATOM   7105  C CD  . PRO C 1 215 ? -27.758 -32.251 -19.011 1.00 27.64  ? 215 PRO C CD  1 
ATOM   7106  N N   . TYR C 1 216 ? -28.691 -29.278 -16.965 1.00 28.14  ? 216 TYR C N   1 
ATOM   7107  C CA  . TYR C 1 216 ? -28.674 -28.288 -15.893 1.00 27.04  ? 216 TYR C CA  1 
ATOM   7108  C C   . TYR C 1 216 ? -28.360 -26.877 -16.341 1.00 29.49  ? 216 TYR C C   1 
ATOM   7109  O O   . TYR C 1 216 ? -28.430 -25.932 -15.571 1.00 32.06  ? 216 TYR C O   1 
ATOM   7110  C CB  . TYR C 1 216 ? -27.672 -28.706 -14.836 1.00 28.94  ? 216 TYR C CB  1 
ATOM   7111  C CG  . TYR C 1 216 ? -28.089 -29.947 -14.091 1.00 31.54  ? 216 TYR C CG  1 
ATOM   7112  C CD1 . TYR C 1 216 ? -27.424 -31.145 -14.295 1.00 34.06  ? 216 TYR C CD1 1 
ATOM   7113  C CD2 . TYR C 1 216 ? -29.118 -29.910 -13.156 1.00 32.61  ? 216 TYR C CD2 1 
ATOM   7114  C CE1 . TYR C 1 216 ? -27.808 -32.295 -13.639 1.00 37.21  ? 216 TYR C CE1 1 
ATOM   7115  C CE2 . TYR C 1 216 ? -29.492 -31.041 -12.474 1.00 34.58  ? 216 TYR C CE2 1 
ATOM   7116  C CZ  . TYR C 1 216 ? -28.856 -32.241 -12.732 1.00 46.28  ? 216 TYR C CZ  1 
ATOM   7117  O OH  . TYR C 1 216 ? -29.269 -33.371 -12.057 1.00 50.31  ? 216 TYR C OH  1 
ATOM   7118  N N   . VAL C 1 217 ? -28.044 -26.732 -17.609 1.00 24.27  ? 217 VAL C N   1 
ATOM   7119  C CA  . VAL C 1 217 ? -27.657 -25.449 -18.180 1.00 21.35  ? 217 VAL C CA  1 
ATOM   7120  C C   . VAL C 1 217 ? -28.866 -24.560 -18.551 1.00 29.11  ? 217 VAL C C   1 
ATOM   7121  O O   . VAL C 1 217 ? -29.561 -24.796 -19.541 1.00 30.75  ? 217 VAL C O   1 
ATOM   7122  C CB  . VAL C 1 217 ? -26.744 -25.680 -19.403 1.00 20.63  ? 217 VAL C CB  1 
ATOM   7123  C CG1 . VAL C 1 217 ? -26.561 -24.391 -20.167 1.00 19.98  ? 217 VAL C CG1 1 
ATOM   7124  C CG2 . VAL C 1 217 ? -25.396 -26.301 -18.960 1.00 18.63  ? 217 VAL C CG2 1 
ATOM   7125  N N   . ASP C 1 218 ? -29.127 -23.542 -17.741 1.00 24.78  ? 218 ASP C N   1 
ATOM   7126  C CA  . ASP C 1 218 ? -30.241 -22.640 -18.016 1.00 24.21  ? 218 ASP C CA  1 
ATOM   7127  C C   . ASP C 1 218 ? -29.907 -21.702 -19.167 1.00 28.07  ? 218 ASP C C   1 
ATOM   7128  O O   . ASP C 1 218 ? -30.797 -21.240 -19.870 1.00 27.86  ? 218 ASP C O   1 
ATOM   7129  C CB  . ASP C 1 218 ? -30.609 -21.797 -16.774 1.00 25.71  ? 218 ASP C CB  1 
ATOM   7130  C CG  . ASP C 1 218 ? -30.982 -22.645 -15.564 1.00 32.30  ? 218 ASP C CG  1 
ATOM   7131  O OD1 . ASP C 1 218 ? -31.977 -23.386 -15.602 1.00 33.71  ? 218 ASP C OD1 1 
ATOM   7132  O OD2 . ASP C 1 218 ? -30.335 -22.487 -14.518 1.00 40.09  ? 218 ASP C OD2 1 
ATOM   7133  N N   . ILE C 1 219 ? -28.626 -21.363 -19.311 1.00 23.11  ? 219 ILE C N   1 
ATOM   7134  C CA  . ILE C 1 219 ? -28.184 -20.491 -20.407 1.00 20.20  ? 219 ILE C CA  1 
ATOM   7135  C C   . ILE C 1 219 ? -26.868 -21.025 -20.904 1.00 22.04  ? 219 ILE C C   1 
ATOM   7136  O O   . ILE C 1 219 ? -25.902 -21.070 -20.144 1.00 22.61  ? 219 ILE C O   1 
ATOM   7137  C CB  . ILE C 1 219 ? -27.911 -19.059 -19.926 1.00 22.59  ? 219 ILE C CB  1 
ATOM   7138  C CG1 . ILE C 1 219 ? -29.067 -18.532 -19.050 1.00 23.08  ? 219 ILE C CG1 1 
ATOM   7139  C CG2 . ILE C 1 219 ? -27.530 -18.140 -21.093 1.00 19.94  ? 219 ILE C CG2 1 
ATOM   7140  C CD1 . ILE C 1 219 ? -29.134 -16.995 -19.003 1.00 17.89  ? 219 ILE C CD1 1 
ATOM   7141  N N   . LEU C 1 220 ? -26.812 -21.345 -22.196 1.00 14.83  ? 220 LEU C N   1 
ATOM   7142  C CA  . LEU C 1 220 ? -25.612 -21.864 -22.822 1.00 11.86  ? 220 LEU C CA  1 
ATOM   7143  C C   . LEU C 1 220 ? -25.000 -20.853 -23.828 1.00 14.84  ? 220 LEU C C   1 
ATOM   7144  O O   . LEU C 1 220 ? -25.694 -20.296 -24.672 1.00 14.82  ? 220 LEU C O   1 
ATOM   7145  C CB  . LEU C 1 220 ? -25.869 -23.274 -23.420 1.00 9.83   ? 220 LEU C CB  1 
ATOM   7146  C CG  . LEU C 1 220 ? -24.670 -24.014 -24.062 1.00 12.68  ? 220 LEU C CG  1 
ATOM   7147  C CD1 . LEU C 1 220 ? -23.696 -24.720 -23.090 1.00 12.29  ? 220 LEU C CD1 1 
ATOM   7148  C CD2 . LEU C 1 220 ? -24.974 -24.890 -25.315 1.00 9.16   ? 220 LEU C CD2 1 
ATOM   7149  N N   . PHE C 1 221 ? -23.706 -20.574 -23.687 1.00 8.36   ? 221 PHE C N   1 
ATOM   7150  C CA  . PHE C 1 221 ? -23.033 -19.642 -24.562 1.00 7.31   ? 221 PHE C CA  1 
ATOM   7151  C C   . PHE C 1 221 ? -22.015 -20.422 -25.412 1.00 13.61  ? 221 PHE C C   1 
ATOM   7152  O O   . PHE C 1 221 ? -21.642 -21.558 -25.080 1.00 11.25  ? 221 PHE C O   1 
ATOM   7153  C CB  . PHE C 1 221 ? -22.216 -18.693 -23.725 1.00 10.49  ? 221 PHE C CB  1 
ATOM   7154  C CG  . PHE C 1 221 ? -22.976 -17.937 -22.677 1.00 12.99  ? 221 PHE C CG  1 
ATOM   7155  C CD1 . PHE C 1 221 ? -22.791 -18.250 -21.343 1.00 14.31  ? 221 PHE C CD1 1 
ATOM   7156  C CD2 . PHE C 1 221 ? -23.642 -16.739 -23.002 1.00 17.10  ? 221 PHE C CD2 1 
ATOM   7157  C CE1 . PHE C 1 221 ? -23.317 -17.440 -20.341 1.00 16.38  ? 221 PHE C CE1 1 
ATOM   7158  C CE2 . PHE C 1 221 ? -24.127 -15.890 -21.988 1.00 20.40  ? 221 PHE C CE2 1 
ATOM   7159  C CZ  . PHE C 1 221 ? -23.974 -16.254 -20.666 1.00 17.79  ? 221 PHE C CZ  1 
ATOM   7160  N N   . GLY C 1 222 ? -21.488 -19.766 -26.446 1.00 12.32  ? 222 GLY C N   1 
ATOM   7161  C CA  . GLY C 1 222 ? -20.452 -20.365 -27.297 1.00 12.49  ? 222 GLY C CA  1 
ATOM   7162  C C   . GLY C 1 222 ? -20.429 -19.575 -28.583 1.00 18.64  ? 222 GLY C C   1 
ATOM   7163  O O   . GLY C 1 222 ? -21.248 -18.671 -28.752 1.00 20.15  ? 222 GLY C O   1 
ATOM   7164  N N   . ASN C 1 223 ? -19.476 -19.862 -29.465 1.00 14.01  ? 223 ASN C N   1 
ATOM   7165  C CA  . ASN C 1 223 ? -19.361 -19.109 -30.717 1.00 13.40  ? 223 ASN C CA  1 
ATOM   7166  C C   . ASN C 1 223 ? -19.763 -19.985 -31.890 1.00 19.94  ? 223 ASN C C   1 
ATOM   7167  O O   . ASN C 1 223 ? -20.136 -21.120 -31.675 1.00 19.34  ? 223 ASN C O   1 
ATOM   7168  C CB  . ASN C 1 223 ? -17.973 -18.474 -30.874 1.00 4.49   ? 223 ASN C CB  1 
ATOM   7169  C CG  . ASN C 1 223 ? -16.883 -19.478 -31.191 1.00 39.31  ? 223 ASN C CG  1 
ATOM   7170  O OD1 . ASN C 1 223 ? -15.727 -19.111 -31.202 1.00 19.14  ? 223 ASN C OD1 1 
ATOM   7171  N ND2 . ASN C 1 223 ? -17.237 -20.746 -31.435 1.00 46.91  ? 223 ASN C ND2 1 
ATOM   7172  N N   . GLU C 1 224 ? -19.675 -19.496 -33.125 1.00 19.77  ? 224 GLU C N   1 
ATOM   7173  C CA  . GLU C 1 224 ? -20.149 -20.299 -34.251 1.00 21.47  ? 224 GLU C CA  1 
ATOM   7174  C C   . GLU C 1 224 ? -19.374 -21.604 -34.465 1.00 29.67  ? 224 GLU C C   1 
ATOM   7175  O O   . GLU C 1 224 ? -19.955 -22.657 -34.771 1.00 31.26  ? 224 GLU C O   1 
ATOM   7176  C CB  . GLU C 1 224 ? -20.274 -19.509 -35.576 1.00 23.36  ? 224 GLU C CB  1 
ATOM   7177  C CG  . GLU C 1 224 ? -19.575 -18.197 -35.690 1.00 42.81  ? 224 GLU C CG  1 
ATOM   7178  C CD  . GLU C 1 224 ? -18.073 -18.330 -35.671 1.00 91.24  ? 224 GLU C CD  1 
ATOM   7179  O OE1 . GLU C 1 224 ? -17.531 -18.952 -36.619 1.00 94.20  ? 224 GLU C OE1 1 
ATOM   7180  O OE2 . GLU C 1 224 ? -17.452 -17.856 -34.683 1.00 93.36  ? 224 GLU C OE2 1 
ATOM   7181  N N   . THR C 1 225 ? -18.053 -21.532 -34.388 1.00 25.79  ? 225 THR C N   1 
ATOM   7182  C CA  . THR C 1 225 ? -17.265 -22.730 -34.597 1.00 24.94  ? 225 THR C CA  1 
ATOM   7183  C C   . THR C 1 225 ? -17.524 -23.764 -33.503 1.00 24.65  ? 225 THR C C   1 
ATOM   7184  O O   . THR C 1 225 ? -17.515 -24.972 -33.783 1.00 24.33  ? 225 THR C O   1 
ATOM   7185  C CB  . THR C 1 225 ? -15.741 -22.448 -34.814 1.00 36.74  ? 225 THR C CB  1 
ATOM   7186  O OG1 . THR C 1 225 ? -15.137 -22.003 -33.596 1.00 40.62  ? 225 THR C OG1 1 
ATOM   7187  C CG2 . THR C 1 225 ? -15.572 -21.380 -35.886 1.00 34.90  ? 225 THR C CG2 1 
ATOM   7188  N N   . GLU C 1 226 ? -17.810 -23.286 -32.283 1.00 15.33  ? 226 GLU C N   1 
ATOM   7189  C CA  . GLU C 1 226 ? -18.133 -24.155 -31.167 1.00 13.27  ? 226 GLU C CA  1 
ATOM   7190  C C   . GLU C 1 226 ? -19.547 -24.743 -31.291 1.00 17.73  ? 226 GLU C C   1 
ATOM   7191  O O   . GLU C 1 226 ? -19.782 -25.906 -30.945 1.00 19.13  ? 226 GLU C O   1 
ATOM   7192  C CB  . GLU C 1 226 ? -17.990 -23.392 -29.857 1.00 14.46  ? 226 GLU C CB  1 
ATOM   7193  C CG  . GLU C 1 226 ? -16.558 -23.244 -29.360 1.00 16.23  ? 226 GLU C CG  1 
ATOM   7194  C CD  . GLU C 1 226 ? -16.298 -21.883 -28.819 1.00 28.93  ? 226 GLU C CD  1 
ATOM   7195  O OE1 . GLU C 1 226 ? -15.149 -21.414 -28.914 1.00 21.96  ? 226 GLU C OE1 1 
ATOM   7196  O OE2 . GLU C 1 226 ? -17.267 -21.233 -28.370 1.00 24.28  ? 226 GLU C OE2 1 
ATOM   7197  N N   . ALA C 1 227 ? -20.467 -23.944 -31.841 1.00 13.86  ? 227 ALA C N   1 
ATOM   7198  C CA  . ALA C 1 227 ? -21.848 -24.337 -32.113 1.00 12.95  ? 227 ALA C CA  1 
ATOM   7199  C C   . ALA C 1 227 ? -21.907 -25.366 -33.276 1.00 21.27  ? 227 ALA C C   1 
ATOM   7200  O O   . ALA C 1 227 ? -22.735 -26.270 -33.292 1.00 22.10  ? 227 ALA C O   1 
ATOM   7201  C CB  . ALA C 1 227 ? -22.648 -23.095 -32.485 1.00 12.60  ? 227 ALA C CB  1 
ATOM   7202  N N   . ALA C 1 228 ? -21.060 -25.196 -34.285 1.00 17.91  ? 228 ALA C N   1 
ATOM   7203  C CA  . ALA C 1 228 ? -21.095 -26.105 -35.400 1.00 18.64  ? 228 ALA C CA  1 
ATOM   7204  C C   . ALA C 1 228 ? -20.523 -27.429 -34.985 1.00 25.44  ? 228 ALA C C   1 
ATOM   7205  O O   . ALA C 1 228 ? -21.027 -28.468 -35.404 1.00 27.40  ? 228 ALA C O   1 
ATOM   7206  C CB  . ALA C 1 228 ? -20.330 -25.554 -36.570 1.00 19.57  ? 228 ALA C CB  1 
ATOM   7207  N N   . THR C 1 229 ? -19.434 -27.392 -34.216 1.00 20.93  ? 229 THR C N   1 
ATOM   7208  C CA  . THR C 1 229 ? -18.772 -28.612 -33.759 1.00 19.29  ? 229 THR C CA  1 
ATOM   7209  C C   . THR C 1 229 ? -19.731 -29.317 -32.824 1.00 21.70  ? 229 THR C C   1 
ATOM   7210  O O   . THR C 1 229 ? -19.911 -30.540 -32.897 1.00 21.84  ? 229 THR C O   1 
ATOM   7211  C CB  . THR C 1 229 ? -17.478 -28.285 -33.014 1.00 22.55  ? 229 THR C CB  1 
ATOM   7212  O OG1 . THR C 1 229 ? -16.616 -27.539 -33.880 1.00 14.72  ? 229 THR C OG1 1 
ATOM   7213  C CG2 . THR C 1 229 ? -16.764 -29.582 -32.515 1.00 14.57  ? 229 THR C CG2 1 
ATOM   7214  N N   . PHE C 1 230 ? -20.410 -28.535 -31.991 1.00 16.44  ? 230 PHE C N   1 
ATOM   7215  C CA  . PHE C 1 230 ? -21.423 -29.141 -31.111 1.00 16.93  ? 230 PHE C CA  1 
ATOM   7216  C C   . PHE C 1 230 ? -22.530 -29.881 -31.904 1.00 22.94  ? 230 PHE C C   1 
ATOM   7217  O O   . PHE C 1 230 ? -22.880 -31.032 -31.582 1.00 23.21  ? 230 PHE C O   1 
ATOM   7218  C CB  . PHE C 1 230 ? -22.053 -28.100 -30.185 1.00 18.00  ? 230 PHE C CB  1 
ATOM   7219  C CG  . PHE C 1 230 ? -22.996 -28.691 -29.161 1.00 19.12  ? 230 PHE C CG  1 
ATOM   7220  C CD1 . PHE C 1 230 ? -22.504 -29.433 -28.082 1.00 21.39  ? 230 PHE C CD1 1 
ATOM   7221  C CD2 . PHE C 1 230 ? -24.369 -28.469 -29.249 1.00 18.29  ? 230 PHE C CD2 1 
ATOM   7222  C CE1 . PHE C 1 230 ? -23.351 -29.919 -27.134 1.00 20.83  ? 230 PHE C CE1 1 
ATOM   7223  C CE2 . PHE C 1 230 ? -25.211 -28.976 -28.319 1.00 20.45  ? 230 PHE C CE2 1 
ATOM   7224  C CZ  . PHE C 1 230 ? -24.707 -29.700 -27.257 1.00 19.40  ? 230 PHE C CZ  1 
ATOM   7225  N N   . ALA C 1 231 ? -23.082 -29.218 -32.927 1.00 18.21  ? 231 ALA C N   1 
ATOM   7226  C CA  . ALA C 1 231 ? -24.163 -29.805 -33.702 1.00 17.47  ? 231 ALA C CA  1 
ATOM   7227  C C   . ALA C 1 231 ? -23.743 -31.154 -34.353 1.00 24.98  ? 231 ALA C C   1 
ATOM   7228  O O   . ALA C 1 231 ? -24.534 -32.115 -34.367 1.00 24.66  ? 231 ALA C O   1 
ATOM   7229  C CB  . ALA C 1 231 ? -24.670 -28.819 -34.729 1.00 17.17  ? 231 ALA C CB  1 
ATOM   7230  N N   . ARG C 1 232 ? -22.484 -31.246 -34.793 1.00 21.53  ? 232 ARG C N   1 
ATOM   7231  C CA  . ARG C 1 232 ? -21.982 -32.437 -35.478 1.00 21.46  ? 232 ARG C CA  1 
ATOM   7232  C C   . ARG C 1 232 ? -21.814 -33.567 -34.473 1.00 28.19  ? 232 ARG C C   1 
ATOM   7233  O O   . ARG C 1 232 ? -22.434 -34.647 -34.581 1.00 28.66  ? 232 ARG C O   1 
ATOM   7234  C CB  . ARG C 1 232 ? -20.677 -32.123 -36.185 1.00 18.31  ? 232 ARG C CB  1 
ATOM   7235  C CG  . ARG C 1 232 ? -20.029 -33.273 -36.900 1.00 33.99  ? 232 ARG C CG  1 
ATOM   7236  C CD  . ARG C 1 232 ? -18.626 -32.879 -37.369 1.00 64.08  ? 232 ARG C CD  1 
ATOM   7237  N NE  . ARG C 1 232 ? -18.662 -32.063 -38.582 1.00 99.22  ? 232 ARG C NE  1 
ATOM   7238  C CZ  . ARG C 1 232 ? -17.647 -31.928 -39.437 1.00 127.55 ? 232 ARG C CZ  1 
ATOM   7239  N NH1 . ARG C 1 232 ? -16.489 -32.543 -39.211 1.00 113.37 ? 232 ARG C NH1 1 
ATOM   7240  N NH2 . ARG C 1 232 ? -17.783 -31.164 -40.518 1.00 124.78 ? 232 ARG C NH2 1 
ATOM   7241  N N   . GLU C 1 233 ? -21.012 -33.296 -33.457 1.00 24.77  ? 233 GLU C N   1 
ATOM   7242  C CA  . GLU C 1 233 ? -20.813 -34.267 -32.394 1.00 23.46  ? 233 GLU C CA  1 
ATOM   7243  C C   . GLU C 1 233 ? -22.147 -34.793 -31.830 1.00 28.94  ? 233 GLU C C   1 
ATOM   7244  O O   . GLU C 1 233 ? -22.268 -35.980 -31.507 1.00 29.62  ? 233 GLU C O   1 
ATOM   7245  C CB  . GLU C 1 233 ? -19.939 -33.656 -31.301 1.00 23.46  ? 233 GLU C CB  1 
ATOM   7246  C CG  . GLU C 1 233 ? -18.542 -33.320 -31.806 1.00 27.96  ? 233 GLU C CG  1 
ATOM   7247  C CD  . GLU C 1 233 ? -17.821 -34.492 -32.512 1.00 41.65  ? 233 GLU C CD  1 
ATOM   7248  O OE1 . GLU C 1 233 ? -17.034 -34.226 -33.466 1.00 27.98  ? 233 GLU C OE1 1 
ATOM   7249  O OE2 . GLU C 1 233 ? -17.986 -35.665 -32.083 1.00 24.38  ? 233 GLU C OE2 1 
ATOM   7250  N N   . GLN C 1 234 ? -23.150 -33.914 -31.759 1.00 24.82  ? 234 GLN C N   1 
ATOM   7251  C CA  . GLN C 1 234 ? -24.451 -34.289 -31.239 1.00 25.24  ? 234 GLN C CA  1 
ATOM   7252  C C   . GLN C 1 234 ? -25.372 -34.852 -32.309 1.00 33.11  ? 234 GLN C C   1 
ATOM   7253  O O   . GLN C 1 234 ? -26.522 -35.161 -32.017 1.00 33.29  ? 234 GLN C O   1 
ATOM   7254  C CB  . GLN C 1 234 ? -25.126 -33.111 -30.515 1.00 26.46  ? 234 GLN C CB  1 
ATOM   7255  C CG  . GLN C 1 234 ? -24.669 -32.833 -29.030 1.00 19.92  ? 234 GLN C CG  1 
ATOM   7256  C CD  . GLN C 1 234 ? -24.489 -34.084 -28.187 1.00 30.76  ? 234 GLN C CD  1 
ATOM   7257  O OE1 . GLN C 1 234 ? -23.384 -34.542 -27.959 1.00 28.82  ? 234 GLN C OE1 1 
ATOM   7258  N NE2 . GLN C 1 234 ? -25.583 -34.658 -27.758 1.00 37.49  ? 234 GLN C NE2 1 
ATOM   7259  N N   . GLY C 1 235 ? -24.874 -34.968 -33.544 1.00 31.31  ? 235 GLY C N   1 
ATOM   7260  C CA  . GLY C 1 235 ? -25.658 -35.522 -34.647 1.00 30.50  ? 235 GLY C CA  1 
ATOM   7261  C C   . GLY C 1 235 ? -26.792 -34.643 -35.163 1.00 32.74  ? 235 GLY C C   1 
ATOM   7262  O O   . GLY C 1 235 ? -27.601 -35.087 -35.959 1.00 34.02  ? 235 GLY C O   1 
ATOM   7263  N N   . PHE C 1 236 ? -26.836 -33.391 -34.741 1.00 27.22  ? 236 PHE C N   1 
ATOM   7264  C CA  . PHE C 1 236 ? -27.881 -32.484 -35.214 1.00 27.68  ? 236 PHE C CA  1 
ATOM   7265  C C   . PHE C 1 236 ? -28.210 -32.498 -36.710 1.00 37.12  ? 236 PHE C C   1 
ATOM   7266  O O   . PHE C 1 236 ? -29.329 -32.167 -37.109 1.00 37.88  ? 236 PHE C O   1 
ATOM   7267  C CB  . PHE C 1 236 ? -27.563 -31.056 -34.812 1.00 28.72  ? 236 PHE C CB  1 
ATOM   7268  C CG  . PHE C 1 236 ? -27.873 -30.759 -33.382 1.00 28.69  ? 236 PHE C CG  1 
ATOM   7269  C CD1 . PHE C 1 236 ? -28.272 -31.774 -32.531 1.00 30.25  ? 236 PHE C CD1 1 
ATOM   7270  C CD2 . PHE C 1 236 ? -27.697 -29.491 -32.878 1.00 29.36  ? 236 PHE C CD2 1 
ATOM   7271  C CE1 . PHE C 1 236 ? -28.521 -31.530 -31.211 1.00 30.70  ? 236 PHE C CE1 1 
ATOM   7272  C CE2 . PHE C 1 236 ? -27.917 -29.249 -31.557 1.00 33.00  ? 236 PHE C CE2 1 
ATOM   7273  C CZ  . PHE C 1 236 ? -28.373 -30.267 -30.727 1.00 31.28  ? 236 PHE C CZ  1 
ATOM   7274  N N   . GLU C 1 237 ? -27.215 -32.780 -37.544 1.00 36.56  ? 237 GLU C N   1 
ATOM   7275  C CA  . GLU C 1 237 ? -27.436 -32.781 -38.989 1.00 36.27  ? 237 GLU C CA  1 
ATOM   7276  C C   . GLU C 1 237 ? -27.904 -31.411 -39.504 1.00 40.29  ? 237 GLU C C   1 
ATOM   7277  O O   . GLU C 1 237 ? -29.010 -31.274 -40.030 1.00 39.13  ? 237 GLU C O   1 
ATOM   7278  C CB  . GLU C 1 237 ? -28.446 -33.871 -39.358 1.00 37.31  ? 237 GLU C CB  1 
ATOM   7279  C CG  . GLU C 1 237 ? -27.876 -35.275 -39.278 1.00 44.74  ? 237 GLU C CG  1 
ATOM   7280  C CD  . GLU C 1 237 ? -28.871 -36.321 -39.712 1.00 66.61  ? 237 GLU C CD  1 
ATOM   7281  O OE1 . GLU C 1 237 ? -30.076 -35.980 -39.826 1.00 44.36  ? 237 GLU C OE1 1 
ATOM   7282  O OE2 . GLU C 1 237 ? -28.449 -37.486 -39.899 1.00 61.90  ? 237 GLU C OE2 1 
ATOM   7283  N N   . THR C 1 238 ? -27.061 -30.395 -39.338 1.00 37.08  ? 238 THR C N   1 
ATOM   7284  C CA  . THR C 1 238 ? -27.397 -29.058 -39.791 1.00 36.39  ? 238 THR C CA  1 
ATOM   7285  C C   . THR C 1 238 ? -26.222 -28.118 -39.521 1.00 41.53  ? 238 THR C C   1 
ATOM   7286  O O   . THR C 1 238 ? -25.543 -28.244 -38.504 1.00 43.27  ? 238 THR C O   1 
ATOM   7287  C CB  . THR C 1 238 ? -28.696 -28.541 -39.133 1.00 40.30  ? 238 THR C CB  1 
ATOM   7288  O OG1 . THR C 1 238 ? -28.829 -27.138 -39.376 1.00 45.23  ? 238 THR C OG1 1 
ATOM   7289  C CG2 . THR C 1 238 ? -28.702 -28.800 -37.618 1.00 33.99  ? 238 THR C CG2 1 
ATOM   7290  N N   . LYS C 1 239 ? -25.920 -27.264 -40.494 1.00 36.09  ? 239 LYS C N   1 
ATOM   7291  C CA  . LYS C 1 239 ? -24.826 -26.323 -40.389 1.00 35.35  ? 239 LYS C CA  1 
ATOM   7292  C C   . LYS C 1 239 ? -25.396 -24.927 -40.181 1.00 39.05  ? 239 LYS C C   1 
ATOM   7293  O O   . LYS C 1 239 ? -24.648 -23.931 -40.199 1.00 40.47  ? 239 LYS C O   1 
ATOM   7294  C CB  . LYS C 1 239 ? -24.002 -26.328 -41.672 1.00 37.21  ? 239 LYS C CB  1 
ATOM   7295  C CG  . LYS C 1 239 ? -22.967 -27.412 -41.752 1.00 40.38  ? 239 LYS C CG  1 
ATOM   7296  C CD  . LYS C 1 239 ? -22.097 -27.231 -42.986 1.00 45.19  ? 239 LYS C CD  1 
ATOM   7297  C CE  . LYS C 1 239 ? -21.206 -28.454 -43.232 1.00 42.02  ? 239 LYS C CE  1 
ATOM   7298  N NZ  . LYS C 1 239 ? -19.800 -28.097 -43.615 1.00 43.09  ? 239 LYS C NZ  1 
ATOM   7299  N N   . ASP C 1 240 ? -26.713 -24.869 -39.971 1.00 31.04  ? 240 ASP C N   1 
ATOM   7300  C CA  . ASP C 1 240 ? -27.434 -23.606 -39.761 1.00 28.81  ? 240 ASP C CA  1 
ATOM   7301  C C   . ASP C 1 240 ? -27.413 -23.166 -38.292 1.00 31.52  ? 240 ASP C C   1 
ATOM   7302  O O   . ASP C 1 240 ? -28.136 -23.734 -37.459 1.00 31.37  ? 240 ASP C O   1 
ATOM   7303  C CB  . ASP C 1 240 ? -28.892 -23.777 -40.214 1.00 28.96  ? 240 ASP C CB  1 
ATOM   7304  C CG  . ASP C 1 240 ? -29.646 -22.489 -40.249 1.00 30.17  ? 240 ASP C CG  1 
ATOM   7305  O OD1 . ASP C 1 240 ? -30.852 -22.548 -39.958 1.00 28.32  ? 240 ASP C OD1 1 
ATOM   7306  O OD2 . ASP C 1 240 ? -29.033 -21.413 -40.467 1.00 41.73  ? 240 ASP C OD2 1 
ATOM   7307  N N   . ILE C 1 241 ? -26.686 -22.092 -37.992 1.00 26.04  ? 241 ILE C N   1 
ATOM   7308  C CA  . ILE C 1 241 ? -26.599 -21.601 -36.622 1.00 25.61  ? 241 ILE C CA  1 
ATOM   7309  C C   . ILE C 1 241 ? -27.917 -21.451 -35.833 1.00 31.44  ? 241 ILE C C   1 
ATOM   7310  O O   . ILE C 1 241 ? -28.021 -21.947 -34.683 1.00 28.99  ? 241 ILE C O   1 
ATOM   7311  C CB  . ILE C 1 241 ? -25.817 -20.314 -36.510 1.00 27.56  ? 241 ILE C CB  1 
ATOM   7312  C CG1 . ILE C 1 241 ? -25.619 -19.990 -35.024 1.00 25.37  ? 241 ILE C CG1 1 
ATOM   7313  C CG2 . ILE C 1 241 ? -26.641 -19.208 -37.152 1.00 30.85  ? 241 ILE C CG2 1 
ATOM   7314  C CD1 . ILE C 1 241 ? -24.259 -20.092 -34.517 1.00 14.43  ? 241 ILE C CD1 1 
ATOM   7315  N N   . LYS C 1 242 ? -28.891 -20.725 -36.408 1.00 29.71  ? 242 LYS C N   1 
ATOM   7316  C CA  . LYS C 1 242 ? -30.230 -20.567 -35.765 1.00 28.98  ? 242 LYS C CA  1 
ATOM   7317  C C   . LYS C 1 242 ? -30.903 -21.918 -35.496 1.00 32.08  ? 242 LYS C C   1 
ATOM   7318  O O   . LYS C 1 242 ? -31.514 -22.105 -34.443 1.00 30.97  ? 242 LYS C O   1 
ATOM   7319  C CB  . LYS C 1 242 ? -31.168 -19.748 -36.637 1.00 30.93  ? 242 LYS C CB  1 
ATOM   7320  C CG  . LYS C 1 242 ? -30.676 -18.354 -36.909 1.00 52.04  ? 242 LYS C CG  1 
ATOM   7321  C CD  . LYS C 1 242 ? -31.819 -17.431 -37.241 1.00 58.19  ? 242 LYS C CD  1 
ATOM   7322  C CE  . LYS C 1 242 ? -31.323 -16.229 -38.021 1.00 75.60  ? 242 LYS C CE  1 
ATOM   7323  N NZ  . LYS C 1 242 ? -32.392 -15.657 -38.886 1.00 80.32  ? 242 LYS C NZ  1 
ATOM   7324  N N   . GLU C 1 243 ? -30.815 -22.832 -36.468 1.00 28.12  ? 243 GLU C N   1 
ATOM   7325  C CA  . GLU C 1 243 ? -31.357 -24.180 -36.324 1.00 29.04  ? 243 GLU C CA  1 
ATOM   7326  C C   . GLU C 1 243 ? -30.560 -24.949 -35.260 1.00 28.90  ? 243 GLU C C   1 
ATOM   7327  O O   . GLU C 1 243 ? -31.139 -25.695 -34.457 1.00 27.35  ? 243 GLU C O   1 
ATOM   7328  C CB  . GLU C 1 243 ? -31.313 -24.923 -37.665 1.00 31.69  ? 243 GLU C CB  1 
ATOM   7329  C CG  . GLU C 1 243 ? -32.017 -26.276 -37.675 1.00 50.01  ? 243 GLU C CG  1 
ATOM   7330  C CD  . GLU C 1 243 ? -33.496 -26.193 -37.327 1.00 79.27  ? 243 GLU C CD  1 
ATOM   7331  O OE1 . GLU C 1 243 ? -34.116 -27.270 -37.165 1.00 81.34  ? 243 GLU C OE1 1 
ATOM   7332  O OE2 . GLU C 1 243 ? -34.047 -25.069 -37.251 1.00 68.18  ? 243 GLU C OE2 1 
ATOM   7333  N N   . ILE C 1 244 ? -29.245 -24.724 -35.213 1.00 22.26  ? 244 ILE C N   1 
ATOM   7334  C CA  . ILE C 1 244 ? -28.429 -25.356 -34.179 1.00 21.53  ? 244 ILE C CA  1 
ATOM   7335  C C   . ILE C 1 244 ? -28.764 -24.801 -32.780 1.00 26.65  ? 244 ILE C C   1 
ATOM   7336  O O   . ILE C 1 244 ? -28.781 -25.563 -31.797 1.00 26.37  ? 244 ILE C O   1 
ATOM   7337  C CB  . ILE C 1 244 ? -26.911 -25.220 -34.406 1.00 24.11  ? 244 ILE C CB  1 
ATOM   7338  C CG1 . ILE C 1 244 ? -26.437 -26.059 -35.606 1.00 23.85  ? 244 ILE C CG1 1 
ATOM   7339  C CG2 . ILE C 1 244 ? -26.188 -25.722 -33.169 1.00 25.32  ? 244 ILE C CG2 1 
ATOM   7340  C CD1 . ILE C 1 244 ? -25.030 -25.694 -36.080 1.00 18.22  ? 244 ILE C CD1 1 
ATOM   7341  N N   . ALA C 1 245 ? -29.019 -23.488 -32.698 1.00 21.10  ? 245 ALA C N   1 
ATOM   7342  C CA  . ALA C 1 245 ? -29.402 -22.856 -31.442 1.00 20.25  ? 245 ALA C CA  1 
ATOM   7343  C C   . ALA C 1 245 ? -30.704 -23.439 -30.975 1.00 27.60  ? 245 ALA C C   1 
ATOM   7344  O O   . ALA C 1 245 ? -30.882 -23.701 -29.780 1.00 28.88  ? 245 ALA C O   1 
ATOM   7345  C CB  . ALA C 1 245 ? -29.559 -21.354 -31.596 1.00 20.42  ? 245 ALA C CB  1 
ATOM   7346  N N   . LYS C 1 246 ? -31.629 -23.597 -31.915 1.00 25.46  ? 246 LYS C N   1 
ATOM   7347  C CA  . LYS C 1 246 ? -32.990 -24.094 -31.628 1.00 25.21  ? 246 LYS C CA  1 
ATOM   7348  C C   . LYS C 1 246 ? -33.001 -25.535 -31.118 1.00 29.35  ? 246 LYS C C   1 
ATOM   7349  O O   . LYS C 1 246 ? -33.721 -25.860 -30.171 1.00 30.29  ? 246 LYS C O   1 
ATOM   7350  C CB  . LYS C 1 246 ? -33.883 -23.954 -32.874 1.00 26.67  ? 246 LYS C CB  1 
ATOM   7351  C CG  . LYS C 1 246 ? -35.023 -24.939 -32.959 1.00 31.11  ? 246 LYS C CG  1 
ATOM   7352  C CD  . LYS C 1 246 ? -36.098 -24.476 -33.926 1.00 38.23  ? 246 LYS C CD  1 
ATOM   7353  C CE  . LYS C 1 246 ? -37.489 -24.985 -33.502 1.00 64.08  ? 246 LYS C CE  1 
ATOM   7354  N NZ  . LYS C 1 246 ? -38.553 -24.823 -34.554 1.00 72.06  ? 246 LYS C NZ  1 
ATOM   7355  N N   . LYS C 1 247 ? -32.195 -26.394 -31.741 1.00 24.92  ? 247 LYS C N   1 
ATOM   7356  C CA  . LYS C 1 247 ? -32.134 -27.788 -31.337 1.00 25.09  ? 247 LYS C CA  1 
ATOM   7357  C C   . LYS C 1 247 ? -31.457 -27.944 -29.973 1.00 31.61  ? 247 LYS C C   1 
ATOM   7358  O O   . LYS C 1 247 ? -31.830 -28.811 -29.163 1.00 33.10  ? 247 LYS C O   1 
ATOM   7359  C CB  . LYS C 1 247 ? -31.413 -28.613 -32.385 1.00 26.77  ? 247 LYS C CB  1 
ATOM   7360  C CG  . LYS C 1 247 ? -31.950 -28.451 -33.798 1.00 36.92  ? 247 LYS C CG  1 
ATOM   7361  C CD  . LYS C 1 247 ? -31.332 -29.480 -34.744 1.00 42.83  ? 247 LYS C CD  1 
ATOM   7362  C CE  . LYS C 1 247 ? -31.926 -29.347 -36.131 1.00 59.03  ? 247 LYS C CE  1 
ATOM   7363  N NZ  . LYS C 1 247 ? -33.355 -29.757 -36.193 1.00 62.93  ? 247 LYS C NZ  1 
ATOM   7364  N N   . THR C 1 248 ? -30.470 -27.085 -29.725 1.00 25.88  ? 248 THR C N   1 
ATOM   7365  C CA  . THR C 1 248 ? -29.737 -27.079 -28.460 1.00 24.04  ? 248 THR C CA  1 
ATOM   7366  C C   . THR C 1 248 ? -30.609 -26.563 -27.313 1.00 24.86  ? 248 THR C C   1 
ATOM   7367  O O   . THR C 1 248 ? -30.592 -27.101 -26.209 1.00 25.32  ? 248 THR C O   1 
ATOM   7368  C CB  . THR C 1 248 ? -28.437 -26.243 -28.570 1.00 20.59  ? 248 THR C CB  1 
ATOM   7369  O OG1 . THR C 1 248 ? -27.646 -26.783 -29.623 1.00 21.15  ? 248 THR C OG1 1 
ATOM   7370  C CG2 . THR C 1 248 ? -27.642 -26.232 -27.258 1.00 6.57   ? 248 THR C CG2 1 
ATOM   7371  N N   . GLN C 1 249 ? -31.346 -25.499 -27.552 1.00 19.24  ? 249 GLN C N   1 
ATOM   7372  C CA  . GLN C 1 249 ? -32.211 -25.001 -26.500 1.00 18.99  ? 249 GLN C CA  1 
ATOM   7373  C C   . GLN C 1 249 ? -33.226 -26.083 -26.084 1.00 25.46  ? 249 GLN C C   1 
ATOM   7374  O O   . GLN C 1 249 ? -33.621 -26.166 -24.932 1.00 26.60  ? 249 GLN C O   1 
ATOM   7375  C CB  . GLN C 1 249 ? -32.904 -23.707 -26.955 1.00 19.42  ? 249 GLN C CB  1 
ATOM   7376  C CG  . GLN C 1 249 ? -34.389 -23.808 -27.136 1.00 37.13  ? 249 GLN C CG  1 
ATOM   7377  C CD  . GLN C 1 249 ? -35.151 -23.603 -25.850 1.00 37.95  ? 249 GLN C CD  1 
ATOM   7378  O OE1 . GLN C 1 249 ? -36.323 -23.887 -25.775 1.00 32.81  ? 249 GLN C OE1 1 
ATOM   7379  N NE2 . GLN C 1 249 ? -34.475 -23.129 -24.835 1.00 31.54  ? 249 GLN C NE2 1 
ATOM   7380  N N   . ALA C 1 250 ? -33.602 -26.937 -27.034 1.00 23.00  ? 250 ALA C N   1 
ATOM   7381  C CA  . ALA C 1 250 ? -34.658 -27.938 -26.844 1.00 20.88  ? 250 ALA C CA  1 
ATOM   7382  C C   . ALA C 1 250 ? -34.160 -29.225 -26.239 1.00 23.58  ? 250 ALA C C   1 
ATOM   7383  O O   . ALA C 1 250 ? -34.922 -30.154 -26.111 1.00 25.68  ? 250 ALA C O   1 
ATOM   7384  C CB  . ALA C 1 250 ? -35.367 -28.219 -28.187 1.00 20.71  ? 250 ALA C CB  1 
ATOM   7385  N N   . LEU C 1 251 ? -32.878 -29.301 -25.923 1.00 18.17  ? 251 LEU C N   1 
ATOM   7386  C CA  . LEU C 1 251 ? -32.284 -30.483 -25.285 1.00 16.96  ? 251 LEU C CA  1 
ATOM   7387  C C   . LEU C 1 251 ? -32.932 -30.737 -23.908 1.00 23.06  ? 251 LEU C C   1 
ATOM   7388  O O   . LEU C 1 251 ? -33.362 -29.798 -23.240 1.00 23.59  ? 251 LEU C O   1 
ATOM   7389  C CB  . LEU C 1 251 ? -30.773 -30.237 -25.107 1.00 16.05  ? 251 LEU C CB  1 
ATOM   7390  C CG  . LEU C 1 251 ? -29.950 -30.222 -26.406 1.00 16.23  ? 251 LEU C CG  1 
ATOM   7391  C CD1 . LEU C 1 251 ? -28.612 -29.575 -26.195 1.00 12.53  ? 251 LEU C CD1 1 
ATOM   7392  C CD2 . LEU C 1 251 ? -29.816 -31.655 -26.946 1.00 15.13  ? 251 LEU C CD2 1 
ATOM   7393  N N   . PRO C 1 252 ? -32.979 -31.996 -23.478 1.00 19.07  ? 252 PRO C N   1 
ATOM   7394  C CA  . PRO C 1 252 ? -33.580 -32.313 -22.187 1.00 18.60  ? 252 PRO C CA  1 
ATOM   7395  C C   . PRO C 1 252 ? -33.058 -31.384 -21.077 1.00 26.58  ? 252 PRO C C   1 
ATOM   7396  O O   . PRO C 1 252 ? -31.853 -31.124 -20.977 1.00 26.33  ? 252 PRO C O   1 
ATOM   7397  C CB  . PRO C 1 252 ? -33.122 -33.763 -21.933 1.00 18.76  ? 252 PRO C CB  1 
ATOM   7398  C CG  . PRO C 1 252 ? -32.769 -34.308 -23.238 1.00 20.47  ? 252 PRO C CG  1 
ATOM   7399  C CD  . PRO C 1 252 ? -32.297 -33.166 -24.069 1.00 17.21  ? 252 PRO C CD  1 
ATOM   7400  N N   . LYS C 1 253 ? -33.985 -30.853 -20.284 1.00 25.95  ? 253 LYS C N   1 
ATOM   7401  C CA  . LYS C 1 253 ? -33.648 -29.989 -19.148 1.00 25.99  ? 253 LYS C CA  1 
ATOM   7402  C C   . LYS C 1 253 ? -34.187 -30.571 -17.828 1.00 30.56  ? 253 LYS C C   1 
ATOM   7403  O O   . LYS C 1 253 ? -35.295 -31.052 -17.781 1.00 30.31  ? 253 LYS C O   1 
ATOM   7404  C CB  . LYS C 1 253 ? -34.158 -28.557 -19.350 1.00 26.23  ? 253 LYS C CB  1 
ATOM   7405  C CG  . LYS C 1 253 ? -33.246 -27.499 -18.710 1.00 17.24  ? 253 LYS C CG  1 
ATOM   7406  C CD  . LYS C 1 253 ? -33.802 -26.122 -18.900 1.00 14.54  ? 253 LYS C CD  1 
ATOM   7407  C CE  . LYS C 1 253 ? -32.966 -25.110 -18.105 1.00 11.06  ? 253 LYS C CE  1 
ATOM   7408  N NZ  . LYS C 1 253 ? -33.311 -25.169 -16.667 1.00 22.01  ? 253 LYS C NZ  1 
ATOM   7409  N N   . MET C 1 254 ? -33.372 -30.569 -16.776 1.00 28.83  ? 254 MET C N   1 
ATOM   7410  C CA  . MET C 1 254 ? -33.733 -31.126 -15.474 1.00 28.67  ? 254 MET C CA  1 
ATOM   7411  C C   . MET C 1 254 ? -34.741 -30.213 -14.731 1.00 38.38  ? 254 MET C C   1 
ATOM   7412  O O   . MET C 1 254 ? -35.826 -30.647 -14.364 1.00 40.50  ? 254 MET C O   1 
ATOM   7413  C CB  . MET C 1 254 ? -32.461 -31.305 -14.658 1.00 30.60  ? 254 MET C CB  1 
ATOM   7414  C CG  . MET C 1 254 ? -32.338 -32.596 -13.926 1.00 34.68  ? 254 MET C CG  1 
ATOM   7415  S SD  . MET C 1 254 ? -33.018 -34.027 -14.813 1.00 39.03  ? 254 MET C SD  1 
ATOM   7416  C CE  . MET C 1 254 ? -31.566 -34.936 -15.436 1.00 34.18  ? 254 MET C CE  1 
ATOM   7417  N N   . ASN C 1 255 ? -34.412 -28.936 -14.574 1.00 36.21  ? 255 ASN C N   1 
ATOM   7418  C CA  . ASN C 1 255 ? -35.306 -27.993 -13.932 1.00 35.99  ? 255 ASN C CA  1 
ATOM   7419  C C   . ASN C 1 255 ? -36.227 -27.358 -14.942 1.00 40.97  ? 255 ASN C C   1 
ATOM   7420  O O   . ASN C 1 255 ? -35.859 -26.456 -15.688 1.00 39.41  ? 255 ASN C O   1 
ATOM   7421  C CB  . ASN C 1 255 ? -34.510 -26.903 -13.214 1.00 41.60  ? 255 ASN C CB  1 
ATOM   7422  C CG  . ASN C 1 255 ? -35.367 -25.677 -12.835 1.00 65.16  ? 255 ASN C CG  1 
ATOM   7423  O OD1 . ASN C 1 255 ? -36.570 -25.778 -12.593 1.00 60.45  ? 255 ASN C OD1 1 
ATOM   7424  N ND2 . ASN C 1 255 ? -34.706 -24.536 -12.691 1.00 57.25  ? 255 ASN C ND2 1 
ATOM   7425  N N   . SER C 1 256 ? -37.476 -27.750 -14.852 1.00 41.78  ? 256 SER C N   1 
ATOM   7426  C CA  . SER C 1 256 ? -38.534 -27.267 -15.720 1.00 42.63  ? 256 SER C CA  1 
ATOM   7427  C C   . SER C 1 256 ? -39.040 -25.830 -15.439 1.00 45.84  ? 256 SER C C   1 
ATOM   7428  O O   . SER C 1 256 ? -39.832 -25.291 -16.234 1.00 44.95  ? 256 SER C O   1 
ATOM   7429  C CB  . SER C 1 256 ? -39.668 -28.256 -15.569 1.00 46.37  ? 256 SER C CB  1 
ATOM   7430  O OG  . SER C 1 256 ? -39.426 -28.995 -14.367 1.00 52.55  ? 256 SER C OG  1 
ATOM   7431  N N   . LYS C 1 257 ? -38.603 -25.227 -14.328 1.00 40.59  ? 257 LYS C N   1 
ATOM   7432  C CA  . LYS C 1 257 ? -39.064 -23.883 -13.980 1.00 40.42  ? 257 LYS C CA  1 
ATOM   7433  C C   . LYS C 1 257 ? -38.495 -22.871 -14.949 1.00 41.92  ? 257 LYS C C   1 
ATOM   7434  O O   . LYS C 1 257 ? -39.124 -21.843 -15.221 1.00 40.79  ? 257 LYS C O   1 
ATOM   7435  C CB  . LYS C 1 257 ? -38.645 -23.506 -12.555 1.00 45.14  ? 257 LYS C CB  1 
ATOM   7436  C CG  . LYS C 1 257 ? -39.562 -24.001 -11.448 1.00 71.02  ? 257 LYS C CG  1 
ATOM   7437  C CD  . LYS C 1 257 ? -38.980 -23.664 -10.071 1.00 87.13  ? 257 LYS C CD  1 
ATOM   7438  C CE  . LYS C 1 257 ? -39.634 -24.488 -8.961  1.00 98.86  ? 257 LYS C CE  1 
ATOM   7439  N NZ  . LYS C 1 257 ? -40.342 -23.632 -7.959  1.00 100.95 ? 257 LYS C NZ  1 
ATOM   7440  N N   . ARG C 1 258 ? -37.287 -23.169 -15.438 1.00 37.21  ? 258 ARG C N   1 
ATOM   7441  C CA  . ARG C 1 258 ? -36.525 -22.291 -16.329 1.00 35.40  ? 258 ARG C CA  1 
ATOM   7442  C C   . ARG C 1 258 ? -36.314 -22.926 -17.691 1.00 38.66  ? 258 ARG C C   1 
ATOM   7443  O O   . ARG C 1 258 ? -35.597 -23.913 -17.822 1.00 40.19  ? 258 ARG C O   1 
ATOM   7444  C CB  . ARG C 1 258 ? -35.143 -22.026 -15.724 1.00 33.38  ? 258 ARG C CB  1 
ATOM   7445  C CG  . ARG C 1 258 ? -35.110 -20.949 -14.642 1.00 43.98  ? 258 ARG C CG  1 
ATOM   7446  C CD  . ARG C 1 258 ? -33.766 -20.897 -13.872 1.00 47.79  ? 258 ARG C CD  1 
ATOM   7447  N NE  . ARG C 1 258 ? -33.958 -20.243 -12.577 1.00 42.23  ? 258 ARG C NE  1 
ATOM   7448  C CZ  . ARG C 1 258 ? -34.244 -18.952 -12.456 1.00 50.80  ? 258 ARG C CZ  1 
ATOM   7449  N NH1 . ARG C 1 258 ? -34.282 -18.193 -13.542 1.00 33.91  ? 258 ARG C NH1 1 
ATOM   7450  N NH2 . ARG C 1 258 ? -34.491 -18.420 -11.268 1.00 46.70  ? 258 ARG C NH2 1 
ATOM   7451  N N   . GLN C 1 259 ? -36.852 -22.303 -18.726 1.00 32.38  ? 259 GLN C N   1 
ATOM   7452  C CA  . GLN C 1 259 ? -36.646 -22.812 -20.064 1.00 30.02  ? 259 GLN C CA  1 
ATOM   7453  C C   . GLN C 1 259 ? -35.218 -22.424 -20.459 1.00 28.04  ? 259 GLN C C   1 
ATOM   7454  O O   . GLN C 1 259 ? -34.707 -21.386 -20.032 1.00 26.46  ? 259 GLN C O   1 
ATOM   7455  C CB  . GLN C 1 259 ? -37.678 -22.201 -21.022 1.00 31.82  ? 259 GLN C CB  1 
ATOM   7456  C CG  . GLN C 1 259 ? -37.825 -22.957 -22.341 1.00 57.77  ? 259 GLN C CG  1 
ATOM   7457  C CD  . GLN C 1 259 ? -38.665 -24.215 -22.209 1.00 76.11  ? 259 GLN C CD  1 
ATOM   7458  O OE1 . GLN C 1 259 ? -38.977 -24.869 -23.214 1.00 70.75  ? 259 GLN C OE1 1 
ATOM   7459  N NE2 . GLN C 1 259 ? -39.015 -24.575 -20.968 1.00 60.39  ? 259 GLN C NE2 1 
ATOM   7460  N N   . ARG C 1 260 ? -34.562 -23.234 -21.281 1.00 19.22  ? 260 ARG C N   1 
ATOM   7461  C CA  . ARG C 1 260 ? -33.213 -22.884 -21.684 1.00 16.21  ? 260 ARG C CA  1 
ATOM   7462  C C   . ARG C 1 260 ? -33.100 -21.588 -22.496 1.00 18.82  ? 260 ARG C C   1 
ATOM   7463  O O   . ARG C 1 260 ? -34.069 -21.068 -23.017 1.00 17.36  ? 260 ARG C O   1 
ATOM   7464  C CB  . ARG C 1 260 ? -32.490 -24.031 -22.404 1.00 13.12  ? 260 ARG C CB  1 
ATOM   7465  C CG  . ARG C 1 260 ? -30.941 -23.911 -22.323 1.00 17.89  ? 260 ARG C CG  1 
ATOM   7466  C CD  . ARG C 1 260 ? -30.289 -25.100 -22.964 1.00 18.28  ? 260 ARG C CD  1 
ATOM   7467  N NE  . ARG C 1 260 ? -30.200 -26.233 -22.050 1.00 13.65  ? 260 ARG C NE  1 
ATOM   7468  C CZ  . ARG C 1 260 ? -30.932 -27.334 -22.103 1.00 19.55  ? 260 ARG C CZ  1 
ATOM   7469  N NH1 . ARG C 1 260 ? -31.835 -27.520 -23.031 1.00 10.24  ? 260 ARG C NH1 1 
ATOM   7470  N NH2 . ARG C 1 260 ? -30.717 -28.289 -21.223 1.00 19.41  ? 260 ARG C NH2 1 
ATOM   7471  N N   . ILE C 1 261 ? -31.881 -21.070 -22.569 1.00 16.13  ? 261 ILE C N   1 
ATOM   7472  C CA  . ILE C 1 261 ? -31.551 -19.925 -23.398 1.00 16.48  ? 261 ILE C CA  1 
ATOM   7473  C C   . ILE C 1 261 ? -30.164 -20.197 -23.992 1.00 21.09  ? 261 ILE C C   1 
ATOM   7474  O O   . ILE C 1 261 ? -29.294 -20.742 -23.315 1.00 19.30  ? 261 ILE C O   1 
ATOM   7475  C CB  . ILE C 1 261 ? -31.618 -18.590 -22.628 1.00 19.65  ? 261 ILE C CB  1 
ATOM   7476  C CG1 . ILE C 1 261 ? -33.015 -18.409 -22.038 1.00 18.60  ? 261 ILE C CG1 1 
ATOM   7477  C CG2 . ILE C 1 261 ? -31.302 -17.432 -23.559 1.00 21.30  ? 261 ILE C CG2 1 
ATOM   7478  C CD1 . ILE C 1 261 ? -33.019 -17.431 -20.928 1.00 25.88  ? 261 ILE C CD1 1 
ATOM   7479  N N   . VAL C 1 262 ? -30.049 -20.011 -25.304 1.00 20.90  ? 262 VAL C N   1 
ATOM   7480  C CA  . VAL C 1 262 ? -28.830 -20.352 -26.073 1.00 20.18  ? 262 VAL C CA  1 
ATOM   7481  C C   . VAL C 1 262 ? -28.277 -19.145 -26.820 1.00 23.07  ? 262 VAL C C   1 
ATOM   7482  O O   . VAL C 1 262 ? -28.930 -18.557 -27.672 1.00 22.88  ? 262 VAL C O   1 
ATOM   7483  C CB  . VAL C 1 262 ? -29.052 -21.538 -27.103 1.00 22.43  ? 262 VAL C CB  1 
ATOM   7484  C CG1 . VAL C 1 262 ? -27.714 -21.986 -27.693 1.00 21.09  ? 262 VAL C CG1 1 
ATOM   7485  C CG2 . VAL C 1 262 ? -29.737 -22.742 -26.421 1.00 21.85  ? 262 VAL C CG2 1 
ATOM   7486  N N   . ILE C 1 263 ? -27.066 -18.753 -26.483 1.00 19.50  ? 263 ILE C N   1 
ATOM   7487  C CA  . ILE C 1 263 ? -26.505 -17.596 -27.135 1.00 19.90  ? 263 ILE C CA  1 
ATOM   7488  C C   . ILE C 1 263 ? -25.215 -17.950 -27.828 1.00 26.08  ? 263 ILE C C   1 
ATOM   7489  O O   . ILE C 1 263 ? -24.298 -18.502 -27.226 1.00 27.38  ? 263 ILE C O   1 
ATOM   7490  C CB  . ILE C 1 263 ? -26.242 -16.436 -26.145 1.00 23.39  ? 263 ILE C CB  1 
ATOM   7491  C CG1 . ILE C 1 263 ? -27.527 -16.002 -25.450 1.00 23.51  ? 263 ILE C CG1 1 
ATOM   7492  C CG2 . ILE C 1 263 ? -25.683 -15.238 -26.902 1.00 24.96  ? 263 ILE C CG2 1 
ATOM   7493  C CD1 . ILE C 1 263 ? -27.830 -14.552 -25.657 1.00 34.19  ? 263 ILE C CD1 1 
ATOM   7494  N N   . PHE C 1 264 ? -25.161 -17.658 -29.116 1.00 21.41  ? 264 PHE C N   1 
ATOM   7495  C CA  . PHE C 1 264 ? -23.985 -17.928 -29.893 1.00 19.51  ? 264 PHE C CA  1 
ATOM   7496  C C   . PHE C 1 264 ? -23.462 -16.619 -30.461 1.00 24.02  ? 264 PHE C C   1 
ATOM   7497  O O   . PHE C 1 264 ? -24.199 -15.829 -31.013 1.00 24.73  ? 264 PHE C O   1 
ATOM   7498  C CB  . PHE C 1 264 ? -24.317 -18.882 -31.042 1.00 21.30  ? 264 PHE C CB  1 
ATOM   7499  C CG  . PHE C 1 264 ? -24.685 -20.276 -30.599 1.00 22.42  ? 264 PHE C CG  1 
ATOM   7500  C CD1 . PHE C 1 264 ? -24.050 -20.871 -29.522 1.00 24.79  ? 264 PHE C CD1 1 
ATOM   7501  C CD2 . PHE C 1 264 ? -25.690 -20.994 -31.255 1.00 21.97  ? 264 PHE C CD2 1 
ATOM   7502  C CE1 . PHE C 1 264 ? -24.355 -22.186 -29.166 1.00 24.28  ? 264 PHE C CE1 1 
ATOM   7503  C CE2 . PHE C 1 264 ? -25.987 -22.324 -30.900 1.00 22.93  ? 264 PHE C CE2 1 
ATOM   7504  C CZ  . PHE C 1 264 ? -25.333 -22.908 -29.865 1.00 20.73  ? 264 PHE C CZ  1 
ATOM   7505  N N   . THR C 1 265 ? -22.165 -16.394 -30.345 1.00 21.65  ? 265 THR C N   1 
ATOM   7506  C CA  . THR C 1 265 ? -21.571 -15.238 -30.979 1.00 22.07  ? 265 THR C CA  1 
ATOM   7507  C C   . THR C 1 265 ? -20.971 -15.657 -32.348 1.00 25.31  ? 265 THR C C   1 
ATOM   7508  O O   . THR C 1 265 ? -20.597 -16.819 -32.546 1.00 23.63  ? 265 THR C O   1 
ATOM   7509  C CB  . THR C 1 265 ? -20.514 -14.597 -30.049 1.00 30.39  ? 265 THR C CB  1 
ATOM   7510  O OG1 . THR C 1 265 ? -19.425 -15.513 -29.826 1.00 30.54  ? 265 THR C OG1 1 
ATOM   7511  C CG2 . THR C 1 265 ? -21.166 -14.246 -28.722 1.00 24.48  ? 265 THR C CG2 1 
ATOM   7512  N N   . GLN C 1 266 ? -20.897 -14.715 -33.290 1.00 21.77  ? 266 GLN C N   1 
ATOM   7513  C CA  . GLN C 1 266 ? -20.310 -14.980 -34.616 1.00 20.97  ? 266 GLN C CA  1 
ATOM   7514  C C   . GLN C 1 266 ? -19.375 -13.860 -35.075 1.00 26.88  ? 266 GLN C C   1 
ATOM   7515  O O   . GLN C 1 266 ? -19.471 -13.409 -36.229 1.00 26.22  ? 266 GLN C O   1 
ATOM   7516  C CB  . GLN C 1 266 ? -21.388 -15.117 -35.674 1.00 21.95  ? 266 GLN C CB  1 
ATOM   7517  C CG  . GLN C 1 266 ? -22.393 -16.194 -35.442 1.00 20.12  ? 266 GLN C CG  1 
ATOM   7518  C CD  . GLN C 1 266 ? -23.481 -16.127 -36.478 1.00 29.19  ? 266 GLN C CD  1 
ATOM   7519  O OE1 . GLN C 1 266 ? -24.373 -15.287 -36.392 1.00 25.15  ? 266 GLN C OE1 1 
ATOM   7520  N NE2 . GLN C 1 266 ? -23.371 -16.957 -37.510 1.00 17.89  ? 266 GLN C NE2 1 
ATOM   7521  N N   . GLY C 1 267 ? -18.532 -13.388 -34.156 1.00 24.32  ? 267 GLY C N   1 
ATOM   7522  C CA  . GLY C 1 267 ? -17.573 -12.348 -34.443 1.00 25.49  ? 267 GLY C CA  1 
ATOM   7523  C C   . GLY C 1 267 ? -18.264 -11.018 -34.719 1.00 34.88  ? 267 GLY C C   1 
ATOM   7524  O O   . GLY C 1 267 ? -18.954 -10.450 -33.868 1.00 35.58  ? 267 GLY C O   1 
ATOM   7525  N N   . ARG C 1 268 ? -18.087 -10.541 -35.939 1.00 34.33  ? 268 ARG C N   1 
ATOM   7526  C CA  . ARG C 1 268 ? -18.692 -9.307  -36.402 1.00 34.03  ? 268 ARG C CA  1 
ATOM   7527  C C   . ARG C 1 268 ? -20.078 -9.596  -36.952 1.00 39.30  ? 268 ARG C C   1 
ATOM   7528  O O   . ARG C 1 268 ? -20.811 -8.680  -37.335 1.00 38.67  ? 268 ARG C O   1 
ATOM   7529  C CB  . ARG C 1 268 ? -17.798 -8.678  -37.473 1.00 34.29  ? 268 ARG C CB  1 
ATOM   7530  C CG  . ARG C 1 268 ? -16.315 -8.720  -37.077 1.00 51.84  ? 268 ARG C CG  1 
ATOM   7531  C CD  . ARG C 1 268 ? -15.426 -8.180  -38.181 1.00 76.77  ? 268 ARG C CD  1 
ATOM   7532  N NE  . ARG C 1 268 ? -15.191 -6.744  -38.043 1.00 94.13  ? 268 ARG C NE  1 
ATOM   7533  C CZ  . ARG C 1 268 ? -15.087 -5.902  -39.062 1.00 109.54 ? 268 ARG C CZ  1 
ATOM   7534  N NH1 . ARG C 1 268 ? -15.226 -6.351  -40.301 1.00 97.68  ? 268 ARG C NH1 1 
ATOM   7535  N NH2 . ARG C 1 268 ? -14.855 -4.614  -38.849 1.00 98.88  ? 268 ARG C NH2 1 
ATOM   7536  N N   . ASP C 1 269 ? -20.455 -10.871 -36.940 1.00 36.86  ? 269 ASP C N   1 
ATOM   7537  C CA  . ASP C 1 269 ? -21.752 -11.267 -37.422 1.00 36.55  ? 269 ASP C CA  1 
ATOM   7538  C C   . ASP C 1 269 ? -22.730 -11.390 -36.256 1.00 37.67  ? 269 ASP C C   1 
ATOM   7539  O O   . ASP C 1 269 ? -22.341 -11.766 -35.170 1.00 35.98  ? 269 ASP C O   1 
ATOM   7540  C CB  . ASP C 1 269 ? -21.609 -12.577 -38.189 1.00 39.56  ? 269 ASP C CB  1 
ATOM   7541  C CG  . ASP C 1 269 ? -21.382 -12.357 -39.677 1.00 50.53  ? 269 ASP C CG  1 
ATOM   7542  O OD1 . ASP C 1 269 ? -22.079 -11.479 -40.235 1.00 51.13  ? 269 ASP C OD1 1 
ATOM   7543  O OD2 . ASP C 1 269 ? -20.529 -13.059 -40.275 1.00 53.63  ? 269 ASP C OD2 1 
ATOM   7544  N N   . ASP C 1 270 ? -23.988 -11.022 -36.493 1.00 36.01  ? 270 ASP C N   1 
ATOM   7545  C CA  . ASP C 1 270 ? -25.085 -11.098 -35.513 1.00 36.28  ? 270 ASP C CA  1 
ATOM   7546  C C   . ASP C 1 270 ? -25.013 -12.207 -34.483 1.00 40.68  ? 270 ASP C C   1 
ATOM   7547  O O   . ASP C 1 270 ? -24.759 -13.385 -34.824 1.00 40.10  ? 270 ASP C O   1 
ATOM   7548  C CB  . ASP C 1 270 ? -26.439 -11.261 -36.215 1.00 37.91  ? 270 ASP C CB  1 
ATOM   7549  C CG  . ASP C 1 270 ? -26.752 -10.129 -37.186 1.00 44.30  ? 270 ASP C CG  1 
ATOM   7550  O OD1 . ASP C 1 270 ? -25.948 -9.181  -37.327 1.00 43.18  ? 270 ASP C OD1 1 
ATOM   7551  O OD2 . ASP C 1 270 ? -27.836 -10.188 -37.796 1.00 48.03  ? 270 ASP C OD2 1 
ATOM   7552  N N   . THR C 1 271 ? -25.381 -11.844 -33.250 1.00 35.41  ? 271 THR C N   1 
ATOM   7553  C CA  . THR C 1 271 ? -25.449 -12.788 -32.134 1.00 34.24  ? 271 THR C CA  1 
ATOM   7554  C C   . THR C 1 271 ? -26.778 -13.541 -32.213 1.00 34.66  ? 271 THR C C   1 
ATOM   7555  O O   . THR C 1 271 ? -27.811 -12.977 -32.527 1.00 33.73  ? 271 THR C O   1 
ATOM   7556  C CB  . THR C 1 271 ? -25.313 -12.074 -30.738 1.00 37.51  ? 271 THR C CB  1 
ATOM   7557  O OG1 . THR C 1 271 ? -23.990 -11.524 -30.596 1.00 39.53  ? 271 THR C OG1 1 
ATOM   7558  C CG2 . THR C 1 271 ? -25.572 -13.062 -29.597 1.00 25.34  ? 271 THR C CG2 1 
ATOM   7559  N N   . ILE C 1 272 ? -26.739 -14.840 -31.988 1.00 29.90  ? 272 ILE C N   1 
ATOM   7560  C CA  . ILE C 1 272 ? -27.963 -15.613 -32.041 1.00 30.19  ? 272 ILE C CA  1 
ATOM   7561  C C   . ILE C 1 272 ? -28.458 -16.038 -30.651 1.00 35.18  ? 272 ILE C C   1 
ATOM   7562  O O   . ILE C 1 272 ? -27.730 -16.671 -29.857 1.00 32.65  ? 272 ILE C O   1 
ATOM   7563  C CB  . ILE C 1 272 ? -27.874 -16.856 -33.027 1.00 31.85  ? 272 ILE C CB  1 
ATOM   7564  C CG1 . ILE C 1 272 ? -27.731 -16.398 -34.483 1.00 30.83  ? 272 ILE C CG1 1 
ATOM   7565  C CG2 . ILE C 1 272 ? -29.113 -17.709 -32.898 1.00 29.84  ? 272 ILE C CG2 1 
ATOM   7566  C CD1 . ILE C 1 272 ? -26.580 -15.513 -34.710 1.00 35.34  ? 272 ILE C CD1 1 
ATOM   7567  N N   . MET C 1 273 ? -29.705 -15.676 -30.358 1.00 33.07  ? 273 MET C N   1 
ATOM   7568  C CA  . MET C 1 273 ? -30.342 -16.106 -29.124 1.00 33.00  ? 273 MET C CA  1 
ATOM   7569  C C   . MET C 1 273 ? -31.548 -16.935 -29.460 1.00 38.19  ? 273 MET C C   1 
ATOM   7570  O O   . MET C 1 273 ? -32.377 -16.518 -30.251 1.00 36.49  ? 273 MET C O   1 
ATOM   7571  C CB  . MET C 1 273 ? -30.766 -14.952 -28.225 1.00 34.91  ? 273 MET C CB  1 
ATOM   7572  C CG  . MET C 1 273 ? -31.843 -15.381 -27.240 1.00 38.40  ? 273 MET C CG  1 
ATOM   7573  S SD  . MET C 1 273 ? -32.280 -14.150 -25.997 1.00 42.55  ? 273 MET C SD  1 
ATOM   7574  C CE  . MET C 1 273 ? -30.661 -13.574 -25.714 1.00 40.42  ? 273 MET C CE  1 
ATOM   7575  N N   . ALA C 1 274 ? -31.634 -18.105 -28.835 1.00 37.60  ? 274 ALA C N   1 
ATOM   7576  C CA  . ALA C 1 274 ? -32.733 -19.028 -29.019 1.00 36.53  ? 274 ALA C CA  1 
ATOM   7577  C C   . ALA C 1 274 ? -33.423 -19.196 -27.669 1.00 43.79  ? 274 ALA C C   1 
ATOM   7578  O O   . ALA C 1 274 ? -32.772 -19.463 -26.649 1.00 43.23  ? 274 ALA C O   1 
ATOM   7579  C CB  . ALA C 1 274 ? -32.220 -20.360 -29.529 1.00 36.32  ? 274 ALA C CB  1 
ATOM   7580  N N   . THR C 1 275 ? -34.742 -18.993 -27.677 1.00 42.00  ? 275 THR C N   1 
ATOM   7581  C CA  . THR C 1 275 ? -35.584 -19.209 -26.503 1.00 41.68  ? 275 THR C CA  1 
ATOM   7582  C C   . THR C 1 275 ? -36.648 -20.272 -26.822 1.00 44.85  ? 275 THR C C   1 
ATOM   7583  O O   . THR C 1 275 ? -36.671 -20.851 -27.926 1.00 42.62  ? 275 THR C O   1 
ATOM   7584  C CB  . THR C 1 275 ? -36.301 -17.924 -26.061 1.00 42.56  ? 275 THR C CB  1 
ATOM   7585  O OG1 . THR C 1 275 ? -36.657 -17.152 -27.215 1.00 45.39  ? 275 THR C OG1 1 
ATOM   7586  C CG2 . THR C 1 275 ? -35.436 -17.099 -25.104 1.00 32.67  ? 275 THR C CG2 1 
ATOM   7587  N N   . GLU C 1 276 ? -37.507 -20.544 -25.848 1.00 41.68  ? 276 GLU C N   1 
ATOM   7588  C CA  . GLU C 1 276 ? -38.567 -21.507 -26.067 1.00 43.02  ? 276 GLU C CA  1 
ATOM   7589  C C   . GLU C 1 276 ? -39.476 -20.919 -27.171 1.00 45.51  ? 276 GLU C C   1 
ATOM   7590  O O   . GLU C 1 276 ? -39.956 -21.628 -28.078 1.00 43.43  ? 276 GLU C O   1 
ATOM   7591  C CB  . GLU C 1 276 ? -39.334 -21.746 -24.756 1.00 44.77  ? 276 GLU C CB  1 
ATOM   7592  C CG  . GLU C 1 276 ? -40.542 -22.646 -24.878 1.00 60.72  ? 276 GLU C CG  1 
ATOM   7593  C CD  . GLU C 1 276 ? -41.696 -22.145 -24.033 1.00 104.05 ? 276 GLU C CD  1 
ATOM   7594  O OE1 . GLU C 1 276 ? -41.429 -21.623 -22.925 1.00 94.13  ? 276 GLU C OE1 1 
ATOM   7595  O OE2 . GLU C 1 276 ? -42.856 -22.222 -24.501 1.00 116.92 ? 276 GLU C OE2 1 
ATOM   7596  N N   . SER C 1 277 ? -39.605 -19.594 -27.115 1.00 40.68  ? 277 SER C N   1 
ATOM   7597  C CA  . SER C 1 277 ? -40.415 -18.836 -28.046 1.00 39.93  ? 277 SER C CA  1 
ATOM   7598  C C   . SER C 1 277 ? -39.867 -18.880 -29.457 1.00 44.43  ? 277 SER C C   1 
ATOM   7599  O O   . SER C 1 277 ? -40.571 -19.264 -30.384 1.00 43.12  ? 277 SER C O   1 
ATOM   7600  C CB  . SER C 1 277 ? -40.543 -17.367 -27.607 1.00 41.62  ? 277 SER C CB  1 
ATOM   7601  O OG  . SER C 1 277 ? -40.259 -17.190 -26.235 1.00 45.55  ? 277 SER C OG  1 
ATOM   7602  N N   . GLU C 1 278 ? -38.640 -18.389 -29.621 1.00 42.60  ? 278 GLU C N   1 
ATOM   7603  C CA  . GLU C 1 278 ? -38.014 -18.282 -30.946 1.00 42.06  ? 278 GLU C CA  1 
ATOM   7604  C C   . GLU C 1 278 ? -36.489 -18.091 -30.931 1.00 42.38  ? 278 GLU C C   1 
ATOM   7605  O O   . GLU C 1 278 ? -35.860 -17.944 -29.880 1.00 40.86  ? 278 GLU C O   1 
ATOM   7606  C CB  . GLU C 1 278 ? -38.605 -17.068 -31.677 1.00 43.46  ? 278 GLU C CB  1 
ATOM   7607  C CG  . GLU C 1 278 ? -40.023 -17.264 -32.190 1.00 57.31  ? 278 GLU C CG  1 
ATOM   7608  C CD  . GLU C 1 278 ? -40.341 -16.361 -33.364 1.00 84.47  ? 278 GLU C CD  1 
ATOM   7609  O OE1 . GLU C 1 278 ? -39.413 -16.049 -34.143 1.00 66.28  ? 278 GLU C OE1 1 
ATOM   7610  O OE2 . GLU C 1 278 ? -41.530 -16.032 -33.563 1.00 85.24  ? 278 GLU C OE2 1 
ATOM   7611  N N   . VAL C 1 279 ? -35.946 -17.957 -32.139 1.00 37.43  ? 279 VAL C N   1 
ATOM   7612  C CA  . VAL C 1 279 ? -34.543 -17.644 -32.359 1.00 36.34  ? 279 VAL C CA  1 
ATOM   7613  C C   . VAL C 1 279 ? -34.494 -16.255 -33.004 1.00 43.21  ? 279 VAL C C   1 
ATOM   7614  O O   . VAL C 1 279 ? -35.137 -16.018 -34.029 1.00 43.60  ? 279 VAL C O   1 
ATOM   7615  C CB  . VAL C 1 279 ? -33.821 -18.665 -33.300 1.00 37.79  ? 279 VAL C CB  1 
ATOM   7616  C CG1 . VAL C 1 279 ? -32.336 -18.342 -33.353 1.00 37.26  ? 279 VAL C CG1 1 
ATOM   7617  C CG2 . VAL C 1 279 ? -34.029 -20.098 -32.851 1.00 36.19  ? 279 VAL C CG2 1 
ATOM   7618  N N   . THR C 1 280 ? -33.738 -15.349 -32.387 1.00 41.07  ? 280 THR C N   1 
ATOM   7619  C CA  . THR C 1 280 ? -33.572 -13.970 -32.848 1.00 40.57  ? 280 THR C CA  1 
ATOM   7620  C C   . THR C 1 280 ? -32.097 -13.666 -33.074 1.00 44.58  ? 280 THR C C   1 
ATOM   7621  O O   . THR C 1 280 ? -31.234 -14.256 -32.433 1.00 46.45  ? 280 THR C O   1 
ATOM   7622  C CB  . THR C 1 280 ? -34.081 -12.958 -31.774 1.00 41.24  ? 280 THR C CB  1 
ATOM   7623  O OG1 . THR C 1 280 ? -35.508 -13.003 -31.723 1.00 41.54  ? 280 THR C OG1 1 
ATOM   7624  C CG2 . THR C 1 280 ? -33.633 -11.534 -32.094 1.00 28.11  ? 280 THR C CG2 1 
ATOM   7625  N N   . ALA C 1 281 ? -31.832 -12.675 -33.919 1.00 38.81  ? 281 ALA C N   1 
ATOM   7626  C CA  . ALA C 1 281 ? -30.483 -12.280 -34.251 1.00 37.30  ? 281 ALA C CA  1 
ATOM   7627  C C   . ALA C 1 281 ? -30.268 -10.867 -33.776 1.00 39.68  ? 281 ALA C C   1 
ATOM   7628  O O   . ALA C 1 281 ? -31.180 -10.063 -33.806 1.00 41.63  ? 281 ALA C O   1 
ATOM   7629  C CB  . ALA C 1 281 ? -30.279 -12.372 -35.748 1.00 38.01  ? 281 ALA C CB  1 
ATOM   7630  N N   . PHE C 1 282 ? -29.052 -10.551 -33.352 1.00 34.31  ? 282 PHE C N   1 
ATOM   7631  C CA  . PHE C 1 282 ? -28.734 -9.223  -32.850 1.00 31.31  ? 282 PHE C CA  1 
ATOM   7632  C C   . PHE C 1 282 ? -27.470 -8.713  -33.482 1.00 37.80  ? 282 PHE C C   1 
ATOM   7633  O O   . PHE C 1 282 ? -26.438 -9.380  -33.453 1.00 39.16  ? 282 PHE C O   1 
ATOM   7634  C CB  . PHE C 1 282 ? -28.589 -9.267  -31.342 1.00 30.84  ? 282 PHE C CB  1 
ATOM   7635  C CG  . PHE C 1 282 ? -29.865 -9.606  -30.631 1.00 29.70  ? 282 PHE C CG  1 
ATOM   7636  C CD1 . PHE C 1 282 ? -30.745 -8.619  -30.267 1.00 31.42  ? 282 PHE C CD1 1 
ATOM   7637  C CD2 . PHE C 1 282 ? -30.221 -10.926 -30.400 1.00 30.49  ? 282 PHE C CD2 1 
ATOM   7638  C CE1 . PHE C 1 282 ? -31.911 -8.934  -29.601 1.00 31.62  ? 282 PHE C CE1 1 
ATOM   7639  C CE2 . PHE C 1 282 ? -31.386 -11.242 -29.735 1.00 31.72  ? 282 PHE C CE2 1 
ATOM   7640  C CZ  . PHE C 1 282 ? -32.214 -10.243 -29.321 1.00 28.96  ? 282 PHE C CZ  1 
ATOM   7641  N N   . ALA C 1 283 ? -27.571 -7.562  -34.124 1.00 34.39  ? 283 ALA C N   1 
ATOM   7642  C CA  . ALA C 1 283 ? -26.435 -7.010  -34.800 1.00 34.47  ? 283 ALA C CA  1 
ATOM   7643  C C   . ALA C 1 283 ? -25.428 -6.507  -33.783 1.00 42.36  ? 283 ALA C C   1 
ATOM   7644  O O   . ALA C 1 283 ? -25.787 -6.094  -32.680 1.00 41.90  ? 283 ALA C O   1 
ATOM   7645  C CB  . ALA C 1 283 ? -26.874 -5.919  -35.724 1.00 34.78  ? 283 ALA C CB  1 
ATOM   7646  N N   . VAL C 1 284 ? -24.163 -6.534  -34.175 1.00 42.87  ? 284 VAL C N   1 
ATOM   7647  C CA  . VAL C 1 284 ? -23.076 -6.100  -33.315 1.00 44.29  ? 284 VAL C CA  1 
ATOM   7648  C C   . VAL C 1 284 ? -22.814 -4.598  -33.400 1.00 52.26  ? 284 VAL C C   1 
ATOM   7649  O O   . VAL C 1 284 ? -23.155 -3.949  -34.393 1.00 51.77  ? 284 VAL C O   1 
ATOM   7650  C CB  . VAL C 1 284 ? -21.798 -6.886  -33.638 1.00 46.94  ? 284 VAL C CB  1 
ATOM   7651  C CG1 . VAL C 1 284 ? -20.686 -6.469  -32.734 1.00 47.06  ? 284 VAL C CG1 1 
ATOM   7652  C CG2 . VAL C 1 284 ? -22.062 -8.337  -33.491 1.00 46.35  ? 284 VAL C CG2 1 
ATOM   7653  N N   . LEU C 1 285 ? -22.205 -4.061  -32.344 1.00 52.64  ? 285 LEU C N   1 
ATOM   7654  C CA  . LEU C 1 285 ? -21.838 -2.645  -32.259 1.00 53.95  ? 285 LEU C CA  1 
ATOM   7655  C C   . LEU C 1 285 ? -20.828 -2.239  -33.342 1.00 64.79  ? 285 LEU C C   1 
ATOM   7656  O O   . LEU C 1 285 ? -19.743 -2.807  -33.409 1.00 65.00  ? 285 LEU C O   1 
ATOM   7657  C CB  . LEU C 1 285 ? -21.219 -2.376  -30.891 1.00 53.09  ? 285 LEU C CB  1 
ATOM   7658  C CG  . LEU C 1 285 ? -22.241 -2.108  -29.793 1.00 56.46  ? 285 LEU C CG  1 
ATOM   7659  C CD1 . LEU C 1 285 ? -21.568 -1.776  -28.483 1.00 56.08  ? 285 LEU C CD1 1 
ATOM   7660  C CD2 . LEU C 1 285 ? -23.182 -0.997  -30.239 1.00 57.73  ? 285 LEU C CD2 1 
ATOM   7661  N N   . ASP C 1 286 ? -21.173 -1.231  -34.146 1.00 65.52  ? 286 ASP C N   1 
ATOM   7662  C CA  . ASP C 1 286 ? -20.312 -0.731  -35.229 1.00 66.37  ? 286 ASP C CA  1 
ATOM   7663  C C   . ASP C 1 286 ? -18.889 -0.386  -34.800 1.00 72.65  ? 286 ASP C C   1 
ATOM   7664  O O   . ASP C 1 286 ? -18.349 0.659   -35.176 1.00 72.52  ? 286 ASP C O   1 
ATOM   7665  C CB  . ASP C 1 286 ? -20.951 0.488   -35.910 1.00 68.23  ? 286 ASP C CB  1 
ATOM   7666  C CG  . ASP C 1 286 ? -21.878 0.097   -37.033 1.00 83.05  ? 286 ASP C CG  1 
ATOM   7667  O OD1 . ASP C 1 286 ? -21.594 -0.921  -37.706 1.00 84.62  ? 286 ASP C OD1 1 
ATOM   7668  O OD2 . ASP C 1 286 ? -22.908 0.782   -37.219 1.00 90.75  ? 286 ASP C OD2 1 
ATOM   7669  N N   . GLN C 1 287 ? -18.276 -1.283  -34.044 1.00 71.01  ? 287 GLN C N   1 
ATOM   7670  C CA  . GLN C 1 287 ? -16.921 -1.080  -33.555 1.00 71.51  ? 287 GLN C CA  1 
ATOM   7671  C C   . GLN C 1 287 ? -15.893 -1.273  -34.671 1.00 76.14  ? 287 GLN C C   1 
ATOM   7672  O O   . GLN C 1 287 ? -14.738 -1.614  -34.384 1.00 75.77  ? 287 GLN C O   1 
ATOM   7673  C CB  . GLN C 1 287 ? -16.647 -2.048  -32.392 1.00 73.24  ? 287 GLN C CB  1 
ATOM   7674  C CG  . GLN C 1 287 ? -16.996 -3.508  -32.700 1.00 98.39  ? 287 GLN C CG  1 
ATOM   7675  C CD  . GLN C 1 287 ? -16.872 -4.415  -31.485 1.00 122.23 ? 287 GLN C CD  1 
ATOM   7676  O OE1 . GLN C 1 287 ? -15.768 -4.663  -30.984 1.00 117.05 ? 287 GLN C OE1 1 
ATOM   7677  N NE2 . GLN C 1 287 ? -18.007 -4.924  -31.009 1.00 115.15 ? 287 GLN C NE2 1 
ATOM   7678  N N   . ASP C 1 288 ? -16.316 -1.032  -35.924 1.00 72.89  ? 288 ASP C N   1 
ATOM   7679  C CA  . ASP C 1 288 ? -15.468 -1.205  -37.123 1.00 72.57  ? 288 ASP C CA  1 
ATOM   7680  C C   . ASP C 1 288 ? -13.994 -0.778  -36.940 1.00 77.63  ? 288 ASP C C   1 
ATOM   7681  O O   . ASP C 1 288 ? -13.578 -0.374  -35.835 1.00 78.01  ? 288 ASP C O   1 
ATOM   7682  C CB  . ASP C 1 288 ? -16.066 -0.521  -38.370 1.00 73.94  ? 288 ASP C CB  1 
ATOM   7683  C CG  . ASP C 1 288 ? -17.513 -0.917  -38.640 1.00 82.83  ? 288 ASP C CG  1 
ATOM   7684  O OD1 . ASP C 1 288 ? -17.762 -2.063  -39.078 1.00 82.32  ? 288 ASP C OD1 1 
ATOM   7685  O OD2 . ASP C 1 288 ? -18.391 -0.030  -38.544 1.00 88.92  ? 288 ASP C OD2 1 
ATOM   7686  N N   . GLN C 1 289 ? -13.204 -0.959  -38.004 1.00 73.24  ? 289 GLN C N   1 
ATOM   7687  C CA  . GLN C 1 289 ? -11.782 -0.600  -38.023 1.00 72.48  ? 289 GLN C CA  1 
ATOM   7688  C C   . GLN C 1 289 ? -10.928 -1.280  -36.936 1.00 76.27  ? 289 GLN C C   1 
ATOM   7689  O O   . GLN C 1 289 ? -9.691  -1.225  -36.977 1.00 76.55  ? 289 GLN C O   1 
ATOM   7690  C CB  . GLN C 1 289 ? -11.602 0.932   -38.018 1.00 73.65  ? 289 GLN C CB  1 
ATOM   7691  C CG  . GLN C 1 289 ? -12.280 1.672   -36.856 1.00 89.11  ? 289 GLN C CG  1 
ATOM   7692  C CD  . GLN C 1 289 ? -12.013 3.160   -36.847 1.00 109.91 ? 289 GLN C CD  1 
ATOM   7693  O OE1 . GLN C 1 289 ? -10.924 3.604   -36.478 1.00 102.69 ? 289 GLN C OE1 1 
ATOM   7694  N NE2 . GLN C 1 289 ? -13.011 3.944   -37.243 1.00 107.13 ? 289 GLN C NE2 1 
ATOM   7695  N N   . LYS C 1 290 ? -11.596 -1.967  -36.007 1.00 72.33  ? 290 LYS C N   1 
ATOM   7696  C CA  . LYS C 1 290 ? -10.936 -2.602  -34.862 1.00 72.06  ? 290 LYS C CA  1 
ATOM   7697  C C   . LYS C 1 290 ? -9.767  -3.536  -35.161 1.00 75.76  ? 290 LYS C C   1 
ATOM   7698  O O   . LYS C 1 290 ? -8.869  -3.690  -34.325 1.00 76.54  ? 290 LYS C O   1 
ATOM   7699  C CB  . LYS C 1 290 ? -11.940 -3.263  -33.910 1.00 74.67  ? 290 LYS C CB  1 
ATOM   7700  C CG  . LYS C 1 290 ? -12.943 -4.193  -34.582 1.00 94.55  ? 290 LYS C CG  1 
ATOM   7701  C CD  . LYS C 1 290 ? -12.283 -5.028  -35.661 1.00 108.13 ? 290 LYS C CD  1 
ATOM   7702  C CE  . LYS C 1 290 ? -13.263 -5.970  -36.317 1.00 119.17 ? 290 LYS C CE  1 
ATOM   7703  N NZ  . LYS C 1 290 ? -14.556 -6.014  -35.574 1.00 127.34 ? 290 LYS C NZ  1 
ATOM   7704  N N   . GLU C 1 291 ? -9.770  -4.125  -36.357 1.00 70.56  ? 291 GLU C N   1 
ATOM   7705  C CA  . GLU C 1 291 ? -8.748  -5.082  -36.786 1.00 69.89  ? 291 GLU C CA  1 
ATOM   7706  C C   . GLU C 1 291 ? -8.141  -5.988  -35.694 1.00 71.67  ? 291 GLU C C   1 
ATOM   7707  O O   . GLU C 1 291 ? -8.644  -7.097  -35.435 1.00 70.16  ? 291 GLU C O   1 
ATOM   7708  C CB  . GLU C 1 291 ? -7.665  -4.412  -37.648 1.00 71.57  ? 291 GLU C CB  1 
ATOM   7709  C CG  . GLU C 1 291 ? -6.863  -3.314  -36.953 1.00 84.98  ? 291 GLU C CG  1 
ATOM   7710  C CD  . GLU C 1 291 ? -5.811  -2.694  -37.861 1.00 109.82 ? 291 GLU C CD  1 
ATOM   7711  O OE1 . GLU C 1 291 ? -4.909  -3.419  -38.348 1.00 116.53 ? 291 GLU C OE1 1 
ATOM   7712  O OE2 . GLU C 1 291 ? -5.909  -1.470  -38.092 1.00 92.45  ? 291 GLU C OE2 1 
ATOM   7713  N N   . ILE C 1 292 ? -7.056  -5.516  -35.073 1.00 67.82  ? 292 ILE C N   1 
ATOM   7714  C CA  . ILE C 1 292 ? -6.344  -6.278  -34.032 1.00 67.55  ? 292 ILE C CA  1 
ATOM   7715  C C   . ILE C 1 292 ? -7.256  -6.570  -32.826 1.00 68.86  ? 292 ILE C C   1 
ATOM   7716  O O   . ILE C 1 292 ? -7.027  -6.046  -31.716 1.00 69.00  ? 292 ILE C O   1 
ATOM   7717  C CB  . ILE C 1 292 ? -5.035  -5.534  -33.521 1.00 70.71  ? 292 ILE C CB  1 
ATOM   7718  C CG1 . ILE C 1 292 ? -4.246  -4.890  -34.670 1.00 70.36  ? 292 ILE C CG1 1 
ATOM   7719  C CG2 . ILE C 1 292 ? -4.114  -6.491  -32.751 1.00 71.54  ? 292 ILE C CG2 1 
ATOM   7720  C CD1 . ILE C 1 292 ? -3.074  -4.058  -34.194 1.00 71.55  ? 292 ILE C CD1 1 
ATOM   7721  N N   . ILE C 1 293 ? -8.293  -7.380  -33.048 1.00 61.33  ? 293 ILE C N   1 
ATOM   7722  C CA  . ILE C 1 293 ? -9.227  -7.680  -31.975 1.00 60.11  ? 293 ILE C CA  1 
ATOM   7723  C C   . ILE C 1 293 ? -9.289  -9.165  -31.657 1.00 62.36  ? 293 ILE C C   1 
ATOM   7724  O O   . ILE C 1 293 ? -9.778  -9.972  -32.464 1.00 64.04  ? 293 ILE C O   1 
ATOM   7725  C CB  . ILE C 1 293 ? -10.636 -7.170  -32.287 1.00 63.03  ? 293 ILE C CB  1 
ATOM   7726  C CG1 . ILE C 1 293 ? -11.049 -7.610  -33.696 1.00 63.87  ? 293 ILE C CG1 1 
ATOM   7727  C CG2 . ILE C 1 293 ? -10.710 -5.646  -32.121 1.00 62.89  ? 293 ILE C CG2 1 
ATOM   7728  C CD1 . ILE C 1 293 ? -12.555 -7.550  -33.942 1.00 71.36  ? 293 ILE C CD1 1 
ATOM   7729  N N   . ASP C 1 294 ? -8.789  -9.512  -30.474 1.00 54.34  ? 294 ASP C N   1 
ATOM   7730  C CA  . ASP C 1 294 ? -8.790  -10.881 -29.987 1.00 51.46  ? 294 ASP C CA  1 
ATOM   7731  C C   . ASP C 1 294 ? -10.242 -11.409 -29.957 1.00 51.49  ? 294 ASP C C   1 
ATOM   7732  O O   . ASP C 1 294 ? -11.017 -11.094 -29.055 1.00 53.27  ? 294 ASP C O   1 
ATOM   7733  C CB  . ASP C 1 294 ? -8.135  -10.901 -28.599 1.00 52.66  ? 294 ASP C CB  1 
ATOM   7734  C CG  . ASP C 1 294 ? -8.093  -12.281 -27.981 1.00 64.21  ? 294 ASP C CG  1 
ATOM   7735  O OD1 . ASP C 1 294 ? -7.737  -12.368 -26.773 1.00 64.91  ? 294 ASP C OD1 1 
ATOM   7736  O OD2 . ASP C 1 294 ? -8.400  -13.267 -28.695 1.00 69.37  ? 294 ASP C OD2 1 
ATOM   7737  N N   . THR C 1 295 ? -10.624 -12.150 -30.990 1.00 42.91  ? 295 THR C N   1 
ATOM   7738  C CA  . THR C 1 295 ? -11.962 -12.723 -31.084 1.00 39.98  ? 295 THR C CA  1 
ATOM   7739  C C   . THR C 1 295 ? -12.335 -13.526 -29.838 1.00 37.93  ? 295 THR C C   1 
ATOM   7740  O O   . THR C 1 295 ? -13.475 -13.528 -29.399 1.00 37.42  ? 295 THR C O   1 
ATOM   7741  C CB  . THR C 1 295 ? -12.045 -13.663 -32.270 1.00 52.36  ? 295 THR C CB  1 
ATOM   7742  O OG1 . THR C 1 295 ? -11.470 -13.026 -33.421 1.00 58.92  ? 295 THR C OG1 1 
ATOM   7743  C CG2 . THR C 1 295 ? -13.493 -14.067 -32.516 1.00 51.31  ? 295 THR C CG2 1 
ATOM   7744  N N   . ASN C 1 296 ? -11.365 -14.238 -29.298 1.00 31.40  ? 296 ASN C N   1 
ATOM   7745  C CA  . ASN C 1 296 ? -11.572 -15.039 -28.119 1.00 29.53  ? 296 ASN C CA  1 
ATOM   7746  C C   . ASN C 1 296 ? -11.808 -14.138 -26.914 1.00 32.51  ? 296 ASN C C   1 
ATOM   7747  O O   . ASN C 1 296 ? -12.827 -14.294 -26.203 1.00 33.48  ? 296 ASN C O   1 
ATOM   7748  C CB  . ASN C 1 296 ? -10.376 -15.965 -27.883 1.00 31.06  ? 296 ASN C CB  1 
ATOM   7749  C CG  . ASN C 1 296 ? -10.235 -17.034 -28.969 1.00 67.79  ? 296 ASN C CG  1 
ATOM   7750  O OD1 . ASN C 1 296 ? -9.142  -17.253 -29.496 1.00 62.62  ? 296 ASN C OD1 1 
ATOM   7751  N ND2 . ASN C 1 296 ? -11.351 -17.685 -29.325 1.00 63.15  ? 296 ASN C ND2 1 
ATOM   7752  N N   . GLY C 1 297 ? -10.883 -13.205 -26.676 1.00 22.61  ? 297 GLY C N   1 
ATOM   7753  C CA  . GLY C 1 297 ? -11.014 -12.268 -25.559 1.00 20.82  ? 297 GLY C CA  1 
ATOM   7754  C C   . GLY C 1 297 ? -12.361 -11.509 -25.609 1.00 24.53  ? 297 GLY C C   1 
ATOM   7755  O O   . GLY C 1 297 ? -12.995 -11.201 -24.552 1.00 22.56  ? 297 GLY C O   1 
ATOM   7756  N N   . ALA C 1 298 ? -12.814 -11.225 -26.830 1.00 18.78  ? 298 ALA C N   1 
ATOM   7757  C CA  . ALA C 1 298 ? -14.102 -10.554 -26.996 1.00 16.94  ? 298 ALA C CA  1 
ATOM   7758  C C   . ALA C 1 298 ? -15.259 -11.434 -26.535 1.00 16.72  ? 298 ALA C C   1 
ATOM   7759  O O   . ALA C 1 298 ? -16.222 -10.930 -25.955 1.00 13.16  ? 298 ALA C O   1 
ATOM   7760  C CB  . ALA C 1 298 ? -14.298 -10.100 -28.427 1.00 17.43  ? 298 ALA C CB  1 
ATOM   7761  N N   . GLY C 1 299 ? -15.180 -12.747 -26.818 1.00 12.97  ? 299 GLY C N   1 
ATOM   7762  C CA  . GLY C 1 299 ? -16.216 -13.680 -26.415 1.00 10.64  ? 299 GLY C CA  1 
ATOM   7763  C C   . GLY C 1 299 ? -16.306 -13.698 -24.888 1.00 16.33  ? 299 GLY C C   1 
ATOM   7764  O O   . GLY C 1 299 ? -17.396 -13.762 -24.332 1.00 17.34  ? 299 GLY C O   1 
ATOM   7765  N N   . ASP C 1 300 ? -15.153 -13.643 -24.216 1.00 13.94  ? 300 ASP C N   1 
ATOM   7766  C CA  . ASP C 1 300 ? -15.085 -13.695 -22.754 1.00 13.40  ? 300 ASP C CA  1 
ATOM   7767  C C   . ASP C 1 300 ? -15.664 -12.433 -22.145 1.00 22.14  ? 300 ASP C C   1 
ATOM   7768  O O   . ASP C 1 300 ? -16.420 -12.485 -21.167 1.00 25.10  ? 300 ASP C O   1 
ATOM   7769  C CB  . ASP C 1 300 ? -13.644 -13.898 -22.276 1.00 13.90  ? 300 ASP C CB  1 
ATOM   7770  C CG  . ASP C 1 300 ? -13.095 -15.283 -22.610 1.00 18.99  ? 300 ASP C CG  1 
ATOM   7771  O OD1 . ASP C 1 300 ? -13.891 -16.213 -22.880 1.00 18.17  ? 300 ASP C OD1 1 
ATOM   7772  O OD2 . ASP C 1 300 ? -11.860 -15.424 -22.593 1.00 25.69  ? 300 ASP C OD2 1 
ATOM   7773  N N   . ALA C 1 301 ? -15.313 -11.304 -22.752 1.00 18.57  ? 301 ALA C N   1 
ATOM   7774  C CA  . ALA C 1 301 ? -15.834 -9.986  -22.396 1.00 16.76  ? 301 ALA C CA  1 
ATOM   7775  C C   . ALA C 1 301 ? -17.358 -9.871  -22.666 1.00 20.07  ? 301 ALA C C   1 
ATOM   7776  O O   . ALA C 1 301 ? -18.070 -9.222  -21.896 1.00 19.78  ? 301 ALA C O   1 
ATOM   7777  C CB  . ALA C 1 301 ? -15.069 -8.921  -23.165 1.00 17.09  ? 301 ALA C CB  1 
ATOM   7778  N N   . PHE C 1 302 ? -17.841 -10.450 -23.766 1.00 15.39  ? 302 PHE C N   1 
ATOM   7779  C CA  . PHE C 1 302 ? -19.269 -10.457 -24.045 1.00 15.60  ? 302 PHE C CA  1 
ATOM   7780  C C   . PHE C 1 302 ? -20.011 -11.131 -22.896 1.00 21.88  ? 302 PHE C C   1 
ATOM   7781  O O   . PHE C 1 302 ? -21.022 -10.623 -22.386 1.00 24.83  ? 302 PHE C O   1 
ATOM   7782  C CB  . PHE C 1 302 ? -19.609 -11.174 -25.363 1.00 18.13  ? 302 PHE C CB  1 
ATOM   7783  C CG  . PHE C 1 302 ? -21.113 -11.359 -25.591 1.00 19.90  ? 302 PHE C CG  1 
ATOM   7784  C CD1 . PHE C 1 302 ? -21.812 -10.490 -26.427 1.00 22.42  ? 302 PHE C CD1 1 
ATOM   7785  C CD2 . PHE C 1 302 ? -21.833 -12.344 -24.905 1.00 20.98  ? 302 PHE C CD2 1 
ATOM   7786  C CE1 . PHE C 1 302 ? -23.187 -10.661 -26.649 1.00 24.33  ? 302 PHE C CE1 1 
ATOM   7787  C CE2 . PHE C 1 302 ? -23.187 -12.510 -25.097 1.00 24.38  ? 302 PHE C CE2 1 
ATOM   7788  C CZ  . PHE C 1 302 ? -23.877 -11.681 -25.997 1.00 23.69  ? 302 PHE C CZ  1 
ATOM   7789  N N   . VAL C 1 303 ? -19.558 -12.313 -22.530 1.00 17.86  ? 303 VAL C N   1 
ATOM   7790  C CA  . VAL C 1 303 ? -20.221 -13.055 -21.469 1.00 16.97  ? 303 VAL C CA  1 
ATOM   7791  C C   . VAL C 1 303 ? -20.292 -12.220 -20.195 1.00 22.57  ? 303 VAL C C   1 
ATOM   7792  O O   . VAL C 1 303 ? -21.323 -12.181 -19.523 1.00 22.16  ? 303 VAL C O   1 
ATOM   7793  C CB  . VAL C 1 303 ? -19.467 -14.387 -21.158 1.00 18.75  ? 303 VAL C CB  1 
ATOM   7794  C CG1 . VAL C 1 303 ? -19.948 -14.965 -19.818 1.00 18.02  ? 303 VAL C CG1 1 
ATOM   7795  C CG2 . VAL C 1 303 ? -19.670 -15.368 -22.272 1.00 17.57  ? 303 VAL C CG2 1 
ATOM   7796  N N   . GLY C 1 304 ? -19.162 -11.617 -19.828 1.00 20.24  ? 304 GLY C N   1 
ATOM   7797  C CA  . GLY C 1 304 ? -19.071 -10.831 -18.606 1.00 20.42  ? 304 GLY C CA  1 
ATOM   7798  C C   . GLY C 1 304 ? -20.091 -9.698  -18.676 1.00 27.17  ? 304 GLY C C   1 
ATOM   7799  O O   . GLY C 1 304 ? -20.768 -9.394  -17.696 1.00 28.40  ? 304 GLY C O   1 
ATOM   7800  N N   . GLY C 1 305 ? -20.208 -9.055  -19.826 1.00 24.37  ? 305 GLY C N   1 
ATOM   7801  C CA  . GLY C 1 305 ? -21.200 -7.994  -19.967 1.00 24.69  ? 305 GLY C CA  1 
ATOM   7802  C C   . GLY C 1 305 ? -22.627 -8.550  -19.793 1.00 26.52  ? 305 GLY C C   1 
ATOM   7803  O O   . GLY C 1 305 ? -23.422 -7.976  -19.052 1.00 27.73  ? 305 GLY C O   1 
ATOM   7804  N N   . PHE C 1 306 ? -22.942 -9.656  -20.467 1.00 18.84  ? 306 PHE C N   1 
ATOM   7805  C CA  . PHE C 1 306 ? -24.257 -10.269 -20.343 1.00 17.25  ? 306 PHE C CA  1 
ATOM   7806  C C   . PHE C 1 306 ? -24.552 -10.537 -18.885 1.00 25.27  ? 306 PHE C C   1 
ATOM   7807  O O   . PHE C 1 306 ? -25.619 -10.154 -18.374 1.00 26.76  ? 306 PHE C O   1 
ATOM   7808  C CB  . PHE C 1 306 ? -24.269 -11.605 -21.075 1.00 18.51  ? 306 PHE C CB  1 
ATOM   7809  C CG  . PHE C 1 306 ? -25.647 -12.186 -21.278 1.00 18.94  ? 306 PHE C CG  1 
ATOM   7810  C CD1 . PHE C 1 306 ? -26.361 -12.662 -20.203 1.00 20.32  ? 306 PHE C CD1 1 
ATOM   7811  C CD2 . PHE C 1 306 ? -26.195 -12.324 -22.555 1.00 18.53  ? 306 PHE C CD2 1 
ATOM   7812  C CE1 . PHE C 1 306 ? -27.611 -13.243 -20.387 1.00 20.08  ? 306 PHE C CE1 1 
ATOM   7813  C CE2 . PHE C 1 306 ? -27.475 -12.836 -22.719 1.00 19.56  ? 306 PHE C CE2 1 
ATOM   7814  C CZ  . PHE C 1 306 ? -28.154 -13.325 -21.643 1.00 17.38  ? 306 PHE C CZ  1 
ATOM   7815  N N   . LEU C 1 307 ? -23.618 -11.227 -18.213 1.00 20.50  ? 307 LEU C N   1 
ATOM   7816  C CA  . LEU C 1 307 ? -23.804 -11.640 -16.825 1.00 17.58  ? 307 LEU C CA  1 
ATOM   7817  C C   . LEU C 1 307 ? -24.054 -10.447 -15.905 1.00 25.40  ? 307 LEU C C   1 
ATOM   7818  O O   . LEU C 1 307 ? -24.835 -10.547 -14.933 1.00 26.88  ? 307 LEU C O   1 
ATOM   7819  C CB  . LEU C 1 307 ? -22.603 -12.439 -16.337 1.00 15.88  ? 307 LEU C CB  1 
ATOM   7820  C CG  . LEU C 1 307 ? -22.264 -13.779 -16.993 1.00 18.00  ? 307 LEU C CG  1 
ATOM   7821  C CD1 . LEU C 1 307 ? -20.762 -14.118 -16.740 1.00 17.93  ? 307 LEU C CD1 1 
ATOM   7822  C CD2 . LEU C 1 307 ? -23.184 -14.876 -16.467 1.00 14.69  ? 307 LEU C CD2 1 
ATOM   7823  N N   . SER C 1 308 ? -23.373 -9.334  -16.207 1.00 19.29  ? 308 SER C N   1 
ATOM   7824  C CA  . SER C 1 308 ? -23.451 -8.118  -15.429 1.00 17.22  ? 308 SER C CA  1 
ATOM   7825  C C   . SER C 1 308 ? -24.854 -7.530  -15.353 1.00 24.28  ? 308 SER C C   1 
ATOM   7826  O O   . SER C 1 308 ? -25.129 -6.635  -14.542 1.00 23.09  ? 308 SER C O   1 
ATOM   7827  C CB  . SER C 1 308 ? -22.498 -7.081  -16.013 1.00 18.59  ? 308 SER C CB  1 
ATOM   7828  O OG  . SER C 1 308 ? -23.080 -6.387  -17.094 1.00 21.45  ? 308 SER C OG  1 
ATOM   7829  N N   . GLN C 1 309 ? -25.732 -7.977  -16.247 1.00 22.66  ? 309 GLN C N   1 
ATOM   7830  C CA  . GLN C 1 309 ? -27.106 -7.484  -16.256 1.00 21.77  ? 309 GLN C CA  1 
ATOM   7831  C C   . GLN C 1 309 ? -27.994 -8.608  -15.764 1.00 26.50  ? 309 GLN C C   1 
ATOM   7832  O O   . GLN C 1 309 ? -28.859 -8.402  -14.937 1.00 24.79  ? 309 GLN C O   1 
ATOM   7833  C CB  . GLN C 1 309 ? -27.526 -7.043  -17.673 1.00 23.01  ? 309 GLN C CB  1 
ATOM   7834  C CG  . GLN C 1 309 ? -26.634 -5.949  -18.277 1.00 29.24  ? 309 GLN C CG  1 
ATOM   7835  C CD  . GLN C 1 309 ? -26.652 -4.664  -17.455 1.00 38.34  ? 309 GLN C CD  1 
ATOM   7836  O OE1 . GLN C 1 309 ? -27.698 -4.031  -17.309 1.00 42.62  ? 309 GLN C OE1 1 
ATOM   7837  N NE2 . GLN C 1 309 ? -25.499 -4.259  -16.919 1.00 10.15  ? 309 GLN C NE2 1 
ATOM   7838  N N   . LEU C 1 310 ? -27.747 -9.810  -16.268 1.00 27.75  ? 310 LEU C N   1 
ATOM   7839  C CA  . LEU C 1 310 ? -28.547 -10.992 -15.940 1.00 28.54  ? 310 LEU C CA  1 
ATOM   7840  C C   . LEU C 1 310 ? -28.690 -11.081 -14.425 1.00 35.61  ? 310 LEU C C   1 
ATOM   7841  O O   . LEU C 1 310 ? -29.733 -11.420 -13.873 1.00 34.77  ? 310 LEU C O   1 
ATOM   7842  C CB  . LEU C 1 310 ? -27.832 -12.239 -16.499 1.00 28.36  ? 310 LEU C CB  1 
ATOM   7843  C CG  . LEU C 1 310 ? -28.468 -13.645 -16.536 1.00 31.89  ? 310 LEU C CG  1 
ATOM   7844  C CD1 . LEU C 1 310 ? -28.119 -14.417 -15.291 1.00 31.84  ? 310 LEU C CD1 1 
ATOM   7845  C CD2 . LEU C 1 310 ? -29.980 -13.633 -16.736 1.00 29.66  ? 310 LEU C CD2 1 
ATOM   7846  N N   . VAL C 1 311 ? -27.630 -10.666 -13.762 1.00 35.14  ? 311 VAL C N   1 
ATOM   7847  C CA  . VAL C 1 311 ? -27.509 -10.725 -12.317 1.00 35.29  ? 311 VAL C CA  1 
ATOM   7848  C C   . VAL C 1 311 ? -28.550 -9.857  -11.581 1.00 42.79  ? 311 VAL C C   1 
ATOM   7849  O O   . VAL C 1 311 ? -28.858 -10.063 -10.388 1.00 42.37  ? 311 VAL C O   1 
ATOM   7850  C CB  . VAL C 1 311 ? -26.069 -10.341 -11.939 1.00 37.27  ? 311 VAL C CB  1 
ATOM   7851  C CG1 . VAL C 1 311 ? -25.980 -8.918  -11.521 1.00 35.71  ? 311 VAL C CG1 1 
ATOM   7852  C CG2 . VAL C 1 311 ? -25.499 -11.275 -10.940 1.00 37.37  ? 311 VAL C CG2 1 
ATOM   7853  N N   . SER C 1 312 ? -29.066 -8.853  -12.278 1.00 40.00  ? 312 SER C N   1 
ATOM   7854  C CA  . SER C 1 312 ? -30.067 -7.967  -11.693 1.00 40.11  ? 312 SER C CA  1 
ATOM   7855  C C   . SER C 1 312 ? -31.379 -8.047  -12.481 1.00 45.98  ? 312 SER C C   1 
ATOM   7856  O O   . SER C 1 312 ? -32.170 -7.112  -12.504 1.00 46.50  ? 312 SER C O   1 
ATOM   7857  C CB  . SER C 1 312 ? -29.569 -6.515  -11.547 1.00 43.72  ? 312 SER C CB  1 
ATOM   7858  O OG  . SER C 1 312 ? -28.630 -6.117  -12.543 1.00 55.00  ? 312 SER C OG  1 
ATOM   7859  N N   . ASP C 1 313 ? -31.587 -9.186  -13.131 1.00 42.52  ? 313 ASP C N   1 
ATOM   7860  C CA  . ASP C 1 313 ? -32.790 -9.449  -13.887 1.00 42.00  ? 313 ASP C CA  1 
ATOM   7861  C C   . ASP C 1 313 ? -33.126 -8.567  -15.068 1.00 43.43  ? 313 ASP C C   1 
ATOM   7862  O O   . ASP C 1 313 ? -34.255 -8.586  -15.522 1.00 44.44  ? 313 ASP C O   1 
ATOM   7863  C CB  . ASP C 1 313 ? -33.990 -9.604  -12.976 1.00 44.19  ? 313 ASP C CB  1 
ATOM   7864  C CG  . ASP C 1 313 ? -34.079 -10.970 -12.389 1.00 54.84  ? 313 ASP C CG  1 
ATOM   7865  O OD1 . ASP C 1 313 ? -34.748 -11.827 -13.000 1.00 54.78  ? 313 ASP C OD1 1 
ATOM   7866  O OD2 . ASP C 1 313 ? -33.403 -11.198 -11.364 1.00 63.77  ? 313 ASP C OD2 1 
ATOM   7867  N N   . LYS C 1 314 ? -32.152 -7.848  -15.615 1.00 37.88  ? 314 LYS C N   1 
ATOM   7868  C CA  . LYS C 1 314 ? -32.397 -7.026  -16.802 1.00 37.15  ? 314 LYS C CA  1 
ATOM   7869  C C   . LYS C 1 314 ? -32.900 -7.957  -17.896 1.00 45.88  ? 314 LYS C C   1 
ATOM   7870  O O   . LYS C 1 314 ? -32.594 -9.150  -17.880 1.00 46.93  ? 314 LYS C O   1 
ATOM   7871  C CB  . LYS C 1 314 ? -31.117 -6.356  -17.295 1.00 38.12  ? 314 LYS C CB  1 
ATOM   7872  C CG  . LYS C 1 314 ? -30.726 -5.087  -16.602 1.00 45.65  ? 314 LYS C CG  1 
ATOM   7873  C CD  . LYS C 1 314 ? -31.897 -4.521  -15.836 1.00 63.25  ? 314 LYS C CD  1 
ATOM   7874  C CE  . LYS C 1 314 ? -31.433 -3.595  -14.712 1.00 70.79  ? 314 LYS C CE  1 
ATOM   7875  N NZ  . LYS C 1 314 ? -31.113 -4.379  -13.499 1.00 69.92  ? 314 LYS C NZ  1 
ATOM   7876  N N   . PRO C 1 315 ? -33.671 -7.416  -18.841 1.00 43.93  ? 315 PRO C N   1 
ATOM   7877  C CA  . PRO C 1 315 ? -34.236 -8.233  -19.923 1.00 42.13  ? 315 PRO C CA  1 
ATOM   7878  C C   . PRO C 1 315 ? -33.081 -8.752  -20.768 1.00 41.20  ? 315 PRO C C   1 
ATOM   7879  O O   . PRO C 1 315 ? -32.031 -8.088  -20.856 1.00 36.33  ? 315 PRO C O   1 
ATOM   7880  C CB  . PRO C 1 315 ? -35.088 -7.229  -20.731 1.00 43.24  ? 315 PRO C CB  1 
ATOM   7881  C CG  . PRO C 1 315 ? -35.316 -6.096  -19.841 1.00 47.64  ? 315 PRO C CG  1 
ATOM   7882  C CD  . PRO C 1 315 ? -34.146 -6.020  -18.899 1.00 43.85  ? 315 PRO C CD  1 
ATOM   7883  N N   . LEU C 1 316 ? -33.315 -9.904  -21.413 1.00 37.38  ? 316 LEU C N   1 
ATOM   7884  C CA  . LEU C 1 316 ? -32.325 -10.573 -22.262 1.00 35.90  ? 316 LEU C CA  1 
ATOM   7885  C C   . LEU C 1 316 ? -31.748 -9.658  -23.339 1.00 42.30  ? 316 LEU C C   1 
ATOM   7886  O O   . LEU C 1 316 ? -30.542 -9.676  -23.617 1.00 41.66  ? 316 LEU C O   1 
ATOM   7887  C CB  . LEU C 1 316 ? -32.914 -11.842 -22.874 1.00 34.90  ? 316 LEU C CB  1 
ATOM   7888  C CG  . LEU C 1 316 ? -33.283 -12.958 -21.884 1.00 36.81  ? 316 LEU C CG  1 
ATOM   7889  C CD1 . LEU C 1 316 ? -34.057 -14.118 -22.524 1.00 34.50  ? 316 LEU C CD1 1 
ATOM   7890  C CD2 . LEU C 1 316 ? -32.019 -13.472 -21.193 1.00 38.38  ? 316 LEU C CD2 1 
ATOM   7891  N N   . THR C 1 317 ? -32.611 -8.837  -23.922 1.00 40.55  ? 317 THR C N   1 
ATOM   7892  C CA  . THR C 1 317 ? -32.185 -7.920  -24.960 1.00 39.88  ? 317 THR C CA  1 
ATOM   7893  C C   . THR C 1 317 ? -31.147 -7.000  -24.348 1.00 42.48  ? 317 THR C C   1 
ATOM   7894  O O   . THR C 1 317 ? -30.243 -6.513  -25.044 1.00 42.70  ? 317 THR C O   1 
ATOM   7895  C CB  . THR C 1 317 ? -33.363 -7.038  -25.450 1.00 46.01  ? 317 THR C CB  1 
ATOM   7896  O OG1 . THR C 1 317 ? -34.267 -7.812  -26.262 1.00 31.27  ? 317 THR C OG1 1 
ATOM   7897  C CG2 . THR C 1 317 ? -32.821 -5.856  -26.254 1.00 48.14  ? 317 THR C CG2 1 
ATOM   7898  N N   . GLU C 1 318 ? -31.319 -6.720  -23.055 1.00 37.54  ? 318 GLU C N   1 
ATOM   7899  C CA  . GLU C 1 318 ? -30.446 -5.781  -22.318 1.00 36.71  ? 318 GLU C CA  1 
ATOM   7900  C C   . GLU C 1 318 ? -29.141 -6.473  -21.894 1.00 32.68  ? 318 GLU C C   1 
ATOM   7901  O O   . GLU C 1 318 ? -28.087 -5.850  -21.706 1.00 28.62  ? 318 GLU C O   1 
ATOM   7902  C CB  . GLU C 1 318 ? -31.181 -5.283  -21.075 1.00 38.73  ? 318 GLU C CB  1 
ATOM   7903  C CG  . GLU C 1 318 ? -30.503 -4.112  -20.389 1.00 50.25  ? 318 GLU C CG  1 
ATOM   7904  C CD  . GLU C 1 318 ? -30.729 -2.850  -21.142 1.00 81.17  ? 318 GLU C CD  1 
ATOM   7905  O OE1 . GLU C 1 318 ? -30.884 -2.946  -22.382 1.00 74.34  ? 318 GLU C OE1 1 
ATOM   7906  O OE2 . GLU C 1 318 ? -30.769 -1.778  -20.497 1.00 87.11  ? 318 GLU C OE2 1 
ATOM   7907  N N   . CYS C 1 319 ? -29.257 -7.784  -21.713 1.00 24.94  ? 319 CYS C N   1 
ATOM   7908  C CA  . CYS C 1 319 ? -28.142 -8.605  -21.363 1.00 22.08  ? 319 CYS C CA  1 
ATOM   7909  C C   . CYS C 1 319 ? -27.203 -8.661  -22.565 1.00 20.65  ? 319 CYS C C   1 
ATOM   7910  O O   . CYS C 1 319 ? -25.952 -8.545  -22.419 1.00 18.31  ? 319 CYS C O   1 
ATOM   7911  C CB  . CYS C 1 319 ? -28.654 -9.984  -21.008 1.00 22.85  ? 319 CYS C CB  1 
ATOM   7912  S SG  . CYS C 1 319 ? -29.344 -10.095 -19.323 1.00 27.10  ? 319 CYS C SG  1 
ATOM   7913  N N   . ILE C 1 320 ? -27.810 -8.809  -23.748 1.00 14.25  ? 320 ILE C N   1 
ATOM   7914  C CA  . ILE C 1 320 ? -27.073 -8.855  -25.011 1.00 15.05  ? 320 ILE C CA  1 
ATOM   7915  C C   . ILE C 1 320 ? -26.398 -7.541  -25.307 1.00 22.83  ? 320 ILE C C   1 
ATOM   7916  O O   . ILE C 1 320 ? -25.226 -7.501  -25.751 1.00 23.36  ? 320 ILE C O   1 
ATOM   7917  C CB  . ILE C 1 320 ? -27.972 -9.243  -26.196 1.00 18.66  ? 320 ILE C CB  1 
ATOM   7918  C CG1 . ILE C 1 320 ? -28.429 -10.705 -26.067 1.00 18.58  ? 320 ILE C CG1 1 
ATOM   7919  C CG2 . ILE C 1 320 ? -27.259 -8.998  -27.524 1.00 20.54  ? 320 ILE C CG2 1 
ATOM   7920  C CD1 . ILE C 1 320 ? -29.641 -11.063 -26.918 1.00 18.90  ? 320 ILE C CD1 1 
ATOM   7921  N N   . ARG C 1 321 ? -27.110 -6.464  -24.956 1.00 20.97  ? 321 ARG C N   1 
ATOM   7922  C CA  . ARG C 1 321 ? -26.636 -5.105  -25.205 1.00 20.56  ? 321 ARG C CA  1 
ATOM   7923  C C   . ARG C 1 321 ? -25.346 -4.798  -24.509 1.00 26.62  ? 321 ARG C C   1 
ATOM   7924  O O   . ARG C 1 321 ? -24.447 -4.193  -25.117 1.00 29.29  ? 321 ARG C O   1 
ATOM   7925  C CB  . ARG C 1 321 ? -27.682 -4.095  -24.796 1.00 19.80  ? 321 ARG C CB  1 
ATOM   7926  C CG  . ARG C 1 321 ? -28.165 -3.234  -25.904 1.00 33.59  ? 321 ARG C CG  1 
ATOM   7927  C CD  . ARG C 1 321 ? -28.946 -2.049  -25.357 1.00 49.07  ? 321 ARG C CD  1 
ATOM   7928  N NE  . ARG C 1 321 ? -28.097 -1.100  -24.627 1.00 51.81  ? 321 ARG C NE  1 
ATOM   7929  C CZ  . ARG C 1 321 ? -28.511 -0.430  -23.555 1.00 61.18  ? 321 ARG C CZ  1 
ATOM   7930  N NH1 . ARG C 1 321 ? -29.728 -0.683  -23.072 1.00 24.47  ? 321 ARG C NH1 1 
ATOM   7931  N NH2 . ARG C 1 321 ? -27.709 0.454   -22.949 1.00 54.24  ? 321 ARG C NH2 1 
ATOM   7932  N N   . ALA C 1 322 ? -25.273 -5.182  -23.227 1.00 23.51  ? 322 ALA C N   1 
ATOM   7933  C CA  . ALA C 1 322 ? -24.078 -4.965  -22.380 1.00 23.36  ? 322 ALA C CA  1 
ATOM   7934  C C   . ALA C 1 322 ? -22.952 -5.953  -22.687 1.00 29.01  ? 322 ALA C C   1 
ATOM   7935  O O   . ALA C 1 322 ? -21.767 -5.581  -22.681 1.00 29.09  ? 322 ALA C O   1 
ATOM   7936  C CB  . ALA C 1 322 ? -24.415 -4.948  -20.916 1.00 23.88  ? 322 ALA C CB  1 
ATOM   7937  N N   . GLY C 1 323 ? -23.330 -7.140  -23.158 1.00 26.31  ? 323 GLY C N   1 
ATOM   7938  C CA  . GLY C 1 323 ? -22.356 -8.087  -23.701 1.00 25.46  ? 323 GLY C CA  1 
ATOM   7939  C C   . GLY C 1 323 ? -21.710 -7.498  -24.969 1.00 26.40  ? 323 GLY C C   1 
ATOM   7940  O O   . GLY C 1 323 ? -20.506 -7.474  -25.077 1.00 25.58  ? 323 GLY C O   1 
ATOM   7941  N N   . HIS C 1 324 ? -22.490 -6.940  -25.889 1.00 24.51  ? 324 HIS C N   1 
ATOM   7942  C CA  . HIS C 1 324 ? -21.882 -6.326  -27.090 1.00 25.61  ? 324 HIS C CA  1 
ATOM   7943  C C   . HIS C 1 324 ? -21.011 -5.131  -26.721 1.00 31.93  ? 324 HIS C C   1 
ATOM   7944  O O   . HIS C 1 324 ? -20.032 -4.829  -27.411 1.00 31.68  ? 324 HIS C O   1 
ATOM   7945  C CB  . HIS C 1 324 ? -22.944 -5.826  -28.093 1.00 26.56  ? 324 HIS C CB  1 
ATOM   7946  C CG  . HIS C 1 324 ? -23.625 -6.907  -28.859 1.00 29.90  ? 324 HIS C CG  1 
ATOM   7947  N ND1 . HIS C 1 324 ? -22.949 -7.961  -29.432 1.00 32.35  ? 324 HIS C ND1 1 
ATOM   7948  C CD2 . HIS C 1 324 ? -24.930 -7.093  -29.156 1.00 32.45  ? 324 HIS C CD2 1 
ATOM   7949  C CE1 . HIS C 1 324 ? -23.808 -8.748  -30.060 1.00 31.96  ? 324 HIS C CE1 1 
ATOM   7950  N NE2 . HIS C 1 324 ? -25.021 -8.257  -29.887 1.00 32.51  ? 324 HIS C NE2 1 
ATOM   7951  N N   . TYR C 1 325 ? -21.424 -4.415  -25.673 1.00 30.50  ? 325 TYR C N   1 
ATOM   7952  C CA  . TYR C 1 325 ? -20.724 -3.220  -25.212 1.00 30.40  ? 325 TYR C CA  1 
ATOM   7953  C C   . TYR C 1 325 ? -19.380 -3.546  -24.579 1.00 32.57  ? 325 TYR C C   1 
ATOM   7954  O O   . TYR C 1 325 ? -18.379 -2.904  -24.864 1.00 31.82  ? 325 TYR C O   1 
ATOM   7955  C CB  . TYR C 1 325 ? -21.589 -2.452  -24.202 1.00 32.14  ? 325 TYR C CB  1 
ATOM   7956  C CG  . TYR C 1 325 ? -20.800 -1.401  -23.426 1.00 32.29  ? 325 TYR C CG  1 
ATOM   7957  C CD1 . TYR C 1 325 ? -20.276 -0.293  -24.079 1.00 34.50  ? 325 TYR C CD1 1 
ATOM   7958  C CD2 . TYR C 1 325 ? -20.464 -1.588  -22.090 1.00 31.86  ? 325 TYR C CD2 1 
ATOM   7959  C CE1 . TYR C 1 325 ? -19.500 0.635   -23.417 1.00 34.32  ? 325 TYR C CE1 1 
ATOM   7960  C CE2 . TYR C 1 325 ? -19.631 -0.690  -21.427 1.00 32.43  ? 325 TYR C CE2 1 
ATOM   7961  C CZ  . TYR C 1 325 ? -19.171 0.429   -22.099 1.00 36.00  ? 325 TYR C CZ  1 
ATOM   7962  O OH  . TYR C 1 325 ? -18.452 1.398   -21.458 1.00 27.24  ? 325 TYR C OH  1 
ATOM   7963  N N   . ALA C 1 326 ? -19.386 -4.505  -23.659 1.00 30.00  ? 326 ALA C N   1 
ATOM   7964  C CA  . ALA C 1 326 ? -18.168 -4.934  -22.951 1.00 28.81  ? 326 ALA C CA  1 
ATOM   7965  C C   . ALA C 1 326 ? -17.126 -5.470  -23.938 1.00 29.14  ? 326 ALA C C   1 
ATOM   7966  O O   . ALA C 1 326 ? -15.926 -5.300  -23.730 1.00 26.78  ? 326 ALA C O   1 
ATOM   7967  C CB  . ALA C 1 326 ? -18.536 -6.026  -21.934 1.00 29.47  ? 326 ALA C CB  1 
ATOM   7968  N N   . ALA C 1 327 ? -17.624 -6.195  -24.948 1.00 25.19  ? 327 ALA C N   1 
ATOM   7969  C CA  . ALA C 1 327 ? -16.847 -6.805  -26.033 1.00 24.80  ? 327 ALA C CA  1 
ATOM   7970  C C   . ALA C 1 327 ? -16.057 -5.761  -26.799 1.00 36.13  ? 327 ALA C C   1 
ATOM   7971  O O   . ALA C 1 327 ? -14.929 -6.021  -27.237 1.00 38.76  ? 327 ALA C O   1 
ATOM   7972  C CB  . ALA C 1 327 ? -17.803 -7.542  -26.999 1.00 24.15  ? 327 ALA C CB  1 
ATOM   7973  N N   . SER C 1 328 ? -16.679 -4.592  -26.973 1.00 35.90  ? 328 SER C N   1 
ATOM   7974  C CA  . SER C 1 328 ? -16.135 -3.469  -27.756 1.00 37.23  ? 328 SER C CA  1 
ATOM   7975  C C   . SER C 1 328 ? -15.069 -2.669  -27.032 1.00 41.08  ? 328 SER C C   1 
ATOM   7976  O O   . SER C 1 328 ? -14.074 -2.260  -27.610 1.00 38.65  ? 328 SER C O   1 
ATOM   7977  C CB  . SER C 1 328 ? -17.274 -2.546  -28.275 1.00 42.77  ? 328 SER C CB  1 
ATOM   7978  O OG  . SER C 1 328 ? -17.943 -1.823  -27.255 1.00 46.96  ? 328 SER C OG  1 
ATOM   7979  N N   . ILE C 1 329 ? -15.288 -2.459  -25.748 1.00 41.77  ? 329 ILE C N   1 
ATOM   7980  C CA  . ILE C 1 329 ? -14.331 -1.726  -24.929 1.00 43.86  ? 329 ILE C CA  1 
ATOM   7981  C C   . ILE C 1 329 ? -13.133 -2.585  -24.517 1.00 51.17  ? 329 ILE C C   1 
ATOM   7982  O O   . ILE C 1 329 ? -12.007 -2.347  -24.958 1.00 48.41  ? 329 ILE C O   1 
ATOM   7983  C CB  . ILE C 1 329 ? -14.984 -1.201  -23.647 1.00 46.70  ? 329 ILE C CB  1 
ATOM   7984  C CG1 . ILE C 1 329 ? -15.931 -0.044  -23.954 1.00 48.83  ? 329 ILE C CG1 1 
ATOM   7985  C CG2 . ILE C 1 329 ? -13.931 -0.796  -22.668 1.00 45.75  ? 329 ILE C CG2 1 
ATOM   7986  C CD1 . ILE C 1 329 ? -15.387 0.996   -24.933 1.00 63.08  ? 329 ILE C CD1 1 
ATOM   7987  N N   . ILE C 1 330 ? -13.405 -3.563  -23.644 1.00 51.85  ? 330 ILE C N   1 
ATOM   7988  C CA  . ILE C 1 330 ? -12.401 -4.492  -23.102 1.00 52.92  ? 330 ILE C CA  1 
ATOM   7989  C C   . ILE C 1 330 ? -11.668 -5.280  -24.196 1.00 59.42  ? 330 ILE C C   1 
ATOM   7990  O O   . ILE C 1 330 ? -12.105 -6.362  -24.636 1.00 58.43  ? 330 ILE C O   1 
ATOM   7991  C CB  . ILE C 1 330 ? -12.991 -5.416  -21.980 1.00 55.43  ? 330 ILE C CB  1 
ATOM   7992  C CG1 . ILE C 1 330 ? -13.823 -4.582  -20.975 1.00 54.96  ? 330 ILE C CG1 1 
ATOM   7993  C CG2 . ILE C 1 330 ? -11.877 -6.162  -21.237 1.00 54.15  ? 330 ILE C CG2 1 
ATOM   7994  C CD1 . ILE C 1 330 ? -13.010 -3.702  -20.050 1.00 45.42  ? 330 ILE C CD1 1 
ATOM   7995  N N   . ILE C 1 331 ? -10.565 -4.680  -24.648 1.00 57.78  ? 331 ILE C N   1 
ATOM   7996  C CA  . ILE C 1 331 ? -9.757  -5.205  -25.744 1.00 57.67  ? 331 ILE C CA  1 
ATOM   7997  C C   . ILE C 1 331 ? -8.287  -5.331  -25.369 1.00 61.17  ? 331 ILE C C   1 
ATOM   7998  O O   . ILE C 1 331 ? -7.565  -4.339  -25.262 1.00 61.77  ? 331 ILE C O   1 
ATOM   7999  C CB  . ILE C 1 331 ? -9.882  -4.297  -27.003 1.00 60.99  ? 331 ILE C CB  1 
ATOM   8000  C CG1 . ILE C 1 331 ? -11.181 -4.599  -27.772 1.00 61.10  ? 331 ILE C CG1 1 
ATOM   8001  C CG2 . ILE C 1 331 ? -8.649  -4.402  -27.899 1.00 62.40  ? 331 ILE C CG2 1 
ATOM   8002  C CD1 . ILE C 1 331 ? -11.711 -3.412  -28.559 1.00 64.93  ? 331 ILE C CD1 1 
ATOM   8003  N N   . ARG C 1 332 ? -7.837  -6.570  -25.218 1.00 57.09  ? 332 ARG C N   1 
ATOM   8004  C CA  . ARG C 1 332 ? -6.445  -6.822  -24.897 1.00 57.24  ? 332 ARG C CA  1 
ATOM   8005  C C   . ARG C 1 332 ? -5.556  -6.677  -26.136 1.00 59.79  ? 332 ARG C C   1 
ATOM   8006  O O   . ARG C 1 332 ? -5.912  -7.143  -27.224 1.00 58.21  ? 332 ARG C O   1 
ATOM   8007  C CB  . ARG C 1 332 ? -6.272  -8.188  -24.226 1.00 57.52  ? 332 ARG C CB  1 
ATOM   8008  C CG  . ARG C 1 332 ? -5.767  -8.058  -22.805 1.00 70.88  ? 332 ARG C CG  1 
ATOM   8009  C CD  . ARG C 1 332 ? -5.683  -9.391  -22.124 1.00 74.90  ? 332 ARG C CD  1 
ATOM   8010  N NE  . ARG C 1 332 ? -4.665  -10.224 -22.750 1.00 79.16  ? 332 ARG C NE  1 
ATOM   8011  C CZ  . ARG C 1 332 ? -4.535  -11.532 -22.538 1.00 75.59  ? 332 ARG C CZ  1 
ATOM   8012  N NH1 . ARG C 1 332 ? -5.375  -12.165 -21.700 1.00 40.86  ? 332 ARG C NH1 1 
ATOM   8013  N NH2 . ARG C 1 332 ? -3.569  -12.206 -23.172 1.00 43.11  ? 332 ARG C NH2 1 
ATOM   8014  N N   . ARG C 1 333 ? -4.416  -6.008  -25.966 1.00 55.58  ? 333 ARG C N   1 
ATOM   8015  C CA  . ARG C 1 333 ? -3.529  -5.745  -27.089 1.00 54.94  ? 333 ARG C CA  1 
ATOM   8016  C C   . ARG C 1 333 ? -2.047  -6.012  -26.854 1.00 56.88  ? 333 ARG C C   1 
ATOM   8017  O O   . ARG C 1 333 ? -1.571  -6.098  -25.724 1.00 55.52  ? 333 ARG C O   1 
ATOM   8018  C CB  . ARG C 1 333 ? -3.751  -4.324  -27.602 1.00 57.12  ? 333 ARG C CB  1 
ATOM   8019  C CG  . ARG C 1 333 ? -5.222  -3.976  -27.750 1.00 70.82  ? 333 ARG C CG  1 
ATOM   8020  C CD  . ARG C 1 333 ? -5.498  -3.469  -29.143 1.00 85.96  ? 333 ARG C CD  1 
ATOM   8021  N NE  . ARG C 1 333 ? -4.580  -2.386  -29.481 1.00 96.74  ? 333 ARG C NE  1 
ATOM   8022  C CZ  . ARG C 1 333 ? -3.354  -2.557  -29.972 1.00 105.70 ? 333 ARG C CZ  1 
ATOM   8023  N NH1 . ARG C 1 333 ? -2.875  -3.780  -30.190 1.00 99.33  ? 333 ARG C NH1 1 
ATOM   8024  N NH2 . ARG C 1 333 ? -2.586  -1.498  -30.208 1.00 74.54  ? 333 ARG C NH2 1 
ATOM   8025  N N   . THR C 1 334 ? -1.330  -6.158  -27.960 1.00 53.26  ? 334 THR C N   1 
ATOM   8026  C CA  . THR C 1 334 ? 0.098   -6.427  -27.947 1.00 51.86  ? 334 THR C CA  1 
ATOM   8027  C C   . THR C 1 334 ? 0.840   -5.101  -27.870 1.00 53.11  ? 334 THR C C   1 
ATOM   8028  O O   . THR C 1 334 ? 0.431   -4.117  -28.473 1.00 51.68  ? 334 THR C O   1 
ATOM   8029  C CB  . THR C 1 334 ? 0.533   -7.177  -29.262 1.00 53.22  ? 334 THR C CB  1 
ATOM   8030  O OG1 . THR C 1 334 ? 0.101   -8.539  -29.206 1.00 51.91  ? 334 THR C OG1 1 
ATOM   8031  C CG2 . THR C 1 334 ? 2.050   -7.155  -29.457 1.00 49.21  ? 334 THR C CG2 1 
ATOM   8032  N N   . GLY C 1 335 ? 1.962   -5.091  -27.176 1.00 49.50  ? 335 GLY C N   1 
ATOM   8033  C CA  . GLY C 1 335 ? 2.770   -3.889  -27.130 1.00 49.81  ? 335 GLY C CA  1 
ATOM   8034  C C   . GLY C 1 335 ? 2.077   -2.769  -26.372 1.00 54.43  ? 335 GLY C C   1 
ATOM   8035  O O   . GLY C 1 335 ? 1.948   -1.647  -26.870 1.00 52.81  ? 335 GLY C O   1 
ATOM   8036  N N   . CYS C 1 336 ? 1.657   -3.082  -25.151 1.00 52.28  ? 336 CYS C N   1 
ATOM   8037  C CA  . CYS C 1 336 ? 1.087   -2.083  -24.270 1.00 52.29  ? 336 CYS C CA  1 
ATOM   8038  C C   . CYS C 1 336 ? 2.025   -1.912  -23.090 1.00 58.13  ? 336 CYS C C   1 
ATOM   8039  O O   . CYS C 1 336 ? 2.313   -0.785  -22.671 1.00 57.45  ? 336 CYS C O   1 
ATOM   8040  C CB  . CYS C 1 336 ? -0.257  -2.518  -23.725 1.00 52.55  ? 336 CYS C CB  1 
ATOM   8041  S SG  . CYS C 1 336 ? -1.454  -3.149  -24.916 1.00 56.74  ? 336 CYS C SG  1 
ATOM   8042  N N   . THR C 1 337 ? 2.432   -3.048  -22.519 1.00 55.57  ? 337 THR C N   1 
ATOM   8043  C CA  . THR C 1 337 ? 3.294   -3.087  -21.336 1.00 55.18  ? 337 THR C CA  1 
ATOM   8044  C C   . THR C 1 337 ? 4.769   -3.145  -21.757 1.00 58.66  ? 337 THR C C   1 
ATOM   8045  O O   . THR C 1 337 ? 5.073   -3.580  -22.878 1.00 57.44  ? 337 THR C O   1 
ATOM   8046  C CB  . THR C 1 337 ? 2.959   -4.350  -20.472 1.00 60.04  ? 337 THR C CB  1 
ATOM   8047  O OG1 . THR C 1 337 ? 2.327   -5.357  -21.287 1.00 47.82  ? 337 THR C OG1 1 
ATOM   8048  C CG2 . THR C 1 337 ? 2.049   -3.982  -19.303 1.00 59.98  ? 337 THR C CG2 1 
ATOM   8049  N N   . PHE C 1 338 ? 5.678   -2.715  -20.877 1.00 55.89  ? 338 PHE C N   1 
ATOM   8050  C CA  . PHE C 1 338 ? 7.111   -2.838  -21.176 1.00 55.82  ? 338 PHE C CA  1 
ATOM   8051  C C   . PHE C 1 338 ? 7.651   -4.033  -20.393 1.00 55.85  ? 338 PHE C C   1 
ATOM   8052  O O   . PHE C 1 338 ? 7.007   -4.527  -19.460 1.00 57.63  ? 338 PHE C O   1 
ATOM   8053  C CB  . PHE C 1 338 ? 7.918   -1.564  -20.866 1.00 58.90  ? 338 PHE C CB  1 
ATOM   8054  C CG  . PHE C 1 338 ? 7.179   -0.288  -21.132 1.00 62.42  ? 338 PHE C CG  1 
ATOM   8055  C CD1 . PHE C 1 338 ? 7.500   0.889   -20.439 1.00 67.00  ? 338 PHE C CD1 1 
ATOM   8056  C CD2 . PHE C 1 338 ? 6.175   -0.250  -22.092 1.00 65.94  ? 338 PHE C CD2 1 
ATOM   8057  C CE1 . PHE C 1 338 ? 6.806   2.079   -20.683 1.00 68.21  ? 338 PHE C CE1 1 
ATOM   8058  C CE2 . PHE C 1 338 ? 5.466   0.933   -22.337 1.00 69.23  ? 338 PHE C CE2 1 
ATOM   8059  C CZ  . PHE C 1 338 ? 5.783   2.099   -21.631 1.00 67.37  ? 338 PHE C CZ  1 
ATOM   8060  N N   . PRO C 1 339 ? 8.789   -4.539  -20.843 1.00 46.72  ? 339 PRO C N   1 
ATOM   8061  C CA  . PRO C 1 339 ? 9.432   -5.695  -20.241 1.00 45.38  ? 339 PRO C CA  1 
ATOM   8062  C C   . PRO C 1 339 ? 9.887   -5.280  -18.858 1.00 50.46  ? 339 PRO C C   1 
ATOM   8063  O O   . PRO C 1 339 ? 10.384  -4.160  -18.700 1.00 50.58  ? 339 PRO C O   1 
ATOM   8064  C CB  . PRO C 1 339 ? 10.653  -5.911  -21.148 1.00 46.42  ? 339 PRO C CB  1 
ATOM   8065  C CG  . PRO C 1 339 ? 10.280  -5.315  -22.485 1.00 48.77  ? 339 PRO C CG  1 
ATOM   8066  C CD  . PRO C 1 339 ? 9.233   -4.277  -22.225 1.00 44.96  ? 339 PRO C CD  1 
ATOM   8067  N N   . GLU C 1 340 ? 9.692   -6.148  -17.862 1.00 47.33  ? 340 GLU C N   1 
ATOM   8068  C CA  . GLU C 1 340 ? 10.060  -5.814  -16.477 1.00 47.19  ? 340 GLU C CA  1 
ATOM   8069  C C   . GLU C 1 340 ? 11.506  -5.360  -16.415 1.00 49.86  ? 340 GLU C C   1 
ATOM   8070  O O   . GLU C 1 340 ? 11.814  -4.321  -15.842 1.00 48.37  ? 340 GLU C O   1 
ATOM   8071  C CB  . GLU C 1 340 ? 9.813   -6.980  -15.494 1.00 48.91  ? 340 GLU C CB  1 
ATOM   8072  C CG  . GLU C 1 340 ? 8.358   -7.445  -15.385 1.00 66.50  ? 340 GLU C CG  1 
ATOM   8073  C CD  . GLU C 1 340 ? 8.222   -8.817  -14.739 1.00 107.30 ? 340 GLU C CD  1 
ATOM   8074  O OE1 . GLU C 1 340 ? 7.201   -9.500  -15.004 1.00 114.67 ? 340 GLU C OE1 1 
ATOM   8075  O OE2 . GLU C 1 340 ? 9.141   -9.206  -13.979 1.00 105.86 ? 340 GLU C OE2 1 
ATOM   8076  N N   . LYS C 1 341 ? 12.384  -6.137  -17.039 1.00 46.77  ? 341 LYS C N   1 
ATOM   8077  C CA  . LYS C 1 341 ? 13.805  -5.841  -17.024 1.00 45.74  ? 341 LYS C CA  1 
ATOM   8078  C C   . LYS C 1 341 ? 14.103  -5.465  -18.460 1.00 44.69  ? 341 LYS C C   1 
ATOM   8079  O O   . LYS C 1 341 ? 13.327  -5.788  -19.346 1.00 44.15  ? 341 LYS C O   1 
ATOM   8080  C CB  . LYS C 1 341 ? 14.607  -7.096  -16.594 1.00 49.53  ? 341 LYS C CB  1 
ATOM   8081  C CG  . LYS C 1 341 ? 14.089  -7.834  -15.326 1.00 72.47  ? 341 LYS C CG  1 
ATOM   8082  C CD  . LYS C 1 341 ? 14.336  -7.034  -14.031 1.00 89.63  ? 341 LYS C CD  1 
ATOM   8083  C CE  . LYS C 1 341 ? 13.498  -7.557  -12.854 1.00 107.33 ? 341 LYS C CE  1 
ATOM   8084  N NZ  . LYS C 1 341 ? 13.567  -6.660  -11.652 1.00 121.05 ? 341 LYS C NZ  1 
ATOM   8085  N N   . PRO C 1 342 ? 15.125  -4.660  -18.695 1.00 38.87  ? 342 PRO C N   1 
ATOM   8086  C CA  . PRO C 1 342 ? 15.477  -4.363  -20.079 1.00 37.45  ? 342 PRO C CA  1 
ATOM   8087  C C   . PRO C 1 342 ? 16.318  -5.532  -20.622 1.00 42.88  ? 342 PRO C C   1 
ATOM   8088  O O   . PRO C 1 342 ? 16.794  -6.395  -19.882 1.00 42.98  ? 342 PRO C O   1 
ATOM   8089  C CB  . PRO C 1 342 ? 16.360  -3.124  -19.972 1.00 38.23  ? 342 PRO C CB  1 
ATOM   8090  C CG  . PRO C 1 342 ? 16.993  -3.245  -18.633 1.00 43.74  ? 342 PRO C CG  1 
ATOM   8091  C CD  . PRO C 1 342 ? 15.941  -3.886  -17.738 1.00 39.66  ? 342 PRO C CD  1 
ATOM   8092  N N   . ASP C 1 343 ? 16.557  -5.539  -21.924 1.00 38.32  ? 343 ASP C N   1 
ATOM   8093  C CA  . ASP C 1 343 ? 17.425  -6.553  -22.500 1.00 38.86  ? 343 ASP C CA  1 
ATOM   8094  C C   . ASP C 1 343 ? 18.421  -5.902  -23.445 1.00 41.01  ? 343 ASP C C   1 
ATOM   8095  O O   . ASP C 1 343 ? 18.335  -6.022  -24.690 1.00 36.39  ? 343 ASP C O   1 
ATOM   8096  C CB  . ASP C 1 343 ? 16.633  -7.607  -23.245 1.00 43.39  ? 343 ASP C CB  1 
ATOM   8097  C CG  . ASP C 1 343 ? 17.516  -8.697  -23.811 1.00 67.01  ? 343 ASP C CG  1 
ATOM   8098  O OD1 . ASP C 1 343 ? 18.468  -9.124  -23.102 1.00 69.73  ? 343 ASP C OD1 1 
ATOM   8099  O OD2 . ASP C 1 343 ? 17.284  -9.072  -24.990 1.00 73.34  ? 343 ASP C OD2 1 
ATOM   8100  N N   . PHE C 1 344 ? 19.355  -5.177  -22.837 1.00 38.67  ? 344 PHE C N   1 
ATOM   8101  C CA  . PHE C 1 344 ? 20.311  -4.411  -23.572 1.00 37.79  ? 344 PHE C CA  1 
ATOM   8102  C C   . PHE C 1 344 ? 21.684  -5.068  -23.526 1.00 49.50  ? 344 PHE C C   1 
ATOM   8103  O O   . PHE C 1 344 ? 22.397  -5.120  -24.551 1.00 49.06  ? 344 PHE C O   1 
ATOM   8104  C CB  . PHE C 1 344 ? 20.367  -3.006  -22.964 1.00 37.65  ? 344 PHE C CB  1 
ATOM   8105  C CG  . PHE C 1 344 ? 21.443  -2.134  -23.555 1.00 35.58  ? 344 PHE C CG  1 
ATOM   8106  C CD1 . PHE C 1 344 ? 21.439  -1.828  -24.896 1.00 34.38  ? 344 PHE C CD1 1 
ATOM   8107  C CD2 . PHE C 1 344 ? 22.506  -1.713  -22.791 1.00 36.20  ? 344 PHE C CD2 1 
ATOM   8108  C CE1 . PHE C 1 344 ? 22.440  -1.061  -25.446 1.00 34.76  ? 344 PHE C CE1 1 
ATOM   8109  C CE2 . PHE C 1 344 ? 23.526  -0.965  -23.347 1.00 37.33  ? 344 PHE C CE2 1 
ATOM   8110  C CZ  . PHE C 1 344 ? 23.480  -0.640  -24.674 1.00 34.10  ? 344 PHE C CZ  1 
ATOM   8111  N N   . HIS C 1 345 ? 22.063  -5.534  -22.328 1.00 50.38  ? 345 HIS C N   1 
ATOM   8112  C CA  . HIS C 1 345 ? 23.393  -6.098  -22.075 1.00 51.51  ? 345 HIS C CA  1 
ATOM   8113  C C   . HIS C 1 345 ? 24.314  -4.895  -21.880 1.00 54.18  ? 345 HIS C C   1 
ATOM   8114  O O   . HIS C 1 345 ? 24.970  -4.474  -22.860 1.00 49.28  ? 345 HIS C O   1 
ATOM   8115  C CB  . HIS C 1 345 ? 23.856  -7.022  -23.243 1.00 52.23  ? 345 HIS C CB  1 
ATOM   8116  C CG  . HIS C 1 345 ? 22.907  -8.149  -23.545 1.00 55.98  ? 345 HIS C CG  1 
ATOM   8117  N ND1 . HIS C 1 345 ? 22.575  -9.120  -22.621 1.00 57.91  ? 345 HIS C ND1 1 
ATOM   8118  C CD2 . HIS C 1 345 ? 22.253  -8.484  -24.686 1.00 57.79  ? 345 HIS C CD2 1 
ATOM   8119  C CE1 . HIS C 1 345 ? 21.763  -10.004 -23.181 1.00 57.10  ? 345 HIS C CE1 1 
ATOM   8120  N NE2 . HIS C 1 345 ? 21.539  -9.633  -24.429 1.00 57.24  ? 345 HIS C NE2 1 
ATOM   8121  O OXT . HIS C 1 345 ? 24.121  -4.184  -20.859 1.00 59.81  ? 345 HIS C OXT 1 
ATOM   8122  N N   . SER D 1 3   ? -25.873 -1.343  8.950   1.00 54.22  ? 3   SER D N   1 
ATOM   8123  C CA  . SER D 1 3   ? -27.049 -0.796  8.262   1.00 54.22  ? 3   SER D CA  1 
ATOM   8124  C C   . SER D 1 3   ? -27.062 0.744   8.281   1.00 57.64  ? 3   SER D C   1 
ATOM   8125  O O   . SER D 1 3   ? -28.140 1.382   8.363   1.00 57.80  ? 3   SER D O   1 
ATOM   8126  C CB  . SER D 1 3   ? -28.346 -1.347  8.872   1.00 58.85  ? 3   SER D CB  1 
ATOM   8127  O OG  . SER D 1 3   ? -28.086 -2.311  9.879   1.00 72.56  ? 3   SER D OG  1 
ATOM   8128  N N   . VAL D 1 4   ? -25.851 1.319   8.244   1.00 50.24  ? 4   VAL D N   1 
ATOM   8129  C CA  . VAL D 1 4   ? -25.625 2.751   8.182   1.00 48.08  ? 4   VAL D CA  1 
ATOM   8130  C C   . VAL D 1 4   ? -24.753 2.989   6.942   1.00 51.70  ? 4   VAL D C   1 
ATOM   8131  O O   . VAL D 1 4   ? -23.916 2.149   6.615   1.00 53.01  ? 4   VAL D O   1 
ATOM   8132  C CB  . VAL D 1 4   ? -24.846 3.227   9.426   1.00 51.69  ? 4   VAL D CB  1 
ATOM   8133  C CG1 . VAL D 1 4   ? -25.634 2.945   10.698  1.00 52.29  ? 4   VAL D CG1 1 
ATOM   8134  C CG2 . VAL D 1 4   ? -23.468 2.571   9.505   1.00 50.84  ? 4   VAL D CG2 1 
ATOM   8135  N N   . ARG D 1 5   ? -24.954 4.103   6.235   1.00 46.53  ? 5   ARG D N   1 
ATOM   8136  C CA  . ARG D 1 5   ? -24.135 4.407   5.055   1.00 44.67  ? 5   ARG D CA  1 
ATOM   8137  C C   . ARG D 1 5   ? -22.896 5.203   5.380   1.00 40.63  ? 5   ARG D C   1 
ATOM   8138  O O   . ARG D 1 5   ? -22.750 5.726   6.488   1.00 40.26  ? 5   ARG D O   1 
ATOM   8139  C CB  . ARG D 1 5   ? -24.917 5.169   3.986   1.00 46.92  ? 5   ARG D CB  1 
ATOM   8140  C CG  . ARG D 1 5   ? -26.358 5.286   4.267   1.00 60.05  ? 5   ARG D CG  1 
ATOM   8141  C CD  . ARG D 1 5   ? -26.632 6.332   5.321   1.00 79.50  ? 5   ARG D CD  1 
ATOM   8142  N NE  . ARG D 1 5   ? -28.070 6.485   5.510   1.00 96.87  ? 5   ARG D NE  1 
ATOM   8143  C CZ  . ARG D 1 5   ? -28.920 5.467   5.646   1.00 114.64 ? 5   ARG D CZ  1 
ATOM   8144  N NH1 . ARG D 1 5   ? -28.478 4.214   5.671   1.00 104.84 ? 5   ARG D NH1 1 
ATOM   8145  N NH2 . ARG D 1 5   ? -30.215 5.703   5.811   1.00 99.95  ? 5   ARG D NH2 1 
ATOM   8146  N N   . GLU D 1 6   ? -22.056 5.360   4.367   1.00 32.02  ? 6   GLU D N   1 
ATOM   8147  C CA  . GLU D 1 6   ? -20.813 6.059   4.549   1.00 31.85  ? 6   GLU D CA  1 
ATOM   8148  C C   . GLU D 1 6   ? -21.070 7.509   4.811   1.00 32.74  ? 6   GLU D C   1 
ATOM   8149  O O   . GLU D 1 6   ? -22.092 8.047   4.374   1.00 30.18  ? 6   GLU D O   1 
ATOM   8150  C CB  . GLU D 1 6   ? -19.831 5.884   3.370   1.00 33.50  ? 6   GLU D CB  1 
ATOM   8151  C CG  . GLU D 1 6   ? -20.403 5.497   2.018   1.00 46.99  ? 6   GLU D CG  1 
ATOM   8152  C CD  . GLU D 1 6   ? -19.367 4.778   1.139   1.00 68.91  ? 6   GLU D CD  1 
ATOM   8153  O OE1 . GLU D 1 6   ? -19.286 3.533   1.259   1.00 68.52  ? 6   GLU D OE1 1 
ATOM   8154  O OE2 . GLU D 1 6   ? -18.611 5.447   0.380   1.00 54.70  ? 6   GLU D OE2 1 
ATOM   8155  N N   . ASN D 1 7   ? -20.139 8.134   5.520   1.00 27.24  ? 7   ASN D N   1 
ATOM   8156  C CA  . ASN D 1 7   ? -20.227 9.555   5.769   1.00 25.59  ? 7   ASN D CA  1 
ATOM   8157  C C   . ASN D 1 7   ? -21.371 9.921   6.690   1.00 27.82  ? 7   ASN D C   1 
ATOM   8158  O O   . ASN D 1 7   ? -21.713 11.091  6.813   1.00 29.51  ? 7   ASN D O   1 
ATOM   8159  C CB  . ASN D 1 7   ? -20.315 10.317  4.436   1.00 24.66  ? 7   ASN D CB  1 
ATOM   8160  C CG  . ASN D 1 7   ? -19.156 9.976   3.482   1.00 31.64  ? 7   ASN D CG  1 
ATOM   8161  O OD1 . ASN D 1 7   ? -19.367 9.319   2.469   1.00 24.61  ? 7   ASN D OD1 1 
ATOM   8162  N ND2 . ASN D 1 7   ? -17.936 10.430  3.809   1.00 16.04  ? 7   ASN D ND2 1 
ATOM   8163  N N   . ILE D 1 8   ? -21.942 8.931   7.363   1.00 22.02  ? 8   ILE D N   1 
ATOM   8164  C CA  . ILE D 1 8   ? -23.039 9.194   8.276   1.00 20.66  ? 8   ILE D CA  1 
ATOM   8165  C C   . ILE D 1 8   ? -22.550 10.050  9.432   1.00 20.72  ? 8   ILE D C   1 
ATOM   8166  O O   . ILE D 1 8   ? -23.264 10.901  9.918   1.00 22.06  ? 8   ILE D O   1 
ATOM   8167  C CB  . ILE D 1 8   ? -23.625 7.908   8.842   1.00 24.30  ? 8   ILE D CB  1 
ATOM   8168  C CG1 . ILE D 1 8   ? -25.052 8.179   9.348   1.00 25.83  ? 8   ILE D CG1 1 
ATOM   8169  C CG2 . ILE D 1 8   ? -22.733 7.354   9.967   1.00 22.38  ? 8   ILE D CG2 1 
ATOM   8170  C CD1 . ILE D 1 8   ? -25.808 6.916   9.864   1.00 32.22  ? 8   ILE D CD1 1 
ATOM   8171  N N   . LEU D 1 9   ? -21.312 9.829   9.838   1.00 14.84  ? 9   LEU D N   1 
ATOM   8172  C CA  . LEU D 1 9   ? -20.652 10.591  10.911  1.00 13.08  ? 9   LEU D CA  1 
ATOM   8173  C C   . LEU D 1 9   ? -19.674 11.626  10.356  1.00 13.42  ? 9   LEU D C   1 
ATOM   8174  O O   . LEU D 1 9   ? -18.761 11.252  9.653   1.00 11.06  ? 9   LEU D O   1 
ATOM   8175  C CB  . LEU D 1 9   ? -19.859 9.634   11.808  1.00 11.78  ? 9   LEU D CB  1 
ATOM   8176  C CG  . LEU D 1 9   ? -19.699 10.027  13.275  1.00 15.41  ? 9   LEU D CG  1 
ATOM   8177  C CD1 . LEU D 1 9   ? -18.337 9.510   13.729  1.00 13.74  ? 9   LEU D CD1 1 
ATOM   8178  C CD2 . LEU D 1 9   ? -19.897 11.538  13.506  1.00 16.63  ? 9   LEU D CD2 1 
ATOM   8179  N N   . PHE D 1 10  ? -19.807 12.896  10.746  1.00 11.48  ? 10  PHE D N   1 
ATOM   8180  C CA  . PHE D 1 10  ? -18.874 13.976  10.306  1.00 11.21  ? 10  PHE D CA  1 
ATOM   8181  C C   . PHE D 1 10  ? -18.080 14.664  11.412  1.00 13.52  ? 10  PHE D C   1 
ATOM   8182  O O   . PHE D 1 10  ? -18.637 15.179  12.367  1.00 13.92  ? 10  PHE D O   1 
ATOM   8183  C CB  . PHE D 1 10  ? -19.601 15.066  9.490   1.00 13.24  ? 10  PHE D CB  1 
ATOM   8184  C CG  . PHE D 1 10  ? -18.721 16.234  9.148   1.00 14.57  ? 10  PHE D CG  1 
ATOM   8185  C CD1 . PHE D 1 10  ? -18.623 17.331  10.037  1.00 16.41  ? 10  PHE D CD1 1 
ATOM   8186  C CD2 . PHE D 1 10  ? -17.837 16.174  8.029   1.00 15.23  ? 10  PHE D CD2 1 
ATOM   8187  C CE1 . PHE D 1 10  ? -17.682 18.384  9.780   1.00 16.57  ? 10  PHE D CE1 1 
ATOM   8188  C CE2 . PHE D 1 10  ? -16.876 17.196  7.783   1.00 16.28  ? 10  PHE D CE2 1 
ATOM   8189  C CZ  . PHE D 1 10  ? -16.821 18.324  8.628   1.00 14.20  ? 10  PHE D CZ  1 
ATOM   8190  N N   . GLY D 1 11  ? -16.769 14.759  11.245  1.00 11.21  ? 11  GLY D N   1 
ATOM   8191  C CA  . GLY D 1 11  ? -15.920 15.387  12.267  1.00 9.69   ? 11  GLY D CA  1 
ATOM   8192  C C   . GLY D 1 11  ? -14.815 16.155  11.592  1.00 16.13  ? 11  GLY D C   1 
ATOM   8193  O O   . GLY D 1 11  ? -14.447 15.852  10.462  1.00 16.38  ? 11  GLY D O   1 
ATOM   8194  N N   . MET D 1 12  ? -14.347 17.201  12.260  1.00 14.83  ? 12  MET D N   1 
ATOM   8195  C CA  . MET D 1 12  ? -13.284 18.054  11.741  1.00 14.30  ? 12  MET D CA  1 
ATOM   8196  C C   . MET D 1 12  ? -12.593 18.624  12.957  1.00 15.66  ? 12  MET D C   1 
ATOM   8197  O O   . MET D 1 12  ? -13.208 18.822  13.991  1.00 13.62  ? 12  MET D O   1 
ATOM   8198  C CB  . MET D 1 12  ? -13.862 19.177  10.848  1.00 16.89  ? 12  MET D CB  1 
ATOM   8199  C CG  . MET D 1 12  ? -14.671 20.223  11.592  1.00 20.70  ? 12  MET D CG  1 
ATOM   8200  S SD  . MET D 1 12  ? -15.333 21.537  10.518  1.00 25.08  ? 12  MET D SD  1 
ATOM   8201  C CE  . MET D 1 12  ? -13.839 21.779  9.345   1.00 19.23  ? 12  MET D CE  1 
ATOM   8202  N N   . GLY D 1 13  ? -11.279 18.740  12.872  1.00 13.57  ? 13  GLY D N   1 
ATOM   8203  C CA  . GLY D 1 13  ? -10.493 19.248  13.984  1.00 13.80  ? 13  GLY D CA  1 
ATOM   8204  C C   . GLY D 1 13  ? -9.034  19.494  13.577  1.00 20.17  ? 13  GLY D C   1 
ATOM   8205  O O   . GLY D 1 13  ? -8.723  19.731  12.404  1.00 22.71  ? 13  GLY D O   1 
ATOM   8206  N N   . ASN D 1 14  ? -8.134  19.404  14.548  1.00 12.95  ? 14  ASN D N   1 
ATOM   8207  C CA  . ASN D 1 14  ? -6.721  19.581  14.318  1.00 10.05  ? 14  ASN D CA  1 
ATOM   8208  C C   . ASN D 1 14  ? -6.037  18.222  14.176  1.00 13.40  ? 14  ASN D C   1 
ATOM   8209  O O   . ASN D 1 14  ? -5.869  17.489  15.150  1.00 11.66  ? 14  ASN D O   1 
ATOM   8210  C CB  . ASN D 1 14  ? -6.099  20.332  15.506  1.00 7.95   ? 14  ASN D CB  1 
ATOM   8211  C CG  . ASN D 1 14  ? -6.782  21.687  15.788  1.00 19.52  ? 14  ASN D CG  1 
ATOM   8212  O OD1 . ASN D 1 14  ? -7.016  22.468  14.873  1.00 6.14   ? 14  ASN D OD1 1 
ATOM   8213  N ND2 . ASN D 1 14  ? -6.873  22.052  17.071  1.00 10.07  ? 14  ASN D ND2 1 
ATOM   8214  N N   . PRO D 1 15  ? -5.598  17.900  12.962  1.00 11.92  ? 15  PRO D N   1 
ATOM   8215  C CA  . PRO D 1 15  ? -4.839  16.672  12.733  1.00 8.92   ? 15  PRO D CA  1 
ATOM   8216  C C   . PRO D 1 15  ? -3.439  16.902  13.285  1.00 9.87   ? 15  PRO D C   1 
ATOM   8217  O O   . PRO D 1 15  ? -2.674  17.690  12.745  1.00 7.65   ? 15  PRO D O   1 
ATOM   8218  C CB  . PRO D 1 15  ? -4.748  16.590  11.192  1.00 11.56  ? 15  PRO D CB  1 
ATOM   8219  C CG  . PRO D 1 15  ? -5.909  17.447  10.664  1.00 17.62  ? 15  PRO D CG  1 
ATOM   8220  C CD  . PRO D 1 15  ? -6.038  18.550  11.701  1.00 14.00  ? 15  PRO D CD  1 
ATOM   8221  N N   . LEU D 1 16  ? -3.078  16.204  14.358  1.00 8.03   ? 16  LEU D N   1 
ATOM   8222  C CA  . LEU D 1 16  ? -1.737  16.352  14.928  1.00 7.71   ? 16  LEU D CA  1 
ATOM   8223  C C   . LEU D 1 16  ? -1.005  15.017  15.073  1.00 14.90  ? 16  LEU D C   1 
ATOM   8224  O O   . LEU D 1 16  ? -1.624  13.960  15.201  1.00 13.78  ? 16  LEU D O   1 
ATOM   8225  C CB  . LEU D 1 16  ? -1.819  16.986  16.319  1.00 7.26   ? 16  LEU D CB  1 
ATOM   8226  C CG  . LEU D 1 16  ? -2.691  18.231  16.541  1.00 11.47  ? 16  LEU D CG  1 
ATOM   8227  C CD1 . LEU D 1 16  ? -2.732  18.637  18.038  1.00 12.29  ? 16  LEU D CD1 1 
ATOM   8228  C CD2 . LEU D 1 16  ? -2.213  19.423  15.677  1.00 9.60   ? 16  LEU D CD2 1 
ATOM   8229  N N   . LEU D 1 17  ? 0.321   15.096  15.140  1.00 12.67  ? 17  LEU D N   1 
ATOM   8230  C CA  . LEU D 1 17  ? 1.152   13.922  15.426  1.00 11.95  ? 17  LEU D CA  1 
ATOM   8231  C C   . LEU D 1 17  ? 1.637   14.070  16.866  1.00 14.36  ? 17  LEU D C   1 
ATOM   8232  O O   . LEU D 1 17  ? 2.328   15.028  17.211  1.00 11.69  ? 17  LEU D O   1 
ATOM   8233  C CB  . LEU D 1 17  ? 2.417   13.860  14.511  1.00 11.77  ? 17  LEU D CB  1 
ATOM   8234  C CG  . LEU D 1 17  ? 3.137   12.501  14.506  1.00 13.62  ? 17  LEU D CG  1 
ATOM   8235  C CD1 . LEU D 1 17  ? 2.299   11.314  14.047  1.00 8.76   ? 17  LEU D CD1 1 
ATOM   8236  C CD2 . LEU D 1 17  ? 4.454   12.543  13.823  1.00 18.59  ? 17  LEU D CD2 1 
ATOM   8237  N N   . ASP D 1 18  ? 1.279   13.123  17.711  1.00 12.21  ? 18  ASP D N   1 
ATOM   8238  C CA  . ASP D 1 18  ? 1.779   13.151  19.067  1.00 11.99  ? 18  ASP D CA  1 
ATOM   8239  C C   . ASP D 1 18  ? 3.214   12.651  19.081  1.00 14.68  ? 18  ASP D C   1 
ATOM   8240  O O   . ASP D 1 18  ? 3.576   11.679  18.397  1.00 13.49  ? 18  ASP D O   1 
ATOM   8241  C CB  . ASP D 1 18  ? 0.919   12.274  19.983  1.00 14.29  ? 18  ASP D CB  1 
ATOM   8242  C CG  . ASP D 1 18  ? -0.508  12.752  20.085  1.00 17.58  ? 18  ASP D CG  1 
ATOM   8243  O OD1 . ASP D 1 18  ? -0.814  13.883  19.648  1.00 12.05  ? 18  ASP D OD1 1 
ATOM   8244  O OD2 . ASP D 1 18  ? -1.358  11.922  20.460  1.00 34.53  ? 18  ASP D OD2 1 
ATOM   8245  N N   . ILE D 1 19  ? 4.043   13.396  19.790  1.00 12.51  ? 19  ILE D N   1 
ATOM   8246  C CA  . ILE D 1 19  ? 5.441   13.070  19.986  1.00 12.49  ? 19  ILE D CA  1 
ATOM   8247  C C   . ILE D 1 19  ? 5.488   12.941  21.498  1.00 19.53  ? 19  ILE D C   1 
ATOM   8248  O O   . ILE D 1 19  ? 5.166   13.916  22.255  1.00 19.53  ? 19  ILE D O   1 
ATOM   8249  C CB  . ILE D 1 19  ? 6.325   14.238  19.586  1.00 16.08  ? 19  ILE D CB  1 
ATOM   8250  C CG1 . ILE D 1 19  ? 6.150   14.583  18.120  1.00 14.75  ? 19  ILE D CG1 1 
ATOM   8251  C CG2 . ILE D 1 19  ? 7.781   13.942  19.931  1.00 19.37  ? 19  ILE D CG2 1 
ATOM   8252  C CD1 . ILE D 1 19  ? 6.951   15.805  17.749  1.00 13.27  ? 19  ILE D CD1 1 
ATOM   8253  N N   . SER D 1 20  ? 5.695   11.706  21.938  1.00 18.02  ? 20  SER D N   1 
ATOM   8254  C CA  . SER D 1 20  ? 5.680   11.414  23.373  1.00 19.22  ? 20  SER D CA  1 
ATOM   8255  C C   . SER D 1 20  ? 6.992   10.847  23.939  1.00 23.04  ? 20  SER D C   1 
ATOM   8256  O O   . SER D 1 20  ? 7.850   10.384  23.210  1.00 20.36  ? 20  SER D O   1 
ATOM   8257  C CB  . SER D 1 20  ? 4.387   10.669  23.805  1.00 21.52  ? 20  SER D CB  1 
ATOM   8258  O OG  . SER D 1 20  ? 4.576   9.286   23.958  1.00 27.86  ? 20  SER D OG  1 
ATOM   8259  N N   . ALA D 1 21  ? 7.201   11.015  25.231  1.00 22.58  ? 21  ALA D N   1 
ATOM   8260  C CA  . ALA D 1 21  ? 8.444   10.584  25.821  1.00 24.70  ? 21  ALA D CA  1 
ATOM   8261  C C   . ALA D 1 21  ? 8.382   10.851  27.309  1.00 31.58  ? 21  ALA D C   1 
ATOM   8262  O O   . ALA D 1 21  ? 7.718   11.808  27.757  1.00 32.06  ? 21  ALA D O   1 
ATOM   8263  C CB  . ALA D 1 21  ? 9.647   11.351  25.180  1.00 25.38  ? 21  ALA D CB  1 
ATOM   8264  N N   . VAL D 1 22  ? 9.049   9.980   28.065  1.00 28.81  ? 22  VAL D N   1 
ATOM   8265  C CA  . VAL D 1 22  ? 9.220   10.162  29.490  1.00 29.78  ? 22  VAL D CA  1 
ATOM   8266  C C   . VAL D 1 22  ? 10.334  11.181  29.768  1.00 35.03  ? 22  VAL D C   1 
ATOM   8267  O O   . VAL D 1 22  ? 11.461  11.025  29.335  1.00 35.02  ? 22  VAL D O   1 
ATOM   8268  C CB  . VAL D 1 22  ? 9.496   8.832   30.192  1.00 33.57  ? 22  VAL D CB  1 
ATOM   8269  C CG1 . VAL D 1 22  ? 9.276   8.947   31.707  1.00 32.96  ? 22  VAL D CG1 1 
ATOM   8270  C CG2 . VAL D 1 22  ? 8.601   7.748   29.586  1.00 33.25  ? 22  VAL D CG2 1 
ATOM   8271  N N   . VAL D 1 23  ? 9.980   12.252  30.455  1.00 32.49  ? 23  VAL D N   1 
ATOM   8272  C CA  . VAL D 1 23  ? 10.934  13.277  30.815  1.00 33.14  ? 23  VAL D CA  1 
ATOM   8273  C C   . VAL D 1 23  ? 11.216  13.308  32.341  1.00 41.36  ? 23  VAL D C   1 
ATOM   8274  O O   . VAL D 1 23  ? 10.999  12.306  33.038  1.00 41.65  ? 23  VAL D O   1 
ATOM   8275  C CB  . VAL D 1 23  ? 10.475  14.667  30.259  1.00 35.85  ? 23  VAL D CB  1 
ATOM   8276  C CG1 . VAL D 1 23  ? 10.213  14.563  28.757  1.00 35.52  ? 23  VAL D CG1 1 
ATOM   8277  C CG2 . VAL D 1 23  ? 9.208   15.172  30.989  1.00 34.72  ? 23  VAL D CG2 1 
ATOM   8278  N N   . ASP D 1 24  ? 11.739  14.440  32.821  1.00 40.19  ? 24  ASP D N   1 
ATOM   8279  C CA  . ASP D 1 24  ? 12.034  14.654  34.236  1.00 40.27  ? 24  ASP D CA  1 
ATOM   8280  C C   . ASP D 1 24  ? 11.460  16.010  34.679  1.00 42.60  ? 24  ASP D C   1 
ATOM   8281  O O   . ASP D 1 24  ? 11.026  16.807  33.838  1.00 42.12  ? 24  ASP D O   1 
ATOM   8282  C CB  . ASP D 1 24  ? 13.543  14.544  34.501  1.00 43.20  ? 24  ASP D CB  1 
ATOM   8283  C CG  . ASP D 1 24  ? 14.353  15.691  33.885  1.00 63.91  ? 24  ASP D CG  1 
ATOM   8284  O OD1 . ASP D 1 24  ? 14.007  16.144  32.769  1.00 64.71  ? 24  ASP D OD1 1 
ATOM   8285  O OD2 . ASP D 1 24  ? 15.375  16.094  34.502  1.00 76.43  ? 24  ASP D OD2 1 
ATOM   8286  N N   . LYS D 1 25  ? 11.370  16.232  35.989  1.00 37.20  ? 25  LYS D N   1 
ATOM   8287  C CA  . LYS D 1 25  ? 10.819  17.484  36.473  1.00 36.45  ? 25  LYS D CA  1 
ATOM   8288  C C   . LYS D 1 25  ? 11.625  18.675  35.979  1.00 35.12  ? 25  LYS D C   1 
ATOM   8289  O O   . LYS D 1 25  ? 11.059  19.731  35.687  1.00 33.29  ? 25  LYS D O   1 
ATOM   8290  C CB  . LYS D 1 25  ? 10.601  17.499  38.000  1.00 40.61  ? 25  LYS D CB  1 
ATOM   8291  C CG  . LYS D 1 25  ? 9.810   18.746  38.504  1.00 67.56  ? 25  LYS D CG  1 
ATOM   8292  C CD  . LYS D 1 25  ? 8.775   18.424  39.605  1.00 80.39  ? 25  LYS D CD  1 
ATOM   8293  C CE  . LYS D 1 25  ? 8.071   19.688  40.126  1.00 86.36  ? 25  LYS D CE  1 
ATOM   8294  N NZ  . LYS D 1 25  ? 7.123   19.417  41.241  1.00 86.49  ? 25  LYS D NZ  1 
ATOM   8295  N N   . ASP D 1 26  ? 12.924  18.481  35.788  1.00 30.66  ? 26  ASP D N   1 
ATOM   8296  C CA  . ASP D 1 26  ? 13.775  19.573  35.303  1.00 31.43  ? 26  ASP D CA  1 
ATOM   8297  C C   . ASP D 1 26  ? 13.291  20.078  33.940  1.00 33.55  ? 26  ASP D C   1 
ATOM   8298  O O   . ASP D 1 26  ? 13.333  21.274  33.635  1.00 29.64  ? 26  ASP D O   1 
ATOM   8299  C CB  . ASP D 1 26  ? 15.233  19.118  35.210  1.00 33.70  ? 26  ASP D CB  1 
ATOM   8300  C CG  . ASP D 1 26  ? 15.904  19.041  36.568  1.00 38.61  ? 26  ASP D CG  1 
ATOM   8301  O OD1 . ASP D 1 26  ? 17.097  18.695  36.611  1.00 34.78  ? 26  ASP D OD1 1 
ATOM   8302  O OD2 . ASP D 1 26  ? 15.246  19.369  37.585  1.00 45.71  ? 26  ASP D OD2 1 
ATOM   8303  N N   . PHE D 1 27  ? 12.831  19.143  33.126  1.00 32.35  ? 27  PHE D N   1 
ATOM   8304  C CA  . PHE D 1 27  ? 12.288  19.492  31.828  1.00 33.13  ? 27  PHE D CA  1 
ATOM   8305  C C   . PHE D 1 27  ? 11.005  20.326  31.937  1.00 38.48  ? 27  PHE D C   1 
ATOM   8306  O O   . PHE D 1 27  ? 10.880  21.358  31.264  1.00 39.70  ? 27  PHE D O   1 
ATOM   8307  C CB  . PHE D 1 27  ? 12.040  18.253  30.976  1.00 34.45  ? 27  PHE D CB  1 
ATOM   8308  C CG  . PHE D 1 27  ? 11.656  18.574  29.570  1.00 35.33  ? 27  PHE D CG  1 
ATOM   8309  C CD1 . PHE D 1 27  ? 12.615  18.947  28.643  1.00 36.45  ? 27  PHE D CD1 1 
ATOM   8310  C CD2 . PHE D 1 27  ? 10.328  18.619  29.190  1.00 38.14  ? 27  PHE D CD2 1 
ATOM   8311  C CE1 . PHE D 1 27  ? 12.274  19.252  27.348  1.00 36.31  ? 27  PHE D CE1 1 
ATOM   8312  C CE2 . PHE D 1 27  ? 9.979   18.920  27.863  1.00 39.98  ? 27  PHE D CE2 1 
ATOM   8313  C CZ  . PHE D 1 27  ? 10.955  19.245  26.961  1.00 36.63  ? 27  PHE D CZ  1 
ATOM   8314  N N   . LEU D 1 28  ? 10.064  19.889  32.777  1.00 32.09  ? 28  LEU D N   1 
ATOM   8315  C CA  . LEU D 1 28  ? 8.809   20.619  32.971  1.00 29.97  ? 28  LEU D CA  1 
ATOM   8316  C C   . LEU D 1 28  ? 9.010   21.997  33.533  1.00 32.89  ? 28  LEU D C   1 
ATOM   8317  O O   . LEU D 1 28  ? 8.317   22.926  33.097  1.00 30.96  ? 28  LEU D O   1 
ATOM   8318  C CB  . LEU D 1 28  ? 7.825   19.845  33.863  1.00 29.31  ? 28  LEU D CB  1 
ATOM   8319  C CG  . LEU D 1 28  ? 7.552   18.407  33.446  1.00 31.38  ? 28  LEU D CG  1 
ATOM   8320  C CD1 . LEU D 1 28  ? 7.003   17.609  34.603  1.00 31.02  ? 28  LEU D CD1 1 
ATOM   8321  C CD2 . LEU D 1 28  ? 6.644   18.347  32.213  1.00 29.49  ? 28  LEU D CD2 1 
ATOM   8322  N N   . ASP D 1 29  ? 9.921   22.119  34.516  1.00 31.22  ? 29  ASP D N   1 
ATOM   8323  C CA  . ASP D 1 29  ? 10.243  23.413  35.161  1.00 32.13  ? 29  ASP D CA  1 
ATOM   8324  C C   . ASP D 1 29  ? 10.925  24.367  34.190  1.00 34.46  ? 29  ASP D C   1 
ATOM   8325  O O   . ASP D 1 29  ? 10.551  25.530  34.084  1.00 36.90  ? 29  ASP D O   1 
ATOM   8326  C CB  . ASP D 1 29  ? 11.082  23.229  36.440  1.00 35.40  ? 29  ASP D CB  1 
ATOM   8327  C CG  . ASP D 1 29  ? 10.304  22.540  37.570  1.00 54.95  ? 29  ASP D CG  1 
ATOM   8328  O OD1 . ASP D 1 29  ? 9.078   22.782  37.702  1.00 56.93  ? 29  ASP D OD1 1 
ATOM   8329  O OD2 . ASP D 1 29  ? 10.928  21.769  38.341  1.00 62.58  ? 29  ASP D OD2 1 
ATOM   8330  N N   . LYS D 1 30  ? 11.859  23.833  33.419  1.00 29.58  ? 30  LYS D N   1 
ATOM   8331  C CA  . LYS D 1 30  ? 12.511  24.552  32.315  1.00 29.32  ? 30  LYS D CA  1 
ATOM   8332  C C   . LYS D 1 30  ? 11.543  25.308  31.389  1.00 30.95  ? 30  LYS D C   1 
ATOM   8333  O O   . LYS D 1 30  ? 11.912  26.328  30.812  1.00 32.63  ? 30  LYS D O   1 
ATOM   8334  C CB  . LYS D 1 30  ? 13.323  23.570  31.453  1.00 29.89  ? 30  LYS D CB  1 
ATOM   8335  C CG  . LYS D 1 30  ? 14.798  23.670  31.669  1.00 41.24  ? 30  LYS D CG  1 
ATOM   8336  C CD  . LYS D 1 30  ? 15.166  23.685  33.171  1.00 47.93  ? 30  LYS D CD  1 
ATOM   8337  C CE  . LYS D 1 30  ? 16.638  24.057  33.350  1.00 41.76  ? 30  LYS D CE  1 
ATOM   8338  N NZ  . LYS D 1 30  ? 16.833  25.501  33.708  1.00 47.39  ? 30  LYS D NZ  1 
ATOM   8339  N N   . TYR D 1 31  ? 10.360  24.743  31.179  1.00 22.45  ? 31  TYR D N   1 
ATOM   8340  C CA  . TYR D 1 31  ? 9.317   25.353  30.355  1.00 21.51  ? 31  TYR D CA  1 
ATOM   8341  C C   . TYR D 1 31  ? 8.134   25.756  31.211  1.00 25.58  ? 31  TYR D C   1 
ATOM   8342  O O   . TYR D 1 31  ? 7.128   26.227  30.692  1.00 24.41  ? 31  TYR D O   1 
ATOM   8343  C CB  . TYR D 1 31  ? 8.858   24.403  29.253  1.00 22.29  ? 31  TYR D CB  1 
ATOM   8344  C CG  . TYR D 1 31  ? 9.981   24.130  28.308  1.00 23.07  ? 31  TYR D CG  1 
ATOM   8345  C CD1 . TYR D 1 31  ? 10.754  22.976  28.436  1.00 25.11  ? 31  TYR D CD1 1 
ATOM   8346  C CD2 . TYR D 1 31  ? 10.410  25.115  27.429  1.00 22.64  ? 31  TYR D CD2 1 
ATOM   8347  C CE1 . TYR D 1 31  ? 11.890  22.780  27.647  1.00 23.59  ? 31  TYR D CE1 1 
ATOM   8348  C CE2 . TYR D 1 31  ? 11.503  24.909  26.601  1.00 22.82  ? 31  TYR D CE2 1 
ATOM   8349  C CZ  . TYR D 1 31  ? 12.239  23.749  26.715  1.00 27.64  ? 31  TYR D CZ  1 
ATOM   8350  O OH  . TYR D 1 31  ? 13.331  23.583  25.895  1.00 24.15  ? 31  TYR D OH  1 
ATOM   8351  N N   . SER D 1 32  ? 8.298   25.636  32.530  1.00 22.30  ? 32  SER D N   1 
ATOM   8352  C CA  . SER D 1 32  ? 7.281   26.064  33.469  1.00 21.20  ? 32  SER D CA  1 
ATOM   8353  C C   . SER D 1 32  ? 5.967   25.426  33.113  1.00 23.52  ? 32  SER D C   1 
ATOM   8354  O O   . SER D 1 32  ? 4.948   26.118  33.010  1.00 24.56  ? 32  SER D O   1 
ATOM   8355  C CB  . SER D 1 32  ? 7.154   27.603  33.461  1.00 25.72  ? 32  SER D CB  1 
ATOM   8356  O OG  . SER D 1 32  ? 8.394   28.258  33.764  1.00 27.47  ? 32  SER D OG  1 
ATOM   8357  N N   . LEU D 1 33  ? 6.005   24.108  32.900  1.00 17.71  ? 33  LEU D N   1 
ATOM   8358  C CA  . LEU D 1 33  ? 4.807   23.320  32.595  1.00 15.53  ? 33  LEU D CA  1 
ATOM   8359  C C   . LEU D 1 33  ? 4.383   22.527  33.815  1.00 18.78  ? 33  LEU D C   1 
ATOM   8360  O O   . LEU D 1 33  ? 5.253   21.971  34.521  1.00 15.48  ? 33  LEU D O   1 
ATOM   8361  C CB  . LEU D 1 33  ? 5.141   22.320  31.479  1.00 15.11  ? 33  LEU D CB  1 
ATOM   8362  C CG  . LEU D 1 33  ? 5.687   22.967  30.202  1.00 17.76  ? 33  LEU D CG  1 
ATOM   8363  C CD1 . LEU D 1 33  ? 6.687   22.109  29.548  1.00 17.60  ? 33  LEU D CD1 1 
ATOM   8364  C CD2 . LEU D 1 33  ? 4.601   23.413  29.230  1.00 15.93  ? 33  LEU D CD2 1 
ATOM   8365  N N   . LYS D 1 34  ? 3.059   22.392  34.001  1.00 17.36  ? 34  LYS D N   1 
ATOM   8366  C CA  . LYS D 1 34  ? 2.468   21.505  35.033  1.00 16.21  ? 34  LYS D CA  1 
ATOM   8367  C C   . LYS D 1 34  ? 2.553   20.038  34.612  1.00 22.01  ? 34  LYS D C   1 
ATOM   8368  O O   . LYS D 1 34  ? 2.512   19.742  33.420  1.00 21.47  ? 34  LYS D O   1 
ATOM   8369  C CB  . LYS D 1 34  ? 1.037   21.910  35.303  1.00 15.28  ? 34  LYS D CB  1 
ATOM   8370  C CG  . LYS D 1 34  ? 0.903   23.378  35.249  1.00 1.00   ? 34  LYS D CG  1 
ATOM   8371  C CD  . LYS D 1 34  ? -0.289  23.859  36.079  1.00 33.69  ? 34  LYS D CD  1 
ATOM   8372  C CE  . LYS D 1 34  ? -1.543  24.029  35.231  1.00 60.13  ? 34  LYS D CE  1 
ATOM   8373  N NZ  . LYS D 1 34  ? -2.481  25.034  35.788  1.00 61.02  ? 34  LYS D NZ  1 
ATOM   8374  N N   . PRO D 1 35  ? 2.803   19.150  35.576  1.00 22.22  ? 35  PRO D N   1 
ATOM   8375  C CA  . PRO D 1 35  ? 2.989   17.686  35.323  1.00 22.39  ? 35  PRO D CA  1 
ATOM   8376  C C   . PRO D 1 35  ? 1.779   16.969  34.674  1.00 24.47  ? 35  PRO D C   1 
ATOM   8377  O O   . PRO D 1 35  ? 1.912   15.900  34.068  1.00 23.59  ? 35  PRO D O   1 
ATOM   8378  C CB  . PRO D 1 35  ? 3.238   17.127  36.724  1.00 24.53  ? 35  PRO D CB  1 
ATOM   8379  C CG  . PRO D 1 35  ? 3.877   18.323  37.500  1.00 27.88  ? 35  PRO D CG  1 
ATOM   8380  C CD  . PRO D 1 35  ? 3.349   19.589  36.877  1.00 21.95  ? 35  PRO D CD  1 
ATOM   8381  N N   . ASN D 1 36  ? 0.604   17.557  34.830  1.00 20.29  ? 36  ASN D N   1 
ATOM   8382  C CA  . ASN D 1 36  ? -0.589  17.054  34.194  1.00 21.10  ? 36  ASN D CA  1 
ATOM   8383  C C   . ASN D 1 36  ? -1.302  18.329  33.686  1.00 23.57  ? 36  ASN D C   1 
ATOM   8384  O O   . ASN D 1 36  ? -1.647  19.187  34.490  1.00 21.61  ? 36  ASN D O   1 
ATOM   8385  C CB  . ASN D 1 36  ? -1.451  16.248  35.186  1.00 20.15  ? 36  ASN D CB  1 
ATOM   8386  C CG  . ASN D 1 36  ? -1.915  14.912  34.615  1.00 65.26  ? 36  ASN D CG  1 
ATOM   8387  O OD1 . ASN D 1 36  ? -1.140  13.969  34.559  1.00 63.81  ? 36  ASN D OD1 1 
ATOM   8388  N ND2 . ASN D 1 36  ? -3.168  14.839  34.169  1.00 72.31  ? 36  ASN D ND2 1 
ATOM   8389  N N   . ASP D 1 37  ? -1.378  18.509  32.356  1.00 17.95  ? 37  ASP D N   1 
ATOM   8390  C CA  . ASP D 1 37  ? -2.080  19.655  31.755  1.00 14.71  ? 37  ASP D CA  1 
ATOM   8391  C C   . ASP D 1 37  ? -2.377  19.448  30.278  1.00 11.26  ? 37  ASP D C   1 
ATOM   8392  O O   . ASP D 1 37  ? -1.917  18.479  29.706  1.00 11.24  ? 37  ASP D O   1 
ATOM   8393  C CB  . ASP D 1 37  ? -1.218  20.910  31.885  1.00 15.64  ? 37  ASP D CB  1 
ATOM   8394  C CG  . ASP D 1 37  ? -2.044  22.170  32.102  1.00 20.47  ? 37  ASP D CG  1 
ATOM   8395  O OD1 . ASP D 1 37  ? -3.288  22.132  31.894  1.00 22.90  ? 37  ASP D OD1 1 
ATOM   8396  O OD2 . ASP D 1 37  ? -1.407  23.210  32.405  1.00 20.59  ? 37  ASP D OD2 1 
ATOM   8397  N N   . GLN D 1 38  ? -3.057  20.420  29.666  1.00 5.00   ? 38  GLN D N   1 
ATOM   8398  C CA  . GLN D 1 38  ? -3.244  20.518  28.201  1.00 6.24   ? 38  GLN D CA  1 
ATOM   8399  C C   . GLN D 1 38  ? -3.237  22.004  27.798  1.00 7.94   ? 38  GLN D C   1 
ATOM   8400  O O   . GLN D 1 38  ? -4.141  22.755  28.202  1.00 7.38   ? 38  GLN D O   1 
ATOM   8401  C CB  . GLN D 1 38  ? -4.566  19.856  27.737  1.00 7.55   ? 38  GLN D CB  1 
ATOM   8402  C CG  . GLN D 1 38  ? -4.661  18.388  28.095  1.00 9.73   ? 38  GLN D CG  1 
ATOM   8403  C CD  . GLN D 1 38  ? -5.917  17.768  27.586  1.00 25.76  ? 38  GLN D CD  1 
ATOM   8404  O OE1 . GLN D 1 38  ? -5.907  17.012  26.586  1.00 16.20  ? 38  GLN D OE1 1 
ATOM   8405  N NE2 . GLN D 1 38  ? -7.041  18.152  28.193  1.00 21.49  ? 38  GLN D NE2 1 
ATOM   8406  N N   . ILE D 1 39  ? -2.260  22.427  27.003  1.00 1.00   ? 39  ILE D N   1 
ATOM   8407  C CA  . ILE D 1 39  ? -2.175  23.831  26.657  1.00 1.00   ? 39  ILE D CA  1 
ATOM   8408  C C   . ILE D 1 39  ? -1.728  23.988  25.225  1.00 2.25   ? 39  ILE D C   1 
ATOM   8409  O O   . ILE D 1 39  ? -1.121  23.106  24.696  1.00 1.04   ? 39  ILE D O   1 
ATOM   8410  C CB  . ILE D 1 39  ? -1.090  24.616  27.616  1.00 5.21   ? 39  ILE D CB  1 
ATOM   8411  C CG1 . ILE D 1 39  ? 0.328   24.053  27.432  1.00 6.59   ? 39  ILE D CG1 1 
ATOM   8412  C CG2 . ILE D 1 39  ? -1.531  24.690  29.101  1.00 1.00   ? 39  ILE D CG2 1 
ATOM   8413  C CD1 . ILE D 1 39  ? 1.430   25.081  27.414  1.00 11.49  ? 39  ILE D CD1 1 
ATOM   8414  N N   . LEU D 1 40  ? -1.971  25.143  24.623  1.00 3.41   ? 40  LEU D N   1 
ATOM   8415  C CA  . LEU D 1 40  ? -1.377  25.437  23.329  1.00 7.25   ? 40  LEU D CA  1 
ATOM   8416  C C   . LEU D 1 40  ? 0.047   26.026  23.531  1.00 18.86  ? 40  LEU D C   1 
ATOM   8417  O O   . LEU D 1 40  ? 0.336   26.688  24.549  1.00 17.93  ? 40  LEU D O   1 
ATOM   8418  C CB  . LEU D 1 40  ? -2.200  26.454  22.580  1.00 7.48   ? 40  LEU D CB  1 
ATOM   8419  C CG  . LEU D 1 40  ? -3.615  25.990  22.297  1.00 10.88  ? 40  LEU D CG  1 
ATOM   8420  C CD1 . LEU D 1 40  ? -4.424  27.222  21.832  1.00 10.51  ? 40  LEU D CD1 1 
ATOM   8421  C CD2 . LEU D 1 40  ? -3.534  24.903  21.265  1.00 9.59   ? 40  LEU D CD2 1 
ATOM   8422  N N   . ALA D 1 41  ? 0.922   25.800  22.545  1.00 19.09  ? 41  ALA D N   1 
ATOM   8423  C CA  . ALA D 1 41  ? 2.287   26.300  22.609  1.00 18.79  ? 41  ALA D CA  1 
ATOM   8424  C C   . ALA D 1 41  ? 2.312   27.802  22.358  1.00 19.54  ? 41  ALA D C   1 
ATOM   8425  O O   . ALA D 1 41  ? 1.685   28.280  21.422  1.00 16.89  ? 41  ALA D O   1 
ATOM   8426  C CB  . ALA D 1 41  ? 3.140   25.591  21.589  1.00 19.68  ? 41  ALA D CB  1 
ATOM   8427  N N   . GLU D 1 42  ? 3.019   28.525  23.214  1.00 17.53  ? 42  GLU D N   1 
ATOM   8428  C CA  . GLU D 1 42  ? 3.259   29.956  23.045  1.00 18.77  ? 42  GLU D CA  1 
ATOM   8429  C C   . GLU D 1 42  ? 4.686   30.016  22.468  1.00 25.30  ? 42  GLU D C   1 
ATOM   8430  O O   . GLU D 1 42  ? 5.330   28.989  22.352  1.00 26.26  ? 42  GLU D O   1 
ATOM   8431  C CB  . GLU D 1 42  ? 3.269   30.645  24.431  1.00 20.32  ? 42  GLU D CB  1 
ATOM   8432  C CG  . GLU D 1 42  ? 2.092   30.342  25.348  1.00 28.40  ? 42  GLU D CG  1 
ATOM   8433  C CD  . GLU D 1 42  ? 0.888   31.177  24.994  1.00 43.92  ? 42  GLU D CD  1 
ATOM   8434  O OE1 . GLU D 1 42  ? 0.958   31.789  23.907  1.00 37.36  ? 42  GLU D OE1 1 
ATOM   8435  O OE2 . GLU D 1 42  ? -0.163  31.109  25.679  1.00 32.40  ? 42  GLU D OE2 1 
ATOM   8436  N N   . ASP D 1 43  ? 5.227   31.211  22.268  1.00 24.49  ? 43  ASP D N   1 
ATOM   8437  C CA  . ASP D 1 43  ? 6.622   31.408  21.875  1.00 26.00  ? 43  ASP D CA  1 
ATOM   8438  C C   . ASP D 1 43  ? 7.721   30.899  22.838  1.00 27.90  ? 43  ASP D C   1 
ATOM   8439  O O   . ASP D 1 43  ? 8.736   30.438  22.349  1.00 28.68  ? 43  ASP D O   1 
ATOM   8440  C CB  . ASP D 1 43  ? 6.855   32.888  21.635  1.00 29.35  ? 43  ASP D CB  1 
ATOM   8441  C CG  . ASP D 1 43  ? 6.543   33.301  20.252  1.00 37.48  ? 43  ASP D CG  1 
ATOM   8442  O OD1 . ASP D 1 43  ? 7.334   33.034  19.332  1.00 37.95  ? 43  ASP D OD1 1 
ATOM   8443  O OD2 . ASP D 1 43  ? 5.494   33.909  20.075  1.00 51.57  ? 43  ASP D OD2 1 
ATOM   8444  N N   . LYS D 1 44  ? 7.560   31.041  24.156  1.00 22.49  ? 44  LYS D N   1 
ATOM   8445  C CA  . LYS D 1 44  ? 8.572   30.558  25.107  1.00 22.88  ? 44  LYS D CA  1 
ATOM   8446  C C   . LYS D 1 44  ? 8.788   29.039  25.026  1.00 29.55  ? 44  LYS D C   1 
ATOM   8447  O O   . LYS D 1 44  ? 9.690   28.531  25.674  1.00 29.72  ? 44  LYS D O   1 
ATOM   8448  C CB  . LYS D 1 44  ? 8.121   30.901  26.544  1.00 25.96  ? 44  LYS D CB  1 
ATOM   8449  C CG  . LYS D 1 44  ? 6.603   30.795  26.777  1.00 19.39  ? 44  LYS D CG  1 
ATOM   8450  C CD  . LYS D 1 44  ? 6.134   31.682  27.926  1.00 32.23  ? 44  LYS D CD  1 
ATOM   8451  C CE  . LYS D 1 44  ? 5.824   30.874  29.163  1.00 48.23  ? 44  LYS D CE  1 
ATOM   8452  N NZ  . LYS D 1 44  ? 6.841   29.774  29.317  1.00 69.24  ? 44  LYS D NZ  1 
ATOM   8453  N N   . HIS D 1 45  ? 7.905   28.338  24.291  1.00 26.09  ? 45  HIS D N   1 
ATOM   8454  C CA  . HIS D 1 45  ? 7.877   26.879  24.212  1.00 24.01  ? 45  HIS D CA  1 
ATOM   8455  C C   . HIS D 1 45  ? 8.594   26.309  23.026  1.00 28.69  ? 45  HIS D C   1 
ATOM   8456  O O   . HIS D 1 45  ? 9.010   25.156  23.074  1.00 29.48  ? 45  HIS D O   1 
ATOM   8457  C CB  . HIS D 1 45  ? 6.374   26.357  24.252  1.00 23.10  ? 45  HIS D CB  1 
ATOM   8458  C CG  . HIS D 1 45  ? 5.604   26.814  25.462  1.00 23.76  ? 45  HIS D CG  1 
ATOM   8459  N ND1 . HIS D 1 45  ? 6.084   26.663  26.745  1.00 24.11  ? 45  HIS D ND1 1 
ATOM   8460  C CD2 . HIS D 1 45  ? 4.415   27.450  25.583  1.00 23.04  ? 45  HIS D CD2 1 
ATOM   8461  C CE1 . HIS D 1 45  ? 5.234   27.194  27.605  1.00 22.07  ? 45  HIS D CE1 1 
ATOM   8462  N NE2 . HIS D 1 45  ? 4.197   27.647  26.925  1.00 22.41  ? 45  HIS D NE2 1 
ATOM   8463  N N   . LYS D 1 46  ? 8.690   27.083  21.946  1.00 26.78  ? 46  LYS D N   1 
ATOM   8464  C CA  . LYS D 1 46  ? 9.379   26.625  20.711  1.00 28.09  ? 46  LYS D CA  1 
ATOM   8465  C C   . LYS D 1 46  ? 10.635  25.734  20.891  1.00 33.05  ? 46  LYS D C   1 
ATOM   8466  O O   . LYS D 1 46  ? 10.878  24.780  20.139  1.00 34.65  ? 46  LYS D O   1 
ATOM   8467  C CB  . LYS D 1 46  ? 9.685   27.806  19.787  1.00 30.15  ? 46  LYS D CB  1 
ATOM   8468  C CG  . LYS D 1 46  ? 8.488   28.354  19.021  1.00 23.41  ? 46  LYS D CG  1 
ATOM   8469  C CD  . LYS D 1 46  ? 8.951   29.254  17.886  1.00 32.15  ? 46  LYS D CD  1 
ATOM   8470  C CE  . LYS D 1 46  ? 8.826   30.722  18.267  1.00 42.27  ? 46  LYS D CE  1 
ATOM   8471  N NZ  . LYS D 1 46  ? 9.810   31.588  17.610  1.00 30.05  ? 46  LYS D NZ  1 
ATOM   8472  N N   . GLU D 1 47  ? 11.428  26.072  21.887  1.00 30.29  ? 47  GLU D N   1 
ATOM   8473  C CA  . GLU D 1 47  ? 12.628  25.335  22.223  1.00 30.71  ? 47  GLU D CA  1 
ATOM   8474  C C   . GLU D 1 47  ? 12.282  23.892  22.624  1.00 32.41  ? 47  GLU D C   1 
ATOM   8475  O O   . GLU D 1 47  ? 13.011  22.964  22.271  1.00 33.35  ? 47  GLU D O   1 
ATOM   8476  C CB  . GLU D 1 47  ? 13.335  26.071  23.381  1.00 33.02  ? 47  GLU D CB  1 
ATOM   8477  C CG  . GLU D 1 47  ? 14.777  25.675  23.622  1.00 53.30  ? 47  GLU D CG  1 
ATOM   8478  C CD  . GLU D 1 47  ? 15.538  26.687  24.455  1.00 78.04  ? 47  GLU D CD  1 
ATOM   8479  O OE1 . GLU D 1 47  ? 15.741  27.818  23.950  1.00 60.54  ? 47  GLU D OE1 1 
ATOM   8480  O OE2 . GLU D 1 47  ? 16.010  26.312  25.557  1.00 74.66  ? 47  GLU D OE2 1 
ATOM   8481  N N   . LEU D 1 48  ? 11.187  23.721  23.366  1.00 24.90  ? 48  LEU D N   1 
ATOM   8482  C CA  . LEU D 1 48  ? 10.805  22.452  23.960  1.00 22.73  ? 48  LEU D CA  1 
ATOM   8483  C C   . LEU D 1 48  ? 10.692  21.355  22.944  1.00 28.13  ? 48  LEU D C   1 
ATOM   8484  O O   . LEU D 1 48  ? 10.950  20.177  23.229  1.00 29.45  ? 48  LEU D O   1 
ATOM   8485  C CB  . LEU D 1 48  ? 9.476   22.605  24.682  1.00 22.22  ? 48  LEU D CB  1 
ATOM   8486  C CG  . LEU D 1 48  ? 8.599   21.392  24.971  1.00 25.30  ? 48  LEU D CG  1 
ATOM   8487  C CD1 . LEU D 1 48  ? 7.518   21.888  25.953  1.00 25.36  ? 48  LEU D CD1 1 
ATOM   8488  C CD2 . LEU D 1 48  ? 7.936   20.853  23.696  1.00 21.87  ? 48  LEU D CD2 1 
ATOM   8489  N N   . PHE D 1 49  ? 10.218  21.706  21.761  1.00 23.40  ? 49  PHE D N   1 
ATOM   8490  C CA  . PHE D 1 49  ? 9.968   20.676  20.770  1.00 22.20  ? 49  PHE D CA  1 
ATOM   8491  C C   . PHE D 1 49  ? 11.191  20.050  20.175  1.00 28.89  ? 49  PHE D C   1 
ATOM   8492  O O   . PHE D 1 49  ? 11.117  18.905  19.740  1.00 29.57  ? 49  PHE D O   1 
ATOM   8493  C CB  . PHE D 1 49  ? 8.985   21.152  19.700  1.00 23.13  ? 49  PHE D CB  1 
ATOM   8494  C CG  . PHE D 1 49  ? 7.574   21.287  20.203  1.00 22.82  ? 49  PHE D CG  1 
ATOM   8495  C CD1 . PHE D 1 49  ? 6.726   20.183  20.253  1.00 24.20  ? 49  PHE D CD1 1 
ATOM   8496  C CD2 . PHE D 1 49  ? 7.127   22.488  20.716  1.00 23.70  ? 49  PHE D CD2 1 
ATOM   8497  C CE1 . PHE D 1 49  ? 5.464   20.275  20.816  1.00 24.46  ? 49  PHE D CE1 1 
ATOM   8498  C CE2 . PHE D 1 49  ? 5.823   22.600  21.234  1.00 25.71  ? 49  PHE D CE2 1 
ATOM   8499  C CZ  . PHE D 1 49  ? 5.003   21.485  21.291  1.00 23.11  ? 49  PHE D CZ  1 
ATOM   8500  N N   . ASP D 1 50  ? 12.281  20.827  20.114  1.00 27.04  ? 50  ASP D N   1 
ATOM   8501  C CA  . ASP D 1 50  ? 13.583  20.377  19.602  1.00 26.88  ? 50  ASP D CA  1 
ATOM   8502  C C   . ASP D 1 50  ? 14.368  19.593  20.650  1.00 30.52  ? 50  ASP D C   1 
ATOM   8503  O O   . ASP D 1 50  ? 14.881  18.511  20.352  1.00 31.19  ? 50  ASP D O   1 
ATOM   8504  C CB  . ASP D 1 50  ? 14.440  21.563  19.118  1.00 29.73  ? 50  ASP D CB  1 
ATOM   8505  C CG  . ASP D 1 50  ? 13.942  22.157  17.804  1.00 40.83  ? 50  ASP D CG  1 
ATOM   8506  O OD1 . ASP D 1 50  ? 13.579  21.350  16.904  1.00 36.31  ? 50  ASP D OD1 1 
ATOM   8507  O OD2 . ASP D 1 50  ? 13.864  23.417  17.707  1.00 47.76  ? 50  ASP D OD2 1 
ATOM   8508  N N   . GLU D 1 51  ? 14.471  20.108  21.876  1.00 25.98  ? 51  GLU D N   1 
ATOM   8509  C CA  . GLU D 1 51  ? 15.224  19.371  22.879  1.00 27.31  ? 51  GLU D CA  1 
ATOM   8510  C C   . GLU D 1 51  ? 14.537  18.115  23.372  1.00 32.90  ? 51  GLU D C   1 
ATOM   8511  O O   . GLU D 1 51  ? 15.195  17.138  23.746  1.00 32.96  ? 51  GLU D O   1 
ATOM   8512  C CB  . GLU D 1 51  ? 15.722  20.265  24.010  1.00 29.09  ? 51  GLU D CB  1 
ATOM   8513  C CG  . GLU D 1 51  ? 14.904  20.265  25.248  1.00 38.52  ? 51  GLU D CG  1 
ATOM   8514  C CD  . GLU D 1 51  ? 15.544  21.127  26.309  1.00 39.38  ? 51  GLU D CD  1 
ATOM   8515  O OE1 . GLU D 1 51  ? 15.413  22.366  26.211  1.00 33.08  ? 51  GLU D OE1 1 
ATOM   8516  O OE2 . GLU D 1 51  ? 16.291  20.590  27.152  1.00 27.89  ? 51  GLU D OE2 1 
ATOM   8517  N N   . LEU D 1 52  ? 13.207  18.124  23.299  1.00 28.03  ? 52  LEU D N   1 
ATOM   8518  C CA  . LEU D 1 52  ? 12.425  16.947  23.622  1.00 25.69  ? 52  LEU D CA  1 
ATOM   8519  C C   . LEU D 1 52  ? 12.874  15.819  22.691  1.00 27.79  ? 52  LEU D C   1 
ATOM   8520  O O   . LEU D 1 52  ? 13.259  14.750  23.131  1.00 28.98  ? 52  LEU D O   1 
ATOM   8521  C CB  . LEU D 1 52  ? 10.920  17.236  23.491  1.00 24.18  ? 52  LEU D CB  1 
ATOM   8522  C CG  . LEU D 1 52  ? 10.082  15.987  23.759  1.00 25.87  ? 52  LEU D CG  1 
ATOM   8523  C CD1 . LEU D 1 52  ? 10.051  15.696  25.259  1.00 25.84  ? 52  LEU D CD1 1 
ATOM   8524  C CD2 . LEU D 1 52  ? 8.704   15.981  23.113  1.00 22.33  ? 52  LEU D CD2 1 
ATOM   8525  N N   . VAL D 1 53  ? 12.941  16.119  21.408  1.00 23.60  ? 53  VAL D N   1 
ATOM   8526  C CA  . VAL D 1 53  ? 13.393  15.151  20.403  1.00 24.02  ? 53  VAL D CA  1 
ATOM   8527  C C   . VAL D 1 53  ? 14.862  14.713  20.571  1.00 30.08  ? 53  VAL D C   1 
ATOM   8528  O O   . VAL D 1 53  ? 15.168  13.512  20.539  1.00 29.62  ? 53  VAL D O   1 
ATOM   8529  C CB  . VAL D 1 53  ? 13.106  15.679  18.952  1.00 26.53  ? 53  VAL D CB  1 
ATOM   8530  C CG1 . VAL D 1 53  ? 13.986  14.991  17.952  1.00 25.93  ? 53  VAL D CG1 1 
ATOM   8531  C CG2 . VAL D 1 53  ? 11.635  15.452  18.586  1.00 25.78  ? 53  VAL D CG2 1 
ATOM   8532  N N   . LYS D 1 54  ? 15.748  15.690  20.775  1.00 28.75  ? 54  LYS D N   1 
ATOM   8533  C CA  . LYS D 1 54  ? 17.184  15.445  20.987  1.00 28.82  ? 54  LYS D CA  1 
ATOM   8534  C C   . LYS D 1 54  ? 17.495  14.728  22.306  1.00 32.29  ? 54  LYS D C   1 
ATOM   8535  O O   . LYS D 1 54  ? 18.214  13.724  22.324  1.00 35.14  ? 54  LYS D O   1 
ATOM   8536  C CB  . LYS D 1 54  ? 17.983  16.753  20.953  1.00 31.03  ? 54  LYS D CB  1 
ATOM   8537  C CG  . LYS D 1 54  ? 18.465  17.215  19.605  1.00 49.67  ? 54  LYS D CG  1 
ATOM   8538  C CD  . LYS D 1 54  ? 18.703  18.730  19.595  1.00 69.62  ? 54  LYS D CD  1 
ATOM   8539  C CE  . LYS D 1 54  ? 18.387  19.380  18.239  1.00 86.36  ? 54  LYS D CE  1 
ATOM   8540  N NZ  . LYS D 1 54  ? 17.189  20.269  18.274  1.00 89.64  ? 54  LYS D NZ  1 
ATOM   8541  N N   . LYS D 1 55  ? 16.985  15.241  23.410  1.00 26.22  ? 55  LYS D N   1 
ATOM   8542  C CA  . LYS D 1 55  ? 17.304  14.644  24.695  1.00 26.70  ? 55  LYS D CA  1 
ATOM   8543  C C   . LYS D 1 55  ? 16.668  13.321  25.129  1.00 32.89  ? 55  LYS D C   1 
ATOM   8544  O O   . LYS D 1 55  ? 17.305  12.549  25.851  1.00 35.20  ? 55  LYS D O   1 
ATOM   8545  C CB  . LYS D 1 55  ? 17.260  15.679  25.823  1.00 26.85  ? 55  LYS D CB  1 
ATOM   8546  C CG  . LYS D 1 55  ? 18.169  16.835  25.596  1.00 35.32  ? 55  LYS D CG  1 
ATOM   8547  C CD  . LYS D 1 55  ? 18.215  17.724  26.839  1.00 47.76  ? 55  LYS D CD  1 
ATOM   8548  C CE  . LYS D 1 55  ? 18.995  19.020  26.601  1.00 53.81  ? 55  LYS D CE  1 
ATOM   8549  N NZ  . LYS D 1 55  ? 20.253  19.034  27.395  1.00 59.51  ? 55  LYS D NZ  1 
ATOM   8550  N N   . PHE D 1 56  ? 15.416  13.072  24.750  1.00 27.44  ? 56  PHE D N   1 
ATOM   8551  C CA  . PHE D 1 56  ? 14.711  11.885  25.226  1.00 25.91  ? 56  PHE D CA  1 
ATOM   8552  C C   . PHE D 1 56  ? 14.346  10.866  24.147  1.00 32.59  ? 56  PHE D C   1 
ATOM   8553  O O   . PHE D 1 56  ? 14.410  11.163  22.941  1.00 30.86  ? 56  PHE D O   1 
ATOM   8554  C CB  . PHE D 1 56  ? 13.482  12.286  26.033  1.00 26.16  ? 56  PHE D CB  1 
ATOM   8555  C CG  . PHE D 1 56  ? 13.751  13.337  27.066  1.00 26.42  ? 56  PHE D CG  1 
ATOM   8556  C CD1 . PHE D 1 56  ? 13.892  14.664  26.696  1.00 29.48  ? 56  PHE D CD1 1 
ATOM   8557  C CD2 . PHE D 1 56  ? 13.835  13.001  28.411  1.00 27.05  ? 56  PHE D CD2 1 
ATOM   8558  C CE1 . PHE D 1 56  ? 14.147  15.638  27.650  1.00 30.26  ? 56  PHE D CE1 1 
ATOM   8559  C CE2 . PHE D 1 56  ? 14.113  13.953  29.368  1.00 29.60  ? 56  PHE D CE2 1 
ATOM   8560  C CZ  . PHE D 1 56  ? 14.270  15.276  28.992  1.00 28.43  ? 56  PHE D CZ  1 
ATOM   8561  N N   . LYS D 1 57  ? 13.970  9.668   24.601  1.00 30.92  ? 57  LYS D N   1 
ATOM   8562  C CA  . LYS D 1 57  ? 13.565  8.568   23.722  1.00 31.24  ? 57  LYS D CA  1 
ATOM   8563  C C   . LYS D 1 57  ? 12.120  8.760   23.350  1.00 34.53  ? 57  LYS D C   1 
ATOM   8564  O O   . LYS D 1 57  ? 11.221  8.207   23.983  1.00 36.07  ? 57  LYS D O   1 
ATOM   8565  C CB  . LYS D 1 57  ? 13.699  7.216   24.453  1.00 35.76  ? 57  LYS D CB  1 
ATOM   8566  C CG  . LYS D 1 57  ? 15.137  6.895   24.961  1.00 50.56  ? 57  LYS D CG  1 
ATOM   8567  C CD  . LYS D 1 57  ? 15.276  5.465   25.461  1.00 49.81  ? 57  LYS D CD  1 
ATOM   8568  C CE  . LYS D 1 57  ? 16.725  5.082   25.625  1.00 48.40  ? 57  LYS D CE  1 
ATOM   8569  N NZ  . LYS D 1 57  ? 17.506  5.374   24.407  1.00 62.53  ? 57  LYS D NZ  1 
ATOM   8570  N N   . VAL D 1 58  ? 11.916  9.474   22.254  1.00 28.21  ? 58  VAL D N   1 
ATOM   8571  C CA  . VAL D 1 58  ? 10.594  9.872   21.797  1.00 26.08  ? 58  VAL D CA  1 
ATOM   8572  C C   . VAL D 1 58  ? 9.853   8.848   20.900  1.00 25.67  ? 58  VAL D C   1 
ATOM   8573  O O   . VAL D 1 58  ? 10.479  7.969   20.307  1.00 23.85  ? 58  VAL D O   1 
ATOM   8574  C CB  . VAL D 1 58  ? 10.720  11.304  21.209  1.00 29.70  ? 58  VAL D CB  1 
ATOM   8575  C CG1 . VAL D 1 58  ? 11.096  11.292  19.746  1.00 28.58  ? 58  VAL D CG1 1 
ATOM   8576  C CG2 . VAL D 1 58  ? 9.556   12.166  21.538  1.00 29.94  ? 58  VAL D CG2 1 
ATOM   8577  N N   . GLU D 1 59  ? 8.517   8.915   20.871  1.00 19.89  ? 59  GLU D N   1 
ATOM   8578  C CA  . GLU D 1 59  ? 7.679   8.022   20.047  1.00 16.99  ? 59  GLU D CA  1 
ATOM   8579  C C   . GLU D 1 59  ? 6.633   8.852   19.323  1.00 18.88  ? 59  GLU D C   1 
ATOM   8580  O O   . GLU D 1 59  ? 6.094   9.794   19.890  1.00 17.19  ? 59  GLU D O   1 
ATOM   8581  C CB  . GLU D 1 59  ? 6.943   7.010   20.906  1.00 17.87  ? 59  GLU D CB  1 
ATOM   8582  C CG  . GLU D 1 59  ? 7.807   6.035   21.642  1.00 33.86  ? 59  GLU D CG  1 
ATOM   8583  C CD  . GLU D 1 59  ? 7.134   4.678   21.776  1.00 60.84  ? 59  GLU D CD  1 
ATOM   8584  O OE1 . GLU D 1 59  ? 6.391   4.279   20.844  1.00 48.78  ? 59  GLU D OE1 1 
ATOM   8585  O OE2 . GLU D 1 59  ? 7.327   4.023   22.822  1.00 68.06  ? 59  GLU D OE2 1 
ATOM   8586  N N   . TYR D 1 60  ? 6.304   8.453   18.096  1.00 17.06  ? 60  TYR D N   1 
ATOM   8587  C CA  . TYR D 1 60  ? 5.304   9.158   17.278  1.00 16.87  ? 60  TYR D CA  1 
ATOM   8588  C C   . TYR D 1 60  ? 4.006   8.352   17.065  1.00 20.54  ? 60  TYR D C   1 
ATOM   8589  O O   . TYR D 1 60  ? 4.065   7.163   16.758  1.00 19.67  ? 60  TYR D O   1 
ATOM   8590  C CB  . TYR D 1 60  ? 5.931   9.497   15.931  1.00 17.01  ? 60  TYR D CB  1 
ATOM   8591  C CG  . TYR D 1 60  ? 7.262   10.193  16.089  1.00 18.75  ? 60  TYR D CG  1 
ATOM   8592  C CD1 . TYR D 1 60  ? 7.339   11.577  16.124  1.00 20.20  ? 60  TYR D CD1 1 
ATOM   8593  C CD2 . TYR D 1 60  ? 8.467   9.474   16.069  1.00 20.70  ? 60  TYR D CD2 1 
ATOM   8594  C CE1 . TYR D 1 60  ? 8.545   12.223  16.214  1.00 20.77  ? 60  TYR D CE1 1 
ATOM   8595  C CE2 . TYR D 1 60  ? 9.698   10.102  16.158  1.00 21.14  ? 60  TYR D CE2 1 
ATOM   8596  C CZ  . TYR D 1 60  ? 9.728   11.481  16.280  1.00 31.02  ? 60  TYR D CZ  1 
ATOM   8597  O OH  . TYR D 1 60  ? 10.957  12.142  16.340  1.00 27.24  ? 60  TYR D OH  1 
ATOM   8598  N N   . HIS D 1 61  ? 2.853   9.008   17.188  1.00 18.71  ? 61  HIS D N   1 
ATOM   8599  C CA  . HIS D 1 61  ? 1.536   8.369   16.997  1.00 20.50  ? 61  HIS D CA  1 
ATOM   8600  C C   . HIS D 1 61  ? 0.617   9.415   16.373  1.00 22.34  ? 61  HIS D C   1 
ATOM   8601  O O   . HIS D 1 61  ? 0.833   10.596  16.608  1.00 20.03  ? 61  HIS D O   1 
ATOM   8602  C CB  . HIS D 1 61  ? 0.938   7.932   18.376  1.00 23.31  ? 61  HIS D CB  1 
ATOM   8603  C CG  . HIS D 1 61  ? 1.717   6.843   19.060  1.00 28.79  ? 61  HIS D CG  1 
ATOM   8604  N ND1 . HIS D 1 61  ? 1.608   5.513   18.700  1.00 31.40  ? 61  HIS D ND1 1 
ATOM   8605  C CD2 . HIS D 1 61  ? 2.649   6.892   20.050  1.00 31.51  ? 61  HIS D CD2 1 
ATOM   8606  C CE1 . HIS D 1 61  ? 2.430   4.791   19.444  1.00 31.55  ? 61  HIS D CE1 1 
ATOM   8607  N NE2 . HIS D 1 61  ? 3.059   5.601   20.282  1.00 31.90  ? 61  HIS D NE2 1 
ATOM   8608  N N   . ALA D 1 62  ? -0.347  9.002   15.533  1.00 18.52  ? 62  ALA D N   1 
ATOM   8609  C CA  . ALA D 1 62  ? -1.304  9.953   14.938  1.00 16.98  ? 62  ALA D CA  1 
ATOM   8610  C C   . ALA D 1 62  ? -2.211  10.453  16.048  1.00 21.06  ? 62  ALA D C   1 
ATOM   8611  O O   . ALA D 1 62  ? -2.637  9.693   16.877  1.00 23.10  ? 62  ALA D O   1 
ATOM   8612  C CB  . ALA D 1 62  ? -2.119  9.350   13.780  1.00 16.77  ? 62  ALA D CB  1 
ATOM   8613  N N   . GLY D 1 63  ? -2.397  11.764  16.124  1.00 17.27  ? 63  GLY D N   1 
ATOM   8614  C CA  . GLY D 1 63  ? -3.184  12.385  17.189  1.00 15.66  ? 63  GLY D CA  1 
ATOM   8615  C C   . GLY D 1 63  ? -4.299  13.319  16.701  1.00 13.42  ? 63  GLY D C   1 
ATOM   8616  O O   . GLY D 1 63  ? -4.806  13.190  15.575  1.00 12.06  ? 63  GLY D O   1 
ATOM   8617  N N   . GLY D 1 64  ? -4.681  14.245  17.568  1.00 6.95   ? 64  GLY D N   1 
ATOM   8618  C CA  . GLY D 1 64  ? -5.794  15.095  17.255  1.00 8.23   ? 64  GLY D CA  1 
ATOM   8619  C C   . GLY D 1 64  ? -6.959  14.515  18.062  1.00 16.38  ? 64  GLY D C   1 
ATOM   8620  O O   . GLY D 1 64  ? -7.154  13.286  18.123  1.00 15.35  ? 64  GLY D O   1 
ATOM   8621  N N   . SER D 1 65  ? -7.661  15.371  18.784  1.00 12.56  ? 65  SER D N   1 
ATOM   8622  C CA  . SER D 1 65  ? -8.721  14.843  19.609  1.00 10.87  ? 65  SER D CA  1 
ATOM   8623  C C   . SER D 1 65  ? -9.875  14.382  18.745  1.00 9.42   ? 65  SER D C   1 
ATOM   8624  O O   . SER D 1 65  ? -10.242 13.225  18.803  1.00 10.84  ? 65  SER D O   1 
ATOM   8625  C CB  . SER D 1 65  ? -9.152  15.831  20.707  1.00 14.92  ? 65  SER D CB  1 
ATOM   8626  O OG  . SER D 1 65  ? -10.132 15.199  21.494  1.00 29.13  ? 65  SER D OG  1 
ATOM   8627  N N   . THR D 1 66  ? -10.399 15.262  17.890  1.00 2.77   ? 66  THR D N   1 
ATOM   8628  C CA  . THR D 1 66  ? -11.518 14.905  17.039  1.00 3.05   ? 66  THR D CA  1 
ATOM   8629  C C   . THR D 1 66  ? -11.134 13.760  16.138  1.00 13.22  ? 66  THR D C   1 
ATOM   8630  O O   . THR D 1 66  ? -11.928 12.839  15.917  1.00 16.42  ? 66  THR D O   1 
ATOM   8631  C CB  . THR D 1 66  ? -12.128 16.080  16.208  1.00 4.35   ? 66  THR D CB  1 
ATOM   8632  O OG1 . THR D 1 66  ? -12.417 17.210  17.051  1.00 4.80   ? 66  THR D OG1 1 
ATOM   8633  C CG2 . THR D 1 66  ? -13.467 15.653  15.548  1.00 1.59   ? 66  THR D CG2 1 
ATOM   8634  N N   . GLN D 1 67  ? -9.902  13.789  15.667  1.00 10.54  ? 67  GLN D N   1 
ATOM   8635  C CA  . GLN D 1 67  ? -9.377  12.756  14.770  1.00 10.39  ? 67  GLN D CA  1 
ATOM   8636  C C   . GLN D 1 67  ? -9.401  11.405  15.402  1.00 14.09  ? 67  GLN D C   1 
ATOM   8637  O O   . GLN D 1 67  ? -9.837  10.430  14.770  1.00 16.87  ? 67  GLN D O   1 
ATOM   8638  C CB  . GLN D 1 67  ? -7.945  13.111  14.272  1.00 11.17  ? 67  GLN D CB  1 
ATOM   8639  C CG  . GLN D 1 67  ? -7.647  12.530  12.900  1.00 23.32  ? 67  GLN D CG  1 
ATOM   8640  C CD  . GLN D 1 67  ? -6.225  12.799  12.412  1.00 32.52  ? 67  GLN D CD  1 
ATOM   8641  O OE1 . GLN D 1 67  ? -5.908  12.619  11.224  1.00 20.90  ? 67  GLN D OE1 1 
ATOM   8642  N NE2 . GLN D 1 67  ? -5.350  13.227  13.333  1.00 11.43  ? 67  GLN D NE2 1 
ATOM   8643  N N   . ASN D 1 68  ? -8.942  11.350  16.647  1.00 10.54  ? 68  ASN D N   1 
ATOM   8644  C CA  . ASN D 1 68  ? -8.885  10.098  17.432  1.00 11.97  ? 68  ASN D CA  1 
ATOM   8645  C C   . ASN D 1 68  ? -10.292 9.491   17.630  1.00 16.03  ? 68  ASN D C   1 
ATOM   8646  O O   . ASN D 1 68  ? -10.474 8.287   17.519  1.00 15.55  ? 68  ASN D O   1 
ATOM   8647  C CB  . ASN D 1 68  ? -8.328  10.375  18.830  1.00 10.80  ? 68  ASN D CB  1 
ATOM   8648  C CG  . ASN D 1 68  ? -6.840  10.523  18.864  1.00 13.07  ? 68  ASN D CG  1 
ATOM   8649  O OD1 . ASN D 1 68  ? -6.160  10.138  17.925  1.00 8.80   ? 68  ASN D OD1 1 
ATOM   8650  N ND2 . ASN D 1 68  ? -6.310  10.872  20.061  1.00 3.16   ? 68  ASN D ND2 1 
ATOM   8651  N N   . SER D 1 69  ? -11.249 10.332  18.024  1.00 11.45  ? 69  SER D N   1 
ATOM   8652  C CA  . SER D 1 69  ? -12.614 9.888   18.291  1.00 10.56  ? 69  SER D CA  1 
ATOM   8653  C C   . SER D 1 69  ? -13.265 9.364   17.054  1.00 18.98  ? 69  SER D C   1 
ATOM   8654  O O   . SER D 1 69  ? -14.036 8.401   17.118  1.00 20.05  ? 69  SER D O   1 
ATOM   8655  C CB  . SER D 1 69  ? -13.455 11.019  18.864  1.00 10.58  ? 69  SER D CB  1 
ATOM   8656  O OG  . SER D 1 69  ? -13.054 11.274  20.188  1.00 13.84  ? 69  SER D OG  1 
ATOM   8657  N N   . ILE D 1 70  ? -12.998 10.034  15.932  1.00 17.80  ? 70  ILE D N   1 
ATOM   8658  C CA  . ILE D 1 70  ? -13.541 9.617   14.628  1.00 16.69  ? 70  ILE D CA  1 
ATOM   8659  C C   . ILE D 1 70  ? -12.979 8.247   14.262  1.00 20.18  ? 70  ILE D C   1 
ATOM   8660  O O   . ILE D 1 70  ? -13.700 7.441   13.698  1.00 20.08  ? 70  ILE D O   1 
ATOM   8661  C CB  . ILE D 1 70  ? -13.268 10.648  13.487  1.00 18.49  ? 70  ILE D CB  1 
ATOM   8662  C CG1 . ILE D 1 70  ? -14.131 11.921  13.656  1.00 18.36  ? 70  ILE D CG1 1 
ATOM   8663  C CG2 . ILE D 1 70  ? -13.524 10.023  12.149  1.00 17.78  ? 70  ILE D CG2 1 
ATOM   8664  C CD1 . ILE D 1 70  ? -15.674 11.701  13.705  1.00 1.37   ? 70  ILE D CD1 1 
ATOM   8665  N N   . LYS D 1 71  ? -11.699 7.989   14.570  1.00 17.16  ? 71  LYS D N   1 
ATOM   8666  C CA  . LYS D 1 71  ? -11.105 6.653   14.316  1.00 16.10  ? 71  LYS D CA  1 
ATOM   8667  C C   . LYS D 1 71  ? -11.749 5.616   15.241  1.00 19.44  ? 71  LYS D C   1 
ATOM   8668  O O   . LYS D 1 71  ? -12.173 4.558   14.782  1.00 22.84  ? 71  LYS D O   1 
ATOM   8669  C CB  . LYS D 1 71  ? -9.601  6.611   14.531  1.00 17.15  ? 71  LYS D CB  1 
ATOM   8670  C CG  . LYS D 1 71  ? -8.835  7.703   13.848  1.00 26.91  ? 71  LYS D CG  1 
ATOM   8671  C CD  . LYS D 1 71  ? -7.340  7.399   13.802  1.00 15.39  ? 71  LYS D CD  1 
ATOM   8672  C CE  . LYS D 1 71  ? -6.687  8.137   12.636  1.00 10.40  ? 71  LYS D CE  1 
ATOM   8673  N NZ  . LYS D 1 71  ? -5.379  8.654   12.998  1.00 21.14  ? 71  LYS D NZ  1 
ATOM   8674  N N   . VAL D 1 72  ? -11.877 5.911   16.534  1.00 11.96  ? 72  VAL D N   1 
ATOM   8675  C CA  . VAL D 1 72  ? -12.576 4.960   17.425  1.00 10.88  ? 72  VAL D CA  1 
ATOM   8676  C C   . VAL D 1 72  ? -14.053 4.660   17.060  1.00 15.55  ? 72  VAL D C   1 
ATOM   8677  O O   . VAL D 1 72  ? -14.538 3.568   17.285  1.00 15.97  ? 72  VAL D O   1 
ATOM   8678  C CB  . VAL D 1 72  ? -12.476 5.303   18.911  1.00 11.52  ? 72  VAL D CB  1 
ATOM   8679  C CG1 . VAL D 1 72  ? -13.475 4.461   19.679  1.00 9.24   ? 72  VAL D CG1 1 
ATOM   8680  C CG2 . VAL D 1 72  ? -11.023 5.041   19.430  1.00 11.10  ? 72  VAL D CG2 1 
ATOM   8681  N N   . ALA D 1 73  ? -14.746 5.659   16.535  1.00 13.03  ? 73  ALA D N   1 
ATOM   8682  C CA  . ALA D 1 73  ? -16.122 5.553   16.081  1.00 12.86  ? 73  ALA D CA  1 
ATOM   8683  C C   . ALA D 1 73  ? -16.149 4.663   14.806  1.00 19.06  ? 73  ALA D C   1 
ATOM   8684  O O   . ALA D 1 73  ? -17.034 3.824   14.637  1.00 20.80  ? 73  ALA D O   1 
ATOM   8685  C CB  . ALA D 1 73  ? -16.689 6.992   15.774  1.00 12.19  ? 73  ALA D CB  1 
ATOM   8686  N N   . GLN D 1 74  ? -15.171 4.840   13.925  1.00 14.74  ? 74  GLN D N   1 
ATOM   8687  C CA  . GLN D 1 74  ? -15.145 4.077   12.693  1.00 16.05  ? 74  GLN D CA  1 
ATOM   8688  C C   . GLN D 1 74  ? -14.812 2.636   13.043  1.00 22.96  ? 74  GLN D C   1 
ATOM   8689  O O   . GLN D 1 74  ? -15.372 1.704   12.472  1.00 24.41  ? 74  GLN D O   1 
ATOM   8690  C CB  . GLN D 1 74  ? -14.165 4.711   11.684  1.00 17.37  ? 74  GLN D CB  1 
ATOM   8691  C CG  . GLN D 1 74  ? -13.938 3.932   10.354  1.00 15.86  ? 74  GLN D CG  1 
ATOM   8692  C CD  . GLN D 1 74  ? -15.207 3.700   9.531   1.00 25.64  ? 74  GLN D CD  1 
ATOM   8693  O OE1 . GLN D 1 74  ? -15.968 4.653   9.226   1.00 12.93  ? 74  GLN D OE1 1 
ATOM   8694  N NE2 . GLN D 1 74  ? -15.378 2.460   9.058   1.00 13.95  ? 74  GLN D NE2 1 
ATOM   8695  N N   . TRP D 1 75  ? -13.949 2.466   14.040  1.00 21.80  ? 75  TRP D N   1 
ATOM   8696  C CA  . TRP D 1 75  ? -13.567 1.148   14.505  1.00 21.33  ? 75  TRP D CA  1 
ATOM   8697  C C   . TRP D 1 75  ? -14.738 0.417   15.141  1.00 25.49  ? 75  TRP D C   1 
ATOM   8698  O O   . TRP D 1 75  ? -14.929 -0.751  14.868  1.00 28.72  ? 75  TRP D O   1 
ATOM   8699  C CB  . TRP D 1 75  ? -12.435 1.231   15.487  1.00 20.05  ? 75  TRP D CB  1 
ATOM   8700  C CG  . TRP D 1 75  ? -12.051 -0.141  16.045  1.00 21.47  ? 75  TRP D CG  1 
ATOM   8701  C CD1 . TRP D 1 75  ? -11.253 -1.090  15.436  1.00 23.55  ? 75  TRP D CD1 1 
ATOM   8702  C CD2 . TRP D 1 75  ? -12.335 -0.648  17.369  1.00 21.69  ? 75  TRP D CD2 1 
ATOM   8703  N NE1 . TRP D 1 75  ? -11.062 -2.157  16.275  1.00 22.18  ? 75  TRP D NE1 1 
ATOM   8704  C CE2 . TRP D 1 75  ? -11.691 -1.909  17.473  1.00 24.09  ? 75  TRP D CE2 1 
ATOM   8705  C CE3 . TRP D 1 75  ? -13.000 -0.127  18.496  1.00 22.63  ? 75  TRP D CE3 1 
ATOM   8706  C CZ2 . TRP D 1 75  ? -11.750 -2.677  18.621  1.00 22.85  ? 75  TRP D CZ2 1 
ATOM   8707  C CZ3 . TRP D 1 75  ? -13.055 -0.894  19.629  1.00 24.13  ? 75  TRP D CZ3 1 
ATOM   8708  C CH2 . TRP D 1 75  ? -12.443 -2.164  19.682  1.00 24.60  ? 75  TRP D CH2 1 
ATOM   8709  N N   . MET D 1 76  ? -15.551 1.106   15.934  1.00 19.06  ? 76  MET D N   1 
ATOM   8710  C CA  . MET D 1 76  ? -16.734 0.471   16.530  1.00 19.48  ? 76  MET D CA  1 
ATOM   8711  C C   . MET D 1 76  ? -17.810 0.144   15.498  1.00 26.45  ? 76  MET D C   1 
ATOM   8712  O O   . MET D 1 76  ? -18.477 -0.874  15.599  1.00 26.21  ? 76  MET D O   1 
ATOM   8713  C CB  . MET D 1 76  ? -17.366 1.299   17.661  1.00 21.25  ? 76  MET D CB  1 
ATOM   8714  C CG  . MET D 1 76  ? -16.524 1.379   18.931  1.00 24.27  ? 76  MET D CG  1 
ATOM   8715  S SD  . MET D 1 76  ? -16.535 -0.114  19.943  1.00 26.22  ? 76  MET D SD  1 
ATOM   8716  C CE  . MET D 1 76  ? -17.920 0.163   21.045  1.00 20.84  ? 76  MET D CE  1 
ATOM   8717  N N   . ILE D 1 77  ? -18.047 1.060   14.571  1.00 24.75  ? 77  ILE D N   1 
ATOM   8718  C CA  . ILE D 1 77  ? -19.047 0.853   13.556  1.00 25.21  ? 77  ILE D CA  1 
ATOM   8719  C C   . ILE D 1 77  ? -18.614 -0.348  12.716  1.00 31.52  ? 77  ILE D C   1 
ATOM   8720  O O   . ILE D 1 77  ? -19.403 -1.213  12.395  1.00 29.64  ? 77  ILE D O   1 
ATOM   8721  C CB  . ILE D 1 77  ? -19.179 2.115   12.710  1.00 28.64  ? 77  ILE D CB  1 
ATOM   8722  C CG1 . ILE D 1 77  ? -19.898 3.208   13.511  1.00 27.78  ? 77  ILE D CG1 1 
ATOM   8723  C CG2 . ILE D 1 77  ? -19.781 1.796   11.341  1.00 28.71  ? 77  ILE D CG2 1 
ATOM   8724  C CD1 . ILE D 1 77  ? -19.674 4.574   12.976  1.00 36.29  ? 77  ILE D CD1 1 
ATOM   8725  N N   . GLN D 1 78  ? -17.324 -0.446  12.432  1.00 33.16  ? 78  GLN D N   1 
ATOM   8726  C CA  . GLN D 1 78  ? -16.802 -1.611  11.708  1.00 33.24  ? 78  GLN D CA  1 
ATOM   8727  C C   . GLN D 1 78  ? -17.381 -1.768  10.310  1.00 37.22  ? 78  GLN D C   1 
ATOM   8728  O O   . GLN D 1 78  ? -16.682 -1.614  9.327   1.00 35.73  ? 78  GLN D O   1 
ATOM   8729  C CB  . GLN D 1 78  ? -17.050 -2.871  12.539  1.00 34.11  ? 78  GLN D CB  1 
ATOM   8730  C CG  . GLN D 1 78  ? -16.097 -4.038  12.243  1.00 59.91  ? 78  GLN D CG  1 
ATOM   8731  C CD  . GLN D 1 78  ? -14.624 -3.641  12.060  1.00 72.31  ? 78  GLN D CD  1 
ATOM   8732  O OE1 . GLN D 1 78  ? -13.961 -3.193  13.004  1.00 57.84  ? 78  GLN D OE1 1 
ATOM   8733  N NE2 . GLN D 1 78  ? -14.083 -3.935  10.881  1.00 71.58  ? 78  GLN D NE2 1 
ATOM   8734  N N   . GLN D 1 79  ? -18.692 -1.954  10.255  1.00 38.05  ? 79  GLN D N   1 
ATOM   8735  C CA  . GLN D 1 79  ? -19.477 -2.200  9.037   1.00 39.79  ? 79  GLN D CA  1 
ATOM   8736  C C   . GLN D 1 79  ? -19.029 -1.546  7.732   1.00 44.69  ? 79  GLN D C   1 
ATOM   8737  O O   . GLN D 1 79  ? -18.134 -2.123  7.071   1.00 48.55  ? 79  GLN D O   1 
ATOM   8738  C CB  . GLN D 1 79  ? -20.969 -2.015  9.303   1.00 42.32  ? 79  GLN D CB  1 
ATOM   8739  C CG  . GLN D 1 79  ? -21.717 -3.312  9.415   1.00 80.03  ? 79  GLN D CG  1 
ATOM   8740  C CD  . GLN D 1 79  ? -21.629 -3.887  10.805  1.00 106.33 ? 79  GLN D CD  1 
ATOM   8741  O OE1 . GLN D 1 79  ? -20.633 -4.521  11.163  1.00 102.03 ? 79  GLN D OE1 1 
ATOM   8742  N NE2 . GLN D 1 79  ? -22.621 -3.576  11.635  1.00 98.17  ? 79  GLN D NE2 1 
ATOM   8743  N N   . PRO D 1 80  ? -19.646 -0.416  7.312   1.00 34.37  ? 80  PRO D N   1 
ATOM   8744  C CA  . PRO D 1 80  ? -19.195 0.199   6.056   1.00 31.42  ? 80  PRO D CA  1 
ATOM   8745  C C   . PRO D 1 80  ? -17.966 1.009   6.348   1.00 35.45  ? 80  PRO D C   1 
ATOM   8746  O O   . PRO D 1 80  ? -17.964 1.798   7.278   1.00 36.42  ? 80  PRO D O   1 
ATOM   8747  C CB  . PRO D 1 80  ? -20.326 1.134   5.661   1.00 32.03  ? 80  PRO D CB  1 
ATOM   8748  C CG  . PRO D 1 80  ? -21.199 1.276   6.866   1.00 36.88  ? 80  PRO D CG  1 
ATOM   8749  C CD  . PRO D 1 80  ? -20.712 0.383   7.951   1.00 32.61  ? 80  PRO D CD  1 
ATOM   8750  N N   . HIS D 1 81  ? -16.908 0.780   5.581   1.00 31.17  ? 81  HIS D N   1 
ATOM   8751  C CA  . HIS D 1 81  ? -15.695 1.554   5.699   1.00 30.79  ? 81  HIS D CA  1 
ATOM   8752  C C   . HIS D 1 81  ? -16.108 2.942   5.293   1.00 32.18  ? 81  HIS D C   1 
ATOM   8753  O O   . HIS D 1 81  ? -17.111 3.109   4.599   1.00 32.73  ? 81  HIS D O   1 
ATOM   8754  C CB  . HIS D 1 81  ? -14.675 1.061   4.694   1.00 32.39  ? 81  HIS D CB  1 
ATOM   8755  C CG  . HIS D 1 81  ? -14.053 -0.239  5.071   1.00 36.08  ? 81  HIS D CG  1 
ATOM   8756  N ND1 . HIS D 1 81  ? -14.265 -0.830  6.298   1.00 38.33  ? 81  HIS D ND1 1 
ATOM   8757  C CD2 . HIS D 1 81  ? -13.177 -1.031  4.416   1.00 38.28  ? 81  HIS D CD2 1 
ATOM   8758  C CE1 . HIS D 1 81  ? -13.560 -1.943  6.377   1.00 37.89  ? 81  HIS D CE1 1 
ATOM   8759  N NE2 . HIS D 1 81  ? -12.892 -2.088  5.247   1.00 38.51  ? 81  HIS D NE2 1 
ATOM   8760  N N   . LYS D 1 82  ? -15.377 3.950   5.740   1.00 24.78  ? 82  LYS D N   1 
ATOM   8761  C CA  . LYS D 1 82  ? -15.796 5.290   5.400   1.00 23.33  ? 82  LYS D CA  1 
ATOM   8762  C C   . LYS D 1 82  ? -17.167 5.650   5.968   1.00 25.71  ? 82  LYS D C   1 
ATOM   8763  O O   . LYS D 1 82  ? -17.886 6.468   5.391   1.00 26.47  ? 82  LYS D O   1 
ATOM   8764  C CB  . LYS D 1 82  ? -15.773 5.471   3.898   1.00 23.72  ? 82  LYS D CB  1 
ATOM   8765  C CG  . LYS D 1 82  ? -14.421 5.126   3.326   1.00 26.90  ? 82  LYS D CG  1 
ATOM   8766  C CD  . LYS D 1 82  ? -14.205 5.785   1.976   1.00 37.87  ? 82  LYS D CD  1 
ATOM   8767  C CE  . LYS D 1 82  ? -12.711 6.016   1.738   1.00 50.98  ? 82  LYS D CE  1 
ATOM   8768  N NZ  . LYS D 1 82  ? -12.030 4.817   1.156   1.00 63.71  ? 82  LYS D NZ  1 
ATOM   8769  N N   . ALA D 1 83  ? -17.481 5.144   7.161   1.00 19.74  ? 83  ALA D N   1 
ATOM   8770  C CA  . ALA D 1 83  ? -18.749 5.532   7.785   1.00 19.11  ? 83  ALA D CA  1 
ATOM   8771  C C   . ALA D 1 83  ? -18.535 6.903   8.388   1.00 19.07  ? 83  ALA D C   1 
ATOM   8772  O O   . ALA D 1 83  ? -19.484 7.674   8.507   1.00 16.15  ? 83  ALA D O   1 
ATOM   8773  C CB  . ALA D 1 83  ? -19.186 4.536   8.883   1.00 19.40  ? 83  ALA D CB  1 
ATOM   8774  N N   . ALA D 1 84  ? -17.269 7.182   8.742   1.00 13.18  ? 84  ALA D N   1 
ATOM   8775  C CA  . ALA D 1 84  ? -16.862 8.435   9.387   1.00 10.78  ? 84  ALA D CA  1 
ATOM   8776  C C   . ALA D 1 84  ? -16.046 9.348   8.489   1.00 12.32  ? 84  ALA D C   1 
ATOM   8777  O O   . ALA D 1 84  ? -15.087 8.912   7.875   1.00 13.16  ? 84  ALA D O   1 
ATOM   8778  C CB  . ALA D 1 84  ? -16.094 8.150   10.678  1.00 10.63  ? 84  ALA D CB  1 
ATOM   8779  N N   . THR D 1 85  ? -16.404 10.628  8.466   1.00 9.65   ? 85  THR D N   1 
ATOM   8780  C CA  . THR D 1 85  ? -15.663 11.660  7.723   1.00 10.39  ? 85  THR D CA  1 
ATOM   8781  C C   . THR D 1 85  ? -14.803 12.597  8.609   1.00 14.39  ? 85  THR D C   1 
ATOM   8782  O O   . THR D 1 85  ? -15.148 12.903  9.761   1.00 11.70  ? 85  THR D O   1 
ATOM   8783  C CB  . THR D 1 85  ? -16.611 12.480  6.885   1.00 13.44  ? 85  THR D CB  1 
ATOM   8784  O OG1 . THR D 1 85  ? -17.643 11.619  6.438   1.00 9.03   ? 85  THR D OG1 1 
ATOM   8785  C CG2 . THR D 1 85  ? -15.923 13.029  5.674   1.00 17.32  ? 85  THR D CG2 1 
ATOM   8786  N N   . PHE D 1 86  ? -13.644 13.001  8.089   1.00 12.26  ? 86  PHE D N   1 
ATOM   8787  C CA  . PHE D 1 86  ? -12.740 13.899  8.844   1.00 10.76  ? 86  PHE D CA  1 
ATOM   8788  C C   . PHE D 1 86  ? -12.147 14.931  7.923   1.00 16.80  ? 86  PHE D C   1 
ATOM   8789  O O   . PHE D 1 86  ? -11.691 14.575  6.846   1.00 18.51  ? 86  PHE D O   1 
ATOM   8790  C CB  . PHE D 1 86  ? -11.611 13.141  9.553   1.00 10.73  ? 86  PHE D CB  1 
ATOM   8791  C CG  . PHE D 1 86  ? -10.800 14.004  10.503  1.00 11.68  ? 86  PHE D CG  1 
ATOM   8792  C CD1 . PHE D 1 86  ? -11.403 14.685  11.571  1.00 13.48  ? 86  PHE D CD1 1 
ATOM   8793  C CD2 . PHE D 1 86  ? -9.451  14.225  10.273  1.00 11.94  ? 86  PHE D CD2 1 
ATOM   8794  C CE1 . PHE D 1 86  ? -10.653 15.518  12.402  1.00 12.36  ? 86  PHE D CE1 1 
ATOM   8795  C CE2 . PHE D 1 86  ? -8.730  15.067  11.095  1.00 13.61  ? 86  PHE D CE2 1 
ATOM   8796  C CZ  . PHE D 1 86  ? -9.320  15.677  12.178  1.00 10.11  ? 86  PHE D CZ  1 
ATOM   8797  N N   . PHE D 1 87  ? -12.192 16.200  8.333   1.00 13.62  ? 87  PHE D N   1 
ATOM   8798  C CA  . PHE D 1 87  ? -11.543 17.298  7.591   1.00 13.34  ? 87  PHE D CA  1 
ATOM   8799  C C   . PHE D 1 87  ? -10.556 18.021  8.518   1.00 19.23  ? 87  PHE D C   1 
ATOM   8800  O O   . PHE D 1 87  ? -10.926 18.383  9.652   1.00 19.40  ? 87  PHE D O   1 
ATOM   8801  C CB  . PHE D 1 87  ? -12.571 18.365  7.186   1.00 13.66  ? 87  PHE D CB  1 
ATOM   8802  C CG  . PHE D 1 87  ? -13.508 17.943  6.095   1.00 13.25  ? 87  PHE D CG  1 
ATOM   8803  C CD1 . PHE D 1 87  ? -13.472 16.649  5.578   1.00 14.15  ? 87  PHE D CD1 1 
ATOM   8804  C CD2 . PHE D 1 87  ? -14.470 18.841  5.611   1.00 12.71  ? 87  PHE D CD2 1 
ATOM   8805  C CE1 . PHE D 1 87  ? -14.377 16.256  4.622   1.00 14.06  ? 87  PHE D CE1 1 
ATOM   8806  C CE2 . PHE D 1 87  ? -15.347 18.456  4.585   1.00 14.84  ? 87  PHE D CE2 1 
ATOM   8807  C CZ  . PHE D 1 87  ? -15.333 17.159  4.130   1.00 11.96  ? 87  PHE D CZ  1 
ATOM   8808  N N   . GLY D 1 88  ? -9.391  18.386  7.984   1.00 14.61  ? 88  GLY D N   1 
ATOM   8809  C CA  . GLY D 1 88  ? -8.438  19.193  8.737   1.00 14.10  ? 88  GLY D CA  1 
ATOM   8810  C C   . GLY D 1 88  ? -7.345  19.703  7.823   1.00 17.99  ? 88  GLY D C   1 
ATOM   8811  O O   . GLY D 1 88  ? -7.277  19.328  6.679   1.00 16.37  ? 88  GLY D O   1 
ATOM   8812  N N   . CYS D 1 89  ? -6.477  20.561  8.340   1.00 17.21  ? 89  CYS D N   1 
ATOM   8813  C CA  . CYS D 1 89  ? -5.363  21.087  7.558   1.00 17.13  ? 89  CYS D CA  1 
ATOM   8814  C C   . CYS D 1 89  ? -4.063  20.448  8.042   1.00 20.22  ? 89  CYS D C   1 
ATOM   8815  O O   . CYS D 1 89  ? -3.740  20.511  9.239   1.00 19.46  ? 89  CYS D O   1 
ATOM   8816  C CB  . CYS D 1 89  ? -5.275  22.613  7.738   1.00 17.43  ? 89  CYS D CB  1 
ATOM   8817  S SG  . CYS D 1 89  ? -4.086  23.491  6.669   1.00 21.44  ? 89  CYS D SG  1 
ATOM   8818  N N   . ILE D 1 90  ? -3.307  19.860  7.115   1.00 16.28  ? 90  ILE D N   1 
ATOM   8819  C CA  . ILE D 1 90  ? -1.979  19.331  7.451   1.00 14.97  ? 90  ILE D CA  1 
ATOM   8820  C C   . ILE D 1 90  ? -0.887  20.026  6.618   1.00 16.27  ? 90  ILE D C   1 
ATOM   8821  O O   . ILE D 1 90  ? -1.176  20.766  5.687   1.00 15.79  ? 90  ILE D O   1 
ATOM   8822  C CB  . ILE D 1 90  ? -1.903  17.823  7.247   1.00 17.07  ? 90  ILE D CB  1 
ATOM   8823  C CG1 . ILE D 1 90  ? -2.279  17.459  5.817   1.00 15.96  ? 90  ILE D CG1 1 
ATOM   8824  C CG2 . ILE D 1 90  ? -2.760  17.081  8.270   1.00 19.51  ? 90  ILE D CG2 1 
ATOM   8825  C CD1 . ILE D 1 90  ? -2.040  16.028  5.507   1.00 8.52   ? 90  ILE D CD1 1 
ATOM   8826  N N   . GLY D 1 91  ? 0.366   19.758  6.929   1.00 13.90  ? 91  GLY D N   1 
ATOM   8827  C CA  . GLY D 1 91  ? 1.462   20.257  6.105   1.00 14.44  ? 91  GLY D CA  1 
ATOM   8828  C C   . GLY D 1 91  ? 1.751   19.229  5.003   1.00 18.96  ? 91  GLY D C   1 
ATOM   8829  O O   . GLY D 1 91  ? 1.330   18.079  5.077   1.00 19.28  ? 91  GLY D O   1 
ATOM   8830  N N   . ILE D 1 92  ? 2.470   19.628  3.969   1.00 15.88  ? 92  ILE D N   1 
ATOM   8831  C CA  . ILE D 1 92  ? 2.862   18.654  2.946   1.00 15.62  ? 92  ILE D CA  1 
ATOM   8832  C C   . ILE D 1 92  ? 4.283   18.168  3.318   1.00 19.79  ? 92  ILE D C   1 
ATOM   8833  O O   . ILE D 1 92  ? 5.263   18.842  3.006   1.00 19.99  ? 92  ILE D O   1 
ATOM   8834  C CB  . ILE D 1 92  ? 2.821   19.267  1.516   1.00 17.23  ? 92  ILE D CB  1 
ATOM   8835  C CG1 . ILE D 1 92  ? 1.417   19.169  0.939   1.00 14.85  ? 92  ILE D CG1 1 
ATOM   8836  C CG2 . ILE D 1 92  ? 3.795   18.584  0.626   1.00 17.92  ? 92  ILE D CG2 1 
ATOM   8837  C CD1 . ILE D 1 92  ? 1.062   20.307  0.095   1.00 13.31  ? 92  ILE D CD1 1 
ATOM   8838  N N   . ASP D 1 93  ? 4.343   17.132  4.165   1.00 15.02  ? 93  ASP D N   1 
ATOM   8839  C CA  . ASP D 1 93  ? 5.594   16.621  4.732   1.00 13.81  ? 93  ASP D CA  1 
ATOM   8840  C C   . ASP D 1 93  ? 5.419   15.200  5.277   1.00 17.43  ? 93  ASP D C   1 
ATOM   8841  O O   . ASP D 1 93  ? 4.333   14.625  5.199   1.00 18.58  ? 93  ASP D O   1 
ATOM   8842  C CB  . ASP D 1 93  ? 6.159   17.569  5.813   1.00 14.67  ? 93  ASP D CB  1 
ATOM   8843  C CG  . ASP D 1 93  ? 5.120   17.949  6.891   1.00 19.71  ? 93  ASP D CG  1 
ATOM   8844  O OD1 . ASP D 1 93  ? 5.363   18.888  7.695   1.00 21.63  ? 93  ASP D OD1 1 
ATOM   8845  O OD2 . ASP D 1 93  ? 4.120   17.227  7.028   1.00 10.98  ? 93  ASP D OD2 1 
ATOM   8846  N N   . LYS D 1 94  ? 6.513   14.603  5.731   1.00 12.95  ? 94  LYS D N   1 
ATOM   8847  C CA  . LYS D 1 94  ? 6.510   13.260  6.304   1.00 14.02  ? 94  LYS D CA  1 
ATOM   8848  C C   . LYS D 1 94  ? 5.381   13.065  7.329   1.00 23.23  ? 94  LYS D C   1 
ATOM   8849  O O   . LYS D 1 94  ? 4.518   12.202  7.139   1.00 24.73  ? 94  LYS D O   1 
ATOM   8850  C CB  . LYS D 1 94  ? 7.887   12.969  6.962   1.00 16.20  ? 94  LYS D CB  1 
ATOM   8851  C CG  . LYS D 1 94  ? 8.241   11.498  7.184   1.00 20.84  ? 94  LYS D CG  1 
ATOM   8852  C CD  . LYS D 1 94  ? 8.893   11.245  8.543   1.00 24.61  ? 94  LYS D CD  1 
ATOM   8853  C CE  . LYS D 1 94  ? 9.084   9.745   8.810   1.00 36.20  ? 94  LYS D CE  1 
ATOM   8854  N NZ  . LYS D 1 94  ? 10.506  9.227   8.700   1.00 46.92  ? 94  LYS D NZ  1 
ATOM   8855  N N   . PHE D 1 95  ? 5.362   13.870  8.402   1.00 22.53  ? 95  PHE D N   1 
ATOM   8856  C CA  . PHE D 1 95  ? 4.284   13.797  9.433   1.00 21.14  ? 95  PHE D CA  1 
ATOM   8857  C C   . PHE D 1 95  ? 2.897   13.781  8.823   1.00 25.07  ? 95  PHE D C   1 
ATOM   8858  O O   . PHE D 1 95  ? 2.064   12.951  9.156   1.00 24.16  ? 95  PHE D O   1 
ATOM   8859  C CB  . PHE D 1 95  ? 4.406   14.948  10.418  1.00 21.36  ? 95  PHE D CB  1 
ATOM   8860  C CG  . PHE D 1 95  ? 5.573   14.810  11.362  1.00 21.35  ? 95  PHE D CG  1 
ATOM   8861  C CD1 . PHE D 1 95  ? 6.249   13.605  11.491  1.00 24.91  ? 95  PHE D CD1 1 
ATOM   8862  C CD2 . PHE D 1 95  ? 5.994   15.869  12.133  1.00 20.44  ? 95  PHE D CD2 1 
ATOM   8863  C CE1 . PHE D 1 95  ? 7.267   13.464  12.395  1.00 24.13  ? 95  PHE D CE1 1 
ATOM   8864  C CE2 . PHE D 1 95  ? 6.995   15.726  13.024  1.00 22.09  ? 95  PHE D CE2 1 
ATOM   8865  C CZ  . PHE D 1 95  ? 7.641   14.527  13.152  1.00 21.23  ? 95  PHE D CZ  1 
ATOM   8866  N N   . GLY D 1 96  ? 2.682   14.671  7.866   1.00 24.45  ? 96  GLY D N   1 
ATOM   8867  C CA  . GLY D 1 96  ? 1.430   14.749  7.115   1.00 23.68  ? 96  GLY D CA  1 
ATOM   8868  C C   . GLY D 1 96  ? 1.165   13.409  6.477   1.00 27.37  ? 96  GLY D C   1 
ATOM   8869  O O   . GLY D 1 96  ? 0.053   12.874  6.586   1.00 29.31  ? 96  GLY D O   1 
ATOM   8870  N N   . GLU D 1 97  ? 2.175   12.849  5.814   1.00 21.33  ? 97  GLU D N   1 
ATOM   8871  C CA  . GLU D 1 97  ? 1.979   11.533  5.161   1.00 20.64  ? 97  GLU D CA  1 
ATOM   8872  C C   . GLU D 1 97  ? 1.611   10.382  6.127   1.00 19.85  ? 97  GLU D C   1 
ATOM   8873  O O   . GLU D 1 97  ? 0.749   9.543   5.836   1.00 18.15  ? 97  GLU D O   1 
ATOM   8874  C CB  . GLU D 1 97  ? 3.154   11.170  4.245   1.00 22.45  ? 97  GLU D CB  1 
ATOM   8875  C CG  . GLU D 1 97  ? 2.761   10.178  3.109   1.00 41.56  ? 97  GLU D CG  1 
ATOM   8876  C CD  . GLU D 1 97  ? 1.780   10.772  2.080   1.00 51.07  ? 97  GLU D CD  1 
ATOM   8877  O OE1 . GLU D 1 97  ? 1.927   11.961  1.751   1.00 62.28  ? 97  GLU D OE1 1 
ATOM   8878  O OE2 . GLU D 1 97  ? 0.874   10.067  1.588   1.00 28.64  ? 97  GLU D OE2 1 
ATOM   8879  N N   . ILE D 1 98  ? 2.220   10.385  7.313   1.00 13.33  ? 98  ILE D N   1 
ATOM   8880  C CA  . ILE D 1 98  ? 1.877   9.389   8.333   1.00 11.58  ? 98  ILE D CA  1 
ATOM   8881  C C   . ILE D 1 98  ? 0.396   9.602   8.741   1.00 20.61  ? 98  ILE D C   1 
ATOM   8882  O O   . ILE D 1 98  ? -0.387  8.639   8.875   1.00 21.17  ? 98  ILE D O   1 
ATOM   8883  C CB  . ILE D 1 98  ? 2.744   9.573   9.593   1.00 12.63  ? 98  ILE D CB  1 
ATOM   8884  C CG1 . ILE D 1 98  ? 4.206   9.220   9.375   1.00 13.32  ? 98  ILE D CG1 1 
ATOM   8885  C CG2 . ILE D 1 98  ? 2.188   8.862   10.809  1.00 7.14   ? 98  ILE D CG2 1 
ATOM   8886  C CD1 . ILE D 1 98  ? 5.044   9.576   10.647  1.00 26.75  ? 98  ILE D CD1 1 
ATOM   8887  N N   . LEU D 1 99  ? -0.012  10.862  8.923   1.00 17.14  ? 99  LEU D N   1 
ATOM   8888  C CA  . LEU D 1 99  ? -1.412  11.130  9.301   1.00 15.59  ? 99  LEU D CA  1 
ATOM   8889  C C   . LEU D 1 99  ? -2.429  10.545  8.283   1.00 19.34  ? 99  LEU D C   1 
ATOM   8890  O O   . LEU D 1 99  ? -3.341  9.800   8.646   1.00 20.60  ? 99  LEU D O   1 
ATOM   8891  C CB  . LEU D 1 99  ? -1.665  12.619  9.646   1.00 13.90  ? 99  LEU D CB  1 
ATOM   8892  C CG  . LEU D 1 99  ? -0.945  13.066  10.938  1.00 15.39  ? 99  LEU D CG  1 
ATOM   8893  C CD1 . LEU D 1 99  ? -1.004  14.559  11.271  1.00 13.58  ? 99  LEU D CD1 1 
ATOM   8894  C CD2 . LEU D 1 99  ? -1.413  12.272  12.095  1.00 15.32  ? 99  LEU D CD2 1 
ATOM   8895  N N   . LYS D 1 100 ? -2.221  10.814  7.004   1.00 13.81  ? 100 LYS D N   1 
ATOM   8896  C CA  . LYS D 1 100 ? -3.101  10.253  5.970   1.00 14.22  ? 100 LYS D CA  1 
ATOM   8897  C C   . LYS D 1 100 ? -3.150  8.717   5.975   1.00 15.74  ? 100 LYS D C   1 
ATOM   8898  O O   . LYS D 1 100 ? -4.202  8.124   6.154   1.00 13.53  ? 100 LYS D O   1 
ATOM   8899  C CB  . LYS D 1 100 ? -2.740  10.787  4.579   1.00 17.05  ? 100 LYS D CB  1 
ATOM   8900  C CG  . LYS D 1 100 ? -3.109  12.255  4.393   1.00 16.11  ? 100 LYS D CG  1 
ATOM   8901  C CD  . LYS D 1 100 ? -1.955  12.996  3.745   1.00 28.63  ? 100 LYS D CD  1 
ATOM   8902  C CE  . LYS D 1 100 ? -2.182  13.187  2.271   1.00 30.12  ? 100 LYS D CE  1 
ATOM   8903  N NZ  . LYS D 1 100 ? -0.977  12.750  1.497   1.00 35.92  ? 100 LYS D NZ  1 
ATOM   8904  N N   . ARG D 1 101 ? -1.994  8.087   5.854   1.00 14.71  ? 101 ARG D N   1 
ATOM   8905  C CA  . ARG D 1 101 ? -1.887  6.626   5.917   1.00 16.54  ? 101 ARG D CA  1 
ATOM   8906  C C   . ARG D 1 101 ? -2.604  6.099   7.147   1.00 25.43  ? 101 ARG D C   1 
ATOM   8907  O O   . ARG D 1 101 ? -3.456  5.207   7.042   1.00 27.71  ? 101 ARG D O   1 
ATOM   8908  C CB  . ARG D 1 101 ? -0.411  6.250   6.025   1.00 18.84  ? 101 ARG D CB  1 
ATOM   8909  C CG  . ARG D 1 101 ? -0.140  4.777   6.224   1.00 25.57  ? 101 ARG D CG  1 
ATOM   8910  C CD  . ARG D 1 101 ? 1.324   4.417   5.901   1.00 19.42  ? 101 ARG D CD  1 
ATOM   8911  N NE  . ARG D 1 101 ? 2.295   5.096   6.755   1.00 30.29  ? 101 ARG D NE  1 
ATOM   8912  C CZ  . ARG D 1 101 ? 2.457   4.830   8.048   1.00 41.20  ? 101 ARG D CZ  1 
ATOM   8913  N NH1 . ARG D 1 101 ? 1.669   3.931   8.631   1.00 16.34  ? 101 ARG D NH1 1 
ATOM   8914  N NH2 . ARG D 1 101 ? 3.389   5.472   8.763   1.00 29.86  ? 101 ARG D NH2 1 
ATOM   8915  N N   . LYS D 1 102 ? -2.264  6.645   8.323   1.00 21.15  ? 102 LYS D N   1 
ATOM   8916  C CA  . LYS D 1 102 ? -2.927  6.211   9.553   1.00 19.71  ? 102 LYS D CA  1 
ATOM   8917  C C   . LYS D 1 102 ? -4.450  6.320   9.482   1.00 20.14  ? 102 LYS D C   1 
ATOM   8918  O O   . LYS D 1 102 ? -5.184  5.372   9.834   1.00 18.36  ? 102 LYS D O   1 
ATOM   8919  C CB  . LYS D 1 102 ? -2.327  6.898   10.767  1.00 21.84  ? 102 LYS D CB  1 
ATOM   8920  C CG  . LYS D 1 102 ? -0.964  6.298   11.124  1.00 24.42  ? 102 LYS D CG  1 
ATOM   8921  C CD  . LYS D 1 102 ? -1.105  4.835   11.515  1.00 21.47  ? 102 LYS D CD  1 
ATOM   8922  C CE  . LYS D 1 102 ? 0.266   4.222   11.720  1.00 54.44  ? 102 LYS D CE  1 
ATOM   8923  N NZ  . LYS D 1 102 ? 0.251   2.736   11.562  1.00 65.34  ? 102 LYS D NZ  1 
ATOM   8924  N N   . ALA D 1 103 ? -4.901  7.426   8.895   1.00 15.04  ? 103 ALA D N   1 
ATOM   8925  C CA  . ALA D 1 103 ? -6.312  7.675   8.679   1.00 15.01  ? 103 ALA D CA  1 
ATOM   8926  C C   . ALA D 1 103 ? -6.969  6.633   7.742   1.00 18.80  ? 103 ALA D C   1 
ATOM   8927  O O   . ALA D 1 103 ? -8.111  6.240   7.932   1.00 14.34  ? 103 ALA D O   1 
ATOM   8928  C CB  . ALA D 1 103 ? -6.471  9.039   8.108   1.00 15.90  ? 103 ALA D CB  1 
ATOM   8929  N N   . ALA D 1 104 ? -6.264  6.266   6.678   1.00 18.92  ? 104 ALA D N   1 
ATOM   8930  C CA  . ALA D 1 104 ? -6.736  5.292   5.713   1.00 19.05  ? 104 ALA D CA  1 
ATOM   8931  C C   . ALA D 1 104 ? -6.802  3.893   6.331   1.00 24.66  ? 104 ALA D C   1 
ATOM   8932  O O   . ALA D 1 104 ? -7.786  3.173   6.146   1.00 24.80  ? 104 ALA D O   1 
ATOM   8933  C CB  . ALA D 1 104 ? -5.820  5.280   4.523   1.00 19.51  ? 104 ALA D CB  1 
ATOM   8934  N N   . GLU D 1 105 ? -5.791  3.547   7.121   1.00 20.51  ? 105 GLU D N   1 
ATOM   8935  C CA  . GLU D 1 105 ? -5.746  2.257   7.805   1.00 21.68  ? 105 GLU D CA  1 
ATOM   8936  C C   . GLU D 1 105 ? -6.858  2.093   8.847   1.00 31.23  ? 105 GLU D C   1 
ATOM   8937  O O   . GLU D 1 105 ? -7.149  0.961   9.333   1.00 32.96  ? 105 GLU D O   1 
ATOM   8938  C CB  . GLU D 1 105 ? -4.419  2.098   8.523   1.00 23.00  ? 105 GLU D CB  1 
ATOM   8939  C CG  . GLU D 1 105 ? -3.191  2.409   7.681   1.00 29.35  ? 105 GLU D CG  1 
ATOM   8940  C CD  . GLU D 1 105 ? -1.949  1.957   8.368   1.00 38.80  ? 105 GLU D CD  1 
ATOM   8941  O OE1 . GLU D 1 105 ? -2.054  1.619   9.563   1.00 33.80  ? 105 GLU D OE1 1 
ATOM   8942  O OE2 . GLU D 1 105 ? -0.910  1.815   7.700   1.00 39.49  ? 105 GLU D OE2 1 
ATOM   8943  N N   . ALA D 1 106 ? -7.388  3.239   9.269   1.00 26.05  ? 106 ALA D N   1 
ATOM   8944  C CA  . ALA D 1 106 ? -8.480  3.270   10.217  1.00 24.15  ? 106 ALA D CA  1 
ATOM   8945  C C   . ALA D 1 106 ? -9.806  3.275   9.453   1.00 26.90  ? 106 ALA D C   1 
ATOM   8946  O O   . ALA D 1 106 ? -10.872 3.319   10.069  1.00 27.47  ? 106 ALA D O   1 
ATOM   8947  C CB  . ALA D 1 106 ? -8.369  4.476   11.067  1.00 25.23  ? 106 ALA D CB  1 
ATOM   8948  N N   . HIS D 1 107 ? -9.726  3.208   8.123   1.00 22.24  ? 107 HIS D N   1 
ATOM   8949  C CA  . HIS D 1 107 ? -10.877 3.185   7.217   1.00 21.83  ? 107 HIS D CA  1 
ATOM   8950  C C   . HIS D 1 107 ? -11.725 4.421   7.336   1.00 26.56  ? 107 HIS D C   1 
ATOM   8951  O O   . HIS D 1 107 ? -12.930 4.355   7.274   1.00 30.10  ? 107 HIS D O   1 
ATOM   8952  C CB  . HIS D 1 107 ? -11.734 1.913   7.418   1.00 23.99  ? 107 HIS D CB  1 
ATOM   8953  C CG  . HIS D 1 107 ? -10.946 0.634   7.372   1.00 29.72  ? 107 HIS D CG  1 
ATOM   8954  N ND1 . HIS D 1 107 ? -10.152 0.277   6.300   1.00 32.62  ? 107 HIS D ND1 1 
ATOM   8955  C CD2 . HIS D 1 107 ? -10.818 -0.365  8.278   1.00 33.39  ? 107 HIS D CD2 1 
ATOM   8956  C CE1 . HIS D 1 107 ? -9.568  -0.882  6.548   1.00 33.06  ? 107 HIS D CE1 1 
ATOM   8957  N NE2 . HIS D 1 107 ? -9.941  -1.287  7.749   1.00 33.53  ? 107 HIS D NE2 1 
ATOM   8958  N N   . VAL D 1 108 ? -11.109 5.560   7.579   1.00 21.08  ? 108 VAL D N   1 
ATOM   8959  C CA  . VAL D 1 108 ? -11.867 6.773   7.767   1.00 19.60  ? 108 VAL D CA  1 
ATOM   8960  C C   . VAL D 1 108 ? -11.812 7.488   6.434   1.00 25.36  ? 108 VAL D C   1 
ATOM   8961  O O   . VAL D 1 108 ? -10.782 7.465   5.756   1.00 24.19  ? 108 VAL D O   1 
ATOM   8962  C CB  . VAL D 1 108 ? -11.208 7.667   8.861   1.00 23.16  ? 108 VAL D CB  1 
ATOM   8963  C CG1 . VAL D 1 108 ? -11.877 9.070   8.965   1.00 22.81  ? 108 VAL D CG1 1 
ATOM   8964  C CG2 . VAL D 1 108 ? -11.213 6.973   10.196  1.00 22.80  ? 108 VAL D CG2 1 
ATOM   8965  N N   . ASP D 1 109 ? -12.914 8.129   6.052   1.00 22.67  ? 109 ASP D N   1 
ATOM   8966  C CA  . ASP D 1 109 ? -12.939 8.927   4.828   1.00 21.70  ? 109 ASP D CA  1 
ATOM   8967  C C   . ASP D 1 109 ? -12.345 10.355  5.095   1.00 21.80  ? 109 ASP D C   1 
ATOM   8968  O O   . ASP D 1 109 ? -13.057 11.373  5.131   1.00 16.00  ? 109 ASP D O   1 
ATOM   8969  C CB  . ASP D 1 109 ? -14.380 8.987   4.291   1.00 25.17  ? 109 ASP D CB  1 
ATOM   8970  C CG  . ASP D 1 109 ? -14.435 9.380   2.812   1.00 37.68  ? 109 ASP D CG  1 
ATOM   8971  O OD1 . ASP D 1 109 ? -13.621 8.848   2.036   1.00 41.17  ? 109 ASP D OD1 1 
ATOM   8972  O OD2 . ASP D 1 109 ? -15.246 10.242  2.429   1.00 36.06  ? 109 ASP D OD2 1 
ATOM   8973  N N   . ALA D 1 110 ? -11.030 10.402  5.309   1.00 20.62  ? 110 ALA D N   1 
ATOM   8974  C CA  . ALA D 1 110 ? -10.342 11.644  5.626   1.00 21.49  ? 110 ALA D CA  1 
ATOM   8975  C C   . ALA D 1 110 ? -9.977  12.505  4.417   1.00 26.42  ? 110 ALA D C   1 
ATOM   8976  O O   . ALA D 1 110 ? -9.457  12.001  3.393   1.00 27.64  ? 110 ALA D O   1 
ATOM   8977  C CB  . ALA D 1 110 ? -9.117  11.360  6.479   1.00 22.78  ? 110 ALA D CB  1 
ATOM   8978  N N   . HIS D 1 111 ? -10.294 13.797  4.537   1.00 20.16  ? 111 HIS D N   1 
ATOM   8979  C CA  . HIS D 1 111 ? -10.087 14.787  3.489   1.00 18.77  ? 111 HIS D CA  1 
ATOM   8980  C C   . HIS D 1 111 ? -9.440  15.959  4.175   1.00 20.49  ? 111 HIS D C   1 
ATOM   8981  O O   . HIS D 1 111 ? -10.004 16.584  5.092   1.00 21.66  ? 111 HIS D O   1 
ATOM   8982  C CB  . HIS D 1 111 ? -11.429 15.221  2.839   1.00 20.88  ? 111 HIS D CB  1 
ATOM   8983  C CG  . HIS D 1 111 ? -12.178 14.105  2.166   1.00 25.32  ? 111 HIS D CG  1 
ATOM   8984  N ND1 . HIS D 1 111 ? -11.904 13.675  0.880   1.00 26.86  ? 111 HIS D ND1 1 
ATOM   8985  C CD2 . HIS D 1 111 ? -13.141 13.278  2.636   1.00 27.55  ? 111 HIS D CD2 1 
ATOM   8986  C CE1 . HIS D 1 111 ? -12.685 12.654  0.581   1.00 25.79  ? 111 HIS D CE1 1 
ATOM   8987  N NE2 . HIS D 1 111 ? -13.435 12.382  1.631   1.00 26.65  ? 111 HIS D NE2 1 
ATOM   8988  N N   . TYR D 1 112 ? -8.204  16.207  3.778   1.00 14.91  ? 112 TYR D N   1 
ATOM   8989  C CA  . TYR D 1 112 ? -7.380  17.195  4.407   1.00 12.10  ? 112 TYR D CA  1 
ATOM   8990  C C   . TYR D 1 112 ? -7.066  18.261  3.424   1.00 19.08  ? 112 TYR D C   1 
ATOM   8991  O O   . TYR D 1 112 ? -6.949  18.001  2.232   1.00 22.32  ? 112 TYR D O   1 
ATOM   8992  C CB  . TYR D 1 112 ? -6.038  16.551  4.778   1.00 11.62  ? 112 TYR D CB  1 
ATOM   8993  C CG  . TYR D 1 112 ? -6.115  15.405  5.764   1.00 11.41  ? 112 TYR D CG  1 
ATOM   8994  C CD1 . TYR D 1 112 ? -5.963  14.089  5.339   1.00 12.74  ? 112 TYR D CD1 1 
ATOM   8995  C CD2 . TYR D 1 112 ? -6.351  15.640  7.127   1.00 10.77  ? 112 TYR D CD2 1 
ATOM   8996  C CE1 . TYR D 1 112 ? -5.940  13.041  6.250   1.00 13.25  ? 112 TYR D CE1 1 
ATOM   8997  C CE2 . TYR D 1 112 ? -6.406  14.599  8.026   1.00 11.16  ? 112 TYR D CE2 1 
ATOM   8998  C CZ  . TYR D 1 112 ? -6.158  13.296  7.584   1.00 14.91  ? 112 TYR D CZ  1 
ATOM   8999  O OH  . TYR D 1 112 ? -6.115  12.261  8.477   1.00 12.65  ? 112 TYR D OH  1 
ATOM   9000  N N   . TYR D 1 113 ? -6.792  19.443  3.940   1.00 16.82  ? 113 TYR D N   1 
ATOM   9001  C CA  . TYR D 1 113 ? -6.318  20.531  3.128   1.00 16.68  ? 113 TYR D CA  1 
ATOM   9002  C C   . TYR D 1 113 ? -4.827  20.494  3.373   1.00 17.51  ? 113 TYR D C   1 
ATOM   9003  O O   . TYR D 1 113 ? -4.394  20.440  4.524   1.00 19.62  ? 113 TYR D O   1 
ATOM   9004  C CB  . TYR D 1 113 ? -6.910  21.854  3.617   1.00 19.22  ? 113 TYR D CB  1 
ATOM   9005  C CG  . TYR D 1 113 ? -6.351  23.063  2.903   1.00 21.54  ? 113 TYR D CG  1 
ATOM   9006  C CD1 . TYR D 1 113 ? -7.032  23.649  1.850   1.00 23.24  ? 113 TYR D CD1 1 
ATOM   9007  C CD2 . TYR D 1 113 ? -5.132  23.596  3.272   1.00 22.47  ? 113 TYR D CD2 1 
ATOM   9008  C CE1 . TYR D 1 113 ? -6.505  24.709  1.173   1.00 23.55  ? 113 TYR D CE1 1 
ATOM   9009  C CE2 . TYR D 1 113 ? -4.635  24.697  2.654   1.00 24.25  ? 113 TYR D CE2 1 
ATOM   9010  C CZ  . TYR D 1 113 ? -5.318  25.266  1.603   1.00 34.27  ? 113 TYR D CZ  1 
ATOM   9011  O OH  . TYR D 1 113 ? -4.792  26.389  0.981   1.00 38.88  ? 113 TYR D OH  1 
ATOM   9012  N N   . GLU D 1 114 ? -4.051  20.421  2.296   1.00 10.59  ? 114 GLU D N   1 
ATOM   9013  C CA  . GLU D 1 114 ? -2.606  20.333  2.421   1.00 11.48  ? 114 GLU D CA  1 
ATOM   9014  C C   . GLU D 1 114 ? -1.901  21.564  1.885   1.00 20.56  ? 114 GLU D C   1 
ATOM   9015  O O   . GLU D 1 114 ? -2.278  22.084  0.840   1.00 21.36  ? 114 GLU D O   1 
ATOM   9016  C CB  . GLU D 1 114 ? -2.087  19.080  1.716   1.00 12.32  ? 114 GLU D CB  1 
ATOM   9017  C CG  . GLU D 1 114 ? -2.893  17.816  2.031   1.00 16.03  ? 114 GLU D CG  1 
ATOM   9018  C CD  . GLU D 1 114 ? -2.420  16.630  1.245   1.00 32.88  ? 114 GLU D CD  1 
ATOM   9019  O OE1 . GLU D 1 114 ? -1.324  16.116  1.589   1.00 24.78  ? 114 GLU D OE1 1 
ATOM   9020  O OE2 . GLU D 1 114 ? -3.081  16.292  0.222   1.00 14.14  ? 114 GLU D OE2 1 
ATOM   9021  N N   . GLN D 1 115 ? -0.888  22.044  2.617   1.00 17.72  ? 115 GLN D N   1 
ATOM   9022  C CA  . GLN D 1 115 ? -0.165  23.229  2.194   1.00 17.74  ? 115 GLN D CA  1 
ATOM   9023  C C   . GLN D 1 115 ? 1.303   23.140  2.606   1.00 25.93  ? 115 GLN D C   1 
ATOM   9024  O O   . GLN D 1 115 ? 1.691   22.278  3.392   1.00 26.85  ? 115 GLN D O   1 
ATOM   9025  C CB  . GLN D 1 115 ? -0.862  24.529  2.680   1.00 19.23  ? 115 GLN D CB  1 
ATOM   9026  C CG  . GLN D 1 115 ? -1.354  24.581  4.176   1.00 8.75   ? 115 GLN D CG  1 
ATOM   9027  C CD  . GLN D 1 115 ? -0.191  24.430  5.181   1.00 24.44  ? 115 GLN D CD  1 
ATOM   9028  O OE1 . GLN D 1 115 ? 0.028   23.369  5.779   1.00 24.15  ? 115 GLN D OE1 1 
ATOM   9029  N NE2 . GLN D 1 115 ? 0.626   25.450  5.253   1.00 19.59  ? 115 GLN D NE2 1 
ATOM   9030  N N   . ASN D 1 116 ? 2.139   23.964  1.981   1.00 22.56  ? 116 ASN D N   1 
ATOM   9031  C CA  . ASN D 1 116 ? 3.571   23.927  2.209   1.00 19.41  ? 116 ASN D CA  1 
ATOM   9032  C C   . ASN D 1 116 ? 4.027   24.982  3.241   1.00 24.56  ? 116 ASN D C   1 
ATOM   9033  O O   . ASN D 1 116 ? 4.990   24.769  3.978   1.00 24.61  ? 116 ASN D O   1 
ATOM   9034  C CB  . ASN D 1 116 ? 4.298   24.151  0.877   1.00 13.15  ? 116 ASN D CB  1 
ATOM   9035  C CG  . ASN D 1 116 ? 3.941   23.107  -0.198  1.00 23.66  ? 116 ASN D CG  1 
ATOM   9036  O OD1 . ASN D 1 116 ? 4.390   21.963  -0.134  1.00 10.21  ? 116 ASN D OD1 1 
ATOM   9037  N ND2 . ASN D 1 116 ? 3.301   23.560  -1.268  1.00 17.77  ? 116 ASN D ND2 1 
ATOM   9038  N N   . GLU D 1 117 ? 3.329   26.109  3.309   1.00 21.07  ? 117 GLU D N   1 
ATOM   9039  C CA  . GLU D 1 117 ? 3.699   27.175  4.220   1.00 21.99  ? 117 GLU D CA  1 
ATOM   9040  C C   . GLU D 1 117 ? 3.917   26.741  5.677   1.00 28.75  ? 117 GLU D C   1 
ATOM   9041  O O   . GLU D 1 117 ? 4.885   27.190  6.340   1.00 26.17  ? 117 GLU D O   1 
ATOM   9042  C CB  . GLU D 1 117 ? 2.650   28.273  4.166   1.00 24.05  ? 117 GLU D CB  1 
ATOM   9043  C CG  . GLU D 1 117 ? 2.640   29.036  2.860   1.00 32.24  ? 117 GLU D CG  1 
ATOM   9044  C CD  . GLU D 1 117 ? 2.069   28.215  1.736   1.00 62.77  ? 117 GLU D CD  1 
ATOM   9045  O OE1 . GLU D 1 117 ? 2.380   28.558  0.577   1.00 32.26  ? 117 GLU D OE1 1 
ATOM   9046  O OE2 . GLU D 1 117 ? 1.348   27.217  1.994   1.00 72.37  ? 117 GLU D OE2 1 
ATOM   9047  N N   . GLN D 1 118 ? 2.986   25.913  6.182   1.00 26.00  ? 118 GLN D N   1 
ATOM   9048  C CA  . GLN D 1 118 ? 3.038   25.425  7.563   1.00 25.18  ? 118 GLN D CA  1 
ATOM   9049  C C   . GLN D 1 118 ? 3.170   23.908  7.618   1.00 28.25  ? 118 GLN D C   1 
ATOM   9050  O O   . GLN D 1 118 ? 2.514   23.188  6.835   1.00 29.54  ? 118 GLN D O   1 
ATOM   9051  C CB  . GLN D 1 118 ? 1.789   25.858  8.288   1.00 27.33  ? 118 GLN D CB  1 
ATOM   9052  C CG  . GLN D 1 118 ? 1.811   27.316  8.660   1.00 44.44  ? 118 GLN D CG  1 
ATOM   9053  C CD  . GLN D 1 118 ? 2.415   27.518  10.023  1.00 66.00  ? 118 GLN D CD  1 
ATOM   9054  O OE1 . GLN D 1 118 ? 3.541   27.100  10.284  1.00 66.66  ? 118 GLN D OE1 1 
ATOM   9055  N NE2 . GLN D 1 118 ? 1.637   28.079  10.930  1.00 54.69  ? 118 GLN D NE2 1 
ATOM   9056  N N   . PRO D 1 119 ? 4.037   23.426  8.512   1.00 20.37  ? 119 PRO D N   1 
ATOM   9057  C CA  . PRO D 1 119 ? 4.302   22.001  8.655   1.00 19.33  ? 119 PRO D CA  1 
ATOM   9058  C C   . PRO D 1 119 ? 3.239   21.399  9.556   1.00 25.90  ? 119 PRO D C   1 
ATOM   9059  O O   . PRO D 1 119 ? 2.778   22.097  10.487  1.00 27.91  ? 119 PRO D O   1 
ATOM   9060  C CB  . PRO D 1 119 ? 5.642   21.979  9.381   1.00 20.78  ? 119 PRO D CB  1 
ATOM   9061  C CG  . PRO D 1 119 ? 5.617   23.168  10.178  1.00 24.81  ? 119 PRO D CG  1 
ATOM   9062  C CD  . PRO D 1 119 ? 4.936   24.228  9.344   1.00 19.79  ? 119 PRO D CD  1 
ATOM   9063  N N   . THR D 1 120 ? 2.820   20.151  9.247   1.00 18.22  ? 120 THR D N   1 
ATOM   9064  C CA  . THR D 1 120 ? 1.798   19.403  9.997   1.00 14.11  ? 120 THR D CA  1 
ATOM   9065  C C   . THR D 1 120 ? 2.006   19.602  11.462  1.00 17.35  ? 120 THR D C   1 
ATOM   9066  O O   . THR D 1 120 ? 3.095   19.388  11.935  1.00 18.62  ? 120 THR D O   1 
ATOM   9067  C CB  . THR D 1 120 ? 1.958   17.907  9.738   1.00 17.43  ? 120 THR D CB  1 
ATOM   9068  O OG1 . THR D 1 120 ? 1.806   17.682  8.346   1.00 22.01  ? 120 THR D OG1 1 
ATOM   9069  C CG2 . THR D 1 120 ? 0.953   17.047  10.486  1.00 14.19  ? 120 THR D CG2 1 
ATOM   9070  N N   . GLY D 1 121 ? 0.929   19.964  12.167  1.00 14.51  ? 121 GLY D N   1 
ATOM   9071  C CA  . GLY D 1 121 ? 0.917   20.214  13.612  1.00 12.43  ? 121 GLY D CA  1 
ATOM   9072  C C   . GLY D 1 121 ? 1.378   19.040  14.442  1.00 13.31  ? 121 GLY D C   1 
ATOM   9073  O O   . GLY D 1 121 ? 1.425   17.887  14.000  1.00 11.52  ? 121 GLY D O   1 
ATOM   9074  N N   . THR D 1 122 ? 1.712   19.354  15.678  1.00 11.65  ? 122 THR D N   1 
ATOM   9075  C CA  . THR D 1 122 ? 2.214   18.344  16.596  1.00 10.85  ? 122 THR D CA  1 
ATOM   9076  C C   . THR D 1 122 ? 1.784   18.665  17.997  1.00 12.72  ? 122 THR D C   1 
ATOM   9077  O O   . THR D 1 122 ? 1.465   19.820  18.301  1.00 10.72  ? 122 THR D O   1 
ATOM   9078  C CB  . THR D 1 122 ? 3.760   18.234  16.501  1.00 14.15  ? 122 THR D CB  1 
ATOM   9079  O OG1 . THR D 1 122 ? 4.354   19.515  16.773  1.00 16.46  ? 122 THR D OG1 1 
ATOM   9080  C CG2 . THR D 1 122 ? 4.166   17.770  15.087  1.00 6.06   ? 122 THR D CG2 1 
ATOM   9081  N N   . CYS D 1 123 ? 1.785   17.636  18.838  1.00 11.69  ? 123 CYS D N   1 
ATOM   9082  C CA  . CYS D 1 123 ? 1.479   17.764  20.265  1.00 12.26  ? 123 CYS D CA  1 
ATOM   9083  C C   . CYS D 1 123 ? 2.575   17.052  20.999  1.00 16.73  ? 123 CYS D C   1 
ATOM   9084  O O   . CYS D 1 123 ? 2.963   15.956  20.612  1.00 13.85  ? 123 CYS D O   1 
ATOM   9085  C CB  . CYS D 1 123 ? 0.144   17.078  20.592  1.00 11.91  ? 123 CYS D CB  1 
ATOM   9086  S SG  . CYS D 1 123 ? -0.679  17.542  22.158  1.00 15.60  ? 123 CYS D SG  1 
ATOM   9087  N N   . ALA D 1 124 ? 3.057   17.660  22.078  1.00 16.78  ? 124 ALA D N   1 
ATOM   9088  C CA  . ALA D 1 124 ? 4.066   16.984  22.882  1.00 16.33  ? 124 ALA D CA  1 
ATOM   9089  C C   . ALA D 1 124 ? 3.402   16.371  24.093  1.00 18.40  ? 124 ALA D C   1 
ATOM   9090  O O   . ALA D 1 124 ? 2.613   17.012  24.772  1.00 17.60  ? 124 ALA D O   1 
ATOM   9091  C CB  . ALA D 1 124 ? 5.201   17.930  23.274  1.00 17.10  ? 124 ALA D CB  1 
ATOM   9092  N N   . ALA D 1 125 ? 3.652   15.090  24.314  1.00 14.99  ? 125 ALA D N   1 
ATOM   9093  C CA  . ALA D 1 125 ? 3.106   14.439  25.515  1.00 12.67  ? 125 ALA D CA  1 
ATOM   9094  C C   . ALA D 1 125 ? 4.267   14.246  26.433  1.00 18.63  ? 125 ALA D C   1 
ATOM   9095  O O   . ALA D 1 125 ? 5.003   13.278  26.325  1.00 20.16  ? 125 ALA D O   1 
ATOM   9096  C CB  . ALA D 1 125 ? 2.452   13.124  25.216  1.00 11.38  ? 125 ALA D CB  1 
ATOM   9097  N N   . CYS D 1 126 ? 4.483   15.216  27.294  1.00 17.11  ? 126 CYS D N   1 
ATOM   9098  C CA  . CYS D 1 126 ? 5.594   15.127  28.239  1.00 17.56  ? 126 CYS D CA  1 
ATOM   9099  C C   . CYS D 1 126 ? 5.157   14.364  29.463  1.00 18.96  ? 126 CYS D C   1 
ATOM   9100  O O   . CYS D 1 126 ? 4.471   14.943  30.306  1.00 17.82  ? 126 CYS D O   1 
ATOM   9101  C CB  . CYS D 1 126 ? 6.064   16.527  28.634  1.00 17.62  ? 126 CYS D CB  1 
ATOM   9102  S SG  . CYS D 1 126 ? 6.682   17.474  27.218  1.00 21.17  ? 126 CYS D SG  1 
ATOM   9103  N N   . ILE D 1 127 ? 5.588   13.097  29.531  1.00 15.13  ? 127 ILE D N   1 
ATOM   9104  C CA  . ILE D 1 127 ? 5.253   12.156  30.590  1.00 15.09  ? 127 ILE D CA  1 
ATOM   9105  C C   . ILE D 1 127 ? 6.215   12.109  31.800  1.00 21.16  ? 127 ILE D C   1 
ATOM   9106  O O   . ILE D 1 127 ? 7.439   11.881  31.639  1.00 18.64  ? 127 ILE D O   1 
ATOM   9107  C CB  . ILE D 1 127 ? 5.222   10.725  30.020  1.00 17.33  ? 127 ILE D CB  1 
ATOM   9108  C CG1 . ILE D 1 127 ? 4.564   10.707  28.649  1.00 16.22  ? 127 ILE D CG1 1 
ATOM   9109  C CG2 . ILE D 1 127 ? 4.458   9.819   30.940  1.00 20.21  ? 127 ILE D CG2 1 
ATOM   9110  C CD1 . ILE D 1 127 ? 4.363   9.340   28.133  1.00 21.09  ? 127 ILE D CD1 1 
ATOM   9111  N N   . THR D 1 128 ? 5.618   12.113  32.998  1.00 17.53  ? 128 THR D N   1 
ATOM   9112  C CA  . THR D 1 128 ? 6.360   11.888  34.231  1.00 18.24  ? 128 THR D CA  1 
ATOM   9113  C C   . THR D 1 128 ? 5.527   10.924  35.104  1.00 27.99  ? 128 THR D C   1 
ATOM   9114  O O   . THR D 1 128 ? 4.413   11.276  35.580  1.00 28.14  ? 128 THR D O   1 
ATOM   9115  C CB  . THR D 1 128 ? 6.773   13.214  34.934  1.00 27.59  ? 128 THR D CB  1 
ATOM   9116  O OG1 . THR D 1 128 ? 5.617   14.031  35.233  1.00 25.42  ? 128 THR D OG1 1 
ATOM   9117  C CG2 . THR D 1 128 ? 7.812   14.020  34.057  1.00 21.19  ? 128 THR D CG2 1 
ATOM   9118  N N   . GLY D 1 129 ? 5.987   9.667   35.187  1.00 25.18  ? 129 GLY D N   1 
ATOM   9119  C CA  . GLY D 1 129 ? 5.239   8.654   35.941  1.00 25.64  ? 129 GLY D CA  1 
ATOM   9120  C C   . GLY D 1 129 ? 3.828   8.562   35.349  1.00 31.23  ? 129 GLY D C   1 
ATOM   9121  O O   . GLY D 1 129 ? 3.676   8.416   34.144  1.00 33.16  ? 129 GLY D O   1 
ATOM   9122  N N   . ASP D 1 130 ? 2.782   8.706   36.153  1.00 26.93  ? 130 ASP D N   1 
ATOM   9123  C CA  . ASP D 1 130 ? 1.438   8.651   35.557  1.00 27.34  ? 130 ASP D CA  1 
ATOM   9124  C C   . ASP D 1 130 ? 0.894   10.022  35.141  1.00 26.43  ? 130 ASP D C   1 
ATOM   9125  O O   . ASP D 1 130 ? -0.291  10.150  34.846  1.00 22.85  ? 130 ASP D O   1 
ATOM   9126  C CB  . ASP D 1 130 ? 0.409   7.942   36.468  1.00 30.93  ? 130 ASP D CB  1 
ATOM   9127  C CG  . ASP D 1 130 ? 0.913   6.600   37.025  1.00 49.03  ? 130 ASP D CG  1 
ATOM   9128  O OD1 . ASP D 1 130 ? 0.419   6.175   38.103  1.00 52.01  ? 130 ASP D OD1 1 
ATOM   9129  O OD2 . ASP D 1 130 ? 1.763   5.947   36.375  1.00 54.42  ? 130 ASP D OD2 1 
ATOM   9130  N N   . ASN D 1 131 ? 1.755   11.039  35.139  1.00 22.79  ? 131 ASN D N   1 
ATOM   9131  C CA  . ASN D 1 131 ? 1.368   12.364  34.685  1.00 21.00  ? 131 ASN D CA  1 
ATOM   9132  C C   . ASN D 1 131 ? 1.645   12.557  33.165  1.00 27.61  ? 131 ASN D C   1 
ATOM   9133  O O   . ASN D 1 131 ? 2.480   11.857  32.540  1.00 26.60  ? 131 ASN D O   1 
ATOM   9134  C CB  . ASN D 1 131 ? 2.084   13.423  35.505  1.00 11.89  ? 131 ASN D CB  1 
ATOM   9135  C CG  . ASN D 1 131 ? 1.806   13.295  36.997  1.00 25.56  ? 131 ASN D CG  1 
ATOM   9136  O OD1 . ASN D 1 131 ? 2.725   13.024  37.759  1.00 23.55  ? 131 ASN D OD1 1 
ATOM   9137  N ND2 . ASN D 1 131 ? 0.571   13.595  37.426  1.00 13.62  ? 131 ASN D ND2 1 
ATOM   9138  N N   . ARG D 1 132 ? 0.895   13.474  32.561  1.00 23.73  ? 132 ARG D N   1 
ATOM   9139  C CA  . ARG D 1 132 ? 1.024   13.762  31.141  1.00 21.82  ? 132 ARG D CA  1 
ATOM   9140  C C   . ARG D 1 132 ? 0.806   15.241  30.904  1.00 20.40  ? 132 ARG D C   1 
ATOM   9141  O O   . ARG D 1 132 ? -0.285  15.763  31.179  1.00 21.34  ? 132 ARG D O   1 
ATOM   9142  C CB  . ARG D 1 132 ? -0.026  12.981  30.363  1.00 23.83  ? 132 ARG D CB  1 
ATOM   9143  C CG  . ARG D 1 132 ? 0.412   11.569  30.042  1.00 41.31  ? 132 ARG D CG  1 
ATOM   9144  C CD  . ARG D 1 132 ? -0.743  10.720  29.604  1.00 49.31  ? 132 ARG D CD  1 
ATOM   9145  N NE  . ARG D 1 132 ? -0.714  10.567  28.159  1.00 55.16  ? 132 ARG D NE  1 
ATOM   9146  C CZ  . ARG D 1 132 ? 0.178   9.817   27.529  1.00 75.28  ? 132 ARG D CZ  1 
ATOM   9147  N NH1 . ARG D 1 132 ? 1.050   9.106   28.241  1.00 67.24  ? 132 ARG D NH1 1 
ATOM   9148  N NH2 . ARG D 1 132 ? 0.175   9.732   26.197  1.00 58.27  ? 132 ARG D NH2 1 
ATOM   9149  N N   . SER D 1 133 ? 1.840   15.912  30.402  1.00 12.55  ? 133 SER D N   1 
ATOM   9150  C CA  . SER D 1 133 ? 1.754   17.336  30.067  1.00 11.99  ? 133 SER D CA  1 
ATOM   9151  C C   . SER D 1 133 ? 1.703   17.481  28.539  1.00 15.13  ? 133 SER D C   1 
ATOM   9152  O O   . SER D 1 133 ? 2.600   17.067  27.829  1.00 15.31  ? 133 SER D O   1 
ATOM   9153  C CB  . SER D 1 133 ? 2.981   18.059  30.638  1.00 14.28  ? 133 SER D CB  1 
ATOM   9154  O OG  . SER D 1 133 ? 2.712   19.366  31.058  1.00 10.94  ? 133 SER D OG  1 
ATOM   9155  N N   . LEU D 1 134 ? 0.592   17.957  28.021  1.00 14.69  ? 134 LEU D N   1 
ATOM   9156  C CA  . LEU D 1 134 ? 0.385   18.090  26.559  1.00 14.05  ? 134 LEU D CA  1 
ATOM   9157  C C   . LEU D 1 134 ? 0.440   19.580  26.137  1.00 17.48  ? 134 LEU D C   1 
ATOM   9158  O O   . LEU D 1 134 ? -0.317  20.437  26.664  1.00 16.34  ? 134 LEU D O   1 
ATOM   9159  C CB  . LEU D 1 134 ? -0.987  17.515  26.150  1.00 13.47  ? 134 LEU D CB  1 
ATOM   9160  C CG  . LEU D 1 134 ? -1.430  16.067  26.450  1.00 17.08  ? 134 LEU D CG  1 
ATOM   9161  C CD1 . LEU D 1 134 ? -2.631  15.683  25.559  1.00 17.22  ? 134 LEU D CD1 1 
ATOM   9162  C CD2 . LEU D 1 134 ? -0.330  15.127  26.158  1.00 15.85  ? 134 LEU D CD2 1 
ATOM   9163  N N   . ILE D 1 135 ? 1.377   19.880  25.244  1.00 11.99  ? 135 ILE D N   1 
ATOM   9164  C CA  . ILE D 1 135 ? 1.568   21.209  24.695  1.00 9.81   ? 135 ILE D CA  1 
ATOM   9165  C C   . ILE D 1 135 ? 1.355   21.017  23.219  1.00 15.62  ? 135 ILE D C   1 
ATOM   9166  O O   . ILE D 1 135 ? 2.045   20.187  22.592  1.00 18.07  ? 135 ILE D O   1 
ATOM   9167  C CB  . ILE D 1 135 ? 3.001   21.678  24.904  1.00 11.55  ? 135 ILE D CB  1 
ATOM   9168  C CG1 . ILE D 1 135 ? 3.454   21.339  26.329  1.00 10.77  ? 135 ILE D CG1 1 
ATOM   9169  C CG2 . ILE D 1 135 ? 3.183   23.154  24.465  1.00 11.09  ? 135 ILE D CG2 1 
ATOM   9170  C CD1 . ILE D 1 135 ? 4.174   19.987  26.396  1.00 10.95  ? 135 ILE D CD1 1 
ATOM   9171  N N   . ALA D 1 136 ? 0.340   21.672  22.664  1.00 11.07  ? 136 ALA D N   1 
ATOM   9172  C CA  . ALA D 1 136 ? 0.110   21.511  21.225  1.00 12.42  ? 136 ALA D CA  1 
ATOM   9173  C C   . ALA D 1 136 ? 0.717   22.638  20.359  1.00 20.04  ? 136 ALA D C   1 
ATOM   9174  O O   . ALA D 1 136 ? 0.531   23.830  20.629  1.00 20.43  ? 136 ALA D O   1 
ATOM   9175  C CB  . ALA D 1 136 ? -1.367  21.259  20.865  1.00 12.33  ? 136 ALA D CB  1 
ATOM   9176  N N   . ASN D 1 137 ? 1.476   22.231  19.334  1.00 14.53  ? 137 ASN D N   1 
ATOM   9177  C CA  . ASN D 1 137 ? 2.015   23.151  18.343  1.00 12.58  ? 137 ASN D CA  1 
ATOM   9178  C C   . ASN D 1 137 ? 1.150   22.962  17.068  1.00 11.59  ? 137 ASN D C   1 
ATOM   9179  O O   . ASN D 1 137 ? 1.397   22.123  16.182  1.00 6.75   ? 137 ASN D O   1 
ATOM   9180  C CB  . ASN D 1 137 ? 3.508   22.893  18.100  1.00 9.09   ? 137 ASN D CB  1 
ATOM   9181  C CG  . ASN D 1 137 ? 4.148   23.955  17.211  1.00 35.30  ? 137 ASN D CG  1 
ATOM   9182  O OD1 . ASN D 1 137 ? 4.360   25.092  17.625  1.00 35.63  ? 137 ASN D OD1 1 
ATOM   9183  N ND2 . ASN D 1 137 ? 4.397   23.603  15.968  1.00 29.00  ? 137 ASN D ND2 1 
ATOM   9184  N N   . LEU D 1 138 ? 0.037   23.662  17.070  1.00 7.33   ? 138 LEU D N   1 
ATOM   9185  C CA  . LEU D 1 138 ? -0.971  23.524  16.037  1.00 7.38   ? 138 LEU D CA  1 
ATOM   9186  C C   . LEU D 1 138 ? -0.419  23.657  14.628  1.00 12.59  ? 138 LEU D C   1 
ATOM   9187  O O   . LEU D 1 138 ? -0.768  22.850  13.774  1.00 12.89  ? 138 LEU D O   1 
ATOM   9188  C CB  . LEU D 1 138 ? -2.133  24.504  16.305  1.00 7.14   ? 138 LEU D CB  1 
ATOM   9189  C CG  . LEU D 1 138 ? -2.933  24.243  17.583  1.00 6.64   ? 138 LEU D CG  1 
ATOM   9190  C CD1 . LEU D 1 138 ? -4.211  25.049  17.521  1.00 3.74   ? 138 LEU D CD1 1 
ATOM   9191  C CD2 . LEU D 1 138 ? -3.193  22.745  17.668  1.00 1.00   ? 138 LEU D CD2 1 
ATOM   9192  N N   . ALA D 1 139 ? 0.498   24.608  14.429  1.00 9.81   ? 139 ALA D N   1 
ATOM   9193  C CA  . ALA D 1 139 ? 1.156   24.832  13.127  1.00 10.40  ? 139 ALA D CA  1 
ATOM   9194  C C   . ALA D 1 139 ? 0.162   24.700  11.997  1.00 14.88  ? 139 ALA D C   1 
ATOM   9195  O O   . ALA D 1 139 ? -0.813  25.433  11.993  1.00 15.03  ? 139 ALA D O   1 
ATOM   9196  C CB  . ALA D 1 139 ? 2.385   23.903  12.932  1.00 11.15  ? 139 ALA D CB  1 
ATOM   9197  N N   . ALA D 1 140 ? 0.324   23.713  11.118  1.00 13.48  ? 140 ALA D N   1 
ATOM   9198  C CA  . ALA D 1 140 ? -0.632  23.501  9.999   1.00 13.82  ? 140 ALA D CA  1 
ATOM   9199  C C   . ALA D 1 140 ? -2.111  23.281  10.379  1.00 16.27  ? 140 ALA D C   1 
ATOM   9200  O O   . ALA D 1 140 ? -2.998  23.616  9.621   1.00 13.98  ? 140 ALA D O   1 
ATOM   9201  C CB  . ALA D 1 140 ? -0.135  22.357  9.054   1.00 14.39  ? 140 ALA D CB  1 
ATOM   9202  N N   . ALA D 1 141 ? -2.367  22.637  11.503  1.00 16.53  ? 141 ALA D N   1 
ATOM   9203  C CA  . ALA D 1 141 ? -3.731  22.433  11.969  1.00 17.06  ? 141 ALA D CA  1 
ATOM   9204  C C   . ALA D 1 141 ? -4.472  23.779  11.946  1.00 21.11  ? 141 ALA D C   1 
ATOM   9205  O O   . ALA D 1 141 ? -5.650  23.859  11.615  1.00 20.62  ? 141 ALA D O   1 
ATOM   9206  C CB  . ALA D 1 141 ? -3.713  21.857  13.415  1.00 17.55  ? 141 ALA D CB  1 
ATOM   9207  N N   . ASN D 1 142 ? -3.746  24.830  12.276  1.00 20.47  ? 142 ASN D N   1 
ATOM   9208  C CA  . ASN D 1 142 ? -4.294  26.182  12.395  1.00 23.88  ? 142 ASN D CA  1 
ATOM   9209  C C   . ASN D 1 142 ? -4.703  26.923  11.114  1.00 33.19  ? 142 ASN D C   1 
ATOM   9210  O O   . ASN D 1 142 ? -5.528  27.837  11.150  1.00 31.55  ? 142 ASN D O   1 
ATOM   9211  C CB  . ASN D 1 142 ? -3.400  27.069  13.263  1.00 23.78  ? 142 ASN D CB  1 
ATOM   9212  C CG  . ASN D 1 142 ? -3.991  28.407  13.474  1.00 54.30  ? 142 ASN D CG  1 
ATOM   9213  O OD1 . ASN D 1 142 ? -3.658  29.343  12.758  1.00 72.15  ? 142 ASN D OD1 1 
ATOM   9214  N ND2 . ASN D 1 142 ? -5.031  28.471  14.306  1.00 37.17  ? 142 ASN D ND2 1 
ATOM   9215  N N   . CYS D 1 143 ? -4.192  26.449  9.987   1.00 35.36  ? 143 CYS D N   1 
ATOM   9216  C CA  . CYS D 1 143 ? -4.448  27.007  8.663   1.00 37.87  ? 143 CYS D CA  1 
ATOM   9217  C C   . CYS D 1 143 ? -5.842  26.864  8.093   1.00 36.30  ? 143 CYS D C   1 
ATOM   9218  O O   . CYS D 1 143 ? -6.174  27.514  7.090   1.00 34.72  ? 143 CYS D O   1 
ATOM   9219  C CB  . CYS D 1 143 ? -3.520  26.321  7.674   1.00 41.46  ? 143 CYS D CB  1 
ATOM   9220  S SG  . CYS D 1 143 ? -1.807  26.264  8.299   1.00 47.97  ? 143 CYS D SG  1 
ATOM   9221  N N   . TYR D 1 144 ? -6.617  25.935  8.644   1.00 29.60  ? 144 TYR D N   1 
ATOM   9222  C CA  . TYR D 1 144 ? -7.937  25.644  8.103   1.00 27.57  ? 144 TYR D CA  1 
ATOM   9223  C C   . TYR D 1 144 ? -8.847  26.862  7.949   1.00 32.72  ? 144 TYR D C   1 
ATOM   9224  O O   . TYR D 1 144 ? -9.214  27.516  8.922   1.00 31.07  ? 144 TYR D O   1 
ATOM   9225  C CB  . TYR D 1 144 ? -8.617  24.531  8.896   1.00 27.29  ? 144 TYR D CB  1 
ATOM   9226  C CG  . TYR D 1 144 ? -9.800  23.909  8.187   1.00 25.66  ? 144 TYR D CG  1 
ATOM   9227  C CD1 . TYR D 1 144 ? -9.657  22.750  7.455   1.00 26.43  ? 144 TYR D CD1 1 
ATOM   9228  C CD2 . TYR D 1 144 ? -11.064 24.467  8.283   1.00 25.42  ? 144 TYR D CD2 1 
ATOM   9229  C CE1 . TYR D 1 144 ? -10.718 22.201  6.778   1.00 25.39  ? 144 TYR D CE1 1 
ATOM   9230  C CE2 . TYR D 1 144 ? -12.136 23.912  7.626   1.00 25.37  ? 144 TYR D CE2 1 
ATOM   9231  C CZ  . TYR D 1 144 ? -11.957 22.797  6.866   1.00 29.98  ? 144 TYR D CZ  1 
ATOM   9232  O OH  . TYR D 1 144 ? -13.046 22.258  6.237   1.00 27.79  ? 144 TYR D OH  1 
ATOM   9233  N N   . LYS D 1 145 ? -9.251  27.121  6.710   1.00 32.68  ? 145 LYS D N   1 
ATOM   9234  C CA  . LYS D 1 145 ? -10.141 28.229  6.370   1.00 32.11  ? 145 LYS D CA  1 
ATOM   9235  C C   . LYS D 1 145 ? -11.334 27.642  5.672   1.00 33.53  ? 145 LYS D C   1 
ATOM   9236  O O   . LYS D 1 145 ? -11.167 26.994  4.667   1.00 34.09  ? 145 LYS D O   1 
ATOM   9237  C CB  . LYS D 1 145 ? -9.435  29.170  5.401   1.00 35.45  ? 145 LYS D CB  1 
ATOM   9238  C CG  . LYS D 1 145 ? -8.319  30.023  6.045   1.00 32.90  ? 145 LYS D CG  1 
ATOM   9239  C CD  . LYS D 1 145 ? -8.826  30.805  7.228   1.00 43.01  ? 145 LYS D CD  1 
ATOM   9240  C CE  . LYS D 1 145 ? -7.669  31.299  8.100   1.00 55.36  ? 145 LYS D CE  1 
ATOM   9241  N NZ  . LYS D 1 145 ? -8.107  32.369  9.055   1.00 61.58  ? 145 LYS D NZ  1 
ATOM   9242  N N   . LYS D 1 146 ? -12.535 27.899  6.180   1.00 30.12  ? 146 LYS D N   1 
ATOM   9243  C CA  . LYS D 1 146 ? -13.767 27.354  5.611   1.00 29.44  ? 146 LYS D CA  1 
ATOM   9244  C C   . LYS D 1 146 ? -13.960 27.670  4.131   1.00 33.73  ? 146 LYS D C   1 
ATOM   9245  O O   . LYS D 1 146 ? -14.493 26.843  3.374   1.00 33.02  ? 146 LYS D O   1 
ATOM   9246  C CB  . LYS D 1 146 ? -14.990 27.822  6.420   1.00 30.78  ? 146 LYS D CB  1 
ATOM   9247  C CG  . LYS D 1 146 ? -15.616 29.161  5.959   1.00 27.97  ? 146 LYS D CG  1 
ATOM   9248  C CD  . LYS D 1 146 ? -16.778 29.628  6.848   1.00 22.61  ? 146 LYS D CD  1 
ATOM   9249  C CE  . LYS D 1 146 ? -18.094 29.746  6.052   1.00 36.66  ? 146 LYS D CE  1 
ATOM   9250  N NZ  . LYS D 1 146 ? -17.932 30.432  4.707   1.00 42.29  ? 146 LYS D NZ  1 
ATOM   9251  N N   . GLU D 1 147 ? -13.547 28.873  3.732   1.00 29.08  ? 147 GLU D N   1 
ATOM   9252  C CA  . GLU D 1 147 ? -13.684 29.289  2.346   1.00 27.98  ? 147 GLU D CA  1 
ATOM   9253  C C   . GLU D 1 147 ? -12.754 28.543  1.399   1.00 27.82  ? 147 GLU D C   1 
ATOM   9254  O O   . GLU D 1 147 ? -13.049 28.455  0.213   1.00 29.27  ? 147 GLU D O   1 
ATOM   9255  C CB  . GLU D 1 147 ? -13.539 30.802  2.209   1.00 29.63  ? 147 GLU D CB  1 
ATOM   9256  C CG  . GLU D 1 147 ? -12.148 31.325  2.543   1.00 39.98  ? 147 GLU D CG  1 
ATOM   9257  C CD  . GLU D 1 147 ? -12.020 31.792  3.985   1.00 56.29  ? 147 GLU D CD  1 
ATOM   9258  O OE1 . GLU D 1 147 ? -13.074 31.987  4.657   1.00 29.06  ? 147 GLU D OE1 1 
ATOM   9259  O OE2 . GLU D 1 147 ? -10.868 32.071  4.386   1.00 58.39  ? 147 GLU D OE2 1 
ATOM   9260  N N   . LYS D 1 148 ? -11.685 27.944  1.920   1.00 21.89  ? 148 LYS D N   1 
ATOM   9261  C CA  . LYS D 1 148 ? -10.774 27.159  1.070   1.00 22.37  ? 148 LYS D CA  1 
ATOM   9262  C C   . LYS D 1 148 ? -10.829 25.638  1.188   1.00 25.11  ? 148 LYS D C   1 
ATOM   9263  O O   . LYS D 1 148 ? -9.949  24.931  0.668   1.00 23.64  ? 148 LYS D O   1 
ATOM   9264  C CB  . LYS D 1 148 ? -9.331  27.635  1.137   1.00 27.02  ? 148 LYS D CB  1 
ATOM   9265  C CG  . LYS D 1 148 ? -8.840  28.217  2.456   1.00 45.48  ? 148 LYS D CG  1 
ATOM   9266  C CD  . LYS D 1 148 ? -7.356  28.552  2.312   1.00 53.55  ? 148 LYS D CD  1 
ATOM   9267  C CE  . LYS D 1 148 ? -7.181  29.916  1.654   1.00 68.95  ? 148 LYS D CE  1 
ATOM   9268  N NZ  . LYS D 1 148 ? -5.804  30.197  1.131   1.00 72.34  ? 148 LYS D NZ  1 
ATOM   9269  N N   . HIS D 1 149 ? -11.871 25.135  1.850   1.00 19.99  ? 149 HIS D N   1 
ATOM   9270  C CA  . HIS D 1 149 ? -12.023 23.709  1.980   1.00 20.28  ? 149 HIS D CA  1 
ATOM   9271  C C   . HIS D 1 149 ? -13.457 23.334  2.283   1.00 28.41  ? 149 HIS D C   1 
ATOM   9272  O O   . HIS D 1 149 ? -14.156 22.706  1.468   1.00 30.05  ? 149 HIS D O   1 
ATOM   9273  C CB  . HIS D 1 149 ? -11.093 23.151  3.092   1.00 20.44  ? 149 HIS D CB  1 
ATOM   9274  C CG  . HIS D 1 149 ? -11.030 21.655  3.131   1.00 21.62  ? 149 HIS D CG  1 
ATOM   9275  N ND1 . HIS D 1 149 ? -11.976 20.893  3.771   1.00 23.41  ? 149 HIS D ND1 1 
ATOM   9276  C CD2 . HIS D 1 149 ? -10.149 20.786  2.599   1.00 21.81  ? 149 HIS D CD2 1 
ATOM   9277  C CE1 . HIS D 1 149 ? -11.683 19.614  3.629   1.00 22.37  ? 149 HIS D CE1 1 
ATOM   9278  N NE2 . HIS D 1 149 ? -10.614 19.523  2.867   1.00 22.20  ? 149 HIS D NE2 1 
ATOM   9279  N N   . LEU D 1 150 ? -13.870 23.674  3.496   1.00 24.97  ? 150 LEU D N   1 
ATOM   9280  C CA  . LEU D 1 150 ? -15.193 23.353  3.971   1.00 24.09  ? 150 LEU D CA  1 
ATOM   9281  C C   . LEU D 1 150 ? -16.285 23.738  2.959   1.00 31.23  ? 150 LEU D C   1 
ATOM   9282  O O   . LEU D 1 150 ? -17.338 23.082  2.917   1.00 31.37  ? 150 LEU D O   1 
ATOM   9283  C CB  . LEU D 1 150 ? -15.428 24.029  5.341   1.00 22.87  ? 150 LEU D CB  1 
ATOM   9284  C CG  . LEU D 1 150 ? -16.816 23.764  5.939   1.00 25.88  ? 150 LEU D CG  1 
ATOM   9285  C CD1 . LEU D 1 150 ? -17.023 22.314  6.287   1.00 25.38  ? 150 LEU D CD1 1 
ATOM   9286  C CD2 . LEU D 1 150 ? -17.151 24.643  7.106   1.00 28.44  ? 150 LEU D CD2 1 
ATOM   9287  N N   . ASP D 1 151 ? -16.045 24.823  2.198   1.00 28.54  ? 151 ASP D N   1 
ATOM   9288  C CA  . ASP D 1 151 ? -17.046 25.409  1.292   1.00 28.17  ? 151 ASP D CA  1 
ATOM   9289  C C   . ASP D 1 151 ? -16.986 24.856  -0.131  1.00 36.85  ? 151 ASP D C   1 
ATOM   9290  O O   . ASP D 1 151 ? -17.872 25.153  -0.955  1.00 38.65  ? 151 ASP D O   1 
ATOM   9291  C CB  . ASP D 1 151 ? -16.991 26.947  1.266   1.00 28.19  ? 151 ASP D CB  1 
ATOM   9292  C CG  . ASP D 1 151 ? -17.318 27.594  2.639   1.00 34.20  ? 151 ASP D CG  1 
ATOM   9293  O OD1 . ASP D 1 151 ? -18.105 27.019  3.443   1.00 31.53  ? 151 ASP D OD1 1 
ATOM   9294  O OD2 . ASP D 1 151 ? -16.732 28.659  2.946   1.00 35.59  ? 151 ASP D OD2 1 
ATOM   9295  N N   . LEU D 1 152 ? -15.928 24.099  -0.434  1.00 31.52  ? 152 LEU D N   1 
ATOM   9296  C CA  . LEU D 1 152 ? -15.790 23.523  -1.761  1.00 29.77  ? 152 LEU D CA  1 
ATOM   9297  C C   . LEU D 1 152 ? -16.860 22.448  -1.816  1.00 37.58  ? 152 LEU D C   1 
ATOM   9298  O O   . LEU D 1 152 ? -16.958 21.609  -0.908  1.00 38.46  ? 152 LEU D O   1 
ATOM   9299  C CB  . LEU D 1 152 ? -14.397 22.902  -1.983  1.00 28.17  ? 152 LEU D CB  1 
ATOM   9300  C CG  . LEU D 1 152 ? -13.151 23.806  -1.839  1.00 29.27  ? 152 LEU D CG  1 
ATOM   9301  C CD1 . LEU D 1 152 ? -11.831 23.152  -2.196  1.00 24.71  ? 152 LEU D CD1 1 
ATOM   9302  C CD2 . LEU D 1 152 ? -13.282 25.183  -2.497  1.00 28.56  ? 152 LEU D CD2 1 
ATOM   9303  N N   . GLU D 1 153 ? -17.679 22.501  -2.869  1.00 35.25  ? 153 GLU D N   1 
ATOM   9304  C CA  . GLU D 1 153 ? -18.781 21.555  -3.060  1.00 34.49  ? 153 GLU D CA  1 
ATOM   9305  C C   . GLU D 1 153 ? -18.485 20.077  -2.782  1.00 36.10  ? 153 GLU D C   1 
ATOM   9306  O O   . GLU D 1 153 ? -19.200 19.468  -1.967  1.00 38.78  ? 153 GLU D O   1 
ATOM   9307  C CB  . GLU D 1 153 ? -19.492 21.747  -4.388  1.00 35.90  ? 153 GLU D CB  1 
ATOM   9308  C CG  . GLU D 1 153 ? -20.384 20.566  -4.739  1.00 51.05  ? 153 GLU D CG  1 
ATOM   9309  C CD  . GLU D 1 153 ? -20.941 20.650  -6.135  1.00 77.36  ? 153 GLU D CD  1 
ATOM   9310  O OE1 . GLU D 1 153 ? -21.765 21.553  -6.372  1.00 60.63  ? 153 GLU D OE1 1 
ATOM   9311  O OE2 . GLU D 1 153 ? -20.477 19.891  -7.020  1.00 75.89  ? 153 GLU D OE2 1 
ATOM   9312  N N   . LYS D 1 154 ? -17.459 19.505  -3.418  1.00 24.92  ? 154 LYS D N   1 
ATOM   9313  C CA  . LYS D 1 154 ? -17.112 18.122  -3.132  1.00 22.76  ? 154 LYS D CA  1 
ATOM   9314  C C   . LYS D 1 154 ? -17.033 17.857  -1.597  1.00 28.28  ? 154 LYS D C   1 
ATOM   9315  O O   . LYS D 1 154 ? -17.699 16.963  -1.076  1.00 26.07  ? 154 LYS D O   1 
ATOM   9316  C CB  . LYS D 1 154 ? -15.812 17.740  -3.850  1.00 23.76  ? 154 LYS D CB  1 
ATOM   9317  C CG  . LYS D 1 154 ? -14.625 18.726  -3.673  1.00 26.95  ? 154 LYS D CG  1 
ATOM   9318  C CD  . LYS D 1 154 ? -13.344 18.172  -4.255  1.00 33.58  ? 154 LYS D CD  1 
ATOM   9319  C CE  . LYS D 1 154 ? -12.143 18.623  -3.475  1.00 56.15  ? 154 LYS D CE  1 
ATOM   9320  N NZ  . LYS D 1 154 ? -11.206 19.466  -4.311  1.00 63.26  ? 154 LYS D NZ  1 
ATOM   9321  N N   . ASN D 1 155 ? -16.345 18.744  -0.867  1.00 27.29  ? 155 ASN D N   1 
ATOM   9322  C CA  . ASN D 1 155 ? -16.213 18.623  0.593   1.00 26.64  ? 155 ASN D CA  1 
ATOM   9323  C C   . ASN D 1 155 ? -17.512 18.929  1.355   1.00 27.60  ? 155 ASN D C   1 
ATOM   9324  O O   . ASN D 1 155 ? -17.911 18.170  2.233   1.00 27.64  ? 155 ASN D O   1 
ATOM   9325  C CB  . ASN D 1 155 ? -15.068 19.497  1.149   1.00 25.01  ? 155 ASN D CB  1 
ATOM   9326  C CG  . ASN D 1 155 ? -13.776 19.396  0.340   1.00 36.05  ? 155 ASN D CG  1 
ATOM   9327  O OD1 . ASN D 1 155 ? -13.058 20.387  0.196   1.00 37.23  ? 155 ASN D OD1 1 
ATOM   9328  N ND2 . ASN D 1 155 ? -13.464 18.207  -0.156  1.00 14.50  ? 155 ASN D ND2 1 
ATOM   9329  N N   . TRP D 1 156 ? -18.155 20.047  1.048   1.00 22.27  ? 156 TRP D N   1 
ATOM   9330  C CA  . TRP D 1 156 ? -19.373 20.370  1.766   1.00 24.03  ? 156 TRP D CA  1 
ATOM   9331  C C   . TRP D 1 156 ? -20.482 19.331  1.562   1.00 30.95  ? 156 TRP D C   1 
ATOM   9332  O O   . TRP D 1 156 ? -21.345 19.150  2.417   1.00 30.11  ? 156 TRP D O   1 
ATOM   9333  C CB  . TRP D 1 156 ? -19.855 21.771  1.446   1.00 24.00  ? 156 TRP D CB  1 
ATOM   9334  C CG  . TRP D 1 156 ? -21.174 22.105  2.188   1.00 25.82  ? 156 TRP D CG  1 
ATOM   9335  C CD1 . TRP D 1 156 ? -22.443 22.104  1.659   1.00 28.29  ? 156 TRP D CD1 1 
ATOM   9336  C CD2 . TRP D 1 156 ? -21.328 22.382  3.593   1.00 25.54  ? 156 TRP D CD2 1 
ATOM   9337  N NE1 . TRP D 1 156 ? -23.351 22.427  2.631   1.00 27.56  ? 156 TRP D NE1 1 
ATOM   9338  C CE2 . TRP D 1 156 ? -22.706 22.556  3.831   1.00 29.38  ? 156 TRP D CE2 1 
ATOM   9339  C CE3 . TRP D 1 156 ? -20.428 22.565  4.654   1.00 26.57  ? 156 TRP D CE3 1 
ATOM   9340  C CZ2 . TRP D 1 156 ? -23.216 22.858  5.107   1.00 28.91  ? 156 TRP D CZ2 1 
ATOM   9341  C CZ3 . TRP D 1 156 ? -20.938 22.878  5.922   1.00 27.69  ? 156 TRP D CZ3 1 
ATOM   9342  C CH2 . TRP D 1 156 ? -22.314 23.005  6.138   1.00 28.18  ? 156 TRP D CH2 1 
ATOM   9343  N N   . MET D 1 157 ? -20.409 18.644  0.426   1.00 31.13  ? 157 MET D N   1 
ATOM   9344  C CA  . MET D 1 157 ? -21.276 17.536  0.036   1.00 32.80  ? 157 MET D CA  1 
ATOM   9345  C C   . MET D 1 157 ? -21.259 16.381  1.079   1.00 33.20  ? 157 MET D C   1 
ATOM   9346  O O   . MET D 1 157 ? -22.330 15.903  1.497   1.00 32.75  ? 157 MET D O   1 
ATOM   9347  C CB  . MET D 1 157 ? -20.797 17.041  -1.343  1.00 37.08  ? 157 MET D CB  1 
ATOM   9348  C CG  . MET D 1 157 ? -21.641 16.004  -2.044  1.00 43.78  ? 157 MET D CG  1 
ATOM   9349  S SD  . MET D 1 157 ? -21.691 16.183  -3.901  1.00 52.00  ? 157 MET D SD  1 
ATOM   9350  C CE  . MET D 1 157 ? -20.904 17.766  -4.206  1.00 47.53  ? 157 MET D CE  1 
ATOM   9351  N N   . LEU D 1 158 ? -20.063 15.953  1.509   1.00 26.79  ? 158 LEU D N   1 
ATOM   9352  C CA  . LEU D 1 158 ? -19.931 14.932  2.571   1.00 25.95  ? 158 LEU D CA  1 
ATOM   9353  C C   . LEU D 1 158 ? -20.451 15.421  3.952   1.00 27.94  ? 158 LEU D C   1 
ATOM   9354  O O   . LEU D 1 158 ? -21.042 14.665  4.740   1.00 26.84  ? 158 LEU D O   1 
ATOM   9355  C CB  . LEU D 1 158 ? -18.494 14.450  2.677   1.00 25.84  ? 158 LEU D CB  1 
ATOM   9356  C CG  . LEU D 1 158 ? -17.826 14.129  1.314   1.00 29.29  ? 158 LEU D CG  1 
ATOM   9357  C CD1 . LEU D 1 158 ? -16.337 13.996  1.430   1.00 27.82  ? 158 LEU D CD1 1 
ATOM   9358  C CD2 . LEU D 1 158 ? -18.451 12.894  0.665   1.00 27.98  ? 158 LEU D CD2 1 
ATOM   9359  N N   . VAL D 1 159 ? -20.381 16.719  4.195   1.00 23.69  ? 159 VAL D N   1 
ATOM   9360  C CA  . VAL D 1 159 ? -20.990 17.234  5.425   1.00 25.41  ? 159 VAL D CA  1 
ATOM   9361  C C   . VAL D 1 159 ? -22.518 17.047  5.405   1.00 28.06  ? 159 VAL D C   1 
ATOM   9362  O O   . VAL D 1 159 ? -23.136 16.815  6.445   1.00 25.75  ? 159 VAL D O   1 
ATOM   9363  C CB  . VAL D 1 159 ? -20.683 18.737  5.710   1.00 29.09  ? 159 VAL D CB  1 
ATOM   9364  C CG1 . VAL D 1 159 ? -21.226 19.123  7.059   1.00 28.16  ? 159 VAL D CG1 1 
ATOM   9365  C CG2 . VAL D 1 159 ? -19.195 18.995  5.705   1.00 29.19  ? 159 VAL D CG2 1 
ATOM   9366  N N   . GLU D 1 160 ? -23.107 17.217  4.217   1.00 22.70  ? 160 GLU D N   1 
ATOM   9367  C CA  . GLU D 1 160 ? -24.543 17.074  3.997   1.00 20.82  ? 160 GLU D CA  1 
ATOM   9368  C C   . GLU D 1 160 ? -25.049 15.624  4.143   1.00 24.46  ? 160 GLU D C   1 
ATOM   9369  O O   . GLU D 1 160 ? -26.246 15.398  4.371   1.00 26.09  ? 160 GLU D O   1 
ATOM   9370  C CB  . GLU D 1 160 ? -24.925 17.647  2.628   1.00 22.07  ? 160 GLU D CB  1 
ATOM   9371  C CG  . GLU D 1 160 ? -24.573 19.125  2.445   1.00 36.01  ? 160 GLU D CG  1 
ATOM   9372  C CD  . GLU D 1 160 ? -25.757 19.959  1.977   1.00 58.03  ? 160 GLU D CD  1 
ATOM   9373  O OE1 . GLU D 1 160 ? -26.178 19.775  0.826   1.00 48.86  ? 160 GLU D OE1 1 
ATOM   9374  O OE2 . GLU D 1 160 ? -26.222 20.851  2.720   1.00 52.56  ? 160 GLU D OE2 1 
ATOM   9375  N N   . LYS D 1 161 ? -24.137 14.651  4.083   1.00 18.43  ? 161 LYS D N   1 
ATOM   9376  C CA  . LYS D 1 161 ? -24.492 13.236  4.277   1.00 16.88  ? 161 LYS D CA  1 
ATOM   9377  C C   . LYS D 1 161 ? -24.601 12.823  5.748   1.00 21.06  ? 161 LYS D C   1 
ATOM   9378  O O   . LYS D 1 161 ? -25.310 11.876  6.078   1.00 24.45  ? 161 LYS D O   1 
ATOM   9379  C CB  . LYS D 1 161 ? -23.473 12.311  3.593   1.00 18.50  ? 161 LYS D CB  1 
ATOM   9380  C CG  . LYS D 1 161 ? -23.297 12.532  2.084   1.00 25.65  ? 161 LYS D CG  1 
ATOM   9381  C CD  . LYS D 1 161 ? -22.163 11.695  1.499   1.00 19.78  ? 161 LYS D CD  1 
ATOM   9382  C CE  . LYS D 1 161 ? -22.655 10.322  1.081   1.00 6.35   ? 161 LYS D CE  1 
ATOM   9383  N NZ  . LYS D 1 161 ? -21.556 9.479   0.435   1.00 14.80  ? 161 LYS D NZ  1 
ATOM   9384  N N   . ALA D 1 162 ? -23.875 13.506  6.625   1.00 14.93  ? 162 ALA D N   1 
ATOM   9385  C CA  . ALA D 1 162 ? -23.914 13.217  8.060   1.00 15.96  ? 162 ALA D CA  1 
ATOM   9386  C C   . ALA D 1 162 ? -25.260 13.365  8.806   1.00 22.91  ? 162 ALA D C   1 
ATOM   9387  O O   . ALA D 1 162 ? -25.977 14.379  8.688   1.00 21.56  ? 162 ALA D O   1 
ATOM   9388  C CB  . ALA D 1 162 ? -22.826 14.024  8.811   1.00 17.09  ? 162 ALA D CB  1 
ATOM   9389  N N   . ARG D 1 163 ? -25.526 12.390  9.676   1.00 21.42  ? 163 ARG D N   1 
ATOM   9390  C CA  . ARG D 1 163 ? -26.674 12.436  10.579  1.00 21.78  ? 163 ARG D CA  1 
ATOM   9391  C C   . ARG D 1 163 ? -26.199 13.103  11.879  1.00 23.91  ? 163 ARG D C   1 
ATOM   9392  O O   . ARG D 1 163 ? -26.938 13.857  12.522  1.00 22.74  ? 163 ARG D O   1 
ATOM   9393  C CB  . ARG D 1 163 ? -27.141 11.009  10.898  1.00 23.02  ? 163 ARG D CB  1 
ATOM   9394  C CG  . ARG D 1 163 ? -27.908 10.343  9.801   1.00 38.85  ? 163 ARG D CG  1 
ATOM   9395  C CD  . ARG D 1 163 ? -29.118 11.149  9.361   1.00 62.21  ? 163 ARG D CD  1 
ATOM   9396  N NE  . ARG D 1 163 ? -30.187 10.272  8.881   1.00 79.85  ? 163 ARG D NE  1 
ATOM   9397  C CZ  . ARG D 1 163 ? -31.375 10.134  9.461   1.00 98.48  ? 163 ARG D CZ  1 
ATOM   9398  N NH1 . ARG D 1 163 ? -32.267 9.324   8.915   1.00 88.83  ? 163 ARG D NH1 1 
ATOM   9399  N NH2 . ARG D 1 163 ? -31.687 10.834  10.548  1.00 90.41  ? 163 ARG D NH2 1 
ATOM   9400  N N   . VAL D 1 164 ? -24.973 12.749  12.271  1.00 20.51  ? 164 VAL D N   1 
ATOM   9401  C CA  . VAL D 1 164 ? -24.301 13.243  13.476  1.00 19.62  ? 164 VAL D CA  1 
ATOM   9402  C C   . VAL D 1 164 ? -22.970 13.976  13.091  1.00 23.89  ? 164 VAL D C   1 
ATOM   9403  O O   . VAL D 1 164 ? -22.196 13.492  12.267  1.00 22.37  ? 164 VAL D O   1 
ATOM   9404  C CB  . VAL D 1 164 ? -24.016 12.031  14.452  1.00 21.51  ? 164 VAL D CB  1 
ATOM   9405  C CG1 . VAL D 1 164 ? -23.465 12.462  15.798  1.00 20.76  ? 164 VAL D CG1 1 
ATOM   9406  C CG2 . VAL D 1 164 ? -25.239 11.219  14.646  1.00 21.12  ? 164 VAL D CG2 1 
ATOM   9407  N N   . CYS D 1 165 ? -22.720 15.137  13.698  1.00 20.97  ? 165 CYS D N   1 
ATOM   9408  C CA  . CYS D 1 165 ? -21.452 15.875  13.512  1.00 20.58  ? 165 CYS D CA  1 
ATOM   9409  C C   . CYS D 1 165 ? -20.805 16.011  14.875  1.00 20.28  ? 165 CYS D C   1 
ATOM   9410  O O   . CYS D 1 165 ? -21.491 16.149  15.893  1.00 18.13  ? 165 CYS D O   1 
ATOM   9411  C CB  . CYS D 1 165 ? -21.632 17.291  12.900  1.00 21.41  ? 165 CYS D CB  1 
ATOM   9412  S SG  . CYS D 1 165 ? -22.417 17.373  11.232  1.00 25.69  ? 165 CYS D SG  1 
ATOM   9413  N N   . TYR D 1 166 ? -19.486 15.878  14.895  1.00 14.73  ? 166 TYR D N   1 
ATOM   9414  C CA  . TYR D 1 166 ? -18.743 16.030  16.128  1.00 12.93  ? 166 TYR D CA  1 
ATOM   9415  C C   . TYR D 1 166 ? -17.467 16.871  15.949  1.00 12.90  ? 166 TYR D C   1 
ATOM   9416  O O   . TYR D 1 166 ? -16.619 16.586  15.110  1.00 9.88   ? 166 TYR D O   1 
ATOM   9417  C CB  . TYR D 1 166 ? -18.419 14.670  16.753  1.00 13.37  ? 166 TYR D CB  1 
ATOM   9418  C CG  . TYR D 1 166 ? -17.491 14.802  17.950  1.00 11.98  ? 166 TYR D CG  1 
ATOM   9419  C CD1 . TYR D 1 166 ? -17.874 15.489  19.082  1.00 8.83   ? 166 TYR D CD1 1 
ATOM   9420  C CD2 . TYR D 1 166 ? -16.182 14.319  17.888  1.00 14.41  ? 166 TYR D CD2 1 
ATOM   9421  C CE1 . TYR D 1 166 ? -17.069 15.531  20.159  1.00 7.20   ? 166 TYR D CE1 1 
ATOM   9422  C CE2 . TYR D 1 166 ? -15.310 14.488  18.950  1.00 15.28  ? 166 TYR D CE2 1 
ATOM   9423  C CZ  . TYR D 1 166 ? -15.772 15.055  20.100  1.00 15.78  ? 166 TYR D CZ  1 
ATOM   9424  O OH  . TYR D 1 166 ? -14.901 15.263  21.146  1.00 9.48   ? 166 TYR D OH  1 
ATOM   9425  N N   . ILE D 1 167 ? -17.327 17.891  16.778  1.00 11.35  ? 167 ILE D N   1 
ATOM   9426  C CA  . ILE D 1 167 ? -16.154 18.750  16.739  1.00 11.84  ? 167 ILE D CA  1 
ATOM   9427  C C   . ILE D 1 167 ? -15.630 19.012  18.147  1.00 16.96  ? 167 ILE D C   1 
ATOM   9428  O O   . ILE D 1 167 ? -16.369 19.536  18.994  1.00 18.36  ? 167 ILE D O   1 
ATOM   9429  C CB  . ILE D 1 167 ? -16.418 20.093  16.001  1.00 13.59  ? 167 ILE D CB  1 
ATOM   9430  C CG1 . ILE D 1 167 ? -17.211 19.831  14.723  1.00 13.02  ? 167 ILE D CG1 1 
ATOM   9431  C CG2 . ILE D 1 167 ? -15.091 20.776  15.656  1.00 13.82  ? 167 ILE D CG2 1 
ATOM   9432  C CD1 . ILE D 1 167 ? -17.395 20.983  13.838  1.00 5.39   ? 167 ILE D CD1 1 
ATOM   9433  N N   . ALA D 1 168 ? -14.359 18.677  18.388  1.00 10.88  ? 168 ALA D N   1 
ATOM   9434  C CA  . ALA D 1 168 ? -13.778 18.954  19.692  1.00 9.42   ? 168 ALA D CA  1 
ATOM   9435  C C   . ALA D 1 168 ? -13.706 20.476  19.829  1.00 15.85  ? 168 ALA D C   1 
ATOM   9436  O O   . ALA D 1 168 ? -13.539 21.169  18.828  1.00 15.84  ? 168 ALA D O   1 
ATOM   9437  C CB  . ALA D 1 168 ? -12.382 18.327  19.818  1.00 8.73   ? 168 ALA D CB  1 
ATOM   9438  N N   . GLY D 1 169 ? -13.917 20.994  21.039  1.00 13.10  ? 169 GLY D N   1 
ATOM   9439  C CA  . GLY D 1 169 ? -13.848 22.433  21.287  1.00 13.59  ? 169 GLY D CA  1 
ATOM   9440  C C   . GLY D 1 169 ? -12.434 22.976  20.994  1.00 20.63  ? 169 GLY D C   1 
ATOM   9441  O O   . GLY D 1 169 ? -12.219 24.181  21.035  1.00 24.45  ? 169 GLY D O   1 
ATOM   9442  N N   . PHE D 1 170 ? -11.470 22.096  20.712  1.00 11.91  ? 170 PHE D N   1 
ATOM   9443  C CA  . PHE D 1 170 ? -10.127 22.551  20.422  1.00 9.40   ? 170 PHE D CA  1 
ATOM   9444  C C   . PHE D 1 170 ? -10.197 23.310  19.103  1.00 11.31  ? 170 PHE D C   1 
ATOM   9445  O O   . PHE D 1 170 ? -9.468  24.271  18.878  1.00 11.56  ? 170 PHE D O   1 
ATOM   9446  C CB  . PHE D 1 170 ? -9.165  21.360  20.258  1.00 10.72  ? 170 PHE D CB  1 
ATOM   9447  C CG  . PHE D 1 170 ? -8.666  20.763  21.562  1.00 12.84  ? 170 PHE D CG  1 
ATOM   9448  C CD1 . PHE D 1 170 ? -8.640  19.369  21.737  1.00 15.75  ? 170 PHE D CD1 1 
ATOM   9449  C CD2 . PHE D 1 170 ? -8.101  21.561  22.549  1.00 12.33  ? 170 PHE D CD2 1 
ATOM   9450  C CE1 . PHE D 1 170 ? -8.102  18.792  22.898  1.00 15.94  ? 170 PHE D CE1 1 
ATOM   9451  C CE2 . PHE D 1 170 ? -7.593  20.978  23.740  1.00 15.92  ? 170 PHE D CE2 1 
ATOM   9452  C CZ  . PHE D 1 170 ? -7.580  19.584  23.898  1.00 13.54  ? 170 PHE D CZ  1 
ATOM   9453  N N   . PHE D 1 171 ? -11.034 22.837  18.192  1.00 7.50   ? 171 PHE D N   1 
ATOM   9454  C CA  . PHE D 1 171 ? -11.078 23.444  16.875  1.00 8.23   ? 171 PHE D CA  1 
ATOM   9455  C C   . PHE D 1 171 ? -11.647 24.858  16.890  1.00 14.31  ? 171 PHE D C   1 
ATOM   9456  O O   . PHE D 1 171 ? -11.501 25.605  15.905  1.00 13.75  ? 171 PHE D O   1 
ATOM   9457  C CB  . PHE D 1 171 ? -11.848 22.583  15.892  1.00 10.71  ? 171 PHE D CB  1 
ATOM   9458  C CG  . PHE D 1 171 ? -11.555 22.887  14.454  1.00 11.54  ? 171 PHE D CG  1 
ATOM   9459  C CD1 . PHE D 1 171 ? -10.237 22.888  13.989  1.00 12.87  ? 171 PHE D CD1 1 
ATOM   9460  C CD2 . PHE D 1 171 ? -12.600 23.100  13.543  1.00 12.97  ? 171 PHE D CD2 1 
ATOM   9461  C CE1 . PHE D 1 171 ? -9.960  23.059  12.623  1.00 13.55  ? 171 PHE D CE1 1 
ATOM   9462  C CE2 . PHE D 1 171 ? -12.343 23.316  12.171  1.00 15.59  ? 171 PHE D CE2 1 
ATOM   9463  C CZ  . PHE D 1 171 ? -11.004 23.282  11.712  1.00 13.74  ? 171 PHE D CZ  1 
ATOM   9464  N N   . LEU D 1 172 ? -12.217 25.262  18.026  1.00 12.51  ? 172 LEU D N   1 
ATOM   9465  C CA  . LEU D 1 172 ? -12.704 26.639  18.148  1.00 11.57  ? 172 LEU D CA  1 
ATOM   9466  C C   . LEU D 1 172 ? -11.569 27.673  18.104  1.00 12.13  ? 172 LEU D C   1 
ATOM   9467  O O   . LEU D 1 172 ? -11.849 28.825  17.795  1.00 10.43  ? 172 LEU D O   1 
ATOM   9468  C CB  . LEU D 1 172 ? -13.528 26.842  19.418  1.00 11.76  ? 172 LEU D CB  1 
ATOM   9469  C CG  . LEU D 1 172 ? -14.836 26.090  19.663  1.00 17.98  ? 172 LEU D CG  1 
ATOM   9470  C CD1 . LEU D 1 172 ? -15.432 26.554  21.004  1.00 20.01  ? 172 LEU D CD1 1 
ATOM   9471  C CD2 . LEU D 1 172 ? -15.826 26.356  18.587  1.00 17.28  ? 172 LEU D CD2 1 
ATOM   9472  N N   . THR D 1 173 ? -10.340 27.294  18.510  1.00 8.03   ? 173 THR D N   1 
ATOM   9473  C CA  . THR D 1 173 ? -9.223  28.269  18.555  1.00 8.45   ? 173 THR D CA  1 
ATOM   9474  C C   . THR D 1 173 ? -8.714  28.528  17.148  1.00 16.48  ? 173 THR D C   1 
ATOM   9475  O O   . THR D 1 173 ? -7.936  29.453  16.941  1.00 16.42  ? 173 THR D O   1 
ATOM   9476  C CB  . THR D 1 173 ? -8.014  27.826  19.425  1.00 13.84  ? 173 THR D CB  1 
ATOM   9477  O OG1 . THR D 1 173 ? -7.234  26.830  18.743  1.00 12.36  ? 173 THR D OG1 1 
ATOM   9478  C CG2 . THR D 1 173 ? -8.478  27.300  20.704  1.00 16.94  ? 173 THR D CG2 1 
ATOM   9479  N N   . VAL D 1 174 ? -9.188  27.717  16.186  1.00 12.55  ? 174 VAL D N   1 
ATOM   9480  C CA  . VAL D 1 174 ? -8.693  27.761  14.818  1.00 10.27  ? 174 VAL D CA  1 
ATOM   9481  C C   . VAL D 1 174 ? -9.675  28.345  13.843  1.00 18.03  ? 174 VAL D C   1 
ATOM   9482  O O   . VAL D 1 174 ? -9.325  29.285  13.122  1.00 18.39  ? 174 VAL D O   1 
ATOM   9483  C CB  . VAL D 1 174 ? -8.267  26.356  14.281  1.00 10.15  ? 174 VAL D CB  1 
ATOM   9484  C CG1 . VAL D 1 174 ? -8.024  26.419  12.738  1.00 9.38   ? 174 VAL D CG1 1 
ATOM   9485  C CG2 . VAL D 1 174 ? -7.075  25.819  15.029  1.00 8.15   ? 174 VAL D CG2 1 
ATOM   9486  N N   . SER D 1 175 ? -10.870 27.736  13.755  1.00 13.41  ? 175 SER D N   1 
ATOM   9487  C CA  . SER D 1 175 ? -11.896 28.210  12.842  1.00 10.55  ? 175 SER D CA  1 
ATOM   9488  C C   . SER D 1 175 ? -13.307 28.143  13.444  1.00 20.46  ? 175 SER D C   1 
ATOM   9489  O O   . SER D 1 175 ? -14.146 27.255  13.109  1.00 25.47  ? 175 SER D O   1 
ATOM   9490  C CB  . SER D 1 175 ? -11.780 27.485  11.507  1.00 11.39  ? 175 SER D CB  1 
ATOM   9491  O OG  . SER D 1 175 ? -12.946 27.489  10.705  1.00 16.85  ? 175 SER D OG  1 
ATOM   9492  N N   . PRO D 1 176 ? -13.614 29.108  14.295  1.00 11.81  ? 176 PRO D N   1 
ATOM   9493  C CA  . PRO D 1 176 ? -14.961 29.177  14.831  1.00 11.40  ? 176 PRO D CA  1 
ATOM   9494  C C   . PRO D 1 176 ? -15.970 29.270  13.663  1.00 18.15  ? 176 PRO D C   1 
ATOM   9495  O O   . PRO D 1 176 ? -17.083 28.706  13.715  1.00 19.32  ? 176 PRO D O   1 
ATOM   9496  C CB  . PRO D 1 176 ? -14.949 30.457  15.685  1.00 12.59  ? 176 PRO D CB  1 
ATOM   9497  C CG  . PRO D 1 176 ? -13.507 30.836  15.830  1.00 15.51  ? 176 PRO D CG  1 
ATOM   9498  C CD  . PRO D 1 176 ? -12.791 30.265  14.651  1.00 10.71  ? 176 PRO D CD  1 
ATOM   9499  N N   . GLU D 1 177 ? -15.585 29.991  12.618  1.00 16.52  ? 177 GLU D N   1 
ATOM   9500  C CA  . GLU D 1 177 ? -16.446 30.194  11.444  1.00 17.93  ? 177 GLU D CA  1 
ATOM   9501  C C   . GLU D 1 177 ? -16.917 28.869  10.822  1.00 19.74  ? 177 GLU D C   1 
ATOM   9502  O O   . GLU D 1 177 ? -18.084 28.726  10.427  1.00 17.19  ? 177 GLU D O   1 
ATOM   9503  C CB  . GLU D 1 177 ? -15.702 31.025  10.388  1.00 19.62  ? 177 GLU D CB  1 
ATOM   9504  C CG  . GLU D 1 177 ? -15.331 32.421  10.868  1.00 33.02  ? 177 GLU D CG  1 
ATOM   9505  C CD  . GLU D 1 177 ? -14.003 32.460  11.686  1.00 51.25  ? 177 GLU D CD  1 
ATOM   9506  O OE1 . GLU D 1 177 ? -13.351 31.414  11.871  1.00 13.13  ? 177 GLU D OE1 1 
ATOM   9507  O OE2 . GLU D 1 177 ? -13.586 33.560  12.144  1.00 42.13  ? 177 GLU D OE2 1 
ATOM   9508  N N   . SER D 1 178 ? -16.006 27.907  10.733  1.00 16.62  ? 178 SER D N   1 
ATOM   9509  C CA  . SER D 1 178 ? -16.332 26.598  10.150  1.00 17.09  ? 178 SER D CA  1 
ATOM   9510  C C   . SER D 1 178 ? -17.309 25.860  11.067  1.00 24.69  ? 178 SER D C   1 
ATOM   9511  O O   . SER D 1 178 ? -18.403 25.461  10.625  1.00 25.95  ? 178 SER D O   1 
ATOM   9512  C CB  . SER D 1 178 ? -15.053 25.774  9.955   1.00 18.87  ? 178 SER D CB  1 
ATOM   9513  O OG  . SER D 1 178 ? -14.180 26.380  9.011   1.00 23.39  ? 178 SER D OG  1 
ATOM   9514  N N   . VAL D 1 179 ? -16.940 25.738  12.352  1.00 19.29  ? 179 VAL D N   1 
ATOM   9515  C CA  . VAL D 1 179 ? -17.797 25.107  13.349  1.00 17.55  ? 179 VAL D CA  1 
ATOM   9516  C C   . VAL D 1 179 ? -19.210 25.705  13.253  1.00 21.60  ? 179 VAL D C   1 
ATOM   9517  O O   . VAL D 1 179 ? -20.203 24.971  13.221  1.00 21.00  ? 179 VAL D O   1 
ATOM   9518  C CB  . VAL D 1 179 ? -17.247 25.365  14.755  1.00 20.44  ? 179 VAL D CB  1 
ATOM   9519  C CG1 . VAL D 1 179 ? -18.267 24.999  15.834  1.00 19.08  ? 179 VAL D CG1 1 
ATOM   9520  C CG2 . VAL D 1 179 ? -15.920 24.660  14.948  1.00 20.66  ? 179 VAL D CG2 1 
ATOM   9521  N N   . LEU D 1 180 ? -19.282 27.030  13.157  1.00 18.90  ? 180 LEU D N   1 
ATOM   9522  C CA  . LEU D 1 180 ? -20.553 27.743  13.119  1.00 18.96  ? 180 LEU D CA  1 
ATOM   9523  C C   . LEU D 1 180 ? -21.396 27.393  11.923  1.00 23.59  ? 180 LEU D C   1 
ATOM   9524  O O   . LEU D 1 180 ? -22.620 27.154  12.053  1.00 23.74  ? 180 LEU D O   1 
ATOM   9525  C CB  . LEU D 1 180 ? -20.352 29.251  13.258  1.00 18.88  ? 180 LEU D CB  1 
ATOM   9526  C CG  . LEU D 1 180 ? -20.245 29.608  14.735  1.00 24.16  ? 180 LEU D CG  1 
ATOM   9527  C CD1 . LEU D 1 180 ? -19.772 31.005  14.956  1.00 25.12  ? 180 LEU D CD1 1 
ATOM   9528  C CD2 . LEU D 1 180 ? -21.570 29.345  15.437  1.00 25.83  ? 180 LEU D CD2 1 
ATOM   9529  N N   . LYS D 1 181 ? -20.741 27.318  10.767  1.00 19.04  ? 181 LYS D N   1 
ATOM   9530  C CA  . LYS D 1 181 ? -21.424 26.923  9.534   1.00 19.42  ? 181 LYS D CA  1 
ATOM   9531  C C   . LYS D 1 181 ? -21.956 25.496  9.673   1.00 25.30  ? 181 LYS D C   1 
ATOM   9532  O O   . LYS D 1 181 ? -23.069 25.188  9.228   1.00 26.59  ? 181 LYS D O   1 
ATOM   9533  C CB  . LYS D 1 181 ? -20.463 26.996  8.346   1.00 21.60  ? 181 LYS D CB  1 
ATOM   9534  C CG  . LYS D 1 181 ? -21.056 26.559  7.019   1.00 30.87  ? 181 LYS D CG  1 
ATOM   9535  C CD  . LYS D 1 181 ? -20.029 26.761  5.913   1.00 42.38  ? 181 LYS D CD  1 
ATOM   9536  C CE  . LYS D 1 181 ? -20.681 26.929  4.548   1.00 34.12  ? 181 LYS D CE  1 
ATOM   9537  N NZ  . LYS D 1 181 ? -20.858 25.584  3.947   1.00 48.50  ? 181 LYS D NZ  1 
ATOM   9538  N N   . VAL D 1 182 ? -21.129 24.630  10.267  1.00 20.40  ? 182 VAL D N   1 
ATOM   9539  C CA  . VAL D 1 182 ? -21.482 23.242  10.489  1.00 19.38  ? 182 VAL D CA  1 
ATOM   9540  C C   . VAL D 1 182 ? -22.617 23.094  11.508  1.00 25.20  ? 182 VAL D C   1 
ATOM   9541  O O   . VAL D 1 182 ? -23.602 22.385  11.232  1.00 25.83  ? 182 VAL D O   1 
ATOM   9542  C CB  . VAL D 1 182 ? -20.241 22.363  10.815  1.00 22.09  ? 182 VAL D CB  1 
ATOM   9543  C CG1 . VAL D 1 182 ? -20.654 20.970  11.260  1.00 21.39  ? 182 VAL D CG1 1 
ATOM   9544  C CG2 . VAL D 1 182 ? -19.295 22.268  9.594   1.00 21.67  ? 182 VAL D CG2 1 
ATOM   9545  N N   . ALA D 1 183 ? -22.498 23.752  12.671  1.00 20.88  ? 183 ALA D N   1 
ATOM   9546  C CA  . ALA D 1 183 ? -23.567 23.684  13.677  1.00 21.05  ? 183 ALA D CA  1 
ATOM   9547  C C   . ALA D 1 183 ? -24.873 24.318  13.160  1.00 28.55  ? 183 ALA D C   1 
ATOM   9548  O O   . ALA D 1 183 ? -25.953 23.733  13.305  1.00 26.91  ? 183 ALA D O   1 
ATOM   9549  C CB  . ALA D 1 183 ? -23.150 24.302  14.970  1.00 21.61  ? 183 ALA D CB  1 
ATOM   9550  N N   . HIS D 1 184 ? -24.772 25.482  12.509  1.00 27.19  ? 184 HIS D N   1 
ATOM   9551  C CA  . HIS D 1 184 ? -25.946 26.095  11.894  1.00 25.60  ? 184 HIS D CA  1 
ATOM   9552  C C   . HIS D 1 184 ? -26.706 25.128  10.936  1.00 26.77  ? 184 HIS D C   1 
ATOM   9553  O O   . HIS D 1 184 ? -27.947 25.060  10.925  1.00 25.45  ? 184 HIS D O   1 
ATOM   9554  C CB  . HIS D 1 184 ? -25.610 27.411  11.173  1.00 25.46  ? 184 HIS D CB  1 
ATOM   9555  C CG  . HIS D 1 184 ? -26.832 28.199  10.810  1.00 28.92  ? 184 HIS D CG  1 
ATOM   9556  N ND1 . HIS D 1 184 ? -27.616 27.894  9.716   1.00 30.40  ? 184 HIS D ND1 1 
ATOM   9557  C CD2 . HIS D 1 184 ? -27.505 29.159  11.494  1.00 30.13  ? 184 HIS D CD2 1 
ATOM   9558  C CE1 . HIS D 1 184 ? -28.669 28.694  9.696   1.00 29.49  ? 184 HIS D CE1 1 
ATOM   9559  N NE2 . HIS D 1 184 ? -28.607 29.496  10.744  1.00 29.38  ? 184 HIS D NE2 1 
ATOM   9560  N N   . HIS D 1 185 ? -25.952 24.375  10.158  1.00 21.10  ? 185 HIS D N   1 
ATOM   9561  C CA  . HIS D 1 185 ? -26.520 23.429  9.205   1.00 20.95  ? 185 HIS D CA  1 
ATOM   9562  C C   . HIS D 1 185 ? -27.270 22.304  9.890   1.00 19.19  ? 185 HIS D C   1 
ATOM   9563  O O   . HIS D 1 185 ? -28.287 21.806  9.383   1.00 18.73  ? 185 HIS D O   1 
ATOM   9564  C CB  . HIS D 1 185 ? -25.377 22.810  8.353   1.00 23.47  ? 185 HIS D CB  1 
ATOM   9565  C CG  . HIS D 1 185 ? -25.828 21.686  7.461   1.00 27.92  ? 185 HIS D CG  1 
ATOM   9566  N ND1 . HIS D 1 185 ? -26.433 21.905  6.238   1.00 30.25  ? 185 HIS D ND1 1 
ATOM   9567  C CD2 . HIS D 1 185 ? -25.763 20.344  7.610   1.00 28.55  ? 185 HIS D CD2 1 
ATOM   9568  C CE1 . HIS D 1 185 ? -26.754 20.745  5.694   1.00 28.78  ? 185 HIS D CE1 1 
ATOM   9569  N NE2 . HIS D 1 185 ? -26.354 19.784  6.504   1.00 28.56  ? 185 HIS D NE2 1 
ATOM   9570  N N   . ALA D 1 186 ? -26.729 21.854  11.017  1.00 14.44  ? 186 ALA D N   1 
ATOM   9571  C CA  . ALA D 1 186 ? -27.318 20.752  11.790  1.00 13.23  ? 186 ALA D CA  1 
ATOM   9572  C C   . ALA D 1 186 ? -28.666 21.225  12.232  1.00 19.10  ? 186 ALA D C   1 
ATOM   9573  O O   . ALA D 1 186 ? -29.674 20.589  11.989  1.00 17.34  ? 186 ALA D O   1 
ATOM   9574  C CB  . ALA D 1 186 ? -26.450 20.403  13.011  1.00 14.05  ? 186 ALA D CB  1 
ATOM   9575  N N   . SER D 1 187 ? -28.695 22.365  12.910  1.00 20.73  ? 187 SER D N   1 
ATOM   9576  C CA  . SER D 1 187 ? -29.973 22.896  13.361  1.00 21.81  ? 187 SER D CA  1 
ATOM   9577  C C   . SER D 1 187 ? -31.018 22.987  12.228  1.00 25.72  ? 187 SER D C   1 
ATOM   9578  O O   . SER D 1 187 ? -31.988 22.231  12.230  1.00 25.72  ? 187 SER D O   1 
ATOM   9579  C CB  . SER D 1 187 ? -29.798 24.212  14.113  1.00 27.32  ? 187 SER D CB  1 
ATOM   9580  O OG  . SER D 1 187 ? -30.639 24.221  15.269  1.00 28.88  ? 187 SER D OG  1 
ATOM   9581  N N   . GLU D 1 188 ? -30.772 23.827  11.220  1.00 22.16  ? 188 GLU D N   1 
ATOM   9582  C CA  . GLU D 1 188 ? -31.667 23.954  10.052  1.00 22.36  ? 188 GLU D CA  1 
ATOM   9583  C C   . GLU D 1 188 ? -32.224 22.647  9.421   1.00 24.37  ? 188 GLU D C   1 
ATOM   9584  O O   . GLU D 1 188 ? -33.168 22.666  8.633   1.00 25.12  ? 188 GLU D O   1 
ATOM   9585  C CB  . GLU D 1 188 ? -30.976 24.740  8.938   1.00 24.19  ? 188 GLU D CB  1 
ATOM   9586  C CG  . GLU D 1 188 ? -30.834 26.216  9.200   1.00 42.24  ? 188 GLU D CG  1 
ATOM   9587  C CD  . GLU D 1 188 ? -30.926 27.023  7.921   1.00 84.72  ? 188 GLU D CD  1 
ATOM   9588  O OE1 . GLU D 1 188 ? -30.375 26.571  6.892   1.00 89.79  ? 188 GLU D OE1 1 
ATOM   9589  O OE2 . GLU D 1 188 ? -31.592 28.083  7.935   1.00 84.45  ? 188 GLU D OE2 1 
ATOM   9590  N N   . ASN D 1 189 ? -31.605 21.523  9.696   1.00 16.97  ? 189 ASN D N   1 
ATOM   9591  C CA  . ASN D 1 189 ? -32.024 20.319  9.039   1.00 14.75  ? 189 ASN D CA  1 
ATOM   9592  C C   . ASN D 1 189 ? -32.189 19.245  10.083  1.00 17.06  ? 189 ASN D C   1 
ATOM   9593  O O   . ASN D 1 189 ? -32.256 18.057  9.781   1.00 17.29  ? 189 ASN D O   1 
ATOM   9594  C CB  . ASN D 1 189 ? -30.975 19.880  8.011   1.00 14.04  ? 189 ASN D CB  1 
ATOM   9595  C CG  . ASN D 1 189 ? -30.747 20.903  6.921   1.00 27.36  ? 189 ASN D CG  1 
ATOM   9596  O OD1 . ASN D 1 189 ? -31.564 21.034  5.999   1.00 29.46  ? 189 ASN D OD1 1 
ATOM   9597  N ND2 . ASN D 1 189 ? -29.588 21.558  6.953   1.00 5.85   ? 189 ASN D ND2 1 
ATOM   9598  N N   . ASN D 1 190 ? -32.209 19.665  11.321  1.00 13.84  ? 190 ASN D N   1 
ATOM   9599  C CA  . ASN D 1 190 ? -32.403 18.733  12.407  1.00 15.78  ? 190 ASN D CA  1 
ATOM   9600  C C   . ASN D 1 190 ? -31.453 17.550  12.468  1.00 21.76  ? 190 ASN D C   1 
ATOM   9601  O O   . ASN D 1 190 ? -31.881 16.394  12.644  1.00 23.02  ? 190 ASN D O   1 
ATOM   9602  C CB  . ASN D 1 190 ? -33.859 18.271  12.474  1.00 20.26  ? 190 ASN D CB  1 
ATOM   9603  C CG  . ASN D 1 190 ? -34.247 17.792  13.859  1.00 55.72  ? 190 ASN D CG  1 
ATOM   9604  O OD1 . ASN D 1 190 ? -34.199 18.555  14.823  1.00 52.63  ? 190 ASN D OD1 1 
ATOM   9605  N ND2 . ASN D 1 190 ? -34.565 16.511  13.979  1.00 54.40  ? 190 ASN D ND2 1 
ATOM   9606  N N   . ARG D 1 191 ? -30.166 17.846  12.356  1.00 17.91  ? 191 ARG D N   1 
ATOM   9607  C CA  . ARG D 1 191 ? -29.124 16.836  12.476  1.00 18.81  ? 191 ARG D CA  1 
ATOM   9608  C C   . ARG D 1 191 ? -28.608 16.952  13.918  1.00 23.86  ? 191 ARG D C   1 
ATOM   9609  O O   . ARG D 1 191 ? -28.925 17.917  14.633  1.00 25.05  ? 191 ARG D O   1 
ATOM   9610  C CB  . ARG D 1 191 ? -27.980 17.154  11.499  1.00 22.43  ? 191 ARG D CB  1 
ATOM   9611  C CG  . ARG D 1 191 ? -28.217 16.664  10.081  1.00 44.56  ? 191 ARG D CG  1 
ATOM   9612  C CD  . ARG D 1 191 ? -29.382 17.366  9.404   1.00 53.84  ? 191 ARG D CD  1 
ATOM   9613  N NE  . ARG D 1 191 ? -29.367 17.135  7.963   1.00 62.90  ? 191 ARG D NE  1 
ATOM   9614  C CZ  . ARG D 1 191 ? -29.277 15.939  7.400   1.00 79.14  ? 191 ARG D CZ  1 
ATOM   9615  N NH1 . ARG D 1 191 ? -29.186 14.845  8.153   1.00 64.38  ? 191 ARG D NH1 1 
ATOM   9616  N NH2 . ARG D 1 191 ? -29.262 15.849  6.077   1.00 66.81  ? 191 ARG D NH2 1 
ATOM   9617  N N   . ILE D 1 192 ? -27.795 15.995  14.347  1.00 17.22  ? 192 ILE D N   1 
ATOM   9618  C CA  . ILE D 1 192 ? -27.253 16.090  15.686  1.00 15.36  ? 192 ILE D CA  1 
ATOM   9619  C C   . ILE D 1 192 ? -25.886 16.744  15.642  1.00 19.29  ? 192 ILE D C   1 
ATOM   9620  O O   . ILE D 1 192 ? -25.021 16.356  14.847  1.00 20.80  ? 192 ILE D O   1 
ATOM   9621  C CB  . ILE D 1 192 ? -27.175 14.738  16.390  1.00 18.42  ? 192 ILE D CB  1 
ATOM   9622  C CG1 . ILE D 1 192 ? -28.588 14.123  16.497  1.00 19.84  ? 192 ILE D CG1 1 
ATOM   9623  C CG2 . ILE D 1 192 ? -26.569 14.907  17.768  1.00 16.27  ? 192 ILE D CG2 1 
ATOM   9624  C CD1 . ILE D 1 192 ? -28.672 12.660  16.212  1.00 13.53  ? 192 ILE D CD1 1 
ATOM   9625  N N   . PHE D 1 193 ? -25.714 17.764  16.488  1.00 12.47  ? 193 PHE D N   1 
ATOM   9626  C CA  . PHE D 1 193 ? -24.469 18.479  16.634  1.00 8.74   ? 193 PHE D CA  1 
ATOM   9627  C C   . PHE D 1 193 ? -23.923 18.295  18.027  1.00 11.25  ? 193 PHE D C   1 
ATOM   9628  O O   . PHE D 1 193 ? -24.589 18.593  19.005  1.00 12.52  ? 193 PHE D O   1 
ATOM   9629  C CB  . PHE D 1 193 ? -24.580 19.966  16.282  1.00 9.11   ? 193 PHE D CB  1 
ATOM   9630  C CG  . PHE D 1 193 ? -23.242 20.654  16.225  1.00 8.91   ? 193 PHE D CG  1 
ATOM   9631  C CD1 . PHE D 1 193 ? -22.466 20.630  15.067  1.00 11.21  ? 193 PHE D CD1 1 
ATOM   9632  C CD2 . PHE D 1 193 ? -22.664 21.113  17.368  1.00 10.28  ? 193 PHE D CD2 1 
ATOM   9633  C CE1 . PHE D 1 193 ? -21.180 21.173  15.024  1.00 11.76  ? 193 PHE D CE1 1 
ATOM   9634  C CE2 . PHE D 1 193 ? -21.361 21.627  17.352  1.00 14.54  ? 193 PHE D CE2 1 
ATOM   9635  C CZ  . PHE D 1 193 ? -20.614 21.657  16.177  1.00 11.65  ? 193 PHE D CZ  1 
ATOM   9636  N N   . THR D 1 194 ? -22.716 17.751  18.087  1.00 9.17   ? 194 THR D N   1 
ATOM   9637  C CA  . THR D 1 194 ? -21.978 17.437  19.304  1.00 8.34   ? 194 THR D CA  1 
ATOM   9638  C C   . THR D 1 194 ? -20.646 18.204  19.362  1.00 15.13  ? 194 THR D C   1 
ATOM   9639  O O   . THR D 1 194 ? -19.991 18.469  18.335  1.00 12.88  ? 194 THR D O   1 
ATOM   9640  C CB  . THR D 1 194 ? -21.644 15.940  19.333  1.00 8.21   ? 194 THR D CB  1 
ATOM   9641  O OG1 . THR D 1 194 ? -20.824 15.657  18.207  1.00 13.37  ? 194 THR D OG1 1 
ATOM   9642  C CG2 . THR D 1 194 ? -22.902 15.127  19.205  1.00 4.73   ? 194 THR D CG2 1 
ATOM   9643  N N   . LEU D 1 195 ? -20.256 18.548  20.586  1.00 12.71  ? 195 LEU D N   1 
ATOM   9644  C CA  . LEU D 1 195 ? -19.040 19.283  20.823  1.00 10.42  ? 195 LEU D CA  1 
ATOM   9645  C C   . LEU D 1 195 ? -18.422 18.795  22.125  1.00 16.31  ? 195 LEU D C   1 
ATOM   9646  O O   . LEU D 1 195 ? -19.116 18.281  23.034  1.00 14.76  ? 195 LEU D O   1 
ATOM   9647  C CB  . LEU D 1 195 ? -19.373 20.777  20.959  1.00 9.16   ? 195 LEU D CB  1 
ATOM   9648  C CG  . LEU D 1 195 ? -18.158 21.718  20.845  1.00 11.09  ? 195 LEU D CG  1 
ATOM   9649  C CD1 . LEU D 1 195 ? -17.974 22.404  19.469  1.00 4.97   ? 195 LEU D CD1 1 
ATOM   9650  C CD2 . LEU D 1 195 ? -18.195 22.750  21.952  1.00 16.91  ? 195 LEU D CD2 1 
ATOM   9651  N N   . ASN D 1 196 ? -17.130 19.065  22.257  1.00 14.45  ? 196 ASN D N   1 
ATOM   9652  C CA  . ASN D 1 196 ? -16.400 18.693  23.442  1.00 13.29  ? 196 ASN D CA  1 
ATOM   9653  C C   . ASN D 1 196 ? -15.803 19.947  24.099  1.00 20.75  ? 196 ASN D C   1 
ATOM   9654  O O   . ASN D 1 196 ? -15.391 20.886  23.385  1.00 22.07  ? 196 ASN D O   1 
ATOM   9655  C CB  . ASN D 1 196 ? -15.322 17.718  23.036  1.00 4.81   ? 196 ASN D CB  1 
ATOM   9656  C CG  . ASN D 1 196 ? -14.843 16.859  24.184  1.00 22.80  ? 196 ASN D CG  1 
ATOM   9657  O OD1 . ASN D 1 196 ? -14.478 17.367  25.251  1.00 23.91  ? 196 ASN D OD1 1 
ATOM   9658  N ND2 . ASN D 1 196 ? -14.874 15.535  24.002  1.00 6.73   ? 196 ASN D ND2 1 
ATOM   9659  N N   . LEU D 1 197 ? -15.778 19.975  25.446  1.00 14.59  ? 197 LEU D N   1 
ATOM   9660  C CA  . LEU D 1 197 ? -15.156 21.083  26.192  1.00 13.09  ? 197 LEU D CA  1 
ATOM   9661  C C   . LEU D 1 197 ? -13.622 21.078  25.996  1.00 15.81  ? 197 LEU D C   1 
ATOM   9662  O O   . LEU D 1 197 ? -12.918 22.109  26.005  1.00 18.56  ? 197 LEU D O   1 
ATOM   9663  C CB  . LEU D 1 197 ? -15.530 21.014  27.682  1.00 13.17  ? 197 LEU D CB  1 
ATOM   9664  C CG  . LEU D 1 197 ? -16.992 21.407  28.008  1.00 14.80  ? 197 LEU D CG  1 
ATOM   9665  C CD1 . LEU D 1 197 ? -17.278 21.476  29.470  1.00 12.46  ? 197 LEU D CD1 1 
ATOM   9666  C CD2 . LEU D 1 197 ? -17.351 22.666  27.302  1.00 14.99  ? 197 LEU D CD2 1 
ATOM   9667  N N   . SER D 1 198 ? -13.113 19.892  25.727  1.00 9.01   ? 198 SER D N   1 
ATOM   9668  C CA  . SER D 1 198 ? -11.723 19.714  25.340  1.00 7.15   ? 198 SER D CA  1 
ATOM   9669  C C   . SER D 1 198 ? -10.627 20.000  26.339  1.00 9.22   ? 198 SER D C   1 
ATOM   9670  O O   . SER D 1 198 ? -9.804  19.155  26.591  1.00 8.17   ? 198 SER D O   1 
ATOM   9671  C CB  . SER D 1 198 ? -11.442 20.301  23.941  1.00 7.87   ? 198 SER D CB  1 
ATOM   9672  O OG  . SER D 1 198 ? -12.184 19.544  22.957  1.00 5.97   ? 198 SER D OG  1 
ATOM   9673  N N   . ALA D 1 199 ? -10.666 21.159  26.979  1.00 6.97   ? 199 ALA D N   1 
ATOM   9674  C CA  . ALA D 1 199 ? -9.610  21.546  27.902  1.00 6.55   ? 199 ALA D CA  1 
ATOM   9675  C C   . ALA D 1 199 ? -10.054 22.794  28.618  1.00 14.60  ? 199 ALA D C   1 
ATOM   9676  O O   . ALA D 1 199 ? -10.757 23.636  28.047  1.00 16.25  ? 199 ALA D O   1 
ATOM   9677  C CB  . ALA D 1 199 ? -8.304  21.836  27.105  1.00 6.38   ? 199 ALA D CB  1 
ATOM   9678  N N   . PRO D 1 200 ? -9.580  22.967  29.841  1.00 10.21  ? 200 PRO D N   1 
ATOM   9679  C CA  . PRO D 1 200 ? -9.894  24.176  30.623  1.00 9.81   ? 200 PRO D CA  1 
ATOM   9680  C C   . PRO D 1 200 ? -9.692  25.478  29.870  1.00 12.39  ? 200 PRO D C   1 
ATOM   9681  O O   . PRO D 1 200 ? -10.572 26.351  29.916  1.00 13.52  ? 200 PRO D O   1 
ATOM   9682  C CB  . PRO D 1 200 ? -8.930  24.065  31.789  1.00 10.24  ? 200 PRO D CB  1 
ATOM   9683  C CG  . PRO D 1 200 ? -8.979  22.588  32.060  1.00 12.56  ? 200 PRO D CG  1 
ATOM   9684  C CD  . PRO D 1 200 ? -8.909  21.969  30.662  1.00 8.22   ? 200 PRO D CD  1 
ATOM   9685  N N   . PHE D 1 201 ? -8.571  25.574  29.144  1.00 7.44   ? 201 PHE D N   1 
ATOM   9686  C CA  . PHE D 1 201 ? -8.212  26.775  28.372  1.00 6.82   ? 201 PHE D CA  1 
ATOM   9687  C C   . PHE D 1 201 ? -9.260  27.274  27.407  1.00 12.92  ? 201 PHE D C   1 
ATOM   9688  O O   . PHE D 1 201 ? -9.477  28.482  27.335  1.00 12.57  ? 201 PHE D O   1 
ATOM   9689  C CB  . PHE D 1 201 ? -6.819  26.737  27.761  1.00 7.32   ? 201 PHE D CB  1 
ATOM   9690  C CG  . PHE D 1 201 ? -6.702  25.924  26.489  1.00 8.87   ? 201 PHE D CG  1 
ATOM   9691  C CD1 . PHE D 1 201 ? -7.086  26.464  25.245  1.00 13.45  ? 201 PHE D CD1 1 
ATOM   9692  C CD2 . PHE D 1 201 ? -6.041  24.679  26.489  1.00 8.24   ? 201 PHE D CD2 1 
ATOM   9693  C CE1 . PHE D 1 201 ? -6.950  25.697  24.033  1.00 11.47  ? 201 PHE D CE1 1 
ATOM   9694  C CE2 . PHE D 1 201 ? -5.846  23.963  25.286  1.00 10.87  ? 201 PHE D CE2 1 
ATOM   9695  C CZ  . PHE D 1 201 ? -6.327  24.470  24.071  1.00 8.77   ? 201 PHE D CZ  1 
ATOM   9696  N N   . ILE D 1 202 ? -10.017 26.337  26.818  1.00 9.77   ? 202 ILE D N   1 
ATOM   9697  C CA  . ILE D 1 202 ? -11.121 26.669  25.915  1.00 10.50  ? 202 ILE D CA  1 
ATOM   9698  C C   . ILE D 1 202 ? -12.208 27.441  26.685  1.00 16.89  ? 202 ILE D C   1 
ATOM   9699  O O   . ILE D 1 202 ? -12.766 28.429  26.187  1.00 19.47  ? 202 ILE D O   1 
ATOM   9700  C CB  . ILE D 1 202 ? -11.755 25.384  25.224  1.00 13.44  ? 202 ILE D CB  1 
ATOM   9701  C CG1 . ILE D 1 202 ? -10.733 24.686  24.327  1.00 14.62  ? 202 ILE D CG1 1 
ATOM   9702  C CG2 . ILE D 1 202 ? -12.956 25.733  24.348  1.00 11.62  ? 202 ILE D CG2 1 
ATOM   9703  C CD1 . ILE D 1 202 ? -9.992  25.640  23.342  1.00 11.22  ? 202 ILE D CD1 1 
ATOM   9704  N N   . SER D 1 203 ? -12.443 27.053  27.934  1.00 11.98  ? 203 SER D N   1 
ATOM   9705  C CA  . SER D 1 203 ? -13.435 27.754  28.770  1.00 13.34  ? 203 SER D CA  1 
ATOM   9706  C C   . SER D 1 203 ? -12.969 29.150  29.226  1.00 20.78  ? 203 SER D C   1 
ATOM   9707  O O   . SER D 1 203 ? -13.745 30.109  29.234  1.00 20.36  ? 203 SER D O   1 
ATOM   9708  C CB  . SER D 1 203 ? -13.840 26.921  29.983  1.00 14.85  ? 203 SER D CB  1 
ATOM   9709  O OG  . SER D 1 203 ? -14.815 25.985  29.592  1.00 21.87  ? 203 SER D OG  1 
ATOM   9710  N N   . GLN D 1 204 ? -11.694 29.237  29.593  1.00 18.26  ? 204 GLN D N   1 
ATOM   9711  C CA  . GLN D 1 204 ? -11.035 30.471  29.950  1.00 17.06  ? 204 GLN D CA  1 
ATOM   9712  C C   . GLN D 1 204 ? -10.890 31.449  28.775  1.00 23.34  ? 204 GLN D C   1 
ATOM   9713  O O   . GLN D 1 204 ? -11.620 32.440  28.695  1.00 24.21  ? 204 GLN D O   1 
ATOM   9714  C CB  . GLN D 1 204 ? -9.685  30.139  30.572  1.00 17.50  ? 204 GLN D CB  1 
ATOM   9715  C CG  . GLN D 1 204 ? -9.848  29.072  31.678  1.00 23.60  ? 204 GLN D CG  1 
ATOM   9716  C CD  . GLN D 1 204 ? -8.538  28.627  32.334  1.00 39.69  ? 204 GLN D CD  1 
ATOM   9717  O OE1 . GLN D 1 204 ? -7.646  28.027  31.701  1.00 33.94  ? 204 GLN D OE1 1 
ATOM   9718  N NE2 . GLN D 1 204 ? -8.474  28.799  33.635  1.00 33.79  ? 204 GLN D NE2 1 
ATOM   9719  N N   . PHE D 1 205 ? -10.020 31.128  27.821  1.00 19.39  ? 205 PHE D N   1 
ATOM   9720  C CA  . PHE D 1 205 ? -9.750  32.032  26.700  1.00 16.63  ? 205 PHE D CA  1 
ATOM   9721  C C   . PHE D 1 205 ? -10.527 31.929  25.363  1.00 18.89  ? 205 PHE D C   1 
ATOM   9722  O O   . PHE D 1 205 ? -10.225 32.676  24.397  1.00 18.76  ? 205 PHE D O   1 
ATOM   9723  C CB  . PHE D 1 205 ? -8.247  32.070  26.486  1.00 16.75  ? 205 PHE D CB  1 
ATOM   9724  C CG  . PHE D 1 205 ? -7.468  31.864  27.739  1.00 16.89  ? 205 PHE D CG  1 
ATOM   9725  C CD1 . PHE D 1 205 ? -7.647  32.714  28.843  1.00 18.72  ? 205 PHE D CD1 1 
ATOM   9726  C CD2 . PHE D 1 205 ? -6.503  30.856  27.826  1.00 19.36  ? 205 PHE D CD2 1 
ATOM   9727  C CE1 . PHE D 1 205 ? -6.830  32.601  30.008  1.00 17.27  ? 205 PHE D CE1 1 
ATOM   9728  C CE2 . PHE D 1 205 ? -5.717  30.704  29.015  1.00 20.56  ? 205 PHE D CE2 1 
ATOM   9729  C CZ  . PHE D 1 205 ? -5.907  31.574  30.096  1.00 16.81  ? 205 PHE D CZ  1 
ATOM   9730  N N   . TYR D 1 206 ? -11.502 31.020  25.277  1.00 13.13  ? 206 TYR D N   1 
ATOM   9731  C CA  . TYR D 1 206 ? -12.302 30.917  24.044  1.00 12.82  ? 206 TYR D CA  1 
ATOM   9732  C C   . TYR D 1 206 ? -13.804 30.902  24.301  1.00 19.94  ? 206 TYR D C   1 
ATOM   9733  O O   . TYR D 1 206 ? -14.567 30.344  23.492  1.00 19.03  ? 206 TYR D O   1 
ATOM   9734  C CB  . TYR D 1 206 ? -11.886 29.716  23.150  1.00 10.92  ? 206 TYR D CB  1 
ATOM   9735  C CG  . TYR D 1 206 ? -10.472 29.814  22.695  1.00 10.23  ? 206 TYR D CG  1 
ATOM   9736  C CD1 . TYR D 1 206 ? -9.429  29.400  23.532  1.00 12.36  ? 206 TYR D CD1 1 
ATOM   9737  C CD2 . TYR D 1 206 ? -10.144 30.535  21.557  1.00 10.23  ? 206 TYR D CD2 1 
ATOM   9738  C CE1 . TYR D 1 206 ? -8.112  29.574  23.183  1.00 10.85  ? 206 TYR D CE1 1 
ATOM   9739  C CE2 . TYR D 1 206 ? -8.790  30.758  21.200  1.00 9.78   ? 206 TYR D CE2 1 
ATOM   9740  C CZ  . TYR D 1 206 ? -7.799  30.269  22.015  1.00 15.70  ? 206 TYR D CZ  1 
ATOM   9741  O OH  . TYR D 1 206 ? -6.485  30.484  21.680  1.00 17.55  ? 206 TYR D OH  1 
ATOM   9742  N N   . LYS D 1 207 ? -14.228 31.487  25.425  1.00 17.83  ? 207 LYS D N   1 
ATOM   9743  C CA  . LYS D 1 207 ? -15.647 31.436  25.808  1.00 19.87  ? 207 LYS D CA  1 
ATOM   9744  C C   . LYS D 1 207 ? -16.590 32.098  24.829  1.00 25.98  ? 207 LYS D C   1 
ATOM   9745  O O   . LYS D 1 207 ? -17.726 31.640  24.619  1.00 28.72  ? 207 LYS D O   1 
ATOM   9746  C CB  . LYS D 1 207 ? -15.944 31.872  27.264  1.00 23.26  ? 207 LYS D CB  1 
ATOM   9747  C CG  . LYS D 1 207 ? -14.782 32.472  28.079  1.00 30.39  ? 207 LYS D CG  1 
ATOM   9748  C CD  . LYS D 1 207 ? -15.300 32.974  29.421  1.00 34.90  ? 207 LYS D CD  1 
ATOM   9749  C CE  . LYS D 1 207 ? -14.164 33.275  30.406  1.00 30.46  ? 207 LYS D CE  1 
ATOM   9750  N NZ  . LYS D 1 207 ? -14.661 33.795  31.727  1.00 37.01  ? 207 LYS D NZ  1 
ATOM   9751  N N   . GLU D 1 208 ? -16.106 33.150  24.201  1.00 22.09  ? 208 GLU D N   1 
ATOM   9752  C CA  . GLU D 1 208 ? -16.906 33.833  23.196  1.00 23.85  ? 208 GLU D CA  1 
ATOM   9753  C C   . GLU D 1 208 ? -17.409 32.870  22.113  1.00 23.65  ? 208 GLU D C   1 
ATOM   9754  O O   . GLU D 1 208 ? -18.586 32.660  21.968  1.00 22.42  ? 208 GLU D O   1 
ATOM   9755  C CB  . GLU D 1 208 ? -16.117 34.983  22.562  1.00 26.50  ? 208 GLU D CB  1 
ATOM   9756  C CG  . GLU D 1 208 ? -17.045 35.910  21.832  1.00 43.50  ? 208 GLU D CG  1 
ATOM   9757  C CD  . GLU D 1 208 ? -16.367 37.089  21.228  1.00 65.08  ? 208 GLU D CD  1 
ATOM   9758  O OE1 . GLU D 1 208 ? -16.003 38.014  21.996  1.00 63.22  ? 208 GLU D OE1 1 
ATOM   9759  O OE2 . GLU D 1 208 ? -16.343 37.136  19.975  1.00 46.93  ? 208 GLU D OE2 1 
ATOM   9760  N N   . SER D 1 209 ? -16.480 32.217  21.433  1.00 19.52  ? 209 SER D N   1 
ATOM   9761  C CA  . SER D 1 209 ? -16.776 31.235  20.410  1.00 16.51  ? 209 SER D CA  1 
ATOM   9762  C C   . SER D 1 209 ? -17.590 30.080  20.984  1.00 18.51  ? 209 SER D C   1 
ATOM   9763  O O   . SER D 1 209 ? -18.548 29.563  20.339  1.00 14.88  ? 209 SER D O   1 
ATOM   9764  C CB  . SER D 1 209 ? -15.460 30.710  19.848  1.00 15.43  ? 209 SER D CB  1 
ATOM   9765  O OG  . SER D 1 209 ? -14.684 31.792  19.405  1.00 21.92  ? 209 SER D OG  1 
ATOM   9766  N N   . LEU D 1 210 ? -17.165 29.639  22.168  1.00 14.50  ? 210 LEU D N   1 
ATOM   9767  C CA  . LEU D 1 210 ? -17.766 28.490  22.806  1.00 14.80  ? 210 LEU D CA  1 
ATOM   9768  C C   . LEU D 1 210 ? -19.231 28.762  23.010  1.00 20.96  ? 210 LEU D C   1 
ATOM   9769  O O   . LEU D 1 210 ? -20.081 27.934  22.698  1.00 20.94  ? 210 LEU D O   1 
ATOM   9770  C CB  . LEU D 1 210 ? -17.100 28.204  24.161  1.00 14.96  ? 210 LEU D CB  1 
ATOM   9771  C CG  . LEU D 1 210 ? -17.673 27.011  24.966  1.00 18.92  ? 210 LEU D CG  1 
ATOM   9772  C CD1 . LEU D 1 210 ? -17.832 25.734  24.141  1.00 17.85  ? 210 LEU D CD1 1 
ATOM   9773  C CD2 . LEU D 1 210 ? -16.883 26.713  26.264  1.00 18.87  ? 210 LEU D CD2 1 
ATOM   9774  N N   . MET D 1 211 ? -19.530 29.963  23.491  1.00 18.37  ? 211 MET D N   1 
ATOM   9775  C CA  . MET D 1 211 ? -20.915 30.331  23.817  1.00 15.72  ? 211 MET D CA  1 
ATOM   9776  C C   . MET D 1 211 ? -21.720 30.789  22.629  1.00 19.31  ? 211 MET D C   1 
ATOM   9777  O O   . MET D 1 211 ? -22.955 30.744  22.636  1.00 18.18  ? 211 MET D O   1 
ATOM   9778  C CB  . MET D 1 211 ? -20.933 31.344  24.943  1.00 15.82  ? 211 MET D CB  1 
ATOM   9779  C CG  . MET D 1 211 ? -20.279 30.783  26.201  1.00 16.69  ? 211 MET D CG  1 
ATOM   9780  S SD  . MET D 1 211 ? -21.242 29.359  26.803  1.00 17.75  ? 211 MET D SD  1 
ATOM   9781  C CE  . MET D 1 211 ? -22.709 30.101  27.398  1.00 14.39  ? 211 MET D CE  1 
ATOM   9782  N N   . LYS D 1 212 ? -21.013 31.132  21.567  1.00 17.34  ? 212 LYS D N   1 
ATOM   9783  C CA  . LYS D 1 212 ? -21.654 31.516  20.321  1.00 17.94  ? 212 LYS D CA  1 
ATOM   9784  C C   . LYS D 1 212 ? -22.039 30.237  19.624  1.00 19.54  ? 212 LYS D C   1 
ATOM   9785  O O   . LYS D 1 212 ? -23.076 30.157  18.980  1.00 19.88  ? 212 LYS D O   1 
ATOM   9786  C CB  . LYS D 1 212 ? -20.714 32.365  19.457  1.00 24.05  ? 212 LYS D CB  1 
ATOM   9787  C CG  . LYS D 1 212 ? -21.458 33.327  18.546  1.00 54.90  ? 212 LYS D CG  1 
ATOM   9788  C CD  . LYS D 1 212 ? -20.520 34.027  17.587  1.00 71.07  ? 212 LYS D CD  1 
ATOM   9789  C CE  . LYS D 1 212 ? -20.034 35.348  18.166  1.00 82.81  ? 212 LYS D CE  1 
ATOM   9790  N NZ  . LYS D 1 212 ? -19.339 35.140  19.461  1.00 90.94  ? 212 LYS D NZ  1 
ATOM   9791  N N   . VAL D 1 213 ? -21.301 29.176  19.932  1.00 17.27  ? 213 VAL D N   1 
ATOM   9792  C CA  . VAL D 1 213 ? -21.575 27.833  19.395  1.00 16.27  ? 213 VAL D CA  1 
ATOM   9793  C C   . VAL D 1 213 ? -22.514 26.979  20.278  1.00 17.95  ? 213 VAL D C   1 
ATOM   9794  O O   . VAL D 1 213 ? -23.296 26.173  19.772  1.00 15.97  ? 213 VAL D O   1 
ATOM   9795  C CB  . VAL D 1 213 ? -20.257 27.063  19.110  1.00 20.65  ? 213 VAL D CB  1 
ATOM   9796  C CG1 . VAL D 1 213 ? -20.441 25.525  19.170  1.00 19.80  ? 213 VAL D CG1 1 
ATOM   9797  C CG2 . VAL D 1 213 ? -19.676 27.497  17.769  1.00 21.35  ? 213 VAL D CG2 1 
ATOM   9798  N N   . MET D 1 214 ? -22.472 27.191  21.591  1.00 12.98  ? 214 MET D N   1 
ATOM   9799  C CA  . MET D 1 214 ? -23.312 26.433  22.521  1.00 11.45  ? 214 MET D CA  1 
ATOM   9800  C C   . MET D 1 214 ? -24.794 26.243  22.151  1.00 17.65  ? 214 MET D C   1 
ATOM   9801  O O   . MET D 1 214 ? -25.355 25.134  22.313  1.00 18.97  ? 214 MET D O   1 
ATOM   9802  C CB  . MET D 1 214 ? -23.153 26.947  23.967  1.00 12.62  ? 214 MET D CB  1 
ATOM   9803  C CG  . MET D 1 214 ? -23.713 25.997  25.058  1.00 15.05  ? 214 MET D CG  1 
ATOM   9804  S SD  . MET D 1 214 ? -22.914 24.372  25.136  1.00 17.35  ? 214 MET D SD  1 
ATOM   9805  C CE  . MET D 1 214 ? -21.191 25.023  25.489  1.00 15.22  ? 214 MET D CE  1 
ATOM   9806  N N   . PRO D 1 215 ? -25.472 27.291  21.680  1.00 13.50  ? 215 PRO D N   1 
ATOM   9807  C CA  . PRO D 1 215 ? -26.896 27.116  21.402  1.00 10.88  ? 215 PRO D CA  1 
ATOM   9808  C C   . PRO D 1 215 ? -27.176 26.110  20.306  1.00 15.89  ? 215 PRO D C   1 
ATOM   9809  O O   . PRO D 1 215 ? -28.317 25.877  19.970  1.00 19.54  ? 215 PRO D O   1 
ATOM   9810  C CB  . PRO D 1 215 ? -27.356 28.517  21.003  1.00 11.39  ? 215 PRO D CB  1 
ATOM   9811  C CG  . PRO D 1 215 ? -26.383 29.418  21.564  1.00 16.62  ? 215 PRO D CG  1 
ATOM   9812  C CD  . PRO D 1 215 ? -25.071 28.702  21.507  1.00 13.73  ? 215 PRO D CD  1 
ATOM   9813  N N   . TYR D 1 216 ? -26.144 25.543  19.693  1.00 10.48  ? 216 TYR D N   1 
ATOM   9814  C CA  . TYR D 1 216 ? -26.353 24.600  18.592  1.00 9.51   ? 216 TYR D CA  1 
ATOM   9815  C C   . TYR D 1 216 ? -26.045 23.169  19.025  1.00 10.64  ? 216 TYR D C   1 
ATOM   9816  O O   . TYR D 1 216 ? -26.484 22.175  18.414  1.00 9.36   ? 216 TYR D O   1 
ATOM   9817  C CB  . TYR D 1 216 ? -25.533 24.977  17.342  1.00 11.16  ? 216 TYR D CB  1 
ATOM   9818  C CG  . TYR D 1 216 ? -25.980 26.260  16.621  1.00 15.44  ? 216 TYR D CG  1 
ATOM   9819  C CD1 . TYR D 1 216 ? -25.309 27.461  16.815  1.00 15.60  ? 216 TYR D CD1 1 
ATOM   9820  C CD2 . TYR D 1 216 ? -27.006 26.238  15.676  1.00 18.50  ? 216 TYR D CD2 1 
ATOM   9821  C CE1 . TYR D 1 216 ? -25.621 28.574  16.090  1.00 14.55  ? 216 TYR D CE1 1 
ATOM   9822  C CE2 . TYR D 1 216 ? -27.370 27.406  14.989  1.00 20.10  ? 216 TYR D CE2 1 
ATOM   9823  C CZ  . TYR D 1 216 ? -26.696 28.570  15.234  1.00 19.84  ? 216 TYR D CZ  1 
ATOM   9824  O OH  . TYR D 1 216 ? -27.024 29.690  14.515  1.00 21.39  ? 216 TYR D OH  1 
ATOM   9825  N N   . VAL D 1 217 ? -25.386 23.061  20.157  1.00 7.35   ? 217 VAL D N   1 
ATOM   9826  C CA  . VAL D 1 217 ? -24.951 21.778  20.681  1.00 6.64   ? 217 VAL D CA  1 
ATOM   9827  C C   . VAL D 1 217 ? -26.104 20.954  21.223  1.00 14.06  ? 217 VAL D C   1 
ATOM   9828  O O   . VAL D 1 217 ? -26.841 21.324  22.162  1.00 10.57  ? 217 VAL D O   1 
ATOM   9829  C CB  . VAL D 1 217 ? -23.883 21.947  21.754  1.00 9.30   ? 217 VAL D CB  1 
ATOM   9830  C CG1 . VAL D 1 217 ? -23.599 20.612  22.430  1.00 9.21   ? 217 VAL D CG1 1 
ATOM   9831  C CG2 . VAL D 1 217 ? -22.653 22.525  21.143  1.00 8.35   ? 217 VAL D CG2 1 
ATOM   9832  N N   . ASP D 1 218 ? -26.327 19.837  20.552  1.00 14.59  ? 218 ASP D N   1 
ATOM   9833  C CA  . ASP D 1 218 ? -27.424 18.976  20.969  1.00 13.44  ? 218 ASP D CA  1 
ATOM   9834  C C   . ASP D 1 218 ? -26.849 18.118  22.042  1.00 17.52  ? 218 ASP D C   1 
ATOM   9835  O O   . ASP D 1 218 ? -27.531 17.811  22.971  1.00 17.12  ? 218 ASP D O   1 
ATOM   9836  C CB  . ASP D 1 218 ? -27.986 18.142  19.805  1.00 12.77  ? 218 ASP D CB  1 
ATOM   9837  C CG  . ASP D 1 218 ? -28.653 19.003  18.741  1.00 13.75  ? 218 ASP D CG  1 
ATOM   9838  O OD1 . ASP D 1 218 ? -29.644 19.705  19.063  1.00 8.73   ? 218 ASP D OD1 1 
ATOM   9839  O OD2 . ASP D 1 218 ? -28.168 18.998  17.588  1.00 21.90  ? 218 ASP D OD2 1 
ATOM   9840  N N   . ILE D 1 219 ? -25.551 17.821  21.944  1.00 14.59  ? 219 ILE D N   1 
ATOM   9841  C CA  . ILE D 1 219 ? -24.860 17.028  22.950  1.00 12.83  ? 219 ILE D CA  1 
ATOM   9842  C C   . ILE D 1 219 ? -23.472 17.601  23.287  1.00 14.80  ? 219 ILE D C   1 
ATOM   9843  O O   . ILE D 1 219 ? -22.551 17.658  22.434  1.00 12.84  ? 219 ILE D O   1 
ATOM   9844  C CB  . ILE D 1 219 ? -24.654 15.603  22.485  1.00 14.58  ? 219 ILE D CB  1 
ATOM   9845  C CG1 . ILE D 1 219 ? -25.969 14.958  22.096  1.00 12.83  ? 219 ILE D CG1 1 
ATOM   9846  C CG2 . ILE D 1 219 ? -23.874 14.785  23.561  1.00 13.96  ? 219 ILE D CG2 1 
ATOM   9847  C CD1 . ILE D 1 219 ? -25.840 13.406  22.061  1.00 3.27   ? 219 ILE D CD1 1 
ATOM   9848  N N   . LEU D 1 220 ? -23.286 17.946  24.551  1.00 11.30  ? 220 LEU D N   1 
ATOM   9849  C CA  . LEU D 1 220 ? -21.967 18.423  24.941  1.00 13.19  ? 220 LEU D CA  1 
ATOM   9850  C C   . LEU D 1 220 ? -21.206 17.370  25.749  1.00 18.90  ? 220 LEU D C   1 
ATOM   9851  O O   . LEU D 1 220 ? -21.779 16.794  26.680  1.00 20.36  ? 220 LEU D O   1 
ATOM   9852  C CB  . LEU D 1 220 ? -22.040 19.775  25.677  1.00 12.74  ? 220 LEU D CB  1 
ATOM   9853  C CG  . LEU D 1 220 ? -20.741 20.434  26.176  1.00 15.98  ? 220 LEU D CG  1 
ATOM   9854  C CD1 . LEU D 1 220 ? -20.089 21.087  24.985  1.00 15.95  ? 220 LEU D CD1 1 
ATOM   9855  C CD2 . LEU D 1 220 ? -20.997 21.490  27.302  1.00 15.59  ? 220 LEU D CD2 1 
ATOM   9856  N N   . PHE D 1 221 ? -19.932 17.120  25.391  1.00 12.16  ? 221 PHE D N   1 
ATOM   9857  C CA  . PHE D 1 221 ? -19.091 16.170  26.129  1.00 10.37  ? 221 PHE D CA  1 
ATOM   9858  C C   . PHE D 1 221 ? -18.060 16.945  26.893  1.00 12.68  ? 221 PHE D C   1 
ATOM   9859  O O   . PHE D 1 221 ? -17.813 18.077  26.547  1.00 11.21  ? 221 PHE D O   1 
ATOM   9860  C CB  . PHE D 1 221 ? -18.314 15.255  25.185  1.00 11.61  ? 221 PHE D CB  1 
ATOM   9861  C CG  . PHE D 1 221 ? -19.170 14.466  24.254  1.00 13.68  ? 221 PHE D CG  1 
ATOM   9862  C CD1 . PHE D 1 221 ? -19.374 14.890  22.953  1.00 13.39  ? 221 PHE D CD1 1 
ATOM   9863  C CD2 . PHE D 1 221 ? -19.676 13.224  24.642  1.00 18.56  ? 221 PHE D CD2 1 
ATOM   9864  C CE1 . PHE D 1 221 ? -20.175 14.169  22.096  1.00 15.44  ? 221 PHE D CE1 1 
ATOM   9865  C CE2 . PHE D 1 221 ? -20.463 12.461  23.763  1.00 20.73  ? 221 PHE D CE2 1 
ATOM   9866  C CZ  . PHE D 1 221 ? -20.702 12.930  22.489  1.00 18.35  ? 221 PHE D CZ  1 
ATOM   9867  N N   . GLY D 1 222 ? -17.328 16.252  27.776  1.00 11.83  ? 222 GLY D N   1 
ATOM   9868  C CA  . GLY D 1 222 ? -16.229 16.845  28.536  1.00 12.88  ? 222 GLY D CA  1 
ATOM   9869  C C   . GLY D 1 222 ? -15.915 16.099  29.820  1.00 19.11  ? 222 GLY D C   1 
ATOM   9870  O O   . GLY D 1 222 ? -16.692 15.266  30.267  1.00 22.02  ? 222 GLY D O   1 
ATOM   9871  N N   . ASN D 1 223 ? -14.790 16.418  30.440  1.00 13.74  ? 223 ASN D N   1 
ATOM   9872  C CA  . ASN D 1 223 ? -14.442 15.780  31.698  1.00 13.73  ? 223 ASN D CA  1 
ATOM   9873  C C   . ASN D 1 223 ? -14.682 16.697  32.923  1.00 19.74  ? 223 ASN D C   1 
ATOM   9874  O O   . ASN D 1 223 ? -15.060 17.864  32.777  1.00 17.64  ? 223 ASN D O   1 
ATOM   9875  C CB  . ASN D 1 223 ? -13.022 15.232  31.649  1.00 8.00   ? 223 ASN D CB  1 
ATOM   9876  C CG  . ASN D 1 223 ? -11.978 16.304  31.713  1.00 27.68  ? 223 ASN D CG  1 
ATOM   9877  O OD1 . ASN D 1 223 ? -10.801 16.003  31.717  1.00 30.04  ? 223 ASN D OD1 1 
ATOM   9878  N ND2 . ASN D 1 223 ? -12.393 17.555  31.814  1.00 25.99  ? 223 ASN D ND2 1 
ATOM   9879  N N   . GLU D 1 224 ? -14.463 16.172  34.128  1.00 18.96  ? 224 GLU D N   1 
ATOM   9880  C CA  . GLU D 1 224 ? -14.743 16.964  35.320  1.00 20.54  ? 224 GLU D CA  1 
ATOM   9881  C C   . GLU D 1 224 ? -13.989 18.275  35.540  1.00 22.81  ? 224 GLU D C   1 
ATOM   9882  O O   . GLU D 1 224 ? -14.548 19.160  36.164  1.00 24.40  ? 224 GLU D O   1 
ATOM   9883  C CB  . GLU D 1 224 ? -14.707 16.134  36.602  1.00 22.67  ? 224 GLU D CB  1 
ATOM   9884  C CG  . GLU D 1 224 ? -14.021 14.808  36.466  1.00 34.72  ? 224 GLU D CG  1 
ATOM   9885  C CD  . GLU D 1 224 ? -12.551 14.932  36.254  1.00 41.56  ? 224 GLU D CD  1 
ATOM   9886  O OE1 . GLU D 1 224 ? -11.873 15.384  37.196  1.00 52.06  ? 224 GLU D OE1 1 
ATOM   9887  O OE2 . GLU D 1 224 ? -12.087 14.500  35.178  1.00 31.45  ? 224 GLU D OE2 1 
ATOM   9888  N N   . THR D 1 225 ? -12.697 18.353  35.198  1.00 15.80  ? 225 THR D N   1 
ATOM   9889  C CA  . THR D 1 225 ? -11.937 19.597  35.378  1.00 14.04  ? 225 THR D CA  1 
ATOM   9890  C C   . THR D 1 225 ? -12.385 20.626  34.328  1.00 19.35  ? 225 THR D C   1 
ATOM   9891  O O   . THR D 1 225 ? -12.437 21.817  34.589  1.00 19.32  ? 225 THR D O   1 
ATOM   9892  C CB  . THR D 1 225 ? -10.409 19.375  35.335  1.00 24.38  ? 225 THR D CB  1 
ATOM   9893  O OG1 . THR D 1 225 ? -10.013 18.682  34.142  1.00 23.18  ? 225 THR D OG1 1 
ATOM   9894  C CG2 . THR D 1 225 ? -9.959  18.590  36.548  1.00 25.96  ? 225 THR D CG2 1 
ATOM   9895  N N   . GLU D 1 226 ? -12.844 20.137  33.178  1.00 18.46  ? 226 GLU D N   1 
ATOM   9896  C CA  . GLU D 1 226 ? -13.355 20.997  32.113  1.00 18.76  ? 226 GLU D CA  1 
ATOM   9897  C C   . GLU D 1 226 ? -14.725 21.540  32.492  1.00 23.85  ? 226 GLU D C   1 
ATOM   9898  O O   . GLU D 1 226 ? -14.992 22.733  32.324  1.00 26.89  ? 226 GLU D O   1 
ATOM   9899  C CB  . GLU D 1 226 ? -13.409 20.248  30.765  1.00 19.31  ? 226 GLU D CB  1 
ATOM   9900  C CG  . GLU D 1 226 ? -12.017 20.002  30.221  1.00 21.42  ? 226 GLU D CG  1 
ATOM   9901  C CD  . GLU D 1 226 ? -11.865 18.750  29.408  1.00 25.10  ? 226 GLU D CD  1 
ATOM   9902  O OE1 . GLU D 1 226 ? -10.700 18.407  29.107  1.00 10.35  ? 226 GLU D OE1 1 
ATOM   9903  O OE2 . GLU D 1 226 ? -12.877 18.079  29.097  1.00 24.23  ? 226 GLU D OE2 1 
ATOM   9904  N N   . ALA D 1 227 ? -15.602 20.675  32.984  1.00 16.08  ? 227 ALA D N   1 
ATOM   9905  C CA  . ALA D 1 227 ? -16.930 21.135  33.402  1.00 16.30  ? 227 ALA D CA  1 
ATOM   9906  C C   . ALA D 1 227 ? -16.784 22.155  34.555  1.00 19.42  ? 227 ALA D C   1 
ATOM   9907  O O   . ALA D 1 227 ? -17.433 23.204  34.608  1.00 19.22  ? 227 ALA D O   1 
ATOM   9908  C CB  . ALA D 1 227 ? -17.729 19.963  33.894  1.00 17.46  ? 227 ALA D CB  1 
ATOM   9909  N N   . ALA D 1 228 ? -15.955 21.779  35.510  1.00 12.96  ? 228 ALA D N   1 
ATOM   9910  C CA  . ALA D 1 228 ? -15.684 22.584  36.647  1.00 13.21  ? 228 ALA D CA  1 
ATOM   9911  C C   . ALA D 1 228 ? -15.241 24.000  36.165  1.00 19.63  ? 228 ALA D C   1 
ATOM   9912  O O   . ALA D 1 228 ? -15.765 25.003  36.667  1.00 19.33  ? 228 ALA D O   1 
ATOM   9913  C CB  . ALA D 1 228 ? -14.561 21.885  37.488  1.00 13.74  ? 228 ALA D CB  1 
ATOM   9914  N N   . THR D 1 229 ? -14.245 24.078  35.254  1.00 12.96  ? 229 THR D N   1 
ATOM   9915  C CA  . THR D 1 229 ? -13.791 25.376  34.757  1.00 12.67  ? 229 THR D CA  1 
ATOM   9916  C C   . THR D 1 229 ? -14.934 26.109  34.038  1.00 15.21  ? 229 THR D C   1 
ATOM   9917  O O   . THR D 1 229 ? -15.059 27.313  34.082  1.00 13.60  ? 229 THR D O   1 
ATOM   9918  C CB  . THR D 1 229 ? -12.623 25.276  33.715  1.00 20.10  ? 229 THR D CB  1 
ATOM   9919  O OG1 . THR D 1 229 ? -11.425 24.722  34.296  1.00 13.65  ? 229 THR D OG1 1 
ATOM   9920  C CG2 . THR D 1 229 ? -12.308 26.681  33.208  1.00 12.43  ? 229 THR D CG2 1 
ATOM   9921  N N   . PHE D 1 230 ? -15.726 25.350  33.300  1.00 14.30  ? 230 PHE D N   1 
ATOM   9922  C CA  . PHE D 1 230 ? -16.840 25.908  32.539  1.00 15.42  ? 230 PHE D CA  1 
ATOM   9923  C C   . PHE D 1 230 ? -17.862 26.611  33.472  1.00 18.25  ? 230 PHE D C   1 
ATOM   9924  O O   . PHE D 1 230 ? -18.235 27.805  33.276  1.00 14.80  ? 230 PHE D O   1 
ATOM   9925  C CB  . PHE D 1 230 ? -17.489 24.803  31.687  1.00 17.32  ? 230 PHE D CB  1 
ATOM   9926  C CG  . PHE D 1 230 ? -18.604 25.297  30.797  1.00 18.33  ? 230 PHE D CG  1 
ATOM   9927  C CD1 . PHE D 1 230 ? -18.330 26.051  29.685  1.00 18.70  ? 230 PHE D CD1 1 
ATOM   9928  C CD2 . PHE D 1 230 ? -19.936 25.086  31.134  1.00 20.87  ? 230 PHE D CD2 1 
ATOM   9929  C CE1 . PHE D 1 230 ? -19.355 26.535  28.899  1.00 19.85  ? 230 PHE D CE1 1 
ATOM   9930  C CE2 . PHE D 1 230 ? -20.967 25.593  30.353  1.00 22.23  ? 230 PHE D CE2 1 
ATOM   9931  C CZ  . PHE D 1 230 ? -20.662 26.311  29.226  1.00 19.69  ? 230 PHE D CZ  1 
ATOM   9932  N N   . ALA D 1 231 ? -18.247 25.866  34.512  1.00 15.03  ? 231 ALA D N   1 
ATOM   9933  C CA  . ALA D 1 231 ? -19.066 26.340  35.627  1.00 14.24  ? 231 ALA D CA  1 
ATOM   9934  C C   . ALA D 1 231 ? -18.608 27.652  36.284  1.00 19.11  ? 231 ALA D C   1 
ATOM   9935  O O   . ALA D 1 231 ? -19.431 28.470  36.626  1.00 20.61  ? 231 ALA D O   1 
ATOM   9936  C CB  . ALA D 1 231 ? -19.161 25.247  36.655  1.00 15.10  ? 231 ALA D CB  1 
ATOM   9937  N N   . ARG D 1 232 ? -17.304 27.884  36.413  1.00 16.85  ? 232 ARG D N   1 
ATOM   9938  C CA  . ARG D 1 232 ? -16.783 29.120  36.999  1.00 15.42  ? 232 ARG D CA  1 
ATOM   9939  C C   . ARG D 1 232 ? -16.721 30.280  36.019  1.00 21.31  ? 232 ARG D C   1 
ATOM   9940  O O   . ARG D 1 232 ? -16.983 31.439  36.355  1.00 20.00  ? 232 ARG D O   1 
ATOM   9941  C CB  . ARG D 1 232 ? -15.402 28.854  37.546  1.00 16.82  ? 232 ARG D CB  1 
ATOM   9942  C CG  . ARG D 1 232 ? -14.737 30.098  38.095  1.00 42.91  ? 232 ARG D CG  1 
ATOM   9943  C CD  . ARG D 1 232 ? -13.255 29.863  38.325  1.00 70.59  ? 232 ARG D CD  1 
ATOM   9944  N NE  . ARG D 1 232 ? -13.039 29.186  39.598  1.00 99.92  ? 232 ARG D NE  1 
ATOM   9945  C CZ  . ARG D 1 232 ? -11.869 29.125  40.227  1.00 123.44 ? 232 ARG D CZ  1 
ATOM   9946  N NH1 . ARG D 1 232 ? -10.794 29.701  39.699  1.00 111.51 ? 232 ARG D NH1 1 
ATOM   9947  N NH2 . ARG D 1 232 ? -11.771 28.499  41.393  1.00 114.91 ? 232 ARG D NH2 1 
ATOM   9948  N N   . GLU D 1 233 ? -16.316 29.965  34.797  1.00 20.09  ? 233 GLU D N   1 
ATOM   9949  C CA  . GLU D 1 233 ? -16.194 30.977  33.767  1.00 19.51  ? 233 GLU D CA  1 
ATOM   9950  C C   . GLU D 1 233 ? -17.553 31.454  33.310  1.00 27.51  ? 233 GLU D C   1 
ATOM   9951  O O   . GLU D 1 233 ? -17.668 32.538  32.781  1.00 29.45  ? 233 GLU D O   1 
ATOM   9952  C CB  . GLU D 1 233 ? -15.345 30.433  32.630  1.00 19.87  ? 233 GLU D CB  1 
ATOM   9953  C CG  . GLU D 1 233 ? -13.939 30.067  33.095  1.00 18.09  ? 233 GLU D CG  1 
ATOM   9954  C CD  . GLU D 1 233 ? -13.068 31.279  33.415  1.00 38.28  ? 233 GLU D CD  1 
ATOM   9955  O OE1 . GLU D 1 233 ? -12.043 31.112  34.111  1.00 30.28  ? 233 GLU D OE1 1 
ATOM   9956  O OE2 . GLU D 1 233 ? -13.365 32.397  32.920  1.00 37.64  ? 233 GLU D OE2 1 
ATOM   9957  N N   . GLN D 1 234 ? -18.575 30.637  33.549  1.00 27.34  ? 234 GLN D N   1 
ATOM   9958  C CA  . GLN D 1 234 ? -19.950 30.945  33.179  1.00 28.51  ? 234 GLN D CA  1 
ATOM   9959  C C   . GLN D 1 234 ? -20.698 31.425  34.441  1.00 33.99  ? 234 GLN D C   1 
ATOM   9960  O O   . GLN D 1 234 ? -21.911 31.657  34.397  1.00 32.05  ? 234 GLN D O   1 
ATOM   9961  C CB  . GLN D 1 234 ? -20.629 29.665  32.650  1.00 30.45  ? 234 GLN D CB  1 
ATOM   9962  C CG  . GLN D 1 234 ? -20.758 29.535  31.118  1.00 31.02  ? 234 GLN D CG  1 
ATOM   9963  C CD  . GLN D 1 234 ? -20.427 30.826  30.382  1.00 31.06  ? 234 GLN D CD  1 
ATOM   9964  O OE1 . GLN D 1 234 ? -19.278 31.081  29.995  1.00 24.91  ? 234 GLN D OE1 1 
ATOM   9965  N NE2 . GLN D 1 234 ? -21.418 31.664  30.234  1.00 6.59   ? 234 GLN D NE2 1 
ATOM   9966  N N   . GLY D 1 235 ? -19.974 31.483  35.574  1.00 30.62  ? 235 GLY D N   1 
ATOM   9967  C CA  . GLY D 1 235 ? -20.516 31.891  36.873  1.00 29.56  ? 235 GLY D CA  1 
ATOM   9968  C C   . GLY D 1 235 ? -21.741 31.091  37.362  1.00 35.05  ? 235 GLY D C   1 
ATOM   9969  O O   . GLY D 1 235 ? -22.733 31.685  37.842  1.00 34.58  ? 235 GLY D O   1 
ATOM   9970  N N   . PHE D 1 236 ? -21.705 29.760  37.197  1.00 28.62  ? 236 PHE D N   1 
ATOM   9971  C CA  . PHE D 1 236 ? -22.803 28.922  37.647  1.00 26.51  ? 236 PHE D CA  1 
ATOM   9972  C C   . PHE D 1 236 ? -22.865 28.975  39.155  1.00 34.70  ? 236 PHE D C   1 
ATOM   9973  O O   . PHE D 1 236 ? -23.931 28.801  39.727  1.00 35.48  ? 236 PHE D O   1 
ATOM   9974  C CB  . PHE D 1 236 ? -22.633 27.458  37.213  1.00 26.51  ? 236 PHE D CB  1 
ATOM   9975  C CG  . PHE D 1 236 ? -23.015 27.187  35.773  1.00 25.41  ? 236 PHE D CG  1 
ATOM   9976  C CD1 . PHE D 1 236 ? -23.465 28.199  34.951  1.00 27.25  ? 236 PHE D CD1 1 
ATOM   9977  C CD2 . PHE D 1 236 ? -22.879 25.925  35.235  1.00 23.31  ? 236 PHE D CD2 1 
ATOM   9978  C CE1 . PHE D 1 236 ? -23.818 27.925  33.642  1.00 26.93  ? 236 PHE D CE1 1 
ATOM   9979  C CE2 . PHE D 1 236 ? -23.193 25.665  33.941  1.00 24.98  ? 236 PHE D CE2 1 
ATOM   9980  C CZ  . PHE D 1 236 ? -23.645 26.667  33.139  1.00 24.49  ? 236 PHE D CZ  1 
ATOM   9981  N N   . GLU D 1 237 ? -21.725 29.166  39.809  1.00 34.24  ? 237 GLU D N   1 
ATOM   9982  C CA  . GLU D 1 237 ? -21.733 29.187  41.267  1.00 34.29  ? 237 GLU D CA  1 
ATOM   9983  C C   . GLU D 1 237 ? -22.167 27.806  41.743  1.00 38.00  ? 237 GLU D C   1 
ATOM   9984  O O   . GLU D 1 237 ? -23.276 27.657  42.269  1.00 37.63  ? 237 GLU D O   1 
ATOM   9985  C CB  . GLU D 1 237 ? -22.734 30.242  41.763  1.00 35.44  ? 237 GLU D CB  1 
ATOM   9986  C CG  . GLU D 1 237 ? -22.449 31.594  41.169  1.00 47.04  ? 237 GLU D CG  1 
ATOM   9987  C CD  . GLU D 1 237 ? -23.419 32.684  41.595  1.00 71.61  ? 237 GLU D CD  1 
ATOM   9988  O OE1 . GLU D 1 237 ? -24.658 32.522  41.461  1.00 15.12  ? 237 GLU D OE1 1 
ATOM   9989  O OE2 . GLU D 1 237 ? -22.919 33.795  41.884  1.00 86.36  ? 237 GLU D OE2 1 
ATOM   9990  N N   . THR D 1 238 ? -21.328 26.800  41.479  1.00 32.94  ? 238 THR D N   1 
ATOM   9991  C CA  . THR D 1 238 ? -21.605 25.430  41.880  1.00 31.55  ? 238 THR D CA  1 
ATOM   9992  C C   . THR D 1 238 ? -20.426 24.552  41.436  1.00 35.26  ? 238 THR D C   1 
ATOM   9993  O O   . THR D 1 238 ? -19.983 24.656  40.292  1.00 36.96  ? 238 THR D O   1 
ATOM   9994  C CB  . THR D 1 238 ? -22.949 24.984  41.307  1.00 33.12  ? 238 THR D CB  1 
ATOM   9995  O OG1 . THR D 1 238 ? -23.378 23.784  41.932  1.00 32.73  ? 238 THR D OG1 1 
ATOM   9996  C CG2 . THR D 1 238 ? -22.880 24.754  39.830  1.00 40.02  ? 238 THR D CG2 1 
ATOM   9997  N N   . LYS D 1 239 ? -19.855 23.794  42.379  1.00 26.56  ? 239 LYS D N   1 
ATOM   9998  C CA  . LYS D 1 239 ? -18.706 22.934  42.131  1.00 23.33  ? 239 LYS D CA  1 
ATOM   9999  C C   . LYS D 1 239 ? -19.202 21.539  41.833  1.00 24.44  ? 239 LYS D C   1 
ATOM   10000 O O   . LYS D 1 239 ? -18.430 20.645  41.478  1.00 25.53  ? 239 LYS D O   1 
ATOM   10001 C CB  . LYS D 1 239 ? -17.806 22.889  43.374  1.00 23.40  ? 239 LYS D CB  1 
ATOM   10002 C CG  . LYS D 1 239 ? -17.012 24.133  43.659  1.00 16.96  ? 239 LYS D CG  1 
ATOM   10003 C CD  . LYS D 1 239 ? -15.807 23.888  44.568  1.00 33.47  ? 239 LYS D CD  1 
ATOM   10004 C CE  . LYS D 1 239 ? -15.059 25.205  44.873  1.00 40.67  ? 239 LYS D CE  1 
ATOM   10005 N NZ  . LYS D 1 239 ? -14.143 25.185  46.056  1.00 41.83  ? 239 LYS D NZ  1 
ATOM   10006 N N   . ASP D 1 240 ? -20.501 21.364  42.017  1.00 19.78  ? 240 ASP D N   1 
ATOM   10007 C CA  . ASP D 1 240 ? -21.158 20.068  41.885  1.00 19.44  ? 240 ASP D CA  1 
ATOM   10008 C C   . ASP D 1 240 ? -21.379 19.654  40.467  1.00 21.78  ? 240 ASP D C   1 
ATOM   10009 O O   . ASP D 1 240 ? -22.305 20.144  39.817  1.00 20.36  ? 240 ASP D O   1 
ATOM   10010 C CB  . ASP D 1 240 ? -22.508 20.040  42.602  1.00 21.98  ? 240 ASP D CB  1 
ATOM   10011 C CG  . ASP D 1 240 ? -23.121 18.648  42.611  1.00 42.23  ? 240 ASP D CG  1 
ATOM   10012 O OD1 . ASP D 1 240 ? -24.358 18.533  42.758  1.00 44.22  ? 240 ASP D OD1 1 
ATOM   10013 O OD2 . ASP D 1 240 ? -22.360 17.666  42.431  1.00 52.51  ? 240 ASP D OD2 1 
ATOM   10014 N N   . ILE D 1 241 ? -20.619 18.638  40.057  1.00 18.24  ? 241 ILE D N   1 
ATOM   10015 C CA  . ILE D 1 241 ? -20.703 18.066  38.724  1.00 16.86  ? 241 ILE D CA  1 
ATOM   10016 C C   . ILE D 1 241 ? -22.122 17.924  38.165  1.00 22.24  ? 241 ILE D C   1 
ATOM   10017 O O   . ILE D 1 241 ? -22.462 18.629  37.214  1.00 21.21  ? 241 ILE D O   1 
ATOM   10018 C CB  . ILE D 1 241 ? -19.753 16.824  38.533  1.00 19.17  ? 241 ILE D CB  1 
ATOM   10019 C CG1 . ILE D 1 241 ? -19.565 16.507  37.037  1.00 20.09  ? 241 ILE D CG1 1 
ATOM   10020 C CG2 . ILE D 1 241 ? -20.192 15.641  39.349  1.00 18.32  ? 241 ILE D CG2 1 
ATOM   10021 C CD1 . ILE D 1 241 ? -18.595 15.352  36.714  1.00 24.29  ? 241 ILE D CD1 1 
ATOM   10022 N N   . LYS D 1 242 ? -22.979 17.134  38.830  1.00 22.03  ? 242 LYS D N   1 
ATOM   10023 C CA  . LYS D 1 242 ? -24.408 16.968  38.438  1.00 21.59  ? 242 LYS D CA  1 
ATOM   10024 C C   . LYS D 1 242 ? -25.213 18.253  38.331  1.00 27.32  ? 242 LYS D C   1 
ATOM   10025 O O   . LYS D 1 242 ? -26.156 18.351  37.556  1.00 28.46  ? 242 LYS D O   1 
ATOM   10026 C CB  . LYS D 1 242 ? -25.135 16.039  39.398  1.00 23.26  ? 242 LYS D CB  1 
ATOM   10027 C CG  . LYS D 1 242 ? -24.610 14.628  39.381  1.00 23.78  ? 242 LYS D CG  1 
ATOM   10028 C CD  . LYS D 1 242 ? -25.645 13.674  39.897  1.00 33.32  ? 242 LYS D CD  1 
ATOM   10029 C CE  . LYS D 1 242 ? -25.048 12.295  40.117  1.00 39.63  ? 242 LYS D CE  1 
ATOM   10030 N NZ  . LYS D 1 242 ? -26.114 11.301  40.499  1.00 47.63  ? 242 LYS D NZ  1 
ATOM   10031 N N   . GLU D 1 243 ? -24.877 19.226  39.155  1.00 25.73  ? 243 GLU D N   1 
ATOM   10032 C CA  . GLU D 1 243 ? -25.575 20.517  39.156  1.00 26.45  ? 243 GLU D CA  1 
ATOM   10033 C C   . GLU D 1 243 ? -25.051 21.379  37.972  1.00 24.67  ? 243 GLU D C   1 
ATOM   10034 O O   . GLU D 1 243 ? -25.805 22.067  37.264  1.00 22.27  ? 243 GLU D O   1 
ATOM   10035 C CB  . GLU D 1 243 ? -25.379 21.188  40.543  1.00 29.51  ? 243 GLU D CB  1 
ATOM   10036 C CG  . GLU D 1 243 ? -26.091 22.534  40.800  1.00 52.41  ? 243 GLU D CG  1 
ATOM   10037 C CD  . GLU D 1 243 ? -27.615 22.441  40.758  1.00 78.63  ? 243 GLU D CD  1 
ATOM   10038 O OE1 . GLU D 1 243 ? -28.283 23.496  40.925  1.00 71.93  ? 243 GLU D OE1 1 
ATOM   10039 O OE2 . GLU D 1 243 ? -28.143 21.318  40.551  1.00 63.04  ? 243 GLU D OE2 1 
ATOM   10040 N N   . ILE D 1 244 ? -23.775 21.225  37.671  1.00 20.41  ? 244 ILE D N   1 
ATOM   10041 C CA  . ILE D 1 244 ? -23.201 21.878  36.486  1.00 19.33  ? 244 ILE D CA  1 
ATOM   10042 C C   . ILE D 1 244 ? -23.726 21.227  35.207  1.00 22.71  ? 244 ILE D C   1 
ATOM   10043 O O   . ILE D 1 244 ? -23.944 21.915  34.215  1.00 22.59  ? 244 ILE D O   1 
ATOM   10044 C CB  . ILE D 1 244 ? -21.677 21.784  36.434  1.00 22.44  ? 244 ILE D CB  1 
ATOM   10045 C CG1 . ILE D 1 244 ? -21.023 22.723  37.453  1.00 21.85  ? 244 ILE D CG1 1 
ATOM   10046 C CG2 . ILE D 1 244 ? -21.234 22.169  35.057  1.00 25.79  ? 244 ILE D CG2 1 
ATOM   10047 C CD1 . ILE D 1 244 ? -19.819 22.114  38.129  1.00 15.73  ? 244 ILE D CD1 1 
ATOM   10048 N N   . ALA D 1 245 ? -23.907 19.894  35.225  1.00 19.21  ? 245 ALA D N   1 
ATOM   10049 C CA  . ALA D 1 245 ? -24.441 19.134  34.077  1.00 17.64  ? 245 ALA D CA  1 
ATOM   10050 C C   . ALA D 1 245 ? -25.900 19.542  33.834  1.00 19.42  ? 245 ALA D C   1 
ATOM   10051 O O   . ALA D 1 245 ? -26.379 19.714  32.687  1.00 15.97  ? 245 ALA D O   1 
ATOM   10052 C CB  . ALA D 1 245 ? -24.360 17.653  34.358  1.00 18.18  ? 245 ALA D CB  1 
ATOM   10053 N N   . LYS D 1 246 ? -26.605 19.749  34.941  1.00 16.73  ? 246 LYS D N   1 
ATOM   10054 C CA  . LYS D 1 246 ? -27.997 20.177  34.858  1.00 16.37  ? 246 LYS D CA  1 
ATOM   10055 C C   . LYS D 1 246 ? -28.176 21.629  34.352  1.00 21.06  ? 246 LYS D C   1 
ATOM   10056 O O   . LYS D 1 246 ? -29.010 21.861  33.466  1.00 20.86  ? 246 LYS D O   1 
ATOM   10057 C CB  . LYS D 1 246 ? -28.699 19.965  36.184  1.00 17.87  ? 246 LYS D CB  1 
ATOM   10058 C CG  . LYS D 1 246 ? -29.635 21.088  36.516  1.00 21.89  ? 246 LYS D CG  1 
ATOM   10059 C CD  . LYS D 1 246 ? -30.684 20.650  37.533  1.00 27.43  ? 246 LYS D CD  1 
ATOM   10060 C CE  . LYS D 1 246 ? -32.017 21.365  37.317  1.00 27.31  ? 246 LYS D CE  1 
ATOM   10061 N NZ  . LYS D 1 246 ? -32.853 21.394  38.559  1.00 37.20  ? 246 LYS D NZ  1 
ATOM   10062 N N   . LYS D 1 247 ? -27.387 22.587  34.875  1.00 16.54  ? 247 LYS D N   1 
ATOM   10063 C CA  . LYS D 1 247 ? -27.446 23.972  34.389  1.00 14.67  ? 247 LYS D CA  1 
ATOM   10064 C C   . LYS D 1 247 ? -27.008 24.121  32.924  1.00 18.05  ? 247 LYS D C   1 
ATOM   10065 O O   . LYS D 1 247 ? -27.601 24.913  32.177  1.00 19.87  ? 247 LYS D O   1 
ATOM   10066 C CB  . LYS D 1 247 ? -26.630 24.896  35.280  1.00 16.09  ? 247 LYS D CB  1 
ATOM   10067 C CG  . LYS D 1 247 ? -27.025 24.828  36.732  1.00 29.55  ? 247 LYS D CG  1 
ATOM   10068 C CD  . LYS D 1 247 ? -25.917 25.278  37.638  1.00 48.87  ? 247 LYS D CD  1 
ATOM   10069 C CE  . LYS D 1 247 ? -26.434 26.357  38.557  1.00 72.96  ? 247 LYS D CE  1 
ATOM   10070 N NZ  . LYS D 1 247 ? -27.424 27.217  37.843  1.00 77.56  ? 247 LYS D NZ  1 
ATOM   10071 N N   . THR D 1 248 ? -25.991 23.354  32.520  1.00 10.79  ? 248 THR D N   1 
ATOM   10072 C CA  . THR D 1 248 ? -25.472 23.417  31.164  1.00 9.95   ? 248 THR D CA  1 
ATOM   10073 C C   . THR D 1 248 ? -26.520 22.929  30.144  1.00 15.25  ? 248 THR D C   1 
ATOM   10074 O O   . THR D 1 248 ? -26.646 23.464  29.056  1.00 14.87  ? 248 THR D O   1 
ATOM   10075 C CB  . THR D 1 248 ? -24.182 22.570  31.025  1.00 13.38  ? 248 THR D CB  1 
ATOM   10076 O OG1 . THR D 1 248 ? -23.203 23.008  31.964  1.00 12.18  ? 248 THR D OG1 1 
ATOM   10077 C CG2 . THR D 1 248 ? -23.596 22.657  29.606  1.00 9.66   ? 248 THR D CG2 1 
ATOM   10078 N N   . GLN D 1 249 ? -27.260 21.885  30.517  1.00 12.53  ? 249 GLN D N   1 
ATOM   10079 C CA  . GLN D 1 249 ? -28.264 21.320  29.654  1.00 10.75  ? 249 GLN D CA  1 
ATOM   10080 C C   . GLN D 1 249 ? -29.457 22.264  29.538  1.00 15.25  ? 249 GLN D C   1 
ATOM   10081 O O   . GLN D 1 249 ? -30.221 22.166  28.604  1.00 16.30  ? 249 GLN D O   1 
ATOM   10082 C CB  . GLN D 1 249 ? -28.647 19.910  30.114  1.00 11.35  ? 249 GLN D CB  1 
ATOM   10083 C CG  . GLN D 1 249 ? -30.094 19.726  30.611  1.00 30.33  ? 249 GLN D CG  1 
ATOM   10084 C CD  . GLN D 1 249 ? -31.182 19.740  29.523  1.00 49.21  ? 249 GLN D CD  1 
ATOM   10085 O OE1 . GLN D 1 249 ? -32.246 20.318  29.731  1.00 48.27  ? 249 GLN D OE1 1 
ATOM   10086 N NE2 . GLN D 1 249 ? -30.951 19.050  28.403  1.00 35.20  ? 249 GLN D NE2 1 
ATOM   10087 N N   . ALA D 1 250 ? -29.542 23.261  30.398  1.00 11.89  ? 250 ALA D N   1 
ATOM   10088 C CA  . ALA D 1 250 ? -30.680 24.190  30.332  1.00 11.45  ? 250 ALA D CA  1 
ATOM   10089 C C   . ALA D 1 250 ? -30.339 25.467  29.603  1.00 18.50  ? 250 ALA D C   1 
ATOM   10090 O O   . ALA D 1 250 ? -31.212 26.288  29.401  1.00 20.28  ? 250 ALA D O   1 
ATOM   10091 C CB  . ALA D 1 250 ? -31.173 24.539  31.740  1.00 11.85  ? 250 ALA D CB  1 
ATOM   10092 N N   . LEU D 1 251 ? -29.065 25.677  29.285  1.00 14.28  ? 251 LEU D N   1 
ATOM   10093 C CA  . LEU D 1 251 ? -28.628 26.867  28.564  1.00 11.70  ? 251 LEU D CA  1 
ATOM   10094 C C   . LEU D 1 251 ? -29.529 27.052  27.354  1.00 15.98  ? 251 LEU D C   1 
ATOM   10095 O O   . LEU D 1 251 ? -30.074 26.061  26.825  1.00 14.44  ? 251 LEU D O   1 
ATOM   10096 C CB  . LEU D 1 251 ? -27.134 26.679  28.136  1.00 10.06  ? 251 LEU D CB  1 
ATOM   10097 C CG  . LEU D 1 251 ? -26.212 26.660  29.363  1.00 10.43  ? 251 LEU D CG  1 
ATOM   10098 C CD1 . LEU D 1 251 ? -24.781 26.269  29.049  1.00 9.02   ? 251 LEU D CD1 1 
ATOM   10099 C CD2 . LEU D 1 251 ? -26.274 28.050  30.100  1.00 5.71   ? 251 LEU D CD2 1 
ATOM   10100 N N   . PRO D 1 252 ? -29.705 28.298  26.901  1.00 16.74  ? 252 PRO D N   1 
ATOM   10101 C CA  . PRO D 1 252 ? -30.511 28.559  25.689  1.00 16.89  ? 252 PRO D CA  1 
ATOM   10102 C C   . PRO D 1 252 ? -30.044 27.675  24.547  1.00 19.09  ? 252 PRO D C   1 
ATOM   10103 O O   . PRO D 1 252 ? -28.849 27.594  24.267  1.00 14.07  ? 252 PRO D O   1 
ATOM   10104 C CB  . PRO D 1 252 ? -30.184 30.027  25.355  1.00 18.11  ? 252 PRO D CB  1 
ATOM   10105 C CG  . PRO D 1 252 ? -29.821 30.649  26.692  1.00 22.63  ? 252 PRO D CG  1 
ATOM   10106 C CD  . PRO D 1 252 ? -29.624 29.518  27.716  1.00 17.89  ? 252 PRO D CD  1 
ATOM   10107 N N   . LYS D 1 253 ? -31.010 27.023  23.907  1.00 20.18  ? 253 LYS D N   1 
ATOM   10108 C CA  . LYS D 1 253 ? -30.766 26.197  22.728  1.00 21.03  ? 253 LYS D CA  1 
ATOM   10109 C C   . LYS D 1 253 ? -31.478 26.711  21.434  1.00 26.88  ? 253 LYS D C   1 
ATOM   10110 O O   . LYS D 1 253 ? -32.702 26.696  21.361  1.00 27.47  ? 253 LYS D O   1 
ATOM   10111 C CB  . LYS D 1 253 ? -31.200 24.757  23.023  1.00 21.22  ? 253 LYS D CB  1 
ATOM   10112 C CG  . LYS D 1 253 ? -30.753 23.734  21.983  1.00 16.88  ? 253 LYS D CG  1 
ATOM   10113 C CD  . LYS D 1 253 ? -30.851 22.275  22.495  1.00 12.83  ? 253 LYS D CD  1 
ATOM   10114 C CE  . LYS D 1 253 ? -30.519 21.381  21.333  1.00 10.37  ? 253 LYS D CE  1 
ATOM   10115 N NZ  . LYS D 1 253 ? -30.189 22.365  20.169  1.00 26.50  ? 253 LYS D NZ  1 
ATOM   10116 N N   . MET D 1 254 ? -30.712 27.028  20.389  1.00 22.90  ? 254 MET D N   1 
ATOM   10117 C CA  . MET D 1 254 ? -31.246 27.353  19.049  1.00 21.67  ? 254 MET D CA  1 
ATOM   10118 C C   . MET D 1 254 ? -32.306 26.409  18.393  1.00 28.62  ? 254 MET D C   1 
ATOM   10119 O O   . MET D 1 254 ? -33.302 26.888  17.863  1.00 27.87  ? 254 MET D O   1 
ATOM   10120 C CB  . MET D 1 254 ? -30.101 27.568  18.075  1.00 22.60  ? 254 MET D CB  1 
ATOM   10121 C CG  . MET D 1 254 ? -30.505 28.385  16.916  1.00 25.07  ? 254 MET D CG  1 
ATOM   10122 S SD  . MET D 1 254 ? -30.618 30.086  17.423  1.00 28.31  ? 254 MET D SD  1 
ATOM   10123 C CE  . MET D 1 254 ? -28.766 30.424  17.665  1.00 24.78  ? 254 MET D CE  1 
ATOM   10124 N N   . ASN D 1 255 ? -32.054 25.094  18.351  1.00 28.86  ? 255 ASN D N   1 
ATOM   10125 C CA  . ASN D 1 255 ? -33.022 24.129  17.762  1.00 28.81  ? 255 ASN D CA  1 
ATOM   10126 C C   . ASN D 1 255 ? -33.941 23.483  18.799  1.00 32.01  ? 255 ASN D C   1 
ATOM   10127 O O   . ASN D 1 255 ? -33.600 22.486  19.430  1.00 33.16  ? 255 ASN D O   1 
ATOM   10128 C CB  . ASN D 1 255 ? -32.309 23.026  16.947  1.00 26.62  ? 255 ASN D CB  1 
ATOM   10129 C CG  . ASN D 1 255 ? -33.265 21.914  16.449  1.00 35.53  ? 255 ASN D CG  1 
ATOM   10130 O OD1 . ASN D 1 255 ? -34.509 22.024  16.551  1.00 20.82  ? 255 ASN D OD1 1 
ATOM   10131 N ND2 . ASN D 1 255 ? -32.675 20.869  15.826  1.00 15.76  ? 255 ASN D ND2 1 
ATOM   10132 N N   . SER D 1 256 ? -35.177 23.944  18.819  1.00 27.22  ? 256 SER D N   1 
ATOM   10133 C CA  . SER D 1 256 ? -36.189 23.427  19.724  1.00 25.67  ? 256 SER D CA  1 
ATOM   10134 C C   . SER D 1 256 ? -36.640 21.989  19.566  1.00 27.70  ? 256 SER D C   1 
ATOM   10135 O O   . SER D 1 256 ? -37.391 21.515  20.423  1.00 28.19  ? 256 SER D O   1 
ATOM   10136 C CB  . SER D 1 256 ? -37.418 24.306  19.614  1.00 28.71  ? 256 SER D CB  1 
ATOM   10137 O OG  . SER D 1 256 ? -38.340 23.734  18.701  1.00 39.76  ? 256 SER D OG  1 
ATOM   10138 N N   . LYS D 1 257 ? -36.286 21.338  18.448  1.00 23.24  ? 257 LYS D N   1 
ATOM   10139 C CA  . LYS D 1 257 ? -36.739 19.964  18.173  1.00 22.50  ? 257 LYS D CA  1 
ATOM   10140 C C   . LYS D 1 257 ? -35.989 18.925  18.947  1.00 26.72  ? 257 LYS D C   1 
ATOM   10141 O O   . LYS D 1 257 ? -36.454 17.790  19.058  1.00 29.10  ? 257 LYS D O   1 
ATOM   10142 C CB  . LYS D 1 257 ? -36.709 19.618  16.678  1.00 25.02  ? 257 LYS D CB  1 
ATOM   10143 C CG  . LYS D 1 257 ? -37.691 20.425  15.848  1.00 35.15  ? 257 LYS D CG  1 
ATOM   10144 C CD  . LYS D 1 257 ? -37.695 19.997  14.405  1.00 47.06  ? 257 LYS D CD  1 
ATOM   10145 C CE  . LYS D 1 257 ? -38.379 21.047  13.530  1.00 60.13  ? 257 LYS D CE  1 
ATOM   10146 N NZ  . LYS D 1 257 ? -39.068 20.453  12.332  1.00 60.48  ? 257 LYS D NZ  1 
ATOM   10147 N N   . ARG D 1 258 ? -34.797 19.295  19.423  1.00 20.96  ? 258 ARG D N   1 
ATOM   10148 C CA  . ARG D 1 258 ? -33.981 18.395  20.254  1.00 19.38  ? 258 ARG D CA  1 
ATOM   10149 C C   . ARG D 1 258 ? -33.661 19.093  21.578  1.00 21.61  ? 258 ARG D C   1 
ATOM   10150 O O   . ARG D 1 258 ? -33.493 20.289  21.617  1.00 22.19  ? 258 ARG D O   1 
ATOM   10151 C CB  . ARG D 1 258 ? -32.697 17.966  19.543  1.00 12.85  ? 258 ARG D CB  1 
ATOM   10152 C CG  . ARG D 1 258 ? -32.938 17.325  18.245  1.00 9.09   ? 258 ARG D CG  1 
ATOM   10153 C CD  . ARG D 1 258 ? -31.633 17.038  17.540  1.00 12.02  ? 258 ARG D CD  1 
ATOM   10154 N NE  . ARG D 1 258 ? -31.884 16.574  16.182  1.00 24.70  ? 258 ARG D NE  1 
ATOM   10155 C CZ  . ARG D 1 258 ? -32.130 15.316  15.866  1.00 38.91  ? 258 ARG D CZ  1 
ATOM   10156 N NH1 . ARG D 1 258 ? -32.080 14.391  16.826  1.00 31.25  ? 258 ARG D NH1 1 
ATOM   10157 N NH2 . ARG D 1 258 ? -32.389 14.997  14.589  1.00 19.19  ? 258 ARG D NH2 1 
ATOM   10158 N N   . GLN D 1 259 ? -33.684 18.347  22.665  1.00 17.00  ? 259 GLN D N   1 
ATOM   10159 C CA  . GLN D 1 259 ? -33.418 18.897  23.985  1.00 16.13  ? 259 GLN D CA  1 
ATOM   10160 C C   . GLN D 1 259 ? -31.943 18.564  24.317  1.00 22.05  ? 259 GLN D C   1 
ATOM   10161 O O   . GLN D 1 259 ? -31.440 17.512  23.915  1.00 24.56  ? 259 GLN D O   1 
ATOM   10162 C CB  . GLN D 1 259 ? -34.417 18.252  24.951  1.00 17.40  ? 259 GLN D CB  1 
ATOM   10163 C CG  . GLN D 1 259 ? -34.525 18.857  26.351  1.00 52.30  ? 259 GLN D CG  1 
ATOM   10164 C CD  . GLN D 1 259 ? -34.952 20.315  26.378  1.00 65.24  ? 259 GLN D CD  1 
ATOM   10165 O OE1 . GLN D 1 259 ? -34.712 21.024  27.371  1.00 50.49  ? 259 GLN D OE1 1 
ATOM   10166 N NE2 . GLN D 1 259 ? -35.529 20.793  25.265  1.00 54.79  ? 259 GLN D NE2 1 
ATOM   10167 N N   . ARG D 1 260 ? -31.177 19.502  24.878  1.00 14.68  ? 260 ARG D N   1 
ATOM   10168 C CA  . ARG D 1 260 ? -29.765 19.175  25.107  1.00 13.22  ? 260 ARG D CA  1 
ATOM   10169 C C   . ARG D 1 260 ? -29.486 17.817  25.778  1.00 18.61  ? 260 ARG D C   1 
ATOM   10170 O O   . ARG D 1 260 ? -30.375 17.173  26.343  1.00 22.23  ? 260 ARG D O   1 
ATOM   10171 C CB  . ARG D 1 260 ? -29.003 20.300  25.857  1.00 7.77   ? 260 ARG D CB  1 
ATOM   10172 C CG  . ARG D 1 260 ? -27.486 20.208  25.615  1.00 7.30   ? 260 ARG D CG  1 
ATOM   10173 C CD  . ARG D 1 260 ? -26.669 21.446  25.962  1.00 11.06  ? 260 ARG D CD  1 
ATOM   10174 N NE  . ARG D 1 260 ? -26.901 22.513  25.022  1.00 18.92  ? 260 ARG D NE  1 
ATOM   10175 C CZ  . ARG D 1 260 ? -27.699 23.541  25.256  1.00 29.38  ? 260 ARG D CZ  1 
ATOM   10176 N NH1 . ARG D 1 260 ? -28.329 23.606  26.412  1.00 28.44  ? 260 ARG D NH1 1 
ATOM   10177 N NH2 . ARG D 1 260 ? -27.876 24.479  24.340  1.00 14.98  ? 260 ARG D NH2 1 
ATOM   10178 N N   . ILE D 1 261 ? -28.237 17.391  25.702  1.00 12.61  ? 261 ILE D N   1 
ATOM   10179 C CA  . ILE D 1 261 ? -27.704 16.251  26.439  1.00 12.38  ? 261 ILE D CA  1 
ATOM   10180 C C   . ILE D 1 261 ? -26.275 16.643  26.828  1.00 17.87  ? 261 ILE D C   1 
ATOM   10181 O O   . ILE D 1 261 ? -25.568 17.305  26.047  1.00 19.74  ? 261 ILE D O   1 
ATOM   10182 C CB  . ILE D 1 261 ? -27.748 14.955  25.647  1.00 16.62  ? 261 ILE D CB  1 
ATOM   10183 C CG1 . ILE D 1 261 ? -29.180 14.731  25.118  1.00 17.90  ? 261 ILE D CG1 1 
ATOM   10184 C CG2 . ILE D 1 261 ? -27.268 13.750  26.510  1.00 14.44  ? 261 ILE D CG2 1 
ATOM   10185 C CD1 . ILE D 1 261 ? -29.400 13.341  24.617  1.00 24.23  ? 261 ILE D CD1 1 
ATOM   10186 N N   . VAL D 1 262 ? -25.929 16.419  28.097  1.00 12.85  ? 262 VAL D N   1 
ATOM   10187 C CA  . VAL D 1 262 ? -24.624 16.798  28.663  1.00 11.26  ? 262 VAL D CA  1 
ATOM   10188 C C   . VAL D 1 262 ? -24.018 15.568  29.345  1.00 19.77  ? 262 VAL D C   1 
ATOM   10189 O O   . VAL D 1 262 ? -24.645 14.910  30.185  1.00 18.69  ? 262 VAL D O   1 
ATOM   10190 C CB  . VAL D 1 262 ? -24.718 18.017  29.653  1.00 12.68  ? 262 VAL D CB  1 
ATOM   10191 C CG1 . VAL D 1 262 ? -23.382 18.437  30.153  1.00 11.55  ? 262 VAL D CG1 1 
ATOM   10192 C CG2 . VAL D 1 262 ? -25.373 19.244  29.013  1.00 11.76  ? 262 VAL D CG2 1 
ATOM   10193 N N   . ILE D 1 263 ? -22.805 15.226  28.940  1.00 19.15  ? 263 ILE D N   1 
ATOM   10194 C CA  . ILE D 1 263 ? -22.134 14.034  29.442  1.00 18.89  ? 263 ILE D CA  1 
ATOM   10195 C C   . ILE D 1 263 ? -20.739 14.448  29.884  1.00 21.18  ? 263 ILE D C   1 
ATOM   10196 O O   . ILE D 1 263 ? -20.050 15.174  29.181  1.00 20.89  ? 263 ILE D O   1 
ATOM   10197 C CB  . ILE D 1 263 ? -22.092 12.935  28.331  1.00 21.11  ? 263 ILE D CB  1 
ATOM   10198 C CG1 . ILE D 1 263 ? -23.453 12.272  28.237  1.00 20.51  ? 263 ILE D CG1 1 
ATOM   10199 C CG2 . ILE D 1 263 ? -21.037 11.921  28.603  1.00 19.87  ? 263 ILE D CG2 1 
ATOM   10200 C CD1 . ILE D 1 263 ? -23.542 11.288  27.160  1.00 19.51  ? 263 ILE D CD1 1 
ATOM   10201 N N   . PHE D 1 264 ? -20.404 14.083  31.115  1.00 15.72  ? 264 PHE D N   1 
ATOM   10202 C CA  . PHE D 1 264 ? -19.161 14.483  31.759  1.00 14.11  ? 264 PHE D CA  1 
ATOM   10203 C C   . PHE D 1 264 ? -18.452 13.257  32.307  1.00 21.88  ? 264 PHE D C   1 
ATOM   10204 O O   . PHE D 1 264 ? -18.988 12.497  33.089  1.00 20.32  ? 264 PHE D O   1 
ATOM   10205 C CB  . PHE D 1 264 ? -19.433 15.458  32.888  1.00 14.81  ? 264 PHE D CB  1 
ATOM   10206 C CG  . PHE D 1 264 ? -19.819 16.846  32.428  1.00 17.16  ? 264 PHE D CG  1 
ATOM   10207 C CD1 . PHE D 1 264 ? -19.295 17.398  31.251  1.00 20.63  ? 264 PHE D CD1 1 
ATOM   10208 C CD2 . PHE D 1 264 ? -20.662 17.643  33.216  1.00 20.11  ? 264 PHE D CD2 1 
ATOM   10209 C CE1 . PHE D 1 264 ? -19.655 18.717  30.831  1.00 20.80  ? 264 PHE D CE1 1 
ATOM   10210 C CE2 . PHE D 1 264 ? -21.020 18.955  32.820  1.00 22.90  ? 264 PHE D CE2 1 
ATOM   10211 C CZ  . PHE D 1 264 ? -20.520 19.483  31.607  1.00 20.45  ? 264 PHE D CZ  1 
ATOM   10212 N N   . THR D 1 265 ? -17.245 13.022  31.824  1.00 22.76  ? 265 THR D N   1 
ATOM   10213 C CA  . THR D 1 265 ? -16.500 11.867  32.261  1.00 22.74  ? 265 THR D CA  1 
ATOM   10214 C C   . THR D 1 265 ? -15.706 12.272  33.476  1.00 22.47  ? 265 THR D C   1 
ATOM   10215 O O   . THR D 1 265 ? -15.371 13.447  33.627  1.00 18.83  ? 265 THR D O   1 
ATOM   10216 C CB  . THR D 1 265 ? -15.597 11.317  31.143  1.00 28.44  ? 265 THR D CB  1 
ATOM   10217 O OG1 . THR D 1 265 ? -14.775 12.377  30.607  1.00 25.98  ? 265 THR D OG1 1 
ATOM   10218 C CG2 . THR D 1 265 ? -16.473 10.760  30.075  1.00 22.43  ? 265 THR D CG2 1 
ATOM   10219 N N   . GLN D 1 266 ? -15.409 11.289  34.322  1.00 18.55  ? 266 GLN D N   1 
ATOM   10220 C CA  . GLN D 1 266 ? -14.765 11.543  35.608  1.00 17.29  ? 266 GLN D CA  1 
ATOM   10221 C C   . GLN D 1 266 ? -13.680 10.521  35.890  1.00 21.04  ? 266 GLN D C   1 
ATOM   10222 O O   . GLN D 1 266 ? -13.470 10.130  37.014  1.00 21.33  ? 266 GLN D O   1 
ATOM   10223 C CB  . GLN D 1 266 ? -15.814 11.498  36.720  1.00 18.57  ? 266 GLN D CB  1 
ATOM   10224 C CG  . GLN D 1 266 ? -16.933 12.592  36.702  1.00 22.81  ? 266 GLN D CG  1 
ATOM   10225 C CD  . GLN D 1 266 ? -17.692 12.657  38.050  1.00 37.63  ? 266 GLN D CD  1 
ATOM   10226 O OE1 . GLN D 1 266 ? -18.360 11.697  38.468  1.00 28.49  ? 266 GLN D OE1 1 
ATOM   10227 N NE2 . GLN D 1 266 ? -17.502 13.757  38.761  1.00 28.64  ? 266 GLN D NE2 1 
ATOM   10228 N N   . GLY D 1 267 ? -12.970 10.097  34.861  1.00 19.29  ? 267 GLY D N   1 
ATOM   10229 C CA  . GLY D 1 267 ? -11.888 9.147   35.036  1.00 20.33  ? 267 GLY D CA  1 
ATOM   10230 C C   . GLY D 1 267 ? -12.376 7.759   35.412  1.00 28.51  ? 267 GLY D C   1 
ATOM   10231 O O   . GLY D 1 267 ? -12.938 7.034   34.590  1.00 27.68  ? 267 GLY D O   1 
ATOM   10232 N N   . ARG D 1 268 ? -12.110 7.374   36.660  1.00 27.97  ? 268 ARG D N   1 
ATOM   10233 C CA  . ARG D 1 268 ? -12.561 6.084   37.197  1.00 27.18  ? 268 ARG D CA  1 
ATOM   10234 C C   . ARG D 1 268 ? -13.892 6.314   37.943  1.00 31.99  ? 268 ARG D C   1 
ATOM   10235 O O   . ARG D 1 268 ? -14.642 5.368   38.232  1.00 31.37  ? 268 ARG D O   1 
ATOM   10236 C CB  . ARG D 1 268 ? -11.497 5.464   38.102  1.00 25.01  ? 268 ARG D CB  1 
ATOM   10237 C CG  . ARG D 1 268 ? -10.094 5.761   37.633  1.00 37.43  ? 268 ARG D CG  1 
ATOM   10238 C CD  . ARG D 1 268 ? -9.013  5.040   38.440  1.00 62.74  ? 268 ARG D CD  1 
ATOM   10239 N NE  . ARG D 1 268 ? -9.067  3.577   38.365  1.00 78.54  ? 268 ARG D NE  1 
ATOM   10240 C CZ  . ARG D 1 268 ? -8.751  2.781   39.386  1.00 97.31  ? 268 ARG D CZ  1 
ATOM   10241 N NH1 . ARG D 1 268 ? -8.343  3.306   40.537  1.00 83.22  ? 268 ARG D NH1 1 
ATOM   10242 N NH2 . ARG D 1 268 ? -8.848  1.466   39.276  1.00 88.54  ? 268 ARG D NH2 1 
ATOM   10243 N N   . ASP D 1 269 ? -14.236 7.579   38.166  1.00 26.79  ? 269 ASP D N   1 
ATOM   10244 C CA  . ASP D 1 269 ? -15.531 7.852   38.735  1.00 26.91  ? 269 ASP D CA  1 
ATOM   10245 C C   . ASP D 1 269 ? -16.632 7.811   37.680  1.00 28.50  ? 269 ASP D C   1 
ATOM   10246 O O   . ASP D 1 269 ? -16.360 7.765   36.475  1.00 27.92  ? 269 ASP D O   1 
ATOM   10247 C CB  . ASP D 1 269 ? -15.541 9.156   39.507  1.00 29.82  ? 269 ASP D CB  1 
ATOM   10248 C CG  . ASP D 1 269 ? -14.969 8.996   40.888  1.00 46.29  ? 269 ASP D CG  1 
ATOM   10249 O OD1 . ASP D 1 269 ? -15.161 7.894   41.456  1.00 45.51  ? 269 ASP D OD1 1 
ATOM   10250 O OD2 . ASP D 1 269 ? -14.376 9.971   41.412  1.00 59.06  ? 269 ASP D OD2 1 
ATOM   10251 N N   . ASP D 1 270 ? -17.874 7.728   38.157  1.00 22.28  ? 270 ASP D N   1 
ATOM   10252 C CA  . ASP D 1 270 ? -19.041 7.649   37.312  1.00 20.17  ? 270 ASP D CA  1 
ATOM   10253 C C   . ASP D 1 270 ? -19.102 8.767   36.258  1.00 28.66  ? 270 ASP D C   1 
ATOM   10254 O O   . ASP D 1 270 ? -18.693 9.912   36.517  1.00 31.26  ? 270 ASP D O   1 
ATOM   10255 C CB  . ASP D 1 270 ? -20.312 7.635   38.181  1.00 20.66  ? 270 ASP D CB  1 
ATOM   10256 C CG  . ASP D 1 270 ? -20.256 6.595   39.302  1.00 29.67  ? 270 ASP D CG  1 
ATOM   10257 O OD1 . ASP D 1 270 ? -19.662 5.503   39.116  1.00 32.58  ? 270 ASP D OD1 1 
ATOM   10258 O OD2 . ASP D 1 270 ? -20.758 6.873   40.406  1.00 31.91  ? 270 ASP D OD2 1 
ATOM   10259 N N   . THR D 1 271 ? -19.660 8.427   35.097  1.00 24.56  ? 271 THR D N   1 
ATOM   10260 C CA  . THR D 1 271 ? -19.920 9.363   34.002  1.00 23.36  ? 271 THR D CA  1 
ATOM   10261 C C   . THR D 1 271 ? -21.251 10.061  34.263  1.00 25.35  ? 271 THR D C   1 
ATOM   10262 O O   . THR D 1 271 ? -22.277 9.416   34.399  1.00 26.85  ? 271 THR D O   1 
ATOM   10263 C CB  . THR D 1 271 ? -20.118 8.571   32.691  1.00 25.88  ? 271 THR D CB  1 
ATOM   10264 O OG1 . THR D 1 271 ? -18.889 7.910   32.325  1.00 30.16  ? 271 THR D OG1 1 
ATOM   10265 C CG2 . THR D 1 271 ? -20.588 9.488   31.583  1.00 13.65  ? 271 THR D CG2 1 
ATOM   10266 N N   . ILE D 1 272 ? -21.261 11.379  34.299  1.00 19.59  ? 272 ILE D N   1 
ATOM   10267 C CA  . ILE D 1 272 ? -22.537 12.081  34.491  1.00 17.81  ? 272 ILE D CA  1 
ATOM   10268 C C   . ILE D 1 272 ? -23.257 12.405  33.163  1.00 20.59  ? 272 ILE D C   1 
ATOM   10269 O O   . ILE D 1 272 ? -22.656 12.935  32.218  1.00 17.86  ? 272 ILE D O   1 
ATOM   10270 C CB  . ILE D 1 272 ? -22.376 13.356  35.409  1.00 18.18  ? 272 ILE D CB  1 
ATOM   10271 C CG1 . ILE D 1 272 ? -22.184 12.957  36.870  1.00 16.28  ? 272 ILE D CG1 1 
ATOM   10272 C CG2 . ILE D 1 272 ? -23.594 14.263  35.339  1.00 16.31  ? 272 ILE D CG2 1 
ATOM   10273 C CD1 . ILE D 1 272 ? -21.252 11.852  37.094  1.00 20.84  ? 272 ILE D CD1 1 
ATOM   10274 N N   . MET D 1 273 ? -24.561 12.139  33.122  1.00 20.49  ? 273 MET D N   1 
ATOM   10275 C CA  . MET D 1 273 ? -25.408 12.523  31.978  1.00 22.12  ? 273 MET D CA  1 
ATOM   10276 C C   . MET D 1 273 ? -26.615 13.269  32.479  1.00 26.44  ? 273 MET D C   1 
ATOM   10277 O O   . MET D 1 273 ? -27.325 12.777  33.334  1.00 25.36  ? 273 MET D O   1 
ATOM   10278 C CB  . MET D 1 273 ? -25.887 11.324  31.136  1.00 25.06  ? 273 MET D CB  1 
ATOM   10279 C CG  . MET D 1 273 ? -26.569 11.711  29.801  1.00 30.04  ? 273 MET D CG  1 
ATOM   10280 S SD  . MET D 1 273 ? -27.680 10.448  29.124  1.00 37.08  ? 273 MET D SD  1 
ATOM   10281 C CE  . MET D 1 273 ? -26.635 9.540   28.030  1.00 34.42  ? 273 MET D CE  1 
ATOM   10282 N N   . ALA D 1 274 ? -26.861 14.430  31.882  1.00 24.52  ? 274 ALA D N   1 
ATOM   10283 C CA  . ALA D 1 274 ? -28.006 15.252  32.173  1.00 23.31  ? 274 ALA D CA  1 
ATOM   10284 C C   . ALA D 1 274 ? -28.855 15.376  30.905  1.00 29.54  ? 274 ALA D C   1 
ATOM   10285 O O   . ALA D 1 274 ? -28.369 15.800  29.861  1.00 27.80  ? 274 ALA D O   1 
ATOM   10286 C CB  . ALA D 1 274 ? -27.547 16.621  32.609  1.00 23.48  ? 274 ALA D CB  1 
ATOM   10287 N N   . THR D 1 275 ? -30.149 15.105  31.052  1.00 27.64  ? 275 THR D N   1 
ATOM   10288 C CA  . THR D 1 275 ? -31.139 15.315  29.998  1.00 27.95  ? 275 THR D CA  1 
ATOM   10289 C C   . THR D 1 275 ? -32.208 16.284  30.526  1.00 30.55  ? 275 THR D C   1 
ATOM   10290 O O   . THR D 1 275 ? -32.064 16.842  31.626  1.00 29.06  ? 275 THR D O   1 
ATOM   10291 C CB  . THR D 1 275 ? -31.809 14.000  29.597  1.00 34.46  ? 275 THR D CB  1 
ATOM   10292 O OG1 . THR D 1 275 ? -32.594 13.522  30.700  1.00 41.45  ? 275 THR D OG1 1 
ATOM   10293 C CG2 . THR D 1 275 ? -30.741 12.955  29.243  1.00 26.41  ? 275 THR D CG2 1 
ATOM   10294 N N   . GLU D 1 276 ? -33.245 16.500  29.720  1.00 26.73  ? 276 GLU D N   1 
ATOM   10295 C CA  . GLU D 1 276 ? -34.302 17.446  30.070  1.00 27.93  ? 276 GLU D CA  1 
ATOM   10296 C C   . GLU D 1 276 ? -35.007 16.972  31.340  1.00 34.89  ? 276 GLU D C   1 
ATOM   10297 O O   . GLU D 1 276 ? -35.314 17.779  32.221  1.00 32.56  ? 276 GLU D O   1 
ATOM   10298 C CB  . GLU D 1 276 ? -35.294 17.612  28.916  1.00 28.88  ? 276 GLU D CB  1 
ATOM   10299 C CG  . GLU D 1 276 ? -36.334 18.699  29.145  1.00 47.20  ? 276 GLU D CG  1 
ATOM   10300 C CD  . GLU D 1 276 ? -37.699 18.340  28.592  1.00 82.50  ? 276 GLU D CD  1 
ATOM   10301 O OE1 . GLU D 1 276 ? -37.805 18.126  27.358  1.00 71.87  ? 276 GLU D OE1 1 
ATOM   10302 O OE2 . GLU D 1 276 ? -38.667 18.283  29.382  1.00 91.60  ? 276 GLU D OE2 1 
ATOM   10303 N N   . SER D 1 277 ? -35.183 15.645  31.426  1.00 33.87  ? 277 SER D N   1 
ATOM   10304 C CA  . SER D 1 277 ? -35.807 14.946  32.552  1.00 34.26  ? 277 SER D CA  1 
ATOM   10305 C C   . SER D 1 277 ? -34.906 14.949  33.780  1.00 43.27  ? 277 SER D C   1 
ATOM   10306 O O   . SER D 1 277 ? -35.327 15.372  34.855  1.00 43.84  ? 277 SER D O   1 
ATOM   10307 C CB  . SER D 1 277 ? -36.112 13.474  32.234  1.00 35.67  ? 277 SER D CB  1 
ATOM   10308 O OG  . SER D 1 277 ? -36.604 13.291  30.931  1.00 46.60  ? 277 SER D OG  1 
ATOM   10309 N N   . GLU D 1 278 ? -33.692 14.415  33.661  1.00 41.26  ? 278 GLU D N   1 
ATOM   10310 C CA  . GLU D 1 278 ? -32.830 14.360  34.844  1.00 40.99  ? 278 GLU D CA  1 
ATOM   10311 C C   . GLU D 1 278 ? -31.319 14.424  34.663  1.00 37.91  ? 278 GLU D C   1 
ATOM   10312 O O   . GLU D 1 278 ? -30.796 14.954  33.675  1.00 36.75  ? 278 GLU D O   1 
ATOM   10313 C CB  . GLU D 1 278 ? -33.168 13.121  35.668  1.00 43.21  ? 278 GLU D CB  1 
ATOM   10314 C CG  . GLU D 1 278 ? -34.496 13.228  36.403  1.00 67.15  ? 278 GLU D CG  1 
ATOM   10315 C CD  . GLU D 1 278 ? -34.686 12.107  37.409  1.00 113.42 ? 278 GLU D CD  1 
ATOM   10316 O OE1 . GLU D 1 278 ? -33.665 11.532  37.852  1.00 122.77 ? 278 GLU D OE1 1 
ATOM   10317 O OE2 . GLU D 1 278 ? -35.849 11.722  37.667  1.00 113.57 ? 278 GLU D OE2 1 
ATOM   10318 N N   . VAL D 1 279 ? -30.652 13.881  35.674  1.00 29.54  ? 279 VAL D N   1 
ATOM   10319 C CA  . VAL D 1 279 ? -29.211 13.771  35.747  1.00 27.88  ? 279 VAL D CA  1 
ATOM   10320 C C   . VAL D 1 279 ? -28.955 12.351  36.285  1.00 32.39  ? 279 VAL D C   1 
ATOM   10321 O O   . VAL D 1 279 ? -29.636 11.908  37.211  1.00 32.26  ? 279 VAL D O   1 
ATOM   10322 C CB  . VAL D 1 279 ? -28.673 14.816  36.703  1.00 31.36  ? 279 VAL D CB  1 
ATOM   10323 C CG1 . VAL D 1 279 ? -27.437 14.341  37.391  1.00 31.88  ? 279 VAL D CG1 1 
ATOM   10324 C CG2 . VAL D 1 279 ? -28.462 16.139  35.989  1.00 30.79  ? 279 VAL D CG2 1 
ATOM   10325 N N   . THR D 1 280 ? -28.081 11.587  35.629  1.00 29.09  ? 280 THR D N   1 
ATOM   10326 C CA  . THR D 1 280 ? -27.820 10.214  36.061  1.00 27.63  ? 280 THR D CA  1 
ATOM   10327 C C   . THR D 1 280 ? -26.354 9.854   35.993  1.00 31.04  ? 280 THR D C   1 
ATOM   10328 O O   . THR D 1 280 ? -25.623 10.347  35.140  1.00 33.85  ? 280 THR D O   1 
ATOM   10329 C CB  . THR D 1 280 ? -28.572 9.160   35.270  1.00 29.69  ? 280 THR D CB  1 
ATOM   10330 O OG1 . THR D 1 280 ? -29.982 9.292   35.503  1.00 24.73  ? 280 THR D OG1 1 
ATOM   10331 C CG2 . THR D 1 280 ? -28.116 7.790   35.761  1.00 26.33  ? 280 THR D CG2 1 
ATOM   10332 N N   . ALA D 1 281 ? -25.928 8.960   36.871  1.00 22.72  ? 281 ALA D N   1 
ATOM   10333 C CA  . ALA D 1 281 ? -24.555 8.569   36.915  1.00 20.68  ? 281 ALA D CA  1 
ATOM   10334 C C   . ALA D 1 281 ? -24.427 7.180   36.286  1.00 24.50  ? 281 ALA D C   1 
ATOM   10335 O O   . ALA D 1 281 ? -25.377 6.409   36.284  1.00 27.07  ? 281 ALA D O   1 
ATOM   10336 C CB  . ALA D 1 281 ? -24.094 8.565   38.359  1.00 21.17  ? 281 ALA D CB  1 
ATOM   10337 N N   . PHE D 1 282 ? -23.263 6.867   35.729  1.00 18.43  ? 282 PHE D N   1 
ATOM   10338 C CA  . PHE D 1 282 ? -23.033 5.577   35.124  1.00 17.55  ? 282 PHE D CA  1 
ATOM   10339 C C   . PHE D 1 282 ? -21.650 5.144   35.563  1.00 24.88  ? 282 PHE D C   1 
ATOM   10340 O O   . PHE D 1 282 ? -20.672 5.852   35.338  1.00 24.45  ? 282 PHE D O   1 
ATOM   10341 C CB  . PHE D 1 282 ? -23.115 5.658   33.584  1.00 18.37  ? 282 PHE D CB  1 
ATOM   10342 C CG  . PHE D 1 282 ? -24.495 6.007   33.057  1.00 19.56  ? 282 PHE D CG  1 
ATOM   10343 C CD1 . PHE D 1 282 ? -25.374 4.996   32.640  1.00 21.08  ? 282 PHE D CD1 1 
ATOM   10344 C CD2 . PHE D 1 282 ? -24.949 7.327   32.993  1.00 20.34  ? 282 PHE D CD2 1 
ATOM   10345 C CE1 . PHE D 1 282 ? -26.644 5.282   32.164  1.00 18.82  ? 282 PHE D CE1 1 
ATOM   10346 C CE2 . PHE D 1 282 ? -26.231 7.597   32.461  1.00 22.07  ? 282 PHE D CE2 1 
ATOM   10347 C CZ  . PHE D 1 282 ? -27.050 6.564   32.038  1.00 17.31  ? 282 PHE D CZ  1 
ATOM   10348 N N   . ALA D 1 283 ? -21.578 3.958   36.153  1.00 23.84  ? 283 ALA D N   1 
ATOM   10349 C CA  . ALA D 1 283 ? -20.321 3.393   36.615  1.00 25.86  ? 283 ALA D CA  1 
ATOM   10350 C C   . ALA D 1 283 ? -19.388 2.927   35.502  1.00 34.28  ? 283 ALA D C   1 
ATOM   10351 O O   . ALA D 1 283 ? -19.801 2.208   34.604  1.00 35.39  ? 283 ALA D O   1 
ATOM   10352 C CB  . ALA D 1 283 ? -20.589 2.240   37.544  1.00 26.73  ? 283 ALA D CB  1 
ATOM   10353 N N   . VAL D 1 284 ? -18.098 3.230   35.638  1.00 33.05  ? 284 VAL D N   1 
ATOM   10354 C CA  . VAL D 1 284 ? -17.102 2.774   34.676  1.00 34.05  ? 284 VAL D CA  1 
ATOM   10355 C C   . VAL D 1 284 ? -16.730 1.301   34.778  1.00 43.22  ? 284 VAL D C   1 
ATOM   10356 O O   . VAL D 1 284 ? -16.470 0.798   35.861  1.00 39.83  ? 284 VAL D O   1 
ATOM   10357 C CB  . VAL D 1 284 ? -15.804 3.563   34.725  1.00 37.23  ? 284 VAL D CB  1 
ATOM   10358 C CG1 . VAL D 1 284 ? -15.052 3.309   33.465  1.00 37.56  ? 284 VAL D CG1 1 
ATOM   10359 C CG2 . VAL D 1 284 ? -16.060 5.013   34.861  1.00 36.84  ? 284 VAL D CG2 1 
ATOM   10360 N N   . LEU D 1 285 ? -16.637 0.649   33.614  1.00 47.87  ? 285 LEU D N   1 
ATOM   10361 C CA  . LEU D 1 285 ? -16.292 -0.768  33.499  1.00 50.63  ? 285 LEU D CA  1 
ATOM   10362 C C   . LEU D 1 285 ? -15.094 -1.095  34.388  1.00 63.82  ? 285 LEU D C   1 
ATOM   10363 O O   . LEU D 1 285 ? -14.047 -0.445  34.286  1.00 65.28  ? 285 LEU D O   1 
ATOM   10364 C CB  . LEU D 1 285 ? -15.892 -1.078  32.053  1.00 50.77  ? 285 LEU D CB  1 
ATOM   10365 C CG  . LEU D 1 285 ? -16.857 -1.498  30.933  1.00 56.30  ? 285 LEU D CG  1 
ATOM   10366 C CD1 . LEU D 1 285 ? -16.033 -1.991  29.710  1.00 55.81  ? 285 LEU D CD1 1 
ATOM   10367 C CD2 . LEU D 1 285 ? -17.844 -2.593  31.396  1.00 60.61  ? 285 LEU D CD2 1 
ATOM   10368 N N   . ASP D 1 286 ? -15.212 -2.152  35.189  1.00 64.55  ? 286 ASP D N   1 
ATOM   10369 C CA  . ASP D 1 286 ? -14.117 -2.565  36.077  1.00 65.32  ? 286 ASP D CA  1 
ATOM   10370 C C   . ASP D 1 286 ? -12.802 -2.927  35.390  1.00 70.30  ? 286 ASP D C   1 
ATOM   10371 O O   . ASP D 1 286 ? -12.288 -4.034  35.549  1.00 69.60  ? 286 ASP D O   1 
ATOM   10372 C CB  . ASP D 1 286 ? -14.578 -3.685  37.006  1.00 67.36  ? 286 ASP D CB  1 
ATOM   10373 C CG  . ASP D 1 286 ? -15.470 -3.172  38.109  1.00 75.90  ? 286 ASP D CG  1 
ATOM   10374 O OD1 . ASP D 1 286 ? -14.917 -2.631  39.094  1.00 75.97  ? 286 ASP D OD1 1 
ATOM   10375 O OD2 . ASP D 1 286 ? -16.705 -3.120  37.898  1.00 79.97  ? 286 ASP D OD2 1 
ATOM   10376 N N   . GLN D 1 287 ? -12.250 -1.966  34.662  1.00 69.38  ? 287 GLN D N   1 
ATOM   10377 C CA  . GLN D 1 287 ? -10.985 -2.148  33.955  1.00 70.81  ? 287 GLN D CA  1 
ATOM   10378 C C   . GLN D 1 287 ? -9.846  -1.838  34.917  1.00 76.22  ? 287 GLN D C   1 
ATOM   10379 O O   . GLN D 1 287 ? -8.855  -1.190  34.539  1.00 75.75  ? 287 GLN D O   1 
ATOM   10380 C CB  . GLN D 1 287 ? -10.926 -1.175  32.770  1.00 72.96  ? 287 GLN D CB  1 
ATOM   10381 C CG  . GLN D 1 287 ? -11.297 0.274   33.141  1.00 93.54  ? 287 GLN D CG  1 
ATOM   10382 C CD  . GLN D 1 287 ? -11.486 1.170   31.927  1.00 118.24 ? 287 GLN D CD  1 
ATOM   10383 O OE1 . GLN D 1 287 ? -10.515 1.655   31.343  1.00 119.08 ? 287 GLN D OE1 1 
ATOM   10384 N NE2 . GLN D 1 287 ? -12.742 1.407   31.552  1.00 106.22 ? 287 GLN D NE2 1 
ATOM   10385 N N   . ASP D 1 288 ? -10.011 -2.253  36.173  1.00 74.05  ? 288 ASP D N   1 
ATOM   10386 C CA  . ASP D 1 288 ? -9.015  -1.954  37.211  1.00 74.04  ? 288 ASP D CA  1 
ATOM   10387 C C   . ASP D 1 288 ? -7.587  -2.377  36.821  1.00 77.42  ? 288 ASP D C   1 
ATOM   10388 O O   . ASP D 1 288 ? -7.381  -2.876  35.702  1.00 77.18  ? 288 ASP D O   1 
ATOM   10389 C CB  . ASP D 1 288 ? -9.454  -2.501  38.581  1.00 75.83  ? 288 ASP D CB  1 
ATOM   10390 C CG  . ASP D 1 288 ? -10.906 -2.165  38.905  1.00 85.34  ? 288 ASP D CG  1 
ATOM   10391 O OD1 . ASP D 1 288 ? -11.303 -0.978  38.777  1.00 85.17  ? 288 ASP D OD1 1 
ATOM   10392 O OD2 . ASP D 1 288 ? -11.663 -3.096  39.247  1.00 92.39  ? 288 ASP D OD2 1 
ATOM   10393 N N   . GLN D 1 289 ? -6.614  -2.101  37.705  1.00 72.84  ? 289 GLN D N   1 
ATOM   10394 C CA  . GLN D 1 289 ? -5.192  -2.463  37.512  1.00 71.77  ? 289 GLN D CA  1 
ATOM   10395 C C   . GLN D 1 289 ? -4.515  -1.848  36.275  1.00 74.27  ? 289 GLN D C   1 
ATOM   10396 O O   . GLN D 1 289 ? -3.309  -2.052  36.037  1.00 72.66  ? 289 GLN D O   1 
ATOM   10397 C CB  . GLN D 1 289 ? -4.991  -3.997  37.556  1.00 72.79  ? 289 GLN D CB  1 
ATOM   10398 C CG  . GLN D 1 289 ? -5.621  -4.754  36.381  1.00 91.29  ? 289 GLN D CG  1 
ATOM   10399 C CD  . GLN D 1 289 ? -5.381  -6.251  36.414  1.00 113.59 ? 289 GLN D CD  1 
ATOM   10400 O OE1 . GLN D 1 289 ? -4.323  -6.727  35.998  1.00 107.91 ? 289 GLN D OE1 1 
ATOM   10401 N NE2 . GLN D 1 289 ? -6.408  -7.010  36.786  1.00 107.41 ? 289 GLN D NE2 1 
ATOM   10402 N N   . LYS D 1 290 ? -5.304  -1.076  35.521  1.00 71.00  ? 290 LYS D N   1 
ATOM   10403 C CA  . LYS D 1 290 ? -4.884  -0.433  34.270  1.00 70.56  ? 290 LYS D CA  1 
ATOM   10404 C C   . LYS D 1 290 ? -3.769  0.614   34.417  1.00 73.75  ? 290 LYS D C   1 
ATOM   10405 O O   . LYS D 1 290 ? -3.051  0.903   33.447  1.00 72.95  ? 290 LYS D O   1 
ATOM   10406 C CB  . LYS D 1 290 ? -6.102  0.164   33.544  1.00 73.76  ? 290 LYS D CB  1 
ATOM   10407 C CG  . LYS D 1 290 ? -7.032  1.018   34.429  1.00 94.25  ? 290 LYS D CG  1 
ATOM   10408 C CD  . LYS D 1 290 ? -6.255  2.059   35.254  1.00 104.66 ? 290 LYS D CD  1 
ATOM   10409 C CE  . LYS D 1 290 ? -7.166  2.875   36.167  1.00 111.84 ? 290 LYS D CE  1 
ATOM   10410 N NZ  . LYS D 1 290 ? -8.562  2.953   35.633  1.00 118.82 ? 290 LYS D NZ  1 
ATOM   10411 N N   . GLU D 1 291 ? -3.640  1.174   35.625  1.00 69.77  ? 291 GLU D N   1 
ATOM   10412 C CA  . GLU D 1 291 ? -2.601  2.159   35.963  1.00 69.75  ? 291 GLU D CA  1 
ATOM   10413 C C   . GLU D 1 291 ? -2.159  3.141   34.849  1.00 73.21  ? 291 GLU D C   1 
ATOM   10414 O O   . GLU D 1 291 ? -2.607  4.301   34.811  1.00 71.96  ? 291 GLU D O   1 
ATOM   10415 C CB  . GLU D 1 291 ? -1.389  1.476   36.634  1.00 71.46  ? 291 GLU D CB  1 
ATOM   10416 C CG  . GLU D 1 291 ? -0.664  0.435   35.758  1.00 86.42  ? 291 GLU D CG  1 
ATOM   10417 C CD  . GLU D 1 291 ? 0.668   -0.032  36.347  1.00 111.43 ? 291 GLU D CD  1 
ATOM   10418 O OE1 . GLU D 1 291 ? 1.667   0.725   36.284  1.00 107.76 ? 291 GLU D OE1 1 
ATOM   10419 O OE2 . GLU D 1 291 ? 0.722   -1.192  36.814  1.00 102.87 ? 291 GLU D OE2 1 
ATOM   10420 N N   . ILE D 1 292 ? -1.228  2.692   34.002  1.00 69.52  ? 292 ILE D N   1 
ATOM   10421 C CA  . ILE D 1 292 ? -0.713  3.504   32.899  1.00 68.93  ? 292 ILE D CA  1 
ATOM   10422 C C   . ILE D 1 292 ? -1.804  3.658   31.831  1.00 71.40  ? 292 ILE D C   1 
ATOM   10423 O O   . ILE D 1 292 ? -1.740  3.043   30.753  1.00 71.12  ? 292 ILE D O   1 
ATOM   10424 C CB  . ILE D 1 292 ? 0.562   2.874   32.254  1.00 72.18  ? 292 ILE D CB  1 
ATOM   10425 C CG1 . ILE D 1 292 ? 1.681   2.691   33.282  1.00 72.38  ? 292 ILE D CG1 1 
ATOM   10426 C CG2 . ILE D 1 292 ? 1.081   3.733   31.100  1.00 74.15  ? 292 ILE D CG2 1 
ATOM   10427 C CD1 . ILE D 1 292 ? 2.890   1.947   32.723  1.00 77.73  ? 292 ILE D CD1 1 
ATOM   10428 N N   . ILE D 1 293 ? -2.823  4.449   32.168  1.00 65.33  ? 293 ILE D N   1 
ATOM   10429 C CA  . ILE D 1 293 ? -3.897  4.759   31.234  1.00 62.96  ? 293 ILE D CA  1 
ATOM   10430 C C   . ILE D 1 293 ? -3.789  6.254   30.960  1.00 63.45  ? 293 ILE D C   1 
ATOM   10431 O O   . ILE D 1 293 ? -3.546  7.061   31.877  1.00 63.52  ? 293 ILE D O   1 
ATOM   10432 C CB  . ILE D 1 293 ? -5.305  4.455   31.814  1.00 64.65  ? 293 ILE D CB  1 
ATOM   10433 C CG1 . ILE D 1 293 ? -5.340  4.800   33.302  1.00 64.43  ? 293 ILE D CG1 1 
ATOM   10434 C CG2 . ILE D 1 293 ? -5.731  3.008   31.518  1.00 63.19  ? 293 ILE D CG2 1 
ATOM   10435 C CD1 . ILE D 1 293 ? -6.721  4.718   33.923  1.00 74.51  ? 293 ILE D CD1 1 
ATOM   10436 N N   . ASP D 1 294 ? -3.879  6.594   29.678  1.00 55.10  ? 294 ASP D N   1 
ATOM   10437 C CA  . ASP D 1 294 ? -3.870  7.972   29.228  1.00 51.80  ? 294 ASP D CA  1 
ATOM   10438 C C   . ASP D 1 294 ? -5.314  8.418   29.477  1.00 49.67  ? 294 ASP D C   1 
ATOM   10439 O O   . ASP D 1 294 ? -6.234  7.859   28.891  1.00 50.12  ? 294 ASP D O   1 
ATOM   10440 C CB  . ASP D 1 294 ? -3.515  8.002   27.730  1.00 52.95  ? 294 ASP D CB  1 
ATOM   10441 C CG  . ASP D 1 294 ? -3.294  9.409   27.201  1.00 57.28  ? 294 ASP D CG  1 
ATOM   10442 O OD1 . ASP D 1 294 ? -2.935  9.544   26.003  1.00 55.11  ? 294 ASP D OD1 1 
ATOM   10443 O OD2 . ASP D 1 294 ? -3.617  10.374  27.934  1.00 59.61  ? 294 ASP D OD2 1 
ATOM   10444 N N   . THR D 1 295 ? -5.522  9.311   30.442  1.00 39.90  ? 295 THR D N   1 
ATOM   10445 C CA  . THR D 1 295 ? -6.875  9.777   30.782  1.00 36.68  ? 295 THR D CA  1 
ATOM   10446 C C   . THR D 1 295 ? -7.489  10.659  29.680  1.00 35.45  ? 295 THR D C   1 
ATOM   10447 O O   . THR D 1 295 ? -8.724  10.734  29.518  1.00 32.22  ? 295 THR D O   1 
ATOM   10448 C CB  . THR D 1 295 ? -6.854  10.536  32.082  1.00 41.01  ? 295 THR D CB  1 
ATOM   10449 O OG1 . THR D 1 295 ? -6.494  9.640   33.129  1.00 44.73  ? 295 THR D OG1 1 
ATOM   10450 C CG2 . THR D 1 295 ? -8.176  11.115  32.371  1.00 42.52  ? 295 THR D CG2 1 
ATOM   10451 N N   . ASN D 1 296 ? -6.608  11.290  28.902  1.00 30.15  ? 296 ASN D N   1 
ATOM   10452 C CA  . ASN D 1 296 ? -7.012  12.086  27.747  1.00 28.22  ? 296 ASN D CA  1 
ATOM   10453 C C   . ASN D 1 296 ? -7.314  11.202  26.549  1.00 28.87  ? 296 ASN D C   1 
ATOM   10454 O O   . ASN D 1 296 ? -8.243  11.455  25.808  1.00 32.21  ? 296 ASN D O   1 
ATOM   10455 C CB  . ASN D 1 296 ? -5.946  13.114  27.384  1.00 25.57  ? 296 ASN D CB  1 
ATOM   10456 C CG  . ASN D 1 296 ? -5.608  13.992  28.538  1.00 46.98  ? 296 ASN D CG  1 
ATOM   10457 O OD1 . ASN D 1 296 ? -4.505  13.904  29.064  1.00 50.47  ? 296 ASN D OD1 1 
ATOM   10458 N ND2 . ASN D 1 296 ? -6.605  14.705  29.075  1.00 32.12  ? 296 ASN D ND2 1 
ATOM   10459 N N   . GLY D 1 297 ? -6.516  10.180  26.321  1.00 19.82  ? 297 GLY D N   1 
ATOM   10460 C CA  . GLY D 1 297 ? -6.817  9.255   25.237  1.00 18.73  ? 297 GLY D CA  1 
ATOM   10461 C C   . GLY D 1 297 ? -8.081  8.426   25.583  1.00 20.84  ? 297 GLY D C   1 
ATOM   10462 O O   . GLY D 1 297 ? -8.781  7.954   24.699  1.00 19.19  ? 297 GLY D O   1 
ATOM   10463 N N   . ALA D 1 298 ? -8.406  8.299   26.870  1.00 16.21  ? 298 ALA D N   1 
ATOM   10464 C CA  . ALA D 1 298 ? -9.620  7.569   27.254  1.00 14.11  ? 298 ALA D CA  1 
ATOM   10465 C C   . ALA D 1 298 ? -10.858 8.453   26.983  1.00 17.49  ? 298 ALA D C   1 
ATOM   10466 O O   . ALA D 1 298 ? -11.914 7.984   26.516  1.00 14.53  ? 298 ALA D O   1 
ATOM   10467 C CB  . ALA D 1 298 ? -9.543  7.142   28.685  1.00 13.89  ? 298 ALA D CB  1 
ATOM   10468 N N   . GLY D 1 299 ? -10.694 9.756   27.214  1.00 16.80  ? 299 GLY D N   1 
ATOM   10469 C CA  . GLY D 1 299 ? -11.742 10.752  26.896  1.00 16.19  ? 299 GLY D CA  1 
ATOM   10470 C C   . GLY D 1 299 ? -12.100 10.656  25.404  1.00 17.20  ? 299 GLY D C   1 
ATOM   10471 O O   . GLY D 1 299 ? -13.212 10.325  25.067  1.00 19.45  ? 299 GLY D O   1 
ATOM   10472 N N   . ASP D 1 300 ? -11.125 10.856  24.524  1.00 10.42  ? 300 ASP D N   1 
ATOM   10473 C CA  . ASP D 1 300 ? -11.312 10.709  23.080  1.00 11.15  ? 300 ASP D CA  1 
ATOM   10474 C C   . ASP D 1 300 ? -11.927 9.356   22.616  1.00 16.53  ? 300 ASP D C   1 
ATOM   10475 O O   . ASP D 1 300 ? -12.684 9.286   21.639  1.00 18.36  ? 300 ASP D O   1 
ATOM   10476 C CB  . ASP D 1 300 ? -9.968  10.881  22.371  1.00 12.10  ? 300 ASP D CB  1 
ATOM   10477 C CG  . ASP D 1 300 ? -9.403  12.274  22.538  1.00 23.01  ? 300 ASP D CG  1 
ATOM   10478 O OD1 . ASP D 1 300 ? -10.134 13.182  22.970  1.00 24.09  ? 300 ASP D OD1 1 
ATOM   10479 O OD2 . ASP D 1 300 ? -8.257  12.489  22.121  1.00 33.75  ? 300 ASP D OD2 1 
ATOM   10480 N N   . ALA D 1 301 ? -11.506 8.269   23.242  1.00 9.27   ? 301 ALA D N   1 
ATOM   10481 C CA  . ALA D 1 301 ? -12.046 6.972   22.901  1.00 9.61   ? 301 ALA D CA  1 
ATOM   10482 C C   . ALA D 1 301 ? -13.503 6.818   23.402  1.00 14.17  ? 301 ALA D C   1 
ATOM   10483 O O   . ALA D 1 301 ? -14.345 6.238   22.744  1.00 13.58  ? 301 ALA D O   1 
ATOM   10484 C CB  . ALA D 1 301 ? -11.175 5.898   23.465  1.00 10.33  ? 301 ALA D CB  1 
ATOM   10485 N N   . PHE D 1 302 ? -13.823 7.411   24.535  1.00 11.59  ? 302 PHE D N   1 
ATOM   10486 C CA  . PHE D 1 302 ? -15.179 7.298   25.049  1.00 10.81  ? 302 PHE D CA  1 
ATOM   10487 C C   . PHE D 1 302 ? -16.119 7.912   24.075  1.00 14.18  ? 302 PHE D C   1 
ATOM   10488 O O   . PHE D 1 302 ? -17.158 7.389   23.860  1.00 15.91  ? 302 PHE D O   1 
ATOM   10489 C CB  . PHE D 1 302 ? -15.313 8.008   26.412  1.00 12.79  ? 302 PHE D CB  1 
ATOM   10490 C CG  . PHE D 1 302 ? -16.733 8.121   26.889  1.00 12.71  ? 302 PHE D CG  1 
ATOM   10491 C CD1 . PHE D 1 302 ? -17.306 7.084   27.633  1.00 11.15  ? 302 PHE D CD1 1 
ATOM   10492 C CD2 . PHE D 1 302 ? -17.520 9.234   26.536  1.00 12.19  ? 302 PHE D CD2 1 
ATOM   10493 C CE1 . PHE D 1 302 ? -18.647 7.156   28.028  1.00 10.04  ? 302 PHE D CE1 1 
ATOM   10494 C CE2 . PHE D 1 302 ? -18.828 9.332   26.965  1.00 12.98  ? 302 PHE D CE2 1 
ATOM   10495 C CZ  . PHE D 1 302 ? -19.401 8.268   27.683  1.00 10.66  ? 302 PHE D CZ  1 
ATOM   10496 N N   . VAL D 1 303 ? -15.777 9.077   23.555  1.00 13.73  ? 303 VAL D N   1 
ATOM   10497 C CA  . VAL D 1 303 ? -16.612 9.805   22.597  1.00 14.47  ? 303 VAL D CA  1 
ATOM   10498 C C   . VAL D 1 303 ? -16.811 8.966   21.334  1.00 14.61  ? 303 VAL D C   1 
ATOM   10499 O O   . VAL D 1 303 ? -17.954 8.723   20.916  1.00 16.20  ? 303 VAL D O   1 
ATOM   10500 C CB  . VAL D 1 303 ? -15.931 11.207  22.232  1.00 19.59  ? 303 VAL D CB  1 
ATOM   10501 C CG1 . VAL D 1 303 ? -16.652 11.925  21.047  1.00 18.98  ? 303 VAL D CG1 1 
ATOM   10502 C CG2 . VAL D 1 303 ? -15.884 12.115  23.460  1.00 18.96  ? 303 VAL D CG2 1 
ATOM   10503 N N   . GLY D 1 304 ? -15.702 8.503   20.752  1.00 6.85   ? 304 GLY D N   1 
ATOM   10504 C CA  . GLY D 1 304 ? -15.746 7.640   19.589  1.00 6.76   ? 304 GLY D CA  1 
ATOM   10505 C C   . GLY D 1 304 ? -16.710 6.463   19.864  1.00 15.69  ? 304 GLY D C   1 
ATOM   10506 O O   . GLY D 1 304 ? -17.513 6.114   19.038  1.00 17.41  ? 304 GLY D O   1 
ATOM   10507 N N   . GLY D 1 305 ? -16.630 5.853   21.028  1.00 14.07  ? 305 GLY D N   1 
ATOM   10508 C CA  . GLY D 1 305 ? -17.563 4.798   21.356  1.00 15.60  ? 305 GLY D CA  1 
ATOM   10509 C C   . GLY D 1 305 ? -19.032 5.257   21.436  1.00 18.27  ? 305 GLY D C   1 
ATOM   10510 O O   . GLY D 1 305 ? -19.910 4.563   20.954  1.00 21.18  ? 305 GLY D O   1 
ATOM   10511 N N   . PHE D 1 306 ? -19.296 6.343   22.154  1.00 11.88  ? 306 PHE D N   1 
ATOM   10512 C CA  . PHE D 1 306 ? -20.647 6.916   22.274  1.00 10.65  ? 306 PHE D CA  1 
ATOM   10513 C C   . PHE D 1 306 ? -21.159 7.302   20.850  1.00 17.80  ? 306 PHE D C   1 
ATOM   10514 O O   . PHE D 1 306 ? -22.305 7.040   20.474  1.00 17.17  ? 306 PHE D O   1 
ATOM   10515 C CB  . PHE D 1 306 ? -20.592 8.160   23.187  1.00 10.20  ? 306 PHE D CB  1 
ATOM   10516 C CG  . PHE D 1 306 ? -21.942 8.783   23.458  1.00 10.25  ? 306 PHE D CG  1 
ATOM   10517 C CD1 . PHE D 1 306 ? -22.684 9.367   22.438  1.00 13.85  ? 306 PHE D CD1 1 
ATOM   10518 C CD2 . PHE D 1 306 ? -22.476 8.793   24.737  1.00 10.30  ? 306 PHE D CD2 1 
ATOM   10519 C CE1 . PHE D 1 306 ? -23.954 9.945   22.689  1.00 13.36  ? 306 PHE D CE1 1 
ATOM   10520 C CE2 . PHE D 1 306 ? -23.734 9.341   24.990  1.00 12.39  ? 306 PHE D CE2 1 
ATOM   10521 C CZ  . PHE D 1 306 ? -24.450 9.953   23.983  1.00 11.19  ? 306 PHE D CZ  1 
ATOM   10522 N N   . LEU D 1 307 ? -20.295 7.915   20.048  1.00 15.17  ? 307 LEU D N   1 
ATOM   10523 C CA  . LEU D 1 307 ? -20.682 8.286   18.686  1.00 15.44  ? 307 LEU D CA  1 
ATOM   10524 C C   . LEU D 1 307 ? -21.082 7.039   17.862  1.00 19.21  ? 307 LEU D C   1 
ATOM   10525 O O   . LEU D 1 307 ? -22.036 7.060   17.072  1.00 21.26  ? 307 LEU D O   1 
ATOM   10526 C CB  . LEU D 1 307 ? -19.514 9.029   17.995  1.00 15.50  ? 307 LEU D CB  1 
ATOM   10527 C CG  . LEU D 1 307 ? -19.224 10.425  18.536  1.00 19.88  ? 307 LEU D CG  1 
ATOM   10528 C CD1 . LEU D 1 307 ? -18.111 11.083  17.741  1.00 19.37  ? 307 LEU D CD1 1 
ATOM   10529 C CD2 . LEU D 1 307 ? -20.502 11.246  18.523  1.00 22.14  ? 307 LEU D CD2 1 
ATOM   10530 N N   . SER D 1 308 ? -20.320 5.966   18.022  1.00 12.61  ? 308 SER D N   1 
ATOM   10531 C CA  . SER D 1 308 ? -20.538 4.764   17.258  1.00 11.83  ? 308 SER D CA  1 
ATOM   10532 C C   . SER D 1 308 ? -21.969 4.273   17.333  1.00 22.06  ? 308 SER D C   1 
ATOM   10533 O O   . SER D 1 308 ? -22.517 3.839   16.328  1.00 25.73  ? 308 SER D O   1 
ATOM   10534 C CB  . SER D 1 308 ? -19.490 3.671   17.564  1.00 12.93  ? 308 SER D CB  1 
ATOM   10535 O OG  . SER D 1 308 ? -19.685 3.022   18.818  1.00 14.68  ? 308 SER D OG  1 
ATOM   10536 N N   . GLN D 1 309 ? -22.610 4.407   18.494  1.00 18.23  ? 309 GLN D N   1 
ATOM   10537 C CA  . GLN D 1 309 ? -23.991 3.983   18.639  1.00 16.47  ? 309 GLN D CA  1 
ATOM   10538 C C   . GLN D 1 309 ? -24.989 5.107   18.364  1.00 21.68  ? 309 GLN D C   1 
ATOM   10539 O O   . GLN D 1 309 ? -26.095 4.866   17.916  1.00 20.87  ? 309 GLN D O   1 
ATOM   10540 C CB  . GLN D 1 309 ? -24.195 3.416   20.040  1.00 17.60  ? 309 GLN D CB  1 
ATOM   10541 C CG  . GLN D 1 309 ? -23.195 2.292   20.438  1.00 31.09  ? 309 GLN D CG  1 
ATOM   10542 C CD  . GLN D 1 309 ? -23.121 1.127   19.422  1.00 40.46  ? 309 GLN D CD  1 
ATOM   10543 O OE1 . GLN D 1 309 ? -24.040 0.312   19.289  1.00 24.55  ? 309 GLN D OE1 1 
ATOM   10544 N NE2 . GLN D 1 309 ? -22.000 1.040   18.746  1.00 36.54  ? 309 GLN D NE2 1 
ATOM   10545 N N   . LEU D 1 310 ? -24.606 6.346   18.666  1.00 20.55  ? 310 LEU D N   1 
ATOM   10546 C CA  . LEU D 1 310 ? -25.513 7.490   18.512  1.00 20.86  ? 310 LEU D CA  1 
ATOM   10547 C C   . LEU D 1 310 ? -25.994 7.545   17.069  1.00 26.39  ? 310 LEU D C   1 
ATOM   10548 O O   . LEU D 1 310 ? -27.109 7.986   16.732  1.00 23.53  ? 310 LEU D O   1 
ATOM   10549 C CB  . LEU D 1 310 ? -24.735 8.780   18.781  1.00 21.06  ? 310 LEU D CB  1 
ATOM   10550 C CG  . LEU D 1 310 ? -25.498 10.003  19.294  1.00 25.47  ? 310 LEU D CG  1 
ATOM   10551 C CD1 . LEU D 1 310 ? -25.443 11.153  18.355  1.00 27.98  ? 310 LEU D CD1 1 
ATOM   10552 C CD2 . LEU D 1 310 ? -26.908 9.710   19.678  1.00 21.53  ? 310 LEU D CD2 1 
ATOM   10553 N N   . VAL D 1 311 ? -25.057 7.191   16.208  1.00 23.41  ? 311 VAL D N   1 
ATOM   10554 C CA  . VAL D 1 311 ? -25.214 7.306   14.782  1.00 20.87  ? 311 VAL D CA  1 
ATOM   10555 C C   . VAL D 1 311 ? -26.292 6.368   14.254  1.00 24.56  ? 311 VAL D C   1 
ATOM   10556 O O   . VAL D 1 311 ? -26.957 6.643   13.232  1.00 23.70  ? 311 VAL D O   1 
ATOM   10557 C CB  . VAL D 1 311 ? -23.848 7.100   14.158  1.00 21.64  ? 311 VAL D CB  1 
ATOM   10558 C CG1 . VAL D 1 311 ? -23.758 5.755   13.557  1.00 20.89  ? 311 VAL D CG1 1 
ATOM   10559 C CG2 . VAL D 1 311 ? -23.475 8.238   13.263  1.00 20.31  ? 311 VAL D CG2 1 
ATOM   10560 N N   . SER D 1 312 ? -26.562 5.315   15.009  1.00 22.26  ? 312 SER D N   1 
ATOM   10561 C CA  . SER D 1 312 ? -27.653 4.422   14.640  1.00 23.72  ? 312 SER D CA  1 
ATOM   10562 C C   . SER D 1 312 ? -28.877 4.514   15.550  1.00 32.85  ? 312 SER D C   1 
ATOM   10563 O O   . SER D 1 312 ? -29.739 3.644   15.540  1.00 36.50  ? 312 SER D O   1 
ATOM   10564 C CB  . SER D 1 312 ? -27.181 2.980   14.406  1.00 28.02  ? 312 SER D CB  1 
ATOM   10565 O OG  . SER D 1 312 ? -26.480 2.436   15.510  1.00 44.01  ? 312 SER D OG  1 
ATOM   10566 N N   . ASP D 1 313 ? -28.980 5.622   16.277  1.00 29.91  ? 313 ASP D N   1 
ATOM   10567 C CA  . ASP D 1 313 ? -30.125 5.926   17.131  1.00 29.59  ? 313 ASP D CA  1 
ATOM   10568 C C   . ASP D 1 313 ? -30.313 5.093   18.364  1.00 30.57  ? 313 ASP D C   1 
ATOM   10569 O O   . ASP D 1 313 ? -31.404 5.084   18.935  1.00 31.09  ? 313 ASP D O   1 
ATOM   10570 C CB  . ASP D 1 313 ? -31.412 5.932   16.325  1.00 32.59  ? 313 ASP D CB  1 
ATOM   10571 C CG  . ASP D 1 313 ? -31.781 7.316   15.872  1.00 55.99  ? 313 ASP D CG  1 
ATOM   10572 O OD1 . ASP D 1 313 ? -31.825 8.213   16.750  1.00 60.51  ? 313 ASP D OD1 1 
ATOM   10573 O OD2 . ASP D 1 313 ? -31.897 7.536   14.642  1.00 61.47  ? 313 ASP D OD2 1 
ATOM   10574 N N   . LYS D 1 314 ? -29.268 4.397   18.784  1.00 24.90  ? 314 LYS D N   1 
ATOM   10575 C CA  . LYS D 1 314 ? -29.372 3.541   19.961  1.00 23.80  ? 314 LYS D CA  1 
ATOM   10576 C C   . LYS D 1 314 ? -29.744 4.360   21.198  1.00 25.14  ? 314 LYS D C   1 
ATOM   10577 O O   . LYS D 1 314 ? -29.573 5.572   21.213  1.00 23.44  ? 314 LYS D O   1 
ATOM   10578 C CB  . LYS D 1 314 ? -28.064 2.772   20.192  1.00 25.48  ? 314 LYS D CB  1 
ATOM   10579 C CG  . LYS D 1 314 ? -27.624 1.966   18.992  1.00 17.56  ? 314 LYS D CG  1 
ATOM   10580 C CD  . LYS D 1 314 ? -28.449 0.718   18.911  1.00 37.65  ? 314 LYS D CD  1 
ATOM   10581 C CE  . LYS D 1 314 ? -28.038 -0.123  17.719  1.00 52.67  ? 314 LYS D CE  1 
ATOM   10582 N NZ  . LYS D 1 314 ? -28.636 0.471   16.492  1.00 66.29  ? 314 LYS D NZ  1 
ATOM   10583 N N   . PRO D 1 315 ? -30.286 3.701   22.227  1.00 21.16  ? 315 PRO D N   1 
ATOM   10584 C CA  . PRO D 1 315 ? -30.608 4.444   23.448  1.00 19.41  ? 315 PRO D CA  1 
ATOM   10585 C C   . PRO D 1 315 ? -29.312 4.996   24.039  1.00 21.40  ? 315 PRO D C   1 
ATOM   10586 O O   . PRO D 1 315 ? -28.236 4.412   23.880  1.00 20.83  ? 315 PRO D O   1 
ATOM   10587 C CB  . PRO D 1 315 ? -31.261 3.400   24.379  1.00 20.57  ? 315 PRO D CB  1 
ATOM   10588 C CG  . PRO D 1 315 ? -31.399 2.141   23.587  1.00 24.51  ? 315 PRO D CG  1 
ATOM   10589 C CD  . PRO D 1 315 ? -30.726 2.278   22.267  1.00 20.36  ? 315 PRO D CD  1 
ATOM   10590 N N   . LEU D 1 316 ? -29.417 6.146   24.704  1.00 16.53  ? 316 LEU D N   1 
ATOM   10591 C CA  . LEU D 1 316 ? -28.266 6.771   25.329  1.00 14.38  ? 316 LEU D CA  1 
ATOM   10592 C C   . LEU D 1 316 ? -27.523 5.807   26.232  1.00 22.07  ? 316 LEU D C   1 
ATOM   10593 O O   . LEU D 1 316 ? -26.297 5.820   26.298  1.00 22.24  ? 316 LEU D O   1 
ATOM   10594 C CB  . LEU D 1 316 ? -28.692 8.003   26.111  1.00 12.72  ? 316 LEU D CB  1 
ATOM   10595 C CG  . LEU D 1 316 ? -29.463 8.943   25.203  1.00 12.03  ? 316 LEU D CG  1 
ATOM   10596 C CD1 . LEU D 1 316 ? -30.130 10.000  26.097  1.00 10.15  ? 316 LEU D CD1 1 
ATOM   10597 C CD2 . LEU D 1 316 ? -28.449 9.574   24.256  1.00 6.86   ? 316 LEU D CD2 1 
ATOM   10598 N N   . THR D 1 317 ? -28.282 4.971   26.933  1.00 22.74  ? 317 THR D N   1 
ATOM   10599 C CA  . THR D 1 317 ? -27.735 3.980   27.847  1.00 22.15  ? 317 THR D CA  1 
ATOM   10600 C C   . THR D 1 317 ? -26.779 3.107   27.098  1.00 25.32  ? 317 THR D C   1 
ATOM   10601 O O   . THR D 1 317 ? -25.702 2.734   27.592  1.00 26.20  ? 317 THR D O   1 
ATOM   10602 C CB  . THR D 1 317 ? -28.823 3.125   28.407  1.00 36.57  ? 317 THR D CB  1 
ATOM   10603 O OG1 . THR D 1 317 ? -29.740 3.957   29.110  1.00 46.79  ? 317 THR D OG1 1 
ATOM   10604 C CG2 . THR D 1 317 ? -28.243 2.169   29.377  1.00 42.33  ? 317 THR D CG2 1 
ATOM   10605 N N   . GLU D 1 318 ? -27.108 2.902   25.830  1.00 21.64  ? 318 GLU D N   1 
ATOM   10606 C CA  . GLU D 1 318 ? -26.310 2.054   24.945  1.00 20.22  ? 318 GLU D CA  1 
ATOM   10607 C C   . GLU D 1 318 ? -25.103 2.760   24.400  1.00 21.97  ? 318 GLU D C   1 
ATOM   10608 O O   . GLU D 1 318 ? -24.045 2.186   24.263  1.00 21.76  ? 318 GLU D O   1 
ATOM   10609 C CB  . GLU D 1 318 ? -27.174 1.568   23.811  1.00 22.33  ? 318 GLU D CB  1 
ATOM   10610 C CG  . GLU D 1 318 ? -26.602 0.372   23.107  1.00 42.71  ? 318 GLU D CG  1 
ATOM   10611 C CD  . GLU D 1 318 ? -26.533 -0.824  24.005  1.00 59.21  ? 318 GLU D CD  1 
ATOM   10612 O OE1 . GLU D 1 318 ? -26.855 -0.654  25.210  1.00 58.52  ? 318 GLU D OE1 1 
ATOM   10613 O OE2 . GLU D 1 318 ? -26.098 -1.901  23.525  1.00 40.90  ? 318 GLU D OE2 1 
ATOM   10614 N N   . CYS D 1 319 ? -25.258 4.048   24.141  1.00 20.96  ? 319 CYS D N   1 
ATOM   10615 C CA  . CYS D 1 319 ? -24.148 4.884   23.692  1.00 20.57  ? 319 CYS D CA  1 
ATOM   10616 C C   . CYS D 1 319 ? -23.048 4.994   24.738  1.00 19.96  ? 319 CYS D C   1 
ATOM   10617 O O   . CYS D 1 319 ? -21.860 4.922   24.415  1.00 18.85  ? 319 CYS D O   1 
ATOM   10618 C CB  . CYS D 1 319 ? -24.674 6.277   23.403  1.00 21.41  ? 319 CYS D CB  1 
ATOM   10619 S SG  . CYS D 1 319 ? -25.969 6.303   22.150  1.00 25.28  ? 319 CYS D SG  1 
ATOM   10620 N N   . ILE D 1 320 ? -23.459 5.267   25.971  1.00 15.04  ? 320 ILE D N   1 
ATOM   10621 C CA  . ILE D 1 320 ? -22.530 5.414   27.080  1.00 14.75  ? 320 ILE D CA  1 
ATOM   10622 C C   . ILE D 1 320 ? -21.777 4.123   27.267  1.00 23.50  ? 320 ILE D C   1 
ATOM   10623 O O   . ILE D 1 320 ? -20.553 4.125   27.400  1.00 24.07  ? 320 ILE D O   1 
ATOM   10624 C CB  . ILE D 1 320 ? -23.283 5.735   28.354  1.00 17.01  ? 320 ILE D CB  1 
ATOM   10625 C CG1 . ILE D 1 320 ? -23.971 7.110   28.231  1.00 16.27  ? 320 ILE D CG1 1 
ATOM   10626 C CG2 . ILE D 1 320 ? -22.357 5.602   29.543  1.00 18.09  ? 320 ILE D CG2 1 
ATOM   10627 C CD1 . ILE D 1 320 ? -24.006 7.912   29.470  1.00 13.26  ? 320 ILE D CD1 1 
ATOM   10628 N N   . ARG D 1 321 ? -22.500 3.008   27.172  1.00 22.66  ? 321 ARG D N   1 
ATOM   10629 C CA  . ARG D 1 321 ? -21.874 1.694   27.308  1.00 22.38  ? 321 ARG D CA  1 
ATOM   10630 C C   . ARG D 1 321 ? -20.736 1.460   26.349  1.00 23.77  ? 321 ARG D C   1 
ATOM   10631 O O   . ARG D 1 321 ? -19.727 0.901   26.726  1.00 23.91  ? 321 ARG D O   1 
ATOM   10632 C CB  . ARG D 1 321 ? -22.901 0.588   27.134  1.00 24.02  ? 321 ARG D CB  1 
ATOM   10633 C CG  . ARG D 1 321 ? -22.566 -0.656  27.914  1.00 21.96  ? 321 ARG D CG  1 
ATOM   10634 C CD  . ARG D 1 321 ? -23.700 -1.649  27.767  1.00 32.80  ? 321 ARG D CD  1 
ATOM   10635 N NE  . ARG D 1 321 ? -23.239 -2.729  26.896  1.00 48.07  ? 321 ARG D NE  1 
ATOM   10636 C CZ  . ARG D 1 321 ? -23.838 -3.127  25.783  1.00 68.66  ? 321 ARG D CZ  1 
ATOM   10637 N NH1 . ARG D 1 321 ? -24.989 -2.590  25.398  1.00 63.43  ? 321 ARG D NH1 1 
ATOM   10638 N NH2 . ARG D 1 321 ? -23.272 -4.087  25.069  1.00 55.09  ? 321 ARG D NH2 1 
ATOM   10639 N N   . ALA D 1 322 ? -20.947 1.774   25.074  1.00 18.56  ? 322 ALA D N   1 
ATOM   10640 C CA  . ALA D 1 322 ? -19.881 1.625   24.082  1.00 17.40  ? 322 ALA D CA  1 
ATOM   10641 C C   . ALA D 1 322 ? -18.729 2.586   24.379  1.00 21.63  ? 322 ALA D C   1 
ATOM   10642 O O   . ALA D 1 322 ? -17.574 2.260   24.108  1.00 22.69  ? 322 ALA D O   1 
ATOM   10643 C CB  . ALA D 1 322 ? -20.417 1.900   22.709  1.00 18.23  ? 322 ALA D CB  1 
ATOM   10644 N N   . GLY D 1 323 ? -19.052 3.767   24.931  1.00 15.67  ? 323 GLY D N   1 
ATOM   10645 C CA  . GLY D 1 323 ? -18.081 4.783   25.293  1.00 13.49  ? 323 GLY D CA  1 
ATOM   10646 C C   . GLY D 1 323 ? -17.168 4.265   26.388  1.00 16.29  ? 323 GLY D C   1 
ATOM   10647 O O   . GLY D 1 323 ? -15.940 4.435   26.321  1.00 18.09  ? 323 GLY D O   1 
ATOM   10648 N N   . HIS D 1 324 ? -17.755 3.618   27.394  1.00 10.56  ? 324 HIS D N   1 
ATOM   10649 C CA  . HIS D 1 324 ? -16.975 2.993   28.463  1.00 10.04  ? 324 HIS D CA  1 
ATOM   10650 C C   . HIS D 1 324 ? -16.119 1.861   27.845  1.00 13.77  ? 324 HIS D C   1 
ATOM   10651 O O   . HIS D 1 324 ? -14.922 1.737   28.096  1.00 13.53  ? 324 HIS D O   1 
ATOM   10652 C CB  . HIS D 1 324 ? -17.904 2.434   29.552  1.00 11.37  ? 324 HIS D CB  1 
ATOM   10653 C CG  . HIS D 1 324 ? -18.495 3.475   30.460  1.00 16.72  ? 324 HIS D CG  1 
ATOM   10654 N ND1 . HIS D 1 324 ? -17.768 4.535   30.969  1.00 19.67  ? 324 HIS D ND1 1 
ATOM   10655 C CD2 . HIS D 1 324 ? -19.747 3.604   30.974  1.00 20.23  ? 324 HIS D CD2 1 
ATOM   10656 C CE1 . HIS D 1 324 ? -18.550 5.285   31.735  1.00 19.66  ? 324 HIS D CE1 1 
ATOM   10657 N NE2 . HIS D 1 324 ? -19.758 4.747   31.748  1.00 20.47  ? 324 HIS D NE2 1 
ATOM   10658 N N   . TYR D 1 325 ? -16.723 1.110   26.944  1.00 11.91  ? 325 TYR D N   1 
ATOM   10659 C CA  . TYR D 1 325 ? -16.056 0.010   26.287  1.00 12.60  ? 325 TYR D CA  1 
ATOM   10660 C C   . TYR D 1 325 ? -14.819 0.433   25.473  1.00 20.50  ? 325 TYR D C   1 
ATOM   10661 O O   . TYR D 1 325 ? -13.715 -0.125  25.630  1.00 21.38  ? 325 TYR D O   1 
ATOM   10662 C CB  . TYR D 1 325 ? -17.043 -0.801  25.408  1.00 10.56  ? 325 TYR D CB  1 
ATOM   10663 C CG  . TYR D 1 325 ? -16.322 -1.832  24.593  1.00 8.00   ? 325 TYR D CG  1 
ATOM   10664 C CD1 . TYR D 1 325 ? -15.647 -2.893  25.208  1.00 9.63   ? 325 TYR D CD1 1 
ATOM   10665 C CD2 . TYR D 1 325 ? -16.189 -1.685  23.229  1.00 10.33  ? 325 TYR D CD2 1 
ATOM   10666 C CE1 . TYR D 1 325 ? -14.848 -3.788  24.474  1.00 11.41  ? 325 TYR D CE1 1 
ATOM   10667 C CE2 . TYR D 1 325 ? -15.429 -2.612  22.447  1.00 11.70  ? 325 TYR D CE2 1 
ATOM   10668 C CZ  . TYR D 1 325 ? -14.750 -3.636  23.087  1.00 19.25  ? 325 TYR D CZ  1 
ATOM   10669 O OH  . TYR D 1 325 ? -13.937 -4.471  22.348  1.00 24.73  ? 325 TYR D OH  1 
ATOM   10670 N N   . ALA D 1 326 ? -15.026 1.372   24.561  1.00 17.31  ? 326 ALA D N   1 
ATOM   10671 C CA  . ALA D 1 326 ? -13.947 1.893   23.739  1.00 17.94  ? 326 ALA D CA  1 
ATOM   10672 C C   . ALA D 1 326 ? -12.831 2.459   24.633  1.00 25.95  ? 326 ALA D C   1 
ATOM   10673 O O   . ALA D 1 326 ? -11.631 2.292   24.366  1.00 26.05  ? 326 ALA D O   1 
ATOM   10674 C CB  . ALA D 1 326 ? -14.498 2.971   22.814  1.00 18.53  ? 326 ALA D CB  1 
ATOM   10675 N N   . ALA D 1 327 ? -13.230 3.158   25.695  1.00 24.16  ? 327 ALA D N   1 
ATOM   10676 C CA  . ALA D 1 327 ? -12.264 3.769   26.615  1.00 22.40  ? 327 ALA D CA  1 
ATOM   10677 C C   . ALA D 1 327 ? -11.308 2.756   27.252  1.00 27.01  ? 327 ALA D C   1 
ATOM   10678 O O   . ALA D 1 327 ? -10.121 3.028   27.346  1.00 26.87  ? 327 ALA D O   1 
ATOM   10679 C CB  . ALA D 1 327 ? -12.975 4.632   27.671  1.00 21.58  ? 327 ALA D CB  1 
ATOM   10680 N N   . SER D 1 328 ? -11.836 1.596   27.649  1.00 25.93  ? 328 SER D N   1 
ATOM   10681 C CA  . SER D 1 328 ? -11.095 0.487   28.283  1.00 26.86  ? 328 SER D CA  1 
ATOM   10682 C C   . SER D 1 328 ? -10.212 -0.312  27.335  1.00 32.38  ? 328 SER D C   1 
ATOM   10683 O O   . SER D 1 328 ? -9.246  -0.934  27.742  1.00 28.90  ? 328 SER D O   1 
ATOM   10684 C CB  . SER D 1 328 ? -12.094 -0.508  28.872  1.00 30.61  ? 328 SER D CB  1 
ATOM   10685 O OG  . SER D 1 328 ? -12.655 -1.321  27.845  1.00 38.69  ? 328 SER D OG  1 
ATOM   10686 N N   . ILE D 1 329 ? -10.621 -0.391  26.085  1.00 36.12  ? 329 ILE D N   1 
ATOM   10687 C CA  . ILE D 1 329 ? -9.867  -1.183  25.123  1.00 39.35  ? 329 ILE D CA  1 
ATOM   10688 C C   . ILE D 1 329 ? -8.796  -0.309  24.489  1.00 48.10  ? 329 ILE D C   1 
ATOM   10689 O O   . ILE D 1 329 ? -7.594  -0.517  24.697  1.00 45.46  ? 329 ILE D O   1 
ATOM   10690 C CB  . ILE D 1 329 ? -10.790 -1.741  24.013  1.00 42.88  ? 329 ILE D CB  1 
ATOM   10691 C CG1 . ILE D 1 329 ? -11.466 -3.032  24.479  1.00 43.22  ? 329 ILE D CG1 1 
ATOM   10692 C CG2 . ILE D 1 329 ? -9.990  -1.971  22.746  1.00 44.41  ? 329 ILE D CG2 1 
ATOM   10693 C CD1 . ILE D 1 329 ? -10.503 -4.179  24.703  1.00 45.79  ? 329 ILE D CD1 1 
ATOM   10694 N N   . ILE D 1 330 ? -9.258  0.684   23.727  1.00 50.07  ? 330 ILE D N   1 
ATOM   10695 C CA  . ILE D 1 330 ? -8.371  1.594   23.022  1.00 51.74  ? 330 ILE D CA  1 
ATOM   10696 C C   . ILE D 1 330 ? -7.448  2.359   23.967  1.00 58.45  ? 330 ILE D C   1 
ATOM   10697 O O   . ILE D 1 330 ? -7.784  3.451   24.453  1.00 56.97  ? 330 ILE D O   1 
ATOM   10698 C CB  . ILE D 1 330 ? -9.117  2.534   22.024  1.00 54.34  ? 330 ILE D CB  1 
ATOM   10699 C CG1 . ILE D 1 330 ? -9.895  1.694   21.000  1.00 52.54  ? 330 ILE D CG1 1 
ATOM   10700 C CG2 . ILE D 1 330 ? -8.069  3.423   21.263  1.00 55.75  ? 330 ILE D CG2 1 
ATOM   10701 C CD1 . ILE D 1 330 ? -9.019  0.721   20.215  1.00 43.64  ? 330 ILE D CD1 1 
ATOM   10702 N N   . ILE D 1 331 ? -6.289  1.748   24.215  1.00 58.01  ? 331 ILE D N   1 
ATOM   10703 C CA  . ILE D 1 331 ? -5.281  2.248   25.145  1.00 58.98  ? 331 ILE D CA  1 
ATOM   10704 C C   . ILE D 1 331 ? -3.956  2.428   24.422  1.00 65.03  ? 331 ILE D C   1 
ATOM   10705 O O   . ILE D 1 331 ? -3.350  1.463   23.945  1.00 63.52  ? 331 ILE D O   1 
ATOM   10706 C CB  . ILE D 1 331 ? -5.051  1.222   26.297  1.00 62.15  ? 331 ILE D CB  1 
ATOM   10707 C CG1 . ILE D 1 331 ? -6.328  1.019   27.107  1.00 63.92  ? 331 ILE D CG1 1 
ATOM   10708 C CG2 . ILE D 1 331 ? -3.869  1.590   27.191  1.00 60.42  ? 331 ILE D CG2 1 
ATOM   10709 C CD1 . ILE D 1 331 ? -6.576  -0.443  27.425  1.00 76.59  ? 331 ILE D CD1 1 
ATOM   10710 N N   . ARG D 1 332 ? -3.510  3.675   24.335  1.00 65.24  ? 332 ARG D N   1 
ATOM   10711 C CA  . ARG D 1 332 ? -2.205  3.958   23.748  1.00 66.08  ? 332 ARG D CA  1 
ATOM   10712 C C   . ARG D 1 332 ? -1.147  3.815   24.833  1.00 68.20  ? 332 ARG D C   1 
ATOM   10713 O O   . ARG D 1 332 ? -1.407  4.086   26.009  1.00 66.28  ? 332 ARG D O   1 
ATOM   10714 C CB  . ARG D 1 332 ? -2.148  5.334   23.063  1.00 67.60  ? 332 ARG D CB  1 
ATOM   10715 C CG  . ARG D 1 332 ? -1.850  5.219   21.560  1.00 79.30  ? 332 ARG D CG  1 
ATOM   10716 C CD  . ARG D 1 332 ? -1.902  6.551   20.847  1.00 83.72  ? 332 ARG D CD  1 
ATOM   10717 N NE  . ARG D 1 332 ? -0.897  7.490   21.342  1.00 83.57  ? 332 ARG D NE  1 
ATOM   10718 C CZ  . ARG D 1 332 ? -0.911  8.797   21.082  1.00 92.90  ? 332 ARG D CZ  1 
ATOM   10719 N NH1 . ARG D 1 332 ? -1.866  9.317   20.316  1.00 73.72  ? 332 ARG D NH1 1 
ATOM   10720 N NH2 . ARG D 1 332 ? 0.044   9.582   21.559  1.00 79.01  ? 332 ARG D NH2 1 
ATOM   10721 N N   . ARG D 1 333 ? 0.020   3.319   24.450  1.00 64.80  ? 333 ARG D N   1 
ATOM   10722 C CA  . ARG D 1 333 ? 1.041   3.065   25.438  1.00 64.63  ? 333 ARG D CA  1 
ATOM   10723 C C   . ARG D 1 333 ? 2.429   3.602   25.084  1.00 65.80  ? 333 ARG D C   1 
ATOM   10724 O O   . ARG D 1 333 ? 2.650   4.158   24.002  1.00 64.88  ? 333 ARG D O   1 
ATOM   10725 C CB  . ARG D 1 333 ? 1.079   1.561   25.759  1.00 67.01  ? 333 ARG D CB  1 
ATOM   10726 C CG  . ARG D 1 333 ? -0.287  0.968   26.131  1.00 80.35  ? 333 ARG D CG  1 
ATOM   10727 C CD  . ARG D 1 333 ? -0.463  0.842   27.652  1.00 94.68  ? 333 ARG D CD  1 
ATOM   10728 N NE  . ARG D 1 333 ? 0.315   -0.262  28.210  1.00 104.90 ? 333 ARG D NE  1 
ATOM   10729 C CZ  . ARG D 1 333 ? 1.592   -0.181  28.583  1.00 115.75 ? 333 ARG D CZ  1 
ATOM   10730 N NH1 . ARG D 1 333 ? 2.275   0.944   28.390  1.00 103.60 ? 333 ARG D NH1 1 
ATOM   10731 N NH2 . ARG D 1 333 ? 2.217   -1.249  29.055  1.00 95.66  ? 333 ARG D NH2 1 
ATOM   10732 N N   . THR D 1 334 ? 3.342   3.448   26.042  1.00 60.71  ? 334 THR D N   1 
ATOM   10733 C CA  . THR D 1 334 ? 4.737   3.839   25.897  1.00 59.60  ? 334 THR D CA  1 
ATOM   10734 C C   . THR D 1 334 ? 5.471   2.536   25.614  1.00 60.07  ? 334 THR D C   1 
ATOM   10735 O O   . THR D 1 334 ? 5.061   1.479   26.079  1.00 58.85  ? 334 THR D O   1 
ATOM   10736 C CB  . THR D 1 334 ? 5.302   4.436   27.261  1.00 67.69  ? 334 THR D CB  1 
ATOM   10737 O OG1 . THR D 1 334 ? 4.631   5.659   27.613  1.00 66.04  ? 334 THR D OG1 1 
ATOM   10738 C CG2 . THR D 1 334 ? 6.818   4.679   27.194  1.00 64.25  ? 334 THR D CG2 1 
ATOM   10739 N N   . GLY D 1 335 ? 6.574   2.614   24.890  1.00 55.94  ? 335 GLY D N   1 
ATOM   10740 C CA  . GLY D 1 335 ? 7.384   1.434   24.634  1.00 55.86  ? 335 GLY D CA  1 
ATOM   10741 C C   . GLY D 1 335 ? 6.592   0.336   23.959  1.00 59.79  ? 335 GLY D C   1 
ATOM   10742 O O   . GLY D 1 335 ? 6.449   -0.758  24.509  1.00 59.26  ? 335 GLY D O   1 
ATOM   10743 N N   . CYS D 1 336 ? 6.013   0.670   22.811  1.00 56.31  ? 336 CYS D N   1 
ATOM   10744 C CA  . CYS D 1 336 ? 5.291   -0.287  21.989  1.00 56.40  ? 336 CYS D CA  1 
ATOM   10745 C C   . CYS D 1 336 ? 6.068   -0.492  20.683  1.00 62.22  ? 336 CYS D C   1 
ATOM   10746 O O   . CYS D 1 336 ? 6.378   -1.619  20.304  1.00 61.69  ? 336 CYS D O   1 
ATOM   10747 C CB  . CYS D 1 336 ? 3.909   0.258   21.625  1.00 56.04  ? 336 CYS D CB  1 
ATOM   10748 S SG  . CYS D 1 336 ? 2.729   0.396   22.997  1.00 59.55  ? 336 CYS D SG  1 
ATOM   10749 N N   . THR D 1 337 ? 6.346   0.621   20.007  1.00 59.95  ? 337 THR D N   1 
ATOM   10750 C CA  . THR D 1 337 ? 7.021   0.653   18.718  1.00 60.68  ? 337 THR D CA  1 
ATOM   10751 C C   . THR D 1 337 ? 8.538   0.709   18.893  1.00 66.29  ? 337 THR D C   1 
ATOM   10752 O O   . THR D 1 337 ? 9.023   0.989   19.993  1.00 65.80  ? 337 THR D O   1 
ATOM   10753 C CB  . THR D 1 337 ? 6.542   1.897   17.895  1.00 74.70  ? 337 THR D CB  1 
ATOM   10754 O OG1 . THR D 1 337 ? 7.000   3.119   18.512  1.00 74.19  ? 337 THR D OG1 1 
ATOM   10755 C CG2 . THR D 1 337 ? 4.999   1.923   17.820  1.00 74.85  ? 337 THR D CG2 1 
ATOM   10756 N N   . PHE D 1 338 ? 9.278   0.388   17.828  1.00 63.91  ? 338 PHE D N   1 
ATOM   10757 C CA  . PHE D 1 338 ? 10.731  0.498   17.755  1.00 63.28  ? 338 PHE D CA  1 
ATOM   10758 C C   . PHE D 1 338 ? 11.168  1.739   16.978  1.00 68.73  ? 338 PHE D C   1 
ATOM   10759 O O   . PHE D 1 338 ? 10.453  2.279   16.145  1.00 70.46  ? 338 PHE D O   1 
ATOM   10760 C CB  . PHE D 1 338 ? 11.273  -0.751  17.059  1.00 64.79  ? 338 PHE D CB  1 
ATOM   10761 C CG  . PHE D 1 338 ? 10.639  -1.978  17.641  1.00 66.45  ? 338 PHE D CG  1 
ATOM   10762 C CD1 . PHE D 1 338 ? 10.560  -3.136  16.878  1.00 69.42  ? 338 PHE D CD1 1 
ATOM   10763 C CD2 . PHE D 1 338 ? 10.152  -1.958  18.937  1.00 68.05  ? 338 PHE D CD2 1 
ATOM   10764 C CE1 . PHE D 1 338 ? 9.994   -4.281  17.420  1.00 69.65  ? 338 PHE D CE1 1 
ATOM   10765 C CE2 . PHE D 1 338 ? 9.587   -3.110  19.475  1.00 70.12  ? 338 PHE D CE2 1 
ATOM   10766 C CZ  . PHE D 1 338 ? 9.508   -4.275  18.722  1.00 67.94  ? 338 PHE D CZ  1 
ATOM   10767 N N   . PRO D 1 339 ? 12.380  2.215   17.311  1.00 64.14  ? 339 PRO D N   1 
ATOM   10768 C CA  . PRO D 1 339 ? 12.986  3.333   16.603  1.00 63.96  ? 339 PRO D CA  1 
ATOM   10769 C C   . PRO D 1 339 ? 13.239  2.988   15.133  1.00 70.98  ? 339 PRO D C   1 
ATOM   10770 O O   . PRO D 1 339 ? 13.917  2.026   14.793  1.00 70.53  ? 339 PRO D O   1 
ATOM   10771 C CB  . PRO D 1 339 ? 14.307  3.660   17.301  1.00 64.72  ? 339 PRO D CB  1 
ATOM   10772 C CG  . PRO D 1 339 ? 14.332  2.915   18.632  1.00 68.68  ? 339 PRO D CG  1 
ATOM   10773 C CD  . PRO D 1 339 ? 13.263  1.755   18.369  1.00 64.14  ? 339 PRO D CD  1 
ATOM   10774 N N   . GLU D 1 340 ? 12.619  3.788   14.244  1.00 69.04  ? 340 GLU D N   1 
ATOM   10775 C CA  . GLU D 1 340 ? 12.816  3.557   12.817  1.00 68.71  ? 340 GLU D CA  1 
ATOM   10776 C C   . GLU D 1 340 ? 14.238  3.071   12.533  1.00 72.11  ? 340 GLU D C   1 
ATOM   10777 O O   . GLU D 1 340 ? 14.469  2.052   11.892  1.00 70.08  ? 340 GLU D O   1 
ATOM   10778 C CB  . GLU D 1 340 ? 12.566  4.875   12.080  1.00 70.40  ? 340 GLU D CB  1 
ATOM   10779 C CG  . GLU D 1 340 ? 11.081  5.228   11.993  1.00 87.60  ? 340 GLU D CG  1 
ATOM   10780 C CD  . GLU D 1 340 ? 10.927  6.655   11.514  1.00 124.67 ? 340 GLU D CD  1 
ATOM   10781 O OE1 . GLU D 1 340 ? 9.914   7.270   11.818  1.00 127.73 ? 340 GLU D OE1 1 
ATOM   10782 O OE2 . GLU D 1 340 ? 11.818  7.135   10.813  1.00 123.85 ? 340 GLU D OE2 1 
ATOM   10783 N N   . LYS D 1 341 ? 15.210  3.874   13.007  1.00 69.11  ? 341 LYS D N   1 
ATOM   10784 C CA  . LYS D 1 341 ? 16.608  3.487   12.872  1.00 68.00  ? 341 LYS D CA  1 
ATOM   10785 C C   . LYS D 1 341 ? 17.250  3.274   14.244  1.00 67.72  ? 341 LYS D C   1 
ATOM   10786 O O   . LYS D 1 341 ? 17.099  4.067   15.164  1.00 68.16  ? 341 LYS D O   1 
ATOM   10787 C CB  . LYS D 1 341 ? 17.338  4.609   12.134  1.00 71.24  ? 341 LYS D CB  1 
ATOM   10788 C CG  . LYS D 1 341 ? 16.468  5.243   11.049  1.00 89.94  ? 341 LYS D CG  1 
ATOM   10789 C CD  . LYS D 1 341 ? 16.589  4.507   9.715   1.00 97.11  ? 341 LYS D CD  1 
ATOM   10790 C CE  . LYS D 1 341 ? 15.748  5.156   8.612   1.00 94.86  ? 341 LYS D CE  1 
ATOM   10791 N NZ  . LYS D 1 341 ? 15.814  4.344   7.400   1.00 82.76  ? 341 LYS D NZ  1 
ATOM   10792 N N   . PRO D 1 342 ? 17.951  2.135   14.380  1.00 59.92  ? 342 PRO D N   1 
ATOM   10793 C CA  . PRO D 1 342 ? 18.606  1.800   15.635  1.00 58.80  ? 342 PRO D CA  1 
ATOM   10794 C C   . PRO D 1 342 ? 19.788  2.727   15.912  1.00 65.45  ? 342 PRO D C   1 
ATOM   10795 O O   . PRO D 1 342 ? 20.344  3.361   15.025  1.00 66.30  ? 342 PRO D O   1 
ATOM   10796 C CB  . PRO D 1 342 ? 19.082  0.354   15.542  1.00 59.59  ? 342 PRO D CB  1 
ATOM   10797 C CG  . PRO D 1 342 ? 19.047  -0.071  14.075  1.00 63.29  ? 342 PRO D CG  1 
ATOM   10798 C CD  . PRO D 1 342 ? 18.186  1.095   13.392  1.00 59.52  ? 342 PRO D CD  1 
ATOM   10799 N N   . ASP D 1 343 ? 20.142  2.827   17.206  1.00 61.69  ? 343 ASP D N   1 
ATOM   10800 C CA  . ASP D 1 343 ? 21.259  3.685   17.575  1.00 61.06  ? 343 ASP D CA  1 
ATOM   10801 C C   . ASP D 1 343 ? 22.311  2.929   18.390  1.00 67.72  ? 343 ASP D C   1 
ATOM   10802 O O   . ASP D 1 343 ? 22.522  3.165   19.573  1.00 68.57  ? 343 ASP D O   1 
ATOM   10803 C CB  . ASP D 1 343 ? 20.715  4.862   18.384  1.00 61.47  ? 343 ASP D CB  1 
ATOM   10804 C CG  . ASP D 1 343 ? 21.840  5.853   18.645  1.00 63.64  ? 343 ASP D CG  1 
ATOM   10805 O OD1 . ASP D 1 343 ? 22.505  6.233   17.680  1.00 61.47  ? 343 ASP D OD1 1 
ATOM   10806 O OD2 . ASP D 1 343 ? 22.030  6.244   19.793  1.00 68.58  ? 343 ASP D OD2 1 
ATOM   10807 N N   . PHE D 1 344 ? 22.955  1.957   17.718  1.00 63.36  ? 344 PHE D N   1 
ATOM   10808 C CA  . PHE D 1 344 ? 24.018  1.211   18.378  1.00 62.21  ? 344 PHE D CA  1 
ATOM   10809 C C   . PHE D 1 344 ? 25.398  1.706   17.938  1.00 68.07  ? 344 PHE D C   1 
ATOM   10810 O O   . PHE D 1 344 ? 26.435  1.170   18.305  1.00 69.23  ? 344 PHE D O   1 
ATOM   10811 C CB  . PHE D 1 344 ? 23.853  -0.269  18.024  1.00 63.00  ? 344 PHE D CB  1 
ATOM   10812 C CG  . PHE D 1 344 ? 24.915  -1.079  18.710  1.00 63.28  ? 344 PHE D CG  1 
ATOM   10813 C CD1 . PHE D 1 344 ? 24.897  -1.207  20.093  1.00 63.76  ? 344 PHE D CD1 1 
ATOM   10814 C CD2 . PHE D 1 344 ? 25.906  -1.693  17.961  1.00 64.98  ? 344 PHE D CD2 1 
ATOM   10815 C CE1 . PHE D 1 344 ? 25.878  -1.956  20.728  1.00 63.66  ? 344 PHE D CE1 1 
ATOM   10816 C CE2 . PHE D 1 344 ? 26.886  -2.444  18.606  1.00 66.31  ? 344 PHE D CE2 1 
ATOM   10817 C CZ  . PHE D 1 344 ? 26.875  -2.579  19.988  1.00 62.94  ? 344 PHE D CZ  1 
ATOM   10818 N N   . HIS D 1 345 ? 25.378  2.750   17.084  1.00 63.85  ? 345 HIS D N   1 
ATOM   10819 C CA  . HIS D 1 345 ? 26.631  3.317   16.599  1.00 63.17  ? 345 HIS D CA  1 
ATOM   10820 C C   . HIS D 1 345 ? 27.595  2.231   16.118  1.00 70.59  ? 345 HIS D C   1 
ATOM   10821 O O   . HIS D 1 345 ? 28.263  1.567   16.898  1.00 75.28  ? 345 HIS D O   1 
ATOM   10822 C CB  . HIS D 1 345 ? 27.267  4.117   17.738  1.00 64.05  ? 345 HIS D CB  1 
ATOM   10823 C CG  . HIS D 1 345 ? 26.564  5.443   17.878  1.00 67.40  ? 345 HIS D CG  1 
ATOM   10824 N ND1 . HIS D 1 345 ? 26.257  6.238   16.822  1.00 68.84  ? 345 HIS D ND1 1 
ATOM   10825 C CD2 . HIS D 1 345 ? 26.131  6.074   19.049  1.00 69.09  ? 345 HIS D CD2 1 
ATOM   10826 C CE1 . HIS D 1 345 ? 25.652  7.321   17.347  1.00 68.23  ? 345 HIS D CE1 1 
ATOM   10827 N NE2 . HIS D 1 345 ? 25.564  7.250   18.678  1.00 68.71  ? 345 HIS D NE2 1 
ATOM   10828 O OXT . HIS D 1 345 ? 27.741  1.976   14.930  1.00 76.03  ? 345 HIS D OXT 1 
HETATM 10829 N N1  . 5I5 E 2 .   ? 9.204   -23.294 19.115  1.00 31.85  ? 500 5I5 A N1  1 
HETATM 10830 C C1  . 5I5 E 2 .   ? 8.719   -23.421 20.371  1.00 1.00   ? 500 5I5 A C1  1 
HETATM 10831 C C2  . 5I5 E 2 .   ? 8.567   -22.324 21.216  1.00 50.75  ? 500 5I5 A C2  1 
HETATM 10832 C C3  . 5I5 E 2 .   ? 8.959   -21.067 20.670  1.00 1.85   ? 500 5I5 A C3  1 
HETATM 10833 N N2  . 5I5 E 2 .   ? 9.436   -20.948 19.408  1.00 11.59  ? 500 5I5 A N2  1 
HETATM 10834 C C4  . 5I5 E 2 .   ? 9.556   -22.068 18.669  1.00 30.33  ? 500 5I5 A C4  1 
HETATM 10835 C C5  . 5I5 E 2 .   ? 8.113   -22.069 22.568  1.00 13.65  ? 500 5I5 A C5  1 
HETATM 10836 C C6  . 5I5 E 2 .   ? 8.259   -20.679 22.774  1.00 22.39  ? 500 5I5 A C6  1 
HETATM 10837 N N3  . 5I5 E 2 .   ? 8.752   -20.079 21.646  1.00 22.79  ? 500 5I5 A N3  1 
HETATM 10838 I I   . 5I5 E 2 .   ? 7.400   -23.390 23.953  1.00 27.40  ? 500 5I5 A I   1 
HETATM 10839 N N4  . 5I5 E 2 .   ? 8.441   -24.681 20.705  1.00 19.22  ? 500 5I5 A N4  1 
HETATM 10840 C C7  . 5I5 E 2 .   ? 8.015   -16.455 21.747  1.00 5.69   ? 500 5I5 A C7  1 
HETATM 10841 C C8  . 5I5 E 2 .   ? 7.610   -17.929 21.538  1.00 28.40  ? 500 5I5 A C8  1 
HETATM 10842 C C9  . 5I5 E 2 .   ? 8.967   -18.627 21.466  1.00 6.82   ? 500 5I5 A C9  1 
HETATM 10843 O O3  . 5I5 E 2 .   ? 9.650   -17.992 22.508  1.00 43.16  ? 500 5I5 A O3  1 
HETATM 10844 C C10 . 5I5 E 2 .   ? 9.402   -16.602 22.411  1.00 17.44  ? 500 5I5 A C10 1 
HETATM 10845 O O2  . 5I5 E 2 .   ? 8.103   -15.842 20.474  1.00 30.31  ? 500 5I5 A O2  1 
HETATM 10846 O O1  . 5I5 E 2 .   ? 6.762   -18.093 20.365  1.00 8.23   ? 500 5I5 A O1  1 
HETATM 10847 C C11 . 5I5 E 2 .   ? 9.453   -15.954 23.796  1.00 13.00  ? 500 5I5 A C11 1 
HETATM 10848 N N1  . 5I5 F 2 .   ? 6.416   20.655  -21.544 1.00 13.75  ? 500 5I5 B N1  1 
HETATM 10849 C C1  . 5I5 F 2 .   ? 5.744   20.833  -22.714 1.00 46.71  ? 500 5I5 B C1  1 
HETATM 10850 C C2  . 5I5 F 2 .   ? 5.400   19.744  -23.548 1.00 1.00   ? 500 5I5 B C2  1 
HETATM 10851 C C3  . 5I5 F 2 .   ? 5.804   18.456  -23.073 1.00 3.99   ? 500 5I5 B C3  1 
HETATM 10852 N N2  . 5I5 F 2 .   ? 6.493   18.296  -21.912 1.00 7.43   ? 500 5I5 B N2  1 
HETATM 10853 C C4  . 5I5 F 2 .   ? 6.794   19.405  -21.175 1.00 6.69   ? 500 5I5 B C4  1 
HETATM 10854 C C5  . 5I5 F 2 .   ? 4.721   19.515  -24.827 1.00 97.99  ? 500 5I5 B C5  1 
HETATM 10855 C C6  . 5I5 F 2 .   ? 4.733   18.130  -25.022 1.00 3.35   ? 500 5I5 B C6  1 
HETATM 10856 N N3  . 5I5 F 2 .   ? 5.370   17.491  -23.980 1.00 46.25  ? 500 5I5 B N3  1 
HETATM 10857 I I   . 5I5 F 2 .   ? 3.890   20.857  -26.159 1.00 27.92  ? 500 5I5 B I   1 
HETATM 10858 N N4  . 5I5 F 2 .   ? 5.449   22.126  -22.932 1.00 24.68  ? 500 5I5 B N4  1 
HETATM 10859 C C7  . 5I5 F 2 .   ? 4.569   13.849  -24.322 1.00 6.48   ? 500 5I5 B C7  1 
HETATM 10860 C C8  . 5I5 F 2 .   ? 4.225   15.289  -23.866 1.00 16.23  ? 500 5I5 B C8  1 
HETATM 10861 C C9  . 5I5 F 2 .   ? 5.563   16.019  -23.847 1.00 15.94  ? 500 5I5 B C9  1 
HETATM 10862 O O3  . 5I5 F 2 .   ? 6.217   15.439  -24.942 1.00 34.61  ? 500 5I5 B O3  1 
HETATM 10863 C C10 . 5I5 F 2 .   ? 5.952   14.056  -24.969 1.00 15.15  ? 500 5I5 B C10 1 
HETATM 10864 O O2  . 5I5 F 2 .   ? 4.609   12.938  -23.201 1.00 16.05  ? 500 5I5 B O2  1 
HETATM 10865 O O1  . 5I5 F 2 .   ? 3.564   15.279  -22.589 1.00 40.30  ? 500 5I5 B O1  1 
HETATM 10866 C C11 . 5I5 F 2 .   ? 6.088   13.488  -26.375 1.00 30.69  ? 500 5I5 B C11 1 
HETATM 10867 N N1  . 5I5 G 2 .   ? -9.019  -23.231 -19.850 1.00 16.31  ? 500 5I5 C N1  1 
HETATM 10868 C C1  . 5I5 G 2 .   ? -8.503  -23.412 -21.100 1.00 42.93  ? 500 5I5 C C1  1 
HETATM 10869 C C2  . 5I5 G 2 .   ? -8.247  -22.320 -21.956 1.00 1.00   ? 500 5I5 C C2  1 
HETATM 10870 C C3  . 5I5 G 2 .   ? -8.580  -21.049 -21.422 1.00 9.99   ? 500 5I5 C C3  1 
HETATM 10871 N N2  . 5I5 G 2 .   ? -9.121  -20.889 -20.174 1.00 13.48  ? 500 5I5 C N2  1 
HETATM 10872 C C4  . 5I5 G 2 .   ? -9.312  -21.985 -19.426 1.00 69.79  ? 500 5I5 C C4  1 
HETATM 10873 C C5  . 5I5 G 2 .   ? -7.721  -22.087 -23.304 1.00 25.37  ? 500 5I5 C C5  1 
HETATM 10874 C C6  . 5I5 G 2 .   ? -7.770  -20.690 -23.473 1.00 15.17  ? 500 5I5 C C6  1 
HETATM 10875 N N3  . 5I5 G 2 .   ? -8.277  -20.075 -22.363 1.00 14.63  ? 500 5I5 C N3  1 
HETATM 10876 I I   . 5I5 G 2 .   ? -7.049  -23.446 -24.743 1.00 29.11  ? 500 5I5 C I   1 
HETATM 10877 N N4  . 5I5 G 2 .   ? -8.277  -24.718 -21.402 1.00 14.28  ? 500 5I5 C N4  1 
HETATM 10878 C C7  . 5I5 G 2 .   ? -7.468  -16.438 -22.594 1.00 19.30  ? 500 5I5 C C7  1 
HETATM 10879 C C8  . 5I5 G 2 .   ? -7.127  -17.899 -22.164 1.00 16.67  ? 500 5I5 C C8  1 
HETATM 10880 C C9  . 5I5 G 2 .   ? -8.469  -18.610 -22.162 1.00 5.90   ? 500 5I5 C C9  1 
HETATM 10881 O O3  . 5I5 G 2 .   ? -9.164  -17.985 -23.204 1.00 38.25  ? 500 5I5 C O3  1 
HETATM 10882 C C10 . 5I5 G 2 .   ? -8.850  -16.609 -23.256 1.00 7.79   ? 500 5I5 C C10 1 
HETATM 10883 O O2  . 5I5 G 2 .   ? -7.496  -15.542 -21.501 1.00 19.01  ? 500 5I5 C O2  1 
HETATM 10884 O O1  . 5I5 G 2 .   ? -6.414  -17.991 -20.920 1.00 24.68  ? 500 5I5 C O1  1 
HETATM 10885 C C11 . 5I5 G 2 .   ? -8.861  -16.178 -24.718 1.00 69.80  ? 500 5I5 C C11 1 
HETATM 10886 N N1  . 5I5 H 2 .   ? -6.091  20.485  19.408  1.00 19.33  ? 500 5I5 D N1  1 
HETATM 10887 C C1  . 5I5 H 2 .   ? -5.399  20.625  20.567  1.00 5.47   ? 500 5I5 D C1  1 
HETATM 10888 C C2  . 5I5 H 2 .   ? -5.035  19.530  21.333  1.00 28.62  ? 500 5I5 D C2  1 
HETATM 10889 C C3  . 5I5 H 2 .   ? -5.445  18.254  20.865  1.00 2.07   ? 500 5I5 D C3  1 
HETATM 10890 N N2  . 5I5 H 2 .   ? -6.147  18.124  19.719  1.00 16.87  ? 500 5I5 D N2  1 
HETATM 10891 C C4  . 5I5 H 2 .   ? -6.426  19.232  19.018  1.00 15.97  ? 500 5I5 D C4  1 
HETATM 10892 C C5  . 5I5 H 2 .   ? -4.305  19.321  22.538  1.00 28.40  ? 500 5I5 D C5  1 
HETATM 10893 C C6  . 5I5 H 2 .   ? -4.292  17.917  22.742  1.00 9.91   ? 500 5I5 D C6  1 
HETATM 10894 N N3  . 5I5 H 2 .   ? -4.973  17.275  21.743  1.00 21.94  ? 500 5I5 D N3  1 
HETATM 10895 I I   . 5I5 H 2 .   ? -3.445  20.766  23.720  1.00 26.17  ? 500 5I5 D I   1 
HETATM 10896 N N4  . 5I5 H 2 .   ? -5.069  21.874  20.873  1.00 29.87  ? 500 5I5 D N4  1 
HETATM 10897 C C7  . 5I5 H 2 .   ? -3.973  13.662  21.882  1.00 16.39  ? 500 5I5 D C7  1 
HETATM 10898 C C8  . 5I5 H 2 .   ? -3.769  15.123  21.402  1.00 29.30  ? 500 5I5 D C8  1 
HETATM 10899 C C9  . 5I5 H 2 .   ? -5.135  15.786  21.562  1.00 9.91   ? 500 5I5 D C9  1 
HETATM 10900 O O3  . 5I5 H 2 .   ? -5.717  15.087  22.615  1.00 46.08  ? 500 5I5 D O3  1 
HETATM 10901 C C10 . 5I5 H 2 .   ? -5.320  13.728  22.595  1.00 18.59  ? 500 5I5 D C10 1 
HETATM 10902 O O2  . 5I5 H 2 .   ? -3.961  12.729  20.803  1.00 10.01  ? 500 5I5 D O2  1 
HETATM 10903 O O1  . 5I5 H 2 .   ? -3.275  15.170  20.042  1.00 13.53  ? 500 5I5 D O1  1 
HETATM 10904 C C11 . 5I5 H 2 .   ? -5.234  13.194  24.011  1.00 15.22  ? 500 5I5 D C11 1 
HETATM 10905 O O   . HOH I 3 .   ? 12.334  -21.821 16.406  1.00 3.96   ? 501 HOH A O   1 
HETATM 10906 O O   . HOH I 3 .   ? 19.335  -16.940 25.345  1.00 10.23  ? 502 HOH A O   1 
HETATM 10907 O O   . HOH I 3 .   ? 17.891  -27.396 26.392  1.00 10.04  ? 503 HOH A O   1 
HETATM 10908 O O   . HOH I 3 .   ? 15.416  -19.099 25.340  1.00 19.20  ? 504 HOH A O   1 
HETATM 10909 O O   . HOH I 3 .   ? 9.301   -20.640 0.302   1.00 13.00  ? 505 HOH A O   1 
HETATM 10910 O O   . HOH I 3 .   ? -7.878  -24.062 -0.372  1.00 11.73  ? 506 HOH A O   1 
HETATM 10911 O O   . HOH I 3 .   ? 32.073  -29.057 14.245  1.00 17.86  ? 507 HOH A O   1 
HETATM 10912 O O   . HOH I 3 .   ? 36.475  -33.448 19.990  1.00 14.94  ? 508 HOH A O   1 
HETATM 10913 O O   . HOH I 3 .   ? 21.042  -17.332 3.811   1.00 21.68  ? 509 HOH A O   1 
HETATM 10914 O O   . HOH I 3 .   ? 7.109   -31.248 17.417  1.00 11.63  ? 510 HOH A O   1 
HETATM 10915 O O   . HOH I 3 .   ? 2.273   -17.401 34.352  1.00 23.85  ? 511 HOH A O   1 
HETATM 10916 O O   . HOH I 3 .   ? 34.061  -19.728 15.161  1.00 17.21  ? 512 HOH A O   1 
HETATM 10917 O O   . HOH I 3 .   ? 7.305   -12.560 4.063   1.00 12.31  ? 513 HOH A O   1 
HETATM 10918 O O   . HOH I 3 .   ? 35.368  -6.505  22.124  1.00 23.39  ? 514 HOH A O   1 
HETATM 10919 O O   . HOH I 3 .   ? 9.689   -27.632 19.133  1.00 9.75   ? 515 HOH A O   1 
HETATM 10920 O O   . HOH I 3 .   ? -7.808  -30.117 30.739  1.00 24.69  ? 516 HOH A O   1 
HETATM 10921 O O   . HOH I 3 .   ? 22.889  0.687   31.749  1.00 32.09  ? 517 HOH A O   1 
HETATM 10922 O O   . HOH I 3 .   ? 3.263   -22.541 11.942  1.00 26.70  ? 518 HOH A O   1 
HETATM 10923 O O   . HOH I 3 .   ? 6.686   -13.339 11.596  1.00 14.71  ? 519 HOH A O   1 
HETATM 10924 O O   . HOH I 3 .   ? 19.359  -2.361  0.959   1.00 25.14  ? 520 HOH A O   1 
HETATM 10925 O O   . HOH I 3 .   ? 16.050  -16.551 29.038  1.00 1.52   ? 521 HOH A O   1 
HETATM 10926 O O   . HOH I 3 .   ? 1.477   -31.556 13.755  1.00 15.80  ? 522 HOH A O   1 
HETATM 10927 O O   . HOH I 3 .   ? -4.256  -28.347 16.467  1.00 26.96  ? 523 HOH A O   1 
HETATM 10928 O O   . HOH I 3 .   ? -0.632  -28.662 0.090   1.00 30.43  ? 524 HOH A O   1 
HETATM 10929 O O   . HOH I 3 .   ? 39.999  -24.603 29.533  1.00 20.46  ? 525 HOH A O   1 
HETATM 10930 O O   . HOH I 3 .   ? -3.240  -7.674  19.805  1.00 28.08  ? 526 HOH A O   1 
HETATM 10931 O O   . HOH I 3 .   ? -5.877  -18.650 10.967  1.00 21.07  ? 527 HOH A O   1 
HETATM 10932 O O   . HOH I 3 .   ? 16.704  -43.802 22.478  1.00 26.16  ? 528 HOH A O   1 
HETATM 10933 O O   . HOH I 3 .   ? -12.509 -29.718 32.200  1.00 29.26  ? 529 HOH A O   1 
HETATM 10934 O O   . HOH I 3 .   ? -5.687  -23.117 3.502   1.00 25.63  ? 530 HOH A O   1 
HETATM 10935 O O   . HOH I 3 .   ? 38.669  -10.097 31.543  1.00 33.82  ? 531 HOH A O   1 
HETATM 10936 O O   . HOH I 3 .   ? 2.738   -34.407 4.380   1.00 12.51  ? 532 HOH A O   1 
HETATM 10937 O O   . HOH I 3 .   ? -11.831 -13.824 32.731  1.00 24.81  ? 533 HOH A O   1 
HETATM 10938 O O   . HOH I 3 .   ? 8.893   -17.788 -0.921  1.00 25.54  ? 534 HOH A O   1 
HETATM 10939 O O   . HOH I 3 .   ? 18.078  -14.999 29.936  1.00 28.03  ? 535 HOH A O   1 
HETATM 10940 O O   . HOH I 3 .   ? -6.819  -19.163 1.972   1.00 16.25  ? 536 HOH A O   1 
HETATM 10941 O O   . HOH I 3 .   ? 2.644   -28.917 19.745  1.00 22.39  ? 537 HOH A O   1 
HETATM 10942 O O   . HOH I 3 .   ? 7.559   -1.796  8.169   1.00 41.85  ? 538 HOH A O   1 
HETATM 10943 O O   . HOH I 3 .   ? 31.241  -35.684 34.382  1.00 33.64  ? 539 HOH A O   1 
HETATM 10944 O O   . HOH I 3 .   ? 5.739   -21.026 0.171   1.00 37.26  ? 540 HOH A O   1 
HETATM 10945 O O   . HOH I 3 .   ? 7.561   -11.477 32.503  1.00 20.34  ? 541 HOH A O   1 
HETATM 10946 O O   . HOH I 3 .   ? 9.443   -31.499 -2.788  1.00 12.84  ? 542 HOH A O   1 
HETATM 10947 O O   . HOH I 3 .   ? -18.522 -7.674  30.697  1.00 33.98  ? 543 HOH A O   1 
HETATM 10948 O O   . HOH I 3 .   ? 31.976  -14.576 8.828   1.00 24.51  ? 544 HOH A O   1 
HETATM 10949 O O   . HOH I 3 .   ? 19.769  -15.922 38.448  1.00 36.98  ? 545 HOH A O   1 
HETATM 10950 O O   . HOH I 3 .   ? 7.289   -18.539 40.776  1.00 28.63  ? 546 HOH A O   1 
HETATM 10951 O O   . HOH I 3 .   ? 18.129  -16.037 -7.641  1.00 26.14  ? 547 HOH A O   1 
HETATM 10952 O O   . HOH I 3 .   ? 24.339  -11.119 -1.866  1.00 39.71  ? 548 HOH A O   1 
HETATM 10953 O O   . HOH I 3 .   ? 25.358  -1.507  32.269  1.00 31.68  ? 549 HOH A O   1 
HETATM 10954 O O   . HOH I 3 .   ? 35.529  -26.859 20.808  1.00 35.87  ? 550 HOH A O   1 
HETATM 10955 O O   . HOH I 3 .   ? -9.021  -6.627  12.146  1.00 34.33  ? 551 HOH A O   1 
HETATM 10956 O O   . HOH I 3 .   ? 5.579   -10.536 31.078  1.00 24.60  ? 552 HOH A O   1 
HETATM 10957 O O   . HOH I 3 .   ? 40.960  -16.211 26.790  1.00 27.85  ? 553 HOH A O   1 
HETATM 10958 O O   . HOH I 3 .   ? -1.182  -9.143  6.501   1.00 31.43  ? 554 HOH A O   1 
HETATM 10959 O O   . HOH I 3 .   ? 23.996  -38.995 13.619  1.00 27.11  ? 555 HOH A O   1 
HETATM 10960 O O   . HOH I 3 .   ? -3.091  -28.688 42.686  1.00 38.77  ? 556 HOH A O   1 
HETATM 10961 O O   . HOH I 3 .   ? -6.667  -26.589 44.699  1.00 25.70  ? 557 HOH A O   1 
HETATM 10962 O O   . HOH I 3 .   ? 9.658   -0.646  5.416   1.00 31.14  ? 558 HOH A O   1 
HETATM 10963 O O   . HOH I 3 .   ? -11.661 -7.945  21.404  1.00 41.66  ? 559 HOH A O   1 
HETATM 10964 O O   . HOH I 3 .   ? 8.025   -29.024 4.775   1.00 25.10  ? 560 HOH A O   1 
HETATM 10965 O O   . HOH I 3 .   ? 9.079   -13.723 14.996  1.00 23.87  ? 561 HOH A O   1 
HETATM 10966 O O   . HOH I 3 .   ? 18.509  -23.370 37.245  1.00 26.02  ? 562 HOH A O   1 
HETATM 10967 O O   . HOH I 3 .   ? -8.130  -18.459 8.956   1.00 31.85  ? 563 HOH A O   1 
HETATM 10968 O O   . HOH I 3 .   ? 24.823  -31.627 37.799  1.00 22.90  ? 564 HOH A O   1 
HETATM 10969 O O   . HOH I 3 .   ? 27.996  -35.975 21.191  1.00 41.75  ? 565 HOH A O   1 
HETATM 10970 O O   . HOH I 3 .   ? 14.818  -22.206 30.796  1.00 34.05  ? 566 HOH A O   1 
HETATM 10971 O O   . HOH I 3 .   ? 15.636  -0.204  27.769  1.00 28.29  ? 567 HOH A O   1 
HETATM 10972 O O   . HOH I 3 .   ? 22.868  -20.218 37.300  1.00 34.10  ? 568 HOH A O   1 
HETATM 10973 O O   . HOH I 3 .   ? 3.551   -5.621  29.852  1.00 40.93  ? 569 HOH A O   1 
HETATM 10974 O O   . HOH I 3 .   ? 14.477  -4.121  37.951  1.00 32.91  ? 570 HOH A O   1 
HETATM 10975 O O   . HOH I 3 .   ? 35.780  -29.504 33.421  1.00 31.20  ? 571 HOH A O   1 
HETATM 10976 O O   . HOH I 3 .   ? 36.137  -28.963 30.371  1.00 26.87  ? 572 HOH A O   1 
HETATM 10977 O O   . HOH I 3 .   ? 36.605  -10.283 22.245  1.00 18.97  ? 573 HOH A O   1 
HETATM 10978 O O   . HOH I 3 .   ? 24.760  -1.821  24.728  1.00 50.25  ? 574 HOH A O   1 
HETATM 10979 O O   . HOH I 3 .   ? 27.337  -15.348 37.407  1.00 30.09  ? 575 HOH A O   1 
HETATM 10980 O O   . HOH I 3 .   ? 32.426  -32.538 28.995  1.00 24.07  ? 576 HOH A O   1 
HETATM 10981 O O   . HOH I 3 .   ? 8.075   -32.300 10.008  1.00 23.54  ? 577 HOH A O   1 
HETATM 10982 O O   . HOH I 3 .   ? 5.939   -4.244  12.306  1.00 28.34  ? 578 HOH A O   1 
HETATM 10983 O O   . HOH I 3 .   ? -2.441  -13.225 38.913  1.00 31.53  ? 579 HOH A O   1 
HETATM 10984 O O   . HOH I 3 .   ? 13.889  -7.814  25.295  1.00 24.90  ? 580 HOH A O   1 
HETATM 10985 O O   . HOH I 3 .   ? 36.421  -16.101 27.297  1.00 36.13  ? 581 HOH A O   1 
HETATM 10986 O O   . HOH I 3 .   ? 32.881  -2.605  5.939   1.00 39.49  ? 582 HOH A O   1 
HETATM 10987 O O   . HOH I 3 .   ? 27.349  -3.922  27.458  1.00 46.45  ? 583 HOH A O   1 
HETATM 10988 O O   . HOH I 3 .   ? 24.614  -34.308 36.836  1.00 31.82  ? 584 HOH A O   1 
HETATM 10989 O O   . HOH I 3 .   ? -6.669  -21.570 42.276  1.00 45.03  ? 585 HOH A O   1 
HETATM 10990 O O   . HOH I 3 .   ? -1.582  -33.031 9.901   1.00 31.25  ? 586 HOH A O   1 
HETATM 10991 O O   . HOH I 3 .   ? 17.531  -12.563 35.772  1.00 43.67  ? 587 HOH A O   1 
HETATM 10992 O O   . HOH I 3 .   ? 1.169   -6.598  0.763   1.00 34.75  ? 588 HOH A O   1 
HETATM 10993 O O   . HOH I 3 .   ? 33.599  -14.645 13.635  1.00 31.61  ? 589 HOH A O   1 
HETATM 10994 O O   . HOH I 3 .   ? 35.545  -29.635 21.682  1.00 35.79  ? 590 HOH A O   1 
HETATM 10995 O O   . HOH I 3 .   ? 9.048   -1.103  34.037  1.00 44.03  ? 591 HOH A O   1 
HETATM 10996 O O   . HOH I 3 .   ? -13.845 -22.220 16.833  1.00 52.80  ? 592 HOH A O   1 
HETATM 10997 O O   . HOH I 3 .   ? 28.999  -32.561 21.332  1.00 31.19  ? 593 HOH A O   1 
HETATM 10998 O O   . HOH I 3 .   ? -15.497 -24.034 22.855  1.00 47.62  ? 594 HOH A O   1 
HETATM 10999 O O   . HOH I 3 .   ? -5.917  -22.971 -0.644  1.00 16.93  ? 595 HOH A O   1 
HETATM 11000 O O   . HOH I 3 .   ? 1.248   -12.117 22.156  1.00 24.58  ? 596 HOH A O   1 
HETATM 11001 O O   . HOH I 3 .   ? -3.627  -24.262 6.885   1.00 39.59  ? 597 HOH A O   1 
HETATM 11002 O O   . HOH I 3 .   ? 12.267  -22.108 30.185  1.00 26.03  ? 598 HOH A O   1 
HETATM 11003 O O   . HOH I 3 .   ? -2.790  -28.277 -0.454  1.00 41.52  ? 599 HOH A O   1 
HETATM 11004 O O   . HOH I 3 .   ? 28.969  -0.853  4.684   1.00 54.51  ? 600 HOH A O   1 
HETATM 11005 O O   . HOH I 3 .   ? 30.117  -27.332 12.488  1.00 37.35  ? 601 HOH A O   1 
HETATM 11006 O O   . HOH I 3 .   ? 24.347  -8.141  34.406  1.00 52.22  ? 602 HOH A O   1 
HETATM 11007 O O   . HOH I 3 .   ? -8.058  -24.325 20.943  1.00 43.72  ? 603 HOH A O   1 
HETATM 11008 O O   . HOH I 3 .   ? 18.469  -21.146 37.769  1.00 47.14  ? 604 HOH A O   1 
HETATM 11009 O O   . HOH I 3 .   ? -10.101 -24.852 32.806  1.00 58.42  ? 605 HOH A O   1 
HETATM 11010 O O   . HOH I 3 .   ? -11.061 -17.408 36.302  1.00 33.82  ? 606 HOH A O   1 
HETATM 11011 O O   . HOH I 3 .   ? -0.629  -23.601 38.138  1.00 52.18  ? 607 HOH A O   1 
HETATM 11012 O O   . HOH I 3 .   ? -13.692 -11.132 28.560  1.00 44.25  ? 608 HOH A O   1 
HETATM 11013 O O   . HOH I 3 .   ? 16.059  -37.258 26.119  1.00 32.48  ? 609 HOH A O   1 
HETATM 11014 O O   . HOH I 3 .   ? 15.285  -9.938  32.355  1.00 32.86  ? 610 HOH A O   1 
HETATM 11015 O O   . HOH I 3 .   ? 34.472  -34.282 26.407  1.00 42.05  ? 611 HOH A O   1 
HETATM 11016 O O   . HOH I 3 .   ? -14.405 -24.671 18.565  1.00 55.03  ? 612 HOH A O   1 
HETATM 11017 O O   . HOH I 3 .   ? 13.647  -0.016  25.760  1.00 50.01  ? 613 HOH A O   1 
HETATM 11018 O O   . HOH I 3 .   ? 3.088   -8.794  15.652  1.00 37.24  ? 614 HOH A O   1 
HETATM 11019 O O   . HOH I 3 .   ? 11.011  -12.927 0.723   1.00 34.40  ? 615 HOH A O   1 
HETATM 11020 O O   . HOH I 3 .   ? 12.316  -33.804 8.371   1.00 37.57  ? 616 HOH A O   1 
HETATM 11021 O O   . HOH I 3 .   ? 39.958  -28.835 16.681  1.00 45.92  ? 617 HOH A O   1 
HETATM 11022 O O   . HOH I 3 .   ? 35.282  -23.092 35.539  1.00 54.36  ? 618 HOH A O   1 
HETATM 11023 O O   . HOH I 3 .   ? 39.739  -28.714 9.498   1.00 41.35  ? 619 HOH A O   1 
HETATM 11024 O O   . HOH I 3 .   ? -10.603 -10.425 12.589  1.00 35.41  ? 620 HOH A O   1 
HETATM 11025 O O   . HOH I 3 .   ? 27.065  -36.564 15.358  1.00 33.74  ? 621 HOH A O   1 
HETATM 11026 O O   . HOH I 3 .   ? -9.629  -12.608 19.218  1.00 39.88  ? 622 HOH A O   1 
HETATM 11027 O O   . HOH I 3 .   ? 25.882  -34.262 9.160   1.00 42.36  ? 623 HOH A O   1 
HETATM 11028 O O   . HOH I 3 .   ? 1.518   -1.233  20.314  1.00 51.20  ? 624 HOH A O   1 
HETATM 11029 O O   . HOH I 3 .   ? 1.700   1.415   20.408  1.00 52.76  ? 625 HOH A O   1 
HETATM 11030 O O   . HOH J 3 .   ? 9.794   18.869  -19.458 1.00 1.00   ? 501 HOH B O   1 
HETATM 11031 O O   . HOH J 3 .   ? 15.446  13.829  -29.379 1.00 1.00   ? 502 HOH B O   1 
HETATM 11032 O O   . HOH J 3 .   ? 1.539   19.161  -13.498 1.00 7.09   ? 503 HOH B O   1 
HETATM 11033 O O   . HOH J 3 .   ? 13.619  33.667  -23.395 1.00 19.87  ? 504 HOH B O   1 
HETATM 11034 O O   . HOH J 3 .   ? 34.757  30.128  -18.934 1.00 8.62   ? 505 HOH B O   1 
HETATM 11035 O O   . HOH J 3 .   ? 3.560   27.632  -28.358 1.00 7.91   ? 506 HOH B O   1 
HETATM 11036 O O   . HOH J 3 .   ? 8.652   19.774  -0.409  1.00 20.74  ? 507 HOH B O   1 
HETATM 11037 O O   . HOH J 3 .   ? 6.044   10.587  -17.740 1.00 21.81  ? 508 HOH B O   1 
HETATM 11038 O O   . HOH J 3 .   ? 0.678   28.461  -11.355 1.00 13.90  ? 509 HOH B O   1 
HETATM 11039 O O   . HOH J 3 .   ? 32.138  6.299   -29.368 1.00 26.27  ? 510 HOH B O   1 
HETATM 11040 O O   . HOH J 3 .   ? -3.266  3.015   -24.532 1.00 30.73  ? 511 HOH B O   1 
HETATM 11041 O O   . HOH J 3 .   ? 7.084   21.780  -12.818 1.00 18.22  ? 512 HOH B O   1 
HETATM 11042 O O   . HOH J 3 .   ? 35.135  5.356   -31.155 1.00 24.25  ? 513 HOH B O   1 
HETATM 11043 O O   . HOH J 3 .   ? 4.610   10.114  -13.774 1.00 10.39  ? 514 HOH B O   1 
HETATM 11044 O O   . HOH J 3 .   ? 7.160   24.591  -21.762 1.00 28.46  ? 515 HOH B O   1 
HETATM 11045 O O   . HOH J 3 .   ? 29.322  28.222  -34.048 1.00 19.15  ? 516 HOH B O   1 
HETATM 11046 O O   . HOH J 3 .   ? -7.830  28.644  -14.697 1.00 14.02  ? 517 HOH B O   1 
HETATM 11047 O O   . HOH J 3 .   ? 28.772  32.612  -31.145 1.00 30.53  ? 518 HOH B O   1 
HETATM 11048 O O   . HOH J 3 .   ? 9.323   33.985  -8.093  1.00 24.78  ? 519 HOH B O   1 
HETATM 11049 O O   . HOH J 3 .   ? 9.859   18.988  -33.954 1.00 12.42  ? 520 HOH B O   1 
HETATM 11050 O O   . HOH J 3 .   ? 3.842   27.660  -31.051 1.00 19.13  ? 521 HOH B O   1 
HETATM 11051 O O   . HOH J 3 .   ? 4.531   6.288   -16.303 1.00 18.33  ? 522 HOH B O   1 
HETATM 11052 O O   . HOH J 3 .   ? 26.774  10.816  -3.958  1.00 16.22  ? 523 HOH B O   1 
HETATM 11053 O O   . HOH J 3 .   ? 26.003  31.722  -27.301 1.00 14.40  ? 524 HOH B O   1 
HETATM 11054 O O   . HOH J 3 .   ? 24.545  2.393   -16.712 1.00 15.45  ? 525 HOH B O   1 
HETATM 11055 O O   . HOH J 3 .   ? -3.069  15.395  -36.691 1.00 24.75  ? 526 HOH B O   1 
HETATM 11056 O O   . HOH J 3 .   ? 33.182  18.677  -6.693  1.00 25.72  ? 527 HOH B O   1 
HETATM 11057 O O   . HOH J 3 .   ? 17.147  9.185   -35.784 1.00 25.76  ? 528 HOH B O   1 
HETATM 11058 O O   . HOH J 3 .   ? 19.256  -3.076  -16.765 1.00 23.85  ? 529 HOH B O   1 
HETATM 11059 O O   . HOH J 3 .   ? 25.012  17.670  -9.384  1.00 23.96  ? 530 HOH B O   1 
HETATM 11060 O O   . HOH J 3 .   ? 10.049  3.812   -32.430 1.00 33.41  ? 531 HOH B O   1 
HETATM 11061 O O   . HOH J 3 .   ? 26.654  28.959  -26.017 1.00 18.73  ? 532 HOH B O   1 
HETATM 11062 O O   . HOH J 3 .   ? 12.527  2.211   -6.128  1.00 24.66  ? 533 HOH B O   1 
HETATM 11063 O O   . HOH J 3 .   ? 17.305  14.798  3.666   1.00 33.55  ? 534 HOH B O   1 
HETATM 11064 O O   . HOH J 3 .   ? 7.293   25.932  -6.737  1.00 18.30  ? 535 HOH B O   1 
HETATM 11065 O O   . HOH J 3 .   ? 32.197  22.168  -34.147 1.00 31.69  ? 536 HOH B O   1 
HETATM 11066 O O   . HOH J 3 .   ? 13.386  17.137  5.988   1.00 26.31  ? 537 HOH B O   1 
HETATM 11067 O O   . HOH J 3 .   ? 8.437   14.611  -35.498 1.00 30.36  ? 538 HOH B O   1 
HETATM 11068 O O   . HOH J 3 .   ? 7.072   21.078  -37.405 1.00 32.77  ? 539 HOH B O   1 
HETATM 11069 O O   . HOH J 3 .   ? 4.911   1.905   -6.442  1.00 28.52  ? 540 HOH B O   1 
HETATM 11070 O O   . HOH J 3 .   ? 30.507  3.790   -35.111 1.00 34.49  ? 541 HOH B O   1 
HETATM 11071 O O   . HOH J 3 .   ? -10.613 30.282  -23.667 1.00 36.50  ? 542 HOH B O   1 
HETATM 11072 O O   . HOH J 3 .   ? 33.307  18.142  -37.024 1.00 42.96  ? 543 HOH B O   1 
HETATM 11073 O O   . HOH J 3 .   ? 29.325  10.552  -40.954 1.00 27.53  ? 544 HOH B O   1 
HETATM 11074 O O   . HOH J 3 .   ? 16.376  18.255  4.750   1.00 47.87  ? 545 HOH B O   1 
HETATM 11075 O O   . HOH J 3 .   ? 34.972  22.868  -30.814 1.00 40.53  ? 546 HOH B O   1 
HETATM 11076 O O   . HOH J 3 .   ? 25.681  4.009   -32.757 1.00 23.07  ? 547 HOH B O   1 
HETATM 11077 O O   . HOH J 3 .   ? 0.271   7.404   -28.544 1.00 30.49  ? 548 HOH B O   1 
HETATM 11078 O O   . HOH J 3 .   ? 13.463  9.409   -33.007 1.00 34.02  ? 549 HOH B O   1 
HETATM 11079 O O   . HOH J 3 .   ? 9.391   15.375  -2.046  1.00 18.76  ? 550 HOH B O   1 
HETATM 11080 O O   . HOH J 3 .   ? -1.975  26.925  -17.671 1.00 38.65  ? 551 HOH B O   1 
HETATM 11081 O O   . HOH J 3 .   ? -23.012 8.951   -19.559 1.00 36.33  ? 552 HOH B O   1 
HETATM 11082 O O   . HOH J 3 .   ? -9.958  0.163   -13.011 1.00 23.46  ? 553 HOH B O   1 
HETATM 11083 O O   . HOH J 3 .   ? 43.104  14.817  -13.656 1.00 25.85  ? 554 HOH B O   1 
HETATM 11084 O O   . HOH J 3 .   ? -15.547 24.154  -30.691 1.00 43.03  ? 555 HOH B O   1 
HETATM 11085 O O   . HOH J 3 .   ? 3.122   15.421  -41.977 1.00 21.02  ? 556 HOH B O   1 
HETATM 11086 O O   . HOH J 3 .   ? 12.599  27.080  -39.438 1.00 25.39  ? 557 HOH B O   1 
HETATM 11087 O O   . HOH J 3 .   ? 13.668  37.165  -21.645 1.00 28.29  ? 558 HOH B O   1 
HETATM 11088 O O   . HOH J 3 .   ? 0.603   6.220   -17.962 1.00 27.75  ? 559 HOH B O   1 
HETATM 11089 O O   . HOH J 3 .   ? 32.841  16.585  -7.950  1.00 36.28  ? 560 HOH B O   1 
HETATM 11090 O O   . HOH J 3 .   ? 8.405   31.611  -0.800  1.00 26.77  ? 561 HOH B O   1 
HETATM 11091 O O   . HOH J 3 .   ? 13.704  12.880  -40.637 1.00 24.60  ? 562 HOH B O   1 
HETATM 11092 O O   . HOH J 3 .   ? 7.947   6.797   -4.022  1.00 20.93  ? 563 HOH B O   1 
HETATM 11093 O O   . HOH J 3 .   ? -8.137  15.961  -42.840 1.00 24.20  ? 564 HOH B O   1 
HETATM 11094 O O   . HOH J 3 .   ? 0.247   28.172  -7.143  1.00 43.42  ? 565 HOH B O   1 
HETATM 11095 O O   . HOH J 3 .   ? 0.168   2.784   -46.594 1.00 17.42  ? 566 HOH B O   1 
HETATM 11096 O O   . HOH J 3 .   ? 35.654  16.448  -23.402 1.00 42.58  ? 567 HOH B O   1 
HETATM 11097 O O   . HOH J 3 .   ? 19.500  -1.891  -36.920 1.00 34.07  ? 568 HOH B O   1 
HETATM 11098 O O   . HOH J 3 .   ? 6.514   1.898   -39.989 1.00 32.41  ? 569 HOH B O   1 
HETATM 11099 O O   . HOH J 3 .   ? 12.907  35.389  -25.695 1.00 33.89  ? 570 HOH B O   1 
HETATM 11100 O O   . HOH J 3 .   ? -7.669  33.376  -18.592 1.00 36.92  ? 571 HOH B O   1 
HETATM 11101 O O   . HOH J 3 .   ? 26.348  4.053   -38.297 1.00 35.88  ? 572 HOH B O   1 
HETATM 11102 O O   . HOH J 3 .   ? 33.760  19.236  -40.155 1.00 45.84  ? 573 HOH B O   1 
HETATM 11103 O O   . HOH J 3 .   ? 20.874  -2.130  -4.411  1.00 26.84  ? 574 HOH B O   1 
HETATM 11104 O O   . HOH J 3 .   ? 10.940  13.346  -32.197 1.00 44.55  ? 575 HOH B O   1 
HETATM 11105 O O   . HOH J 3 .   ? 17.058  -1.340  -4.611  1.00 34.26  ? 576 HOH B O   1 
HETATM 11106 O O   . HOH J 3 .   ? -19.372 12.350  -17.688 1.00 33.73  ? 577 HOH B O   1 
HETATM 11107 O O   . HOH J 3 .   ? 20.681  -1.453  -20.691 1.00 33.48  ? 578 HOH B O   1 
HETATM 11108 O O   . HOH J 3 .   ? 29.886  24.738  -20.341 1.00 36.35  ? 579 HOH B O   1 
HETATM 11109 O O   . HOH J 3 .   ? 38.011  17.811  -22.531 1.00 36.20  ? 580 HOH B O   1 
HETATM 11110 O O   . HOH J 3 .   ? 10.455  34.014  -36.214 1.00 58.61  ? 581 HOH B O   1 
HETATM 11111 O O   . HOH J 3 .   ? -11.797 20.049  -16.042 1.00 29.18  ? 582 HOH B O   1 
HETATM 11112 O O   . HOH J 3 .   ? 7.543   19.369  -32.646 1.00 20.49  ? 583 HOH B O   1 
HETATM 11113 O O   . HOH J 3 .   ? -1.083  0.488   -14.725 1.00 39.29  ? 584 HOH B O   1 
HETATM 11114 O O   . HOH J 3 .   ? -7.975  22.179  -19.259 1.00 20.84  ? 585 HOH B O   1 
HETATM 11115 O O   . HOH J 3 .   ? 31.413  -1.458  -11.473 1.00 41.90  ? 586 HOH B O   1 
HETATM 11116 O O   . HOH J 3 .   ? 42.260  9.153   -38.504 1.00 27.14  ? 587 HOH B O   1 
HETATM 11117 O O   . HOH J 3 .   ? 16.991  30.679  -31.641 1.00 29.79  ? 588 HOH B O   1 
HETATM 11118 O O   . HOH J 3 .   ? 6.696   21.021  -34.302 1.00 22.71  ? 589 HOH B O   1 
HETATM 11119 O O   . HOH J 3 .   ? -0.630  15.471  -5.946  1.00 27.12  ? 590 HOH B O   1 
HETATM 11120 O O   . HOH J 3 .   ? 13.363  12.425  -34.166 1.00 23.65  ? 591 HOH B O   1 
HETATM 11121 O O   . HOH J 3 .   ? 17.800  -5.987  -14.828 1.00 38.65  ? 592 HOH B O   1 
HETATM 11122 O O   . HOH J 3 .   ? 8.342   8.796   -6.719  1.00 50.32  ? 593 HOH B O   1 
HETATM 11123 O O   . HOH J 3 .   ? -3.041  26.510  -33.191 1.00 37.92  ? 594 HOH B O   1 
HETATM 11124 O O   . HOH J 3 .   ? 5.235   17.542  -2.464  1.00 13.30  ? 595 HOH B O   1 
HETATM 11125 O O   . HOH J 3 .   ? 26.007  24.330  -44.480 1.00 28.41  ? 596 HOH B O   1 
HETATM 11126 O O   . HOH J 3 .   ? 29.356  13.480  -7.618  1.00 25.14  ? 597 HOH B O   1 
HETATM 11127 O O   . HOH J 3 .   ? 21.455  -3.210  -30.245 1.00 27.35  ? 598 HOH B O   1 
HETATM 11128 O O   . HOH J 3 .   ? 5.222   29.485  -26.142 1.00 15.94  ? 599 HOH B O   1 
HETATM 11129 O O   . HOH J 3 .   ? 6.601   27.657  -0.285  1.00 28.76  ? 600 HOH B O   1 
HETATM 11130 O O   . HOH J 3 .   ? 23.544  7.482   -2.920  1.00 32.40  ? 601 HOH B O   1 
HETATM 11131 O O   . HOH J 3 .   ? -0.765  22.497  -33.983 1.00 47.09  ? 602 HOH B O   1 
HETATM 11132 O O   . HOH J 3 .   ? 16.390  2.887   -33.033 1.00 33.04  ? 603 HOH B O   1 
HETATM 11133 O O   . HOH J 3 .   ? -16.463 29.429  -24.834 1.00 44.64  ? 604 HOH B O   1 
HETATM 11134 O O   . HOH J 3 .   ? 32.251  27.531  -15.078 1.00 29.86  ? 605 HOH B O   1 
HETATM 11135 O O   . HOH J 3 .   ? -6.370  19.897  -39.758 1.00 43.73  ? 606 HOH B O   1 
HETATM 11136 O O   . HOH J 3 .   ? -26.287 5.098   -17.818 1.00 41.41  ? 607 HOH B O   1 
HETATM 11137 O O   . HOH J 3 .   ? 32.213  19.568  -34.830 1.00 30.56  ? 608 HOH B O   1 
HETATM 11138 O O   . HOH J 3 .   ? 14.535  0.177   -12.176 1.00 34.91  ? 609 HOH B O   1 
HETATM 11139 O O   . HOH J 3 .   ? 29.688  9.280   -7.790  1.00 39.69  ? 610 HOH B O   1 
HETATM 11140 O O   . HOH J 3 .   ? 8.570   3.907   -18.709 1.00 37.61  ? 611 HOH B O   1 
HETATM 11141 O O   . HOH J 3 .   ? 13.116  13.616  -30.143 1.00 30.60  ? 612 HOH B O   1 
HETATM 11142 O O   . HOH J 3 .   ? 0.263   5.539   -25.829 1.00 27.81  ? 613 HOH B O   1 
HETATM 11143 O O   . HOH J 3 .   ? 24.390  -1.510  -10.083 1.00 63.19  ? 614 HOH B O   1 
HETATM 11144 O O   . HOH J 3 .   ? 11.683  -5.072  -36.648 1.00 44.37  ? 615 HOH B O   1 
HETATM 11145 O O   . HOH J 3 .   ? 33.132  8.082   -26.794 1.00 44.04  ? 616 HOH B O   1 
HETATM 11146 O O   . HOH J 3 .   ? -23.428 6.170   -18.710 1.00 38.22  ? 617 HOH B O   1 
HETATM 11147 O O   . HOH J 3 .   ? 11.465  15.992  -29.198 1.00 57.71  ? 618 HOH B O   1 
HETATM 11148 O O   . HOH J 3 .   ? -12.682 16.821  -41.203 1.00 40.06  ? 619 HOH B O   1 
HETATM 11149 O O   . HOH J 3 .   ? 20.961  24.544  -0.882  1.00 46.93  ? 620 HOH B O   1 
HETATM 11150 O O   . HOH J 3 .   ? -9.758  4.666   -22.656 1.00 42.81  ? 621 HOH B O   1 
HETATM 11151 O O   . HOH J 3 .   ? -11.378 4.894   -25.137 1.00 37.97  ? 622 HOH B O   1 
HETATM 11152 O O   . HOH J 3 .   ? 21.234  37.959  -18.127 1.00 44.81  ? 623 HOH B O   1 
HETATM 11153 O O   . HOH J 3 .   ? 10.713  31.461  -19.964 1.00 39.84  ? 624 HOH B O   1 
HETATM 11154 O O   . HOH J 3 .   ? 32.854  9.843   -32.233 1.00 35.22  ? 625 HOH B O   1 
HETATM 11155 O O   . HOH J 3 .   ? -5.134  25.559  -39.349 1.00 30.81  ? 626 HOH B O   1 
HETATM 11156 O O   . HOH J 3 .   ? 19.721  31.139  -11.456 1.00 17.88  ? 627 HOH B O   1 
HETATM 11157 O O   . HOH J 3 .   ? 20.011  30.502  -40.623 1.00 30.52  ? 628 HOH B O   1 
HETATM 11158 O O   . HOH J 3 .   ? 5.142   28.331  -19.267 1.00 40.58  ? 629